3PEWA

S. cerevisiae dbp5 l327v bound to rna and adp bef3
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
391
structure length
391
Chain Sequence
AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGVMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 145
structure length 391
sequence length 391
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pewA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pewA02
3QKSA 4Q7KA 2ZVQX 3VR2A 3CH4B 2QAJA 1CIPA 2Z4SA 4TSFA 4QNMA 2DR3A 2OHFA 4GT1A 1KDPA 5FTNA 1ZC4A 1P61B 3EXAA 2BJWA 4BLQA 1N25A 2W6JA 2BOVA 2B8WA 4OQNA 3ADBA 4I1OA 2GETA 3PV0A 3TVTA 1SVLA 3AH8A 4I1UA 4V0OA 4HI0E 2IS2A 3HR7A 3ND8A 4BLTA 1LS1A 1ZNXA 3OFND 5H70A 2QTVB 1VYTA 2CLCX 3W6NA 2WWGA 3SU8A 3LRPA 3X1XA 2AWNA 3DOEA 2OM2A 4QL3A 1U0LA 1QHXA 1TL7C 1SXJA 4A2WA 5FH9A 2HF9A 5JFGA 4PHHA 3L82B 2PZGA 1QRAA 3KFVA 1G3MA 3CNNA 2G0NA 1VDZA 2G0TA 2X77A 4MQBA 3NC1C 2D7DA 4JJKA 2Q9BA 5GJVC 1FQKA 4DLWA 2NO9A 5J4YA 3GLIB 3IILA 1DELA 4XOIA 4E09A 1RIFA 3IHLA 5EXPA 1KYIA 1Q0UA 3FVQA 1N6RA 5KUTA 4Q9IA 2LKDA 5K8UA 2GHIA 4FCWA 1AS2A 2ZRCA 3B60A 4B3DA 4KFTA 4B35A 2C77A 3HYRA 4D4MA 4FW9A 5EE1A 3GEEA 2J1LA 1LFDB 3IQXA 2XB2A 5G3ZA 3P32A 4CDGA 4A4DA 4HLUC 2KE5A 5SZHB 1U99A 4IFBA 1VG9B 1KGDA 2BBWA 4XVQA 2V4ZA 1E2PA 4HDOB 2GTPA 1U81A 2JLVA 3TLXA 4LYJA 4O25A 1YR9A 3UMFA 1W0KA 3I3SR 3IEVA 4KSCA 2V6JA 3A1SA 3K0FA 1XTRA 3DMNA 4A82A 2HJGA 3AVQA 4GDFA 2B7BA 2D06A 2QP3A 1Z22A 4C0QC 1T8TA 2O0KA 4YDSA 5AUQA 3W8RA 5DSZA 1OT3A 3O8CA 2ODNA 2VEDA 3BRWD 2CCKA 4Q66C 4JZKA 4TYNA 3CRMA 2KB0A 4NYJQ 4UXHA 2X19A 2BBSA 1OH7A 3UMSA 4TQUS 3NBFA 1US8A 3U7EB 4F92B 5H68A 2XNDD 1MO5A 4TMKA 2ZJ5A 2CDNA 3PEYA 2IA5A 5C46F 2FFBA 2DFTA 2ZROA 2EFDB 3HYTA 1N0WA 4TT3D 3KQLA 2W0SA 2VHCA 1NVVR 5F98A 2PCLA 4LCBA 4AKEA 3P26A 2QTFA 4L15A 3GLGA 5C18A 2VBCA 3QPWA 2FZLA 3BH0A 3KQNA 3KX2A 5E7MA 2XTNA 3VQTA 1ZD8A 2G83A 1S8FA 1CJKC 4FN5A 5FPTA 3VX4A 5B64A 4O0MA 5CYOA 3JZMA 5J4KA 4NYIR 1II0A 4BGDA 4TZ0A 8OHMA 1XDBA 2AXNA 1KK0A 2XJ9A 2JAQA 4M1WA 1JXMA 2ZSAA 2PT7A 4TLBA 1ELOA 3HU1A 3THXA 1NNEA 2QA5A 1QHGA 1XMJA 4ZCMA 4V0KA 1TUEA 3ZDQA 3L0SA 3AKEA 2RKOA 4YMUA 621PA 1NN1A 2IYTA 1OXTA 4HYYA 4JIMA 2VP5A 2QMHA 4IDOA 3Q3JB 4IXMA 3B9PA 4OI1A 4DLSA 1RC8A 3IQWA 4HLCA 1B0UA 4Q01A 3EZ9A 1ODFA 3RNLA 2FH5B 3AP3A 1GKIA 3GLHE 2OUKA 3L8ZA 2DY1A 2NO7A 3OEHD 4IW3B 4Z8YA 2Q9AA 4D0NA 1NG9A 1P73A 4A8JA 4AURA 2VSOA 1X3SA 2EWVA 2RGNC 3TAHA 2QPTA 5FUVA 3B2EA 4EQ6A 2ZJ2A 5EP2A 4DSTA 4RFVA 3ADDA 4HZIA 2J7PA 2O8CA 4QBIA 3HU2A 2A3RA 2AFIE 2OFXA 4LJYA 1KO7A 4QHYA 3AVWA 4GZMA 4Q02A 3QBVA 1JJVA 5JSZB 1PLJA 3KXLA 4G5GA 4NYMQ 3UANA 2GF9A 2CLDX 3A1VA 4MRVA 4CEHB 4EPWA 2BWJA 4O2LA 4UNNA 3MWLA 1D5CA 1G18A 1S9HA 1XZPA 1IY0A 3CRQA 3TQFA 2H57A 2VHTA 1SQ5A 1PJRA 3ICQB 1HE1C 1KJZA 4IDHA 3D31A 5JEEA 4A9AA 5G40A 3EPHA 3ZVMA 4HAWA 1AN0A 3CO5A 1EFHA 2ZVPX 3B7GA 4UQOA 2CL0X 4ZDWA 2BDTA 2ODWA 2PZEA 5SZJA 1UJ2A 4G01B 3WP0A 5HPYB 2OAQ1 1FTNA 1P62B 1Z47A 4GRAA 4ILEA 2KI5A 3N2EA 1A82A 4M21A 2IUTA 3IBGA 1N0UA 1YR8A 2ODBA 2ORWA 4B2IA 1KIMA 5DE3A 3LX5A 2BHRA 1QVAA 4I81A 1OF1A 2DBYA 3PIRA 4LPKA 3MWKA 1CR0A 4RD3A 3TK1A 4ARZB 4BE7B 2ZUBA 4LYAA 4B71A 1SXJB 4OQMA 2LCFA 1OFTA 4MUBA 1G8PA 2F7SA 1NN0A 1Z06A 2J0VA 1E2EA 2P6UA 2ZS8A 4UNRA 2ZRJA 4IOLA 3QPVA 4FMCB 4TLAA 2ZETA 4YDHB 1GSIA 3U4QB 3A6PC 4PSAA 2OO7A 3RC3A 4Q9JA 3QXXA 5CK4A 1W4RA 2QT0A 3QEOA 1BO6A 5EXXA 2MSEB 3CB4A 4MA4A 2AXPA 2JGNA 1ZUNB 2HDNB 3W34A 2OEPA 3WRYC 2JLSA 1QBKC 4BEBA 1CR1A 4B2LA 2OZEA 2IWRA 1RRPA 3UKDA 2ASEA 4M53A 4PC1A 3LBIA 1WBBA 1R6BX 2OAP1 3NWJA 1OXVA 3LH5A 1XTSA 3WNBA 3B1XA 3LO5A 2E87A 5JEDA 1I4DD 3C5HA 1JI0A 2VP4A 4HEJA 3M4YA 5JLJA 1G8HA 5TDHA 2NTYC 5J4LA 4AIIA 1ZIPA 3LFUA 4HSEA 4NCJA 3V4FA 4DSUA 1BS1A 1JNYA 3K0FB 2O5VA 4QG7A 2W6IA 5C2JB 3X1WA 2ZYWX 1R0ZA 2WWFA 4PPGA 1R2QA 4LJ8A 3ETLA 2OCPA 2VA8A 3TVDA 4DCVA 2IS1A 1G19A 2FSGA 1NJFA 5DI3B 2IYQA 2YVUA 4IDQA 2QGZA 2QP9X 3LWNA 1P3JA 2V7QA 4W5WA 4O3MA 1JECA 3KJIA 3MSXA 4JYBA 3W3ZB 1AKYA 1A4RA 3MG9A 4URXR 3EZ2A 5DGXA 1U8ZA 1OH6A 2ZPTX 1Q20A 3LQRA 3T1QA 3K1JA 4LC1A 2WOOA 1E1QA 1P4SA 3DVLA 4MRRA 3SFVA 2CHVA 3MMPA 1VHLA 2ZYTX 1A1VA 3T35A 4Y0VA 5E4FA 1E9EA 3UXMA 2W83A 1WXQA 5HR5A 1RYHA 4M0LA 1KO4A 4OJQA 2FPMA 5EE5B 5JBQA 3I92A 4QM7A 5BN3A 1G3QA 1XEWY 4DCTA 3NBYC 2C9CA 4MKHA 2WHXA 3FB4A 2YC4C 4PX9A 2RCNA 4BLRA 4G5QA 1NKSA 2OLJA 1FNNA 3THXB 1RZ3A 4TYQA 2KBEA 2BCJQ 3TSOA 2JASA 2WKRA 1J70A 2CMKA 2ORVA 2OV2A 1HTWA 3VHXA 4QRHA 3PUXA 2IUUA 4RD4A 2XSZD 3D3QA 5DHFA 4LYFA 1JPNA 4C9BA 1KSGA 4HAUA 1NN3A 5FBQB 3AP1A 1U2RA 4QKQA 1G6OA 3PUWA 3SR0A 3H0KA 3CR8A 3IPYA 3DOFA 3GJ0A 3CNLA 2WVJA 4IKEA 5FI0B 5FPKA 5IK2A 4XSGA 4XIGS 4G3XA 1KY3A 4DB4A 3E5HA 4PAOA 4A8JB 4MGYR 4A2QA 1A5TA 4GSYA 3U7GA 4BECA 1NIPA 2KJQA 3T34A 4EQ6B 4Z1MA 4QOSA 1FX0B 1MR3F 4F4JA 5KDDA 4KXFB 2MSCB 1GL9B 2OILA 4DZZA 1LTQA 4B2PA 1Z8FA 1BIFA 1YQTA 3TRFA 4CRWB 3QG5A 1MO6A 3JZAA 3RS0A 1EFRD 4XWAA 3RS7A 2DB3A 2O8FA 2ANCA 1W49A 5JS8A 2ZE6A 721PA 1GL7A 4UJ3A 3MLEA 2DFKB 3U6BA 1ZW6A 2GBLC 1KI7A 2ORIA 3OHMA 3OEED 5FOUA 3NBZC 1E2FA 2P3SA 1F6BA 1TEXA 5JWRA 1AGRA 3VTKA 1W48A 4ZO4A 5AR1A 4MYCA 3GFOA 1TAGA 3NHAA 2RHMA 1J2JA 4FXPA 4ITRC 1S3GA 5K8IA 3W9YA 4PC3A 4WAUA 4TYYA 4Q4JB 1SXJE 3QPUA 4GZLA 2J0SA 1NLZA 4JSTA 2D74A 3K9GA 4W7SA 1PUIA 2HJVA 4G1UC 1JAHA 2GVZC 2ZRHA 3H1TA 1MV5A 3GP8A 3R9XA 5CLQA 4YXWA 4JKYA 2FFQA 1OXXK 2PJRA 4Q4AA 4CGZA 2O8BA 3ECCA 1QG4A 3B1YA 3IHWA 1SKYE 2ZU6A 1J7KA 1W44A 4L8GA 1YKSA 3NG1A 2WPDD 3TUZC 4IVPA 3QIAA 1OB2A 2XOKA 3OZXA 2A7QA 3OESA 3P1JA 1KI9A 4Q4HB 3PUVA 1Z5ZA 1KDTA 1U94A 4Q03A 1N6OA 1IY1A 4AY2A 4DDVA 5CM9C 4LDJA 5DIFA 2ZE8A 1W0JA 1QZXA 1Z0DA 3OIWA 2ZJAA 2CEAA 2ZAOA 5JWHA 2WWHA 4ZCLA 2B7CA 3DDCA 2BMJA 2QG6A 1XCGB 4KJZA 4A2PA 3T1TA 1WBDA 4HLDA 3FFAA 2IYUA 2GJ9A 4NDZA 2QGNA 1IBRA 1ZNZA 3K09A 2YOGA 1NVVQ 3U3RA 1ZUIA 1E99A 4BASA 3LQQA 3EASA 5FUXA 1HQCA 4AK9A 1GL6A 3PVSA 5ELXA 4TLCA 4C0HA 1Z63A 3FMPB 4XTCS 2W58A 3ZVLA 1F48A 2F9MA 2WIBA 5FL3A 1C9KA 4PANA 1W2GA 4Q00A 2H18A 4Q5IA 3KKMA 4EPXA 1YZLA 4NYIQ 1OW3B 1TU3A 1GZSA 3FKSD 3RVBA 1M74A 3I1FA 4DXAA 1OHHA 1X86B 3C41J 1PUJA 3WY9A 3THWA 1G8GA 2ZUDA 1IY2A 1DPFA 2JLWA 3OE7D 3PR1A 2RAPA 3B1VA 2OXRA 1XP8A 4LHWA 1Z6XA 3DPUA 2HEIA 2YC2C 1ZM4A 3GLGE 2Z43A 4Q4LA 4JVMA 1D8TA 4LRWA 1NKTA 2A2ZA 3BH7A 2BKEA 2OE2A 4M9QA 4AKHA 5AJWA 221PA 1G21E 1SXJC 1KNQA 1N6LA 1YZGA 4Q1CA 1I2MA 4OI0A 3VX3A 3KXIA 1NRJB 3WHKA 4TSFD 1KI6B 4IXNA 3SYKA 2VHUA 1M7BA 2CL6X 3RYTC 1HQYE 1ZAKA 2H92A 4KSBA 2W6JD 1GNQA 4C7OA 1P2UA 2P6NA 3N70A 3ZZ0A 1SULA 2RGBA 3NVAA 1VHTA 2IT1A 2QM8A 4ESVA 5BYKA 1V43A 2PL3A 4TTRA 4M2LA 2QAGB 4NCIA 5K8LA 4RFSA 2GILA 3GJ7A 2AK2A 2AKYA 1NMZA 1WQ1R 3KKOA 4L5BA 3V4RA 5KO2A 3PXGA 2IWHA 1SXJD 3WYFA 4ACBA 2J3EA 3U7FB 1NLFA 2WSMA 3LD9A 4DUGA 4BEJA 3B85A 1AS0A 4LV5B 1N0VC 2GCNA 1TX4B 2J46A 4BZQA 1TQ4A 2L0XA 3HU3A 4MKIA 4G5OA 1GP2A 1IJFA 4RCYA 4YMSA 5CDFA 4Q1DA 2FX3A 1GOTA 5BQ5A 4Q7LA 3BB4A 2X1VA 2FFHA 2RGGA 1W1WA 1CF4A 3KKQA 1T0JB 1G8FA 1W36B 2C5LA 4AG6A 1E79A 1IONA 3X1ZA 3UATA 2GK6A 2UZ3A 1JEDA 1PLKA 2W2TA 4KBFA 1GUAA 2BIFA 3BH6A 1E3MA 1R8QA 5JJLA 1CRPA 2GJ8A 3THYA 2VSXA 2G1KA 4D0GA 2CBZA 1W2HA 4X8HA 1UAAA 3CH5A 3LBNA 4I4LA 3AUXA 4BPBA 3QEJA 3A1WA 3B6EA 4CIDA 1F2UA 1M1YE 2IEYA 1W0KD 2WJJA 1E2GA 2ZRFA 4KV9A 1XD9A 5L3QA 2REXB 1G6HA 1FL9A 3LLMA 1HE8B 3AB3A 2O8FB 4QGFA 1NBMA 1UDXA 5E7JA 4QBFA 2GEVA 1D2NA 5TV2A 4DCUA 4DLVA 3SQWA 2QL6A 3CPHA 3SI7A 2D62A 4MUAA 1HV8A 2P0EA 4WA7A 4HZUA 3RWOA 2XXAA 3G0HA 1VPLA 3AKDA 3DKPA 1E9DA 2X2EA 1VYVA 1ZM3A 2F6RA 5EXSA 3CF0A 3GLHB 2NZ8A 2V6IA 1KI4A 3IO5A 4JSYA 4OQFA 4RD2A 2R44A 3Q85A 3WXMA 3HR8A 1CLUA 1MO4A 4KCGA 5CB6A 3WBKA 5FI1B 2REOA 4JLMA 1R7RA 3HP1A 1AKEA 1WF3A 2AKAB 4Q4AB 1OFHA 3BJIC 1Q57A 4LBWA 2O8BB 3BBPA 1MT0A 1KO5A 4N0EA 4JKIA 4I1SA 4C0AC 1II8A 4GNKA 3FYHA 4A8JC 3EAQA 2OCBA 3ZGXA 1CJMA 3R7WB 1UKEA 4MKGA 2B21A 5TMPA 1H8HD 2ZRIA 1E94E 5C4GB 1BMFA 4YMTA 3QJYA 1COWA 2F9LA 1SVSA 3K0CA 3DM9B 4OHXA 3IPXA 5EJEA 3T12A 5DN6A 1OYWA 3K9NA 4R71A 4ZV4A 3CNOA 3HPQA 3T15A 1UDWA 2DPXA 1M7HA 4W9MC 4IJMA 1S9DA 5KDOA 3VMFA 4JVNA 4ERNA 4Z54A 2GCOB 4F91B 2GXAA 1Y3AA 4WVFA 2F1HA 1T9HA 2QT1A 3R9WA 2ZE7A 3CM0A 5FTLA 1NIJA 1XJ0A 3GJ5A 4JT4A 1AQYA 4OL0A 1JJ7A 3UWKA 5BN5A 5FTJA 4DT1B 4BWYA 5LBIA 1Z83A 2P6RA 1VYUA 2HLDD 4P4SA 1T5LA 2VSFA 1JR3D 3SNHA 5KSYA 3SS8A 4TZ6A 1HA3A 1KDOA 2I3BA 2VP9A 4LJAA 3SHFA 1XCMA 5CIQA 1FP7A 4QJ4A 2OBNA 3Q9LA 2ERYA 2JJ8A 4X8MA 2J7PD 1N6PA 1LY1A 1PV4A 2ATVA 3I5XA 2ANBA 5L3VA 3BK7A 1JR6A 1CXZA 4QBGB 4Q7JB 4Q1FA 3EA0A 1AS3A 1S2MA 5AJVB 4B6EA 1KK2A 1OB5A 3THWB 1TQ2A 3AF2A 1IJEA 1KI2A 1O3YA 2WSSA 3NEYA 3TGPA 3GEIA 2GJAA 4ASUA 1E0SA 1NLYA 4HB4A 1T6NA 3DHWC 3TR5A 5FBRB 5K8TA 4CZ2A 1KJWA 4R2IA 2E1RA 4JLJA 2BMEA 3ZZUA 3JVUA 3FHCB 2VO1A 1ETUA 3RSOA 5IRCD 1K6MA 2C04A 2XTZA 4ACAA 2CXXA 2ECKA 4DLUA 4GL2A 4Q9KA 3T1OA 5FOTA 2FN4A 3EPKA 4BLSA 2NIPA 3I32A 2EYQA 2JJ2A 3A4LA 2JJ1A 1YZKA 3EIHA 1KMHA 3VHLB 2D7CA 4TTQA 3EWAA 4ZKEA 4C0LA 1R0YA 2NGRA 3CWQA 1Z0KA 1VG8A 4C7OB 2W0MA 4V0LA 4DRZA 1E0KA 4IHQA 4TL9A 3S1AB 4FMDB 4W5HA 4GP7A 4G0NA 1WB9A 3AUYA 5SZIA 4CW7A 3NDBB 2DFNA 2OBMA 5AJZA 4RCZA 3U6KA 1OXSC 2NPFA 2BBTA 2OG2A 2CHQA 4NCKA 4X8OA 1G4AE 1XTIA 4CEIA 4EPRA 3MRSA 1DAKA 3NH9A 5KU1A 3KJGA 1N5JA 1XZQA 4TMVA 1G7TA 4Q18A 1SHKA 3WMFA 3FE2A 2RMKA 1FNMA 3QG1A 1W4CA 1KAGA 2ZRMA 2MMCA 4M8NE 5KSZA 5EUQB 3TAUA 2H17A 4HDCA 1Z6YA 3U7HB 2XTMA 2REBA 5CYPA 3AKYA 5DI9A 1M7GA 4OK6A 1E1RA 1MRNA 1ZD9A 2GZHA 2GJKA 1SVOA 3P4YA 5JI2E 2RGEA 1RJ9A 1DADA 4TYWA 4UXJA 5HE9A 2DWQA 5ANRB 1D9ZA 2ZJZA 5JZVA 1RRGA 1ZP6A 3PEVA 2QPOA 3AV0B 4KITB 2GXSA 1NY6A 3QKUA 2QROA 2DHRA 5A0FA 1FFHA 3B82A 3TW4A 2HT1A 4P33A 3MGCA 3BIFA 4AKGA 4MRPA 4GOXA 1W7AA 1DAEA 4Q1BA 1LS6A 1AGPA 4KVAA 1XMIA 1CJVC 2AHOA 2XNSA 3OFNA 4KODA 5L3QB 1Q44A 1XEFA 2C8VA 4M1MA 3U3MA 1ZIOA 3AVYA 2RGCA 3KTAB 2QE7D 1TU4A 1JQLB 4TMWA 1CJTC 1P5ZB 4HDQB 2QAGC 2O8EB 1ZM9A 4TL7A 5FOXA 3ZD6A 2P67A 2V7QD 3TH5A 2Z4RA 2ERXA 2CNWA 2G1JA 5TVKA 2FF7A 3H4MA 1NSFA 1UADA 1TF5A 4K81B 4WZAE 4LHYA 4WZBE 1GM5A 4DB2A 3QXJA 4M9XA 2FZ4A 2IYZA 4OI4A 1P72A 1DO2A 5F9FA 1HT2E 5FBWB 2E9SA 5GJBA 3ZVRA 2V3CC 1OPXA 1RW4A 2SHKA 1I4TD 1UKYA 4MH0R 2IW3A 1NSTA 3A58B 2ZJOA 3QKSB 1KZGB 1E2KA 1WA5A 4KI0A 2XEXA 2VIIA 3WRXC 4DLYA 2F1JA 2PCJA 3T06B 2Q3MA 1W36C 4AI6A 2RGDA 2BM0A 2PZFA 1II8B 1U9IC 1NMXA 1Q12A 4XD7D 2A9KA 1GFIA 1CBUA 3B1ZA 5H8WA 4B48A 4R7ZA 5FOSA 3KQKA 1DAMA 3RANA 3ZLJA 1II9A 1TMKA 3VR5A 3RC8A 2ZI7A 3KUDA 4EJSA 3ZIAA 4WOPA 5CJPA 1F3OA 3GLFE 2WM9B 1XTKA 1E2HA 1FZQA 2J41A 4EIWA 1MABA 1G7CA 2CE7A 3LNCA 4LK2A 4V03A 1W47A 2NQ2C 3KZ1E 2IYSA 2ZI9A 3REGA 4DKXA 3VR6A 4RJLA 2JIZD 2VRWA 2ZRKA 5HTKA 3ADCA 3FPAA 4HLUA 2Z0MA 1W36D 1EESA 2DWPA 2EFEB 4LOAA 4P4SB 5IK2D 2CJWA 5IDVA 3DZDA 4AWXA 4KLNA 4U00A 4OHVA 3NIBA 1SKYB 3CW2A 1N5KA 4LBVA 4YC7A 5KSOA 1E96A 4XTRA 3W5IA 4IVQA 1D2MA 2YNMA 5E95A 3VAAA 4Z1MD 3GPLA 4OHZA 3CKLA 4MGKR 2BEKA 1DARA 2ATXA 4HAZA 5FR1A 4NP6A 1E2DA 4B34A 3QI2A 1JALA 3K0SA 2ZR9A 5JI3E 4QGAA 1FUKA 3U61B 2CK3D 1EK0A 2JLRA 4JLAA 1HYQA 3QE0A 3TUIC 2FSHA 3NHBA 1N5IA 1NMYA 1LV7A 1EFCA 2EU8A 2QENA 3VKGA 2WWIA 2ZYVX 2FMXA 4PPQA 1KO1A 3KJHA 3BE4A 3TBKA 4BFXA 2AD5A 2H16A 4JYCA 4N1AA 1L4UA 3EZ6A 2GEUA 3ASYA 3JVVA 3AVUA 2YWEA 4N0DA 3AM1A 1P6XA 1KAOA 2ZS9A 1BOFA 2MSDB 3E2IA 2LKCA 3F8TA 2JLXA 3CONA 3RLFA 4PO1A 3O8BA 2WV9A 2QTHA 1KY2A 3LLUA 2XITA 4P31A 1JEEA 3VR3A 2B8TA 1US8B 2YZ2A 3NXSA 1OLOA 2GZAA 2FDCA 2RGAA 3K70B 4XVRA 1QHSA 5CDFE 5B58C 2C99A 2WMNB 2QSYA 3LVQE 3I62A 1NVWQ 1ONBA 4PQFA 2NZJA 1HUQA 1ZU4A 3GLGB 4BFVA 2F1RA 5B2ZA 2ZR0A 2G88A 1KKMA 2JDID 2X2FA 4V0ME 4EPTA 2QZ4A 4GPTA 1F5NA 4QC2A 4UNSA 1KSJA 1W0JD 2HF8A 4Y0AA 3U2QA 1P2TA 1XTJA 1Z6AA 1GKUB 2PX3A 2TMKA 2AX4A 2QQ0A 3AF4A 3QF4A 4WZ6A 3VU9A 4JLDA 4HUQA 5BXQC 2XZLA 3M6AA 5KNCA 1G16A 1IXSB 5CJ2A 1VMAA 4UKDA 1EWQA 1EFTA 2RGNA 4IOMA 4N3NA 4DSNA 5E3HA 1P7CA 2R2AA 3IDQA 2JA1A 4EUNA 4LI0A 3WNCA 4C0SA 1OKKA 1NBME 1R5BA 1BKDR 2WZQA 1P75A 1IN7A 4LUCA 5DO9A 1XB2A 2FEOA 3SOPA 1G9XA 3WBJA 3TUJC 2QQEA 3FHOA 5DISB 3K9HA 1P2SA 5GVRA 5FPSA 3K8YA 3BD9A 1HURA 2IYXA 2VPPA 1YZNA 2WJIA 5AUOB 1G5RA 1KZ7B 1TF2A 3GJ8A 1N6NA 1OHHD 2J45A 3KQUA 2GAAA 2HYIC 4PHTA 3KFXA 5EP3A 3CZQA 3R9IA 2FSFA 2O8CB 2IK8A 3NBXX 1VTKA 1UF9A 5C1BA 3I4LA 2OFOA 4A1FA 1U0HC 3FGNA 3FWYA 1G4UR 1KTVA 3KB2A 5HKKA 3CX7A 2GK7A 4US1R 3RABA 1DBSA 4KU4A 4IFEA 2D3WA 5DHAA 3EX7C 2WAXA 4LJ4A 1XMSA 2VL7A 2C96A 1G3IA 2FFAA 3F3YA 4NCNA 4TMXA 5KHOC 3QKTA 4EFMA 1GRNA 4FIDA 4JLBA 4M9SA 1KJYA 3EPJA 4JVLA 2GDJA 4ON9A 2OCAA 1KSFX 2FPKA 3AVXA 2OSBA 2ZRPA 4LV6A 1CR4A 1XBTA 1L8QA 3UK6A 3EZ7A 2FEMA 1KO8A 3O47A 2XGJA 4D6PA 4MDEA 5JECA 4A0RA 1C4OA 2P5TB 1A2BA 2B92A 4TLEA 3QVVA 3TSZA 1XPOA 1FQJA 3SJCA 1OE0A 1XPUA 2YJTD 1LNZA 2ZEJA 2ONKA 2QRNA 4M1SA 4JVSB 4EJSB 2HUPA 3DM5A 2HT6A 1R0WA 1FW6A 1E9BA 2DCUA 4FI3C 4PHFA 4TQAA 1R0XA 1S1MA 3D6TB 3IIMA 2DYKA 3SEAA 3OAAA 3ASZA 2ZJYA 1ZBDA 3GFTA 2VH5R 2FU5C 1P9NA 2BMFA 1NY5A 4LX0A 4QGHA 4URUR 3Q7QA 4KFSA 1E79D 3W5JA 1KK3A 1P2VA 2EQBA 5J4VA 2FWRA 3SC3A 1R4AA 1WMSA 3MWJA 4HB3A 4OI2A 1ZJ6A 1N6IA 4LYHA 1C1YA 1TQDA 3LDAA 3QQ5A 1UBCA 2IS6A 3W90A 1Z6GA 2GAOA 1X8JA 2AN9A 2FGKA 5CITA 4RZ2A 1W4AA 4DJTA 4XWOA 1J8MF 4QXAA 3A1TA 3TMKA 3G82C 2AK3A 1MRSA 1UFQA 1ZM2A 2B6HA 2NOAA 1D2EA 3GLFA 2I1VB 5F2EA 4BRWA 5HZHA 3LA6A 4AYXA 4A6XA 5AUPB 1NBMD 2VP0A 2PX0A 3IIKA 4HAYA 1Z6TA 4D81A 5EXTA 3NKVA 3VNVA 1I2DA 1XWIA 4BFSA 3N2IA 2H7VA 1OSNA 4DLRA 4IDNA 1R5NA 2G3YA 4QGGA 3V00A 3MAAC 4GMDA 1LVGA 2ZI4A 1Q1EA 1OXUA 1XD2A 3QOFA 3BFKA 2QBYA 1DS6A 1ESMA 2XSZA 3K0CC 4F4CA 2FV8A 2J0QA 5G41A 2C98A 2CHGA 4URVR 2R9VA 3UG7A 1EXMA 1GVNB 3SBDA 5CK5A 4U02A 2J59A 1U98A 4E03A 1NP6A 1G41A 2PEYA 4JLVA 2ZSFA 3TJZA 3PITA 4RVCA 5GJWC 1W4BA 4LGMA 2Z6VA 1Z28A 2ZTSA 3M0EA 2GRJA 2NG1A 3R8CA 3I5YA 3HDTA 4FCVA 1OJLA 4K8OA 1YZUA 1XU4A 4KO8A 4Q1AA 5JCPA 3BXZA 2R6GA 2I4IA 1FP6A 3X1YA 5HCIA 1BMFD 1YRAA 1K8RA 5FBLB 5DYGA 2R6DA 2Q3FA 5AWFC 4YONB 4B74A 1COWD 1LF0A 4C0KA 1XXHA 2R62A 1ZNWA 4ZDIA 1SHZA 4A36A 4LJ9A 3GD7A 4V02A 4U7DA 2WWYA 4YMWA 3CR7A 3GJ4A 3VU9B 2CCJA 2J87A 4BQSA 4TQ9A 2YWGA 1B23P 2UZIR 4NBSA 2ZIAA 1DEKA 3V9PA 2GCPA 2QEQA 4TL8A 1EFUA 3EWSA 2G77B 3IEUA 3L43A 4F7WA 5J4HA 2VP2A 3TW8B 4Q7MB 2GJSA 1KOFA 5FR2A 4B75A 2PJZA 2X8AA 3ND9A 5D3MA 1H8EA 1G7SA 1XEXA 3PCRB 1KI3A 1P60A 3RSLA 1ZNYA 3THOA 3U5ZB 1YJ5A 1O87A 2G9NA 4KYUA 5FPHA 4V0MA 1YZTA 3RWMB 4KBGA 2FGJA 1RRFA 2RHDA 2WPDA 2NO6A 4U5XA 521PA 3LW7A 2CVHA 2WSSD 2XAUA 1NN5A 4NPHA 1GIAA 2J5XA 2UVQA 2QPAA 2VHQA 4CVNA 2A5GA 3K70C 3BFXA 4BUJA 4ZI2A 3NTUA 1M34E 3WYAA 2IYWA 1CTQA 2J7KA 2WTUA 1OFUX 2D4HA 3SHWA 5CB8A 1OYYA 4GP6A 5FL7A 4E5UA 2A5YB 4KLZA 2YKGA 4FCTA 1HH4A 3O8DA 4FMBB 4DSOA 1NJGA 3QXHA 4ESHA 1BH2A 4IDPA 5GADl 4V0NA 2ZSBA 4YLGA 4F4IA 2JLQA 5HCNA 1T3LA 3P27A 4QHSA 4OJKA 1K5DA 4IEEA 2JJ1D 4O2RA 5BN4A 2FG5A 1E69A 4AKIA 1DO0A 2A5JA 4QM6A 1GWNA 3PEWA 2H8KA 4OK3A 3K70D 1DOAA 3FMIA 2XX3A 2BVNA 2C78A 3ZJYA 121PA 3K9LA 1S3SA 4TL6A 3FKSA 2QUZA 5BW8A 2C95A 3MUFA 1QF9A 1FTSA 2EYUA 3EG5A 5JSZA 1QHIA 2F55A 3OE7A 5TB5A 2WOJA 4OK5A 1SKQA 3EIEA 3E70C 4OKSA 4AYWA 5FBVB 4MRSA 3KQHA 2VP6A 1T0HB 4PQRA 3QXCA 4D0LB 1X1RA 2ZRGA 4C0BA 1ZU5A 4DIDA 2N42A 4TN1A 4EKDA 2AFHE 2Z5FA 4KFUA 4LPSA 2Q0HA 3LAWA 3QXSA 1KNXA 4Q19A 2OXCA 1PVOA 1XFAA 4RD1A 4M4SA 4KYIB 3B8HA 3LX8A 2PBRA 1G20E 3ZQ6A 3ZQJA 1S0UA 2WWXA 3AF1A 4JL5A 3B1WA 4HB2A 1WRBA 1SZPA 3CWZA 4M1YA 3UMRA 4LZZA 2ZRLA 1E4VA 4DCNA 4II7A 2O0HA 3RRMA 3GLFB 3WMGA 2BKUA 3DEFA 3KL4A 4NE2A 4ARZA 4UJ5A 4E07A 2PH1A 3EZFA 1BYIA 1Z29A 4JBXA 2DWOA 3U3KA 1IHUA 1S96A 1HT1E 3IGFA 4EFLA 4URZR 5GJCA 3U4QA 1G5PA 3BS4A 4WW0A 1DAGA 1E9CA 4IEIA 1XD2B 4Z8XA 2CNWD 3M1IA 2QBYB 4RSGA 4EJSC 2EWWA 1YR6A 1GNRA 5EUMA 5CLLA 1SVKA 1UM8A 3VKWA 3H2YA 4OBEA 1RE0A 4JLOA 2ZU0C 2GA8A 1PZNA 5LD2B 5CIWA 4GOKA 1YHNA 2W00A 1FMLA 3D8BA 4A0GA 1Z0AA 2H5EA 1DTSA 3AKCA 1M6NA 3K53A 3EPLA 3U44A 2WJHA 4BLPA 4L4UA 5EE9A 1AZSC 3EC1A 1G1MA 1WDTA 1YE8A 4DDWA 3AVPA 2Q9CA 3OIUA 5IT5A 3QNUA 1SVMA 3I73A 3EA5A 3BORA 4KFRA 3W8NA 4P32A 1KHTA 1VIYA 2YOFA 4PC6A 4PC2A 1VG0B 3SJBA 3U3JA 2CL7X 3CBQA 3KUCA 3SJAA 1XXHB 3ZIAD 1X1SA 5A4JA 5CM8B 4H1VA 2FE4A 4J0QA 3SE0A 1CR2A 1T4GA 2GEDA 4PC7A 4RFSB 5LB2A 3T5DA 1OFIA 1XRJA 3F0TA 4P4UA 5DI3A 3FOZA 5DYIA 4B3CA 3HPRA 2IHBA 4JS0A 4BRUA 1F60A 1E4YA 2OESA 3ZYCA 3RRZA 3H84A 1IXRC 3DKVA 4WXPA 2FOLA 4LHZA 3RS5A 1UKZA 2DFLA 2OBLA 2R65A 3J81k 5P21A 1UBGA 2ZJ8A 5BWMA 5IHPA 4BFUA 1T91A 1V5WA 5KPDA 1A7JA 3KDSE 4YMVA 1G3UA 4FMCF 4PHGA 1XEXB 3DMDA 4QBHA 5D3MB 2D2FA 1HY3A 3LXXA 5H1YA 4LSGA 1GG2A 4GBMA 2KBFA 2VHJA 3LBHA 4KHZA 4TYPA 1XMVA 3AVTA 2IUSA 2WIAA 4M9ZA 4A6PA 1J99A 3THYB 2NO1A 2PMKA 1NI3A 1G17A 4GMXA 1OIVA 3B9QA 1H8HA 3H86A 4US0R 3RDPA 3RRNA 3ZS8A 4NH0A 2ZSDA 4Q9HA 3BAFA 5AJXA 1J8YF 2IHYA 5C4MA 5J5CA 5TXGA 1Z3IX 1JBKA 1F2UB 1N6KA 1UBFA 1E9RA 5IF9A 1UEJA 3SJZA 2ZS7A 421PA 2H1LA 2R6AA 4ZDKA 1XTQA 1E9FA 3B13B 2QSZA 2W6ID 2Y8EA 1UPTA 1DG1G 2F3RA 3K0EA 4DLXA 4ZI3A 1NVUQ 4DLTA 3Q8XB 2ZI5A 3MD0A 4I99A 3GJXC 2C03A 1MO3A 2QP4A 4URWR 4XJXA 2HYDA 1DG3A 2N46A 3BOSA 4HZUB 4MITA 2XXAB 3TQCA 3C15C 2HLDA 1TNDA 3GEHA 2ONJA 1JR3A 3VR4A 4TWZA 3PG5A 3W3AA 4UNQA 3NC0C 1E2MA 3WNDA 1Q1QA 2WJYA 3BC1A 1K5GA 2NO0A 3C7KA 1FX0A 3TR0A 2YOHA 4P3YA 3X2SA 1EX6A 1E1QD 4EAQA 3A8TA 821PA 4URYR 5KDLA 3OIVA 1IQPA 3ZS9A 3PUZA 2Z83A 2VF7A 4PR0A 4PO8A 3BERA 3CX8A 1Z0IA 4PXAA 1FOEB 3ONWA 5D3QA 5HE8A 3MFYA 2Q21A 3AVVA 5JS7A 3IO3A 3OIYA 5FTMA 3P4XA 3WYGA 2Q3HA 1E9AA 4OQLA 1NVXQ 4RKFA 4D4KA 4ZIRA 1X6VA 1ZCBA 2V55B 2C2HA 1WE2A 1ZC3A 1E98A 1W5TA 3CRVA 4BZXA 2G6BA 3CRRA 1KKLA 3SZRA 2WAYA 1UKVY 3I72A 2JLUA 4DLZA 4LV8B 1QHNA 4EPYA 5JCZA 4ZCIA 4C2TA 1XNJA 3N5CA 1FPMA 1OKKD 2WKQA 2HXYA 3KKNA 4PSVA 4Q4JA 2KSQA 1CRQA 3IBYA 1ZRHA 1Z07A 2PLRA 2WBLC 3LW8A 5JJKA 1VECA 2FA9A 3L2OB 1GILA 3GFPA 2FPLA 1EG7A 1AM4D 3KXKA 4M1TA 1NG1A 3CLVA 2KWIA 4LBYA 3DL0A 2N1BA 1KSHA 2IYRA 4PSKA 1YVDA 3GLIE 1TADA 2XNDA 3BWDD 1WCV1 4TMTA 1EGAA 2IF2A 3RAPR 4C30A 4YQFA 3QF7A 2ZE5A 1DE0A 4R9UC 4PZLA 4TT3A 1CEEA 4DC9A 1ZVQA 4Q21A 3NH6A 1F2TA 4Q4HA 4QHTA 2ZR7A 3UPUA 1VCMA 2BMDA 3C14C 1N3BA 2PLFA 2ZI3A 3BB1A 1AA9A 1XX6A 2FNAA 2BEJA 1NL3A 3C5CA 2OCYC 1IN4A 2QY9A 4AYTA 2WMOB 4MGIR 4IOJA 3K0AA 5FUWA 2BBOA 4HB0A 5HKKD 3LV8A 4B47A 2ZXUA 3W6OA 4QNRA 3U3OA 4AG5A 3ZVNA 2W2XA 1XPRA 4B33A 1OH5A 1I4LD 4X8LA 4PQYA 4LHVA 3ZZTA 4JJZA 4DBLC 3TKLA 3F5FA 1XXHE 2ZI6A 4RKEA 3OF5A 3FDIA 5FTKA 1A2KC 5GVSA 1XJQA 4CEJA 2ZUCA 1E0AA 1Z0JA 4XSHA 4JL6A 4OHYA 2NPIA 3QVUA 5SZKB 2CVFA 4JBWA 3U44B 4B44A 3LXRA 1ESNA 1GNPA 2OT3B 4CF7A 2IYYA 4PFSA 3RS2A 5KYKA 3IIJA 4R98A 2XZPA 3CPJB 1VIAA 4FWIB 5JWOA 1QHYA 1KMHB 2PEZA 2AL7A 2ZRBA 3PUYA 5LPNA 1MOZA 3OEHA 1M8PA 2QN6A 4TLDA 4YXWD 1Q21A 1TUIA 1UBEA 1ZCAA 4PAQA 2FJUA 3REFA 2K5UA 2O8DA 4PO9A 4B32A 4DEXA 1IN6A 2R8RA 3K09C 4NMMA 1TTTA 1GDDA 2ZM5A 2F3TA 2ODEA 1QVRA 1XD8A 1N2CE 5TY0A 4POAA 4B3XA 3RS4A 2ZRAA 2QE7A 3IUYA 2F1IA 4BLOA 4ZPXA 2XOKD 1OIXA 4FINA 2A5FA 4DDUA 3AVOA 4R2HA 2CE2X 4JMPA 4CEIB 3Q5DA 3OAAD 2P2LA 2MMGA 4I1VA 2F43A 4BFYA 3QKRA 1IN8A 1AZTA 3GMTA 2EFCB 2IXEA 4D4LA 1QDEA 1G7RA 1T5IA 3R20A 4K46A 1RPZA 5LB4A 4BFTA 2PT5A 4Q9LA 1JAIA 1KI6A 1DVRA 4EFNA 1IOZA 3WP1B 1CP2A 1YR7A 2QM7A 3T61A 1HEIA 4B73A 1J90A 4A0HA 2O0JA 4CT4B 1IM2A 2YV5A 2IS4A 2BM1A 4C0JA 1ANKA 3R8FA 1Q3TA 1JQJC 1RJ9B 3MJHA 4A15A 5EE3A 1NF3A 2JATA 3CX6A 4IVRA 3BGWA 4OHWA 5M04A 4FWTA 4Z51A 5F9HA 1AIPA 1EX7A 4MYTA 3VFDA 5LD2C 5F3WB 4MGZR 2RH5A 3HWSA 2QAGA 3EIQA 1XEWX 4CYMA 2HXSA 2WJGA 1LB1B 3GQBA 4XD7A 1W46A 4WBSA 5EP4A 4RZXA 1GITA 1IN5A 3B5JA 3A4MA 1X8LA 3B78A 4ZKDA 3SYLA 1VCNA 2ZREA 1BYUA 4TMZA 3IKJA 3FKQA 3EC2A 1L2TA 2P65A 2EW1A 2P5SA 3AGPA 4PPNA 3GJ3A 4UNPA 4GI7A 4WXRA 1G3RA 1SVWA 1JPJA 4EPVA 2QORA 2Q6TA 1GKYA 4A92A 2JIZA 1E32A 4C4PA 4D80A 1QHHA 2NMVA 2GWHA 3T1VA 4WIAA 4M22A 5L3SA 4F38A 2D2EA 5FFMA 3RRYA 1E2IA 2BC9A 5FOVA 1U9IA 1D6JA 5JJIA 1CJUC 3GCGA 4LC0A 1PLLA 5J40A 4JT2A 1G8YA 1VG1A 1KI8A 5KSPA 1R5OA 1S1CA 4NYJR 4AC9A 1FMJA 1AJEA 4QJ3A 3DZ8A 2HCBA 4W5JA 1U8AA 4P4TA 1N6HA 3LVRE 3W6PA 4DVGA 3KJEA 1CS4C 1E2NA 3NDPA 4UXIA 2UKDA 2CK3A 3QBTA 3CIOA 4M1OA 2YWHA 1RFLA 2RB4A 1Q22A 1VKJA 3TNFA 4XWKA 4ZIRB 3Q7PA 2QMUA 5TARA 1WP9A 4NTZA 3CZPA 5AK0A 2XZOA 4IOKA 2WICA 2YYZA 1Y63A 4RZ3A 1D9XA 3C16C 3X1DA 3A4NA 1Z2CA 1G5TA 2V54A 5L3RA 4DWJA 4DUGD 2V1UA 2C9YA 4MDFA 3KKPA 3GLHA 4HAVA 1DAIA 3D7MA 4L16A 1EWRA 2V1XA 2XJ4A 1VCOA 1ZMXA 1E6CA 1YRBA 1MABB 2I1QA 3L0PA 3EW9A 2ZAMA 4HATA 4PAMA 1TF7A 3L0OA 4NZYA 1OV4A 3AQ4A 2OFWA 2J0UA 3A1UA 4L9WA 1U0JA 4JLKA 3UIEA 1RVDA 2BJVA 1H8ED 1E2QA 1FUUA 2ZANA 5UKDA 3PQCA 1YU9A 3WHLA 4B6FA 4BZPA 1S4QA 1AQUA 3CF6R 2CJWB 4B43A 3TE6A 3RHFA 4CT5A 3BB3A 1MKYA 1F2TB 3R7WA 1P9WA 4B3GA 4PTLA 2A5DA 2ZRNA 1RYFA 2JDIA 4ZDJA 4JBYA 4AD8A 2JCSA 2R6FA 4PZZA 5EE0A 3LY5A 1TPZA 1E2JA 1XF9A 3K0AB 4S35A 3QSYA 4EDHA 5FL7D 1SVIA 4GFDA 1N5LA 4NONA 2W2VA 4L9SA 3VKHA 2GCOA 1YZQA 4RD0A 3TIFA 3AP2A 5JRZA 1T8UA 4OQXA 2ZJBA 5FOWA 3MCAA 4KVGA 4NYMR 1TQ6A 2VLIA 2QU8A 4DT1A 5KNDA 2IEZA 3GLIA 3A37A 3KB1A 4CEJB 6Q21A 2JEOA 1T3HA 2IYVA 1G291 3UG6A 4H1UA 1RRCA 4P0TA 4DEYA 2VTKA 5DLQC 1ZD1A 2GKSA 2YHSA 2J9RA 4C3ZA 3QUSA 2RGXA 2QMOA 3SN6A 3VNUA 2AWOA 4D2IA 4HLQB 5EP1A 4NU0A 3I8XA 2O8DB 1UEIA 4BFWA 4RY2A 1R8SA 3AF0A 3L8YA 2ZITA 5B30A 4LBZA 1RKBA 2VQSA 3L0IB 4MYUA 1KI1A 4LJ6A 1XCPA 2C9OA 4C2UA 2ZRDA 5EZ6B 4DCSA 3G5UA 4DDTA 2BV3A 3I8SA 3PJRA 4LJ5A 3DO6A 2ZQ5A 3NEJA 4A0FA 2GNOA 1SGWA 2IC5A 1ZM7A 3T5GA 4NHOA 2LWIA 4Q47A 2JLYA 2EFHB 2HCJB 1EFRA 2JLZA 5DNYB 2F43B 3QKRB 5DN6D 4MYHA 2V8OA 1R10A 3QENA 1DAHA 4MRNA 4HUTA 2CLSA 3UWOA 5FUYA 3CPEA 4DIEA 1IXZA 3A36A 1QG2A 3QF4B 4Q1EA 2IL1A 4GOJA 3AGQA 4HUQB 2IBMA 4D26A 5DH9A 3OEEA 4OYHA 3Q5EA 2GVDC 1U90A 4G5RA 4D82A 5JMTA 1W5SA 1G64A 2V9PA 3WMEA 4LY6A 4Q48A 3S1AA 1CKEA 1CU1A 5LDDC 1U8YA 5AUNB 1OH8A 4IRUB 3SBEA 3C8UA 3SFZA 3O8RA 1LF5A 4B3BA 2IYLD 1ZYUA 3SYNA 3C4JA 1GRQA 4RD6A 4XVUA 3QY0A 4F93B 1JXOA 4DHEA 1TEVA 1E2LA 3FTQA 1JR3E 3HJNA 1E0JA 5EQTA 3SDZA 4E22A 3Q72A 4ABYA 3PENA 4TTPA 2VYFA 1H65A 2GBLA 2GXUA 2EFGA 3PFIA 4XH9B 3CF2A 1ZINA 2QI9C 1KDRA 2ZYUX 4ASUD 1XJCA 4NL4H 4B76A 4US2R 2QNRA 3FHTA 1T3SA 1MH1A 2IX3A 3SQXA 5HZKA 1QHHB 1P9RA 3EARA 2YINC 1IAQA 2QMEA 4G5SA 4QFMA 4JL8A 2AD1A 5BYJA 5L3SB 3FFBA 1CULC 1KMQA 3MJRA 2BCGY 4FD2A 4D4JA 3U60B 3CRW1 4S2EA 2A78A 2WJVA 4RZUA 2WKPA 3FMFA 2O52A 5A5GA 1E9SA 5FPYA 2JJ2D 1JB1A 4KAXA 5EZ5A 4LHXA 5KTYA 4M1KA 2A30A 5AJYA 5JHHB 3P20A 2FSIA 1Q1ZA 2CCGA 4HAXA 2EVWX 1GRRA 4LWZA 2R6CA 1GAJA 4QJ5A 1ZUHA 2PMDA 3AF3A 2VF8A 5G53C 1KK1A 2ZSEA 4H9GA 4JLPA 3ZD7A 1Q3HA 5G3YA 5L8VA 5KNBA 5E7IA 4BFZA 2IXFA 3AEZA 3MWYW 5B57C 2IXGA 3E1SA 4NCHA 3KTAA 5KPJA 2QRZA 1DAFA 1AK2A 1L4YA 3PEUA 3ICEA 1VCIA 2GF0A 3GJ6A 2XB4A 1Q1BA 1OIWA 4FMDF 2GZDA 3VR1A 2O8EA 5J47A 2GXQA 1Z2AA 3CUEF 2YWFA 4PPFA 1Z08A 3I61A 4D25A 4NKRA 4LJ7A 3BFVA 1LW7A 5KOYA 1Z0FA 3RS3A 5JRJA 4CEHA 1L7VC 4B3FX 2HV8A 4MKFA 3ADKA 1M2OB 3FMOB 3TSWA 1X8KA 2AR7A 2WWWA 2GESA 2J0UB 4JLNA 1E1RD 5JHGB 2OLKA 3ZH9B 4PZYA 1GTVA 2IF0A
chains in the Genus database with same CATH superfamily
2HLNA 2V7BA 1NJ2A 4AJKA 1KMIY 2R8XA 3MNFA 1EQUA 1L4NA 1DEHA 2DR3A 1VC2A 4R8MA 1ZC4A 3SM9A 5CNJA 3VO2A 5HJ5A 2ZWMA 3AHEA 5K51A 2Q3BA 2ZB2A 1N25A 1Q95A 2Z8XA 2OC4A 2B8WA 3A6HA 1Z4JA 5JASA 3ECSA 4I1OA 1DU4A 5KYUB 3PV0A 3TVTA 2P6MA 5FORA 4HI0E 3IS3A 2Y68A 4LF4B 3N39C 3HR7A 3ND8A 1SQFA 3QE9Y 1ZNXA 1QMPA 1TCCA 3PZBA 5H70A 3A04A 4MX8A 1Y5IA 2ECFA 2WVHA 1F0NA 4MVXA 3WKAA 3Q8KA 1EXVA 1X80A 4FT4A 4D9NA 2OM2A 1N5DA 5LA6F 3EGCA 1QHXA 3OLVA 3ZDXB 4A2WA 5FH9A 4MQEA 1ECLA 2L69A 1CYEA 4ZVKA 5NLLA 4RBNA 4EARA 1TW2A 2P3LA 1D6MA 1SA0A 2G0NA 1SQSA 1VDZA 4MQBA 3GRZA 4NULA 4YCNA 2HB6A 2Q0XA 1GAWA 2Q9BA 2QTLA 1HWYA 3HV2A 3QTTA 5JH7F 1ECBA 1H0RA 2CXRA 1P0MA 3IILA 4LE0A 3FH0A 2HGZA 4Y8VA 1K89A 3GLIB 1S02A 3INYA 2NZYA 3IHLA 3BXXA 1IRXA 1N6RA 5KUTA 3RS8A 1KYQA 3QZUA 5BORA 2LKDA 3GCXA 4V2UA 4GYKA 3A9WA 1HTBA 4FCWA 2V0GA 3SR3A 3GOHA 4PYQA 4B3DA 1Q50A 1SCDA 2HM7A 2X8BA 5ALWA 4B35A 2DEUA 1L6IA 4D4MA 1LI5A 2BM9A 4ZGBA 4FW9A 2MDTA 3D0RA 1PJTA 2J1LA 4K6HA 4N6NA 1LFDB 3IQXA 2XB2A 3E27A 5G3ZA 3P32A 4CDGA 1WQ3A 5DKFA 3A2NA 2A4MA 2KE5A 1MJGA 4PG5A 1M2HA 1SU6A 5SZHB 4XJTA 1X1CA 2CV0A 1LJUA 5JV5A 2GTPA 2CY0A 4LYJA 1YR9A 3B3JA 3WWZA 3ZWKA 5JNSA 4ZVTA 4L72A 2V3VA 3A1SA 5EAIA 3COZA 2C3YA 1XT6A 4R5HA 4BAZA 3LQKA 1EHIA 4TUYA 2B7BA 1ORVA 4IICA 3HACA 3NHSA 4PN3A 4YDSA 4QU8A 5AUQA 3T4PA 4EHIA 3QOYA 1M5UA 4W6QA 1U2GC 3LL7A 5IN5A 4ZOLA 4K9SA 4R3WA 4C1NA 4TYNA 3U1BA 1L8AA 1XZAA 2FR8A 5NULA 4BMOB 2WM8A 5CXUA 4S04A 4L5JA 3ZK9A 1CUDA 2BBSA 3ABIA 4F92B 3NYQA 2GASA 2RE8A 2XNDD 1UM9A 4TMKA 2GK4A 2CDNA 3AHCA 4FDLA 4QOJA 5J63A 3FGPA 2UXDB 4B4DA 4E1VA 3GIDA 1C4WA 5JQGA 5GINE 1N0WA 1OC4A 4D42A 1DJLA 1VJGA 1IWBB 1NVVR 1Q7GA 1U2PA 2PCLA 2VHCA 3FFWA 4AKEA 1P1JA 1P4HA 2GBIA 3DT9A 5F3DA 4DGQA 5C18A 5KYNA 2PQ2A 2VBCA 3PNLA 1FJGB 4K3VA 3T7SA 4MV7A 3KX2A 4LVUA 3FY4A 4M83A 3VC2A 3X1JA 2XTNA 1MAVA 2YVAA 3BE8A 5ALMA 2NSYA 5GM2A 1XNRB 4FDAA 3QEBZ 1RT9A 2AQHA 5EIBC 1BCRB 1G21A 5B64A 3OZGA 4QODA 3JASB 4O0MA 5AKLA 5AVOA 3U1VA 3T1NA 1MX1A 2AOTB 3EF1A 3MK31 4C4YA 1O7JA 1RE1A 1JXQA 1A50B 5F1PA 4KTVE 1XDBA 3HZZA 3N0VA 1OU4A 4NV1A 3C6BA 3OPYB 4F7DA 2A58A 4OX9Y 1QVVA 1WZ2A 8ADHA 2PT7A 4NC9A 3PDUA 4DBZA 5AVTA 3M70A 3THXA 4NFSA 1NNEA 2QA5A 1GLGA 1GPAA 4NQZA 1IEQA 4ZCMA 2WTBA 3L0SA 4BV2A 3AKEA 1ZK2A 1VXRA 5JC8A 2BI7A 1RWBA 1P7WA 1OXTA 5AP9A 1YQGA 4IZ6A 4DDHA 3JAKB 5BWCA 1J0AA 5K0GA 2EFYA 4EHNA 2YH2A 1SCUB 1EAYA 1TJYA 4KHPB 1MZPA 1RC8A 1B0UA 5J5VA 2AX3A 4ZEVA 3KEOA 3QI7A 2XA2A 4L0MA 2CLOB 3OEHD 1ZXXA 3KOWA 1BW9B 4Z8YA 2XKJE 5EIBD 3RV4A 3WB9A 4D0NA 4U7HA 1O8CA 2Q6VA 4IDFA 4P3XA 1X3SA 4NEHB 3HA3A 3TAHA 1QYVA 3A28A 5K7SA 3V2GA 4U2DA 3G7UA 4MKRA 4HZIA 9MHTA 4O4IA 2EKZA 4HQ0A 1DC7A 1FFSA 3HU2A 1L7XA 2AFIE 4QHYA 2BP7A 4LJYA 5AHOA 3ZCQA 5BURA 3RGGA 3ETHA 4FX2A 5FNVB 1JHAA 1E66A 2BHNA 4GZMA 5JBIA 1JJVA 2AJCA 2X9NA 4CKCB 3PHIA 1KQPA 1V3VA 2PAAA 3HVJA 3R0VA 4RUKA 1RZUA 4N47A 1ZGHA 1IWPB 1LQ2A 2G8LA 2X0KA 3RJ9A 2BWJA 4O2LA 3N2GB 1HORA 4MJXA 3VPGA 1RLUA 2Y1WA 1VJRA 2Z2ZA 4N3AA 3T3GA 4OXNA 2IKQA 4JHLA 2H9AA 3ZS8A 3TQFA 1W88B 1RTKA 1SQ5A 1PJRA 3M1YA 5B4UA 1VIVA 5DX0A 1EPUA 4IIJF 1UK9A 5JO0A 4AF8A 1HTTA 1ONSA 3GBSA 2FQXA 3I9V1 4IIDA 3D31A 4BMCA 1A98A 2VK2A 1RBZA 3DP9A 3PQEA 5G40A 3ZVMA 4HAWA 3CO5A 1S8NA 1EFHA 4NJOA 4UQOA 1T36B 2B83A 4I14A 4JP5A 4R2WA 3RH0A 4AJIA 4G01B 4GD3Q 1V11A 3G8CA 2OAQ1 1GCGA 2PSJA 3BX1A 3QFCA 4ZVRA 1K88A 3IVXA 3QYAA 2KI5A 2QSJA 2F1OA 2MT9A 4M21A 1X19A 3HJUA 3TEJA 4R0VA 2VK4A 3LK7A 1U0FA 3SBOA 3KKZA 1SUBA 3K8ZA 1OF1A 3DQZA 1QRDA 2DBYA 4XM1A 3PIRA 4EMUA 3SZUA 3K6SB 4WSOA 4O63O 3JQQA 5DMHA 3TLYA 4ARZB 3D6MA 4BE7B 4JI0B 3SR4A 4PM4A 3JRWA 3WLRA 4B71A 2PVPA 1PFKA 1IEVA 1ZI9A 2J0VA 1O54A 2QRGA 1UPCA 2P6UA 2ZS8A 3DS8A 3IQDB 1FPQA 1HEYA 3NT5A 1SC4A 4FMCB 4IOLA 4H3SA 4NCXA 3TVYA 2OO7A 4AZVA 4Q9JA 4WACA 5F7JA 1ENZA 2XQGA 5T57A 4CG1A 5AW9A 1XTZA 2HJWA 3PGLA 4ZC1A 4NDNE 4DSZA 2JGNA 4RY9A 5KC8A 3R3SA 4G1MB 3A10A 4O4LA 2Q4RA 3TQOA 3MINB 1HZJA 3DP7A 4BEBA 4WK6A 2QX9A 1DC4A 2CJXA 1U9YA 1Z7YA 4IJWA 3G8YA 2W2QA 4EEZA 2G0AA 1UBKS 4ZV9A 2R1TA 2MINA 1WBBA 1VMIA 2IIQA 4KW7A 1NQUA 1R6BX 2OAP1 3PNSA 2ZWAA 4U6QA 5F7ZA 3OJOA 3ROTA 4FJ2A 1XTSA 3E9EA 1CUSA 4OLBA 1JDBB 3LO5A 2E87A 4DV1B 1C0KA 1I4DD 2OORA 1JI0A 1G5IA 1MTZA 1O6BA 2VNJA 3E3NA 4WCFA 5EL0A 3M4YA 4YRGA 3QBDA 4DWOA 4YV1A 1ZIPA 5J4LA 2IH2A 3TBHA 4QECA 4EWLA 5B2FA 1Y9EA 3P9YA 3TLBA 2LP4Y 1OLUB 1S2DA 4CV2A 1WLSA 3AIOA 3AZOA 5JROA 4FW8A 2D1QA 4MCJA 1KJQA 3CZMA 1C9JA 1R4ZA 4OA8A 2ZCJA 4MI9A 4PG6A 1AV6A 1F0YA 1BU5A 1X7XA 4LJ8A 2A5LA 2YWBA 3GY0A 1V35A 3FDJA 1KOLA 4HAOA 4JI8B 1G19A 3IPCA 4RQUA 4JT8A 1SIOA 1VHWA 2IYQA 1YZHA 1NLMA 3QSGA 4X61A 1P3JA 1FRFS 4I3HA 5ES4B 5L45A 1OI3A 3MSXA 3KPYA 3MG9A 4P3NA 1H4TA 3EZ2A 3OU7A 1U3VA 5MGNA 1OH6A 2CXUA 2IY7A 2ZPTX 3VR2A 3LQRA 2YMLA 3B1JA 2YICA 4M0FA 1KA9H 1S7GA 1PT8A 3GEDA 1FYVA 1BA3A 1P4SA 4NV3A 4YFVA 3SFVA 1C0EA 5FI3A 2CHVA 1FNSA 2Z08A 5KNDH 2VPTA 3FI0A 3MMPA 1VHLA 2E4YA 4FP9A 2PXAA 5DX1A 5IP5A 3T35A 1A1VA 1GZUA 3G1TA 2LPMA 4Y2SA 2EZUA 4IDBA 1E9EA 5BSRA 5JZOA 2BTEA 4UAUA 4ZTUB 4BQPA 1WXQA 3ITNA 4U3JA 2WHRA 1NW3A 1YQQA 4MARA 1QKKA 4B7UA 5EE5B 2J31A 3ETEA 3H9EO 1T8RA 4YRIA 4B8ZA 2W22A 1EUDB 2O2YA 3UHAA 3P9IA 2A0UA 4OUDB 2C9CA 4MKHA 2WHXA 3JQ7B 3G2NA 2AG1A 3GGSA 1QB7A 3GU3A 4Y2QA 2YBDA 4IG4A 1NKSA 3GDHA 2OLJA 1FNNA 1V7ZA 1Z5WA 1MU0A 4MEJA 4QUEA 3ZJVA 1BXRB 4TVOA 4LZOA 4HPJB 1NKVA 1B42A 3TSOA 4YAKA 1M2KA 2JASA 2WKRA 2TMDA 4JLUA 3TW8A 2HPAA 4D3DA 3VHXA 3IXMA 4W1QA 4R2MA 4RD4A 4G0QA 1YZFA 4H6WA 5FWNA 1QFMA 4Q4CA 3PS9A 4TTTS 1ZQ9A 3EE6A 4HAUA 5LP6A 1QCZA 1PCXA 5FBQB 1UFRA 1U0NA 3D6VA 2P7HA 1J21A 3OCXA 3K20A 4IIFA 1GU1A 4X20A 1RXIA 3CNLA 2WVJA 3GJ0A 4IKEA 5FI0B 1PAUA 1G2IA 2Q5LA 4XIGS 4MVJI 3CZ4A 4A8JB 4C04A 1OX4A 3SP1A 1GKLA 4ZO8A 4JB3A 2OZLA 1J09A 4Y2PA 3O0DA 4FC6A 4Z1MA 3T34A 3PD1A 4QOSA 7MHTA 3H97A 1YJ8A 2H4YA 4F4JA 2R8OA 1Z6QA 3UQYS 1R4NA 1MVNA 2MSCB 4KWEA 4DZZA 5SV2A 5AESA 2G9RA 1ETHA 2PKWA 1Y5RA 4NK5A 1F17A 1LTQA 4B2PA 1BCSB 4DLXA 1CS0B 2RHTA 3H8SA 4YYZA 4KREA 4J3NA 5CDUA 5ITSA 3A06A 3Q3VA 4NFHA 5DTIA 4B5LA 1MO6A 4CRWB 2DX7A 2DB3A 5EWJA 4LWPA 1W49A 3O83A 4NWIA 5PGMA 1JKJA 4RTLA 7ABPA 5BMVF 1RMTA 5DWVA 2SNIE 4DIKA 2GBLC 2NYVA 2OWDA 2ORIA 4JBNA 3VNQA 4DG5A 1VSUA 5FOUA 3FOAA 1A96A 1MQ8B 4YRZA 1UPUA 1MT3A 1TEXA 3ZV3A 3ZHSA 1AGRA 4FXOA 4N49A 1W48A 4JGIA 2PUTA 1X2EA 3GFOA 4MYCA 4NE9A 2I55A 1C9NA 1J2JA 1L7RA 3OZ7A 4FXPA 3FVRA 4ITRC 4Y3UA 3W9YA 4WAUA 1NRIA 4TYYA 4Q4JB 4YFYA 3QPUA 3K2QA 1PR9A 2WIJA 4KPGA 3L46A 4KIFA 2CHEA 4JSTA 4BO0A 3K9GA 4J7AA 4W7SA 1PUIA 2AV6A 1Z5VA 1JAHA 2HJVA 2ZRHA 4G1UC 3SIWA 3ZHUA 2PHZA 4HQRA 1D1QA 1XTVA 3R9XA 2FFQA 2C0QA 2BGJA 3NP9A 3LQ4A 4LGYA 3ZW7A 2D13A 5IG2A 4IHJB 3U7IA 3UH1A 2XGSA 1WAMA 2CC2A 1OLSB 5I7FA 3S0JA 1W44A 3UEOA 3EVDA 4W5NA 1AN9A 4L8GA 3ANSA 3NG1A 2Y1XA 1PF7E 5CW2A 5DNAA 3QIAA 1WDWB 3OZXA 4PBRA 2A7QA 5K0LA 3RHZA 4OTZA 1UXIA 1I33A 1R8YA 4Q4HB 3QX3A 4X7MA 5EGSA 1MPXA 4JP1A 1Y1KE 2CD7A 4MPPA 1FUEA 4FHCA 4F21A 4BCDA 4LDJA 4FS3A 2UUAB 4X6YA 5DIFA 3WLLA 4DRXA 1FUYB 5C5DA 2AN5A 3PQ6A 1SHTX 3CGGA 2IRWA 1PS9A 1GLNA 1N8KA 3UT5B 3ANYB 2CEAA 2EF1A 4HDKB 4HYQA 1GCUA 5JE8A 4IJ6A 1PJ3A 2YUTA 2WJWA 3MWGA 5LQDA 1K7SN 3GEPA 3GYGA 3T1TA 4HLDA 3BZUA 1BGVA 2IYUA 2GJ9A 3B3QA 3HRHA 1DX4A 1NYRA 1ZNZA 1ZUIA 1DZIA 1QK5A 2FWJA 3LQQA 4F71A 4D5EA 3ROMA 1I51A 4Y9RA 1V47A 5JCOA 3SF8B 2NU9B 2B8JA 3ELWA 1J8DA 1T2CA 4AY5A 5ELXA 5SICE 1BDMA 4J7CA 4ZARA 5F1YA 4MIYA 2W58A 3BTOA 3ZVLA 1F48A 1TJPB 2WIBA 3EIOA 3KFLA 1AXEA 3BICA 2BFNA 3MWDA 4J7UA 4X66B 3OJFA 1X0VA 3MJCA 1IMJA 4Q5IA 4HQ6A 4KMSA 2D6FA 3D7RA 1TU3A 4BTEA 4GGOA 3RVBA 3W79A 1L7OA 2WPNA 2XEDA 2YHIB 1D4FA 3PDIB 3GCZA 1PUJA 3N8NA 3F9CA 4DNPA 1Y1SA 1IY2A 3BMXA 3B1VA 3O0TA 1Z38A 2FK7A 2OXRA 2Q4EA 2QD4A 4PGFA 4YRNA 4E7OA 4M49A 2Z43A 2VBFA 4F2HA 3R4CA 3B3GA 4LRWA 4I50F 1P9OA 1VE7A 2OV6A 5DLYA 4NLLA 1UQRA 4Q37A 4F72A 4JQCA 5DDIP 1BE8A 1R1DA 3DXYA 1ZGZA 2X7HA 3SX2A 2XYQA 5LCXA 3UA3A 3RWBA 1SXJC 1VPTA 2GDZA 1N6LA 4FFNA 4DQXA 4WDQA 4J03A 2CNNA 1W4LA 2H3EA 3MSCA 2JG3A 3QUQA 3KXIA 4CV0A 4RANA 2WAOA 4HH4A 2P1RA 1Z35A 4NS1A 3QK7A 1M7BA 3RYTC 1HQYE 5I9NA 2HWXA 3GUYA 3A1NA 4C7OA 4X44A 5G1NA 1YS7A 1MPTA 4O4JB 4K9QA 1QOQB 3QLVA 4EH1A 1SULA 2QTTA 2RGBA 3L06A 1VHJA 1M0EA 2BFPA 4HFJA 2IT1A 3AINA 1H1LA 4ESVA 1WO8A 1KH3A 4E6PA 2ISQA 1YVUA 5AHKA 1WW2A 5CVTA 4YP1A 2H5IA 2IGTA 1Q91A 4RFSA 3GJ7A 4G26A 1YUMA 3MZ0A 4O5OA 4RHXA 1WUTA 5KO2A 2IWHA 1SXJD 4ACBA 1T8YA 3NHFA 4MSUA 3OQMA 4RE6A 3RUFA 3LD9A 2XB6A 1WU8A 3SIXA 4F85A 5IYZB 2AJBA 5T8KC 1LGYA 4OLAA 1LZLA 4RK0A 3WFJA 1P44A 2FMUA 3GRAA 1TX4B 4HGNA 4OP1A 1D4OA 4RXMA 4ZRNA 1SKMA 3CQ9A 4FQ8A 3C4VA 4BZQA 1RTTA 1QO0D 4QQKA 1BVRA 3HGQA 4G5OA 4QDXA 2B2CA 1V5FA 2JFYA 1ZICA 4YJ2F 4KKXB 1CEXA 4DLAA 1DMRA 2HBRA 1FB5A 3BB4A 2FFHA 2PYDA 1G0OA 4AG6A 3KO8A 2I6FA 1IONA 3X1ZA 3UATA 4CMCA 2JIQA 1J0CA 3RJZA 3O03A 3PX7A 3FPFA 3UJAA 3K1ZA 4YUZA 1V3UA 1ODIA 2G1KA 4DR4B 1KWKA 1U0EA 1K8XB 4X8HA 4DSAA 3GRKA 1K98A 2PZAA 3PUJA 1XG5A 2YVKA 4YASA 3B6EA 1ZD5A 3DWEX 3OVMA 1PTJA 2QE6A 1W0KD 2AXEA 1EG2A 5L3QA 2REXB 1U63A 1G6HA 1SOAA 1HE8B 5MDHA 3AB3A 1JQAA 4MQFB 2NP6A 3M34A 1AHPA 4NEGA 4D8YA 1K3FA 5TV2A 4DCUA 3SDBA 2OVFA 4EUFA 3EXG2 4FNMA 1XIVA 2A0XA 3SI7A 1T2VA 3RWOA 1HV8A 2P0EA 3PT5A 1QX3A 3KZKA 4HZUA 5B1HA 3W4JA 4DJAA 1VPLA 3DKPA 5EZYF 1E9DA 2X2EA 1EWKA 1VYVA 4X64B 2M6RA 5IX8A 3RYCA 3E4CA 5EXSA 1JLRA 2GFQA 3CF0A 2YZGA 3EHDA 3EZLA 2NZ8A 2YWDA 4JOCA 1Q77A 3CEHA 3UTDA 2GCIA 3G5TA 4BTLA 4RD2A 1CVLA 2BFDA 1XVIA 2A57A 4S05A 2UYGA 5CB6A 1WTCA 1G6Q1 4LISA 3UAYA 3WBKA 3CLTC 5F2KA 4N41A 2GJ4A 4Y2XA 2Q1WA 3D8SA 3FJ1A 4Q82A 3DCIA 3ZY6A 3IQGX 5FI1B 3V8MA 2REOA 4EBFA 2XUPA 1XTPA 2LTAA 3FTCA 4JHXA 1R7RA 4QU5A 2D1FA 2W2NA 3TB4A 2A1UB 1AKEA 2A0FA 5ITZA 3TS1A 4MULA 3BJIC 3UXHA 1RADA 4U2FA 4R1TA 1RMYA 1E64A 4LMRA 4N0EA 4RENA 4F4UA 3CPSA 3H4TA 3BRSA 1LI7A 4Y2HA 5EUBA 2OCBA 4F8EA 3CE6A 1CJMA 2XE7A 1UKEA 4MKGA 4RVHA 3FW1A 2B21A 2Z04A 4HMPA 4MUMA 1E94E 1I6WA 2H0AA 3JSAA 1BMFA 1C2YA 4FILA 3FCOA 5BSGA 5M7EA 3BCHA 4NR0A 1H42A 4DJJA 1COWA 1WABA 1SVSA 2AC2A 2F9LA 3IT0A 4J94A 3T1YB 5D2CA 4WLOA 1H4SA 1OYWA 5JG7A 3ZDRA 2AW3A 3G85A 3IB6A 3F46A 3HPQA 1UDWA 4UQLA 1HNZB 4IJMA 1UWKA 4JUFA 4J4BA 4KXYA 1XALA 3NTLA 4DIFA 4Z54A 2QD3A 2EL9A 1NV8A 2P4EA 1Y3AA 2BY4A 5D5PA 5T5QA 4A10A 2GXAA 5JXWA 2QV0A 3ZI7A 3F6SA 1Z4PX 1T35A 2ZSHA 3R9WA 2CVZA 4XUGB 3MVEA 4WEOA 3DBHA 2R86A 3PNOA 2QQFA 3MRVA 1A2OA 1Z83A 4XQ9A 2HLDD 3CJTA 5FBKA 4DQUA 2REQA 4EY5A 2O1WA 1RJDA 1JR3D 2OCDA 3KQTA 3SNHA 1PZXA 2W90A 2QQGA 3BA6A 5KCZA 1BWSA 1RCTE 5ALOA 2I3BA 2VP9A 3DZGA 3E9ZA 2ID7A 4LJAA 3SHFA 5A62A 3DC2A 3DBRB 5J2UB 1YA8A 3GVHA 2ERYA 4I2NA 2JJ8A 1Y3CE 3KSRA 3EJWA 2J7PD 4I6EA 3TUZC 1N6PA 5C35A 1HQDA 5I4CA 1ZONA 2YN2A 2CNLA 4MJ7A 5L3VA 2J5QA 3KVVA 4LOHA 1LKZA 4O1HA 1PW7A 4BKUA 4L9AA 1O0SA 4EP1A 1J2YA 4XWTA 4MQ6A 1KK2A 2JGKA 5F52A 4EMSA 4X84A 5LP1A 5EKUA 2ZXFA 1GG9A 3HKBB 3ONNA 3PFBA 4P3OA 1Y34E 3GEIA 4KIWA 5JVDB 4B3HA 5T6MA 4KR2A 3AUKA 1E0SA 3PNQA 3M81A 2JHAA 1ZITA 3CX4A 4HB4A 2VDWB 4RIHA 3V6LA 1JQEA 2VTVA 4NOLA 2WRZA 5DNEA 4RJTA 5AW8A 1OTHA 4Z3OA 4OXYA 4D9JA 3WLTA 2I2DA 2EFJA 4BE4A 1X94A 2B99A 3VGPA 1O4WA 4NMXB 3N2NA 2VO1A 1E1MA 1FEZA 1V8BA 2FDXA 4GKBA 3FD8A 4KG7A 5TIIA 3C3CA 2CXXA 4DLUA 3TNDA 2CFTA 3PXDA 1CJBA 3T1OA 4R1MA 1U2DC 3SZ3A 2J5BA 1PGOA 1GQSA 1CJCA 2JJ2A 3I32A 3NT2A 1A9ZA 1H9CA 3EIHA 1SKUA 3M3PA 1L7PA 1YIDA 2OBBA 3HCBA 2O6LA 4ZKEA 4BO8A 3U9TA 4DXHA 4KR9A 3CWQA 1Y3DE 1T6XA 2WY2D 1FCJA 1GEEA 1VJCA 2J4FA 3BN3A 3H5NA 4R51A 1E3WA 5CLGA 4DRZA 3UK1A 4WASA 2Q2OA 4DG8A 5HS4A 4DQDA 2OQRA 2PU5A 4GP7A 4G0NA 4W5HA 1WB9A 4YAFA 1HDGO 4CLEA 1RI5A 2VRNA 4RH0A 4CI0B 1Q7BA 3G0DA 1OXSC 1R12A 4Q1VA 2BGUA 2JIDA 4UD2A 2NWQA 2WJZB 4NCKA 1JA9A 1UBUS 2VRCD 4X8OA 4EKYA 1HEUA 3ZUPA 1N32B 3AFGA 2ZBVA 2P1DA 1DAKA 3H5OA 3MRSA 3TPCA 1IAVA 1R64A 2BRUA 2O7VA 4CI9A 1JHDA 1FNMA 2OSVA 2ZRMA 5KSZA 1CFJA 1K27A 3L5OA 3UMJA 3IUBA 2H17A 2HBYA 4HDCA 2X0NA 4K0KB 5I7AA 1MV8A 3V1TC 2XLCA 2XMBA 4V1CB 1PL6A 3AW8A 3QFFA 4HNUA 4PYKA 4CBVA 4BY9E 3COPA 1CY7A 1RM4A 1ZJJA 3B6MA 3GGPA 2GJKA 4JSRA 4DPMA 1CV2A 1GR0A 2WILA 1N9KA 3R5KA 3MCVA 2V9ZA 2XYRA 5EMMA 5KNLA 1D9ZA 2ZJZA 3KWMA 3OUZA 4M60A 3VYVA 4AMYA 3ICVA 3I5MA 4KITB 1ULHA 3DLHA 1FFHA 4DIBA 4RFLA 2HT1A 1TA4A 3SHVA 3HXQA 3BIFA 3FRHA 5K0JA 1R37A 2NO5A 1KEPA 2ODQA 4MRPA 5EIXA 4JV5B 4E5DA 1ESDA 3UC9A 1LS6A 3TWOA 3GH3A 3WLIA 1H1TA 3Q7EA 2VWPA 4KODA 3L8DA 2C8VA 1P0PA 1M54A 4JA0A 13PKA 3C3BA 4OGGA 3I3OA 3R3WA 1ZIOA 3WOVA 2QJOA 4H3HB 3CEPB 5JH7B 5LU9A 3WL6A 3HG7A 4J0FA 3K0BA 5LC1A 3TTVA 2VHXA 4YCMA 4HDQB 2QAGC 4KQMA 4CJXA 1VGQA 2YV1A 4QC2A 5FOXA 2BZ0A 3EIXA 1D6NA 5LWQA 4HEA6 3I0ZA 2Z4RA 3U37A 1PK9A 1QSGA 4UPVA 1PFUA 1C41A 1BDHA 2ZIFA 2FF7A 4K81B 4ZO7A 2PUJA 3IEXA 4MTLA 3K1YA 1P72A 3HABA 4HNGA 5IW8A 1W6RA 2X5JO 5CCEA 2BHTA 5FBWB 5M3BA 4C08A 1WCXA 5GJBA 4E33A 2JJMA 3IJPA 4BJHB 3R5JA 4ND8A 5WRFA 3CO0S 5GOZA 1W5BA 1G8JA 3QKSB 1WUHS 3IVMA 3L6RA 4NENB 2F1JA 3CT6A 3DEJA 4UZSA 3SS7X 3WRXC 4E11A 5FPPA 3S6JA 3LT0A 2BM0A 1II8B 1U9IC 4RH1A 4K6MA 1NMXA 5EN4A 1TYEB 1QIFA 4LAFA 2CN1A 2WSYB 2PFSA 2CNBA 5DW0A 1CBUA 5H8WA 4R7ZA 3CRZA 2HA5A 2W4MA 1EVJA 2YFHA 4K2HA 1I3KA 3PNKA 1II9A 5FP0A 3VR5A 2GZMA 2HA4A 1KBQA 4EJSA 1JLLA 2FMTA 3ZLTA 1C80A 4J75A 4Y6OA 1FZQA 1KERA 3AR3A 3K0KA 5D8DA 1HYEA 1GQ2A 3R6WA 4LK2A 5IAEA 3P9QA 3NUZA 4G9EA 3IPAA 3OQ6A 2ZI9A 3BRWA 4K3UA 4UUMA 3REGA 4HD8A 5E4JA 4DKXA 1B8PA 2HA3A 2OXIA 4CKEA 3LIIA 1ZJZA 3N28A 2JIZD 1XUOA 3R24A 3LP8A 3KEFA 3FPAA 3CY6A 4JQSA 5AHRA 5CD1A 2BMWA 2J6BA 2VJKA 5A9RA 4I5EA 5JCJA 1KY4A 1RAIA 1WUIS 2DWPA 2EFEB 3W5SA 1GYQA 4ME6A 4P4SB 1SBIA 2F4VB 4EG6A 2CJWA 3K30A 3VMMA 4NHEA 1QBGA 1A5ZA 3RYIA 4E2WA 1MUUA 4GGMX 3NIBA 3GT3A 4BKRA 3CW2A 1N5KA 1O08A 3JQAA 4XTRA 2D0DA 1A0OA 2YNMA 3DAOA 2IOQA 3A27A 3CH7A 5E95A 3VAAA 3HXPA 4HAZA 3ZWOA 1JNXX 4NP6A 1A8QA 1E2DA 3OECA 3QI2A 4J3FA 2YZ7A 1U8EA 1JKIA 2PK3A 3MMSA 3QFRA 1P81A 5JI3E 4D9EA 3RTEA 2YV2A 1Q0RA 1AZWA 1EB8A 5K3AA 3GVIA 3U61B 2CK3D 2G9UA 1Y5MA 3EUWA 3MUEA 2OD2A 3DC7A 4PGMA 1YC5A 5KOJB 1TUBA 4OVKA 1LV7A 2QENA 2EU8A 2XYGA 4DL9A 5GPBA 1W85A 3DDOA 1DIGA 1X87A 4JP8A 1HDIA 4G1EB 4I4TF 3T0FA 1OFGA 1UDAA 4H7PA 2P2DA 4M1EA 1FJ2A 2VI5A 3AETA 3GT7A 3HFSA 1J39A 3L79A 4B4OA 1Q83A 1NURA 1L4UA 1A69A 2OO5A 2PN1A 3EZ6A 4N1AA 1TW3A 4G8CA 5KHLB 5LQUA 1U7ZA 2H2WA 4N0DA 3DYIA 1PKXA 1U6IA 1WXXA 4NBNA 4EG5A 1KAOA 1M2NA 1YQWA 5IEBA 2ZS9A 2MSDB 4M7OA 2WFLA 5I7OA 4N6OA 3JR7A 4PO1A 3O8BA 4DAEA 2ZWIA 1AB5A 4OXIA 1UDRA 2X8LA 1EFAA 1XAJA 4YTEA 5K3OA 2YZ2A 3F6RA 3NXSA 1JJIA 2NVBA 2GZAA 1A72A 1C9MA 4TKVA 4X0EA 1U1FA 1U5BA 3KB8A 3QIVA 3FUCA 5LQKA 5HZMA 3M6UA 2FX5A 1KC3A 1ONBA 1WXWA 1UPXA 4IIBA 4BU1A 3DLBA 1ZU4A 3GLGB 5FYQA 3AUUA 1FDIA 1FBTA 3D5QA 4QUJA 5B2ZA 1S5PA 3BQ9A 5IC6A 1RWPA 4RTKA 1KEEA 4EJFA 1K2VN 4QJIA 3VOAA 5H80A 4S1TA 1ZGAA 1ZVMA 3JR3A 4YMLA 1BWPA 3CN7A 1HK7A 5FDFA 3EC7A 1OZAA 3IEIA 1PK7A 1PK8A 1WUJS 5CVCA 4BQOA 1DJMA 4IIJB 1DC3A 1GKUB 2YCBA 2ESRA 3VU9A 3AF4A 5K6AC 2CXHA 2FWIA 4U7GA 1OTYA 4EB3A 3DCJA 4Y2GA 2ID8A 4YB8A 3VDRA 1RWVA 1DBIA 1MJNA 3WK7A 5CJ2A 3KVOA 4UKDA 3RNOA 5JD5A 2RGNA 1YQDA 3N0TA 2DUNA 4DSNA 1KYTA 3IDQA 4TS9A 1SUFA 1OKKA 4C0SA 1U0BB 2OHGA 2NZWA 5KNDD 1NBME 1BKDR 3IP9A 4LF7B 1RLTA 3MIZA 2OYCA 4N39A 3V7WA 3TM4A 1BFKA 1KBOA 3SHOA 3SOPA 2A92A 2YZKA 3O7MA 1N3LA 1E1KA 1RC1A 1K8QA 2F8LA 2QQEA 3FHOA 3K9HA 1P2SA 4LXHA 4MR8B 5FPSA 3AI3A 3H3XA 5GVRA 2CNOA 3WE7A 1E92A 1I7PA 5LBUA 3FDZA 4UPEA 5CEJA 5K6TA 5JNVA 3EGXA 2ZJ1A 4AO8A 2ZTHA 2Y99A 5AUOB 2WJIA 4UPDA 1QR6A 3DYBA 3WAJA 1TF2A 3AEXA 4ROSA 1B2LA 1GQOA 2PUCA 1OHHD 2J45A 4UCQA 3WG9A 2GAAA 1RD4A 1QYCA 4FUTA 4PHTA 3TLCA 2DH5A 4DN6A 1CZLA 2IY9A 4G89A 3H11A 2C2WA 2RARA 1Y5NA 4IWXA 3TRJA 2O8CB 3QFTA 1P7YA 3NGXA 1E1NA 4P35A 4LDRA 3I4LA 3LFHA 4MRAA 3O3CA 4A27A 1OI4A 3FWYA 4IXDA 2CGEA 4FBGA 1T34A 3IAFA 4GE3A 4KGVA 4RK7A 4WTOA 5F3RA 5TF0A 3UBMA 5JFTA 3KB2A 3KLPX 2VHVA 2OK7A 3CX7A 2QHXA 1VLJA 2GK7A 1VYHA 2P41A 2QIOA 3G1WA 4OQZA 3OF3A 4US1R 3RABA 4BNXA 1NONA 2DQYA 2YBEA 3FZNA 3KXDA 1IVNA 4WJZA 4WWHA 3MOIA 1FXWA 2XIJA 4IFEA 4KE6A 4U5QA 2D3WA 4OXKA 2VKQA 1WNTA 5FFFA 1XMSA 1Z4LA 2JHCA 2Y76A 2O59A 4CKWB 1KVTA 2C96A 2YWXA 3AEUB 3BRQA 1OZ0A 2J6CA 3F74A 5H9WA 3K6JA 3QKTA 5KHOC 2DHDA 5ALYA 5FPQA 4MKXA 4JLBA 4DJFC 3ZZ1A 2ST1A 4JVLA 3L0CA 5HBRA 4A0QA 1M1YB 4IHAA 5DTEA 4B4VA 3EGDB 2M1ZA 3A70A 4GP9A 1PUXA 1DG9A 2SCUB 1DNPA 1KEWA 3KR9A 2QZSA 4D6PA 4MDEA 3UJBA 4AS2A 3D54D 2AUMA 4KQEA 2OY0A 1OBFO 1C4OA 4X63A 2VF5X 4D4IA 4LXXA 2P5TB 1A2BA 3N0XA 5HF6A 4KLRA 3ENNA 2F48A 1XZ8A 4DTCA 1XPOA 2NP7A 3SJCA 1OE0A 1XPUA 5BWOA 1VMEA 2AR0A 3NMUF 2J4CA 1YE5A 1WMEA 2WAAA 3BSWA 3HQ4O 2HUPA 4JVSB 4M1SA 5AW3A 1F0PA 3KT0A 4FI3C 4JEIA 4WZAA 4PYMA 3HLTA 4HY3A 1JTEA 5B1DA 4CQJA 1MAHA 2CXOA 2RI1A 3C1OA 3W5DA 3ASZA 1EH5A 3WAGA 4OGKA 3GFTA 1JDPA 2VH5R 2JI6A 1P9NA 3IVAA 5HKLA 1NY5A 3LBAA 4URUR 1PNOA 3SM3A 4OGFA 4DCOA 1E79D 2V3WA 3DCYA 4GLLA 1KQGA 2EQBA 3LZCA 4KUGA 4UM5A 5J4VA 1VJ1A 3U56A 4BQIA 1T13A 4BAGA 1E1CB 2W6OA 5JJ5A 1C1YA 5C8VA 3ZIDA 3N7TA 1WETA 1Z34A 4NCBA 2C3PA 1D2AA 3E3LA 4MKZA 1COZA 4L8LA 3QQ5A 1UBCA 4AX4A 5HBGA 5HJ7A 4JKOA 3TD9A 5L53A 4IMIB 4HP8A 5A04A 4FJ0A 3C3WA 4CFYA 2VDNB 1W4AA 6CHYA 1UC4B 4R6WA 1TE2A 1P5RA 4LS3A 3MGBA 1J8MF 4ADSG 4HADA 1QMGA 1Y1LA 2D8AA 2OAGA 3I9V6 5JYBA 3G82C 3NTOA 4O4HF 4CUJA 2B6HA 1Y6JA 1D2EA 3GLFA 3OP4A 4H4DA 1TC2A 3P8ZA 4QZVA 2GYWA 4HDMB 4H1WA 3IMCA 2PX0A 3IIKA 4HAYA 1Z6TA 3T0IA 4H15A 5EXTA 1R6AA 3VNVA 4FOLA 3M6FA 3TBFA 3BK1A 2G1UA 4E1AA 1TTHA 4LXQA 2HOQA 2MSLA 4JASB 4XYMA 3LY7A 2FSVC 4WOKA 3AEQB 2JIBA 1T8PA 3BCRA 4LYEA 2OKCA 1LVGA 4XASA 3HUUA 5A9SB 3WJ2A 5L3SB 1DIAA 1OXUA 2G1PA 2EP8A 3KQPA 4LSMA 4R7GA 4WXHA 1LPAB 4F4CA 1N2HA 2VQ6A 4X24A 2HHJA 2JBAA 3AYZB 3ZU6A 5G41A 3GUZA 4IMPA 1VRCA 3G8BA 4JH0A 3G2IA 4TKUB 1EP9A 1GVNB 1QB8A 3JQFC 4CQMB 2W4IA 1D0SA 3D6JA 4L6AA 1X7ZA 2PEYA 4LMPA 4D8WA 2ZSFA 3QHQA 5I6DA 1JHUA 4IQ4A 5CB4F 3ZV4A 5HUHA 1CERA