3PEYA

S. cerevisiae dbp5 bound to rna and adp bef3
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
391
structure length
391
Chain Sequence
AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase DBP5
total genus 144
structure length 391
sequence length 391
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA02
2GEDA 3SC3A 4KV9A 1TF2A 3BIFA 2B6HA 1GL6A 1S3GA 2CCJA 2QENA 2J0UB 3TAHA 2Q21A 3WBJA 2GTPA 3S1AA 3VR2A 3V4RA 2DWOA 3R8CA 1OKKA 2QPOA 1JEDA 4I4LA 1GRQA 1NIPA 3AF3A 5HTKA 1G3MA 2XITA 2YV5A 3NEJA 2GWHA 4TLCA 3TBKA 3KQUA 2IYZA 2FGJA 5KPJA 1XXHA 4JL6A 1JR3D 1P9NA 2C8VA 3BGWA 2BJVA 1R7RA 4EJSB 1F60A 1QG4A 3EW9A 3LY5A 2H1LA 1WMSA 1X3SA 2QE7A 2VQSA 4B73A 4UNRA 4WZ6A 3NVAA 1COWA 2HDNB 4RFVA 4KVAA 4LJAA 1AGPA 2IYRA 2H7VA 5FPYA 1C9KA 3LWNA 3UWKA 4Q5IA 3HU1A 1J99A 3FWYA 5FTLA 4PSKA 3LFUA 1GM5A 2GEVA 3OIUA 1E2IA 2BHRA 2E9SA 2ZM5A 3NC1C 4A8JC 4V0ME 1W0JA 2XOKD 1J8MF 1G5PA 1KI3A 4ACAA 4MGIR 1LV7A 3TUZC 5FBWB 4D25A 3LO5A 3Q85A 5DH9A 1HQYE 1AJEA 4B43A 3CNNA 4LOAA 4GOKA 1R5BA 4OHWA 2LKCA 4TYPA 3EPKA 4S2EA 5JCZA 4MRNA 3QJYA 4MH0R 3KXLA 1M7GA 1F48A 1WP9A 3P20A 4QJ5A 3EIEA 5CIQA 5IDVA 3X1WA 1G3RA 2OUKA 4NU0A 2RHMA 5A5GA 1E2FA 2W6ID 1E96A 1T3HA 1WCV1 3NBZC 1DO2A 2WHXA 4ITRC 4DDTA 5J4YA 3AVOA 1CBUA 2ZJBA 4JLBA 4RKEA 3HYTA 3KQKA 2RGNC 2EFCB 3MCAA 3LBNA 4TMTA 2AHOA 2CXXA 3LD9A 1NMYA 1N0UA 3CF2A 5KSYA 1ZNZA 1FNNA 1YZGA 3WMEA 3TE6A 1IAQA 1DAEA 2D06A 4S35A 4KXFB 4QBFA 4PPQA 1OXUA 2NZJA 3MJHA 3UPUA 2IXFA 2CLDX 1A82A 4PXAA 5CJPA 2DYKA 1D9XA 2FA9A 2Z4SA 1XEWY 2ZYWX 3DOEA 4HYYA 5BWMA 1NSTA 1Z07A 3PIRA 1GKUB 1XMIA 4NHOA 5A0FA 4ZCIA 1F2TB 1EX6A 1F2TA 3FMPB 2KSQA 3K0CC 1P72A 3OESA 3E2IA 4OHVA 3CR8A 1KIMA 2FEOA 2F43A 4TQUS 1JB1A 1KJZA 2CVFA 2DR3A 1EWRA 4DLZA 5BYJA 2ZS9A 1KI6B 2F9LA 3K53A 2F3TA 2XJ4A 5FL7D 2OXRA 2NO6A 3C8UA 1II8A 1Y63A 1E2LA 1FTNA 4FD2A 4BFTA 1G3QA 2NGRA 4TT3A 2EU8A 3AGPA 1AK2A 1DG3A 1N0VC 5K8IA 2O8CA 5JJIA 1CR0A 3RVBA 4EPVA 4NBSA 3B85A 5JCPA 2IHBA 2RGXA 4KLNA 2EVWX 5JS8A 1ZJ6A 2GJSA 3H84A 1CLUA 3TAUA 2IX3A 3KKQA 1L7VC 5DI3A 1O3YA 5JSZB 3U44A 1ZNXA 2CCGA 1P61B 3U3KA 3W6NA 3PCRB 4Q4JB 1K8RA 3WXMA 1G3UA 121PA 1KI8A 3QEJA 4CEJA 3B1WA 4UQOA 4EJSA 3D3QA 1FL9A 3N70A 3M0EA 4G5RA 1XPRA 5IF9A 2WWFA 2IWRA 5EQTA 5JJKA 1S9HA 1HY3A 2FOLA 2V7QD 2VP4A 2ZE6A 4WOPA 3SYLA 1EWQA 1T9HA 1AZTA 1B23P 2Z5FA 2ZRNA 1N6IA 2GBLC 4I1UA 3ZS8A 4A4DA 5SZJA 1II9A 1DE0A 3KKPA 4QBHA 2JJ1D 4MRVA 3KQNA 1H8ED 1GL7A 4EQ6B 1VMAA 1WA5A 5KUTA 4V03A 4MKIA 2DFTA 2FGKA 3K9GA 4HZUA 3ND9A 6Q21A 1NBME 1KI1A 3FDIA 2V4ZA 1AA9A 2GJAA 3IQXA 1PVOA 4RCYA 4ZKEA 2IEYA 2PT7A 1ZIPA 2GVZC 4LGMA 4IKEA 2PMKA 2XSZA 2GZHA 5H68A 4GMDA 5GVSA 4M1WA 2ZR7A 4WIAA 3THWA 2ANCA 2REBA 1RRFA 1NRJB 3WYGA 1WB9A 4FCTA 2JLYA 1MT0A 4GZMA 1MH1A 3ADKA 2E87A 1N5KA 3AGQA 4PPFA 3A1UA 2PLFA 4BFSA 4IVRA 3TSWA 3RC3A 5J47A 3AKDA 2GESA 3UANA 4PZLA 3CW2A 3KJGA 3ZYCA 4F4JA 2R44A 1XJQA 3CONA 4QG7A 3NBXX 2OG2A 1T4GA 4ZDWA 3NXSA 2ZSDA 4LV6A 2ZEJA 2PCLA 1GFIA 1X8JA 3CNOA 4GZLA 1KGDA 4DLXA 2ZYTX 3KXKA 1GITA 4PC3A 3KFVA 2ZU0C 4PZYA 5JRZA 2JDIA 4EJSC 1Q20A 4EPTA 4EFMA 5FBLB 5ELXA 4HB4A 1RRPA 4QJ4A 2ZRJA 4EPXA 3TUIC 1N6OA 4NH0A 1F5NA 5FOVA 2ZETA 4O0MA 3W5IA 1XMSA 2R9VA 2ZIAA 1QZXA 2HCJB 1RJ9B 3CPEA 2GBLA 2CMKA 4LBWA 4CEIA 3TNFA 2ZRAA 3QNUA 5FI0B 4D4MA 4EAQA 1W36D 1SXJA 3SFVA 1Q1ZA 4B33A 5HZHA 3I5XA 3CRQA 4CRWB 2W00A 4RFSB 3SN6A 4Z54A 4NYMR 2XX3A 2PZEA 2ODEA 4OYHA 2AXNA 3U7GA 2PH1A 2VP6A 4W5HA 5EP1A 3ASYA 3QKSB 1YR6A 1ZRHA 4HAXA 3K9NA 4FWTA 2XSZD 4QGGA 3AF4A 1RPZA 1W4CA 4TMVA 4JSYA 2Q9AA 3O8RA 2O8DA 2JJ8A 2QSZA 4Q18A 1KDPA 3A36A 3AF2A 1HA3A 1XP8A 2WWXA 4LJ8A 1DBSA 3U44B 1OFIA 4GNKA 1Z06A 2H17A 1AN0A 3RS2A 5AJYA 5SZHB 4HUTA 1NNEA 1W46A 1ZCAA 5JWHA 4JVMA 2O8EA 4Q4AA 2I4IA 1G7SA 1ETUA 2Q9BA 2ZPTX 3HPQA 3A1WA 4IDOA 5CITA 4IOJA 3RRMA 1E0SA 3WHKA 2BMEA 4XD7D 3TR0A 1FNMA 3AKCA 2OCAA 3LQQA 1Z3IX 4TSFD 3AVYA 5H1YA 1MR3F 4B3CA 3QSYA 1EESA 5L3SA 3SHWA 4LPSA 2WWHA 2G0TA 4A9AA 4D6PA 1Q21A 2RGNA 3TIFA 5CYPA 1KSJA 2GZDA 1HURA 5E4FA 3D7MA 2O8BA 3PV0A 1GNQA 3O8DA 3KFXA 1JI0A 2ZI5A 2QROA 1SKQA 1Z2CA 4TLEA 3KDSE 4URYR 2CJWA 4D4LA 1IBRA 4A6PA 3WNBA 4D4JA 1KHTA 3GLIB 2RGCA 1ZM9A 3DM9B 4HLDA 3VX3A 4JKYA 2BBWA 2ZQ5A 4PANA 1R5NA 3FGNA 4XVRA 1XZPA 3K1JA 5HCIA 1G8HA 4TMWA 1V5WA 2OXCA 2P6NA 4W9MC 2XXAB 1NVUQ 4I1SA 3TKLA 2ONJA 4CYMA 2ORVA 1QVAA 1J2JA 2CVHA 3IIJA 3K70B 2B8TA 3RSOA 1MABB 3EZ9A 1W2GA 2UZ3A 4O25A 1UBCA 3FKQA 4EPRA 4URZR 2C77A 3GFTA 3VHLB 4QL3A 2PJRA 2CNWA 3CRMA 1WBDA 3X2SA 2HLDD 2V8OA 4KBFA 3F3YA 4L9WA 3N5CA 4TYWA 2WJJA 2J0SA 1SKYB 1OIWA 2OZEA 2DFLA 1UJ2A 3AUXA 4Q7LA 5CYOA 3MUFA 3C5HA 3LXRA 2ZR9A 3NHAA 4EPYA 2CK3A 2WAYA 4HLUA 4DCVA 1E94E 2FSIA 2XJ9A 3QKRA 5KNCA 5L3VA 2RGBA 4Q66C 3THOA 2EWWA 4LJ9A 3FVQA 5FFMA 1G16A 4WBSA 1U0HC 2BBTA 3HR8A 4Q02A 3D8BA 2GCOA 2EQBA 4KFUA 3PEYA 3W90A 2FFQA 5C2JB 4A15A 4IEEA 2Z83A 3LX8A 4B2PA 4ILEA 1N5LA 1W49A 4DRZA 3WRXC 1E79A 4C4PA 4Q1BA 1CJUC 1JXMA 1KO1A 1UADA 1J70A 1GILA 1Z6TA 3G0HA 3AVXA 2A5YB 1RRCA 1E1RD 1KZGB 1TU4A 4WAUA 2R6GA 3ADDA 1EX7A 1DVRA 2BVNA 5JHGB 2CE7A 4OQNA 4AY2A 3M4YA 2AD5A 2QP4A 4DEYA 1PLKA 2YWFA 4QBGB 1UBFA 3EWAA 1SVWA 3SU8A 1US8B 2C9CA 5L3RA 1E2GA 4PC2A 1WXQA 3EZ7A 3FYHA 5HE9A 1BO6A 4PAOA 3AV0B 4P31A 1RW4A 5IK2D 4G5SA 1DAGA 4V0OA 3CZPA 4DLSA 3OZXA 3W34A 1P60A 2P2LA 1D2EA 1G7CA 1G5RA 3EC2A 2ZJZA 1NVVQ 3CKLA 4G1UC 4M1TA 4URUR 2WMOB 2Q9CA 3TJZA 4LJ6A 2E1RA 1YKSA 1KSFX 2VRWA 2HUPA 3T12A 4B3XA 821PA 4KI0A 1M7HA 2DPXA 4OK3A 2AFIE 5JSZA 1G17A 1GL9B 5G3YA 3BH7A 1YE8A 4JLNA 3VR5A 4RVCA 2IF2A 4JS0A 4YXWD 1OYYA 4TL9A 3GEIA 3L8YA 2ODBA 3W6PA 4C7OB 4BLQA 4B3DA 1XTSA 2BCGY 2QPAA 1YZNA 3C7KA 4GMXA 1CJTC 3QKRB 1E99A 2NOAA 2X77A 2EFHB 2WOOA 5TV2A 2VBCA 1NMZA 4FMBB 3IBGA 4PQRA 2ZITA 4Q9JA 2ECKA 1TX4B 3AP2A 4M22A 1ZIOA 4DUGA 4TTRA 2JLXA 2ZE7A 1ZM2A 2OESA 1SXJC 2PMDA 2QA5A 1UPTA 2FF7A 3SBEA 4AG5A 4XWOA 4MUBA 5CJ2A 2Z4RA 3AVTA 2HF9A 3B2EA 3W6OA 1S9DA 4PO8A 3QIAA 3F0TA 4HB0A 2QRNA 1S96A 4A0HA 4JVLA 1AZSC 5LB4A 2J1LA 4C3ZA 1IJEA 3MSXA 2QPTA 1G8PA 4MDFA 4H1UA 3RLFA 5CB8A 4CVNA 2H5EA 3C5CA 4DDWA 2FH5B 1RC8A 1ZCBA 4GFDA 3BB1A 3WRYC 2ZAMA 4YDHB 4IOMA 3CH5A 2BMFA 2FPMA 4B47A 4NE2A 4QM6A 1KMHA 1IJFA 2ZJYA 3T5GA 3TQFA 5E95A 3QXXA 1YZKA 1BYUA 1KNQA 1R0YA 4JBYA 3ECCA 3SOPA 1MKYA 1XB2A 5FUYA 3CLVA 2ZJ2A 4XTRA 1IXZA 2ZUDA 4IFEA 2JLVA 2VLIA 2WPDA 3ZS9A 2ZRMA 1AKYA 2GK7A 4IW3B 4I81A 1XTJA 1M74A 1VG9B 2B21A 2TMKA 4LHVA 4M0LA 2VO1A 4OJQA 2C9OA 3BFVA 4QGAA 2FV8A 4ACBA 1F2UB 1Q0UA 2IUTA 2QU8A 4NKRA 2JAQA 3R9IA 1KJYA 2ZRPA 4IEIA 4P33A 2NO9A 1XEWX 2FU5C 2WZQA 1OF1A 2JLSA 4LCBA 3WHLA 2GVDC 3QUSA 5FOTA 3G5UA 1FPMA 1SVLA 4NPHA 2F3RA 3W8RA 1VG0B 4HAWA 4DLTA 3U60B 1NG9A 3KXIA 5M04A 3KQLA 1GKIA 3VKWA 1DOAA 1N5IA 1QHXA 3DHWC 3KB1A 1CR4A 3Q8XB 1X8LA 4OJKA 2G3YA 2BKUA 4AC9A 4N0EA 1EFCA 1HYQA 2HYDA 1QHHA 1ZVQA 1C1YA 4PC1A 1TUEA 1W5TA 4PHGA 4OQXA 4A92A 1IXSB 4AG6A 2FFBA 3QY0A 4CT4B 1OFUX 2F9MA 2HXYA 2C03A 1NVXQ 1DAIA 1II0A 2XTZA 4DLUA 4Q03A 3UG6A 1C4OA 5FBQB 4IOLA 3EX7C 4V02A 1SVIA 2D7CA 1R2QA 3ZVNA 3RRZA 1N25A 2C2HA 3OAAA 4B74A 4OQFA 421PA 5JFGA 2NQ2C 2WJIA 4PAQA 4MDEA 2Z0MA 1D5CA 1JQLB 4M1YA 3THWB 3BB3A 4D2IA 1FP7A 1OXXK 2BC9A 4KCGA 3SDZA 2VHQA 4CDGA 2WMNB 2QBYB 5L8VA 3DDCA 5AUOB 5FH9A 4FCWA 1XTQA 2YWEA 4LBYA 4XWKA 3FMFA 4URVR 2V1UA 1G8GA 1OFHA 1XJCA 5FTJA 2LKDA 1NI3A 3QKUA 4CEHB 3UKDA 4R71A 2IK8A 2QY9A 2VP9A 4DEXA 2O5VA 4C0AC 1DADA 5LDDC 4Z1MD 1KI7A 4TZ6A 2Q3HA 1ZC4A 1RFLA 1P5ZB 3FB4A 4UXIA 2G9NA 2IT1A 4NMMA 2VSXA 5FL7A 4A82A 1E0AA 1ZD1A 5E7MA 2MSDB 3P4XA 3UATA 4LUCA 3LX5A 4M9SA 4POAA 2BOVA 5DYIA 2VTKA 2GAAA 1OYWA 3CB4A 4PX9A 4B75A 3M6AA 1TL7C 1BOFA 3KUCA 2RAPA 3FKSA 1G7RA 2BJWA 5TVKA 1R8QA 4RD6A 2GK6A 3HWSA 1ZC3A 1G6OA 2C96A 3LV8A 1JPNA 3LXXA 4M21A 2GCOB 5EE5B 2WJVA 1IHUA 1RYFA 3L2OB 4QGFA 4E07A 4IVQA 4LK2A 2ZSBA 1NKSA 2HYIC 2J7PD 3K0FA 3ZD7A 4IHQA 3U2QA 4TMKA 3L8ZA 4MKGA 3ICQB 1DELA 5AWFC 3DL0A 3GJ7A 3AH8A 4M4SA 3KZ1E 4BGDA 5KO2A 3NBFA 2CHQA 1UM8A 1EGAA 4Q4HB 3OIWA 3TMKA 2GAOA 4OHXA 5TY0A 4F38A 4FWIB 4LYAA 1CRPA 1KJWA 1W36B 4P4TA 2NZ8A 1UDWA 4A0FA 2HT1A 2GHIA 2ZREA 1CTQA 4TTPA 3BWDD 2JGNA 3ZH9B 3TVTA 4LDJA 1SVKA 1NLFA 1L2TA 3SFZA 1XTRA 4BE7B 3GPLA 3KL4A 1GOTA 1OHHA 4DCSA 3QF4B 4HAUA 4XIGS 1YRAA 3C15C 5FBRB 2HLDA 3TW8B 4BFWA 5EE9A 3PENA 1XJ0A 2DB3A 1S1MA 1YR7A 5C46F 3QVVA 3I8XA 5KDLA 1EFUA 1E9SA 1GRRA 2QN6A 4DSUA 2FSGA 3EAQA 1P9RA 2OLJA 4QOSA 5DI9A 2FMXA 4BFYA 1E2EA 5DN6D 3EZFA 1KY3A 1FW6A 2C99A 2GJ8A 3GLIA 2QM8A 4HUQA 3KUDA 1I2DA 1G8FA 1QHGA 1OLOA 1DARA 2P5SA 2MMCA 3LW7A 1W1WA 2IHYA 1L8QA 3SBDA 3KX2A 3CZQA 1M7BA 2O0KA 1PJRA 3AVQA 4JMPA 1MOZA 2ZRFA 4L9SA 4QRHA 4UNQA 1NJGA 4F4IA 4DB2A 1NVVR 1E98A 2W2XA 3IQWA 3T35A 4GDFA 4DCNA 4US2R 3PG5A 1TMKA 4X8MA 3GLFB 1IY0A 4NP6A 3VKGA 1KK3A 4NZYA 1GUAA 3IO3A 3QXJA 1IN5A 3RS0A 4DDVA 2OFXA 2G88A 4LY6A 2NO1A 3SHFA 4Q9KA 4DT1A 2CEAA 1GNRA 2FJUA 4TYNA 4XWAA 4ZCMA 4RJLA 5IT5A 2H16A 4MKHA 2O8EB 4N3NA 1KI9A 2EFDB 2QTFA 2Z6VA 1OE0A 2YJTD 2JATA 4HDQB 1KTVA 2X1VA 2W0MA 3AKYA 4NCNA 3DZ8A 1IXRC 1P7CA 4OKSA 1G4UR 4EFLA 2P65A 1XMJA 2BKEA 2N46A 4QGHA 4PHFA 2K5UA 2W2VA 4IDPA 1GSIA 3BC1A 4DXAA 1XZQA 1YZLA 4IXNA 5KSPA 1TQ6A 4MGZR 2RGAA 2IUSA 4UNSA 1HUQA 4KFRA 3DKVA 4LYJA 4JJZA 4PC7A 4D26A 3AM1A 3DMDA 3HDTA 3RANA 3SI7A 1UF9A 3QPWA 4RFSA 3C14C 3K70C 4B71A 4O2LA 1ANKA 5B64A 5H8WA 1YHNA 2BEKA 1KDOA 1Z6YA 2IXEA 4BZXA 4B6EA 1SVOA 2NMVA 2N42A 2ZI9A 1A2KC 4U00A 3WP1B 5ANRB 5E7JA 4G0NA 1Q57A 4AKGA 4Y0AA 5FI1B 4LHZA 2ZANA 4C0BA 2R6FA 1SXJE 4ZDIA 1H8EA 3ADCA 1DAMA 5DO9A 1Q1EA 4LWZA 4Q1CA 3T1VA 1Z0JA 1PLLA 3LH5A 4AKEA 1JEEA 3ZIAD 1G6HA 4OK6A 2V7QA 1S0UA 3ZD6A 1XNJA 2LCFA 3QXSA 4WZBE 1KSHA 4KSCA 3AQ4A 3B8HA 1J7KA 1JBKA 5C18A 3TW4A 1E9DA 2CDNA 3HJNA 4A36A 5LBIA 2ZJ5A 5AUPB 2FG5A 1XDBA 3QPVA 5AUQA 4HDCA 4U5XA 4PAMA 2ZRLA 1CR2A 3GLHB 3A6PC 1ODFA 1XPUA 3BOSA 1KMQA 1FFHA 4ABYA 1T3SA 3PUZA 4EUNA 1E9AA 4BRWA 1U99A 2C5LA 1A2BA 3OIVA 1LNZA 4TT3D 5FBVB 3H0KA 3UMFA 1VCMA 4GPTA 2RCNA 2V54A 1OW3B 3REGA 1UKYA 1MABA 3T61A 3CRRA 1NF3A 3U6KA 4MYTA 4U02A 1ZAKA 1JQJC 1HE8B 2AX4A 3GJXC 4KAXA 1NLYA 2XTMA 2HJGA 3FHTA 4LHXA 3K9HA 4JVNA 1QDEA 2CK3D 4BEBA 3EASA 3NH6A 1T5LA 1F3OA 5GVRA 2D4HA 2EYQA 1E2PA 1JJVA 1I2MA 4TN1A 3CNLA 4BWYA 2IBMA 1FQKA 1KO4A 3CRVA 3JVUA 5JEEA 3B78A 1U8AA 5TMPA 3U7HB 1T8TA 1W44A 3A1VA 1T0HB 2IYLD 3IUYA 3OIYA 1G5TA 2Q0HA 1OHHD 1DAFA 1Z28A 2GCNA 2VHJA 4NCHA 4DIEA 1TQ4A 3I4LA 2OEPA 4Q48A 4D0NA 1XBTA 2ZRIA 1JR3E 4UNNA 3TH5A 2KWIA 3QQ5A 2A9KA 1CJMA 3FOZA 2JJ1A 3R9WA 4PFSA 4TL6A 3B7GA 4G5QA 2JA1A 4ZI2A 2OE2A 2OM2A 3QKSA 3O8BA 1MRNA 2MSEB 1HT2E 4MITA 1LS1A 2ZI4A 3KKOA 4RD2A 2XNSA 1VTKA 3D6TB 2KBEA 4AYTA 1L4UA 3SNHA 2REXB 1R5OA 3NIBA 2DY1A 4FMDF 2BM1A 1LVGA 3NEYA 4A1FA 2ZE8A 4HAZA 5IRCD 2FZ4A 3WNDA 4RZ3A 2V1XA 1AS0A 5F9HA 4Z51A 2IYVA 3AF1A 4C0LA 1U90A 5FUVA 3PVSA 4PTLA 1E2NA 4C0QC 4Z1MA 3OF5A 3MG9A 4KODA 1CU1A 2BV3A 5FPTA 5HE8A 3SQXA 5CLQA 4NL4H 1WBBA 4Q1EA 3PEUA 4FCVA 5FUWA 4C0KA 3U4QA 3W5JA 3EIQA 2CLSA 2P6RA 2GRJA 4C2TA 4ZDJA 3LRPA 3L0SA 2UVQA 2W2TA 3OFND 2YINC 4RZUA 3T1OA 2FSHA 2QAGC 4YMUA 1XXHE 5B58C 1R0WA 4FINA 1XFAA 5FR2A 1R0ZA 3REFA 1NN1A 1NL3A 1XD2A 2JJ2D 1Z29A 5BN4A 4WXPA 3EXAA 1EXMA 2WJHA 4YMSA 2DWPA 4Q1FA 4PSAA 3OE7A 3WYFA 2WTUA 4PSVA 4M8NE 2H8KA 3AP1A 4MYUA 2WKPA 1E2MA 3BH0A 1ZD9A 2WVJA 2WV9A 2GA8A 3CWZA 2BMJA 2PEZA 3Q9LA 1N5JA 1P62B 4HI0E 4A2QA 2N1BA 1D8TA 1E1RA 1OIVA 2XEXA 3BB4A 3GP8A 3CX8A 4QC2A 2IL1A 3QG5A 3TVDA 2HCBA 1BIFA 1FX0B 2Q6TA 2XB2A 2ZVPX 2ZRGA 3I3SR 2NPIA 4RY2A 3P4YA 1E2QA 5HZKA 5JJLA 4RD0A 4BECA 3KJIA 2ZRHA 1NMXA 1UKEA 3B13B 1UBGA 4AYWA 8OHMA 1FZQA 4AWXA 3H4MA 4RZ2A 4CF7A 1T91A 4V0KA 1M1YE 1YR9A 1S4QA 5AJWA 4I1OA 1OV4A 1Q22A 2XNDA 3UG7A 4Q01A 4A2WA 2BIFA 1EFRA 4JLAA 3VR4A 3RDPA 3IHWA 1P2UA 1RKBA 1G64A 1TQ2A 2GDJA 5JZVA 4NONA 2CL7X 3U7EB 4C2UA 1MO5A 2ZI6A 2QQEA 2V55B 3PUYA 5DHAA 4DB4A 3M1IA 5FTNA 1FTSA 4AYXA 3OEHD 2ZE5A 1Z0FA 1Q12A 2G1KA 3NHBA 1LS6A 4C0JA 5LD2C 3Q5DA 3QBTA 4C9BA 2DHRA 1Z0KA 1TU3A 4HZUB 4X8HA 2EFEB 3UMSA 3LAWA 4HLCA 1KYIA 5HCNA 3C16C 5AJXA 4CZ2A 1QHSA 2J0QA 2CLCX 4M1MA 2WWYA 3ZGXA 1UEJA 5FOWA 2F55A 2GF9A 2ERYA 3LBIA 3UMRA 4BPBA 4R9UC 1GNPA 3TSOA 1KO8A 4QXAA 4Q1AA 4D0LB 4DZZA 4NYMQ 2VIIA 1AQYA 4HSEA 3IIMA 1U81A 3IILA 1OKKD 3GEEA 1E2HA 2CL0X 2ZRKA 5CB6A 1YZQA 1E2KA 2F43B 5GADl 3T1QA 1A7JA 2C04A 2AK3A 2NTYC 1X1RA 5CM9C 3ZDQA 3Q7QA 1NVWQ 3HPRA 5KPDA 4WXRA 4BLOA 2CBZA 3J81k 2ZTSA 4TMXA 3CX6A 1IN8A 3JZMA 2JLUA 4K8OA 2WOJA 2ZUCA 2KE5A 4FMDB 1Z6GA 4HUQB 4MA4A 1Y3AA 3WBKA 4DWJA 2A30A 5G53C 2YC4C 3I92A 3LBHA 2WSSA 2FWRA 2V6IA 3IHLA 2IC5A 1II8B 2QMUA 2B7BA 3DM5A 1GZSA 3L43A 2KB0A 3VNUA 2ZR0A 3CPJB 4KVGA 3VR1A 1U9IC 3KQHA 2VHCA 3U61B 1CEEA 4Q9IA 3W9YA 3K0SA 3QF4A 2OFOA 1P9WA 1P3JA 4LC0A 2P0EA 4DT1B 4ERNA 1FUKA 2IYWA 3GLGE 4LJ4A 3MGCA 1U8YA 3B60A 3B1YA 2YOGA 2G83A 5K8LA 1G291 3EPJA 2ZRCA 5AR1A 2PX3A 2ATXA 4Z8YA 1W36C 5AK0A 2D7DA 3GMTA 4ZPXA 1R4AA 3O47A 3T34A 1T6NA 2ZYVX 3BE4A 3FE2A 3SJCA 3CF6R 4FMCB 4YC7A 3ND8A 3GJ0A 1LW7A 3JVVA 2AWNA 3OHMA 4WA7A 3HU2A 3P27A 1IONA 2GJ9A 4XSGA 3KKNA 4PR0A 4BRUA 2V6JA 3NG1A 5CIWA 4AIIA 1FP6A 1Z0DA 2A2ZA 1XEXA 1N6HA 1TAGA 4G3XA 3VTKA 1QF9A 1IY1A 2AFHE 3SEAA 5JRJA 3C4JA 3MMPA 1ESNA 1OJLA 3RABA 3P32A 1N6KA 2R6CA 2F1IA 1VDZA 3GJ6A 3ZZUA 2QT1A 4M9ZA 2QMEA 3DZDA 1WRBA 3CRW1 3OEED 3AVWA 1Z6XA 1JJ7A 2GZAA 3IBYA 3PUWA 1HV8A 3B5JA 4R2IA 1TF5A 4KFSA 1AM4D 5IK2A 4D82A 2CL6X 2QEQA 2ZJOA 3PXGA 2OBMA 1AS3A 2VSOA 4QM7A 1Z5ZA 4IDQA 2JEOA 3PFIA 1JAHA 1ZINA 1XXHB 2PBRA 5DLQC 2QAGB 3AVUA 2QZ4A 4JLPA 1HQCA 5FUXA 2J0VA 4Q47A 4LHYA 1K5GA 2HF8A 1VG1A 2O52A 2WWGA 4Q00A 5FL3A 3WMFA 1YZTA 4L8GA 4KITB 2O8FB 2D2EA 3CUEF 2BCJQ 3QENA 4F4CA 4KO8A 3AP3A 5FPKA 1P6XA 4PPGA 3DO6A 1DEKA 1US8A 1TQDA 3A1SA 1U0LA 5DN6A 2BEJA 2YWHA 3MWKA 4PZZA 1E79D 3SE0A 4Q7MB 4TMZA 4FW9A 1KK0A 1FX0A 4KFTA 3AF0A 3SQWA 3AKEA 2C98A 1OH7A 4QNRA 1U94A 4DIDA 4IDNA 4DLRA 1A4RA 1SKYE 2XAUA 3MWJA 1W4BA 2HXSA 1SGWA 1GRNA 4TYYA 3H86A 1RRGA 2WIBA 4PO1A 1TPZA 4LJ7A 1P4SA 2W6JD 1ZD8A 5FTMA 3OFNA 3KTAA 3DMNA 1U98A 2WKRA 3R20A 4NCIA 4O2RA 1JNYA 1KDTA 2IYTA 4GP6A 1N6PA 3KKMA 4AD8A 2IF0A 4JYBA 4UXJA 1G3IA 2CHGA 1ZBDA 1XD2B 3GFPA 3GQBA 4DSOA 5EXTA 4PHHA 3RWMB 1XCGB 2J0UA 4C0HA 1ZM3A 4D0GA 1BH2A 1LB1B 3VU9B 3RAPR 2H18A 2VF7A 1R6BX 4DCTA 1JAIA 3QXCA 2AXPA 2KJQA 4H1VA 5HKKD 1GP2A 1E0JA 5TXGA 2A3RA 5JI2E 4GRAA 2XZPA 1OH5A 221PA 3ZVRA 1A5TA 2R6AA 1XD8A 3BERA 4B2LA 3B82A 1UBEA 1GIAA 2QG6A 5HKKA 4R98A 2FE4A 1CXZA 2AKYA 5LPNA 1G41A 2VEDA 5KOYA 2ODNA 2RHDA 4URXR 3W3AA 4LX0A 2IYQA 2REOA 4LJYA 1RZ3A 2OAP1 1VPLA 5GJCA 4ZDKA 1E2JA 4IRUB 3GCGA 1YRBA 4PHTA 2O8FA 2FNAA 3EPLA 3KTAB 1MO3A 2QQ0A 2WAXA 4UJ3A 3TSZA 3R7WB 2J46A 3PUVA 5J4KA 1MO4A 5EJEA 2OV2A 2WM9B 2MMGA 4HLUC 4HB2A 2LWIA 3GJ4A 4JBWA 5JECA 4HB3A 2PEYA 4FMCF 2J9RA 3H1TA 2OHFA 2YHSA 3CO5A 2YKGA 4A0GA 1Z6AA 1KSGA 5DE3A 2QUZA 3QOFA 1IM2A 1FOEB 4Q9LA 1RE0A 4CW7A 2W6JA 3GLIE 2RMKA 1G19A 4ZCLA 1QHHB 1X6VA 1W0KA 2QORA 2IA5A 2FEMA 2OO7A 2PZGA 4L4UA 1ZM4A 2VHUA 4IXMA 3N2IA 4JL5A 4DLVA 3ZVLA 1G7TA 3IKJA 4Q21A 1R10A 2PJZA 1WDTA 2DWQA 3FMOB 2I3BA 2O8CB 3RNLA 3FHOA 4KYUA 3SJAA 1QG2A 2W58A 1A1VA 3OAAD 3GJ8A 4RKFA 2YC2C 1DS6A 4TL8A 4TQ9A 3ZZ0A 1NY5A 2VHTA 1U0JA 3G82C 3PEWA 4GOXA 3B9QA 1IN4A 1NJFA 3RS4A 1BYIA 2QGZA 4LV8B 2J7PA 1JXOA 5BYKA 2FSFA 4X8LA 3MD0A 4US0R 4XJXA 2PT5A 4CGZA 2WWIA 4P32A 5J4LA 3FFBA 621PA 3OEEA 3A4NA 4JKIA 4O3MA 3AEZA 4OL0A 4LPKA 3T06B 4M1KA 2C95A 2QL6A 4Q4LA 1AS2A 1KMHB 4OQLA 3VR3A 1M6NA 2JIZD 2VA8A 2JDID 2WBLC 4MRRA 4NYIQ 5FPHA 3GEHA 1XEXB 2R2AA 1TTTA 1S8FA 2GETA 5SZIA 4XH9B 2XGJA 3R7WA 3LQRA 4NDZA 1MV5A 2FFAA 4B3FX 1OPXA 3GLHA 4TTQA 5CDFE 1S2MA 2X2FA 3RS3A 2PZFA 5HR5A 3WP0A 2CCKA 4FN5A 5TDHA 5DGXA 2YOFA 1YZUA 3RHFA 2H57A 4W5JA 1VKJA 3I5YA 4F91B 1ZMXA 2A7QA 2IYXA 2J7KA 4TSFA 1KY2A 1NBMD 2QRZA 5AJZA 1LFDB 1E69A 4Q7JB 2J59A 1COWD 2V3CC 3V9PA 4H9GA 2P6UA 3BH6A 4MUAA 1HT1E 2XB4A 3E70C 4TLAA 1CJVC 1GG2A 5CLLA 1OSNA 2OAQ1 4IFBA 4M9QA 3I61A 1VCNA 2IYYA 4US1R 4JZKA 5JLJA 1ESMA 4OQMA 2EFGA 1D2MA 2AWOA 4BFXA 3UIEA 5J5CA 5GJBA 1TEVA 1OXSC 4A8JB 3MAAC 4QFMA 2ZRBA 3D31A 1NLZA 1ZU4A 4FIDA 1E9CA 4JT4A 5DYGA 1ZM7A 4FI3C 4BZPA 4E22A 1W0KD 5KYKA 4QJ3A 1E4YA 3F5FA 2QGNA 3IEUA 4GSYA 3E5HA 1Z47A 3ETLA 4DJTA 3I1FA 1NBMA 1E4VA 1KO5A 2VP5A 3PQCA 3QBVA 4MGYR 3W3ZB 5KNDA 1YR8A 2ATVA 1PUJA 2ZSAA 2ZVQX 4V0MA 2QTHA 1OT3A 4D4KA 1ZU5A 5F3WB 2FPKA 3U6BA 2L0XA 2ORWA 4LYHA 3NBYC 1KKMA 2VSFA 3EIHA 5A4JA 5JI3E 1TEXA 3P26A 4AKIA 4OI2A 3A4MA 3L0OA 4M53A 2WJYA 3V4FA 3K9LA 3NTUA 4WVFA 4ZIRB 4BZQA 1KNXA 4FXPA 2RGEA 2VL7A 1SVSA 3ZQ6A 2MSCB 3I8SA 4K81B 4AURA 1SZPA 1E0KA 2F1RA 3SR0A 4ESHA 2F7SA 3QVUA 1ZUNB 1FUUA 3CH4B 3Q3JB 5BN5A 4LBZA 4CEJB 4LBVA 2IS2A 2ZYUX 3Q7PA 3BD9A 5J4HA 1HTWA 5EXXA 3TUJC 2OFWA 4XVUA 5JBQA 4P4SA 3RC8A 5BXQC 2GEUA 2GILA 2QNRA 4ZV4A 2A5FA 2A5GA 1XWIA 1K6MA 2C9YA 3TLXA 5G41A 5B30A 2CE2X 3CM0A 3LW8A 3VR6A 1RIFA 1EFTA 2CJWB 4PPNA 4QHTA 4A8JA 1XTKA 3VMFA 5AJVB 1P2SA 3MLEA 4MYCA 1KKLA 2OSBA 3IPXA 1T8UA 2WIAA 5DISB 5J40A 3SJBA 1VYTA 5JEDA 3QPUA 1R8SA 1PV4A 1PUIA 1AGRA 1X8KA 2YZ2A 1MO6A 2ZI3A 3EA0A 4NTZA 3LVRE 4OI1A 1K5DA 3I72A 1U9IA 3RWOA 3T15A 3L82B 5CK5A 2J87A 4LI0A 3U4QB 1Z2AA 2DBYA 1ZW6A 3QE0A 4RD1A 1DPFA 2ZU6A 5CK4A 1P2VA 4MRSA 2IUUA 3BORA 4K46A 5CDFA 5K8UA 3MFYA 1KAOA 3EG5A 5KDDA 3OE7D 3H2YA 3FMIA 3K0CA 4JJKA 2B7CA 3R9XA 5DIFA 4LHWA 4L15A 4A2PA 2XXAA 4Q4HA 4LZZA 2QM7A 5DHFA 1UKZA 1E6CA 1QRAA 3QEOA 4DHEA 2W83A 1UKVY 3X1YA 1W7AA 1CR1A 5KDOA 5E3HA 1NIJA 4G5OA 5DSZA 2VP0A 3AVPA 4URWR 3RRNA 5IHPA 2G1JA 5EZ6B 5EE0A 5C1BA 4Q7KA 3N2EA 5GJVC 3ZZTA 3O8CA 2ORIA 1UEIA 4IJMA 4RD3A 4B32A 1JECA 4BLPA 1G20E 1N2CE 3ADBA 2QT0A 3UXMA 3NC0C 3CF0A 2OBLA 3FKSD 4F92B 1WE2A 2AD1A 2O8BB 2GCPA 3QXHA 4HZIA 4MQBA 3LLMA 4ZO4A 5EP4A 4EIWA 3VNVA 2ZJ8A 1FMJA 5F9FA 4KSBA 1JPJA 1JR6A 3CIOA 3B6EA 3X1DA 3ZQJA 2ZSFA 2R62A 1JR3A 1XMVA 2IYSA 2RKOA 1CJKC 4JLKA 4WW0A 1N0WA 721PA 1KDRA 5FOXA 3MWYW 2ODWA 3T1TA 3ZJYA 4KBGA 5EE3A 3KJEA 1SHKA 2FDCA 4KU4A 1MRSA 1G18A 1GTVA 3VQTA 2QE7D 5C4MA 3ZVMA 1Q1QA 3BJIC 1TADA 1D9ZA 3NWJA 4PC6A 4DSTA 3GLFE 1Q44A 4JBXA 1R0XA 4UNPA 2G77B 3EZ2A 2JLWA 2FFHA 4DDUA 3NDBB 1Z63A 1DO0A 4TLBA 4QBIA 2AN9A 1VYVA 4HLQB 4YMVA 5D3QA 2RH5A 1CULC 1OFTA 1YQTA 3VX4A 1PLJA 2QBYA 1D2NA 3FFAA 2Q3FA 4BLSA 1OH6A 2JASA 4W7SA 3HP1A 3IEVA 1H65A 4HEJA 3CBQA 4Q9HA 2GXSA 2AK2A 4ARZA 1VCOA 2OT3B 4IDHA 2PLRA 4LYFA 4BQSA 2BM0A 2ONKA 4JLJA 5EP2A 2B8WA 2OBNA 2X19A 2ANBA 3RS7A 2FN4A 1GWNA 3E1SA 2QP3A 1KK2A 1E3MA 3THYB 1AKEA 1DAKA 1SXJB 3FTQA 1DTSA 4RCZA 2QI9C 2OCYC 2CNWD 1CP2A 4CEIB 4J0QA 2R6DA 2HJVA 2QSYA 1HEIA 2HV8A 3HR7A 4PQFA 3IDQA 1OH8A 2P3SA 1OB5A 3A4LA 4P3YA 2D3WA 4BFZA 4V0NA 3L0IB 2BBOA 4QKQA 1QBKC 4B35A 5G3ZA 4E09A 3U7FB 1N6NA 1AIPA 2WPDD 2RGGA 1E2DA 2WKQA 3LDAA 1QVRA 2OILA 4GT1A 1EG7A 3GLHE 5JHHB 2PL3A 1BMFD 2J3EA 2R8RA 5FTKA 2VYFA 5SZKB 4DKXA 4N0DA 4A0RA 4C30A 1F2UA 4JLMA 3WY9A 2IYUA 1ZP6A 3B1XA 3MWLA 1I4DD 4TL7A 2BWJA 5CM8B 3U3JA 4E5UA 1FMLA 3WMGA 1KAGA 3TK1A 2WICA 2ASEA 2NO7A 1IOZA 5L3QB 1IY2A 1CRQA 1VCIA 2WJGA 3PUXA 3ONWA 2J41A 4ESVA 2VP2A 5P21A 3QKTA 1NY6A 3VFDA 1GAJA 2P5TB 4X8OA 1CIPA 2J5XA 3IO5A 4XOIA 1BS1A 2GXQA 3AUYA 3SYNA 2DFKB 1LTQA 2A5JA 1ELOA 1UAAA 5AUNB 4B3BA 4XD7A 2XNDD 3A37A 2RB4A 4WZAE 1E1QA 4JVSB 3V00A 3ZIAA 5DNYB 2QAJA 3LA6A 2O0HA 4EKDA 2ZROA 3K0EA 4JSTA 5JWOA 2QMHA 3A1TA 3IPYA 3BAFA 1JALA 2KBFA 3LNCA 3SS8A 1T5IA 3VHXA 2W0SA 1DG1G 1T3LA 1SULA 1TNDA 2ZSEA 1VG8A 5FR1A 4ASUD 2GJKA 2DFNA 3K09C 4A6XA 5FOSA 1XD9A 3B1VA 4EPWA 1E32A 3C41J 4YQFA 1W5SA 4TQAA 3TR5A 1DAHA 1W48A 3ICEA 3DVLA 2YYZA 1U2RA 1FQJA 4DUGD 5BN3A 1LF0A 4JT2A 2ZRDA 2BBSA 4Q4JA 4YXWA 2GKSA 3BK7A 5KU1A 2F6RA 2J45A 2ZJAA 3VAAA 3PITA 1Q3HA 2XZOA 5DI3B 1UDXA 5HPYB 5JS7A 2QP9X 3WNCA 1D6JA 1X86B 2EYUA 2IS4A 4R7ZA 1P2TA 2AR7A 1F6BA 2JJ2A 4QNMA 5JWRA 2IS1A 5EXSA 1UFQA 2PCJA 1W4AA 2IS6A 4Q1DA 3Q72A 1YVDA 1XPOA 4G5GA 4JLOA 1W47A 1NG1A 5EE1A 2ZS7A 1E1QD 3MRSA 1BKDR 3OEHA 3GLFA 4NCKA 2BDTA 2JIZA 2NO0A 3NKVA 5L3SB 3CWQA 1SHZA 1Z22A 4RSGA 4Z8XA 3T5DA 1V43A 4M2LA 3ZLJA 2NPFA 1OB2A 2Y8EA 3LVQE 1IN6A 1EFRD 4IVPA 5C4GB 1RYHA 1Z0IA 2EW1A 1XTIA 4ZIRA 3X1ZA 3A8TA 1WF3A 1N3BA 1M2OB 1NSFA 4KYIB 4TYQA 521PA 4BFVA 1W2HA 1XEFA 4II7A 4XTCS 1BMFA 3THXA 4N1AA 1WQ1R 2OLKA 5BW8A 5B2ZA 4GOJA 2QMOA 2AKAB 3MJRA 1CF4A 4B44A 2FZLA 2UKDA 2ERXA 3R8FA 1Z0AA 3TGPA 4MGKR 3AVVA 4QHSA 1Z8FA 4KLZA 4JL8A 5UKDA 4MKFA 2ZXUA 4B3GA 1G21E 1XRJA 2C78A 3GJ5A 1G9XA 1M8PA 4JYCA 3EWSA 4I99A 3I32A 1GDDA 1E9BA 1IQPA 2IEZA 3EARA 3GFOA 1YJ5A 4GBMA 3KJHA 5EUMA 1E9EA 3RSLA 4DLWA 2RGDA 3HU3A 2A78A 3BFKA 3S1AB 1T0JB 5EZ5A 3K09A 4ON9A 1G1MA 1J8YF 3JZAA 3EPHA 4OHYA 4NCJA 3CR7A 1LY1A 3QI2A 4M1OA 5B57C 4OI0A 4DBLC 4TZ0A 4NYJR 2B92A 2X8AA 3FPAA 2BMDA 4OBEA 4DC9A 4IOKA 2WWWA 3PEVA 2F1JA 1Q1BA 4QHYA 3EC1A 2CHVA 3DOFA 2H92A 3K70D 3LLUA 5FOUA 4ZI3A 4CIDA 3I62A 4GP7A 1G8YA 4AK9A 1HH4A 1PZNA 2QTVB 2W6IA 5L3QA 1M34E 3VU9A 5LD2B 1P73A 2ZS8A 4B2IA 2UZIR 1KK1A 2F1HA 4L16A 4Q19A 2I1QA 3U3OA 1ZUIA 2JLRA 1Z08A 3THYA 3Q5EA 4YLGA 3F8TA 4JLVA 3BFXA 2G6BA 2O0JA 2IWHA 4RD4A 3U3MA 1S1CA 2EWVA 3A58B 4BLRA 2OCBA 2I1VB 4D80A 2D62A 3DEFA 4B34A 4ARZB 3THXB 2FX3A 2XOKA 3GJ3A 4CEHA 3UWOA 5GJWC 1NN5A 1EFHA 2NIPA 4HAYA 1I4TD 2VH5R 4EFNA 3QG1A 3TQCA 3WYAA 3U3RA 5EXPA 2GXUA 4BASA 5KSZA 2X2EA 4NYJQ 2P67A 3ASZA 2KI5A 4W5WA 4MRPA 1NKTA 5TARA 1OXTA 5E7IA 3W8NA 4JLDA 4EQ6A 4UKDA 4U7DA 2YVUA 4KJZA 3RS5A 1XCPA 1EK0A 1HE1C 5BQ5A 4I1VA 5J4VA 2JLZA 1Q3TA 4LJ5A 3KB2A 1ZYUA 2YWGA 3BXZA 5LB2A 2YOHA 1U8ZA 4P4UA 5FPSA 3K0AB 4F93B 1I4LD 1RVDA 1VYUA 1XU4A 5KNBA 4BFUA 2Z43A 4R2HA 5G40A 1Z83A 4YONB 2QAGA 5KSOA 1ONBA 3PR1A 4F7WA 5F98A 3L0PA 1XX6A 4DLYA 1CKEA 4OK5A 5JMTA 1G4AE 4Y0VA 4KHZA 3PJRA 3HYRA 3AB3A 3SYKA 2OCPA 4Q4AB 5D3MB 1KOFA 3DKPA 1J90A 5EP3A 4OHZA 2D2FA 3CPHA 1O87A 3NDPA 5K8TA 4UJ5A 5EUQB 3GLGB 5H70A 2IXGA 3QF7A 1H8HA 1TUIA 1KI4A 4YMTA 5KTYA 3BRWD 2GXAA 1SVMA 2WSMA 1E9FA 3RYTC 2R65A 3EA5A 1VHLA 1N6RA 1IN7A 3GD7A 1SQ5A 1VIAA 1X1SA 4OI4A 4YMWA 4EDHA 3TRFA 4XSHA 1E9RA 3NH9A 4PO9A 3K8YA 3K0AA 1KI6A 2GF0A 1B0UA 2XTNA 4LV5B 1QHIA 1W0JD 2G0NA 1SXJD 4AKHA 2JCSA 4ZKDA 1NN0A 1KI2A 1XF9A 1CS4C 4M1SA 3VKHA 4HATA 4BLTA 2D74A 2VF8A 3IIKA 4YDSA 3SZRA 1OXVA 4PQYA 4L5BA 1VECA 3I73A 1RJ9A 4B6FA 3EZ6A 2JLQA 1QHYA 3RRYA 3BBPA 4BEJA 4M9XA 3X1XA 2V9PA 4G01B 5F2EA 4CT5A 4E03A 2O8DB 1XCMA 1GVNB 4DCUA 4TWZA 4LC1A 2AL7A 3SJZA 1P75A 1LF5A 1OIXA 3K0FB 1NN3A 2YNMA 1VHTA 1VIYA 4B76A 1KO7A 3B1ZA 4C0SA 2HEIA 4AI6A 4DVGA 3GLGA 2VPPA 4BUJA 4GI7A 5TB5A 4GL2A 2NG1A 5D3MA 4DSNA 4JIMA 1QHNA 2SHKA 4HDOB 4LRWA 4C7OA 5KHOC 1ZNWA 2DCUA 1N6LA 4NYIR 4P0TA 1ZUHA 1ZNYA 2Q3MA 1KZ7B 1GKYA 1S3SA 4P4SB 3DPUA 1TF7A 2ZI7A 2WSSD 3CX7A 2ZUBA 4RZXA 4UXHA 4HAVA 2HT6A 2A5DA 3UK6A 4MYHA 4ASUA 2FPLA 1NP6A 2ZAOA 3BS4A 3IGFA 2PX0A 4LSGA 4TLDA 4B48A 3U5ZB 3FHCB 4XVQA 2IW3A 4D81A 3P1JA 4V0LA 1H8HD 2XZLA 3B9PA 1W4RA 2GNOA 1AQUA 1YU9A 1L4YA
chains in the Genus database with same CATH superfamily
4B87A 1TF2A 3REOA 4D9KA 7REQB 3O6VA 5BQFA 3UAGA 3WBJA 3S1AA 5KMGB 3D5QA 3GNTA 1GRCA 3MGGA 5TPZA 3OU7A 2QR5A 4ZT5A 3ZCXA 5K99A 3EOZA 1V71A 4P93A 3R8CA 3RIXA 4EG0A 2G80A 2HC9A 2OTCA 4BNTA 4DC0A 3AF3A 3ZWWA 1POWA 2ZYDA 3TKYA 2XITA 1QH8B 2J9YB 2PL9A 3BA6A 3NEJA 5BUSA 1YD7A 4FBMA 3HP4A 2IYZA 2SNIE 5M04A 1NONA 1G98A 2FGJA 1I3CA 2PD3A 2RHCA 3SJ7A 4FDUA 3UM9A 4D4HA 1JR3D 4KRFA 2B3TA 1T5BA 2O4CA 4ZO8A 1GEEA 4QZVA 4J9VA 3QTLA 5BNWA 3KV1A 3N86A 3MPUA 1M6WA 4G09A 1DCFA 1QG4A 4Y2HA 5DF1A 5KQMA 1V1MB 3UK7A 3LY5A 2H1LA 2JZOA 5IYZB 3AINA 1AOXA 2QE7A 2VHYA 1Y82A 2JGDA 2WSBA 4Y2TA 4D57A 1ZH8A 2XMQA 3SEFA 3NVAA 3I6MA 1COWA 2HDNB 4LQLA 1ZJYA 4XDZA 5CNMA 3PWSA 1U63A 1AGPA 2BTQB 5LBUA 1R0BA 1ZOLA 3HU1A 3BXXA 2OOKA 3ITEA 4AJ1A 2X5OA 5A5VA 2NZXA 1M5RA 3OIUA 1R0RE 1VPEA 2JHGA 4PIMA 3UT5A 5GIPE 1W0JA 1D2HA 1W0CA 1KI3A 1CYEA 3I39X 4MGIR 1LV7A 2GBIA 4MRAA 4PICA 2H2DA 3T7DA 3TUZC 3HNRA 1XZIA 4BVFA 2I33A 3B9RA 3FPKA 2ZG6A 5DH9A 1IBMB 1NJ1A 1G20B 3RHTA 4LFCB 3T5PA 2YW9A 4LGVA 5J63A 5LLDA 1CS0B 3HUEA 4GOKA 4OHWA 4JOSA 1REQB 1QGUB 2E85A 2FPPA 2LKCA 3EPKA 4S2EA 3GXBA 1O95D 3TNDA 4MRNA 2QXTA 1RKUA 1O8BA 1JH8A 4QJ5A 3P20A 4FLFA 3EIEA 2ATIA 2WQ7A 1G3RA 2UXDB 3QY9A 3PKZA 1NTOA 4GOND 5A04A 5IMSA 2F8TA 1EEHA 2OHIA 2V0GA 3NBZC 3ZXIA 1WCV1 3ZGOA 4IFTA 3OY7A 3EFHA 5J4YA 3ZDAA 3AVOA 1FY2A 1MOPA 2XKJE 3KEGA 4YALA 3UCXA 3C98A 4A73A 1CBUA 3VGJA 5JC1A 1OV6A 2HMYB 2EZTA 4HXEB 4EY8A 2H4JA 4JI2B 3ZHQA 1IG0A 4XYGA 3LBNA 2VCHA 3VHQA 1E3QA 4UC0A 5KTTA 5HK9A 5KSYA 2C2MA 3HDHA 4A0QA 1YZGA 3WMEA 4FNAA 5ICMA 1DAEA 5LXTF 5CNKA 3B9BA 4K2AA 4S1NA 3L01A 4PPQA 3NHWA 2WA1A 1HDOA 3DMYA 1OA0A 1Z68A 2CLDX 5BMVA 1A82A 4S05A 2NT4A 4OFZA 1D9XA 2CJYA 1T4DA 2QZ9A 1DXQA 2VAMA 3L1JA 1IB6A 1ZITA 2NZUG 2ZYWX 3HRIA 4HYYA 2ZJ3A 4YT4A 1LLFA 1Z07A 2G70A 1GKUB 2DQSA 3O91A 2K4MA 3E9NA 1R6TA 3U9LA 5K3BA 2WW8A 2H11A 5AD1A 1P72A 4LISA 1Y4SA 4RL4A 3OESA 1JQBA 2A1TR 3IPLA 1AHHA 1SY7A 2OHXA 2Z2YA 3CR8A 4BC1A 1HG1A 4QEKA 2O3RA 4YUZA 2VDJA 3OC6A 5HUQA 3UJNA 3B20A 1KJZA 1MIOB 2ODQA 4TPKA 4RH3A 4FTWA 4Y2JA 3WDSA 2P68A 4G67A 1X13A 2I1WA 3CF4A 3K53A 2F3TA 2XJ4A 2CFOA 1O6GA 2YN2A 3IDOA 4YTEA 2BMWA 1TVCA 2AEEA 1II8A 1X7YB 2W6QA 3C8UA 4TWBA 3WO1A 3AHJA 3OZGA 4FD2A 1QQ7A 2C5BA 4OUDB 4AUNA 4DA6A 2XYRA 4TT3A 4UBNA 4C4YA 1DG3A 2X3UA 3ORSA 5EVCA 4J0JA 1U2ZA 4Q37A 2I1LA 4Y6GB 4IGIA 1BGXT 4ZP1A 4KX5A 5DNVA 5U1PA 4KW7A 3RVBA 4A16A 4D9NA 5EIFA 1Y7IA 5JCPA 3DZFA 1BCRB 4R5HA 2RGXA 4KLNA 2EVWX 4QICA 2G5GX 2IX3A 3KKQA 4ALKA 2FQWA 3RTDA 1S4MA 3SYRA 1RBMA 1JNXX 1ZI8A 1DB3A 6REQB 3VDXA 3PFKA 5JSZB 3A9WA 3IAUA 2CCGA 4QPJC 3HUFA 1D1TA 3SQLA 3U3KA 3ZWMA 2CLFB 2VT3A 3ACCA 4J75A 5INTA 1G3UA 1Y9EA 3QVLA 3E3MA 1RAEA 3H8VA 4RPGA 3RYFB 1LTKA 5CBPA 3D3QA 4FBGA 3AX6A 1E89A 3PGLA 1FL9A 4XW2A 1E60A 3BMQB 3Q4GA 1Z82A 3DEKA 4LSMA 4MCHA 3M0EA 5IF9A 1KEEB 2OQRA 5EN4A 1F7UA 2FOLA 2V7QD 2VP4A 3CINA 4S0XA 3GV0A 1V26A 4E5MA 5DNCA 1SRQA 4B4VA 5J2UA 1EWQA 1XL1A 1BN6A 4DLNA 3RGGA 3JQ8B 3SPXA 3VM6A 3P19A 2ZWMA 3TXXA 4U8GA 3RUEA 5SZJA 1TQHA 1DE0A 2PGAA 4QBHA 2YY6A 4A4DA 3KQNA 3BCUA 3KBBA 1GL7A 1B8PA 4YJGB 5BSUA 1VMAA 1WA5A 5BP7A 1F8YA 4QECA 2BM9A 3RR2A 1Z37A 2DFTA 2FGKA 3HN6A 3OSZA 2YHUA 2AMLA 3KOMA 1KI1A 2V4ZA 1AA9A 2X5NA 3AFHA 3IQXA 4K9SA 4EB3A 3PWZA 3N8HA 1ZIPA 3ZLTA 1PQ4A 4G9GA 5F3WB 2WD9A 4DFDA 3CKKA 4O4JB 4F9GA 3IH5A 3E4DA 4M1WA 3GUYA 5HFNA 1LLDA 2REBA 2AFIA 4XB1A 4ZWNA 3G1UA 3ZEAA 2JLYA 4GZMA 2TECE 1U0RA 4WBNB 3F7NA 3GJZA 1C41A 2WWRA 1GLVA 1NLUA 4BIIA 5CFZA 3BGSA 2QJOA 5DHTA 3NHKA 3AKDA 3UANA 1U7HA 3K1AB 5I9NA 2Q4RA 4OU4A 1QCYA 1M8GA 1YK1A 2VKQA 3CF4G 4ZYZA 1VJ1A 4NZPA 3CZ4A 5CR9A 2Z30A 4A10A 4Q0MA 3NBXX 1JJFA 1T4GA 1XDSA 4ZDWA 5K3DA 4DWVA 2ZSDA 4LV6A 4AZ3B 4XRRA 1IHYA 1HX7A 1X8JA 4X95A 1KGDA 4O59O 5CTAA 2BCEA 2XB6A 4DLXA 1RPTA 4KPEC 3KXKA 1YFLA 1UMDA 2FWJA 2ZU0C 4L7QA 5JRZA 1NBOA 4JI5B 2V5AA 3PSHA 4Z9XA 3DLPX 1Q20A 4Z4GA 1JLLB 1NPDA 4EPTA 1A9XA 1HDZA 3N2YA 4F3KA 5ELXA 1J07A 3KPJA 2B4YA 2IEIA 2V9ZA 4KWTA 5EJ2A 3VU3A 4W8OA 2RE8A 1F5NA 1RWBA 3QHAA 4HY3A 5FXMA 3PFCA 2FOXA 4G56A 2R9VA 3UBTA 1OJ7A 3DXFA 4KGXA 3W9UA 3CUYA 1RJ9B 1U1IA 4YAJA 2HZBA 4INOA 2CW5A 2P6OA 5JH7F 2B99A 1MAVA 3HCDA 1W36D 3OT5A 1JQAA 1Y4DE 3SFVA 4BLUA 1MAAA 4O4HF 4EMUA 4CRWB 2E48A 1CEXA 1GQRA 4KIUA 4ECEA 3DFMA 3QLEA 4EW1A 2LCIA 4RTQA 3DDWA 1Z56C 5E8JA 5LZ8A 1KFJB 1CY1A 1P31A 1ZRMA 2AEJA 2FEAA 4ZAXA 4QOEA 2WYOA 4RGVA 4W5HA 3L1IA 2OO3A 3D6HA 1TFRA 1YR6A 2QTMA 1Y98A 1D0VA 4Y7DA 4BBAA 4C4OA 4R69A 4QGGA 4R81A 4ZJUA 1N36B 1RPZA 2YYSA 2XKKA 3O8RA 4BKQA 3ERCA 3L7CA 1P0MA 2QSZA 3L07A 3A36A 2VN8A 3AF2A 3AJAA 1XP8A 2IIBA 4MYRA 4MR9A 5HIKA 1OFIA 3KLBA 1Z06A 3HB5X 1KC1A 4HNHA 3CUWA 4Y1GA 5SZHB 3VPBA 2YUIA 1W75A 1N9ZA 1MAHA 2WJ6A 4WESA 4X92A 4TRRA 1LSSA 2I4IA 5HFAA 1S2LA 1ETUA 3HPQA 1I5EA 3JQ8A 3CXUA 1FEZA 2EBFX 3A1WA 3CRNA 1QUFA 1FRFS 5HFJA 5KNCD 1E0SA 3WHKA 1KMIY 5DHPA 1A72A 1GN9A 3H18A 1KEVA 5C51B 5IFKA 1U0TA 1FNMA 1OXKB 1YI0A 3E0XA 3CNBA 1TT5B 4B3IA 4B3CA 1MR3F 2AEMA 4LNHA 4JUFA 5JNLA 2RKBA 1QU3A 2O8VA 4LPSA 2M1XA 4HQ6A 3B53X 3D7KA 4MR7B 1K5HA 5CYPA 1IEWA 1HURA 1TVKB 4RM2A 1D6MA 1GU0A 1EFAA 2ETVA 4O6VA 4B09A 4RA6A 4RPIA 3WJ1A 2V58A 3WWCA 4ER5A 2VYND 2I4OA 1YA8A 2VK4A 5KOJB 1BCSB 4URYR 3RRXA 3U4GA 2CJWA 3K71B 2EEZA 3HFGA 3CT4A 3IIEA 3PRJA 4HKTA 5DTEA 3WNBA 4H7HA 1KHTA 3GLIB 1VLLA 1KC3A 1T9CA 5IT4A 1QRUA 4J2HA 1RTTA 3AO0B 3L0YA 2D5BA 4H7FA 1T1SA 4BJ1A 5C35A 2GNAA 1U7OA 4I3FA 1X3LA 4XVRA 5JVDB 1XZPA 3K1JA 4EKYA 2BAGA 2F67A 4GKJB 5D8DA 1P6UA 3GA5A 4M54A 5AQEA 3WGVA 1WR8A 1FFWA 2OAEA 5EJMA 3HLKA 1PQWA 1GZDA 2YMLA 1SXPA 1U7ZA 3AWDA 2B8TA 3RSOA 1FFXB 3A27A 1V9CA 2J3IA 3H2KA 2OV4A 4S2UA 2B8JA 3TQRA 4HNGA 4MVJE 5DCYA 5LNK1 3ROFA 4BMSA 1AC5A 3Q0IA 1APBA 1UBCA 4BV8A 5KTRA 1B14A 1Z33A 2C77A 3GFTA 2EKLA 4MCAA 2BRUC 1WBDA 2HQSA 2Q4BA 3BJMA 3KPVA 4JYMA 3W6ZA 4L9WA 2WJJA 1FNBA 2XY4A 2J0SA 1OIWA 1XRRA 3T4PA 2OZEA 3G6KA 1BE0A 1UJ2A 1MO2A 4ZVQA 1WZUA 3AUXA 4DTCA 5AMXA 1YJXA 4JUCA 3IXQA 3P2EA 5CYOA 4RUKA 3ZDZB 2CK3A 3HZZA 3W79A 1AKUA 3I2JA 2H4YA 1GPWB 1EBFA 1AQJA 4P86A 1UL1X 5C1OA 4P82A 5CP8A 4LGCA 4WBSA 2R85A 3HR8A 1XQVA 1KOLA 1CQJB 1XTTA 2EQBA 4KFUA 1OZAA 1IM8A 4MEJA 4A3SA 4A15A 2Z83A 2B6NA 4ILEA 1FFGA 3PHJA 3UUGA 1UJNA 4LZJA 5BVGB 4RF2A 4F5EA 2HCTA 3PA6A 4R51A 1ZXLA 2Q1TA 2D1RA 1KO1A 2PZJA 1NQTA 3G0HA 5A7FA 4Z4CA 5FO0A 1OT5A 4BWVA 3CVJA 3MILA 3QYJA 4IH9A 2H4HA 5COBA 1E1RD 3I34X 1TU4A 1YB2A 2EZ8A 1VLVA 2FKAA 2QR2A 3A04A 3O4JA 5LDDC 4DJJA 3ADDA 2DTXA 1X1TA 2AD5A 2QP4A 1M54A 4XDGA 1G4HA 1M5TA 3ROGA 2CZGA 2GN2A 3LM8A 3VH1A 3FSGD 4JI8B 2P9ZA 1S8AA 3S1SA 5F77A 1IIBA 1X8XA 2Q5CA 1DEAA 3P71T 1CQXA 2C9CA 3Q41A 2W6MA 1E3IA 3VZQA 1N57A 3OI7A 5DNEA 3WJ7A 3EZ7A 5HE9A 4GGMX 3FYUA 2JIMA 2YZKA 1BD4A 1V95A 3L05A 4WECA 3UJ7A 3CZPA 3N2ZB 3JSAA 4Q9AA 4N3BA 2O0LA 3B6KA 2G1PA 4D5EA 2P0YA 3EC2A 4FFRA 2UU9B 1J0BA 2ZJZA 1NVVQ 5C3MA 1ZJJA 5IC5A 4MQMA 2ACEA 4XD2A 1A9OA 3S2UA 2FQXA 1SHLA 3VO8A 3IUPA 2AHRA 4EY6A 5IFLA 4JEHA 3MCWA 1FDSA 1CIJA 1I2AA 1IHDA 1N1EA 1LQTA 4MJXA 2GGSA 5JSHA 3VOSA 4YGYA 2VTDA 3ILSA 1YKSA 1KSFX 2HUPA 3AIIA 3NANA 4OK3A 4YO7A 2AFIE 1QGAA 5BWLA 3S44A 1H3FA 2BFCA 2V7BA 3HWWA 3S99A 4JLNA 4WKOA 3VR5A 2WG1A 4LYEA 2W9XA 4RVCA 4JS0A 1R0KA 4D79A 2ODBA 1ZPDA 4ILKA 2YW2A 3W6PA 4B3DA 4AY5A 4DAEA 2QPAA 3QU4A 4M60A 1C4KA 3HJUA 5HOEA 3FWKA 4R1MA 2V9CA 2PQ0A 1UBOS 3OE5A 1E99A 2NOAA 4I3GA 2X77A 2WOOA 1PFKA 3RV3A 3X1JA 4LYYA 4BATA 2FPUA 2XT9A 1NOKA 1D03A 1QVZA 3JRXA 2A0UA 5K0NA 2ZITA 1O5TA 3ITNA 4TKUA 1E6EA 2IU4A 2WTMA 4F6RA 2G5PA 2QX7A 3KLNA 3QHPA 4JU8A 1W85B 2X6TA 4XWOA 1LRJA 2B61A 4WY8A 3GOHA 2Z4RA 5CJ2A 5KNDD 3AVTA 1N9GB 5G1NA 2FPRA 4C6HA 4FHEA 5JH7A 1IBCA 4DZRA 1BVHA 3F0TA 1FFAA 1S96A 3GGJA 4A0HA 1R4MA 5AVXA 2VF5X 1E18A 3FOWA 4CCYA 2ZWPA 3DV9A 5CVCA 3DP7A 4BX8A 3H4IA 2J1LA 4C3ZA 1FP2A 3PD1A 4BMXA 2X8BA 1BQ4A 3MSXA 1RP1A 4MDFA 1M0WA 2AFHB 3OPYI 4MOWA 3RLFA 4D1YA 4CVNA 3C5CA 1OTYA 1XFDA 2C8JA 1RC8A 1ZCBA 4GMHA 1CY2A 3OP1A 4PLZA 1WV0A 3ACDA 4YCDA 1NJ8A 3E7FA 4CM6A 2WZBA 3FCCA 2ZAMA 5KWIA 2CEKA 3CH5A 1ZVVA 1Z6PA 4DV5B 1QHEA 1N2JA 2P6PA 4IKOA 2OXTA 5BV1A 3O21A 1IJFA 3BXHA 1M83A 3HJHA 1UPAA 4DR5B 3BTOA 5E95A 4Y18A 3SXUA 1HNWB 4ID3A 2BE7A 1R0YA 3DTTA 3UBMA 2A0WA 3ECCA 1Y7LA 5CG2A 1XB2A 2WNIA 3HXTA 1QM5A 3D2BA 2ZUDA 1TE2A 3O2NA 1AKYA 3P9YA 2GK7A 4I81A 4CIXA 2B21A 4LDQA 2TMKA 5FWDA 1GXSA 4M0LA 1NQWA 1QR2A 2G9RA 1LPOA 3DOOA 3EZLA 2FV8A 2H7YA 2QU8A 1F1JA 3KVYA 2R5NA 4ACBA 1KJYA 1Y8ZA 3ONDA 2NO9A 4F9TA 1KQOA 2ZBQA 4LCBA 5MN5A 4BNMA 5E8RA 3L0CA 4UTXA 3EVTA 3W8RA 2GK3A 3GT4A 3RGWS 1HFEL 2EJBA 3KXIA 3QFFA 1GADO 2QX4A 3VKWA 1BEZA 5AQ1A 1W5FA 5LP6F 4AQDA 4C43A 1OTHA 5FF9A 5B3JA 4KDEA 3IFSA 4AC9A 1I1QB 2BKUA 4G6ZA 4AWBA 2DQ4A 4YB8A 3VR4D 1ZWKA 1HYQA 2AXEA 3JXEA 5KYUA 1CQZA 1NAHA 1QHHA 3VPAA 1E9VA 3CZAA 1C1YA 2ZBRA 4L5JA 1WPGA 1M0TA 1EWVA 2E4YA 4OQXA 4C08A 8LDHA 1WHSA 3K7EA 4GGPA 3MIZA 3QITA 3UWPA 3I5UA 3UA3A 2X5JO 2R6R1 2IZ6A 4DLUA 2XTZA 3TRKA 1II0A 2A9FA 4CR6A 3U3XA 4ND3A 1YQGA 4IOLA 5EWMA 2BELA 4MR8A 2EJVA 4NG4A 5FBQB 1SVIA 5JDIA 1R2QA 5L3ZA 4BE4A 2FOIA 3RIEA 4IHAA 3ZVNA 3OUUA 3ITDA 3SM9A 1B43A 1PVDA 4OQFA 2O7QA 4MUNA 4Q82A 1QRRA 2ODTX 3D02A 1NUAA 4TGLA 4NBRA 3UYKA 2R0QC 3THWB 3BB3A 3H9UA 2L18A 1C50A 4MWTA 3OQBA 4KIFA 1PJZA 4PXYA 1A3CA 2YVAA 2VJMA 2ZGVA 3JQFC 2QBYB 3CJTA 2J5QA 3TLKA 3IR6A 1H23A 3OZTA 1Q74A 3QIVA 4FCWA 1XTQA 2XBUA 3ED5A 3PDHA 4LBYA 2QYTA 4M7OA 2FWNA 1ORDA 4BUCA 4URVR 4XWKA 3CGGA 4GM1A 5BR7A 2XMGA 3ER6A 1PWHA 1PZEA 2D8AA 2X1MA 5GAJA 2XCSB 1T2CA 2VJAA 3QKUA 3CSUA 2QY9A 3SC6A 1OYOA 2VP9A 2O5VA 2KW5A 1DADA 1NDQA 1CQPA 2FXVA 3LIPA 4IH1A 4JBIA 4Z9AA 1OMOA 5DXJA 3TGWA 3VPFA 2RGRA 4CI0B 3MTBA 2IT1A 2Q3JA 3FDJA 3EXFB 4GLBA 1FF9A 1T35A 5E7MA 3GBVA 3C4QA 2JD2A 4WQMA 3AJ8A 4I8IA 1AV7A 2YASA 1EHIA 1C1XB 3DO5A 4W4TA 3UK2A 2A4KA 5A6VA 1AY0A 3O4HA 4H0CA 2QKYA 4M9SA 4POAA 4ARUA 1RS0A 2XDQB 1UKCA 5DYIA 2A33A 3W4JA 1T4CB 1XLWA 4RY0A 1VBKA 4EWLA 2CDAA 1DSSG 5DSTA 3RSFA 3VR5H 1IDN1 4BQOA 4F4FA 3E5RA 2IV7A 3N7UA 1XP5A 4LXQA 3KKKA 4HXFB 4RD6A 1QLJA 2GK6A 2EP7A 1ZC3A 3LV8A 3N58A 3L6CA 5DWVA 4GX5A 2WJVA 4MULA 4QWMA 3L2OB 4CTOA 3PGJA 1SCNE 4E07A 3FDZB 4IVQA 4ZI7F 3WGIA 1J0EA 1JQKA 4Y1RB 4RDIA 4CPDA 1DC8A 1XRLA 2HYIC 1C7IA 3L5KA 1PJTA 3N76A 1AMOA 3SZMA 3NBAA 3N9IA 2Q5HA 3IMCA 1ZNQO 4KQ6A 3ZQKA 3DL0A 3VYUB 2OQ2A 5AOBA 1SB8A 4BGDA 1L5GB 1S7GA 1V4BA 2HSEA 2GM9A 4P4NA 3LTEA 2ZB3A 4QBKA 4Y6SA 1UM8A 1O9HA 1ZEMA 1EGAA 4Q4HB 4BQFA 3TMKA 2QYSA 3UVEA 5TY0A 4F38A 1Q50A 1CZOA 2VJLA 4FWIB 1KJWA 3G49A 4PGFA 4BNUA 2OV6A 5IEBA 5EYPB 4M0EA 1W36B 4XGQA 4EECA 5ILGA 3RFFA 4EJ6A 2DU8A 3CURA 4J1QA 2ZREA 3EGOA 4CFSA 1JQ3A 4TTPA 1PTJC 3BWDD 2JGNA 4WNAA 3ZTWA 4ESOA 1NYQA 1YV9A 3OA2A 5ERXA 2IH4A 1ZD3A 2RJNA 3VNRA 3KQPA 3H5OA 1XTRA 4JVOA 2Y1FA 2QN7A 5C37A 1GTG1 2QRGA 1JHXA 4U6NA 3QF4B 3ZXUB 4HAUA 4WPGA 2Y1KA 3C15C 1O4VA 1WOMA 3L9WA 4BFWA 4CMIB 4GPZA 2YWXA 1JEQA 4ALNA 2NP7A 2DB3A 1O0BA 1ZIYA 1YR7A 2GFHA 3HI6A 1DIHA 1UT5A 3I8XA 3QVVA 4MRMB 1HDCA 1L8XA 5EJAA 4YN3A 2FSGA 2PJDA 2OLJA 3EAQA 2OK8A 3Q15C 2GF2A 2FMXA 3UEOA 1E2EA 1G8MA 5D6NA 4QUAA 3TWOA 3UMVA 3AUSA 4BN4A 2YXEA 1M2KA 3EZFA 1KY3A 3L8HA 4PG4A 5DV9A 1CETA 2O2HA 1ZFNA 4IG9A 5FI3A 1E3LA 3KUDA 1QB8A 1QHGA 1JDTA 1OLOA 3WISA 4RJTA 4HZGA 1XJWA 3LW7A 1LDEA 5AIBA 4D9GA 2IHYA 3C1AA 3TCNA 3KX2A 1BFDA 2NUPB 3NDIA 3WLOA 2QUHA 2R96A 1LK0A 4JMPA 1XQ1A 1CC1S 1HGXA 3H5IA 3ZHZA 4E2WA 4P2BA 3ZZNA 4X66B 4F4IA 3IV9A 3CLUC 3EXEA 3KVVA 3PQ3A 4D3DA 4YASA 2W2XA 3CS3A 3LCRA 4R3UC 4ZEOA 3R6DA 3T35A 3BD8A 4OOEA 4CV0A 1NDUA 5KNBH 2XUFA 3GYBA 1TMKA 3PHGA 4X8MA 5K5EA 5CCBA 3GLFB 1T9BA 3O0TA 5A5EA 1WS6A 5IM4A 5AH0A 2ZZNA 2PGIA 2DPHA 1GUAA 2BH9A 3IO3A 1WCIA 3RS0A 1U4OA 3L7JA 4DDVA 4OQDA 1DXOA 1NVGA 1Q6ZA 3SFTA 3SHFA 1MN6A 1DTWB 2E4UA 1M76A 2FR0A 2GH1A 4RIFA 1Q0QA 2CEAA 4TYNA 3I83A 4XWAA 3W6UA 3BA1A 4YYZA 4XWYA 4WESB 3PNQA 4FLEA 4FYJA 3H16A 1HL7A 1PR4A 1U3DA 1JA9A 2YJTD 1BS2A 1TEHA 1CDZA 2QNBA 3NHSA 1KTVA 3R76A 4DIBA 2XXBA 4P3KA 4NCNA 3VH4A 4LZPA 4IO1A 3WWEA 4OKSA 1G4UR 4YRRA 2P65A 4EA6A 3I23A 4BX2A 4EFLA 3H2HA 4C78A 4PHFA 4NH4A 2K5UA 2JIPA 4KR9A 3RV4A 2KLHA 2IYEA 4LVUA 1TM4E 3OE1A 3VGPA 4PHHA 4DXAA 1C3LA 1YZLA 2AI2A 4PCLA 1S7CA 4PCUA 3ANSA 5KSPA 3IP3A 3ZWKA 4MGZR 3L93A 2IUSA 1FDOA 2JL1A 4LXTA 3DKVA 3HFRA 1YI8A 1NGSA 1RT9A 1T8PA 3ELDA 3ZW7A 4YXFA 2YWBA 5FWXA 1SZCA 4Q24A 3EJ6A 2DC1A 3UJCA 4ER7A 5B64A 1YH3A 2BEKA 5CIYA 1KDOA 1ZESA 1GPUA 1Z6YA 4I5FA 4MUJA 1DC4A 4ZVOA 3MNFA 3ZDDA 5EPUA 5J5VA 4OLHA 4O63O 2N42A 3LQ1A 3SVZA 1E1LA 3CX4A 5EZSA 1IZ7A 2AOVA 5FI1B 1CQIA 1EZZA 2ZANA 1SQSA 3AI7A 4C0BA 4ZDIA 3OY2A 1G6Q1 3FLAA 4MQ5A 5ELMA 3CR3C 1DAMA 1H6AA 5JD3A 2YXPX 4CCAA 5CD9A 2NXNA 3ADCA 5ELLA 3R7FA 4MZXA 3TQOA 1I5OA 1MU0A 4JXXA 3K92A 5DNWA 3V8RA 4DVJA 2J4FA 3IMKA 2YRXA 3DBHB 2Q5QA 3ZIAD 3C3BA 2V7QA 5HQTA 2MOKA 5LZ2A 2HPAA 4IQFA 3MUOA 3QXSA 5T3UA 3G5TA 3U81A 2AT1A 1IHXA 4OMUA 1TA0A 2I80A 3B8HA 3H5NA 4II3A 1J00A 4MI6A 4WXHA 3NNSA 1E9DA 2YH2A 3C3KA 2QRQA 2FWPA 3EF3A 1EFVB 3HJNA 3UJ8A 1Z4NA 4IG4A 2ZTHA 3PQ8A 3BWCA 3QEKA 3BGVA 1MVLA 3ESDA 3ZWOA 3BE5A 3QLTA 4IV8A 1MB4A 3C5EA 5LP6C 1ODFA 1J09A 5SV2A 4EA7A 2SKEA 1BXZA 5C1DA 3GPDG 3PXXA 3LT5A 3KAKA 1DEXA 1PSZA 3LC1O 4RHYA 4EKEA 4JLUA 1U80A 3FPSA 4RZSA 4M0UA 2PIAA 3IOBA 2VTBA 2FMHA 3DZHA 4EHLA 3DE5X 2NAPA 3I6BA 3OIVA 2A3NA 4HH3C 4TT3D 4PLFA 1UJBA 4AZVA 3HZHA 4GPTA 1YSCA 2VDPB 3IIIA 3RSCA 3GT7A 3QBEA 4Q3LA 4DR6B 1RWOA 1UKYA 2AC4A 2GR9A 2FLWA 3L92A 3T61A 4CQMA 5A4DA 1K9SA 1NF3A 5LQUA 1ZQ1A 3L8FA 1BW9B 4YAWA 1EXWA 3E5NA 1T5OA 3VYWA 4DV7B 1HE8B 1UBUS 3RE1A 1EG2A 1YDMA 2MSKA 1NLYA 1THGA 2QDKA 3AZOA 4DNFA 4DNXA 2HJGA 3Q3CA 3K9HA 3FPJA 4JVNA 1LJ8A 3QEMA 2FE1A 3I0MA 4ZRNA 1U2EA 1DKLA 5PNTA 5FRDA 3WKCA 2D4HA 4UOZA 3KZKA 1E2PA 4RTSA 3CNLA 2NQ8A 3CRVA 1B7GO 4ENSA 1YQWA 3HQ4O 3B78A 3GXOA 4Z86A 2WQZA 3A1VA 1M2WA 2OFFA 3E7PA 2NU8A 3R09A 2WILA 4N9WA 5EXEA 4CUKA 4YAGA 4TXMA 2GCNA 2VHJA 1B0AA 1I2BA 1P1BA 4IJWA 3B3FA 5DX0A 4DIKA 4MGEA 4UNNA 3PCXA 5LQMA 5I9SA 1X1AA 3V42A 1KZ1A 3ZCUA 2VZ9A 4JQYA 4KMMA 4G5QA 2JA1A 3BMOA 4TM7A 4OKNA 1P80A 3O8BA 5AHXA 1EGQA 5ITSA 1PV1A 1AUXA 2PS9A 3HBFA 1QSGA 4LOHA 1E1DA 2XNSA 1TUBA 1QNLA 3D6TB 2KBEA 4BTEA 1T1EA 1L4UA 2JCGA 2E4ZA 2HNBA 3P2JA 4IM7A 3ZKAA 3SNHA 2REXB 5KEIA 3NIBA 1TUGA 1Z5NA 2IZZA 4FMDF 1LI7A 5SYNA 1H2XA 1EINA 4O3FA 3NEYA 1KR5A 5EYPA 4CLXA 5IRCD 2I6UA 5T3YA 1ZSNA 3IHTA 3KG2A 3WNDA 4A5OA 3C5WP 1DIGA 2V1XA 1L5SA 1AS0A 3FR8A 2X7XA 1SD1A 2IYVA 2YXLA 3K1ZA 1U90A 3MPOA 1Y5NA 1E2NA 3CZMA 4P9NA 3OF5A 5DOZA 1RYMA 2C5GA 3HDJA 3PYXA 3JD2A 2P4SA 3KR2A 5FPTA 2BR5A 5HE8A 4B4UA 4HN9A 5CLQA 4C3UA 2QTLA 4O2BF 4DM4A 5KTPA 4DV6B 5JZ9A 1NOJA 3PEUA 1C1DA 5JPCA 1BX3A 3MJDA 4C0KA 3W5JA 3U4QA 3WB2A 2B0JA 2VRBA 1HSOA 4FB4A 2Y1XA 2MT9A 4K3VA 1IBKB 1EB8A 5JNUA 3ZZMA 4FZ3A 2QLTA 3MTEA 4LHSA 2AJDA 1H85A 2C5HA 2YINC 3EF1A 2XGGA 3PZRA 5K3AA 3LDFA 2FSHA 2QAGC 4NDNE 5E7QA 4YMUA 5HM6A 1FJGB 3KQSA 1XFAA 1H4VB 3V5NA 1NL3A 1AQIA 1Z29A 2JJ2D 4WXPA 2OORC 1RM5A 1SUPA 2WJHA 1OZFA 3L4EA 2DWPA 4TXJA 1NJ5A 5G0SA 4BKUA 4C06A 2VK8A 4N7BA 1C7QA 1MDFA 3VNQA 3OE7A 1PL6A 4PV7A 3WYFA 3HUUA 3GMIA 4MINA 4POOA 6LDHA 4MUGA 3IT1A 1ZD9A 2W2OA 4HGOA 3CVXA 2WV9A 3UAOA 1E6MA 1TLFA 2PEZA 3CWZA 1LDNA 1P62B 1MRZA 3HY4A 3HXLA 4DQKA 4P35A 3ZDYB 1OIVA 2Q3CA 3QRWA 5HMLA 1ZA1A 4RTKA 2RG7A 5JS2A 2O7NA 2QIOA 3Q7SA 1WZEA 4HXGA 2PUVA 1L5FA 3S2FA 4DC1A 1BIFA 1WY5A 2Q6TA 2RKWA 3VDRA 3UMGA 1RSZA 4GKKB 3QU2A 2AV6A 1L8OA 4YY3B 2NVUB 2XA1A 2HY7A 3T0FA 1EVEA 4BECA 4LXUA 2HMAA 4C7JA 3FUXA 3B13B 4H77A 1UBGA 1KJ9A 3LPMA 5HIMA 2SICE 3GJQA 3SZUA 4F5DA 3IS3A 1DL5A 1ID1A 1ULAA 1SU4A 2EZ4A 4WMLA 4A91A 4AWXA 4CF7A 4V0KA 3S70A 1EVQA 1S4QA 3UT6A 4QYSA 3TLGA 1GGJA 1Q22A 4JFAA 1JFFA 4A2WA 3S68A 3WA6A 3WTCA 1KEEA 5J5AA 1FTYA 3RSGA 3FTCA 3SGLA 3PJFA 5I7EA 3DXYA 1G64A 1KBQA 1TQ2A 1TZBA 2GDJA 2QK4A 3D8RA 2CL7X 4FSDA 3TINA 1SQFA 4QU9A 3U7EB 4C2UA 2BKXA 3GG9A 1RQNA 3SMVA 1Y1KE 4FS8A 2A57A 4GSLA 1Y1PA 3P9RA 4UTRA 2ZE5A 2G1KA 3T54A 5LD2C 1LS6A 1SU6A 4A8PA 4RVOA 1DKPA 2BZ0A 1NBHA 2ZKIA 1QWOA 4HZUB 2JFPA 2Z56A 4TQGA 4X8HA 5KC9A 3GDWA 3LAWA 4HLCA 5EKUA 3KSBC 2W42A 4J07A 5AJXA 5I7RA 1FJXA 1U7PA 4X93A 2FG6C 2ZWIA 1L7XA 4JBGA 4MPPA 4DOMA 3TIXB 3A4IA 4BPBA 4G4GA 4AO8A 3FLEA 2NTJA 2QQGA 1WUKS 1GDHA 5IDYA 4QOJA 3NHJA 3TSOA 1FK8A 3CU5A 4U9UA 4ZT2A 1OUMA 2QN3A 4I1YA 1EB9A 2R68A 1YAHA 2VIIA 5IJ0B 5BPHA 5EIBD 2IVZA 1SM4A 3IIMA 4XGRA 4B45A 4HEHA 1OKKD 5IDXA 3LCJA 1E5QA 2ZRKA 1H2AS 1Z8NA 2PUGA 5CH8A 4J1SA 5CB6A 1JHMA 2VDRB 1YUMA 4AIRA 2VHZA 4JN6B 4QNNA 3UJPA 3WKBA 4D6XA 3PRKE 2JZCA 3TZLA 3RFCA 2XR1A 5LM3A 2JLBA 1A7JA 3ZHXA 2O06A 2C04A 2AK3A 2A5LA 1K0FA 2PRSA 1X1RA 3BZWA 2OCGA 4Y2SA 3ZDQA 4OXQA 4BJ6A 5KPDA 3EHEA 4CKWA 1FSGA 1AUOA 5CT8A 3J81k 5AI8A 1IN8A 1C3XA 4OU5A 2JKZA 1QMGA 4K8OA 2OKCA 5GY7A 2VH2A 2HCFA 1JFSA 5A9SA 1GR0A 2A30A 2VAPA 5JV5A 1KQPA 3DQQA 2NZ2A 3NV9A 5FUBA 1GCUA 3VMMA 1V2HE 1EVLA 3LBHA 3KDPA 3IHLA 3ORHA 3OT1A 1II8B 1X7YA 1GNLA 2O2SA 2OD7A 3DC7A 3ZX5A 4H31A 2JZNA 3L43A 4MIKA 5AXAA 5JISA 2KB0A 2NO4A 4YJFA 1NXQA 4BNWA 5CAEB 1GQQA 2VHCA 1N7JA 1P77A 3FWZA 4Y6PA 3QP9A 4C1NA 2DQYA 4LC0A 4I66A 3I04A 3V4OA 2P0EA 5ARCA 3HHPA 4OKIA 1BCSA 3S27A 2RH4A 2HWKA 1E1KA 2QF7A 3CUUA 3VV3A 2R4UA 3M9WA 1MORA 1SUDA 4UMEA 4Y2RA 5G1PA 2XVAA 2O5RA 2PAFA 2RH8A 1DINA 1FDIA 3KLPX 5TS3A 3ZU4A 2CB9A 4DMMA 4AO7A 1YI1A 5EUCA 1CUEA 3IAS1 4MSUA 1QYVA 1R4AA 3DMPA 1FU7A 4NABA 2ZYVX 4YP7A 5IWAB 2CVZA 2WF7A 4YC7A 5EIAA 2P4EA 3N2GB 5C8VA 4ZOCA 1BOOA 2AWNA 4HGQA 4ZOBA 5DASA 4BWGA 1L5WA 3P27A 3ZWYA 3N8IA 3GNLA 1TO2E 5K0JA 4BP9A 3D2CA 4JEMA 1Z0DA 3R2JA 2A2ZA 3IC5A 3R7SA 1RQPA 1TAGA 5K0CA 2G5TA 2P27A 2AFHE 4IIVA 3F6YA 3HRHA 4WHMA 4HDAA 5ED0A 1ESNA 1H6CA 2VPIA 5JCJD 4LZOA 3CN9A 1DDGA 3GB9A 2VWGA 1UK7A 1CUFA 5CT9A 3W78A 2C2YA 2QT1A 2QMEA 3J7AC 2WFAA 1XU7A 3EF0A 2K6GA 3KVRA 1Y1LA 2PWAA 4JYAB 1O2DA 3LBAA 3PUWA 4PLPA 3B5JA 4R2IA 4TTVA 5C32A 3K32A 4Q3NA 3G0GA 3EGEA 1Q7GA 5IK2A 1IZ0A 2W8ZA 4D82A 3PXGA 13PKA 3W2HA 1AS3A