3PEYA

S. cerevisiae dbp5 bound to rna and adp bef3
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
391
structure length
391
Chain Sequence
b'AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
molecule tags Hydrolase/rna
source organism Saccharomyces cerevisiae
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
total genus 144
structure length 391
sequence length 391
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA02
1KNXA 4E07A 4TL6A 1YZTA 5AUQA 3K0AB 5J40A 1CF4A 4Q9IA 2CHQA 4FMBB 4F38A 2QMUA 1WA5A 3AUYA 3SHFA 1O87A 2PLFA 1GITA 3NC0C 1GL6A 1X86B 3NG1A 1IN8A 4PAMA 2J87A 3OZXA 1G8HA 1ZAKA 3AB3A 2JASA 4LJ5A 2QP9X 4Q7LA 2WWGA 1ODFA 2PL3A 1KO1A 5E7IA 4JLMA 1F48A 3L0OA 3KUDA 4F7WA 1Z06A 2NTYC 3FHCB 5D3QA 1S4QA 5CITA 2GJKA 4GP7A 1G19A 4BPBA 1OXTA 1Q1QA 5CK5A 4D82A 1VG8A 2ZREA 3ASYA 1N6KA 4M21A 3WP1B 3CZQA 1T5IA 3RS3A 1SQ5A 2O0HA 2J7PD 4OL0A 1KI9A 1ZM9A 3BC1A 1S1CA 4WAUA 5JJLA 2VLIA 4KFTA 4Q9KA 3NHAA 1ZMXA 3V9PA 1I4LD 2JGNA 1G64A 1R0ZA 4FCVA 2QGZA 3SJZA 1JXMA 3GPLA 1XD9A 4JL5A 1OIVA 4PSVA 2CMKA 4WIAA 1XEXB 3LA6A 5KSYA 2J0UA 4EFMA 4W7SA 1L2TA 4IFEA 4RSGA 1K6MA 1NP6A 2GJ8A 3CW2A 1FW6A 3CUEF 4TLEA 4TLAA 2H1LA 3MJRA 1OFIA 3DHWC 4PHFA 1M8PA 4A82A 5HKKA 5FBLB 4Q01A 1FQJA 4QJ3A 2A5DA 2IHYA 2EYUA 1T6NA 4OHVA 4TMVA 1OB5A 3PV0A 1XXHA 2P6NA 2GCNA 4B3FX 4CEIB 4B2PA 5SZJA 1Z5ZA 2XNDD 3T5DA 2YZ2A 4KSCA 5FOVA 3AP2A 2R6CA 1AZSC 1Q57A 3EG5A 1KSFX 3CWZA 3PXGA 4Q1DA 3GP8A 3NXSA 2NO6A 4BGDA 1R5NA 2WWFA 2EFDB 3IHWA 2C77A 1VHTA 1WE2A 4DB4A 1KO7A 2ZUCA 1OHHD 1NG1A 3A8TA 2REXB 5B58C 3LVQE 1P5ZB 1W4CA 2YWHA 3KKPA 5HE8A 3QF7A 1GIAA 3NDBB 4LPSA 1U0LA 3K09A 2GEVA 3O8BA 5AUOB 2OILA 1OFHA 3A1UA 1QHIA 1GFIA 2L0XA 4KHZA 2QROA 3JZMA 3EWSA 5F9HA 4M1MA 4PC6A 3I61A 3UANA 1XTSA 2HT1A 2V7QA 4HLQB 1TF7A 2REBA 3AVWA 1S8FA 4HZIA 2XTZA 2R6DA 2WSSD 1U81A 3UMFA 3CNNA 3LBHA 4XD7D 3THXB 2FH5B 1CR2A 4F92B 4HAUA 1CJUC 4V02A 2FFHA 1FX0B 4ITRC 2ZR9A 2B8TA 3HPRA 2RGAA 3CLVA 4R7ZA 4BLQA 1N3BA 1RZ3A 2VHJA 3RYTC 2BEJA 1J99A 1ZCAA 3NBFA 3W9YA 3DO6A 1TEXA 1ZUIA 1P75A 2ODBA 2ZI6A 1J8MF 5CJPA 1UBEA 3DKPA 4W5HA 2IWHA 1Q44A 1NMZA 3U7FB 3DL0A 1C1YA 2C95A 4AD8A 5JBQA 1V43A 4LDJA 1EESA 4GT1A 2X77A 4UNPA 1OJLA 4U02A 2XITA 3VQTA 1KI2A 1U8ZA 4DCNA 2QBYA 1Q20A 3DM9B 4ARZA 1G21E 1Q3TA 2PLRA 4Z1MD 3WBJA 3U3OA 3BGWA 1GZSA 2XZLA 2ZRLA 4YXWA 1ZM4A 1EG7A 2MSEB 2ODNA 2UVQA 2BKEA 2W00A 1HV8A 1WBDA 1SVIA 5EP2A 2OHFA 1UDWA 3VU9A 4D0NA 4B3CA 1N2CE 4A2PA 4AYWA 5EE3A 3W6PA 4QXAA 4X8LA 1UKEA 2IUUA 4R2IA 1JI0A 3B85A 1D2NA 3M0EA 1G3RA 1OIXA 1ZINA 4HB2A 1EGAA 4DCSA 4HAVA 4B34A 4XWOA 1IJEA 4CEJB 5FH9A 4W5WA 1G4UR 1X8KA 3TK1A 2MMCA 4B2LA 4DLYA 4EJSC 2ZYUX 2CE7A 4WOPA 1SXJD 3MGCA 3U3MA 5C18A 2LKDA 3C5CA 1E9BA 2YINC 4NH0A 3BAFA 1RC8A 4M4SA 3IGFA 4ZIRA 4V0MA 2F1JA 3UG6A 2WV9A 2ATXA 3WMEA 4IOJA 1G3IA 4RKEA 2CBZA 3OIVA 5EZ5A 1P60A 3F0TA 4MYHA 1CS4C 2ZI5A 2NOAA 5D3MA 3GLIA 2H92A 1U9IA 3NH9A 1DS6A 2BMEA 2QSZA 3QBVA 1SVLA 2CK3A 2QAGA 2VHQA 4HLCA 4MRVA 2A5FA 5AWFC 4M1OA 3ZZTA 3KJGA 4X8MA 1M7HA 3LDAA 1Z6AA 4KVAA 3AP3A 1R2QA 3W5JA 4A9AA 2P3SA 2WWYA 1N6NA 3KB1A 4EIWA 1W0JD 4OQFA 2QRZA 1XP8A 1ZVQA 4IDNA 3VKGA 2GHIA 3LBIA 1EWQA 1R5OA 2VSFA 1NN0A 5K8TA 3PEYA 4G5QA 1YRAA 5EP3A 4NYJQ 1EFRD 2JIZD 3HU1A 3UG7A 4DCTA 5JHHB 1YVDA 3QEJA 2DHRA 4IJMA 1G16A 1N0WA 5G40A 2RMKA 4LSGA 4UQOA 2ZXUA 3RS2A 3QKRB 2O8DB 2H7VA 4QHYA 1EFRA 1XWIA 2FPMA 2JIZA 1N6IA 1YR6A 3G5UA 5LB2A 3UATA 6Q21A 1EFTA 3D6TB 1NSFA 2QTFA 2RGCA 1HQCA 5G3ZA 1XCMA 4A92A 1G6OA 4E22A 4DUGD 2CK3D 1WCV1 2ZJBA 2P6UA 3AF1A 1G7TA 3B13B 2J7PA 4TL8A 2WJYA 1VTKA 4AKGA 2GWHA 3H4MA 5TY0A 3CF0A 4CT4B 2FEOA 2YHSA 4IDPA 4Q7JB 2GXUA 1NI3A 1PVOA 3FFAA 4GZLA 4DUGA 3P26A 1SVWA 5CIQA 1X1RA 5KDLA 5DGXA 2JDID 2VHTA 3CRVA 3T34A 3TQCA 5L3QA 3FE2A 2OBLA 5E4FA 5CYPA 4Z8YA 3FYHA 1KMHB 4R9UC 2R8RA 1Z6TA 2KBFA 2PMDA 4PPGA 2XSZD 4NMMA 1PLKA 5LBIA 1M74A 1SVSA 3OEHA 1L7VC 4JMPA 2P67A 2QM8A 5EUQB 2PJZA 5CLLA 1KHTA 2H17A 4AKIA 1RIFA 2BM1A 4TMZA 3GLFA 1ZC3A 2C98A 3CPJB 3VKHA 3QXSA 1SXJC 1VDZA 3CRQA 1T0HB 1KK3A 3U6BA 2F7SA 1G291 1VKJA 3OEHD 4QKQA 1QHSA 2GEDA 3T61A 5JJIA 1E2JA 4DLVA 3EPKA 4CEHB 1IONA 5C4MA 2IF0A 4QGGA 5FL7A 4IDHA 1HEIA 2WJIA 4K8OA 1MKYA 4B76A 1BO6A 4CEHA 4EDHA 2FWRA 4KCGA 1Z6GA 1W5TA 4HSEA 2QAJA 5J4KA 4OQLA 1SXJE 3W3AA 3R8CA 1DAMA 4NCJA 1AS2A 1RRFA 5FI1B 4PHHA 3THYB 3GJ4A 2IYQA 3U3RA 2A7QA 1XB2A 2ZRGA 3O8CA 1AQYA 1HT1E 3A1WA 2ZJ8A 5JS7A 2BEKA 3BERA 1Q12A 1UEIA 2D06A 1T3SA 1B0UA 1N5LA 3MCAA 3KQNA 1YQTA 5JRJA 1N6LA 3L0PA 4TTRA 1H8ED 1W1WA 1LW7A 4NU0A 1ZIOA 3R9XA 4DT1B 2PMKA 4LRWA 4RD2A 1KDTA 1NMXA 2JATA 2XOKA 2IYUA 3SFVA 4JSYA 5BN3A 2WOJA 3KXIA 4RKFA 1G8GA 3K0EA 2VHCA 3FB4A 4MYCA 4DHEA 2WHXA 2CLCX 1PUIA 2A5YB 1EFUA 1M34E 4BECA 3VFDA 3TUZC 4BFUA 4EPYA 3HR7A 2ZSDA 3BBPA 2FGJA 4CEIA 4PSKA 5FTLA 2JJ1A 1M2OB 2N42A 3VNUA 2O0KA 5DN6A 2DFKB 1MRSA 1Z0FA 2PZGA 4PHTA 1ZM2A 2Z4RA 5TB5A 1GWNA 1PZNA 2O8FA 1KOFA 2CE2X 3IBGA 2ANBA 1NBMA 3IO5A 4CF7A 3A36A 4Q66C 2GETA 1ZD1A 4CT5A 1E9EA 1T91A 3TVDA 3W90A 4HLUA 2AKAB 3K70C 2H16A 2WZQA 1E94E 4QC2A 4ZCLA 4E5UA 4QRHA 3QBTA 2PZEA 1FNMA 3TUIC 4URVR 1T5LA 2OCPA 5CK4A 5FBRB 4GMDA 3EZ2A 4IOMA 1U90A 3B8HA 4P3YA 3P1JA 2JLUA 1KO5A 3UWKA 2W6ID 1HH4A 3WXMA 1AKEA 4LHYA 2FJUA 1E0JA 4PTLA 1G9XA 3R9IA 2GZDA 2KBEA 3KXLA 1XTQA 3KX2A 1EWRA 3AUXA 1OXSC 3TBKA 1T3LA 5IHPA 1SKYE 5L3SA 3WYGA 3QXJA 1T8TA 2FGKA 1TF2A 4OQXA 1E1QA 3SJBA 1R7RA 1Q1BA 1W48A 2YVUA 4H1UA 3T1QA 4IFBA 1F60A 2XZOA 3QXCA 2ZRIA 2A30A 1R6BX 4JVNA 2CL7X 5CDFA 1TNDA 1GDDA 5E3HA 4IKEA 5KSZA 1SGWA 2AFIE 4AY2A 1Z2CA 2E87A 2DWQA 2ORVA 5L3VA 3TRFA 4U00A 3IQWA 4L15A 2HXYA 2IF2A 4B6EA 2BKUA 1KGDA 3X2SA 4AI6A 1D2EA 1TX4B 1DAHA 2IUTA 3HYTA 3L82B 1MOZA 5A0FA 1N5KA 2ZYWX 1G7CA 4PAOA 2OCYC 5CLQA 3A1VA 1TQDA 2WIBA 4DBLC 1NY6A 5HZKA 1AIPA 1WMSA 1ETUA 2JJ2A 4LJ8A 4KITB 2O8EB 3VR5A 2F1HA 1CU1A 5DHFA 4BEBA 3K70D 1FMJA 2Q3MA 1Z6XA 5J5CA 1ZRHA 5EJEA 4OK5A 3AF2A 1S1MA 2DBYA 5LB4A 5HCNA 3EW9A 3RWMB 3ADCA 1ZU5A 3L2OB 4LYAA 3HR8A 4Q48A 4D0LB 1QVAA 2CVFA 1RYFA 4LV5B 3RS0A 2GK6A 5DIFA 3V00A 3MAAC 4IW3B 4EJSA 2BVNA 3L0SA 2YC2C 4DDUA 4EJSB 4B44A 1OXXK 1KNQA 4A0HA 2W0MA 2HLDA 5FR1A 3BK7A 3ZLJA 3FHTA 4TYYA 3ZQJA 4HATA 1NKTA 1IXRC 1K5GA 1RJ9A 3QJYA 3ZYCA 3EARA 2C04A 2HCBA 2V54A 4LJAA 4F4IA 3WHKA 2QQEA 3CRRA 3LLMA 2ZJYA 3FVQA 4PPQA 1P9NA 3ECCA 4BLRA 4YDHB 2RCNA 2V9PA 3EA0A 4GL2A 4ILEA 3VR4A 3DMDA 1CP2A 3VR3A 4ASUA 2Q6TA 2F1RA 3LLUA 2W6JD 4I1VA 3U2QA 4A6XA 3R8FA 2F9MA 3S1AA 1LY1A 2VH5R 1JR3A 4OHWA 5KU1A 1W4BA 3RANA 3B1ZA 3NKVA 4PR0A 2QMEA 2ZE8A 3CX7A 3EC1A 5BN5A 3Q7QA 3TMKA 1L8QA 4ASUD 4MUBA 4P4TA 3UMRA 2V6IA 3UXMA 1HTWA 2EVWX 2UZIR 3W5IA 4LX0A 1S3SA 2C78A 2OEPA 4FW9A 4KSBA 4LOAA 2GZHA 1SHKA 2GXAA 2WJJA 3PQCA 3QKRA 4FMCB 2WSSA 4V0KA 2O8DA 2XNSA 2HJGA 2DFLA 4WZAE 4EPTA 1LNZA 4XIGS 1NLZA 5AR1A 4BLTA 4OI0A 3AEZA 1DOAA 4TLCA 5JI3E 3FPAA 2JJ1D 5KTYA 2QT0A 3GLHA 4JLKA 3SDZA 2OBNA 2G1JA 4AKHA 3NHBA 1SULA 3I32A 1G18A 2H5EA 4O0MA 4EKDA 3T12A 3SC3A 4XTRA 3V4RA 1I4TD 1FX0A 1X6VA 4Q00A 2V4ZA 4DSOA 1ZUHA 1J70A 1N25A 4ZV4A 1G1MA 4V0LA 5TMPA 4F93B 3T15A 2A3RA 2WKRA 2OCBA 1Z3IX 1L4UA 4FCWA 3L0IB 2YOHA 1OYWA 5L3QB 2WMOB 2QI9C 4V0ME 4EUNA 3FDIA 1YZKA 2AWNA 3CPHA 3WRYC 4TMTA 1XF9A 3ZZUA 2OFXA 3I92A 4UXHA 4JLJA 3N5CA 4YMUA 5TV2A 2V6JA 2FMXA 4S2EA 4DLRA 1ZC4A 2RH5A 4AYXA 4DSNA 2NPFA 4EFLA 3C14C 1Z2AA 4GBMA 4Q4HB 4HLUC 3EX7C 1UF9A 3DEFA 2VP4A 1SVOA 4HDCA 5DI9A 5DSZA 4ACBA 3ZZ0A 4ESHA 5JWOA 4KI0A 1LS1A 4D4JA 1Z47A 1DO2A 2OCAA 3TH5A 1XMVA 3MFYA 3VU9B 4US2R 1UAAA 1LTQA 4RZ3A 1T8UA 5TVKA 4TQUS 3C8UA 1NNEA 3ADKA 1QF9A 2HUPA 2KJQA 2VRWA 1EK0A 3K53A 3O8DA 2QPTA 4ZDJA 2QEQA 4HAZA 4A4DA 2W2XA 4IEEA 4FMCF 1IN5A 1N0VC 3VAAA 2ERYA 4HI0E 1F2TB 3NBZC 2IA5A 2ZRBA 2MSCB 4TTQA 1VIYA 4BE7B 3LX8A 1F2TA 1Z0JA 4Y0VA 3TR5A 3T1TA 4PPFA 5EP4A 1GRQA 4XSGA 4QBHA 2BCJQ 4MQBA 5EE9A 5LPNA 1M7BA 4KV9A 3TGPA 1SKQA 2AR7A 5EE5B 1VG9B 2ZJOA 4I1UA 5JHGB 4K46A 4JYBA 3UIEA 3PUXA 1XMJA 2VSOA 2LWIA 1QG4A 4DCVA 1W5SA 3CIOA 1D6JA 1JR6A 3U3JA 4Q4AA 1W44A 1OE0A 1FMLA 2GEUA 3QPVA 1YHNA 4NONA 2QA5A 3BFVA 3BRWD 2IC5A 3BE4A 2F3TA 2NQ2C 4NYJR 2ZM5A 3QVUA 1E0SA 2BMFA 1XMSA 3BD9A 2J3EA 3QF4A 1GSIA 2BJVA 4Q4JA 3DKVA 1C9KA 4LV8B 3RRNA 1E79A 2FSGA 2JJ8A 2OSBA 4NYMR 2YWFA 5J4YA 4IEIA 2WWHA 4ZDKA 3LO5A 1TADA 4AURA 1NMYA 4M9QA 5G3YA 4N0DA 2GF0A 3VX4A 3GFTA 4FCTA 4AYTA 1GAJA 1XZPA 2WM9B 4HB3A 3R9WA 4JLAA 2ZI7A 4KLZA 4GDFA 1KI6A 2QGNA 3CPEA 2AFHE 2ZETA 3IIMA 5CB6A 1IN6A 1FQKA 3CZPA 4ZKEA 4O2RA 4RCZA 3T06B 1KY2A 1MO6A 1IM2A 5FL7D 2VIIA 1E3MA 2BIFA 3B9PA 4URWR 2ZS9A 2NO1A 2ZU0C 2OXCA 5UKDA 4ZCMA 2O5VA 1DG3A 3DVLA 4AIIA 4HZUA 2HDNB 3ZVRA 4B3DA 3D3QA 4JSTA 5FUYA 1OH7A 3OIWA 1UBCA 1MO3A 1KY3A 2IYRA 2WWIA 1U0HC 4GZMA 4KODA 1OHHA 2WVJA 4DC9A 4DXAA 3KL4A 4W5JA 1E79D 2QT1A 2F9LA 2AWOA 2D62A 4Z1MA 2ZRDA 4H1VA 1E9RA 4KFRA 1E4VA 4L9WA 5CM8B 2IX3A 5TXGA 1RE0A 3LD9A 5K8LA 1ZM3A 2W83A 1BMFA 1JR3D 4PC2A 3K9GA 4G1UC 4B48A 1W7AA 1J90A 4MRSA 4A0FA 2PCLA 4PO9A 1G4AE 2ODWA 4V03A 4A8JA 1S2MA 4G5OA 1R4AA 3FGNA 2ZE7A 2ZRCA 3B78A 4FMDB 2VTKA 4OJKA 5DNYB 3GCGA 1SXJA 1E6CA 1T4GA 4B75A 3GLGB 2J0QA 4JJZA 1SXJB 1QRAA 1XJQA 1YZLA 4YLGA 2FSHA 4P4SB 4PO8A 1US8A 3CM0A 5C4GB 3TR0A 2YV5A 4GPTA 3UKDA 3GFOA 1COWD 1IXSB 3ZD6A 2ZRMA 3BFXA 4KVGA 4LC0A 1US8B 4AC9A 3WYAA 4B3XA 4ZKDA 3R7WB 3IILA 4DIEA 2O8CA 2QUZA 2IK8A 4JZKA 3SYKA 4Q18A 1Q21A 3ICQB 3K0SA 3DM5A 3R7WA 5FPKA 2HXSA 2G1KA 2J9RA 4KU4A 4ACAA 2XB4A 2Q3FA 3FWYA 4JJKA 2GDJA 3AVXA 2GF9A 3THYA 4AG5A 5GJVC 4LHWA 3RSLA 1CXZA 2EQBA 5JCZA 5F98A 3AVUA 2PT7A 3ZS8A 3FTQA 4M1YA 4L5BA 2C9OA 1Z0AA 4S35A 5JLJA 1XTJA 2FOLA 1ZW6A 2E9SA 3UK6A 1R10A 4I99A 3F3YA 4AWXA 5JECA 4WXPA 4FINA 4U7DA 1OYYA 4US1R 5EXXA 2CJWB 4BRWA 3FKSA 2GTPA 3PUWA 2F3RA 4B43A 3WY9A 3HU2A 3OIUA 4QNMA 1II8B 3LWNA 3Q85A 1N6HA 1JAHA 1ESMA 3F8TA 4MKHA 4WA7A 2FV8A 1OKKA 2E1RA 5C2JB 2SHKA 3AF4A 1GNPA 5A4JA 1E0AA 1YJ5A 1MO4A 1AJEA 2Q9CA 3RNLA 1UM8A 1Z08A 4PXAA 4B6FA 3LXRA 2CCKA 1OXVA 4B73A 1W0KA 2QNRA 2IW3A 4TLDA 2BBOA 3QIAA 1XXHB 3KQHA 4A8JC 3QEOA 3ZVNA 3MWKA 4OHXA 2QQ0A 4Q1AA 3IKJA 1E2QA 3ZD7A 2VO1A 1AGRA 4JVSB 2D2EA 2A2ZA 4IXNA 1UADA 4C0QC 3GLFB 3KJEA 2FE4A 4KBFA 3OAAA 3THOA 3SZRA 3CX6A 1LS6A 3BOSA 2CNWD 1BYUA 1VCOA 4HUQA 1T3HA 4MKIA 2WWWA 3X1XA 1Z29A 2VSXA 1GKIA 4DEYA 3TAUA 1KJYA 5FUVA 3QUSA 1RRPA 3KFVA 1G7RA 1VECA 1HT2E 3GMTA 1IN7A 3I72A 2K5UA 2XJ9A 2IS6A 2GESA 1QVRA 3PVSA 1IN4A 2XZPA 4Q9JA 1EFCA 1NN5A 2CHGA 4DSUA 2P5SA 2GCPA 2O0JA 4I1SA 5FR2A 4D4KA 5K8UA 2HCJB 1NVVR 2HF8A 5K8IA 4II7A 1W0KD 2EFCB 4OHYA 1H65A 5L3SB 1CR0A 3LNCA 2OT3B 3KQLA 5DO9A 3SEAA 3TUJC 2HLDD 5IK2D 4RFVA 2BBWA 2QTVB 5B57C 1A4RA 1DAKA 4AK9A 4GOJA 1ZM7A 3H2YA 4TQ9A 2MMGA 4BEJA 3JVUA 4P4UA 4CRWB 1S9HA 2FN4A 3P4YA 3K1JA 4IHQA 3KB2A 3GJ3A 4GI7A 4QBFA 3UWOA 3ZIAD 4Q02A 4BRUA 1AS0A 4E09A 4QNRA 1GNQA 3KTAA 4FWIB 3RS5A 3ZH9B 2G0TA 4GP6A 3SBDA 5KO2A 1NY5A 3KTAB 4Z8XA 2FPKA 1ZJ6A 4ARZB 3PFIA 4DSTA 4X8OA 4C7OA 1W2GA 3NEJA 4HAYA 4NBSA 3H86A 1XDBA 1P73A 4I4LA 2RGGA 1GILA 1MT0A 3U5ZB 3AGQA 1ESNA 2ZSBA 4LJ6A 3B2EA 3V4FA 5KPDA 3LFUA 5AJYA 2BMDA 3F5FA 4BZPA 2JLVA 2O8EA 4J0QA 2DPXA 1BOFA 2CCGA 4MH0R 2QU8A 2C5LA 3AKCA 4TZ6A 5F2EA 1UBFA 2IS4A 3DMNA 4C0AC 1QHHA 3Q7PA 2Y8EA 2QP4A 4DLXA 4C0LA 2CLSA 3VR1A 2QMHA 2ZR0A 4DCUA 2ZPTX 1E32A 2QRNA 1KKLA 1X8JA 2NPIA 1OV4A 3SYLA 5C46F 1JNYA 4TSFA 3K0FA 2WAXA 2ZJAA 2D4HA 4TL9A 4EPXA 3D31A 3CB4A 1J8YF 2CCJA 3FMPB 4URUR 2DWOA 4P33A 4H9GA 1DAFA 4OQNA 1OKKD 1NBMD 1KIMA 4E03A 5EP1A 2KWIA 2ZS7A 3IIJA 4ZI2A 1A2KC 4TYNA 4YXWD 3U61B 1NL3A 4C0BA 1NVUQ 3OE7A 4EAQA 1P9WA 1ZP6A 4QBIA 1TQ4A 4QM7A 1OSNA 3SS8A 3GLIB 1AZTA 1E2HA 3B60A 4TLBA 4Q1CA 421PA 2FZLA 1D5CA 2QAGB 2BWJA 2R62A 4DVGA 2YOFA 1OPXA 4MUAA 2ZU6A 1KSHA 4LHZA 3QE0A 1U99A 3A58B 1XJ0A 4L16A 1U9IC 2YWGA 1OIWA 4A15A 4A6PA 2XB2A 2F6RA 3VKWA 2GAOA 1QHXA 4M1KA 1GTVA 3FOZA 3G82C 1CRPA 5B2ZA 2JLQA 3HJNA 1U8AA 3IDQA 4I1OA 3JVVA 3EPLA 1BH2A 2FEMA 4WVFA 1F2UB 3AV0B 2P0EA 2ZUDA 2PJRA 2OAP1 1F2UA 1ZD8A 1RW4A 2ATVA 2ODEA 3LRPA 3TKLA 2OAQ1 2NMVA 1G5RA 5DN6D 4QG7A 3I62A 1TL7C 4NTZA 2IXFA 3GJXC 1XXHE 2DFTA 1XEWY 1NIJA 4QJ4A 4D26A 1YZNA 4BFTA 1E9CA 1E96A 2O8BB 1WQ1R 3CRW1 4PC7A 2O8BA 1NG9A 2QORA 4UNSA 1GRRA 1XU4A 2ZITA 3LX5A 4UNQA 3Q8XB 621PA 2AN9A 4PC3A 3IEVA 1GRNA 3KQUA 3SQWA 4RJLA 1W36C 2DCUA 2PX3A 1WBBA 5J4LA 3PG5A 4JLPA 3UPUA 3GLFE 2VYFA 2GAAA 5KYKA 4NDZA 1D8TA 2XGJA 2QE7A 3B1WA 5KOYA 1BYIA 2ZRKA 2IUSA 2V55B 5DE3A 1QBKC 3EZ6A 3GLHE 4Q4HA 4A8JB 1YZUA 3CH4B 5F3WB 2ZANA 4QGHA 1PLLA 2BJWA 4QHTA 2GZAA 2HYIC 1A7JA 3B1VA 3G0HA 2NO9A 721PA 2A5JA 3TAHA 1WXQA 4YMWA 2JDIA 3BFKA 2ZJZA 4UXIA 4BFYA 1NIPA 4P4SA 4N0EA 5SZHB 1ZNXA 5BYKA 3ZDQA 1DARA 1OH6A 3FMOB 2BCGY 2FA9A 4M9ZA 4LI0A 4BFVA 4KAXA 3CKLA 1AS3A 3NVAA 1VHLA 3RWOA 4QM6A 1I2MA 1MABA 2D3WA 4CGZA 3MSXA 1C4OA 4DWJA 2ZE5A 1U98A 1MABB 1E2EA 5FOSA 1G7SA 4QOSA 3VMFA 2GRJA 2G6BA 2NZ8A 1G8PA 4HAXA 3N2EA 4BLSA 2J0SA 3AF3A 5EXSA 4Q9LA 3CONA 3TSOA 2XSZA 2QG6A 2BM0A 2ZR7A 1VYTA 1KJZA 1SZPA 5E95A 2ZSAA 1OF1A 5BYJA 2CJWA 1W36B 1NVVQ 1E98A 4QFMA 4IRUB 1II8A 1P9RA 3B7GA 5P21A 3KUCA 2VP0A 3C15C 3A37A 4RD3A 1T0JB 2IL1A 4FXPA 3RABA 4XTCS 2XJ4A 2ZI4A 3AVOA 2ZSEA 1CR4A 4ABYA 1Y63A 5J4VA 1E2KA 3WRXC 5HR5A 4OJQA 2IT1A 1PV4A 3C16C 2FSIA 5EQTA 2ZQ5A 1JXOA 2J5XA 3PJRA 2IYLD 1NRJB 2JLRA 2V7QD 3CNOA 2OV2A 3HU3A 4U5XA 2WBLC 5M04A 1W47A 1D9ZA 2OFOA 1Q22A 4MGKR 3PCRB 1OW3B 2R44A 5FTMA 2KI5A 2XXAB 4BZQA 1J2JA 2Z43A 3X1ZA 4Q19A 5FBQB 4Q7KA 4URXR 3MJHA 1Q0UA 2ZI3A 4LYJA 2ORIA 4M9SA 1G20E 3BIFA 1KI4A 3AP1A 3NC1C 3TSWA 3X1DA 2P6RA 4ERNA 1V5WA 4QGAA 2H57A 2VP9A 4URYR 2OUKA 1F5NA 5H70A 3E1SA 1KYIA 2C9CA 3KKQA 4LC1A 4DEXA 1AK2A 1JQLB 4ZDWA 4HDQB 3H0KA 1Z0KA 2LKCA 3TE6A 1QHNA 3I73A 4D80A 3OHMA 3VHLB 1GM5A 2Q0HA 4M1TA 2QZ4A 2CVHA 3MD0A 5KNCA 2D2FA 2X2FA 4DIDA 4NCIA 2P5TB 4MYTA 4F4CA 2AD5A 2GVZC 1VCNA 4EPVA 3I3SR 1NJGA 3Q5DA 4QHSA 4TSFD 4JBXA 4ESVA 1XZQA 1GL9B 2R6AA 4JVLA 4LGMA 5ELXA 2QN6A 4JBWA 4A0RA 3NBYC 3CO5A 4KBGA 2CNWA 4DLTA 2JCSA 1TQ2A 2RGXA 2GA8A 1XD2A 3KXKA 3B5JA 5EUMA 3GJ6A 5FOXA 1XD2B 2GBLA 4M2LA 2JLWA 3DZ8A 4WBSA 4DDVA 5BWMA 2G88A 3U44B 2BMJA 5JI2E 3EASA 2ONJA 4XVRA 2V3CC 4DLUA 1N6PA 4G5SA 4TYQA 1FUKA 3R20A 4B3GA 3J81k 3X1YA 3SFZA 4MRNA 4LHXA 3AM1A 4LJ7A 5HKKD 3CF2A 4HYYA 1AA9A 1XX6A 1E2NA 2B92A 1W4AA 2VP2A 3QXHA 1N5IA 3PITA 3B6EA 4MDFA 1H8HD 3QKTA 3O47A 3EA5A 5LD2B 1QZXA 2XOKD 4PQRA 1E2MA 3GEHA 2A78A 3KKNA 4L4UA 5FL3A 1AKYA 1CR1A 1JBKA 1KAOA 2O8CB 2Q9AA 4R71A 3QVVA 2XTNA 1JJVA 4BWYA 3U7GA 5EE1A 3BJIC 3RVBA 4JKYA 5IRCD 3TVTA 4TYPA 5DYGA 3QKSB 1QHHB 1UEJA 2VL7A 3WNCA 1AN0A 3E2IA 2RHDA 2OESA 1KI3A 3QG5A 4CVNA 1ANKA 4B32A 5JZVA 3SYNA 1HUQA 2XTMA 1JB1A 5DISB 2QL6A 3Q5EA 5TDHA 3C41J 1G8FA 4GRAA 1IHUA 1CJKC 2Z0MA 2JJ2D 1IXZA 1G17A 3LH5A 1Z8FA 2X2EA 1EX7A 3FKQA 2QBYB 3OFNA 4PQFA 1TUIA 1M7GA 5FOUA 1N6OA 3LW7A 1KMQA 2JEOA 2NO0A 1ZCBA 1UKZA 3CR8A 1VCIA 3FHOA 3W6OA 4RZUA 2ANCA 4HEJA 2XEXA 5HZHA 2X1VA 4D6PA 1J7KA 2ZJ5A 2PT5A 1FL9A 3QG1A 2DFNA 4HDOB 3IIKA 1VG0B 3FFBA 2A5GA 4BQSA 5H8WA 2DWPA 2D7DA 5F9FA 1Z83A 5E7JA 1JJ7A 1ZIPA 3ND9A 4G5RA 2HV8A 4JIMA 3WMFA 3THWB 2WOOA 3B82A 2V8OA 1LFDB 2AHOA 3NBXX 3THWA 4LJYA 5CB8A 2RKOA 3TNFA 3S1AB 1OFUX 2W2VA 4WW0A 2B7CA 3AVYA 3H84A 4EQ6A 3AKYA 1L4YA 1W49A 1XEXA 1XRJA 4F91B 1NVXQ 5JCPA 2J0UB 2IYZA 4HUQB 4FIDA 4M1WA 1E2LA 1AGPA 4A2WA 1HE1C 3AKEA 5KSOA 4MGIR 1P62B 2CLDX 3Q3JB 4R2HA 3DOEA 3GJ5A 1HQYE 1E9FA 2OZEA 3RS4A 1TPZA 2FG5A 4MRPA 2I1VB 2YNMA 2OFWA 4RZ2A 4Q1FA 1JPJA 3EIHA 5EXPA 4DLWA 3VNVA 2ZUBA 2C96A 2WICA 3M1IA 2QSYA 1FUUA 2ZRPA 3RAPR 1E4YA 5TARA 2J0VA 1OXUA 1PLJA 1HYQA 5FFMA 5IDVA 2N1BA 5FBVB 2XNDA 3NH6A 4XVQA 3LXXA 1A1VA 3MWLA 2GKSA 2IYYA 4LCBA 3CWQA 1JEDA 1KTVA 2AKYA 1GKUB 4GOXA 3DOFA 4NCKA 1KZGB 2FX3A 3BB3A 3W3ZB 1ZU4A 3EZ9A 2DR3A 1E9SA 2G3YA 3BB4A 4PPNA 2H8KA 4WZ6A 4NCNA 3CX8A 3IUYA 2CL0X 3PUZA 3OE7D 2ZEJA 1XFAA 4C2UA 5FUWA 1GL7A 2DY1A 3NIBA 3PEVA 3TW8B 2ASEA 5HPYB 1Q1EA 1XPRA 1S0UA 1XJCA 1UKVY 4BFZA 4LYFA 2ECKA 3WMGA 4TN1A 2R2AA 4IVPA 4RFSB 1D2MA 2VEDA 3GQBA 2PCJA 2ZVPX 3QNUA 3SQXA 1E2IA 4PZZA 4RFSA 2J46A 1PUJA 1GUAA 1UKYA 4PO1A 4C7OB 2DB3A 3I8SA 1P61B 1GKYA 4UXJA 4XVUA 4GMXA 3PENA 4MITA 2GXSA 3KZ1E 2VBCA 5AUPB 3THXA 1OH8A 1KDRA 4JS0A 2YJTD 3SJCA 3WNBA 2WIAA 5JJKA 3RDPA 4PAQA 2G9NA 2RGBA 3CRMA 2QY9A 1DELA 3RRYA 1E9AA 5FOTA 1SVMA 2FSFA 4RD0A 2JLSA 1P2VA 5JSZA 1XEWX 2ZRFA 2JLYA 4C0SA 5EZ6B 2AL7A 2NO7A 3EXAA 5BN4A 4MA4A 4YDSA 4UNRA 4LJ4A 2NIPA 3ONWA 3K9HA 5CJ2A 4QGFA 4LJ9A 5H1YA 5HTKA 221PA 4B2IA 2RB4A 3KJHA 4KO8A 4HUTA 2MSDB 2YKGA 2GCOA 4TWZA 3RC8A 3A6PC 4OYHA 4UNNA 1H8EA 2Q9BA 1P2TA 4C0KA 3ZVMA 2GCOB 2I4IA 2W58A 4G0NA 4YQFA 1ELOA 1XEFA 2IYXA 4XWKA 2AX4A 3KFXA 2C99A 4Q4AB 2PBRA 3UMSA 3ICEA 1CJMA 1DG1G 1OT3A 3SR0A 5KNBA 4A0GA 1CRQA 2YYZA 1G6HA 2CHVA 5IK2A 2J7KA 2QPAA 3MG9A 1KI1A 4W9MC 4WZBE 1N6RA 2GNOA 1P7CA 1NN1A 3CF6R 3GLGE 1YKSA 3PEUA 4IVRA 5H68A 4RY2A 3SJAA 2WJHA 4PFSA 2IWRA 2JAQA 2PEZA 2Z6VA 4C30A 1E2FA 2GJAA 2G0NA 2QAGC 2LCFA 4M0LA 1A2BA 4FD2A 1E9DA 2W6IA 5JFGA 3TSZA 3PUYA 3AVVA 1FP7A 3PIRA 4M8NE 1XPUA 4DB2A 4OKSA 3VHXA 3GJ8A 4O2LA 4KFSA 1XD8A 4R98A 1G8YA 4D2IA 1TEVA 2EWWA 3QPUA 3PR1A 4JLVA 1M1YE 2BHRA 1KI6B 2RGEA 4YC7A 2RGDA 3HYRA 4ZO4A 1Z63A 2C03A 5AJZA 1P3JA 2WSMA 1BKDR 3CBQA 4D25A 2QPOA 1VMAA 3SU8A 1VIAA 4ZDIA 1ZNWA 5EE0A 1X3SA 4G01B 5FUXA 5J4HA 2NGRA 3DPUA 1NLYA 2JLXA 3HPQA 4Q7MB 4KLNA 4JT2A 1II0A 1Y3AA 1E1RA 5KNDA 2PX0A 4HZUB 1Z6YA 3QSYA 821PA 4PC1A 2ONKA 1G3QA 5KDDA 1RYHA 3EIEA 1P72A 5FTKA 1AM4D 2YWEA 3BORA 3REFA 4TMKA 2V1UA 5AJWA 4BLPA 1X8LA 3CR7A 1R8QA 3LY5A 3M4YA 1K8RA 1MO5A 3E70C 3QY0A 2UZ3A 4Q5IA 3MWJA 1LV7A 3LBNA 1II9A 3Q9LA 4HLDA 5SZKB 1CJTC 4HAWA 2EYQA 3N70A 1XTIA 3REGA 4P0TA 2J59A 4RD1A 4TT3D 1T9HA 3U44A 1IY2A 1S3GA 4FI3C 3SBEA 2AXPA 2EW1A 1QHYA 1Q1ZA 3LAWA 3U3KA 4PSAA 4ZPXA 1U8YA 4C0JA 3EPHA 4C4PA 5KSPA 1NVWQ 1Z0DA 2BBSA 1TF5A 2IEYA 1XNJA 2BDTA 5JWRA 3GLGA 1E1RD 2KE5A 3O8RA 2BV3A 4LV6A 2KB0A 1U94A 1UFQA 2VP5A 3HWSA 4IVQA 1A82A 2F43A 4TMXA 4XSHA 5GJCA 2B21A 2X19A 4QL3A 5BXQC 1XTKA 3ETLA 2F43B 1FP6A 3ZIAA 4BFWA 2VQSA 4C0HA 3ADDA 2VHUA 5GJBA 5B30A 3GEEA 4I81A 2ZSFA 3QKSA 2UKDA 2GILA 2NG1A 1QHGA 4C9BA 3OIYA 2OE2A 4M9XA 4Q9HA 3VTKA 1YZQA 2FNAA 4BFSA 2ZTSA 2ZIAA 3CH5A 1DO0A 3ZQ6A 3BXZA 2W6JA 2ZROA 4OI1A 3PUVA 5BQ5A 3RSOA 2WPDD 1RVDA 1RRGA 4NHOA 1LVGA 4Q03A 2KSQA 1DADA 2B7BA 2VPPA 2XAUA 3BWDD 5GADl 2IYTA 2ORWA 4N1AA 4Q47A 4RCYA 4CDGA 3QOFA 3I5XA 4G5GA 1KDPA 4TYWA 2AK3A 5DLQC 1KK2A 3KDSE 4PQYA 4XJXA 2C2HA 3C7KA 4BFXA 3WP0A 4NYMQ 2QE7D 2ZJ2A 4NE2A 2P65A 2IYSA 3A4LA 3RC3A 1E2DA 1W2HA 5FTJA 3IHLA 2QTHA 3OEED 3NWJA 4LBZA 8OHMA 1FOEB 4EPWA 4LWZA 3NTUA 1H8HA 2XXAA 2IXEA 2ZI9A 4IOLA 3H1TA 1F3OA 1YE8A 4OQMA 2CL6X 5B64A 4LBWA 1JR3E 5AJXA 3SNHA 5FI0B 4MGYR 4UKDA 5CYOA 2WKQA 1K5DA 3U60B 2Z5FA 1Z0IA 1GNRA 4HB0A 1DVRA 2EU8A 4GSYA 5G53C 2F55A 3W6NA 1HA3A 2OO7A 4MGZR 4OI2A 4Z54A 4D0GA 2OG2A 4L8GA 1ZNZA 3ZS9A 3IPYA 4JKIA 1W46A 1W0JA 2FFAA 4FN5A 4O25A 2ZE6A 5DYIA 3AVTA 4YONB 2G83A 3WBKA 3K70B 1TU3A 1VCMA 1ZYUA 1CIPA 5JMTA 4NPHA 1A5TA 1RRCA 5KUTA 1Z28A 3NEYA 5BW8A 3AGPA 2GXQA 2AXNA 3A4MA 2G77B 1XCPA 1ZD9A 2ERXA 5A5GA 3D8BA 3OAAD 5ANRB 3K0CC 1IBRA 2WWXA 3NDPA 2FU5C 3LVRE 2RAPA 1NF3A 4TL7A 1P2UA 1FFHA 3I5YA 4A1FA 5FPTA 4URZR 5DH9A 5GJWC 2I1QA 4XOIA 3B1YA 3TQFA 3SHWA 4MKGA 2HJVA 4JL6A 121PA 4TMWA 5FTNA 4OK6A 3W34A 1R0WA 1FTSA 1WDTA 3GD7A 5E7MA 1E2GA 3AH8A 2OM2A 1DE0A 3ASZA 1JEEA 3K09C 3L8ZA 1KI7A 1W4RA 4P32A 2WJVA 1O3YA 2ZVQX 4YMSA 1FPMA 4PZYA 1CKEA 4JLBA 4TZ0A 1FNNA 3MRSA 3FMIA 5DI3B 5HCIA 2FFQA 5AJVB 1I4DD 1G5PA 2ZAMA 5L8VA 4OHZA 3T5GA 5DI3A 5SZIA 3B9QA 1GG2A 2H18A 5JSZB 3QENA 1NLFA 2ZRHA 3RS7A 3L8YA 1UPTA 2CEAA 2ZRJA 5KDOA 2ZS8A 2OXRA 4Q1BA 2C8VA 4M53A 2FFBA 1WB9A 4DKXA 5GVRA 2ZYTX 4AG6A 1E2PA 4LPKA 3K0FB 2FF7A 2R6FA 2YC4C 1KO4A 3EZFA 1KSJA 3QQ5A 2OLKA 3QI2A 1KDOA 1DEKA 2HT6A 5HE9A 3RHFA 3DZDA 4BLOA 3B1XA 5IF9A 1VG1A 3EWAA 2IEZA 4XD7A 1IJFA 3AVQA 5FPHA 2AK2A 1KK1A 1DAGA 2EWVA 3C5HA 3C4JA 3LW8A 1LF0A 1OLOA 4US0R 1CEEA 1RFLA 2QENA 3EAQA 3BS4A 3MLEA 3P32A 1XPOA 5DHAA 1UJ2A 4NYIQ 3OFND 4IDQA 3U4QB 3KQKA 4N3NA 3T1OA 1OB2A 1RKBA 3U4QA 1YRBA 1JPNA 5GVSA 1NN3A 3GFPA 1R0YA 2W0SA 1ONBA 4NP6A 3T1VA 4CZ2A 4CEJA 1B23P 1G3MA 2N46A 4EQ6B 3SE0A 1I2DA 2PEYA 3GJ7A 4DRZA 1R8SA 2R9VA 5FBWB 5KPJA 1HE8B 3EIQA 2D7CA 1TTTA 4YMTA 3ADBA 3D7MA 3AVPA 1BMFD 3RRMA 4UJ3A 4ZI3A 4D4MA 4ON9A 2GVDC 3GJ0A 5AK0A 5C1BA 1VYUA 2HEIA 2WPDA 3VX3A 1G41A 4Q4LA 4TQAA 1EXMA 4LY6A 1RJ9B 3W8RA 2HYDA 4V0NA 4A36A 4CW7A 1XBTA 4LYHA 2WMNB 1GVNB 1OH5A 4YMVA 2EFGA 4B47A 1IAQA 2JA1A 4XWAA 4M1SA 2WAYA 4KXFB 3HDTA 1E1QD 3BH7A 2RHMA 1G3UA 5L3RA 1CJVC 3IO3A 1JECA 1R0XA 1IQPA 1BIFA 1NSTA 2ZAOA 4ZCIA 2RGNC 3EZ7A 521PA 5IT5A 1KJWA 4O3MA 4HB4A 1Z22A 1DAIA 2Z83A 3WYFA 3A1TA 4B3BA 1TMKA 3X1WA 4JLDA 2D74A 2RGNA 1CTQA 2XX3A 1LB1B 2CDNA 1R5BA 3PEWA 1OFTA 5JS8A 4GOKA 1E0KA 2VF7A 1MR3F 1YU9A 2JLZA 4RD6A 2R6GA 1TAGA 5FOWA 1XCGB 4IOKA 4B71A 3LV8A 1WP9A 4XH9B 3EC2A 1FTNA 1MH1A 2TMKA 1CULC 4AKEA 1KK0A 3ZGXA 1P4SA 1WRBA 5JEEA 3GLHB 3LQQA 2A9KA 3ZVLA 1SHZA 3K0CA 3FKSD 3SN6A 4LZZA 3ZJYA 2W2TA 2BC9A 4B35A 2IXGA 1YR8A 5J47A 2IS1A 3I1FA 3U6KA 3U7HB 4Y0AA 2GJSA 2J41A 4QJ5A 4B33A 5AUNB 3ND8A 4JVMA 3RLFA 3WNDA 1ZBDA 5FPYA 1RPZA 4MRRA 1EX6A 2GK7A 3BB1A 1ZUNB 2EFHB 3K8YA 1Z07A 2IHBA 1MV5A 4TT3A 2GJ9A 2DYKA 4OBEA 1VYVA 3OF5A 1DTSA 2WJGA 4POAA 2IS2A 1JALA 1KMHA 1UDXA 3N2IA 2HF9A 4IXMA 4C2TA 3CNLA 2C9YA 4KJZA 3GEIA 1FZQA 3QKUA 2WTUA 5JWHA 3MMPA 1NKSA 4LHVA 3MWYW 3A1SA 1UBGA 5JRZA 4DZZA 2VF8A 4BASA 2R65A 3HP1A 4G3XA 1M6NA 4OI4A 1KO8A 4NYIR 4DDTA 2Q21A 3E5HA 1S9DA 1XTRA 1DAEA 3IPXA 1LF5A 1AQUA 1W36D 2QMOA 1KKMA 2F1IA 1DPFA 5EXTA 3L43A 5FPSA 4P31A 2OLJA 2FPLA 3W8NA 4BUJA 4NL4H 2IYWA 3T35A 4A2QA 4EPRA 3IEUA 2EFEB 2OBMA 4DLSA 1GOTA 4GNKA 2ZRAA 1N0UA 1WF3A 3K9NA 4JYCA 3RRZA 4FWTA 3IBYA 1HURA 4RVCA 4GFDA 4JLOA 2GBLC 4D4LA 3KJIA 1VPLA 3AF0A 1TUEA 2Z4SA 5CM9C 4FMDF 4KFUA 5G41A 1QG2A 3BH0A 3Q72A 3P27A 3MUFA 1D9XA 4ZIRB 4IDOA 1EFHA 1QDEA 2J1LA 2ZRNA 3VR2A 4OK3A 4DT1A 1COWA 1NBME 1KSGA 3M6AA 4C3ZA 1NJFA 2I3BA 5D3MB 1GP2A 4L9SA 4Q1EA 4B74A 3QF4B 4KYUA 4Q4JB 4DJTA 1E69A 2J45A 1IY0A 3VR6A 1KI8A 1TQ6A 5LD2C 4KYIB 4EFNA 2NZJA 4LUCA 2BOVA 1KAGA 2V1XA 5CDFE 4LK2A 3K9LA 1P6XA 1Q3HA 2VA8A 4LBVA 4Q21A 4DDWA 3U7EB 4CIDA 4D81A 3A4NA 4NZYA 1ZNYA 4BZXA 3P20A 2AD1A 5JEDA 1IOZA 3I8XA 3SI7A 1U0JA 5KHOC 3LQRA 1CBUA 1SKYB 1U2RA 4PX9A 2PZFA 2O8FB 5CIWA 3QPWA 4MDEA 1JQJC 4Z51A 1DBSA 1S96A 4LBYA 4PZLA 4DLZA 2IYVA 4PANA 3KKMA 4CYMA 1IY1A 1YR7A 2FZ4A 4WXRA 3TW4A 2YOGA 4RZXA 5LDDC 2WKPA 3WHLA 2X8AA 2Q3HA 1KZ7B 1YZGA 1YR9A 3QXXA 4NKRA 4PHGA 1JAIA 3AKDA 3DDCA 4QBGB 4JL8A 4X8HA 3EPJA 2O52A 4M22A 4NCHA 1MRNA 4V0OA 4MYUA 2B6HA 1P2SA 3GLIE 2FDCA 2P2LA 3OESA 2ZYVX 2CXXA 4JBYA 3TIFA 3FMFA 1TU4A 4RD4A 3TLXA 1BS1A 1F6BA 2IBMA 2B8WA 3I4LA 3BH6A 3P4XA 1G5TA 1E99A 1HY3A 2QP3A 1N5JA 2REOA 2VP6A 4K81B 3TJZA 2PH1A 1XMIA 1CLUA 4MKFA 4F4JA 3KKOA 3JZAA 2BBTA 3AQ4A 1PJRA 1X1SA 2QM7A 4JLNA 3IQXA 4TTPA 1SVKA 3SOPA 3OEEA 4JT4A 3K0AA 4UJ5A
chains in the Genus database with same CATH superfamily
2YS7A 4E07A 1YZTA 5CX1A 4LDQA 4GZ6A 5J40A 1CF4A 1OTHA 4LFAB 4L5AA 2R1UA 2QVBA 3KQYA 4LMRA 4NG4A 2VDWB 5EJ4A 3NC0C 3MLAA 1GL6A 1X86B 4GPEA 1PWZA 4RK4A 2DQSA 1JLLA 2J87A 4U4AA 4OQZA 4MS1A 1ZAKA 3JYLA 3AB3A 4R0NA 2O2ZA 4LJ5A 4RXMA 3ZV5A 1KIAA 5K8CA 1FZTA 1NQWA 1KO1A 1UWCA 3QUBA 5E7IA 1EE2A 3H7AA 2AC7A 1G1AA 1Y89A 3OTQA 3EJ6A 4CUJA 4D9CA 5IAKA 4F7WA 3SIXA 1Z06A 3ORFA 3C0KA 5ICGA 4N18A 3WWYA 5CITA 1WEHA 1G19A 2P90A 3W8EA 3N6VA 1OXTA 2HADA 3WGJA 3ZWAA 2ZSUA 3QEKA 3IUSA 1U4NA 5AOBA 3O2JA 4BO8A 3RUCA 1H3EA 1V8OA 3ASYA 1N6KA 1PJQA 4MVJF 3WP1B 3CZQA 1T5IA 4MUIA 5FV7A 3CSDA 1ZM9A 3DPSA 3EVTA 5EHXA 3ZEAA 3SVTA 2O2HA 4WAUA 5JJLA 3SKXA 5JQWA 2PUTA 4WKPA 3B51X 1ZMXA 5ES3A 1HSZA 2PA3A 3TLMA 3ZYZA 1X77A 3LCCA 4Q6WA 1GUYA 1JEQB 3BL5A 3QLUC 4FCVA 4XGIA 4ARSA 4BNDA 2PKCA 2GQ0A 4WIAA 2CMKA 2HRDA 1XEXB 4NECA 2P2SA 1N8TA 4EFMA 1RPNA 4W7SA 4KRGA 3FCCA 1P74A 1F2DA 2INGX 3QA9A 1HG0A 4EHIA 1NUQA 2L17A 4RSGA 4BCDA 1NI4B 2NNWB 1NP6A 1ZMTA 2PMCA 2GDZA 1CDEA 3O3MB 5ALRA 1BSVA 1EG2A 1R9GA 4MJLA 5FA5A 2ZBDA 4LY3A 4TLAA 4L2IA 1T5BA 2H1LA 1VP3A 3MJRA 3MTDA 2P27A 2G07A 3RTBA 2JC3A 4I9NA 4ZAYA 1L5HA 1GQOA 2Q41A 5C8ZA 1RNLA 4Y2VA 2ZBQA 5FBLB 4XYBA 3WKDA 3GLVA 4TWIA 2A5DA 2IHYA 2EYUA 1U4OA 4G1FA 2AFRA 4CUKA 4IDBA 3PV0A 4DQ0A 2P6NA 3L1HA 2ZTVA 2GCNA 5K1ZA 3EVAA 1Q1GA 3KM0A 5B3JA 4CI9A 2OWEA 4ZJYA 3QVXA 4YHHB 2YZ2A 2Q4EA 1M2OA 3PQ5A 3VH4A 4MCIA 3ERCA 3LHSA 4P22A 4MRAA 5FOVA 1VGRA 1RWXA 4DGQA 2R6CA 4GKKB 1AZSC 4WD3A 1VPWA 3FCOA 2H3EA 3ICCA 3PXGA 3CNBA 3GP8A 1B6TA 3NXSA 3VOTA 2NO6A 2YRXA 1R5NA 2WWFA 3R3VA 3LOPA 1ZPDA 3MTBA 2WWVD 1GTRA 1U0SY 3GWZA 2EKLA 2UZAA 4YQZA 4AUNA 3UO8B 2ZUCA 1OHHD 2O9JA 4NEGA 3R7DA 4QRDA 4DNOA 4FYXA 1DRKA 2NZXA 4ZO9A 1OZ0A 2YWHA 3BKXA 3NDBB 1RQXA 4BRZA 1LDBA 4LPSA 1M1NB 3DV0A 3G9UA 3I05A 1U0LA 3K09A 3OT4A 2GM4A 2H0QA 4NC9A 3OM1A 3O8BA 4EHHA 5AUOB 3NONA 2OILA 3GHHA 1I5EA 1OFHA 4W82A 3UQZA 3IOBA 1LDEA 3T8YA 1LKZA 1ZVKA 1FXWA 4FMPA 3EWSA 5TGZA 4CMGA 4M1MA 3I61A 2A0FA 2P4UA 3UANA 1JT2A 4HFRA 5HRUA 1E3IA 1S8FA 3QM1A 4QOGA 1OLSA 2B94A 2WSSD 1U81A 1MJGM 2R4TA 2YV2A 4P2GA 4YJFB 4E3ZA 1QJCA 3A3OA 1ADBA 4BWGA 1TECE 2LRHA 4HAUA 3QVJA 4L8WB 4BVKA 3S2SA 3D59A 4Q24A 3LQ1A 1XYYA 1SUFA 2B8TA 4RZIA 2RGAA 4BLQA 1HDZA 4GPZA 1RZ3A 3GZNA 3SF8B 4LTMA 3IMFA 3W9YA 2DP4E 1ZUIA 3IXLA 1P75A 2ODBA 3RVJA 4BVAA 5HQ3B 1M6HA 3OD1A 1LLCA 1V1JA 3L6BA 1NF9A 1O57A 2OHVA 4B3MB 1NMZA 2YWBA 3A6ZA 1AXEA 3KCQA 4MO2A 3WRXA 3DL0A 3DPIA 4GGOA 4N5MA 3A0RB 5JBQA 1V43A 4LDJA 2GARA 3ESYA 4FZ5A 4GT1A 2X77A 3H75A 5LQKA 4UNPA 1M66A 2QVYX 1OJLA 4ZMBA 1DT3A 2XITA 4ENUA 3OG9A 1KI2A 1U8ZA 4HNAB 4DCNA 1LZLA 1NPDA 1Z0ZA 4RQAA 4II2A 4PV7A 3RSCA 1V3UA 2XCOA 3WBJA 4XUEA 3U3OA 2H7YA 1GNVA 2V6FA 1P31A 3UPDA 4ARCA 2XZLA 1ZM4A 1EG7A 2UVQA 4JJEA 2NUTB 3EIOA 3ZJVA 2ZRQA 1LWNA 3KZNA 5EP2A 1NHGA 2ZUFA 3ORHA 3ZG6A 4A2PA 4AYWA 4BNKA 1IULA 5EE3A 4J94A 4M8LA 5HFNA 5HYVA 1MP0A 2CJYA 2W2MA 5ISMA 4QXAA 2IUUA 3R0QA 4R2IA 3C3AA 3ZIUA 1KEEA 2DPMA 2VDKB 3K73O 4YTEA 4ND3A 1T1IA 4HAVA 4B34A 1SWWA 5COBA 2M1ZA 5E9AA 4YAGA 2FHSA 3LOUA 4CEJB 5ADHA 5BV7A 4B2LA 3E48A 3KJQA 2G71A 3LUAA 2XGGA 4CU2A 3BX1A 1IWOA 2XQKA 2M6SA 1X1TA 2LKDA 1RWVA 5C9ZA 3GNTA 2YXPX 2IYFA 1J56A 2YINC 4QA9A 4HTFB 3BAFA 1RC8A 4P80A 1RI4A 4FUTA 4ZIRA 4V0MA 2F1JA 3CIFA 2WV9A 3GN2A 4L5JA 4KWCA 4AJNA 1O95C 3FOCA 4RESA 2I3AA 3WMEA 4IOJA 3CT6A 4MV4A 4RKEA 3K2EA 4KH0A 4QQKA 1P60A 5EZ5A 4IFTA 4MYHA 1IHXA 1CS4C 1R8JA 2PZAA 4WXMA 4BEVA 1XDSA 5D3MA 1Y1SA 4Z4GA 4N48A 1DS6A 4JI0B 2QVLA 2QSZA 4HDNB 1T0UA 2CK3A 4QU5A 1ONOA 3AINA 3ZH2A 1ZK4A 3LKVA 2A5FA 4FTWA 3ZZTA 3RF7A 3UMVA 4JEUA 4OAPA 1CRLA 3KJGA 4ZVNA 4GOMD 1IMJA 1HLFA 2QXTA 4B6SA 4G89A 1Z6AA 5ABPA 5BR1A 2ID7A 5MGNA 1GZHB 5H16A 1JDBB 2X40A 2HJRA 3K05A 4XM0A 1LBQA 4MAAA 4OQFA 2QRZA 5BPHA 4GL4A 1CSEE 1JDVA 3LBIA 3E27A 3G3EA 3ZK8A 2MT9A 2NYAA 1UFOA 1QIIA 1X92A 1FIUA 3PEYA 3N7UA 3ZGVA 5EP3A 3P97A 3AI1A 1JA9A 1AHIA 3HU1A 5BN1A 5JHHB 4YRIA 1G16A 4RGYA 1WXXA 3MVEA 5G40A 4H0CA 2RMKA 4IUYA 3HBFA 4GGMX 2O8DB 2H7VA 1EFRA 1XWIA 2JIZA 3GRAA 1N6IA 3G5UA 4FJ0A 1E7WA 2H9IA 5DTJA 1Y4ZA 3VR5H 1PCXA 5FV4A 1M33A 3FUTA 1DQPA 3KBBA 1NSFA 2G9QA 4NOJA 3G5TA 2RGCA 3MA0A 5JH7B 4JUDX 1T6BY 1GYQA 1P4HA 4YJHB 4REMA 4DUGD 4LXQA 1WCV1 1WV1A 2Q29A 3FIJA 3ZWMA 3B13B 1OBCA 1R4NB 3H8SA 2WJYA 3ZNNA 4O4IF 1K68A 2SCUB 2GWHA 1LK5A 4O4JB 1EK6A 2QN3A 4X62B 2HSDA 2FLVA 3ADPA 4IDPA 2GXUA 1EINA 2CDRA 2SCUA 3D0RA 3EMBA 4GZLA 1P44A 2O57A 3DAFA 3OFVA 3G49A 3P26A 4EG5A 5AFSA 5CIQA 5IM4A 3V3KA 1UBJS 4LHSA 1NMQA 5I47A 2BONA 5DGXA 1VRWA 3CRVA 3K31A 4X6LA 5U4QA 3T34A 3TQCA 4OB7A 1D2HA 4X1IA 3FE2A 1L4EA 1NF8A 3V1UA 2O1EA 4NABA 3R5HA 4UU1A 4DLLA 1Y3HA 5CIYA 5JAIA 3FYHA 1MENA 4RJ2A 4R9UC 4AMVA 4I3GA 4YJ2A 3SXUA 5H3HA 1R16A 2YUIA 3FM9A 5E6RB 3EVFA 4NMMA 4CQMB 1PLKA 4YJ2B 4QUIA 4RACA 2ZWMA 5LBIA 1SHJA 1LK0A 1YZ3A 3ILSA 2WE7A 3TRIA 1M74A 4RY9A 3OEHA 2VHEA 1L7VC 4JMPA 2ZJ3A 4MVJP 4CQMA 2H17A 1LSJA 1V25A 4AJPA 4I1YA 1W88A 1IDOA 4U7GA 4X90A 1IK4A 1M34B 4F5YA 4Z2AA 5JCXA 1ZC3A 3CPJB 4M0PA 1SXJC 4ZZ2A 2O3UA 5ALSA 1MW8X 4LY9A 3T7AA 2RGRA 1A1SA 3ZGNA 2WB4A 1JH9A 3JZDA 3OEHD 4QKQA 2GEDA 3MIIA 4MKZA 2H29A 3HDYA 1PR2A 1E2JA 2P9TA 2VDUE 3ZU2A 4DLVA 3EPKA 1PFYA 3JAWB 4ARUA 3IDAA 4EQZA 1IONA 2NVBA 1JWAB 2HA0A 4J3FA 3H8JA 5MHTA 4B76A 1BO6A 4GMHA 4YJDA 4EDHA 5FNVA 3T0FA 4JI2B 4TV9F 2P30A 2GBGA 4HSEA 3L92A 4UUQA 4OQLA 5J4KA 3ZNOA 3W3AA 3R8CA 4KR0A 2PGLA 3D7SA 3MELA 3C6YA 1PR3A 1NVBA 2O20A 2Z1MA 1XB2A 2JIOA 2ZRGA 1AQYA 5JDCC 3O8CA 2AH5A 1HT1E 4ZRMA 3C6BA 2GYWA 3ZJ5A 1FYEA 2I7VA 1PJSA 2X3UA 1T3SA 2VT3A 3I9KA 4ZVQA 2PTGA 4F8YA 4LRUA 3KQNA 2QD4A 4IMIB 4EHDA 3LGSA 3FCYA 1J5PA 4R1QA 4RSRA 1N2OA 4DT1B 1HETA 2R1VB 1OBVA 1KDTA 1NMXA 1VJRA 2XOKA 3TKAA 4IDFA 4DDKA 3N2ZB 1HORA 1CNFA 1SUBA 2IYUA 2XQIA 3I2GA 4JSYA 4DHWA 1BHSA 2B36A 1EX1A 2RCYA 2Q27A 3KXIA 4MYSA 5HDQA 3K0EA 3FB4A 4MYCA 4P82A 4N12A 2XEDA 3LFHA 3K8QA 1OA1A 2IVZA 2WF7A 3QJGA 1PUIA 4M87A 4XEUA 3VR0A 2XMZA 5KCZA 1M34E 5ESWA 3UJBA 1K2VN 4DIFA 3H4IA 1O8BA 5BRNA 2FGJA 2YFKA 4LNUB 4AJOA 2BFMA 3IHKA 1P0QA 4QXQA 4BOYA 4KN5A 1MGOA 3G88A 2VJYA 1AV6A 3TWOA 2JHPA 2GK4A 4OLBA 1B8NA 1MRSA 1Z0FA 1K06A 1YDGA 1ZM2A 2XRMA 2Z4RA 5TB5A 1OOEA 4J1SA 5EPUA 4B6PA 2YWCA 1MZPA 2QZPA 1V71A 2XYGA 3ESZA 3C48A 4MAFA 2H7CA 3DUFA 3EJWA 1L5WA 4OYLA 4IJ5A 1WL8A 4Q66C 2VYCA 2ZQYA 4CT5A 2E82A 2QRPA 1E9EA 4MTLA 1WMEA 3DZHA 3AI2A 3O8OA 1MPXA 2Q4DA 3W90A 4BPRA 4JI8B 4HLUA 4E15A 4DDMA 4UREA 2O3TA 5CLHA 5JUWA 2PZEA 3TUIC 1GGFA 1QK3A 1TUBA 3QE4A 2OCPA 2R0QC 5TS2A 1DGQA 2R751 4XFJA 2PSSA 4C4SA 3RYCA 3P1JA 5HKOA 2JLUA 1AF7A 1WUHS 1R00A 1NONA 2FZCA 3CEHA 3H4VA 4BJHB 4YX9A 3NP7A 4LHYA 1M2FA 2R87A 4MVJG 4KQCA 2A1TR 2G9ZA 4Y6QA 3UB2A 3NFYA 3VYSB 3R9IA 2OR3A 1RJDA 2GZDA 3BWYA 3KXLA 3RU2A 1MJGA 4UPDA 4AY5A 3PX2A 1OXSC 3HGQA 3TW6A 2OHXA 3TBKA 4XZ3A 5IHPA 1I1OA 1SKYE 2QT9A 2DOKA 1Y7PA 3EEFA 2BGTA 3AJEA 5DTIA 4A3SA 2PAAA 1TF2A 3RUFA 2LPMA 5HM8A 2R11A 1ODKA 5DMXA 3T4XA 1HF3A 1R7RA 3MGGA 5CT4A 4ZMRA 1W48A 3VPGA 3KQVA 1F60A 4NS4A 4G4GA 2A30A 2QTVA 1QV6A 4WV3A 4J1TA 1Z75A 1FYVA 1YQQA 1L8LA 3TI9A 5IDQA 2C5GA 4JUFA 5TMDA 1KAEA 1RU3A 3U7JA 2RD2A 1GDDA 8MHTA 2NUAB 1PTJC 3MCVA 2DWQA 2AZXA 4ZHSA 1H4TA 2J09A 4S05A 1ST3A 1QFSA 3IQWA 1YOVA 3T9EA 2IEBA 2IF2A 1HT3A 3C4VA 1UMKA 3RRXA 2Q3EA 2BKUA 3TQSA 3W5HA 1KGDA 1SFRA 2W98A 4TZKA 3X2SA 4EW6A 2XVZA 1Q6YA 1U1DA 3EOZA 2IUTA 4D79A 1SBCA 4BATA 2BFEA 4QREA 5I9IA 5A9TA 2Q5FA 1T15A 3LUJA 1N5KA 4PAOA 3ZI7A 2XUKA 2OCYC 2VOJA 5CLQA 3IYLW 3A1VA 3NHZA 3ABRB 4MWDA 3ORQA 2P8SA 5HZKA 4U7TB 1WMSA 4JJ7A 1YBFA 1ETUA 1AN9A 3B20A 3BA1A 2I9PA 2WKWA 4MQ5A 4AUKA 1XCLA 4JOQA 1V5IA 3G0OA 4DIMA 1CRZA 4XGRA 2A9RA 1L1EA 3CN9A 3DV9A 4AXBA 4BEBA 1LQTA 1V11A 2J3MA 4AT1A 5J5CA 3WISA 1ZRHA 2OQRA 2GM3A 2GS9A 5EJEA 5TNXA 4B73A 1F8UA 2YFHA 2BT4A 3J7TA 1WY5A 3AF2A 4KLRA 4OATA 3HCDA 3UV3A 4CTKA 1ZU5A 1LDYA 3FAZA 4PZ9A 4LYAA 3BRQA 2IXBA 2IV2X 2R48A 3HR8A 5A2QA 1Q5PA 4Q48A 2XQGA 4CM1A 1B43A 4D0LB 2HW8A 4LV5B 3OEWA 2KM1A 4GQBA 1JGTA 6ADHA 2ZVJA 1QV9A 1Q0PA 3N3AC 5DPMA 3NYQA 1AKRA 2J5RA 2AQ8A 4DUYB 4JGIA 3IBTA 1Z36A 2IY8A 3JYNA 4EJSA 2W8ZA 5D85A 5CDGA 2QM3A 5E2IA 4LCEA 2WQZA 1P2BA 4XPIA 4DDUA 3IELA 4Z4EA 1K5HA 1RHKA 4IGFA 2W0MA 4NXMB 3CH6A 4U1RA 1DJNA 4ND7A 1JJBA 3JAKB 3JVIA 3QJYA 2R1ZA 5F1PA 4A8HA 4R9SA 3AR8A 3EARA 2C04A 1WZ2A 5DKFA 1TFRA 2QQEA 2W6PA 1LTHR 2NADA 2ETVA 4TKLA 4MV3A 3V2UA 4PNHA 3ECCA 5LM3A 1KVUA 1N0HA 2RCNA 2V9PA 4D97A 4FX5A 2FW9A 4TXMA 1DFHA 5G0VA 5B4UA 2ET6A 1PZGA 1T8WA 2Y77A 1DC3A 3A4IA 3L7YA 4XPZA 1WCWA 4IILA 4IXWA 2FZVA 1JR3A 4P08A 4R3WA 5A3SA 5EIEA 3FWHA 4DR6B 2I66A 5T3YA 2CWDA 2QMEA 1SAYA 2ZE8A 3GGJA 3CX7A 3EC1A 2I1WA 4A91A 3D8TA 4UUMA 2OHIA 3P2OA 1J23A 3V1LA 4P4TA 2Q5JA 3TO5A 2V6IA 3NWPA 3T5CA 3R6TA 1U7TA 3TZHA 3UT0A 3H97A 3WGZA 3KV3O 3O0DA 2C78A 1ZGJA 1HLPA 2WTXA 2OEPA 3IJPA 4FW9A 1OI2A 4GU5A 4LOAA 1QZZA 3ONFA 4WACA 3QKRA 1PQ4A 2VI5A 2XDAA 4BO4A 3TJRA 3CVYA 2IPOA 3WL4A 1U9JA 3HWX1 1RHJA 2OO3A 4EATA 1D6SA 2C0CA 5FADA 5JG7A 1XLUA 2CY0A 5AR1A 2PVSA 2DR0A 3BGOS 3WB0A 3UN1A 3FPAA 4X60A 2CFCA 2D8AA 3U4IA 4W1PA 3HI4A 3VPBA 1TYBE 1YFKA 2QT0A 4TV8F 5G0WA 3K94A 4CL8A 3SDZA 3ROTA 5J2UB 4EF6A 1SULA 3OTIA 4JBGA 4OV6B 3H9EO 3K15A 3KEFA 3MINB 4XTRA 4AMGA 3F6SA 2RHCA 5J43A 5M34A 5J2UA 4A15A 1FX0A 3DCYA 2UV8A 1IFXA 5D86A 3LUDA 2FMUA 3L46A 3HABA 4QVIA 1ZUHA 2VDRB 4MR8B 2P9JA 4G0XA 4GXTA 4V0LA 4F93B 3F6EX 1XQ1A 4PCVA 3NAZA 3MT0A 1EQAA 4PNZA 3T15A 1Z3IX 1L4UA 3D5EA 2YOHA 5L3QB 2IH5A 2QI9C 4V0ME 4WFIA 3FDIA 1YZKA 2Q7XA 1TXGA 4N7MA 3N6RA 4QYTA 2PUEA 4IZIA 1Y8RB 2AWNA 1XF9A 2HJWA 5EIWA 3ZZUA 4ZVMA 3QQPA 3N5CA 1SRRA 1ZC4A 3F7OA 4WKCA 4B85A 2CYCA 4WEOA 1LW6E 3D6VA 2NPFA 3TEMA 4A16A 2GTHA 1T35A 2O0LA 3PGLA 4AJ2A 3RG8A 2F4NA 4B4VA 1FVOA 3PHIA 5F33A 3VVLA 3KD3A 3P0FA 2BL4A 2N1MA 3MMZA 4ESHA 1E6EA 5IBCA 5JWOA 5I4BA 2J33A 3LIPA 4JYMA 4PN3A 2QJWA 1XMVA 2Y0CA 1LBSA 4Y2HA 4WPGA 2ACKA 1KXZA 3CV3A 2UXBB 2VHZA 3C8UA 3ER9A 1ID8A 1QF9A 1EMDA 2GPTA 2KJQA 3IP7A 4D9FA 4ZDJA 2QEQA 3QXGA 1Z4LA 2CB0A 2IDZA 2GZSA 2XMRA 3FUVA 2HA5A 5BP7A 3DE7X 2E4WA 4DYHA 5J3JA 4JV5B 5PGMA 3ID6C 4L5YA 3HYSA 1U1CA 1Z7EA 1R9NA 1GU0A 3PUJA 5B1SA 2GFQA 3F67A 3O91A 4HVTA 1EIZA 2CUKA 2R1TA 1O03A 3GRKA 2Q6IA 3JALA 3EEQA 1U8FO 2XBUA 2UXDB 2JAHA 4QBHA 1M5UA 1QIMA 2V0CA 4IV5A 3JALB 1QKIA 4FN4A 3SD7A 5GM2A 1SKQA 1NW4A 5EE5B 1VG9B 2ZJOA 3TLAA 3A2LA 4JAVC 5D3ZA 4UATA 4JYBA 3FF4A 4RH0A 3L7MA 1SO8A 4Q7QA 4CLEA 3ANSA 2VSOA 1G21B 2FF5A 4H4DA 1BDHA 5LQNA 4PBRA 1QG4A 4LDRA 1W5SA 1YSCA 2EBUA 2IU4A 3O8LA 1P0CA 1C3VA 3U3JA 4LF7B 2DUMA 1FMLA 4QUBA 3OMXA 5KTTA 5I7WA 1AG9A 1ZWLA 3DKIA 5JRDS 2UUBB 2EAUA 3A6KA 1TA0A 4KACA 3HKDB 4L7VA 1E0SA 4K0KB 3Q7EA 1BZYA 2BGLA 2BMFA 2WJ4A 2J3EA 1T9ZA 3L0ZA 2EFJA 1GSIA 1P39A 4M83A 4Q4JA 1BD4A 3DKVA 3IQIX 4NULA 3VH1A 1C9KA 1M3SA 3RRNA 4KQ2A 1E79A 3K6JA 1YH3A 5LA6F 4KFCA 1O95A 4JX8A 5J4YA 1QO0D 3HXLA 3LO5A 4ZDKA 1YMQA 4CLHA 2CXNA 2YWJA 1K7CA 1NMYA 3KTDA 4KYVA 2R8YA 3UFXA 4E3WA 4L4ZA 2WINI 4YAOA 2GF0A 1XDZA 1V96A 1ZW1A 3OIDA 4AYTA 2Z08A 3IR5A 4XIFA 1P5RA 4BP3A 2OZPA 2MWMA 3U5TA 4EUFA 3R9WA 4XI9A 3HCWA 4JLAA 3AL2A 2C20A 4ZV7A 3PHJA 4GDFA 3ESAA 5K3SA 1EGHA 5DBGA 5BUSA 2AFHE 3IIMA 4X1YA 4EB6A 3GUYA 4YRKA 3NBAA 4DCGA 5E0OA 4YCSA 3B38A 5ALVA 1B6SA 2OXIA 4R1OA 2LNDA 3DYBA 3MT7A 1QFXA 2Q1WA 5K3CA 1KEKA 2VIIA 4K6GA 1E3MA 3P2JA 2BTQA 1TJYA 5JLAA 2DBRA 4I0WB 2NO1A 5UKDA 3T3GA 1BVRA 1PS0A 5JSUA 1PJZA 1A50B 3TDNA 3CNEA 4GBGA 2GN9A 1CQJB 1ZSNA 3ABIA 3DVLA 3ZVRA 4YAIA 2QRLA 1FNCA 4B3DA 4YRQA 5HIMA 4AS1A 1P1IA 4HBZA 1KY3A 2QMZA 4G65A 1XELA 2EG5A 3Q41A 4F06A 1VIMA 2WVJA 4DC9A 3KL4A 3DZJA 2VDVE 4RK0A 3FPSA 2D62A 4GX0A 4Z1MA 2XAAA 1VE6A 1WLSA 2XWPA 2ZRDA 4AJ1A 1E4VA 5CM8B 4PU0A 1NC3A 3KZXA 1ZLYA 3L9WA 1NT4A 4GC5A 3RBZA 4CIXA 4G0UA 2CVOA 3M89A 1IZ7A 3U1VA 3V9AA 3I01A 4MR9B 1JR3D 1XWWA 1QQAA 3GRUA 5A5FA 4LXGA 3AFIA 4G1UC 4NAHA 4EJ2A 3W3AH 4OQPA 5EA2A 1LX7A 4B48A 2NZ2A 2OAEA 3WL5A 1DG9A 1R4ZA 2PCLA 2Q28A 3MT9A 4PO9A 5C7LO 1E62A 4BLUA 1F3LA 3LFTA 5IXSA 1Q0TA 4MVYA 3A1NA 5EZSA 3ZWOA 1ZSYA 3C4QA 4V03A 3SX4A 3ZHYA 4A8JA 1S2MA 4G5OA 5T67A 4DNQA 1R4AA 2BEWB 2ZE7A 3FGNA 3KOYA 4FMDB 1TPYA 3IT3A 1NQ5A 2OP0A 3DCIA 1LPAB 1YA8A 1L7OA 2N0SA 3GCGA 1PK8A 2X1LA 3H5OA 2BEWA 1NJ8A 1T4GA 4B75A 3GLGB 2J0QA 1MLDA 4X00A 2BEUB 1J97A 1XJQA 3E3AA 1I94B 2FSHA 3DHYA 4QAJA 3CM0A 4IMRA 5C4GB 2YV5A 4GPTA 1JLKA 4PO3X 1HRDA 2W4IA 3WJAA 2IEAA 1Q92A 2P4EA 4O3FA 3WYAA 3VYTB 1ABFA 1DUSA 4Q3DA 3WGHA 1AX9A 4JZKA 5GZ3A 3U1BA 4Q18A 1Q21A 4YRJA 1UOOA 3DM5A 5TQ0B 1T13A 4E5YA 2OB2A 4XQEA 2Y6VA 3GDHA 5TQ0A 2GPJA 2IV7A 2W90A 2HRBA 5ITSA 1DIBA 2HU5A 3H2KA 3FTDA 3KDAA 3OX2A 3THYA 3AM5A 2JVJA 4XUDA 4L5CA 4S12A 3ZC3A 3H3XA 4RAQA 3FTQA 1C81A 4M1YA 2C9OA 1Z0AA 5BV2P 2RARA 4EVIA 1XTJA 3K9BA 4COOA 2E9SA 3IUNA 4OHKA 4RH3A 5K6RA 3IKLA 3GFFA 4WXPA 4BNDB 2BLLA 1JHPA 4FINA 5D1NA 1QVWA 3JQBA 2C3PA 3ILYA 3JZFA 4MNTA 4ETNA 5KNLA 4BRWA 3FKSA 4YRLA 2F3RA 3B1JA 3WY9A 1D4OA 1II8B 3OQIB 4Z86A 3Q3VA 4G97A 2HBYA 3SXPA 2FQYA 2QF7A 1TYAE 2WKSA 1JAHA 4UBIA 2WWTA 1M2GA 2G6TA 2E1RA 2JCYA 3EGWA 4CE6A 5A4JA 1H9AA 2ACWA 1MO4A 3PGVA 1AJEA 3G1UA 1SIBE 5AI5A 1BGXT 3RNLA 4PXAA 3UCFA 4PGFA 1FFEA 1YMVA 1RAFA 2A9FA 3PFCA 4MW4A 1XG5A 4JY7A 3ZE2B 3LCUA 2Z9DA 1OI4A 1IIRA 3IAFA 4YN3A 2IBSA 3KQHA 3LUCA 1MQ9A 3QEOA 1MBZA 3WIEA 2EWMA 3E7DA 1Y9ZA 2BGNA 2EOAA 1W19A 1SCQA 2VS1A 4DILA 1E2QA 2PL1A 3HM2A 3RHTA 2VO1A 1AURA 4HWPA 5DP2A 3G2KA 1UADA 4LZLA 5LWHA 3JYOA 4MHOA 1GZ3A 1HDXA 4Q3CA 1L5YA 3CX6A 4AZ3A 4HUQA 4MKIA 5AI9A 3OZSA 1TZKA 1L4HA 5G2OA 1KJYA 4JC8A 1K98A 2VNHA 3QUSA 1G7RA 1LRKA 4EG7A 1HT2E 1Z7BA 1G2OA 5K3EA 2MTBA 1CJCA 4JB3A 2NSYA 3ETGA 3R7BA 5CG2A 2JIBA 3H9JA 3JWJA 3TNYA 4RQUA 2QD1A 5AW8A 1QO7A 2GZ1A 1N8KA 1QVRA 4F1KA 3KLMX 3PL1A 4RVUA 2HCRA 4Q9JA 1PT9A 3HB0A 4DSUA 4ZO7A 3RC9A 4EUEA 4TV9A 2GCPA 1EAMA 3OQHA 2Y2UA 4XGQA 2VPTA 4F5EA 2CGEA 4OLJA 5I7HA 1FFWA 1V7ZA 4OX9Y 3R0JA 3TZ6A 1VSBA 1W0KD 1ZK3A 4E32A 2EFCB 2FDXA 1HG1A 2GD2A 3G2QA 4QDOA 5DXJA 1Z17A 2OT3B 1ZI8A 1PJCA 2E0IA 2RK3A 3ILXA 4HQNA 2FPSA 1HBJA 2VRCD 3TUJC 2Z2XA 3JQRA 2BKLA 2QTZA 4HGOA 3OE1A 4UBMA 4FYIA 5FCDA 4GKVA 3V2HA 3MGBA 4AK9A 3GD5A 3ZX4A 3AU9A 3H2YA 2MMGA 3DFIA 1VKHA 3PXAA 1EEXB 3FRHA 4BEJA 4RENA 2FN4A 3U13A 4QATA 4UEQA 5LBUA 5A4MS 4DAOA 4UTNA 1QPBA 3GJ3A 4URFA 1NNUA 4QBFA 4LSMA 5JPIA 3UWOA 2FPIB 4BNXA 3DZBA 4BRUA 1K8YB 2FQQA 4CIBA 1GNQA 1A3CA 3MM4A 1MG0A 1MC4A 2EZ4A 3NTOA 1TRKA 5ALGA 3WO0A 1NY5A 4Z8XA 4NDAA 4G0YA 2ODTX 4KXMA 4RAOA 4R8VA 4C7OA 3NEJA 3UA3A 4HAYA 4NBSA 1XDBA 1P73A 1Z33A 4GECA 1GZ7A 1E89A 3QVGA 4P35A 4KB5A 4R7GA 3LFUA 4D9GA 3ETJA 2B98A 4BZPA 2O8EA 4IICA 3DLCA 4ARIA 3JYHA 4MH0R 4UEJA 1M2VA 4JWTA 1L5FA 3BHJA 3HMQA 4WKNA 2WTBA 2JG3A 3NYIA 2V9ZA 2CW5A 3H04A 3KPVA 3CRNA 3MERA 4OBBA 4R0MA 3KHUA 1MFPA 1CYDA 2JW5A 1M2JA 1FDVA 1P7VA 2CLSA 2XLBA 2ZW9A 2DBVO 4HWGA 2QMHA 2ZR0A 3FSRA 3P2KA 3RJ9A 5K3OA 1PDVA 1E32A 4INJA 4ZXPA 1KKLA 3WZ2A 3OJXA 5D3KA 2IOFK 4O8CA 4TSFA 4J2TA 3OH8A 4YHBA 2WAXA 1AY0A 3K9WA 1XQ9A 4TWRA 9MHTA 3T38A 1IC6A 1OVMA 2YBEA 5A6SA 3FMPB 5T41A 4AX4A 8ATCA 3M4XA 1T10A 2P9FA 2GLXA 3O94A 1XAJA 4KZKA 2XQVA 3PF9A 4OQNA 1OKKD 1OAOC 3ZWWA 1NBMD 2BCEA 1IVSA 4UUAA 1UWLA 1RQLA 3IIJA 1JSLA 1Q0SA 2HHCA 1Z4NA 2VA9A 1ECFA 4JQOA 2C2YA 4Y9TA 4YXWD 3QGMA 2PLWA 3CJQA 3E35A 3C7AA 1P1RA 3PKJA 4UEWA 4B1FA 5BT8A 1RWMA 4F2DA 3SS8A 4DLKA 2QYHA 421PA 2FZLA 3D8RA 3IV6A 1CNMA 2DPYA 1GL3A 2BWJA 2Q49A 2X5KO 4NOLA 4CLRB 4YUAA 1M76A 5BOSB 2G06A 2YOFA 1OPXA 3B3GA 4MUAA 3VU3A 4UULA 1U99A 3A58B 4K9LA 3FZQA 4H4CA 2C0QA 2PUVA 4L16A 1X7YB 1OIWA 4IH9A 4ROSA 2F6RA 4GOOD 1G6KA 2I2WA 3V42A 4M1KA 3RAJA 1XQVA 3G82C 1CRPA 4PZAA 3FGPA 1CDOA 2JFBA 1Y1LA 2AOWA 4IQGA 4F04A 2AZDA 2OUIA 2QTRA 3JVVA 1W5EA 3H2HA 4QUJA 4PYMA 5B37A 3TSAA 5A7GA 2OHGA 4WQMA 1BH2A 3SX0A 2FX2A 3EPLA 5IDYA 3ND6A 5IVPA 1F2UB 1P3Y1 4ZJUA 3IUQA 2ZUDA 4YWJA 2X1HA 1Y42X 2OAP1 3U26A 1ZONA 2O8NA 2BH2A 3GJSA 4OXYA 3PC8A 4Q4HA 5HKAA 1BXRA 3OTHA 2YL2A 3IODA 2ATVA 4X45A 1YL6A 2XNJA 3IDSA 4RXTA 4UEKA 2ODEA 3OUTA 2OAQ1 4KDEA 1G5RA 3GPDG 1CERA 4QG7A 2OVBA 4OHPA 4Y1RA 1TL7C 2R97A 4ZXFA 1XXHE 3AIMA 1XEWY 1ARZA 1LX6A 1NIJA 2WFLB 5ALEA 4BVHA 4D26A 1NW9B 4BFTA 2ATIA 3G0IA 3GR6A 3V8VA 1E96A 1ORDA 3FPHA 4RQTA 1W76A 1WQ1R 4N4AA 1THTA 1NG9A 2QORA 3FI0A 4K1LA 4UNSA 5M3BA 4TKVB 3VUEA 1CUWA 3H7IA 4UNQA 4Y8VA 4B40A 4LF6B 5LP6C 3F3KA 1K92A 1GRNA 3HZRA 1BQ4A 2UAGA 3KQUA 2YIMA 4RJLA 2X8WA 4EEZA 2B5VA 3PG5A 3I01M 5ENZA 3QMPA 3SIWA 1N34B 2X8LA 2D2VA 2GAAA 3GAFA 4H7HA 2A33A 2VYQA 2JLCA 3OURA 4MCJA 3UNXA 4NDZA 1N78A 2PXCA 3EGDA 4YASA 4KTTE 4TXNA 2BKVA 1NBIA 5EI5A 1J1UA 1J1IA 1X1BA 4XYMA 1CK4A 2Q0XA 3Q87B 2AOVA 2V55B 5AP9A 5JMPA 1PT5A 3B1KA 4F12A 4A8TA 2VAVA 5I7EA 3D64A 1WHSA 4CF4A 3VR6H 2CVQA 4RFLA 5CHYA 4ZYUA 2A5JA 2GUWA 3G0HA 4YMWA 1MJNA 5MF6A 3JQDA 2C2OA 3ZE9A 2B9EA 4P4SA 3L7OA 2H2WA 2G28A 3A3KA 2P9EA 3FMOB 3D3EA 2LE0A 4INZA 3O95A 4XYLA 4M55A 4M9ZA 4LI0A 5I8PA 1KJ9A 3CKLA 4EJ6A 3A9SA 1SBYA 1ECPA 1I2MA 2OCKA 3DOUA 1EIWA 4LF8B 2JAUA 2ZE5A 5JROA 1MABB 1WZEA 2FFRA 2BH9A 4CM5A 1V5FA 5FOSA 1RP7A 3IR6A 5BN4B 5ICEA 5K0EA 3KOUA 3V4VB 1P6QA 3EDQA 1YWGO 2D5BA 1OAKA 2B0JA 2FCAA 1ZK2A 3DWEX 1FRQA 3H2GA 4GXQA 3AF3A 4AN4A 3OZGA 5TT1A 1XZEA 4N40A 2WJ6A 2O2JA 2BM0A 1UAGA 2DF8A 4DV1B 3DLBA 1ZN9A 2PWAA 1PG0A 4KMMA 4ML3A 5BVGA 3GEDA 4AMZA 2ZB3A 1UOPA 1KZ4A 2VWGA 2ZSAA 1SHLA 3EFEA 3NHWA 3OLXA 4FEAA 5E95A 4EB0A 5DXFA 5K0NA 1EWKA 1NVVQ 2C5FA 1U1FA 4RLQA 1P9RA 3WLLA 1E60A 6GPBA 1YJCA 3ELUA 3B7GA 2NXCA 2HHJA 5AHOA 3KUCA 1NM5A 2P6PA 4I4TF 3A2MA 1H23A 3C3KA 1KKUA 2RE8A 4B8WA 1N77A 1QCCA 2FKNA 3N2YA 4KNVA 3A0UA 4FXPA 3VTFA 3GV0A 3CH7A 2XJ4A 3IEKA 5B1YA 3BRSA 5AI0A 1Y63A 4ABYA 5J4VA 3VISA 3WLTA 1DC4A 3C16C 4AS2A 4R51A 2Q1TA 5EQTA 3VGJA 4HS9A 2J5XA 1TM4E 2V7QD 2JLRA 4I9UA 3MB5A 4RCVA 1MA0A 3DE1X 5I5GA 1ENZA 2PMEA 2UZ0A 1KERA 1P77A 3OY7A 1T0PA 4LNUA 2AJDA 2E4XA 3IV9A 4TKMA 1J2TA 1D9ZA 4HCJA 4I19A 1Q22A 2GJ4A 2PS0A 4BNFA 3PCRB 2XXAB 1NA5A 2OZVA 1J2JA