3PEWA

S. cerevisiae dbp5 l327v bound to rna and adp bef3
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
391
structure length
391
Chain Sequence
AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 145
structure length 391
sequence length 391
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pewA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pewA02
4IOMA 3WXMA 3T5GA 1IM2A 1YZLA 5DHFA 5HKKD 4ZI3A 4UXJA 2C77A 3QSYA 1VG0B 1ZU4A 2NPFA 2QAJA 4URVR 4HAZA 4URWR 4YONB 2SHKA 5D3QA 3TUIC 4B32A 1HUQA 2GXUA 2RGGA 2YYZA 4EFNA 3FTQA 4BLSA 2J0UA 2DWOA 4DCTA 4EUNA 2YVUA 3CF6R 2VSXA 1HT1E 4JLOA 4EPYA 5JBQA 1OXUA 3BAFA 3C16C 5TDHA 4M9QA 1E79D 3BK7A 1PLLA 1DO0A 2XNDA 3Q7QA 1RKBA 1P2VA 3AF0A 1II0A 1NIPA 1NI3A 1W5SA 5LB2A 4E03A 3O8RA 3HWSA 2IEZA 1P4SA 2JLZA 2KB0A 3T35A 2FFQA 3S1AB 1DG3A 1GNRA 3IEUA 1P61B 2MSEB 4HAVA 3MWJA 1VDZA 4JLNA 4UKDA 2AKAB 1S9DA 1Q12A 2JJ1D 3NHAA 3SR0A 4F4JA 1EFRA 3MJHA 3AVYA 5CDFA 2HT1A 1U90A 2X19A 4J0QA 1XXHE 3JZMA 4JS0A 5M04A 2BMFA 4GMDA 4F92B 3KUCA 4BFWA 1BYIA 1PLJA 3NIBA 3UWKA 1IXRC 1XF9A 2KWIA 2G9NA 1N6RA 4G5GA 2O8BB 3K09C 1RC8A 1W2HA 1OLOA 2R6DA 5EP3A 2JGNA 1AKEA 3Q9LA 4PZLA 3OE7D 2F9LA 3LQQA 2EWWA 2D2EA 2GXQA 1QZXA 3V4RA 3DZ8A 1R0XA 2V7QD 3VNUA 4MGYR 5EP2A 2RGNC 4G01B 4RZ2A 3K0SA 2ZS7A 3LNCA 5GJVC 1OKKA 1LTQA 4Q7JB 4M9SA 5HZKA 1GIAA 1FTNA 2CMKA 4B43A 3AGQA 3L0IB 4IEIA 4U7DA 4E09A 4DLYA 3Q72A 2CCGA 2HLDA 3A1UA 4PPQA 4WIAA 4CEHA 4IDPA 1T3SA 3LW8A 4JVNA 1OV4A 2C8VA 4LHWA 4YMWA 1Z07A 1E2DA 1ESNA 2CXXA 2GBLC 4KVGA 1MO4A 2GEVA 3CRRA 2IW3A 2WWGA 4PR0A 4WZ6A 1AM4D 4OI0A 3I61A 1SVOA 4LHVA 4MA4A 4W7SA 1O87A 2OBNA 5J5CA 4YQFA 3RRZA 3I4LA 5K8LA 1NLFA 4GNKA 1FQKA 3B7GA 4LI0A 3U6BA 4EJSB 1BO6A 3QKRA 2GJ9A 5E7IA 1W36D 1D8TA 1JAIA 1G8PA 4JVSB 3ZIAD 4C0AC 3ETLA 2L0XA 1ZRHA 4OI1A 3ZS9A 4A8JC 3GLGB 3TSWA 4IDOA 5LD2B 1EK0A 1NJFA 2G1KA 1II8B 4QHYA 1CR0A 2OG2A 4IXNA 2OLKA 3CW2A 1NSFA 2ZR9A 3H86A 4D4MA 1FP7A 1GOTA 4CDGA 3WRXC 1FX0A 2IEYA 4TN1A 4B35A 1BH2A 2ZU0C 1U9IC 4JBWA 1R0WA 3KKNA 5EE9A 3LO5A 1CIPA 4FXPA 3UKDA 1T8UA 4A15A 1P73A 1WF3A 2PCJA 3B2EA 3BOSA 3ZVNA 3OIVA 5KU1A 1W36B 4V0LA 3GJXC 3WHKA 4A2WA 4HAYA 4AG5A 2QBYB 3UANA 3OEHD 4H1VA 3SJZA 2F9MA 2R9VA 3DKVA 3IKJA 4FCWA 2ZAMA 5J4LA 2FSHA 2AHOA 3T06B 1XJ0A 3ADKA 2IL1A 4AG6A 4FD2A 3SJBA 1DAHA 5L3QB 2V9PA 5E3HA 1RYHA 2IT1A 3NH9A 4HZUA 1N5JA 1G21E 2LKCA 2BEKA 4AURA 3RRYA 1OIVA 1ZINA 2GETA 2WJHA 4M0LA 1VPLA 4X8LA 1Z2AA 3A36A 4DLSA 2IYSA 1OIXA 1G5RA 2GNOA 3CF0A 5LBIA 3U3JA 1G3MA 2ANCA 1CP2A 2FMXA 1QHNA 3CRMA 4C9BA 221PA 1E1RA 3BRWD 2IYZA 4MKHA 3X1ZA 1AS3A 4PXAA 1W4RA 1LY1A 2YWEA 1J70A 4MKIA 2OE2A 2BJVA 2XOKA 2A5DA 2QUZA 3PEVA 4JJZA 2Q9BA 1G7TA 5TARA 3OZXA 2ZJYA 1LS1A 4TT3D 1T0JB 1W4CA 3W9YA 1OH6A 4FWIB 2WKRA 3EG5A 4V0ME 1SXJD 3A37A 4F38A 3GLFB 3NXSA 2XTZA 4RJLA 4V0KA 4CEHB 1LV7A 3T12A 5FPHA 1GL9B 5FPSA 5AUOB 2JDIA 5JLJA 4QXAA 1ZIPA 3GJ7A 1UPTA 3P26A 2GCNA 4ZO4A 1DAKA 3MMPA 4QGFA 4PPGA 1UBCA 3TUZC 5L3SA 2EW1A 2JLVA 1KZ7B 2OFXA 3PFIA 1QG2A 4IVQA 2OFWA 1H8HA 1ZD8A 5FR2A 1CTQA 3WMGA 4DLWA 3U61B 3B1ZA 3GPLA 2QT0A 2IUUA 2GILA 2VP2A 2AKYA 5FOWA 4PC3A 4CGZA 5FI1B 5P21A 3MD0A 5GJBA 5TXGA 3WYAA 1SXJB 2PX3A 2CCKA 4EPXA 4GP7A 3AKDA 1N6IA 2ZRPA 4LX0A 4TMXA 5F98A 1VMAA 2CNWA 3ND8A 2ZVQX 1KNXA 3AVOA 2D3WA 3HPQA 3IBYA 5EJEA 1XEFA 1KJYA 1RRFA 4Q1FA 4DB4A 1GSIA 3DO6A 3R20A 4D80A 2WSSA 4NONA 2ZITA 3L43A 4IOKA 3SNHA 3UPUA 2P6UA 4N3NA 4MITA 1E2FA 5FBRB 4JJKA 3DM9B 3M0EA 4Q1EA 1E0KA 1YZKA 2HYIC 5G3ZA 2DFNA 1XEXA 3D31A 4I1OA 3P27A 3NG1A 4TMZA 1IBRA 1QBKC 1HH4A 2J59A 3B8HA 4MRVA 3ASYA 3FB4A 3THYA 4MRPA 1M7HA 1Z22A 4FINA 2Q21A 2FF7A 4G5RA 1TL7C 1X1RA 1Z08A 1H65A 2QMEA 2QAGB 1GL6A 5CIWA 4IOLA 1UKYA 5GJCA 4E5UA 2VHQA 5LB4A 3ZD6A 1X8LA 4G1UC 4XSHA 4OHVA 4RFSB 5HR5A 1OPXA 4A2PA 2Q3FA 2RH5A 4RFVA 3QKSA 1NKTA 4A2QA 1IN8A 1G7RA 4AYTA 4EPRA 5HPYB 1OSNA 2QU8A 4Q21A 3NH6A 5FR1A 1G6HA 3GD7A 4DBLC 4CIDA 1JNYA 1A1VA 4DLUA 5DISB 5CK5A 4BZQA 1KI7A 2QP9X 1DE0A 3CH4B 3B9QA 3LBIA 4LDJA 4DLVA 2GXSA 2JA1A 3DMDA 3X1YA 5EXPA 2G3YA 3EWSA 5BYJA 3BFVA 4RVCA 1CU1A 2ZI9A 3OAAD 1JJ7A 3W3ZB 4HUTA 1L2TA 2AX4A 4TYQA 1ELOA 1NSTA 1E2GA 1E0JA 1O3YA 4A4DA 2ZRBA 2VEDA 4DEXA 1KSGA 5D3MB 2OAQ1 3R7WB 1CRQA 1F2TA 1P5ZB 1QHIA 4JLVA 2RHMA 4PZZA 1ZW6A 1E2NA 1CJVC 4TSFD 4QM6A 1YR9A 2AR7A 4AY2A 3AKEA 3IIMA 5AUNB 3KL4A 3DOEA 4GI7A 5EE5B 4QJ3A 3BH7A 3CX7A 1HEIA 1D5CA 2CE7A 2PJZA 5FTNA 2YJTD 5EP1A 1G8GA 3B1WA 3BS4A 2Z83A 2OXRA 5CIQA 1AQUA 1CJKC 3RS3A 4E07A 4V0NA 4LPKA 4ZDWA 3FHCB 3HYRA 2JIZA 1KSJA 2BJWA 3K8YA 1DAMA 3FGNA 2GWHA 3RNLA 2RGCA 3LLUA 1IY0A 2CBZA 2GJKA 2P6NA 1HY3A 2QSYA 4Q1BA 3NDBB 2QORA 4HLQB 3TAUA 4LBWA 2WHXA 4TL7A 1XEXB 2ZR0A 4H1UA 4Q19A 2B21A 4YXWD 4I99A 2CVHA 4B48A 2FNAA 1TAGA 3RSLA 1OE0A 2X2FA 2RGEA 1NY6A 1XRJA 1QHHA 2O52A 1U0HC 1FMJA 3L82B 4IXMA 1IONA 1Q44A 2OILA 2R65A 3FFAA 2PBRA 4Y0AA 4NYIR 1QHYA 5JZVA 3BGWA 2J7PD 3G0HA 1GRQA 4YC7A 1R0ZA 3KTAA 5H1YA 3LVRE 1G17A 5KNBA 3R8FA 5DI3A 2DYKA 3A4NA 3C5HA 1DPFA 2JLRA 2B8TA 1MR3F 1XMVA 4LGMA 1F3OA 3AGPA 3EZFA 1SHZA 4C7OA 2NPIA 1W44A 2R2AA 1G3UA 3K9LA 2QM7A 4RZUA 5KPJA 5KTYA 4M22A 3H0KA 2JJ2D 1YZQA 4QGHA 4A0HA 2O8DA 3VAAA 2VF8A 2O8FA 3CH5A 5CJPA 4V03A 3WNDA 4DIEA 4NL4H 2H57A 3AKCA 4D26A 2P67A 2ZUDA 3PV0A 2OAP1 2QG6A 1XDBA 3CLVA 3KQUA 3I92A 3UMSA 3TK1A 1S1MA 1SVMA 1RFLA 3GLIA 2XGJA 3U7FB 1H8ED 1NBME 4IDHA 4QM7A 3KKMA 1G1MA 1BS1A 1G41A 4ZIRA 3E1SA 4UNPA 2ZXUA 3KQLA 2OESA 4QG7A 1XEWY 3LAWA 3H1TA 1CEEA 4BLPA 4P0TA 3QG1A 1OYWA 1CR2A 4GP6A 2P65A 2J1LA 4OHWA 2QA5A 3Q85A 5GVRA 3A4LA 4MYCA 2XB4A 4URYR 5KO2A 2W0MA 2ZI5A 4KCGA 1OB5A 3WYGA 1VG1A 2O0JA 1Z0AA 2PT5A 4LV8B 2FU5C 4LBVA 4LK2A 4B75A 2CK3D 2C9OA 1JAHA 3RSOA 4M8NE 5DI9A 2VP6A 2ZPTX 1NVUQ 1COWA 5CLLA 4TYWA 3GFTA 3AVQA 3ADCA 3QUSA 3K0FB 5FTMA 4BEJA 1WE2A 1X8JA 3BE4A 1VECA 4GZMA 1RRGA 2HV8A 2ZSAA 3CZPA 1E4VA 3BB1A 5TV2A 4BPBA 2EWVA 4M9XA 2KBFA 3UMRA 4XOIA 1JBKA 1KDTA 1T3LA 5BWMA 1AA9A 4QHTA 1QHHB 1Z28A 2D06A 1U0JA 4TYYA 1S0UA 2X1VA 1YR7A 1D2NA 1HT2E 3X1XA 1KO5A 1J8YF 1P72A 2FGJA 1U99A 4AWXA 3H2YA 3AM1A 2IS2A 4DDUA 1KI1A 1US8B 2ZJZA 3KTAB 4CRWB 1DVRA 1XMJA 1Z6YA 5DI3B 6Q21A 5FUXA 1KJZA 1OXSC 1XNJA 2NOAA 1N6HA 3LH5A 4TTRA 5CLQA 2IXGA 1W4BA 1FW6A 4MDFA 3D7MA 4OK5A 2Z4SA 4Q47A 4NP6A 4DCSA 5L3RA 3AH8A 4OI2A 4UXIA 5C18A 3Q3JB 2IYRA 3VQTA 4RD3A 1YQTA 2P5TB 1JR3A 1ETUA 2ZETA 2O8DB 2IX3A 2O8FB 1RPZA 3MFYA 4DSTA 5ELXA 2JASA 1T3HA 1GDDA 2GEUA 4MDEA 2D62A 1KJWA 3EPLA 2PEZA 2H16A 3HJNA 2NGRA 2I1VB 2V55B 2WOOA 1OFIA 5LDDC 3GLIB 1PVOA 4LUCA 4IHQA 1X1SA 2W2XA 1AS2A 1MRNA 4R71A 1GFIA 2OZEA 4RCYA 1GVNB 2C5LA 4HAUA 4JBXA 5HZHA 4CT4B 5HKKA 5EP4A 2OBMA 3AP2A 1F2UA 1CLUA 1V43A 5EE0A 2JLXA 4NYIQ 1YZNA 3NBXX 3NHBA 3A1TA 3W34A 2WWWA 5IT5A 2NMVA 2BM1A 4ZV4A 1ZYUA 4NH0A 3DMNA 1E2KA 2B7CA 2BCGY 2KSQA 4PZYA 5HE8A 1E9AA 2UVQA 3EC2A 3FDIA 2RB4A 2ECKA 4C4PA 2O8BA 3KKOA 1E79A 5SZKB 2B8WA 4LHZA 1XMSA 2F6RA 1YRAA 2ZI6A 3VR5A 4GBMA 1IAQA 3THOA 821PA 2BOVA 5EXTA 3TRFA 4P31A 4DLRA 2ZSBA 1YR6A 4HDCA 1N0VC 3FVQA 4B2PA 5CM8B 3B5JA 3NDPA 2AFHE 3WMEA 2JJ1A 1WCV1 1TF5A 1SKYE 3V9PA 1E99A 3CB4A 4Q1CA 4WXPA 2QT1A 3KB1A 3TVDA 1AN0A 1E96A 3B1XA 4M1SA 1FL9A 3KFVA 4KITB 1RYFA 2G0NA 3LXXA 1JQLB 3TJZA 5JWRA 5F2EA 2GTPA 4NYJQ 1CKEA 4OK6A 2UZ3A 1T9HA 1XXHB 2OEPA 1E98A 5FUWA 3I5XA 4M1YA 1DBSA 5FTJA 4CW7A 4EQ6B 1VG9B 3OE7A 3N2IA 2GDJA 2RGDA 4RY2A 4AYWA 1IQPA 1G9XA 3HU3A 1E32A 4GFDA 3KKPA 3NVAA 3TNFA 2V7QA 2H17A 4Q00A 4BFUA 3U7GA 3LW7A 2VL7A 1ZCAA 4HDOB 2CL0X 2ORVA 3W5IA 3EA0A 2HF8A 4JLBA 5ANRB 3GLGA 4NHOA 4KLZA 3VX4A 1XP8A 1II8A 3ZQ6A 4M1OA 1EXMA 2GESA 3IHLA 2FFHA 1VCIA 4B47A 5FOVA 4DIDA 4FCTA 1YHNA 3KKQA 4R2HA 1B0UA 2MSDB 3HR8A 3Q7PA 1KKMA 3DKPA 1RVDA 3CWQA 1EWQA 3CNOA 2F3RA 3GEHA 3B13B 4DUGD 5DGXA 4XSGA 2IWRA 4KLNA 4OHYA 4LHYA 3ONWA 4AKIA 3QKUA 1G3RA 2QI9C 4HUQA 1JEDA 4C2UA 4Z1MD 3B1YA 3EA5A 1Z0IA 3LFUA 4Q01A 1QF9A 2BHRA 3EZ7A 4BFTA 1J99A 1SVIA 3L8YA 1E9DA 3AVXA 1P2UA 1NN3A 3W5JA 3ZIAA 4QGAA 2ATVA 4C0HA 4WBSA 1TQ6A 4P4UA 2QBYA 3PVSA 1UEJA 4GRAA 4QHSA 3U3OA 2WM9B 4KAXA 3G5UA 4ACAA 1IHUA 2NZJA 1F5NA 3ZZTA 1F2UB 1NKSA 4LJ6A 1XTQA 2R8RA 5L3QA 3BORA 5CITA 2JLWA 3IQWA 4LJ9A 2C98A 4QOSA 2IUTA 2QP3A 2P0EA 3EPKA 3DPUA 1HV8A 2GCPA 2R62A 4RSGA 3FMIA 3REFA 2IBMA 5JSZB 2GHIA 3HR7A 1OHHD 4WAUA 5FL7D 3T1VA 2BIFA 3QENA 3AF4A 2QPTA 4K8OA 2YOFA 2W83A 2FE4A 4ZDJA 2D4HA 2PZGA 2WWXA 2Q3MA 4IDNA 5J4HA 1P60A 3OEHA 4ZCMA 2AK2A 2ZR7A 1T5IA 1LF0A 4KI0A 3DZDA 2Q9CA 4QJ5A 4Q4HB 1G7CA 3P32A 1XTRA 3GEIA 3CPJB 2PMKA 3EARA 3B85A 4DT1A 1IN6A 1VHTA 5BN3A 3FHTA 1XCMA 3FYHA 1XD2A 3RAPR 2G88A 4M53A 3GLFA 3NTUA 1U81A 3GJ5A 2RGAA 2J9RA 5G3YA 2ANBA 2VSFA 4D4LA 2ZRLA 5KSYA 2H18A 2Q0HA 3IGFA 1XBTA 4URXR 2QENA 5FBLB 1AGPA 1TU3A 4QL3A 2A30A 4US1R 3CRVA 1NY5A 1FZQA 1MABB 1Z3IX 5B64A 1OJLA 2ZEJA 2F1HA 4PFSA 4JMPA 1W1WA 2GA8A 1CJMA 1CJUC 3QE0A 4IFBA 4TT3A 4Q4LA 2J46A 2WIAA 5KSZA 4Q5IA 3CNNA 4FMDF 4UNRA 2FSIA 1DADA 2BVNA 1SXJA 3L0SA 4B2LA 1Q20A 3LQRA 3AKYA 1HA3A 3LXRA 1KDOA 3RANA 3F0TA 4KJZA 3W8RA 2F3TA 4A36A 1EFTA 1G7SA 3IDQA 4TL8A 2OCYC 1E2IA 1FUKA 4HATA 3IPXA 1KOFA 4A82A 2P5SA 2VIIA 3EPHA 2NO7A 3K09A 4OQNA 3KQNA 3K1JA 4HUQB 4MUAA 4B3DA 1WBBA 5HCNA 1I4LD 2FOLA 3ZZUA 2F1JA 1L8QA 4DLZA 1OW3B 4I1UA 4KFUA 4N1AA 1IJEA 3K53A 1R7RA 1SGWA 5DE3A 3KJEA 2C9CA 3LA6A 3EASA 3C14C 3VKWA 2A5JA 3THXA 2F7SA 4BRUA 3U44B 2RGNA 2RCNA 3PUVA 2DR3A 2YOGA 2K5UA 3GMTA 1XTIA 1FQJA 1CR4A 3NBFA 3F3YA 4XWOA 1TEXA 4D4JA 4HSEA 5F3WB 2AXPA 2CL7X 4LJ5A 2QAGA 3CNLA 1Z6AA 4NCJA 3OF5A 5CYOA 1TQ2A 1JXMA 4Q02A 1Z0FA 3C5CA 4PQFA 5CYPA 5DH9A 1E2MA 3MWYW 3ZYCA 5BN5A 5AWFC 2GF9A 5K8IA 1IY2A 3TSOA 3BD9A 3BBPA 2GBLA 4PHHA 1MO5A 4Q4AA 1XB2A 4RFSA 1S1CA 5B30A 2QPAA 1GNPA 2WJGA 4JLDA 2X77A 3VU9B 2AK3A 1C9KA 2DFLA 3U3RA 2D7CA 3WY9A 1MO6A 2VHTA 3K9HA 2HEIA 4PPFA 4UNNA 1GTVA 1OB2A 3GFPA 1EWRA 4RCZA 5BN4A 4EKDA 2FPLA 1WBDA 1MO3A 3TIFA 3PEWA 5C1BA 3KQHA 2FA9A 2CHGA 4LC0A 2REBA 2ZI7A 1J7KA 1T5LA 2HCBA 4DT1B 3LDAA 1G3QA 4LV5B 1IOZA 4Z51A 3CR8A 5JS7A 1KZGB 2V1UA 2JJ8A 1XD2B 2WZQA 5E4FA 5F9HA 3K0AA 1ZIOA 3KJGA 5J47A 2QTFA 4I81A 4O3MA 1AIPA 2BBTA 2OO7A 1TEVA 2YWHA 1U9IA 4PO8A 4B3GA 2PLRA 4PC6A 2IF0A 4MRNA 2OCAA 5FFMA 4ERNA 4M21A 4D4KA 1WMSA 4B3BA 4E22A 1XD8A 1PUJA 1Z0JA 3U5ZB 3I72A 3LY5A 4LV6A 5D3MA 1YZUA 3R7WA 3L8ZA 1YR8A 2C78A 2CCJA 4I4LA 4TLCA 3T1TA 1FNNA 3AF2A 1KK3A 3C15C 1SVSA 4G5QA 1QHSA 3FOZA 4Q48A 1U98A 3I73A 3OAAA 3AVPA 3Q8XB 2FEOA 2QGNA 4QC2A 1GKYA 4BFYA 3FFBA 5G41A 4PC1A 4OQFA 1XEWX 2ZRGA 3FWYA 4C3ZA 1PLKA 1AJEA 2ZYWX 2BBOA 5JCPA 3LX8A 4XVRA 4B6EA 1NL3A 4HLUC 2FWRA 4BWYA 5CDFE 1CR1A 5AR1A 3OEED 4Q9KA 1KY2A 4NCIA 4OJQA 4TSFA 4G5OA 2ODEA 5DNYB 1Z6XA 2WJVA 4D0NA 1Q3HA 4QJ4A 1XTJA 1N5LA 1A5TA 2CDNA 4A6XA 3THXB 4PHGA 3UG6A 2AD5A 3BC1A 2XSZD 2LCFA 3K0CC 1EX6A 3HPRA 5EE1A 2W58A 5E7MA 5JHHB 2ZUBA 4A0FA 3IO5A 3FKSD 4IFEA 2GZHA 2GKSA 1M8PA 1NN1A 5HTKA 4ZI2A 1YZGA 3SOPA 2ZRJA 3OHMA 3DOFA 4A0GA 4PSKA 1W2GA 5TMPA 3TW8B 5L8VA 4YLGA 4Q4AB 1XU4A 1X8KA 2QQ0A 2IXFA 3UIEA 4HB3A 1BMFD 1NVWQ 1U8AA 3QPVA 3LWNA 3RS4A 1Z5ZA 3IQXA 1DAEA 1IJFA 2O0HA 2QROA 4MGKR 3RWOA 3E2IA 2J3EA 4YXWA 4MH0R 4NU0A 3AB3A 1E9CA 4ITRC 4IVRA 4S2EA 4EPVA 5BW8A 3N5CA 2IK8A 4O25A 5FL3A 4A8JB 4OK3A 4P4TA 1VYVA 2QP4A 2XTNA 2YKGA 3B60A 3NC0C 4KU4A 4YDHB 5DLQC 1TUIA 2QEQA 1A7JA 5CB6A 1EGAA 2ZANA 3W90A 5FOXA 4WA7A 5C4MA 4AI6A 2J7PA 1C1YA 3TR0A 1ANKA 3D8BA 4OI4A 4WZBE 3K0AB 5JWOA 1ZM9A 1G5PA 3MWKA 3GLHE 4PPNA 4DLXA 1U8YA 4LJAA 1JPNA 4XVUA 3ZLJA 2F43A 2QMHA 1I4DD 1GILA 1WDTA 4PTLA 4US2R 2RMKA 4QBGB 4BLTA 1NBMD 2OT3B 3MGCA 4BLOA 1NN5A 2OM2A 3QEOA 1NMZA 1W0KD 3JVVA 1SHKA 2JJ2A 3EX7C 1DAIA 1TF7A 1XZPA 3KZ1E 4ZKDA 1KAOA 4QNMA 1AK2A 4ZKEA 4GL2A 2J87A 1P2SA 1X86B 4A9AA 1W48A 1QRAA 1BKDR 1CBUA 4IW3B 4JSTA 3EPJA 2G1JA 4HZIA 1AZTA 2BEJA 4G5SA 2HF9A 1D9XA 2VTKA 1RE0A 3ZVLA 2QL6A 4WZAE 2VP4A 3SU8A 2WJIA 1H8EA 2FG5A 5KOYA 4W5HA 4AK9A 1VKJA 4JLAA 4B34A 3AP3A 3RC3A 1UM8A 1R5BA 2XEXA 4EAQA 2Q6TA 3K0FA 1TTTA 2VP9A 2IYQA 4NZYA 5EUMA 5A5GA 3CPHA 2H5EA 2WKQA 4JLKA 4RD0A 2EFHB 4R9UC 3KXIA 2JLQA 3LRPA 3PIRA 1W7AA 4EPTA 2FH5B 4L4UA 2ORIA 2R6GA 5KUTA 4DCVA 2QSZA 4H9GA 1ZNXA 1EFHA 4RZXA 1W0JD 4HB4A 5C2JB 5IK2D 4MYUA 4XD7D 4DDWA 1E9EA 4UXHA 1M7GA 2CK3A 3QPUA 3ZS8A 2J0QA 2WBLC 1NN0A 1WA5A 3QBVA 3EZ9A 4P33A 3FMFA 4WXRA 1R10A 3SFVA 5FOUA 521PA 4II7A 1E94E 2DFKB 1US8A 3I5YA 3UMFA 3IBGA 1YRBA 3F5FA 2EQBA 3TE6A 3U3KA 4KSBA 3R9WA 4ZDKA 3SFZA 2EYUA 3QIAA 3AVTA 1R8QA 2FGKA 3ZGXA 2FZLA 2WSMA 1R8SA 2IA5A 4JKYA 1ZUNB 4KVAA 1E9RA 2PX0A 2RGXA 3BFXA 3SE0A 2HJVA 3G82C 3SHWA 3SYKA 3NBYC 5FUYA 4D0GA 1FP6A 4DXAA 5DN6D 5EE3A 3TR5A 4KFTA 3H4MA 4BFVA 5EUQB 4LYJA 2YWGA 4TQAA 3EWAA 1W47A 5JRZA 3QXCA 2KE5A 2PCLA 2VHCA 3IPYA 4PX9A 3QOFA 2G83A 5LPNA 3BERA 1W46A 3DVLA 3UATA 4C2TA 2C95A 5G53C 2W0SA 5TVKA 5EZ5A 2FEMA 4B33A 3C41J 2F43B 1XD9A 4NYJR 5DIFA 3U2QA 2CJWB 4B3FX 4O0MA 2FPMA 3EIEA 2NO6A 4L15A 4Q1DA 3C4JA 5EXSA 3A8TA 3U6KA 4R7ZA 2I4IA 2YC2C 1R6BX 1NMXA 1SKQA 1E0SA 5DYGA 1W4AA 2NG1A 1E69A 1Z06A 2IC5A 1F60A 4HB2A 3X2SA 3PITA 2H8KA 4UNQA 4KYUA 5C46F 5FTLA 1M1YE 5AUPB 2E1RA 3SC3A 2J0SA 3QXHA 2V1XA 2ZTSA 4NYMR 3O8CA 2ZUCA 1WQ1R 1FUUA 1G3IA 2ODNA 1UDXA 4Q03A 1XPOA 4HYYA 3WHLA 1RJ9A 4CEIB 4MKFA 4L9SA 2OCPA 1G8HA 3PUXA 2ZI4A 1TX4B 4DSNA 4D0LB 3AQ4A 1KO4A 2Q9AA 3UG7A 1VYTA 4KBGA 4GZLA 1XZQA 4HAWA 2KI5A 1K6MA 4MRSA 1AKYA 5TY0A 4JL6A 4IRUB 3IIJA 4ZPXA 2E87A 1XXHA 4Q7KA 4X8HA 2REOA 4PSAA 4XH9B 3TAHA 5FH9A 4EQ6A 1JXOA 2OCBA 1N0WA 4DKXA 3TLXA 4LJ4A 2CL6X 1ZD1A 4LY6A 4HB0A 3D3QA 4RD1A 1D6JA 2XZLA 3MUFA 3O8BA 3PG5A 1NIJA 4XJXA 2XAUA 2IUSA 5JMTA 3WYFA 4B44A 2VSOA 3AP1A 3LV8A 4B3CA 1ZM7A 2QMOA 1NVXQ 5JRJA 5UKDA 4KXFB 4DHEA 3PEUA 5AJYA 1G64A 2KBEA 2ZYUX 2A9KA 1G19A 1SKYB 2GZAA 1QG4A 2IYVA 2A7QA 4IJMA 1HE1C 1KO1A 1LNZA 2ERYA 4OYHA 4RKFA 4ASUD 3CM0A 2EYQA 2W6JD 3VTKA 1XPRA 4HLDA 1W5TA 1MKYA 2GCOB 2R6CA 2ZJBA 1OH7A 2VHUA 4TLAA 3U4QB 1XFAA 3T1QA 1S2MA 1KI9A 2REXB 2KJQA 3KB2A 3UWOA 4CF7A 2CLSA 1FTSA 2GK7A 5DO9A 1RW4A 3GJ0A 2IXEA 3R9IA 4DDTA 4YMVA 721PA 1GNQA 2ZREA 1Q1EA 1AS0A 4OHZA 4C0JA 1OIWA 2DY1A 3T61A 1ESMA 3QF7A 1OYYA 1N6NA 3PUZA 1L7VC 3L0PA 1U8ZA 3BB4A 3RRMA 4BECA 1WP9A 2TMKA 2GVDC 1T0HB 1EX7A 2HYDA 4Q9IA 1G18A 4DUGA 2A5FA 4EJSC 2ZQ5A 1CULC 4A6PA 4BZPA 1M2OB 5JFGA 1GP2A 4FMCB 1N6PA 4F7WA 5JSZA 4Z1MA 3IEVA 2WIBA 2C99A 2QN6A 5FPTA 5FTKA 1G5TA 3V00A 1ZP6A 2FFAA 3B6EA 5AJWA 1FOEB 2DBYA 1NG1A 3HP1A 3TKLA 2WTUA 2ZRCA 1S8FA 4OQLA 1DS6A 2VP0A 4B71A 4EDHA 1U94A 1OT3A 4US0R 1CRPA 1ZNZA 4Q4HA 1VIYA 1RJ9B 1Q21A 3BH6A 2ZE7A 2R6AA 2QTVB 4ZDIA 1VG8A 3CR7A 4HDQB 1KNQA 5AJZA 3Q5EA 4AKGA 3QKTA 3SBDA 4D81A 2WV9A 3KJIA 1D2MA 1GL7A 1KK2A 4LWZA 5EXXA 121PA 2VRWA 2WJJA 1EESA 1XJCA 4JSYA 2A78A 2WKPA 1QVAA 3KFXA 1KO7A 2ZRNA 2QNRA 1W36C 1SQ5A 5KSOA 2VH5R 4JT4A 4P32A 2VBCA 2BBWA 3AUXA 1OHHA 2OSBA 3PXGA 4A92A 5FL7A 4TZ6A 3ZZ0A 2O5VA 2X2EA 4NMMA 1KI8A 1OFHA 5J4VA 1ZNWA 5KPDA 1ZM4A 4AIIA 1MH1A 4TMWA 2IYYA 4JVLA 3WBKA 4AD8A 1MABA 2VLIA 2NQ2C 2MMCA 2HDNB 1NLYA 3EIHA 3TVTA 4WVFA 4YMUA 2W6ID 1UDWA 1VYUA 4KSCA 3TH5A 1E1QD 2WWYA 1YZTA 2V6JA 3LBNA 4PC7A 5AK0A 3KJHA 2PL3A 3ZDQA 1N5IA 1UJ2A 3ZVMA 2ZJ2A 4ON9A 2WPDD 1GUAA 4FW9A 4IDQA 4BZXA 1J8MF 2ZROA 4NYMQ 2WWIA 2ZS9A 3ECCA 2OV2A 1M7BA 5FPYA 4BGDA 3T34A 1ZBDA 2ZRAA 5FBQB 3HYTA 2F1IA 4V0MA 1D2EA 5E7JA 2HUPA 5IRCD 4GDFA 3ICQB 4TQ9A 1KIMA 2B92A 4OBEA 2VHJA 4UQOA 2HXYA 2V3CC 2HXSA 1JI0A 4N0DA 4RD2A 2YINC 3K9GA 1A2BA 3SZRA 4QBFA 2WVJA 4D2IA 1K8RA 1KY3A 1Z8FA 3EZ2A 4C0KA 2PEYA 3SYNA 1UADA 2GRJA 1N6LA 2ODBA 1NF3A 3AEZA 4DVGA 4G0NA 3PJRA 1GRNA 1XCGB 2O0KA 4BLQA 5DYIA 5JJKA 4XVQA 3U44A 4CEJB 3W3AA 2NO9A 4GOKA 2ZYVX 3CWZA 3OFND 2VO1A 5FPKA 3PENA 2GK6A 4BASA 4DCNA 3FMOB 3WNCA 3CF2A 4DSUA 3W6OA 4QRHA 1Q1ZA 2UKDA 3CZQA 2J0VA 3BWDD 3I1FA 4DSOA 3A1VA 2FX3A 4A1FA 2O8EA 5CK4A 5IDVA 2GJ8A 3P1JA 4TLEA 3MG9A 4K46A 1Q0UA 4B2IA 1G8FA 1DO2A 1UFQA 2IYXA 2Z5FA 4URUR 3VU9A 2HT6A 5JJLA 1Y3AA 1QVRA 5JCZA 2OUKA 1AQYA 3PQCA 1SXJC 3L2OB 2QTHA 4LBZA 1CF4A 1GWNA 4KODA 4JZKA 1IN7A 2MSCB 2QMUA 4ILEA 4U5XA 2VA8A 1SULA 3RRNA 4DCUA 1KHTA 4Z54A 2FZ4A 5JHGB 4ARZB 1GAJA 2IYUA 4TL9A 3SJCA 5F9FA 2DFTA 2NO1A 2JCSA 1CXZA 3N70A 2IS6A 3VR4A 2IF2A 1UAAA 1OFTA 2QE7D 1P3JA 4OHXA 3RS0A 5CM9C 4S35A 4AYXA 2EFCB 2FFBA 3TSZA 1S3GA 3CBQA 1G291 4GPTA 2ZS8A 3CKLA 4DWJA 1EFUA 3OIWA 4DJTA 2ZJ5A 3IILA 5GADl 3T1OA 4Y0VA 1SVKA 1TQDA 4MUBA 1JJVA 2LWIA 4D6PA 2P3SA 4Q9HA 4QKQA 1NNEA 1JR3E 2EFEB 3BXZA 2UZIR 3QF4A 4KBFA 2P2LA 4PAQA 2QAGC 2WAYA 2Q3HA 3SYLA 3GQBA 3C7KA 1YKSA 4YMSA 5FUVA 3TQCA 1ZD9A 4NCKA 1KI6B 4NBSA 1KSHA 2XITA 3AF1A 5AJXA 3VFDA 2XTMA 3BFKA 4TL6A 1G4AE 4PSVA 1C4OA 1KMHB 1LF5A 3IHWA 4L16A 4ZCLA 1TPZA 3VNVA 2CHVA 3ADDA 1ZMXA 4Q18A 2WMOB 4GMXA 1F6BA 5IHPA 1Q22A 3O8DA 1DEKA 2XNDD 1GZSA 5J40A 4GSYA 1QHXA 1AGRA 4LJ7A 3GLHA 4F4IA 1N5KA 3B9PA 3I8SA 2ODWA 1ONBA 1JB1A 3NC1C 2N1BA 4RKEA 2ZYTX 5C4GB 2D2FA 1TF2A 1VCNA 1P9NA 3NWJA 4C30A 2FPKA 1NMYA 3ZVRA 2F1RA 2WWHA 4PO1A 1E6CA 4UJ5A 5SZHB 2PLFA 1EFRD 3K0EA 3EZ6A 4QGGA 1TMKA 1K5GA 1J90A 1OXVA 2C96A 3QXSA 5KHOC 1WXQA 4FI3C 3RHFA 1QDEA 1U2RA 2V6IA 4TQUS 2J0UB 3AUYA 1DARA 1PUIA 4NTZA 4XTRA 4CZ2A 2ZJAA 4M1TA 2V8OA 5JI3E 5KYKA 3LBHA 3ZH9B 5H70A 1GG2A 1X6VA 2NO0A 1FPMA 3GJ8A 4F93B 1NVVQ 2C04A 2GJAA 2IWHA 2I1QA 3OIUA 3BJIC 2O8EB 1N0UA 3ZQJA 4YMTA 2JEOA 1KGDA 3D6TB 4JLJA 4XIGS 1S9HA 2QY9A 2NIPA 4M1MA 2V4ZA 4JYCA 3FPAA 3OEEA 1XPUA 3O47A 2JATA 4XTCS 4QBHA 2GXAA 1FNMA 1OKKD 4P4SA 2ATXA 2D7DA 1II9A 2FSFA 2XSZA 2YV5A 1ZJ6A 4K81B 4LPSA 5DHAA 1ZU5A 1Z63A 5FBWB 4KYIB 3ADBA 2GJSA 2CVFA 1N6KA 2HLDD 4QBIA 4V02A 1N2CE 4A8JA 1Z0KA 3FKSA 3KXKA 5JJIA 3CO5A 4OL0A 4O2RA 4AKEA 1LVGA 2DWPA 1GRRA 2AXNA 2BDTA 5E95A 4HI0E 3DM5A 1E3MA 2WJYA 3LX5A 1XTSA 4ESVA 4TLDA 2B6HA 1HQYE 5HE9A 1D9ZA 3F8TA 5B2ZA 3T15A 1B23P 3MSXA 2ZIAA 2CLCX 1E2EA 1GKIA 2ORWA 2J5XA 1BMFA 1JR6A 4B73A 3GLGE 3W6PA 1PZNA 4L5BA 3UXMA 2A5YB 5KSPA 2G77B 2YOHA 4NCNA 2PH1A 5EQTA 3U7EB 4JL8A 4Z8XA 3KDSE 3CIOA 3QF4B 3B78A 4Q7MB 3I62A 2QRZA 3A1WA 2BM0A 1KI2A 4DLTA 1XJQA 3CRQA 2H1LA 4OJKA 4EPWA 4B3XA 4IKEA 2WICA 2GAAA 2ZJOA 3HU2A 1BOFA 4CYMA 1V5WA 1TNDA 1JQJC 3TGPA 3WRYC 4M1WA 2D74A 5JI2E 2HCJB 1E2QA 1T4GA 2IHYA 2QPOA 2ZRMA 4DEYA 3WBJA 5FOTA 2ERXA 4JIMA 1JPJA 3QKRB 3PUWA 4Q9LA 2FJUA 1NBMA 3GLHB 4N0EA 1IN5A 3R9XA 2XNSA 1W0KA 1Y63A 3QNUA 3QXXA 3QBTA 1UKEA 2FSGA 1KO8A 5J4YA 4AKHA 3VX3A 4B74A 1UBFA 2BC9A 1A4RA 4LSGA 1E9BA 4MGZR 4L9WA 1ZC3A 1FX0B 1DTSA 1RIFA 4U00A 3B1VA 3AVUA 2YWFA 1UKZA 2G6BA 4WW0A 3H84A 4C0LA 3VKGA 4Q7LA 1G8YA 3M1IA 2GAOA 2C9YA 4BE7B 2YHSA 4BRWA 3KUDA 1RZ3A 4JBYA 2NTYC 3I32A 4MKGA 2HJGA 3PUYA 4G3XA 4ABYA 1E1RD 2N42A 3A6PC 4W9MC 4O2LA 4HEJA 5A0FA 1HTWA 2BMDA 4GT1A 3QI2A 2AWNA 2ZVPX 4JKIA 1KAGA 4OQMA 4TMTA 3GP8A 4LOAA 1TU4A 2W2TA 3QG5A 2A3RA 2XOKD 2PJRA 1M74A 2YC4C 3GLFE 4XWAA 4CT5A 4P4SB 3TUJC 3M6AA 1TUEA 4Q1AA 2IYLD 3U3MA 1OH8A 4MRRA 4HZUB 2AD1A 4UJ3A 8OHMA 5IK2A 2EFGA 1W0JA 4TMKA 2XZOA 2VQSA 4XD7A 1UBGA 1E9SA 3LVQE 3MCAA 1HQCA 4QNRA 3RDPA 3WP0A 2JLUA 5FBVB 3PCRB 2C2HA 1KYIA 1XMIA 3I3SR 4P3YA 2BWJA 2DHRA 2JDID 4IOJA 5TB5A 5IF9A 5JEDA 3ZD7A 3VKHA 2Y8EA 3Q5DA 1A2KC 1J2JA 3GJ6A 3U60B 1BIFA 2VYFA 3LLMA 4FN5A 2AFIE 1WRBA 4RZ3A 1TADA 3VHXA 2RGBA 2RHDA 3QVVA 3SBEA 4FMDB 1KDPA 4NCHA 1T6NA 4PHFA 1KTVA 2ZSEA 4QFMA 5FOSA 3ICEA 1YVDA 4WOPA 3QPWA 1Z6TA 2CJWA 4W5WA 1H8HD 4URZR 2GZDA 3QVUA 3NKVA 1SXJE 2XXAA 1HURA 4POAA 2GF0A 2ZE5A 4HLUA 4M9ZA 4EIWA 1TQ4A 1ZCBA 5DN6A 5AJVB 3VR6A 3VMFA 1VHLA 1YE8A 4OQXA 2OBLA 4F91B 3TMKA 2CNWD 4TLBA 3K0CA 2J45A 4FCVA 3RVBA 5BXQC 1Z47A 3EW9A 4MYTA 2VF7A 3OESA 4BFZA 2MMGA 3WNBA 4NE2A 2O8CA 4CVNA 3FMPB 1QHGA 1DAGA 2WSSD 4D25A 2IS4A 1NRJB 3VR1A 1E9FA 5GVSA 2A5GA 1HE8B 4LRWA 1ZUHA 2XB2A 5L3SB 1DELA 2LKDA 3BH0A 3TBKA 621PA 3DHWC 2ONJA 2PMDA 1KK0A 1X3SA 2FV8A 3V4FA 3EXAA 4PHTA 1Q57A 2J7KA 3QQ5A 5H68A 5G40A 4CEIA 1E0AA 1Z0DA 1ZNYA 4GOXA 3PEYA 4C0BA 4LC1A 4LBYA 4RD6A 1ZC4A 3KQKA 3SQXA 5JS8A 4JLPA 3JZAA 2EU8A 2XJ4A 3IO3A 2W00A 1XTKA 4EFLA 2ZI3A 3HDTA 3QEJA 3U7HB 2QZ4A 3CX6A 3CX8A 4M4SA 3GJ4A 2ZRDA 3VR2A 1ZAKA 1JEEA 4KV9A 2RKOA 3P20A 4PQRA 1NG9A 4FMCF 3ND9A 4I1SA 3A1SA 5SZJA 2XX3A 1KKLA 1MOZA 3VHLB 3QXJA 2QM8A 2P6RA 5JEEA 2AN9A 3RWMB 4MQBA 1OXXK 4FIDA 1RRPA 3C8UA 4BEBA 1VTKA 2ZAOA 3NBZC 2BBSA 3THYB 1I2MA 3RABA 2A2ZA 2BMEA 3IIKA 1SVLA 3A4MA 1FMLA 2R44A 2OHFA 3EC1A 4Q66C 1DAFA 3MWLA 1GKUB 1UEIA 4R98A 4V0OA 1KMQA 2CE2X 4DC9A 3ZJYA 4LYHA 1IN4A 2WWFA 3E5HA 1S96A 2GCOA 4Q9JA 1N3BA 2ZRKA 1L4UA 2H7VA 4IEEA 5BQ5A 4PAOA 4JT2A 1P6XA 3SJAA 4PO9A 3U4QA 3MRSA 1MRSA 3ASZA 1F48A 1R5OA 3AV0B 3QKSB 4AC9A 5K8TA 2I3BA 1SZPA 3RYTC 4PANA 5H8WA 2OFOA 2JAQA 2ZRFA 3NEJA 1DG1G 3GEEA 2WOJA 3K70C 2XXAB 4LYFA 2ZM5A 1KSFX 4FWTA 4PAMA 4KO8A 1LW7A 1P62B 4IVPA 4L8GA 4LZZA 2H92A 2QQEA 3P4YA 4ASUA 2W6JA 2CEAA 4A0RA 3SQWA 5AUQA 3QJYA 4TYPA 1ZM3A 2EVWX 2Z43A 1A82A 1KDRA 1LB1B 1UBEA 4TMVA 5FI0B 3MLEA 4KFRA 5JECA 3AVWA 3EIQA 1DOAA 3A58B 3KXLA 2ZE6A 4JVMA 1U0LA 4PQYA 2O8CB 1Z2CA 3RLFA 2ZSDA 2JIZD 1UKVY 3OIYA 4TYNA 1Z6GA 3FKQA 1CS4C 3QY0A 2XZPA 5KDLA 2JLYA 1F2TB 2OLJA 2DB3A 2VP5A 1E2HA 1EG7A 4HLCA 3KX2A 2QGZA 2BKEA 1N6OA 3E70C 4YDSA 4DB2A 3VR3A 3LD9A 4PC2A 5BYKA 4UNSA 3FE2A 3TQFA 5CB8A 4JLMA 4Q4JA 1G6OA 4EFMA 1G20E 1MV5A 2ASEA 1OF1A 421PA 4HAXA 3SS8A 3RC8A 1KI3A 5HCIA 5KDOA 1HYQA 4D82A 1VCMA 3HU1A 2EFDB 1R4AA 2IYWA 4R2IA 4B6FA 3CRW1 1ODFA 1S3SA 4XWKA 2AWOA 2N46A 2PZFA 5A4JA 1I2DA 2IHBA 3N2EA 2IYTA 3UK6A 4RD4A 1E2LA 4NDZA 1P7CA 4LHXA 4TTQA 2BCJQ 2C03A 4X8MA 2YNMA 4TZ0A 1S4QA 5CJ2A 3THWA 2OXCA 2YZ2A 3DDCA 1FFHA 2R6FA 3AVVA 2XJ9A 2F55A 2CLDX 1XX6A 3CPEA 1I4TD 3M4YA 3MAAC 2VPPA 1XWIA 2Z4RA 1JALA 4BLRA 5KNDA 3BIFA 4ACBA 1ZUIA 1P9WA 4LJYA 3DEFA 2X8AA 3T5DA 3RS5A 2FN4A 4KFSA 4C7OB 3SDZA 3GJ3A 4C0SA 4ZCIA 1P2TA 1M34E 2GVZC 2ZU6A 3W6NA 2WAXA 4U02A 1WB9A 1W49A 1IXSB 2W6IA 1L4YA 2BV3A 2G0TA 1E1QA 4MYHA 2RAPA 4B76A 5JWHA 2ZSFA 5KDDA 4W5JA 5SZIA 4DRZA 4CEJA 1Q3TA 4GOJA 3REGA 4OKSA 3R8CA 2JLSA 4I1VA 2B7BA 2WPDA 1Z29A 1OFUX 3EAQA 2E9SA 4X8OA 2WMNB 3CUEF 3JVUA 1G4UR 1Q1BA 3L0OA 3SN6A 1R0YA 1IXZA 1E4YA 3SEAA 3WMFA 1MT0A 2W2VA 4Z8YA 2BKUA 3AF3A 2BMJA 3IUYA 5GJWC 5DSZA 3J81k 1P75A 4ZIRB 1COWD 5KNCA 5K8UA 3B82A 1RRCA 2QRNA 2DPXA 3S1AA 1EFCA 3WP1B 1CJTC 1NJGA 1YU9A 4TWZA 1R5NA 5LD2C 4TTPA 1ZM2A 4C0QC 2PZEA 3GFOA 1YJ5A 4M1KA 4ESHA 1BYUA 3I8XA 1LS6A 1R2QA 3OFNA 2DWQA 2PT7A 3K70D 1E2JA 4LCBA 4ARZA 1GM5A 3MJRA 3CONA 1NP6A 2IS1A 2Z6VA 1KK1A 1JECA 1E2PA 3SHFA 1AZSC 5J4KA 1LFDB 4JL5A 3TW4A 4BFSA 4Q4JB 1T8TA 5B58C 2AL7A 2Z0MA 1Q1QA 1M6NA 4NKRA 1PV4A 1OH5A 1KI4A 2V54A 1VIAA 5EZ6B 1SVWA 3BB3A 3NEYA 2ZRIA 3W8NA 4LYAA 5B57C 1N25A 1T91A 4LJ8A 3K9NA 4BFXA 3PR1A 3GCGA 2ZRHA 1GITA 1NVVR 1P9RA 1ZVQA 4JYBA 4F4CA 1OXTA 4DDVA 4FMBB 5L3VA 1UF9A 1KI6A 3K70B 1JR3D 3FHOA 2J41A 4MGIR 3SI7A 2ZJ8A 1KMHA 4KHZA 3RS7A 4BUJA 3GLIE 1PJRA 2QE7A 1NLZA 3THWB 3RS2A 2FDCA 1IY1A 3DL0A 2CHQA 1VCOA 3P4XA 2DCUA 2ONKA 4DZZA 1Z83A 4EJSA 2ZE8A 2GEDA 4M2LA 1G16A 1K5DA 4NPHA 4BQSA 1XCPA 3X1WA 3X1DA 2NZ8A
chains in the Genus database with same CATH superfamily
4RA6A 4D98A 1QCCA 3WXMA 1UOOA 4LE1A 3D3KA 2CV1A 1IM2A 3CUTA 5DHFA 2XVZA 1VIDA 3UKJA 4YRDA 4CKBB 1VMEA 1XJWA 3QX7A 4NFLA 2Q2NA 5D01A 1E58A 3OEWA 2QAJA 4PXSA 4JBNA 4YONB 3MJEA 1NQUA 1LI7A 2AX3A 2GXUA 2RGGA 1JMVA 3LZCA 3GJZA 4H0NA 1K89A 2YYZA 5IFKA 3NGLA 1LPOA 3FTQA 3O94A 4DCTA 1KEEA 2YVUA 2HEGA 4AIRA 4BEWA 2VSXA 4Q6BA 5K0GA 4JLOA 3IUQA 2IZ5A 5CNKA 1OLUA 5JBQA 3G2OA 3SXUA 3T4UA 1I7QB 5J2UB 1KJJA 5TDHA 2QUKA 3QLVA 3TLAA 4OQQA 5CAEA 4J0HA 1AQLA 1II0A 2JLAA 5EYPA 2CBXA 2NT3A 2W93A 3D0QA 3PQ5A 3OOJA 4RVOA 1U7WA 1DGQA 3E3AA 1X0VA 4ICIA 1CEQA 1GNRA 1P61B 1SOWA 3IEUA 4HR7A 3RVRA 3H5OA 3X1JA 2GN2A 1S9DA 2QRMA 4H17A 2A0UA 2PM8A 2XHEA 1V48A 4U63A 1J0EA 1J2UA 4HH3C 4C4SA 1OC4A 1WXDA 2Y2UA 3AVYA 2F1OA 1U90A 2HT1A 4K9DA 1FDUA 2ALJA 5GV7A 1XXHE 3PGMA 4PRZA 2NZUG 3QFCA 4Z4EA 5MGBA 4GMDA 4C6TB 4D57A 4F92B 1BYIA 1PLJA 2HA6A 1M67A 4TKVB 3UWKA 2B36A 2KWIA 5ALXA 1EIZA 1NPDA 4RV9A 4G5GA 2VNIA 5F76A 3SQNA 5ICEA 3E4CA 3KJQA 3GT0A 2O8BB 3BD6A 2JGNA 5FAKA 3Q9LA 2AN5A 4YALA 3VU1A 4CI9A 3I9V6 2DPMA 5A7GA 2EWWA 3RFXA 3HJFA 2ZRQA 1G9SA 4ADSG 1DDOA 3DZ8A 1R0XA 1SIBE 2V7QD 3MT8A 3H2JA 4I1IA 3UOWA 3UWDA 3B5IA 4EI2A 3L1UA 1G8SA 1NKVA 2VF5X 4GKAA 4MGYR 3ZDCA 2VUSA 1YZHA 4UTZA 2JHPA 3FIJA 4G01B 1AK9A 4YO8A 3U39A 4PLWA 3U4HA 3C6XA 1LTQA 2EEPA 4Q7JB 5HZKA 2QW1A 5LOVA 1PNVA 4OQ4A 3U3XA 5H16A 3SZOA 4RTPA 4IEIA 3IX7A 1BJKA 1BE6A 2CCGA 1NZJA 4G63A 4KDCA 4WIAA 2CDAA 3HCPA 1T3SA 1RXCA 2VG8A 2WZDA 3LW8A 2A0WA 2C8VA 2I3ZA 3L04A 3PDUA 4FOTA 4R31A 4ATNA 4C7MA 1H4QA 1E2DA 1ESNA 2CXXA 1JG4A 2A5LA 3C1UA 1PR6A 1N2CB 3EODA 2O5EA 4OI0A 4LVUA 4MS3B 1WEKA 1DJMA 3LK7A 1SVOA 3PGXA 4MA4A 1A71A 3DMRA 2OBNA 5J5CA 3U19A 3HU5A 4AY4A 4DNOA 4BC1A 1FQKA 4F8YA 4LI0A 4YCSA 1RFGE 1VJRA 2GJ9A 4WZBA 4E5NA 1G8PA 5IAGA 3U0BA 4ARUA 5KVSA 4BMYA 1NXXA 3FD8A 3NYIA 1NQAO 2WFLB 3LO8A 1ZRHA 3S3TA 2N75A 2ZK7A 3R0JA 4A8JC 4ALIA 5LC1A 3TSWA 4BQPA 2QJOA 1K88A 1DNPA 4IDOA 3TLYA 5JC1A 1II8B 4QHYA 1CR0A 4IXNA 1NW8A 1PF7E 3WZ2A 4LZPA 4BEVA 1WHTB 3KLPX 2Q3EA 4CMJA 4TKLA 1NSFA 4J29A 1EJ6A 3CLKA 5EMHA 1FP7A 5GIOE 2DERA 1GOTA 4CDGA 1H4SA 4ZEOA 2RC5A 4B35A 2JFHA 1BH2A 2ZU0C 3VVLA 1RI1A 1HDZA 1VB3A 2WIFA 4JBWA 4DIBA 4Z3OA 3UY4A 3EQZA 4GXRA 3UKDA 3QPAA 3LO5A 4FXPA 3WLNA 4YCNA 4V24A 3C4VA 1HYHA 3ET5A 3LIIA 4FQ7A 2BH9A 2R8PA 3PHBE 1W36B 3ZKWA 3ZHUA 2D5IA 3JWHA 3ROPA 3GJXC 4MTLA 4GGMX 4A2WA 2J6BA 1A69A 4HAYA 2G4CA 4MIYA 4DQVA 3GDHA 4JYMA 1ZW1A 2ZB8A 2FCRA 1DKNA 3O9VA 4OGFA 3DKVA 3BMXA 2Z56A 4FCWA 2ZAMA 4INJA 3DZKA 2FSHA 3VC3A 3BUSA 1Z7BA 1V37A 2YHIA 5LQJA 4FM9A 4DJ5X 3THRA 1P1BA 2RJOA 5L3QB 2XT6A 2XE7A 3PNLA 5E3HA 4U1RA 2DC1A 2IT1A 3F3KA 4MAMA 4DEVA 3JQQA 2ZJ6A 5AJUA 1I24A 5BO5A 2RJ3A 4AURA 2SICE 2G1AA 3K30A 2PRYA 1CZNA 2MR5A 3MMSA 2WJHA 1FDIA 3JTMA 5KYUA 1L7EA 1TTHA 1POXA 2QRPA 3OCVA 4ZEWA 1UKCA 4NOJA 5CEJA 4KNYA 2CMDA 1PJZA 4PRLA 3PPYA 1CP2A 1WKBA 4C6HA 2YZGA 4C9BA 2QN7A 1T2UA 1ZX1A 5DTEA 2YJZA 5HRAA 3AW8A 4LGCA 3HY4A 4MKHA 1ZJYA 4LOHA 5F12A 5IWCA 1Q19A 1NU6A 4YRIA 1CV2A 3M81A 4H3SA 1AS3A 3RHTA 1W4RA 4B3RB 2VWGA 1J70A 2QX6A 2ZWVA 5A4MS 3PEVA 2YW2A 2Q9BA 5TARA 4JFAA 2R5FA 3NONA 3AZPA 3X44A 3LUAA 1T0JB 4CV3A 2IW1A 4NG4A 4RK1A 1TFUA 4FWIB 3MWFA 4R54A 4ESOA 5F23A 5ES4B 3KC2A 2WAAA 5BQOA 4DMRA 3SZLA 1SXJD 2W2LA 1H2RS 1MAAA 2YICA 3KTOA 3R23A 5BVGA 3NXSA 3LDUA 4FNGA 3CJRA 5JR3A 1X7GA 3U48A 3OPYB 2R7AA 3T12A 5FPHA 3PQ4A 4FDLA 2PGXA 3BMQA 4N5NA 1FDRA 1XZ8A 4QXAA 4D46A 1N8TA 3TOXA 4NULA 4PZ9A 5J58A 3P26A 2HA2A 4NK4A 1XTUA 4PYMA 4YI3A 3URKA 1IVNA 1ZD2P 3JQ6A 3SM9A 4AJ4A 2AVNA 1IC6A 4KDEA 4L9AA 2XOXA 4EBBA 4C7VA 1AF4A 2GO1A 3D3NA 5L3SA 3CLSD 3H5NA 3GMIA 1KZ7B 1MNAA 1NQ5A 3LXUX 3QIVA 4Y2VA 4YIKA 2OFXA 5IC5A 2HLHA 3VPHA 3FDXA 4IVQA 3WL6A 3PFWO 2OFWA 4BFCA 2GN8A 3WMGA 3UH0A 4DLWA 2G40A 3B1ZA 4ZOLF 1R27A 1V25A 2W48A 2IUUA 2GILA 2VDWA 4WHMA 2ZJFA 3STYA 1ETHA 4PC3A 2WUVA 1C1XB 2BFFA 3WK4A 1WPRA 4UTRA 3T3PB 4EZEA 1VBFA 5TXGA 5GJBA 1FYVA 1WOYA 2JZCA 3QITA 5HIAA 1F8GA 5IT4A 3A6EA 2P35A 3DCIA 4LX0A 4NU5A 4TMXA 5HX7A 5F98A 2KS6A 3MJVA 3GUHA 1QIIA 2ZVQX 5D2CA 2Q1UA 2CUNA 4X3PA 4O4JA 1P7YA 1GSIA 1NHWA 1DCTA 1AHNA 1LTHR 4D80A 1XAIA 1VIVA 3L0ZA 5LP6B 3FCAA 2ZCJA 3K32A 3HBNA 3OPQA 4G41A 2O9JA 4L1KA 1E2FA 1P2DA 3A6JA 4RF2A 3NVMB 3SSNA 1BCRB 1QIGA 3M0EA 4Q1EA 4WZAB 2Y1CA 4RHUA 1E0KA 3MF4A 1ZJJA 2O0MA 3UW1A 2VZ9A 2HYIC 2FPGB 5L3ZA 2WNIA 3EIOA 3KSBC 2DFNA 4OXQA 3D31A 1Z5VA 4J1QA 1HM5A 1U1GA 2PZJA 3VH3A 1ZJWA 3OHPA 4DIOA 3T54A 3E05A 4HYQA 4AZTA 4GLFA 4NV1A 3ASYA 1QC5A 4WKBA 3EDOA 4XOUA 1NQWA 1TMGE 1MP0A 1GPYA 3G68A 3THYA 1Z22A 2VHVA 3RJ9A 1TCVA 1TL7C 1U3WA 5DJ5A 1TJ3A 1UJNA 1ZH8A 3IEKA 4IOLA 5CIWA 3TTXA 2GOYA 4AW9A 2I7CA 1EGQA 5LZ9A 3OH8A 5GJCA 2VCHA 2VHQA 1CDZA 1YVEI 4Q15A 4YRMA 3ZD6A 2EP8A 3QUCA 4AS1A 1P2BA 4G1UC 1M5RA 5CCEA 4TRMA 3WYEA 1EFPA 2JGDB 3N2KB 4HNHA 1UBUS 4OHVA 4RFSB 2AJBA 5E9AA 2I4MA 1W29A 2VFAA 3IMCA 4G2NA 4PYKA 1FVOA 3CUVA 3C5EA 1LVUA 2QIOA 3BMCB 3EXG1 3H3FA 4O4HB 4X97A 4YTEA 4P7BA 2IHNA 1NBHA 2AQKA 1PI3A 4OBBA 3TZLA 1RVV1 2NXEA 5F3DA 3ZN2A 4AYTA 4YCLA 1NYQA 4N3BA 1X19A 1OPRA 1ZITA 1H05A 4GNRA 4JNKA 4XQ9A 5GAJA 3C8MA 1YL7A 5TF4A 4F8EA 4MS1A 1G6HA 2VHYA 3ORSA 4OP1A 2KM1A 1SA0A 2MR6A 3I64A 5FR1A 4BVHA 4CIDA 1QIJA 5DWDA 4M0UA 5THQA 5A4FS 1YTLA 4RELA 3R0VA 2Y1OA 5COAA 4DLVA 3D4BA 3GJTA 2EJBA 2V7VA 4GH5A 2O23A 5EXPA 5BYJA 1BMQA 3KO8A 3BFVA 5PGMA 2PR7A 1CU1A 3AG6A 4CMAA 5IKXA 4LMRA 4DS3A 4F46A 1E7WA 4N6OA 3I5UA 3OP4A 4WNAB 2AX4A 4R8LA 2G08A 1U2QA 3DJYA 1TZMA 3GA0A 4GEGA 4I8XA 2Q8PA 3GWGA 1E2GA 4PO3X 1MMFB 1O3YA 4A4DA 2FSVC 2IHVA 4KQCA 3KJZA 1D4OA 4DEXA 2GLXA 4RAQA 3D4LA 2E4UA 1KQGA 4FYIA 5KWVA 2WTAA 4EA9A 3OT5A 4PZZA 1ZW6A 4BN0A 3N0RA 2CNOA 5JAIA 3G89A 2CD9A 4AY2A 1JL3A 3DAGA 2HZBA 2IYFA 3OY2A 1TUBA 3KXDA 3DOEA 3AL0C 4GI7A 3WTCA 5EE5B 2WUFA 1WQ4A 2NYRA 4B4UA 3QEBZ 3CLTC 2CE7A 3JWGA 1BJRE 5AI5A 2JKZA 2Y3IA 5AICA 4DV5B 1H6CA 2PK3A 4UHDA 5B37A 1IG0A 3WISA 3ROGA 4EY3A 2VKTA 3AUFA 1WNFA 3OMXA 2ZKIA 4B4DA 1AQUA 3GA5A 1JV2B 4QU9A 3DHVA 1Z6ZA 1D8AA 4S2UA 3RS3A 1P80A 4E2XA 3P9KA 3ROKA 2GWHA 3LCMA 2RGCA 1YDFA 2A35A 3JQ8B 3KPYA 3KR1A 3K1AA 1V6AA 4Y3UA 1HNXB 1KWGA 2UZAA 2QSYA 1WO8A 1HY3A 1KA9H 3FPEA 4HGNA 4Z0TA 3ITEA 5A0TA 3NDBB 2QORA 3BKWA 2HF2A 4LBWA 1HRDA 1ESDA 2WHXA 3RCBA 2NVOA 4DRXA 1RP1A 3EGIA 5HIIA 1KZYC 2FNAA 4IJ5A 3JQAB 4GL4A 2Q1WA 4FKMA 2ZUTA 4DW8A 2P4EA 1XTVA 3AOGA 1NVAA 3ACBA 1NY6A 1XRJA 4ZQGA 5I9MA 5JADA 2A9QA 2O52A 2HAEA 5DX0A 1ONNA 3V8EA 3VZDA 3IAFA 1T2VA 3C85A 1O5IA 3LTEA 4XM0A 2IPMA 4JBHA 4M7RA 1ZQ9A 3EB9A 1H23A 1QHYA 1JVBA 1IHOA 3LRXA 1GRQA 3FCSB 3KTAA 1G17A 5DI3A 3O2QB 4YQYA 1DPFA 5EJ6A 2JLRA 3USCS 3AFMA 4LGMA 3L8GA 1F3OA 2A8YA 3AGPA 3OZBA 2B2NA 4RIFA 1SHTX 3NM6B 3TIVA 3W06A 4PLTA 1WXEA 1QRSA 1V95A 3WA7A 2V65A 4RMGA 5IMBA 2QM7A 2PQ0A 4RZUA 5I8ZA 5KPJA 5JFTA 4M22A 1E6UA 3H0KA 3JVIA 2JJ2D 1Y8CA 3QYFA 3HS3A 3U81A 4A0HA 4EP1A 4QA9A 3TB4A 1SQGA 1G38A 1X1DA 2PN1A 4M60A 5CJPA 1MO2A 2VF2A 1QYVA 4V03A 4EBFA 1C2TA 2VDNB 3DE2X 5IJAA 3PPVA 3DE1X 4ID9A 2H57A 3PGJA 5LZ7A 3T8YA 4D26A 3MGGA 2P67A 2RDMA 3L1IA 3IESA 2QG6A 1XLTA 1FIUA 3MYRA 4W5TA 1S1MA 1SVMA 1V35A 2GSDA 3SLKA 1PWZA 3DS8A 3HUTA 1H8ED 1NBME 4WESA 3F6SA 1G1MA 4OA8A 4ZHSA 1SKBA 1XZJA 1Q2XA 1G41A 2F59A 1JE0A 4QDOA 5H9WA 1XQVA 2KYRA 3E1SA 1QIDA 3PWTA 3ZWYA 4UNPA 1PAUA 3KQLA 2OESA 4QG7A 1OUMA 4BWFB 1EE2A 1NWHA 1XEWY 1ZA1A 3H1TA 2W9XA 4JEHA 4P0TA 3GF4A 1H3FA 1PSZA 3LUPA 3UB2A 2OHGA 1Q17A 1E3WA 4NI5A 1CQJB 4X41A 2J1LA 2RBGA 4NFHA 4B7AA 5KU7A 2QA5A 3CLRC 1M83A 3A4LA 4NMXB 3UWPA 5HM8A 3BIOA 1DAPA 4MB6A 1OAKA 2QW8A 3N7UA 5KO2A 4EVQA 3EBPA 2Q41A 5DNVA 3R7AA 1OB5A 3N8IA 3WYGA 1VG1A 1BZYA 4LV8B 1CLEA 2YVAA 2FU5C 2CK3D 2ZIEA 1XTZA 4MJ7A 2ID8A 4KZKA 1RRKA 5AQ1A 2J5KA 3LHDA 1SUSA 1DEAA 4H27A 4HGQA 2VP6A 4RIGA 2Q29A 3EFBA 2ZYSA 4UD2A 2YVLA 4IDEA 1COWA 1PT6A 4N82A 4S1VA 3GFTA 3KK0A 3ZZMA 5H3LA 2V7GA 4LSMA 5D1NA 3EEQA 3QSGA 3WR5A 5BPFA 1WE2A 2PO7A 4XIFA 2XWJI 1QE3A 1LDBA 3O84A 3OQHA 1F4VA 1E3JA 3BE4A 3JYOA 4AWBA 5JAQA 4IS3A 1QCDA 1A9TA 2HV8A 5LQMA 1NC3A 2C4KA 3DE5X 2FUNB 3I6YA 3W6UA 1R16A 2ZBRA 4KQWA 5ERGB 2GEKA 3L8CA 1QVZA 3F8SA 1AK1A 3L7IA 1Z4IA 4M9XA 4KC0A 4B09A 4BPBA 5JARA 4XQEA 1M76A 1TLTA 1KDTA 1ISIA 1U0GA 4DQXA 3WDKA 1XP5A 2VP3A 4CM4A 1TKBA 1Z4LA 1D2NA 1T8WA 2VN8A 3JD0A 1HT2E 1IRXA 2CGEA 1KO5A 2BTQA 2ZUUA 3CYFA 4KQXA 3X1XA 2RI6A 5BSWA 2XECA 4YUVA 4B79A 3AM1A 3GGPA 1JIVA 4BFLA 5EKTA 3GG2A 3W5DA 1FUEA 4CMEC 2BCEA 1DVRA 4CRWB 4E5VA 4H7PA 1JX6A 3CURA 1ZLXA 6Q21A 3L8FA 3H9QA 5DM60 5EHZA 2IZ7A 1EXVA 4HWTA 4BATA 1KH2A 2XHZA 3PQ2A 1LLUA 2DZDA 2FXVA 2V59A 3DP7A 3DUFB 3IUPA 4FC7A 5HMLA 3ZGLA 4CKBA 4UXIA 1U3VA 3KVRA 5IKPA 1VPWA 4WY2A 1V5GA 4F71A 4YRGA 2X3FA 2O8DB 1JR3A 1ETUA 1JT2A 1V71A 2ZETA 2IX3A 3RR2A 3BSFA 2Y9MB 3MFYA 2PKQO 3DZFA 3K3PA 1FMCA 4OQDA 1RBMA 5BV1A 3FVTA 3QE4A 1KJQA 4WGFA 4HQ6A 2OMKA 4AICA 4YT5A 2WIKA 3HJNA 5J2UA 4FQ8A 2I1VB 3DOCA 1Y5MA 2V55B 2WOOA 1HKUA 5KNBH 3TRIA 1JILA 3F3MA 3UBTA 3TL2A 3EY9A 3JARB 1XWWA 3ZDZB 4R71A 1UANA 1EP1B 5SY4A 2OZEA 5H4GA 1GVNB 2C5LA 4LZLA 1O0CA 2I4LA 1OILA 4RH3A 1SEPA 4OJMX 5HZHA 4PSCA 1G1AA 1UBRS 1IUNA 2OBMA 1RPTA 3GRPA 1JEOA 3D7RA 4YQEA 5EE0A 3L4JA 1BDJA 3EZGA 1DKQA 1CP3A 1YZNA 2OP0A 3A1TA 2WWWA 1I7SB 5HK8A 3B38A 5A7FA 4BUZA 4ZV4A 3X1MA 1NXWA 1NUHA 3DMNA 1NQXA 4MV7A 1UL1X 1WU8A 2UVQA 3G5AA 2WFZA 3ORQA 4A8TA 3NHLA 5IAJA 3M3HA 4Y2PA 2FFJA 5ED4A 1ZS9A 1WV1A 1Y8QB 2O8BA 2BGLA 5DVZA 1E2BA 3VO9A 1LDMA 1R9NA 2C2ZA 3Q0IA 2XVXA 2F6RA 3KKZA 1YRAA 4I5IA 4I6JA 1W35A 4TWRA 5AKZA 2BFDB 3UJ8A 2HOQA 2J4DA 3C7DB 3HI6A 3HJHA 1BVRA 1YQ9A 2YASA 4UU0A 1S5PA 4W5NA 4Y2JA 3ZIDA 3G1TA 4WLNA 3LTNC 1L7RA 2ZSBA 5JALA 1YRWA 1Y37A 3EVNA 3FVQA 3HBFA 2BFWA 3WO0A 3FZNA 1GZDA 3SY8A 1L4FA 4N0QA 3T3NA 1F3LA 4Q1CA 3L0CA 1UBJS 4CNQA 4LKOA 1QK4A 2JCVA 3R7NA 1AN0A 3TVDA 3ZTTA 4L0DA 2JJQA 2JI9A 4FX2A 4JODA 1TZKA 2XMGA 1RYFA 2QXTA 3KFVA 4FGUA 4B8WA 3M1LA 1T3TA 3QVGB 4WY8A 5JWRA 1JHDA 2I5PO 2GTPA 1CKEA 4G65A 2B37A 5AOVA 4NLLA 4BY9E 2WJ4A 5FUWA 1N2CA 3A3NA 4RMHA 1CY7A 3DEKA 1H5NA 1VG9B 3A4VA 2FR1A 2GDJA 3T9FA 2GFQA 4RY2A 4EITA 1G9XA 2W2NA 3KKPA 1D6SA 5CMLA 3TNFA 2REQB 2G9UA 4W1PA 1NOIA 3TLEA 4BFUA 1VE5A 3FROA 3A4YA 2IJGX 3LW7A 3SVTA 4CKZA 1VPEA 2PXAA 5K0LA 4HDOB 1KVQA 1Z5GA 2WFLA 1PWYE 3EA0A 3OQPA 4XUCA 2HF8A 5IM4A 5ANRB 5LQRA 1F17A 4NHOA 5GZ3A 2R6HA 4P22A 5KOJB 1II8A 2CY0A 1W4ZA 1SC4A 3IHLA 2GESA 4JBIA 5ALEA 4D9BA 3M5DA 4Q3DA 3RYHB 4FCTA 1R6DA 1T8RA 4R2HA 2RAUA 3HR8A 1V1JA 2IZOA 2X0RA 4OQYA 1I2BA 4ZRMA 5IBRA 3DKPA 4GMKA 3MCVA 5BY2A 3AI3A 3BCSA 3T3EA 1MZPA 5KJEA 1UMCA 2F3RA 3B13B 3W1WA 3RF6A 2IWRA 1FJHA 2GD6A 2O3RA 4NJMB 1PP4A 3DZGA 3TM5A 4ETIA 4LNHA 2Q2OA 5KHAA 1UXIA 3ZEAA 4GOMD 2QI9C 3DBRB 3QFHA 4LXIA 4NV0A 3EA5A 2G4VA 3L84A 3VDQA 4C2UA 2ZTVA 1KVSA 2L18A 2BHRA 2LDBA 3EZ7A 5FWYB 1J99A 3PNYA 3OQBA 1E9DA 1Y6FA 4RJIA 3V1NA 3W5JA 3LP5A 4FDMA 3IP9A 4ISBA 2ENWA 1YZFA 3PVSA 1RADA 1UEJA 4XX0B 2BGGA 1DJQA 4AJ2A 3U3OA 1LSJA 1K68A 3G9XA 1EJBA 3IMKA 3V4OA 1IHUA 2NZJA 1MAVA 2V7WA 1FEZA 1NKSA 3BJEA 4LJ6A 4PBSA 4BKMA 4Y2YA 2HU8A 2R8RA 5L3QA 4AFNA 2V4MA 3BORA 2HU7A 1J9GA 3AMVA 2WU8A 4GQIA 3L05A 2UV8A 1N5RA 2CUZA 1OVMA 3LC2O 4J3FA 4RETA 4UCFA 4BO9A 4ZVOA 3ML1A 2IUTA 2QP3A 1DBPA 2ECQA 2QZPA 1TK2A 4JGGA 1VFPA 2R62A 3HN7A 4RSGA 2PXCA 1O2DA 3FMIA 1O97C 4MKZA 2IHTA 2IBMA 1BTOA 1QIMA 2GHIA 3H2ZA 3HR7A 1L5MA 4WAUA 4DIFA 5DXAA 2QPTA 1K06A 2GM5A 2W83A 2Y1DA 2YOFA 3FFTA 2FE4A 3LC0A 3LNTA 4HSGA 5H3CA 5IKMA 4MV5A 2QRHA 4N48A 5J4HA 1N0HA 1P60A 4W5QA 2YUTA 4KKVA 3OEHA 1Q1NA 4M8KA 3IVAA 5JXHA 2AK2A 4KI0A 3DZDA 4GUAA 4Q4HB 3ZQUA 3VJRA 3P32A 5G0VA 3GEIA 4KPFC 2NZWA 1SIWA 1WDMA 2PMKA 3ZGYA 1VHTA 1XYVA 2FJPA 3E7WA 4G0MA 4EABA 1KRHA 4CTJA 4EHDA 4UTPA 4WV3A 3UGKA 5EKXA 1HDCA 1I5EA 4U7JA 3GJ5A 2RGAA 3BMOB 2J9RA 4IHJF 3KIPA 4E46A 2ANBA 4BNIA 4G4JA 1TTPB 5D7NA 2O2YA 3FUTA 1IU9A 4BKQA 3E9QA 2FEWB 3GBSA 5B2FA 1HK7A 1GCGA 5JRDS 4RY9A 4EI7A 3FYTA 1JHMA 1GARA 3D7SA 1TB4A 4MVJM 4XWTA 4NMLA 1A5AB 1RXSA 5FBLB 4BGVA 1C3LA 4K05A 2COEA 3LPDA 4GR5A 2J3HA 4HXEB 1MEJA 3GLRA 1MABB 4KAJA 4ZT2A 5FHQA 2BR4A 5KINB 3IULA 4PFSA 4JMPA 4QVKA 2PY6A 1KMCA 3EJWA 3CKKA 4ENVA 4I8IA 3TOSA 4MIOA 4Q4LA 5K3SA 5T6BA 1C1XA 2A1TR 5IZ4A 4R9NA 1O94D 4HC4A 5IDXA 3FAZA 3E48A 3F78A 4YFYA 3W3AD 4JC0A 3WLOA 1HEUA 3K6JA 1Z2OX 2A7XA 1NX9A 4IWNA 3OZTA 4RTOA 3H5TA 3N6RA 4M9UA 3RANA 4G85A 3RASA 2JGJA 3RVOA 1SKUA 3VZPA 1EFTA 3V1LA 4ZAWA 3LKZA 2PVCA 4F1JA 3TKYA 1FUKA 4HATA 3NM4A 2P5SA 4MGHA 4XLZA 4V0RA 5JAZA 3L0BA 5LP6A 1RM4A 3RG2A 1QZUA 4ZYLA 1AHHA 4K8RB 7MHTA 2FOLA 1DT5A 2XQJA 2XUAA 3BIXA 4L5AA 3WFJA 1JLRA 1FXWA 2QN2A 4KFUA 1G5QA 2FEPA 2C0QA 1IJEA 3I3OA 2FPGA 3D1JA 3R7DA 3IDSA 2XBMA 1K27A 2XUDA 4JYPA 3EASA 3ILHA 3MIZA 3THXA 1FE8A 1CPYA 3U44B 1UUFA 3ICCA 4X71A 2DR3A 2YOGA 4U4AA 1PJ2A 1A98A 2XCSB 4K28A 3IQDB 1Y9AA 2I4TA 4ZREA 1CR4A 1RWOA 3C70A 3F8WA 3F3YA 3NBFA 4OV6B 5A3VA 1RMYA 5E6SB 2AXPA 4B83A 4O63O 3JAKB 2YIMA 1NQTA 3OF5A 3UUEA 5TLSA 5JCOA 3C5CA 3KYBA 3VOBA 3OUTA 4ARIA 3G5MA 5ALPA 3OQIB 2IPXA 4R1TA 2GF9A 4L6AA 5D6OA 3LOUA 5EWMB 4F11A 5A2GA 5IZCA 1AGYA 3BBPA 4BMZA 5HUQA 2GN6A 3OZEA 5EIXA 1MO5A 2JGDA 4Q4AA 2Q6IA 1WZCA 1HQDA 4RFSA 3WLRA 1JHRA 4TV8B 4BGIA 1DKRA 1F2DA 1ORRA 4O4HA 3VU9B 5KTSA 3BMCA 4Q37A 3FA2A 2D7CA 3R3SA 4G2TA 3ZPXA 1E7QA 1MO6A 4UNNA 3GFPA 1V3TA 1EWRA 4DAEA 4NFYA 3RVDA 4EKDA 4OLAA 2FPLA 1MO3A 3TIFA 3DB2A 4XGKA 2HZ7A 1ESEA 1QH9A 1QSGA 3VOSA 1KYYA 4QOEA 4Z51A 3DBIA 5BN3B 5JS7A 1NRXA 3R7FA 2NN3C 1P0PA 2JJ8A 3MBIA 3SJUA 5EVCA 1UJ5A 2VK8A 3EVEA 1ORWA 1ZOLA 5E4FA 2W5UA 5DFAA 2FMUA 4RTRA 2DR0A 2A9OA 1SUCA 4ARAA 3ZY3A 1KORA 1ZIOA 1X1BA 3A6FA 3ZNNA 3WYCA 2V5UA 3P0EA 4O3MA 2QPLA 1TEVA 3OPNA 1U9IA 4GX5A 2APJA 4XQGA 5KWJA 2I33A 5TT0A 1VPVA 2OCAA 2P0YA 2K4MA 3IERA 3KRTA 4IO1A 3HCWA 3S40A 4C3OB 2Y05A 2OV4A 4E22A 4QXOA 2CVQA 2VXCA 3RQSA 1OTHA 1NUPA 3UUFA 3OQJA 1M8KA 4WVLA 3WL7A 5TPZA 5COQA 1FQWA 1ZD4A 4UHCA 3RTEA 4X65B 3T3DA 4ND5A 2ZP1A 1N2SA 2HSDA 3O90A 5DM4A 2XVMA 2ADFA 1TUGA 3SGLA 3L8ZA 3RVKA 3V9AA 2HMUA 3HZOA 1K75A 2GPJA 2P9EA 2CCJA 3D1LA 4AROA 3T1TA 3AF2A 4AJLA 3ROFA 1RCFA 1YXMA 4KB5A 1GTSA 1CUXA 2FZ5A 4B87A 4E7OA 3ZDBA 1Q7EA 1QGZA 1W85B 1Z7YA 4YLEA 3I73A 4PR3A 4BDSA 5A4KA 1IVSA 2FEOA 3H7IA 4QTTB 4UOEA 1R9JA 3K9CA 2DKOA 3FFBA 2CXSA 5G41A 1CVIA 3V33A 4PC1A 4A6EA 5BVHB 5D7BA 5BWBA 1PLKA 2P75A 1STOA 2ZYWX 3DOOA 1CUFA 5JCPA 4PLPA 5IN4A 1QLHA 1XNQB 2C7VA 2P4HX 4CG2A 4LMAA 3O5AA 2R25B 4JD5A 2OENG 1OBCA 4X94A 3OEED 4Q9KA 3C6BA 4I5EA 4G5OA 2ODEA 1H2WA 4D0NA 3CW9A 1M2HA 2R7KA 1NDHA 3DGEC 4G8JA 4HVAA 1ULAA 5G2OA 4UEJA 2I2DA 2P27A 2YWJA 3BGIA 3BC1A 2XSZD 4XDGA 2LCFA 2NVUA 3G2MA 4PU0A 2VAVA 4AJJA 1EX6A 1L7OA 5BSGA 4MQLA 1YA4A 4A0FA 3IO5A 1SUDA 3FKSD 3PLRA 5DXFA 5EPOA 2QTCA 2GKSA 4K6GA 3L1KA 1CERA 1M8PA 3NVKI 3RRBA 4ZI2A 1YZGA 4Y6OA 2O48X 3PHIA 2XQKA 2EX4A 4NEGA 1MFZA 2QZZA 3A3YA 1T5SA 4O5OA 1W5AA 4UEOA 3TW8B 4C4RA 5JC8A 2GAJA 2E18A 2AT1A 1XU4A 1X8KA 4JH0A 4UVIA 4UM9B 2RH4A 4BBJA 5FX2A 4KR2A 4UUQA 4TUYA 1DKMA 5FI3A 5E1BA 3QPVA 1ATIA 2BGMA 2QDXA 3AY6A 3LWNA 3RS4A 5EJ5A 1IJFA 4L78A 5KBYA 1VRCA 3ZXUB 4ROSA 1OGJA 5IAEA 3IURA 4MH0R 5BN4B 3PFBA 4GAEA 2YBEA 2X8JA 3ZQKA 2KMLA 1PR4A 1I5RA 1ZZGA 2DECA 2GYYA 3TTUA 1OMOA 5FL3A 2YWDA 1VYVA 4LISA 4LXXA 2DGDA 1W76A 3FUVA 4GF5A 2C3PA 3NC0C 4RHEA 5CYGA 4GQAA 4XKJA 1EGAA 2HSGA 5FOXA 5C4MA 4WZBE 1D3AA 5JWOA 1A4XA 1G8JA 1ZM9A 3GGGA 3GLHE 4WKNA 5AKKA 5HCUA 3HG7A 1ILWA 5TQVA 4F7DA 1YA6A 4AQYB 2F43A 2QMHA 1WDTA 1HO3A 4NZPA 3GARA 1B42A 4WL0A 4L6IA 3PXAA 4CQMB 3WGNA 1NBMD 3MGCA 3DE7X 4O1IA 4G89A 1K7EB 1YRHA 4CUZA 5C1DA 2JI7A 1NMZA 1OI7A 2BI7A 2WJPA 2D54A 5L95A 4PN3A 4H6WA 2B61A 3MXOA 1Z73A 4MWOA 1X86B 1B1AA 3AU9A 4A9AA 2JIBA 1CBUA 1LK5A 4P0PB 3Q40A 3HSSA 1FDVA 4P53A 5BNWA 1AZTA 2FKAA 1UQRA 4W1SA 2ARKA 1T36A 2VZ0A 2YY5A 1SCJA 3LHKA 3SIRA 5K1ZA 4K7JA 4ZZIA 1S2GA 3OOEA 4KE6A 3R41A 3QPBA 4W6ZA 1FBNA 3C3WA 1KU0A 2II6A 3JY6A 4PAWA 1HE4A 1HYBA 2FG5A 3KSMA 4XUEA 1BQ4A 4P08A 4AK9A 5KOYA 1SU8A 2XD9A 1Z5WA 3RC3A 5DHTA 1EZ4A 1UM8A 3ZV5A 1E62A 3QFTA 4DA6A 5KTTA 3W7BA 2Q5CA 3CSSA 4MVJA 4NZYA 5ALSA 1WXWA 1MBZA 4ZALA 3CPHA 2H5EA 2QJTA 1TMOA 5EIAA 5TMDA 4K6OA 3KXIA 2JLQA 2CHFA 5CPBA 3C3YA 1W7AA 3KV3O 3KT3A 5ABPA 4ZZ1A 1EP9A 1VKHA 2Q1YA 4OVKA 3ER6A 1OTXA 1U1CA 3AUKA 5GP1A 2FH5B 2H2HA 3WADA 4BP3A 4LFBB 1VLZA 2ORIA 4IQGA 2R6GA 1A1SA 3HJBA 1DX6A 3H11B 3QU9A 4ND4A 4QOFA 4RLSA 1B7GO 1KF0A 2P9JA 3FTFA 2BFBB 1QZZA 1CZUA 3WYNA 1T9DA 3NAQA 4OHKA 2EX0A 4RFLA 4PLVA 1NN0A 3VYTB 1ISSA 1U1IA 1BRMA 1ZJ5A 1QPGA 1GPLA 1XCBA 3FMFA 3H13A 3IE2A 3QWIA 4WMLA 5FOUA 2JFWA 2FUG1 2NXCA 4P1ZA 2GN0A 3UPDA 3L79A 2EJVA 2R8XA 3TL3A 1YRBA 3A1FA 3F5FA 1C81A 4XPZA 1PGPA 3F2IA 3HBLA 2HRRA 2AUMA 3N2LA 4DMUB 4HL6A 1DZIA 3B3JA 3IUJA 2HK6A 3QHQA 4P54A 4TXJA 1ZOIA 3KAPA 2VJYA 3LDFA 1Y1RA 2OWDA 3R24A 1R8SA 5CVTA 5KOIA 5JCJA 3CX4A 2PX0A 1IPHA 3HEAA 4WINA 1Y6GA 5IJ9B 4K6CA 3SZGA 3G82C 2A6PA 3ZG6A 1UWLA 2HB6A 1RXWA 2PBLA 1UJBA 1YB1A 1NQOA 3QU7A 3NWBA 4ER0A 4TXNA 1N2JA 3VR6D 3TPCA 3BBLA 3PQ6A 4KFTA 4RVHA 5EUQB 4BFVA 1CQPA 2IY7A 2SKDA 4TQAA 2JD2A 1T2AA 3QXCA 2JBWA 4L73A 2G83A 4K03A 4Y8VA 1I33A 3FOWA 1W46A 1C1DA 1QH1B 3UC9A 4C2TA 2W0SA 3JARA 1LD3A 1PQYA 2C92A 4IGEA 3OE5A 3R7LA 2FEMA 2ZDGA 2V96A 4NYJR 4BRZA 4MNTA 1MOSA 2CJWB 3P7MA 2O20A 2CT8A 1L8AA 4B3FX 3JASB 1NHGA 2YR0A 3EIEA 2O2XA 4A91A 2CYBA 9ATCA 4L15A 1WZNA 3A6ZA 1B6RA 1SN7A 3BGVA 1T34A 4IGIA 2EG9A 4N12A 3PRYA 2YNMC 3ESYA 2P91A 3U6KA 2I4IA 1UBNA 2AUTA 1R6BX 2AQIA 4OAQA 2VK4A 3AZOA 1SKQA 3LUFA 4P3OA 3A31A 3R40A 3IP6A 5DYGA 2JAPA 1S02A 1V7CA 5JY6A 1INLA 1F60A 5KNLA 4O33A 5JS6A 3X2FA 1WVGA 3NKFA 3KSRA 4KYUA 3LUGA 2Z1MA 5C46F 4LNAA 5AUPB 2IITA 2E1RA 2BFDA 4XB2A 1SCDA 4GC5A 5CT9A 4C4ZA 4OY3A 2ZTSA 4U2FA 3O8CA 3G17A 1G5HA 4EDFA 3K8QA 2CVZA 3I1IA 4RK4A 1UOEA 3EGWA 4I7EA 1WQ1R 1FUUA 1G3IA 2ODNA 3QRWA 1UDXA 4Q03A 4WTOA 1E1YA 3O0DA 3F97A 1Y9JA 4LZAA 1H6BA 3W0LB 1JXQA 4I2NA 4CEIB 1PSWA 4MKFA 4L9SA 3EXIA 2OCPA 3PUXA 1XLVA 2OGTA 1TX4B 2ZI4A 1KOJA 4PCAA 4DSNA