3PEYA

S. cerevisiae dbp5 bound to rna and adp bef3
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
391
structure length
391
Chain Sequence
b'AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 144
structure length 391
sequence length 391
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA02
4FN5A 3W5JA 3UATA 5FBQB 2EFGA 1NRJB 4WOPA 3TAUA 4DCSA 3CBQA 3RHFA 4M9XA 4D4LA 5CJPA 5AUOB 1H65A 1GITA 3UANA 4PSKA 3QBVA 1CR4A 4D0GA 1VYUA 3HU2A 4KO8A 5E3HA 1LFDB 3CKLA 1BYIA 2IYWA 2IYLD 2P5TB 1UKEA 1XD8A 1RW4A 3UG6A 5CM8B 4D25A 1ELOA 3WMGA 4UXIA 1DTSA 1M1YE 5FTMA 2VHUA 5BXQC 1Z06A 2HXSA 4JLJA 1NIPA 3QG1A 2OHFA 1CJTC 3HYTA 5L3QB 2VH5R 2ANBA 1CR0A 5AUPB 3B1WA 1IN5A 1EX7A 4PC2A 1XD2A 4IDPA 1DAFA 1Z6XA 2PMKA 4A2PA 4HI0E 1Z0AA 2CJWB 2WJGA 3MWYW 1G17A 2BOVA 3H1TA 4FXPA 1N5IA 3CH5A 1AQUA 2RGCA 3I1FA 4URUR 2FGJA 1K6MA 2ZSEA 4MGZR 1COWD 4C2TA 3HDTA 2IYZA 1ONBA 1CEEA 3AVXA 2QA5A 3GMTA 1RIFA 3D7MA 1AK2A 4KBFA 2VHJA 4Q9JA 4FIDA 1XTQA 1GM5A 3CIOA 5H68A 4BLSA 4E07A 3PUYA 4ARZA 4JVNA 1E2JA 4P3YA 1OV4A 1T3SA 4TMKA 2DHRA 1RYFA 1XMJA 2PZGA 2GNOA 2XX3A 1ZIPA 1TEVA 5JSZB 1OKKA 2PT5A 4Q4LA 4U00A 3U3MA 3A6PC 3C15C 1XPUA 5B57C 4B35A 3VTKA 1WRBA 1QRAA 4KI0A 2CCKA 1II8A 2ZITA 2OE2A 3C14C 4P4SA 3TSZA 3THXA 4GZLA 3PEUA 4K81B 3PEWA 1HT1E 3PITA 4LK2A 5JWRA 2F3TA 4B3CA 1W4CA 1R2QA 4NBSA 2GHIA 5K8UA 3RSLA 5GJCA 1RVDA 4GL2A 2HLDD 3PVSA 2ZREA 3LO5A 5J4LA 3UWKA 1KSFX 2NIPA 3SQXA 5JMTA 1D5CA 4KFTA 3R8CA 4TTQA 2OM2A 1E9RA 2OXRA 5C46F 1W36B 1KO1A 1Z0DA 3I4LA 1Q3TA 4DDTA 3S1AA 1DAHA 2EYQA 2YYZA 3ADCA 3WYFA 4GT1A 3W6PA 4ERNA 3EPJA 3JVUA 2IHYA 2KI5A 1W5SA 5FBRB 4A8JC 4OQFA 3TUIC 4OQXA 4DLRA 4URXR 2GRJA 2BBTA 4GFDA 3RWOA 2R6FA 4R2IA 5KOYA 1FQKA 1UBCA 2I3BA 4TMVA 2ZAOA 1LF0A 4TLEA 1VHTA 4BFXA 1P9NA 2P2LA 1UKYA 3BIFA 2Q9AA 1GNQA 1PUJA 2QGNA 2OO7A 3BK7A 3SBEA 5JJKA 1OIVA 1D9ZA 1G4AE 4W7SA 4MGKR 1EGAA 2ZRKA 3BE4A 2JLSA 2ZRGA 4I1UA 5LDDC 5EQTA 2AK2A 4A1FA 2FG5A 3IBGA 1N6KA 4CVNA 1L7VC 4V0ME 3CX7A 2KJQA 4QKQA 1GRNA 2ECKA 1G7CA 1KYIA 3AP1A 2F6RA 1E99A 1D2NA 2AFIE 4OI0A 4B73A 1SHKA 1KDRA 3T1OA 1WMSA 3L8YA 4AYTA 2W2VA 2FV8A 2H1LA 4IJMA 5G3ZA 5D3MB 3NDBB 4V0LA 1XPRA 2WMNB 5IF9A 3SR0A 4HLUA 4GDFA 2AXPA 4PPQA 4NCIA 1E0KA 3IDQA 1DG1G 3GJ7A 4DKXA 1N0WA 2QM8A 1XZPA 4JVSB 5C1BA 1PVOA 1Z47A 3TR5A 1LVGA 3NEYA 3PUXA 4BZPA 2IYQA 3TW8B 2F55A 2AX4A 2VA8A 3E2IA 2IUUA 4US2R 3Q5DA 2QMOA 2P67A 2D7CA 2GK6A 4CYMA 1KIMA 1MO3A 2FZLA 3K70D 2KWIA 1JALA 2RGEA 2ZI3A 1XU4A 5JLJA 2DYKA 4MUBA 4Q4HA 3GLIA 4Q9HA 5EXPA 2QORA 4LCBA 5EE3A 2JLYA 4DJTA 4JIMA 2IK8A 3IGFA 1NMXA 3DOFA 4RZXA 1JXOA 2GZHA 2XJ4A 4ASUD 1C9KA 4NYMQ 4Q9LA 2ZVPX 5IRCD 3SYNA 4DSNA 2FPLA 2W6JA 2ZRAA 4TL8A 3WYGA 3TVDA 4PHFA 1A82A 4MKHA 4F91B 5J4KA 4IFBA 1JR3E 5E95A 2A30A 2ZSFA 1HURA 4HLDA 5AR1A 3H4MA 5CIWA 4JL8A 4BLQA 4D4JA 2IEZA 4A2QA 3A4MA 1IQPA 2VP5A 3QKRB 2F1RA 4LHWA 3NC0C 3FDIA 3FFBA 5DLQC 4X8HA 1YZQA 4B6FA 3TQFA 4TLCA 2XJ9A 4JLKA 2OG2A 3AQ4A 1U8ZA 5FL7A 4ZDKA 5IHPA 1BH2A 3WP1B 2ZUDA 1U0JA 1QHHA 1ZVQA 4RCYA 4LJYA 2F1IA 5AWFC 2DCUA 4V0NA 1JNYA 2MSDB 1Z0KA 4DUGA 1AS3A 1SKQA 4QOSA 3THWB 4ZIRA 1P5ZB 1KY2A 2WSMA 2EFDB 3QXCA 3RRNA 1XJCA 1EFRD 2IYUA 1XTIA 1Q57A 4QFMA 2WWFA 3U61B 2IWRA 1MH1A 2PMDA 2ZI5A 1A5TA 3K9LA 1ZM3A 5BYJA 1KMQA 1SVWA 3KKOA 3C7KA 3EZ9A 5E7MA 3PENA 3AVTA 2B8WA 2FSIA 4G5OA 2AR7A 4C7OB 2HDNB 3CO5A 1PLKA 3MMPA 3OHMA 4FCVA 5H70A 3VHXA 1DPFA 1E6CA 4I1OA 4Q4JA 1U81A 4AYWA 3GLHA 2GKSA 1XCGB 3LLUA 2FSHA 2OFOA 1I2MA 1G291 2ATVA 3C5HA 1L4YA 3H86A 4Q1AA 2QQEA 1D2MA 1GIAA 1U99A 4ZO4A 4NP6A 4IKEA 1QHGA 1G4UR 2BMEA 1IHUA 1E0AA 4Q7MB 2RGXA 5KU1A 2D7DA 5SZHB 1P7CA 3MWKA 4URWR 3MAAC 2Z4RA 2ZJYA 1XTJA 1R0YA 3DZ8A 4HLCA 4EJSB 3U6BA 421PA 3T15A 5DNYB 1N0UA 3T61A 3KQHA 5K8TA 2QMEA 1EG7A 1E2QA 2V3CC 3M0EA 4LSGA 2AD1A 2RHMA 5HZKA 4S35A 1M6NA 3CF6R 1NBMD 1XMIA 3LH5A 3KQNA 1XTSA 4RCZA 4ZI2A 1E96A 1SVOA 2ZE7A 1B23P 3B78A 4JLNA 4HAZA 4UXHA 4I99A 3PEVA 3O47A 5DYGA 2XZOA 1JEDA 1Z08A 3ZD7A 2E87A 2ZJOA 4CT5A 4XWOA 5B64A 2CL7X 4LV8B 3BFVA 2FFBA 5CDFA 3W5IA 2XZPA 2V1UA 2V7QA 2WM9B 4Q1FA 3QNUA 1LF5A 2H7VA 2KBEA 2XXAA 1GRQA 1UAAA 5HTKA 2X1VA 4ZCIA 1OLOA 4PC7A 5G40A 3FHCB 5JI2E 3MCAA 2DFKB 2JCSA 1G16A 1SKYB 2WJHA 1ANKA 1OYWA 1RPZA 5JS8A 5L3SA 4EPXA 2BCGY 3D31A 2RB4A 1XEFA 3DVLA 3K0AA 2D2EA 2XGJA 2ZYWX 3ADBA 1Z0IA 2BVNA 4B3FX 1SXJC 1SKYE 1QHNA 3QKUA 2XEXA 2W83A 3SN6A 4CT4B 2J1LA 3A37A 4JBXA 3WY9A 3RS0A 2WJJA 2D62A 4QBIA 4Q03A 3MSXA 4ITRC 2PBRA 4D4KA 2I1VB 1G19A 4LC1A 4DIDA 1KI2A 2ZPTX 3CRRA 3EWAA 3SEAA 2QP4A 4YMUA 3EA0A 3K53A 1RFLA 2LKDA 4OYHA 3LQRA 2QMHA 5HZHA 2C9OA 2ZYUX 3GLFE 2FF7A 3ZS8A 3JZMA 4V02A 3MJRA 1W0JA 2O52A 2G0TA 4IOKA 2CLSA 4FWTA 2OILA 2FA9A 2A3RA 1COWA 1YQTA 3T12A 3PUWA 1A4RA 2BMJA 4LJ4A 3KKQA 1KSHA 2FDCA 2EWVA 1AA9A 4JLAA 3SNHA 5BQ5A 1G3MA 4KYUA 5TARA 2BBSA 4F4JA 4OHYA 3L8ZA 2UVQA 5AJVB 2ZM5A 1KNXA 3CX8A 4DDVA 2RCNA 4PO8A 1FPMA 4BFSA 3ZJYA 5JJIA 4PPFA 5CK5A 4ZDIA 1CU1A 1ZM9A 2BKEA 4IVQA 3RRYA 4OI4A 1IBRA 3VU9B 3M6AA 1ZCAA 3MJHA 4MDFA 2G88A 3DDCA 5KPJA 4MYTA 4JJKA 4B2IA 4JYCA 3TSWA 4DEXA 2C9YA 2RGAA 4DLTA 1ZP6A 3FGNA 1US8A 4N0DA 3FKSA 3TNFA 4UNPA 4UXJA 3HYRA 1IXRC 3VKGA 2H57A 5JRJA 4LYJA 4LJ6A 2E1RA 3EC2A 3VHLB 3MRSA 2MSCB 1JAIA 1CIPA 4MRSA 5P21A 4LJ9A 2IF0A 4Q9KA 1XJ0A 4ZKDA 1XTRA 1JXMA 2HLDA 5L3VA 4WZBE 2PEZA 1WDTA 2ORVA 1IN6A 4W9MC 1CS4C 1UF9A 2A5FA 3BH0A 1E1RA 5FFMA 1E2IA 5HR5A 2BBOA 3VR1A 3P4YA 2WIAA 2A5YB 2R6AA 3OESA 1OH8A 4NCJA 4EQ6A 1SVMA 1WXQA 3MWJA 4F92B 2IX3A 3IILA 5DI9A 3ICQB 3RC8A 3QF4A 3LW8A 1FUKA 3FVQA 3PG5A 3HPQA 4PHGA 4GP6A 2G1JA 3LVQE 1E0SA 2HCBA 2ERXA 3R9WA 1QZXA 5KO2A 4O2LA 2F1HA 3TUJC 3ZZTA 3MFYA 1LW7A 1U90A 5F9HA 3GJXC 2ZE6A 2HF9A 3OF5A 5FOSA 3ZQJA 2L0XA 1SVSA 2X19A 1ZUIA 3LXRA 1J8MF 1T8TA 1N5JA 5TDHA 3CNLA 2PX0A 3NBXX 3W3ZB 4BFTA 1GL7A 4B34A 4PAMA 4JSTA 3EWSA 4IXMA 4Q4AA 1DAEA 3TBKA 4Q1BA 2KB0A 3Q85A 3K1JA 1KAGA 4RVCA 5KNDA 2IS2A 2O8DB 4GP7A 2JJ8A 2CHVA 4WXPA 2ATXA 621PA 2YZ2A 4P33A 1E9AA 4OHWA 1Z29A 1GL9B 3FE2A 1UBFA 3K0CA 1HQCA 2R6DA 4KBGA 4OJQA 5CK4A 1EWRA 1S8FA 3MD0A 4CDGA 4NCKA 2NO6A 4LI0A 5AJZA 2VBCA 2OCYC 4HAWA 2V55B 3BB3A 2QU8A 1P3JA 2VEDA 4BPBA 1GWNA 3DM5A 1GUAA 3B2EA 1Z28A 5EUQB 5AUQA 1DO2A 1NMYA 4TL9A 3TVTA 2QL6A 1Z6TA 4QGAA 1OXSC 4HZIA 4WZ6A 3BB4A 1VG9B 1G5TA 3AF2A 1KJWA 4OL0A 1N6NA 2UKDA 3VR5A 2X77A 4HSEA 2N46A 3B1YA 4MGIR 4TZ0A 1J8YF 3CWZA 1JI0A 1IONA 3KJHA 1E4VA 4KAXA 5FL3A 5FR2A 1R0WA 4MUAA 2QZ4A 5F3WB 1W46A 4IRUB 1OXTA 1TAGA 4HAVA 1P9RA 2ODWA 4A0HA 3B9QA 1KHTA 4TMZA 3QBTA 3QQ5A 2ZRHA 5HE9A 4N0EA 1E9EA 1QBKC 2H17A 5EZ5A 3E5HA 4A36A 1U94A 2Q3FA 3W6OA 1SXJD 4DSOA 1Z6AA 3VNUA 2ZEJA 1YJ5A 4ASUA 3ADKA 2IUTA 1OFHA 5DE3A 1JAHA 1AKEA 1TF5A 4Q18A 3B1VA 4FWIB 2QT1A 4LGMA 4EUNA 3LFUA 2ORIA 4WBSA 2W2TA 3E1SA 1I4DD 3QKSB 2GWHA 4NYIQ 4DUGD 1G8PA 1OH7A 4WZAE 2O8EB 2ZRJA 4JLOA 4TL6A 1I2DA 4RD0A 2VP4A 2GJSA 1FW6A 3KZ1E 3AKCA 5FH9A 2A9KA 3ZLJA 1W0KD 1RZ3A 1UFQA 2XZLA 3DMNA 5KDLA 4A82A 1YZGA 3LW7A 5CM9C 4LJ7A 4NE2A 3RYTC 1E2MA 3NBYC 4OK5A 4TT3D 4LWZA 5E4FA 1EWQA 2F43A 1XB2A 2EWWA 2AD5A 1AKYA 5DGXA 1F48A 1Q1BA 1MRSA 2C95A 1T0HB 1ZUHA 5KNCA 1ZD1A 1EESA 1BKDR 1OW3B 4MKIA 1E0JA 3FPAA 1EFRA 3SU8A 4NHOA 3BXZA 4US0R 3BFXA 5FBVB 4DB4A 2YC2C 2CBZA 2G6BA 2QAGC 1KI6B 4PSAA 4KHZA 4M53A 1F60A 2PCLA 1M2OB 4F7WA 1VCMA 2IS4A 3THYA 3K0CC 2X8AA 4RD6A 1ZINA 3EARA 1X6VA 3A1UA 4MDEA 4Q66C 1KI4A 5KSZA 3U5ZB 1OF1A 2G9NA 4DLZA 4URVR 2J7PD 2WWGA 3FYHA 2AXNA 3ZVNA 3LA6A 3EIHA 3RC3A 1DE0A 4FMDF 3K0FA 5EXSA 4C0KA 4V0KA 2X2EA 4JBYA 4DHEA 1R8SA 1FNMA 2D06A 4E5UA 3CRMA 1XCMA 1GTVA 1Z22A 4RFVA 2QQ0A 3FKQA 4DLWA 4PZLA 4C3ZA 2B21A 3C4JA 1TADA 3KKPA 3A1TA 3DKPA 1KK3A 3WNCA 2ZYTX 3A8TA 1Q22A 5KNBA 5C4MA 1UEIA 5KYKA 5JWOA 5HPYB 1CKEA 4TN1A 4JT2A 1FL9A 1NBMA 3OIUA 4QGFA 4FMBB 3KQUA 4XOIA 3A4NA 2OCPA 4DCNA 4EPRA 2OSBA 4QM6A 1XX6A 4L9SA 2QGZA 3IKJA 4DWJA 3FMIA 1FMLA 4HB4A 1AM4D 2ASEA 3RVBA 3NBZC 5F2EA 4A8JA 4KFUA 1TPZA 1UKZA 2VSFA 5LB4A 1K5DA 4MA4A 4YDHB 1NY6A 3TIFA 2R2AA 2EFEB 5F98A 2DWQA 5A0FA 3R9IA 4NZYA 1ZW6A 5DI3A 1YZLA 1G41A 2NOAA 3AVYA 1YZNA 3B1ZA 3RABA 4HDOB 2R6CA 3X1DA 1PLLA 2GXUA 521PA 1T3LA 4HEJA 2C5LA 4QNRA 4AI6A 1DBSA 4LJ8A 4AK9A 2GCNA 4B33A 2NG1A 4OK6A 4EPWA 3ZD6A 4URZR 4CEIA 3ASZA 2P6RA 4QL3A 3PUVA 2H92A 3U3KA 1W0JD 1G5PA 4JSYA 1OPXA 3SJBA 4II7A 3SZRA 1XD2B 2J0UA 4Z1MD 2GZAA 4M1WA 2ODNA 1VG0B 2VHCA 3T06B 5IT5A 4NYJR 5G41A 1B0UA 2KBFA 4MYCA 3AVVA 2EQBA 2HXYA 1DAMA 2WICA 3U44A 1R8QA 2V8OA 4J0QA 4L9WA 3U3RA 2WJIA 4U02A 3PFIA 2ZSBA 1IXZA 3VKWA 2DB3A 5JZVA 1T5LA 3PR1A 4U7DA 2RGDA 5FUWA 5GJBA 5FTNA 4LY6A 1SVKA 2VO1A 1GILA 2GA8A 2BWJA 2WKQA 5EXXA 4OI1A 2V6IA 5E7IA 1LB1B 2NZJA 3DKVA 4QNMA 5FPTA 2WAXA 4Q47A 3UKDA 2N1BA 3BH6A 4L8GA 4TTRA 4CEJA 2VHTA 1LV7A 1GVNB 1NL3A 2ZETA 3K9NA 4ARZB 1NVVR 2WBLC 2DPXA 3X1ZA 3P1JA 2DFLA 3FKSD 1NJFA 2PLFA 4BFWA 2IXFA 5JSZA 4AY2A 2QPOA 1W4BA 1YR7A 3EPHA 4EAQA 1N6OA 2F9MA 1KI1A 1IJFA 5CB6A 2J5XA 5TY0A 1OFUX 4A0RA 4K8OA 2ZRFA 4IXNA 2IA5A 2CHQA 2F3RA 4BECA 1C1YA 2J7KA 3IQWA 3KTAA 3QUSA 3IIJA 4WXRA 4PHTA 3VFDA 4ZDWA 2VQSA 4IVRA 3VNVA 4ZPXA 3FHOA 2AFHE 3THXB 4P4SB 3IHWA 2VRWA 4DC9A 1OYYA 3SJZA 4M9ZA 4HDQB 4TLBA 3CW2A 1E1RD 1KI3A 2JLVA 4FCWA 2AWNA 3U60B 3I5XA 1K8RA 4LHXA 4POAA 1E3MA 2NO1A 2NMVA 1ODFA 2ZI4A 2REXB 2HJVA 1R0ZA 3K09C 4ZKEA 2XB4A 4Q02A 3LNCA 3NTUA 1N6IA 2B7CA 1E2NA 2YV5A 3NH6A 3S1AB 2WPDD 2FE4A 2OLJA 1MR3F 3UG7A 2GJ8A 2IUSA 1IN7A 5JHHB 2H18A 4RFSA 2ORWA 2ZRIA 5CIQA 1NVXQ 1QG2A 1T3HA 2JLUA 1GNRA 5EUMA 1JBKA 1M8PA 4MRRA 3KL4A 3A1SA 2CVHA 3CF0A 2BCJQ 1U8YA 4OQNA 3GEHA 2ONJA 3VAAA 3AKDA 4D6PA 3KJGA 1N0VC 3I32A 1RRFA 4RZ2A 2G83A 4X8MA 4BASA 5LD2B 2VSOA 4IEEA 4NONA 1NIJA 3K9HA 4RY2A 1XP8A 2QT0A 1FOEB 2OBMA 4TMWA 3WNDA 2FX3A 1G20E 2CE7A 3LXXA 4TMTA 5FOVA 1TQ6A 2YHSA 4PC3A 1XCPA 3LV8A 4IOMA 3TLXA 4A6PA 4JKIA 2RGNC 3V4FA 4M21A 1O3YA 3IQXA 4Y0AA 3MUFA 2HEIA 1D2EA 1HYQA 1CP2A 1FUUA 2QROA 3JVVA 4M1OA 4BZQA 4XWKA 4PC1A 1NKTA 4GOJA 4C0SA 5JWHA 5H8WA 5FTKA 3QOFA 2IYVA 2JJ1D 5KSYA 3T5DA 3ETLA 4NL4H 3ND8A 1AZTA 1UM8A 1QF9A 1LY1A 1T4GA 1XEXB 4QJ4A 3RANA 4QHSA 1RJ9A 2GCPA 2LCFA 4ILEA 3ICEA 3CZQA 1J99A 1II9A 1P62B 4BFUA 1GZSA 3A1WA 1KK0A 1ZC3A 4OHZA 2QBYA 1KO5A 4Q4HB 3GLIB 2GDJA 2Z5FA 3T34A 1E2GA 4FCTA 3RRZA 2CE2X 1FX0B 3EIEA 2W0MA 3VKHA 2GILA 4RZ3A 1JPNA 4TQAA 3WRYC 1E32A 2WSSD 3GLIE 4CRWB 4LDJA 3G5UA 2FJUA 1SZPA 2XTMA 4PQFA 4AWXA 2GVDC 3AV0B 3W8NA 2PJZA 2VIIA 3DMDA 3UXMA 1WBBA 1SXJA 2QE7A 4DSUA 3JZAA 1ZC4A 1ZD9A 2ZE8A 3I73A 4XH9B 4DLYA 3I62A 3DZDA 2OFXA 5G53C 1II0A 1CR2A 1NMZA 2FGKA 3LRPA 2KE5A 4YMVA 1W36C 2O8CA 1CJKC 2RAPA 3WBJA 4B43A 2H16A 2OZEA 4BLRA 5CB8A 3PIRA 4G5SA 5EP3A 1VDZA 4GMXA 2MMCA 5FI1B 3GLGB 2I1QA 3GJ4A 2WZQA 1ZM4A 1QHHB 5A5GA 1DAIA 1XDBA 4ZCLA 4Z51A 3THWA 1W0KA 1AIPA 1DAKA 4D82A 3MG9A 2CCGA 1PJRA 4ZIRB 3GLGE 4MYUA 3P27A 1ZJ6A 2DR3A 4F4CA 4TYPA 4KLZA 2GXSA 1UADA 2PH1A 1KAOA 2REOA 4KODA 3TK1A 2VP2A 1ZU5A 4A0FA 3U4QB 4TT3A 5HE8A 1DO0A 2FFQA 4X8OA 1GL6A 4PR0A 5JECA 4I4LA 4OKSA 2VP6A 1NKSA 1ETUA 3OEHD 1OHHD 2E9SA 1VG8A 1G7RA 4Y0VA 4EPYA 2J41A 5EZ6B 1PLJA 4P32A 4TYNA 4FI3C 3KXKA 4JVLA 3L82B 4QJ3A 4IFEA 1E9FA 2YVUA 1HA3A 2QY9A 3Q9LA 3ADDA 3KDSE 4HAUA 4DT1A 1DG3A 2ZRPA 3AEZA 4Q4JB 4M2LA 3GLHB 1VIYA 4XSHA 2ZI6A 4NU0A 2P5SA 4B3XA 3HP1A 3MLEA 4M9QA 4L16A 5EE0A 1GRRA 1P2SA 5TXGA 3WRXC 1IN8A 4XJXA 1KK1A 5GADl 3CPEA 3GLHE 2PLRA 3CM0A 2IBMA 3RS7A 3W90A 2J7PA 3F3YA 4DDUA 3AKEA 1TQ2A 1R7RA 3T35A 1GKIA 2C8VA 4FMDB 3N2IA 4BRUA 1KSGA 3IIMA 1XFAA 1DELA 3PQCA 1XBTA 2ZRCA 2BJWA 3FHTA 2JDID 2RHDA 2FMXA 4DLVA 1M7GA 2IWHA 4D26A 2OCBA 5EE9A 3W34A 1CULC 3WBKA 2WAYA 3N2EA 4C0LA 3MWLA 3BJIC 3OZXA 1KMHA 2IEYA 3CX6A 4M8NE 4Q7LA 1E1QD 3L43A 3QEJA 3VMFA 1G6HA 4M1SA 5ANRB 2CMKA 1U0HC 2XXAB 4E03A 1IXSB 3GEEA 1VPLA 3NXSA 2CLCX 2PZEA 1U9IC 5LBIA 2ONKA 4P0TA 1G5RA 1FTSA 2IYYA 2ZTSA 3RS3A 1OSNA 1OH6A 3K0AB 4NDZA 4LV5B 1AN0A 3OFND 4YONB 2VP9A 2VTKA 1KKLA 5AUNB 4W5JA 1MRNA 2CXXA 3FB4A 4I81A 5AJXA 1S3GA 4LZZA 2D74A 4B3DA 1F2TA 2C04A 3PUZA 1BYUA 4MRPA 2GZDA 3U6KA 4JT4A 1E98A 4H1VA 3EAQA 1KDTA 3O8RA 3GLFA 5FPHA 4N1AA 1U0LA 4K46A 2VL7A 2IW3A 1YU9A 4WA7A 2MSEB 1NF3A 3K8YA 3U7EB 3QPUA 3TGPA 4GBMA 1NSTA 1D6JA 4MRNA 3DPUA 1ZNYA 1ZNZA 4TZ6A 2AN9A 4Z1MA 3EW9A 4JLBA 4LC0A 4US1R 3UMRA 2GAOA 1K5GA 2QPAA 3F0TA 3X1XA 4YXWD 1RC8A 1Q1ZA 3SBDA 2IL1A 4P4UA 1QHYA 3VR2A 4YC7A 4PPNA 3HJNA 3REGA 1N6LA 2PEYA 4F4IA 4IOJA 2QSYA 1Z2CA 3P4XA 2ZANA 3FMFA 3KXIA 4D0NA 1RRGA 3BERA 4G3XA 1TU4A 2DY1A 1M34E 3U7HB 4EPVA 2AWOA 2EFHB 4LV6A 2BDTA 4R2HA 3HR7A 5DSZA 1MABA 2NPFA 3EIQA 3GJ6A 5FPSA 2PZFA 2ZAMA 1GFIA 1LS1A 4QBFA 2W58A 2SHKA 3KB2A 2V4ZA 5DIFA 4BEJA 1Z63A 3AUXA 3KQKA 1JB1A 2QI9C 4BRWA 1H8HD 4EJSC 1E94E 1HE1C 2QG6A 4HUQA 1KI8A 3R7WA 1AS0A 2R6GA 1G8GA 3GFPA 3W8RA 1P75A 1TUEA 5L8VA 1VMAA 3N5CA 3CWQA 4B75A 4C2UA 4EKDA 3C8UA 3TKLA 1W36D 2OESA 2YNMA 3VX3A 3IHLA 2BMDA 4LPSA 1US8B 3EZ6A 4CF7A 3OIWA 2YOHA 1XRJA 3QVUA 3OEED 1NVUQ 4BZXA 2GCOA 4XD7A 4M9SA 4KYIB 1G3IA 1OFTA 3RSOA 3THOA 1UBEA 3SDZA 1W4RA 3PXGA 4AURA 4TQ9A 1Q1EA 4NH0A 4C0QC 1BOFA 5CYOA 2YWFA 2W00A 2D3WA 3SFZA 4L5BA 3QEOA 1AS2A 2ZU0C 3QF7A 4X8LA 1VHLA 4DZZA 1YZUA 1HTWA 4LBZA 3GD7A 2RH5A 3LVRE 1HV8A 1E9BA 3AVPA 3ZVRA 4HAXA 5DYIA 2QMUA 1WP9A 3QY0A 3EXAA 3WNBA 4TLDA 1XXHB 2J9RA 2JATA 3X2SA 4UKDA 4PO1A 4FW9A 1G3UA 5DHAA 2JA1A 4EQ6B 1T0JB 4YDSA 3BFKA 1ZCBA 2WPDA 3OE7D 1N3BA 3RS2A 4ESVA 4JLDA 3LD9A 5KPDA 1XXHE 1GP2A 1G7TA 1KK2A 1OXUA 1U8AA 3ZVLA 1Z2AA 2QAGA 4B3BA 1RYHA 2Q9BA 5KTYA 1P2UA 4BWYA 2ZRBA 3QI2A 1QG4A 3UWOA 1Z07A 2O8BA 1CRQA 1KGDA 2ZROA 4Z54A 1R5NA 4Q4AB 2O8DA 1M7HA 2YINC 1S1CA 1QDEA 1W5TA 1YRBA 1GNPA 4G1UC 5JCZA 3U7GA 3NG1A 4LPKA 2PL3A 5HCNA 1WBDA 5L3RA 1P4SA 3DL0A 1HEIA 2IS1A 1E2FA 4P31A 3W6NA 5DHFA 2O8FA 1KDPA 1PUIA 2W0SA 2DFTA 4LBWA 1E79D 2ZE5A 4PSVA 1G7SA 4L15A 2C99A 2ZJ2A 1QHIA 4RKEA 1VIAA 1JR6A 4KSBA 1JR3D 4JLPA 4JS0A 1G3QA 1Z83A 2F1JA 3AVWA 5K8IA 4TMXA 3HR8A 1KI7A 2V9PA 3QXSA 4M1MA 1YHNA 1R0XA 5DISB 1VTKA 1KZGB 3T5GA 1S9DA 2JJ1A 3BGWA 5EP4A 4A2WA 1XJQA 4Z8XA 3SJCA 3WMFA 4QHYA 2QP9X 3Q3JB 4B32A 3ZVMA 3LX8A 5G3YA 1XD9A 1DADA 3P20A 2ZI7A 3UPUA 2N42A 4TYWA 2QE7D 3QXHA 4OI2A 2EW1A 4M1TA 2ZYVX 3SJAA 4C0AC 3HPRA 1JJVA 4TYQA 3K70B 3LBNA 4G5GA 3CNNA 1Z6GA 1C4OA 2I4IA 2JLRA 4OBEA 4Q7KA 3TQCA 1Q12A 4ZV4A 1Q20A 4YLGA 5E7JA 4M1KA 1EFHA 1NG1A 4L4UA 3H2YA 3QPVA 1UDXA 2WSSA 2WKPA 1HY3A 4Q1CA 1NN0A 4CGZA 1T91A 3C5CA 4MYHA 4RD3A 2OEPA 4DLSA 2J0QA 3AVQA 2O8EA 2AKYA 4FD2A 1Z0FA 2OAQ1 2GXQA 3LBHA 1Y63A 2OBLA 3O8DA 3B8HA 3I61A 2DWPA 3CRW1 4PHHA 2Q0HA 1T8UA 2XTNA 2ZRNA 1DARA 721PA 2ZJ5A 1OB5A 1U98A 2A78A 1NLYA 4MH0R 4O2RA 3GEIA 4BGDA 3CPJB 1IY2A 3NEJA 3TMKA 3Q5EA 3W9YA 5AK0A 4KJZA 4B48A 5FPKA 2CNWD 2BEJA 3I8XA 3TW4A 1LTQA 4V0OA 1OIWA 2Q9CA 2ZRDA 2J59A 3TAHA 1XPOA 2CVFA 2F43B 3B5JA 3QE0A 1IOZA 3R20A 4M1YA 2GBLC 4R7ZA 5KSPA 3U2QA 4OHXA 4AG6A 1NNEA 2ZS7A 2JEOA 1MT0A 2QUZA 4D4MA 2OV2A 4EIWA 3VR3A 4F38A 4HZUA 1OXXK 3AF0A 4LHZA 2YWGA 1G3RA 1CR1A 4Q9IA 4A92A 3OEHA 1OHHA 1NLZA 2VF7A 3NIBA 5GVSA 2VHQA 1Y3AA 4LYHA 4QBGB 2R65A 3THYB 4HUTA 3IPYA 1F3OA 2ODBA 4BLOA 3ZH9B 2F9LA 3E70C 1F2UA 3OAAD 3DHWC 1CF4A 1JQLB 2B92A 3M1IA 5BN5A 1HUQA 1S3SA 4A15A 4ACBA 3HU1A 2ZR9A 3K0FB 3SFVA 4A9AA 3O8CA 5FOWA 2ODEA 2JGNA 2ZJ8A 4OJKA 1TEXA 3QENA 4JJZA 4Q21A 3CB4A 3NC1C 2GXAA 2ZUBA 4UJ3A 5TVKA 1AZSC 1RRCA 5UKDA 5DH9A 4CEHB 3SC3A 1P2VA 1W2HA 3QXXA 4KCGA 4O25A 5H1YA 3BH7A 2OBNA 5KDDA 1HH4A 4MGYR 1ESNA 1WB9A 4PAOA 4LOAA 4W5HA 1KI9A 2WWWA 1TQ4A 3CUEF 4PC6A 4TWZA 1VECA 2AL7A 4O3MA 3PEYA 3K09A 1DOAA 2JDIA 3RLFA 1SVLA 4B2LA 4NMMA 4BUJA 3AVOA 4PXAA 2FH5B 5B30A 2QTFA 3NHBA 5FUVA 4YMSA 4IDHA 2QTVB 1NBME 4MKGA 4XTRA 4Q48A 1KO7A 4A8JB 4C0JA 1E1QA 2YJTD 2ZRMA 4NYIR 1O87A 1W49A 3ZQ6A 3P32A 1YZTA 5J40A 2JIZA 3B13B 4LBYA 4E22A 4XWAA 3RS5A 2Z6VA 3VR6A 5DI3B 5L3QA 2P0EA 3AGQA 2R62A 2G1KA 1FP6A 1D8TA 2YWHA 1A7JA 3CR7A 3RWMB 1R4AA 4TQUS 1OJLA 4XSGA 1NVWQ 4DXAA 5KHOC 1G9XA 1N5KA 1L8QA 2CJWA 2IXEA 2Q3MA 4PFSA 4CZ2A 5KUTA 3R9XA 4GZMA 1M7BA 3OFNA 3OIYA 5GVRA 4UNQA 4LYAA 4BQSA 4DLXA 4TSFA 5BN4A 1LNZA 2FOLA 1KO4A 1ZNXA 4BLTA 4CEIB 1S4QA 1RKBA 2FPKA 1I4LD 3EZ2A 5ELXA 3GJ0A 2XTZA 2EU8A 2OXCA 2FSGA 2J0UB 2RGNA 2R8RA 2YKGA 1M74A 4PTLA 2BKUA 2PT7A 1MO5A 4D80A 2JAQA 5C2JB 3U44B 1MV5A 5J4HA 2YWEA 2BMFA 4B3GA 3CONA 2ZRLA 1N6PA 1ZM2A 5BN3A 2FFHA 1R5OA 3GJ8A 4YXWA 4YMTA 2BHRA 1J2JA 3NWJA 5TMPA 3UIEA 4HLQB 4DCUA 5JS7A 2MMGA 1XMVA 2WWYA 1SHZA 4CEJB 3U3JA 2A2ZA 4KVGA 1BMFD 1TX4B 4G5QA 4PZYA 1DAGA 3L0SA 1X3SA 4QJ5A 1S2MA 2DBYA 2IC5A 2C03A 4DDWA 4M4SA 2EFCB 4AKGA 2B8TA 1II8B 4XD7D 1IJEA 1S9HA 3CPHA 2ZUCA 4JYBA 1CTQA 1VYVA 4HDCA 2IS6A 3P26A 1G21E 1H8HA 3B85A 3KTAB 4S2EA 5JHGB 2VPPA 2BEKA 3SI7A 2A5DA 2CLDX 4LJ5A 4B47A 2J0SA 5FUYA 4AC9A 4AG5A 2Z83A 3V00A 5KSOA 1Q44A 2ZR0A 3NDPA 1W1WA 3KUCA 2NO0A 1G8HA 3B1XA 3OEEA 4F93B 2GTPA 5K8LA 1OFIA 5DO9A 2FEOA 5DN6A 4HB2A 3LDAA 1YR6A 4H9GA 4PANA 4WVFA 4RD1A 1DS6A 1X1RA 1BIFA 1TL7C 2HJGA 3EG5A 4MRVA 4IDQA 1YRAA 1VKJA 1PV4A 5EE5B 3I5YA 3KKMA 4PAQA 3GFOA 2XNSA 4IHQA 4IEIA 5F9FA 2A7QA 4RKFA 2LKCA 3H84A 4V0MA 4C0HA 1DEKA 1X1SA 4RJLA 1VCIA 2C77A 4RFSB 3PV0A 1AGRA 3FWYA 2FWRA 2JLZA 2ZU6A 5CLQA 4D81A 5EJEA 4PX9A 1RRPA 2QAJA 5C18A 3WYAA 5JRZA 2FZ4A 3MGCA 3OE7A 4QC2A 2FEMA 4DB2A 2B7BA 1AGPA 3GCGA 3KFXA 2V1XA 3KFVA 3ZIAD 4Q01A 3Q72A 4WW0A 3ZGXA 2FNAA 4XIGS 5D3MA 3O8BA 3ASYA 5FUXA 4KU4A 5J4VA 4DCTA 2CDNA 4MITA 121PA 3V9PA 4GNKA 1E9CA 3AF3A 1XEWY 3HU3A 4EFNA 3DEFA 1GOTA 3T1QA 4BLPA 4N3NA 5JCPA 4DVGA 4QHTA 4ZCMA 1E69A 5AJWA 4OQLA 1KJZA 5FOXA 4P4TA 2NZ8A 5SZIA 5KDOA 3QVVA 6Q21A 2GVZC 2IYRA 2ZJZA 1P6XA 3WMEA 2IYXA 1P73A 3GJ5A 4LHVA 1E79A 1W47A 2ZS8A 2J0VA 3UMFA 2Y8EA 3VQTA 2C2HA 4KVAA 1FNNA 1XEXA 2XSZD 2W6ID 1JR3A 4C0BA 2G77B 2WJYA 4Z8YA 3N70A 4GMDA 3ONWA 3CNOA 3TSOA 1RJ9B 1G8FA 1F5NA 4R9UC 2OFWA 4O0MA 2QBYB 4QXAA 4LYFA 3AB3A 4UNRA 1FX0A 1MKYA 2G3YA 2GF9A 1V5WA 1IAQA 3NVAA 1FTNA 1G6OA 2TMKA 1WCV1 4UNNA 2ZS9A 4JBWA 3I72A 1U9IA 1XTKA 5FPYA 4NPHA 4KSCA 1KO8A 1JPJA 5CLLA 1T9HA 5D3QA 2NGRA 2ERYA 2GF0A 3IEUA 4V03A 4D2IA 3QKRA 5HKKD 4GRAA 4FINA 5SZKB 1SXJB 4C4PA 1E9DA 1NI3A 3C41J 4NCHA 4JLVA 3TRFA 2CK3D 1KZ7B 1Q3HA 2YOFA 2FU5C 2JLXA 5IK2A 1KY3A 4BFYA 1GSIA 2UZ3A 1CLUA 3L0PA 2O8CB 5JEDA 3NHAA 5CITA 4AKIA 1SXJE 4BEBA 2WOJA 821PA 1R10A 3TJZA 1Z0JA 3CH4B 4OK3A 4CW7A 1J70A 3GLGA 3LBIA 4DBLC 3LX5A 4KITB 2XB2A 4M22A 1UPTA 3L2OB 5GJVC 2XOKD 1Q21A 2HV8A 4JL5A 1H8EA 2UZIR 3KQLA 4LX0A 2QPTA 3AH8A 1Z5ZA 2HCJB 5BW8A 3EA5A 1N6HA 1S0UA 1L2TA 3KXLA 1P72A 2CNWA 3U4QA 3GP8A 5CJ2A 3KKNA 3H0KA 3LY5A 2GJAA 4C7OA 2VF8A 1VG1A 4I1VA 1YR8A 5LD2C 1VCOA 1OE0A 2D2FA 3RS4A 4DLUA 3EZFA 2QN6A 5IDVA 4D0LB 4EPTA 1ZNWA 1BO6A 2VSXA 1ZD8A 3A1VA 4AKHA 3A4LA 3B6EA 1OH5A 1JJ7A 2WJVA 4A6XA 4A4DA 5BYKA 2HUPA 4RD2A 4EJSA 2D4HA 3A58B 2O0HA 5J4YA 3X1WA 1IY0A 4DT1B 1W44A 3CRQA 3R8FA 1FQJA 1X8KA 2XNDA 4B76A 1KSJA 1JEEA 4JMPA 4HLUC 4JZKA 2JJ2D 1UJ2A 4QM7A 4BFVA 1VCNA 1RE0A 3GJ3A 2WIBA 2J87A 3OAAA 4IDNA 3ZZ0A 1ZU4A 4LJAA 2WWXA 3AP3A 4NYMR 2GJKA 1G1MA 1N6RA 1UKVY 3I3SR 3KX2A 4HB3A 2ZXUA 2RGGA 5EE1A 2KSQA 3L0OA 1CXZA 4JKYA 2V6JA 1X8LA 3LAWA 4IDOA 2JIZD 3SS8A 1A2KC 3OIVA 1AJEA 4HB0A 4URYR 1KMHB 2GJ9A 2BC9A 3IPXA 1IN4A 4QBHA 5CDFE 2GEDA 1HT2E 2G0NA 3ECCA 4FMCB 1NP6A 3QIAA 2NO9A 1X86B 4TYYA 5L3SB 3WP0A 2JASA 2QSZA 1WF3A 4DEYA 4TSFD 5JEEA 2GEUA 4A0GA 1W4AA 4CIDA 3U7FB 5JJLA 1GKUB 1A2BA 1F6BA 3KB1A 4Q7JB 4YQFA 4XVRA 3FMPB 4G0NA 2GESA 221PA 2QEQA 2OAP1 1N2CE 1QHXA 3AUYA 2OT3B 2VP0A 3UK6A 3ZYCA 3RRMA 2CL0X 3CF2A 1F2TB 3LQQA 5FI0B 2F7SA 2ZSDA 3SYKA 4ESHA 2AKAB 5JI3E 1MO6A 2ZI9A 4BFZA 4G5RA 2ANCA 3GLFB 3FOZA 4Q19A 4WIAA 2QTHA 3FTQA 1EFCA 2ZJBA 3K0SA 2ZIAA 3IBYA 1ZYUA 3ND9A 1UBGA 3L0IB 4HAYA 4I1SA 2WMOB 4ZI3A 1G8YA 4LHYA 1E9SA 1TQDA 2YOGA 3ZS9A 1SVIA 1G18A 4TL7A 1IY1A 1TTTA 4ZDJA 3LLMA 5JFGA 3X1YA 2PCJA 1OKKD 2FN4A 4WAUA 4B74A 2BIFA 4EFLA 3I92A 1NG9A 2AHOA 1L4UA 2WHXA 5J5CA 4G01B 1XEWX 2C9CA 3RDPA 4ABYA 2HYDA 1CBUA 4OQMA 3VU9A 2BJVA 1Z3IX 2QRZA 2AK3A 1GG2A 4AD8A 1MABB 2J3EA 3AKYA 3VX4A 2VYFA 3BWDD 1EX6A 4AYXA 1S1MA 3ZDQA 2YC4C 2RKOA 1Z6YA 3BRWD 2QENA 2Q21A 1BMFA 2BM1A 4PPGA 4GSYA 3KJIA 3K0EA 4GPTA 4HUQB 2HYIC 5LPNA 4ACAA 1SGWA 3R7WB 4B6EA 1ZBDA 5EP2A 1R5BA 5FR1A 1TF7A 1X8JA 2LWIA 4KFSA 5B2ZA 1KTVA 5BWMA 5DN6D 1NN5A 2P65A 4Q1DA 2QM7A 1EK0A 1R6BX 4DSTA 2CEAA 5FBLB 3U3OA 1N5LA 2Z43A 1ZM7A 3RNLA 4LRWA 3FMOB 2DWOA 4UJ5A 2GCOB 4LBVA 2DFNA 1KJYA 1KNQA 1T5IA 4PQRA 3GPLA 1E2EA 1YE8A 4DIEA 3DM9B 5FBWB 2VLIA 1CJUC 3HWSA 2OUKA 4UQOA 1E2LA 2QNRA 1XF9A 5HCIA 2P6NA 3I8SA 4JLMA 2GEVA 1JECA 2R9VA 4GOKA 1YVDA 4QRHA 3EPKA 2XAUA 3QSYA 3F8TA 4H1UA 2R44A 1S96A 3BAFA 4PO9A 3D8BA 3SHWA 2BM0A 5TB5A 1OB2A 1J7KA 1TF2A 2H5EA 2HF8A 3QF4B 1PZNA 1XXHA 4HYYA 2ZSAA 4NCNA 1I4TD 3RAPR 5EXTA 2GBLA 3AF1A 3UMSA 2J45A 2ZR7A 3BC1A 1ZAKA 4NTZA 1CRPA 3DOEA 3FFAA 1OT3A 3B9PA 3NH9A 4JL6A 1LS6A 1T6NA 1W2GA 2ZJAA 1KKMA 4LUCA 4PQYA 3F5FA 1FP7A 3AVUA 4IOLA 2QAGB 4W5WA 4R98A 4QGHA 4DRZA 1FMJA 3BS4A 1E2KA 3BD9A 2A5JA 5GJWC 5FTJA 3BB1A 4XVQA 2NQ2C 2O8BB 3TR0A 1TU3A 3ZIAA 1V43A 1GKYA 1CJVC 2K5UA 1GDDA 5FOTA 1WE2A 4TLAA 1KOFA 4XVUA 3M4YA 3LWNA 4AKEA 1NN3A 1GAJA 1E2DA 3A36A 2IT1A 3QKTA 2IF2A 2Q3HA 4B2PA 2WWHA 1NLFA 3TE6A 1BS1A 3EC1A 5SZJA 5AJYA 2O8FB 3IUYA 2IHBA 3D3QA 2H8KA 3B60A 4JVMA 4B44A 5M04A 2BBWA 2Z4SA 1SULA 1EFUA 4KLNA 2QP3A 4DCVA 2ZVQX 3Q7PA 1YZKA 2W2XA 4ON9A 4YMWA 1DVRA 1MOZA 2W6JD 4Q5IA 1NN1A 1EXMA 2RMKA 1ZUNB 3AP2A 2GETA 3GQBA 4C9BA 2ZQ5A 1W7AA 2XSZA 2W6IA 4EFMA 3DO6A 4GOXA 2NPIA 2HT1A 4NKRA 4Q1EA 5TV2A 4OHVA 1TMKA 1J90A 4MKFA 1N25A 4XTCS 5EP1A 5IK2D 1JQJC 1Q0UA 2PX3A 1P2TA 2WKRA 3QKSA 4TTPA 1G64A 4KFRA 5A4JA 3EX7C 5LB2A 3T1TA 3G82C 3REFA 2QRNA 1ZMXA 2WTUA 1VYTA 4HATA 5FL7D 4BE7B 1E2PA 2IXGA 2XITA 2RGBA 2PJRA 4U5XA 4KXFB 1KDOA 1H8ED 1QVRA 1TUIA 2HT6A 1OIXA 3CRVA 3W3AA 5C4GB 2WWIA 3V4RA 3IEVA 5HKKA 1SQ5A 2O0KA 5B58C 1FFHA 1XMSA 2FFAA 1EFTA 2GAAA 2OCAA 1ESMA 2A5GA 1E2HA 2C98A 2CK3A 2GK7A 3CR8A 3EASA 4IVPA 2Q6TA 4QGGA 1XZQA 3SHFA 3KUDA 1ZIOA 1Z8FA 1XNJA 1HE8B 2JLQA 2X2FA 2V54A 3C16C 4RD4A 1W48A 3EPLA 4NYJQ 2CL6X 3Q8XB 3G0HA 2FPMA 4M0LA 3K9GA 3QJYA 3AF4A 2XOKA 4R71A 3NKVA 1UDWA 1UEJA 2EVWX 3CLVA 1TNDA 2NO7A 3AM1A 1KI6A 1P9WA 4PZZA 3KJEA 4RZUA 5J47A 3BORA 3B82A 3WHKA 4IW3B 3BOSA 2BV3A 1CJMA 3EZ7A 3Q7QA 2XNDD 4RSGA 3QXJA 3AGPA 4HZUB 1IM2A 3WHLA 4EDHA 1WA5A 2NTYC 1QVAA 4MQBA 1Q1QA 2WV9A 3ZZUA 2WVJA 1D9XA 2JLWA 2FSFA 4E09A 1MO4A 1NY5A 3PJRA 1NVVQ 5FTLA 2OLKA 2P3SA 1P60A 3J81k 5CYPA 3PCRB 1XWIA 2C78A 1WQ1R 2IYTA 4UNSA 3NBFA 1QHSA 4Q00A 2J46A 3IIKA 2CHGA 2Z0MA 3B7GA 4GI7A 4QG7A 4AIIA 5JBQA 2O0JA 1E4YA 1FZQA 1F2UB 1U2RA 2P6UA 3SOPA 3BBPA 3T1VA 2REBA 3QG5A 2C96A 3TH5A 1YR9A 2JJ2A 8OHMA 1OXVA 2V7QD 3D6TB 1YKSA 4C30A 4CEHA 1P61B 3CZPA 2EYUA 4FMCF 4KV9A 2CCJA 1NSFA 5FOUA 3SYLA 1AQYA 2IYSA 4B71A 3WXMA 3SQWA 3IO5A 2B6HA 1ZRHA 3TUZC 3SE0A 1NJGA 3GFTA 1A1VA 2WOOA 3IO3A 3VR4A 1HQYE 2O5VA 3QPWA 3K70C
chains in the Genus database with same CATH superfamily
4P34A 2JAHA 3CPSA 3TAUA 4DCSA 3D6AA 4WERA 2PGOA 3HO6A 3RHFA 5DM0A 1H65A 1BGWA 4MQMA 2VBFA 4PSKA 1TAHA 3FVVA 3HU2A 3RSHA 4RH3A 1LFDB 1DU4A 1YBMA 2PLWA 3CKLA 4FFSA 4OOEA 5C4IA 2IYLD 2P5TB 4Z2YA 3WZMA 2FFJA 5HSGA 5IWCA 4L75A 3BXOA 1BDJA 5DYNA 1EBUA 3ZWMA 1EQ2A 2B2CA 3T7JA 1OYOA 3G23A 2VHUA 5BXQC 5I4IA 5JJCA 1JDZA 4ZEOA 4X3PA 5AVOA 1NIPA 1EWYA 1F7UA 3QK7A 3HYTA 5ALFA 3SR4A 3HKEB 5FF9A 4CMGA 5A9SA 5IT4A 3B1WA 1IN5A 2I5PO 4MMZB 2PT6A 5CXUA 4G1CA 3UMGA 4DR3B 1ESCA 1SXHA 1A7KA 5JD6A 1PHRA 1QF6A 1Y4ZA 4PNHA 2BW0A 1Z0AA 3GRRA 5EWMA 4JU8A 4ZYLA 2BTQA 4YPOA 3ENNA 3R77A 3H1TA 3CH5A 2HHCA 2SNIE 3CNEA 4R2XA 2WHYA 3TDNA 4CI0B 5J2UF 1GGJA 3I4CA 1P7ZA 3NORA 5BRNA 4KO4S 4URUR 3PD1A 3WLMA 4MGZR 2JFHA 5CUQA 4DR1B 4WL0A 1ONBA 1QUEA 4WNAA 2HJRA 1U4SA 3K1TA 3HEMA 5DHSA 2IJGX 5LR6A 1DLIA 1H5UA 4QSMA 4XUEA 3D7MA 3WTCA 5K2MA 4KBFA 2VHJA 2R5NA 1OAOC 4LRTB 4G4GA 4URHA 4Q9JA 4N47A 3T9BA 3B1KA 4KPYA 1ITZA 1WZNA 3CIOA 4E07A 2CLMB 3RSQA 4UHHA 4WFIA 4BLSA 3VSAA 1EGQA 2EG9A 3PQ6A 4ENUA 4QG3A 3EYAA 4P3YA 1T3SA 3PZBA 5EIBD 2VFAA 3IV9A 1DQSA 3SVZA 4TRJA 4AM8A 4FYHA 1AG9A 2XX3A 2TS1A 2BSAA 5JSZB 3CCFA 3PWKA 5E6RA 3I9KA 2BONA 4R84A 3WAJA 5JFTA 2QNBA 1DQNA 5DGHA 5B1EA 4A8PA 1TIPA 3EVGA 3U31A 3PL5A 4DTIA 2GZRA 1CUSA 3K0HA 4UM9D 2P2DA 5ES3A 5LSAA 1T2VA 2H1OA 2ZITA 4RIGA 3V7YA 4TKUB 1JBQA 2O3SA 5EHGA 3Q9UA 1BXZA 3THXA 4YEDA 1FNDA 4UEOA 2ILTA 1TM2A 1WCYA 4GWGA 3PEWA 4D0RA 2DUJA 1YONA 2J31A 4W5QA 1AKVA 3OQJA 1BQ4A 2F3TA 1JSRA 1W4CA 4O4HF 3PDCA 5HF5A 4DIBA 2GHIA 3EEYA 1E2UA 4UTZA 1DC5A 4DXDA 1U7DA 2XEDA 3K35A 3LO5A 4P84A 5J4LA 2Y1FA 1KSFX 4JUAA 3SQXA 1J0DA 1UBRS 3KV3O 3COVA 3Q12A 4KFTA 1YKFA 1TM7E 4ZQEA 1KMCA 3AIOA 4PLGA 5KB3A 3DLHA 4POOA 2VK1A 5HX7A 5DWVA 1DTWB 2J9XB 1KO1A 1WHTB 2C83A 3RO7A 4FB4A 4MPJA 5DNWA 3ADCA 2Q6VA 3TFOA 2ZWAA 1P4RA 4G1VA 4WGGA 5C9ZA 5EVJA 4ERNA 1QSGA 1AGXA 3JVUA 1VHDA 1DRUA 1ZVMA 1S7CA 2GZMA 3QU5A 4GLBA 5FOQA 4CQLA 4FKMA 2ODAA 2DJIA 4KG7A 4ETNA 5BR4A 2ZUFA 4M0KA 1KYQA 1V4VA 1A98A 3BXPA 4Q15A 3ZQ4A 1W5EA 1BXKA 3DE2X 3AJRA 4BCBA 3ELYA 1RJWA 2R6FA 3F4KA 2I3BA 4AY3A 3UTCA 4CKCB 1DQYA 1NV8A 2V58A 1CJBA 4KQMA 1UKYA 3AZPA 3QUTA 3JSXA 1S8NA 4E7OA 3D3WA 2IZ0A 1GNQA 1IB6A 1VYHA 4EG1A 5B3KA 5JJKA 4W7SA 2J07A 1YB7A 4DG5A 4Y30A 4ZCRA 5JBIA 3NT2A 4IRXA 4LRYA 5J5VA 5REQB 1P0MA 2X9VA 3HJHA 4H7HA 4A1FA 1R6VA 3BILA 1YR2A 2OKGA 3GXOA 3TXYA 1YHYA 4KN9S 1N6KA 2D54A 4KXNA 4YJGA 4D3ZA 4PX5A 1L7VC 2CBGA 3OFVA 3WQQA 3T7RA 3I9V1 4QKQA 4OJNA 1G7CA 2C4TA 3DO8A 3NRCA 5T4HA 1Z5WA 2F6RA 4O29A 1D2NA 4E5PA 3G85A 4B73A 4YRNA 3DCIA 1TB4A 4UM5A 1OA0A 2W2VA 4YBZA 4HPWA 1CQPA 5ALUA 2HHHB 3JYPA 3ZY6A 5TPWA 3L7MA 2X86A 5IF9A 2VWPA 4F3CA 1DBVO 2NU7A 3VGJA 3E84A 3AL2A 1NYQA 3CSUA 3PC2A 1V9SA 3DJYA 4NCIA 1BE8A 1E0KA 1SD2A 3B3JA 3KYCA 3BSFA 4HX2A 4XYBA 2W6QA 4DKXA 2VXCA 1XZPA 1WXHA 1MLDA 1PVOA 3EEIA 1LVGA 4IIJF 2F55A 1D6NA 4X6YA 3CUWA 3TW8B 4BZPA 1UJBA 4LXHA 1T8WA 1EVIA 2FPIA 4US2R 3ZQKA 2P67A 1XDGA 5KQPA 2AQKA 1X70A 3VHRA 1N57A 4GUDA 3OPYB 3PFCA 1PFUA 2ZI3A 2ZSIA 3FDZA 3IAAA 4XLLA 4MUBA 2DGDA 2XVAA 2DFVA 4Q4HA 2A3NA 4KQHA 3DUFA 3RRFA 5EXPA 1S3IA 1NAHA 8ABPA 2JLYA 2IZ5A 4DR5B 2IK8A 4C6SA 2R60A 2Q8PA 1ZD5A 2H9AA 3FFTA 2HLHA 3MIZA 4KGDA 3DB2A 4ASUD 1FDVA 1Z62A 2NZXA 2QJOA 1Q91A 3P8ZA 2RFLA 4QQRA 4ZEMA 5IRCD 5CW2A 2YWBA 5JMWA 4RABA 4MAAA 4JEMA 2G06A 1C7FA 3WYGA 2Q27A 4PHFA 4RF4A 2CEKA 5F64A 3T41A 4WN9A 2YVKA 4F91B 4BV3A 5CA0A 3FYTA 3GPDG 1LWNA 4PAGA 2QJTA 2YXEA 4OP1A 4CF6A 5ADVA 2WQ7A 2RHGB 1P74A 3H6GA 1IJKA 1ORHA 4XCXA 5GV8A 4YCSA 4CM3A 5HZGA 3RUIA 3H4MA 1HKHA 1VCHA 2ZFUA 4INJA 1GZ3A 3EA4A 3KQPA 4BLQA 1O9HA 4XQ9A 4IWYA 2YZGA 1RAHA 4IF4A 3QKRB 4E5YA 3BK2A 5LMUB 2I66A 1UWKA 5GM1A 2GPYA 4C4YA 1SIOA 3FDIA 3FFBA 4CTMA 1C41A 3BA6A 4W9NA 5DLQC 1IIRA 2QZZA 4ZAZA 3TQFA 2RAFA 3AQ4A 4FFLA 1JA0A 1QHHA 4ZT6A 3RKRA 2VKQA 4MI9A 5JCOC 1FP4B 3GMSA 3B6IA 1JNYA 2MSDB 3HI6A 1RAIA 4MVJF 4KQFA 1SKQA 1UZUA 3LOPA 4LN1A 3RV3A 4BNWA 3LP5A 5BSTA 4E3WA 4Z4FA 1P5ZB 2WSMA 1RC1A 2IYUA 3H83A 3O6VA 4HDRB 2IV7A 3U61B 4K03A 2YVLA 2Z8YA 3I76A 1U11A 2PMDA 2ZI5A 2IWRA 3KD2A 3ZTWA 4J4BA 2FUNB 1R00A 4K0RA 3BL5A 1A5TA 2C20A 5NLLA 4BY9E 5ERGB 4KK4A 2O4UX 4BNZA 5JTUA 1JVBA 3JQQA 3C7KA 4YQYA 2C2OA 3OU7A 4FSDA 4G6ZA 3DYIA 2EFYA 3IURA 2DULA 2QKYA 2XA9A 1P9LA 2HDNB 2KS6A 3CO5A 3I30X 3HYNA 1C4WA 2I4NA 4J75A 4MWCA 4UE6A 5PGMA 1CQJA 1ZZGA 3PHJA 3TCNA 3Q9SA 4TQGA 3GLHA 5JQWA 2AH5A 5JROA 3LLUA 1QE0A 2OFOA 4AMGA 2ATVA 2Q1SA 2QZPA 4Q1AA 4ETIA 1IBKB 1AO3A 1M2FA 5JTTA 2HMUA 1G4UR 4OCZA 3ILXA 1QVZA 4YR7A 2PFSA 2RGXA 1YT5A 3BCSA 4URWR 2CVQA 1QP8A 3CSSA 2R66A 3V1YA 4OH1A 3DZ8A 2ZATA 2OXFA 4K6HA 1PZFA 5EFOA 3IQEA 5CEJA 1FE8A 1EG7A 4ND8A 1ZH8A 4RVOA 1IL0A 1G5HA 2CZGA 3M0EA 1Y7TA 3M89A 5BSRA 2AD1A 2RHMA 1KMMA 4OGFA 1O6FA 3LT2A 3QUCA 1V11A 3LH5A 4LQ4A 3M6MD 2Z9BA 4RCZA 2IRWA 1E96A 1PX2A 1E61A 3F7OA 3MMXA 1OZGA 4RX1A 1XZGA 2NUBA 4JLNA 1B23P 3WGGA 1L4HA 1ODJA 2BAGA 3C6BA 3O47A 2AZ4A 3PEVA 5DYGA 2QSUA 2GTHA 5A2GA 5J2TA 2E87A 3L8HA 3PQDA 4UTOA 5A7GA 3NONA 4RPJA 4QU8A 3GEPA 1IWOA 3T7CA 1NURA 5CDFA 2V1UA 2V7QA 4H2DA 5EJIA 1KEZA 3QNUA 4S1PA 2VPTA 2Z56A 3E2MA 3IKLA 2XCIA 4DHWA 3IBFA 2X1VA 3GNLA 3K0BA 4HAOA 4OATA 2N0SA 4EATA 4GBED 4ZCIA 5CFLA 4FS8A 4OQZA 3HBMA 4QYWA 5HS6A 1XI2A 4QFCA 2CLOB 1HLGA 3RGGA 2Q5IA 2FSPA 4YROA 5JW6A 3DFIA 1QKJA 3DVLA 4V3CA 2D2EA 4RCVA 3D81A 3L92A 5KWEA 1Z0IA 2IITA 1JFFA 2Y2UA 3ZLTA 4B3FX 4ZJYA 1YIDA 1RJGA 4D8YA 3TSCA 2W83A 3I6ZA 4YRRA 4JBXA 3CVJA 4D5EA 3NS7A 4QBIA 5KOIA 4N18A 4Q03A 1YIAA 5KYTA 1PFGA 2WWTA 3Q2IA 4ITRC 3RHTA 4Y6OA 2PBRA 5IT0A 1FTGA 1G19A 1GN9A 1QS0B 1ZGCA 3RSZA 4KR3A 3CEHA 2ZPTX 2XNCA 3IUBA 3CRRA 1XZJA 2NV2B 3A6HA 1MCZA 3GUHA 3UAZA 2I4MA 2DQ4A 1JDNA 4X9XA 4G1MB 2HUNA 1AZLA 4LTDA 1KORA 3A9WA 3DT9A 5FKJA 5FQOA 4ENWA 4YXFA 4TLLB 3WXBA 5BOSA 5JRDS 3INGA 4OYHA 2UUPA 4A91A 3OURA 2Z8YM 3GLFE 3EBPA 3QVSA 2WFLA 4V02A 5J2UB 4M0FA 4BBAA 1A88A 1XZMA 3MJRA 4IOKA 2G0TA 3V4SA 4CM8B 3L4JA 4TS3A 3MERA 1Y89A 1PFVA 1PS0A 5K09A 2XQVA 4CXMA 3GRKA 1C7IA 1J0EA 1COWA 1YQTA 2ZCJA 1A4RA 3HKCA 5FA5A 4YQEA 3KKQA 1KSHA 4R2JA 3GVIA 3DKRA 4E13A 1AA9A 4BQEA 3KALA 1LDMA 5BQ5A 3ZZ1A 3ZGLA 3A6ZA 3LXMA 1DKLA 3M3DA 4GZ5A 4F4JA 5GGXA 2EDCA 1K6EA 4M1QA 3NGMA 3T7TA 5AJVB 3NWBA 3CX8A 2C2YA 4EY4A 1DT5A 5DIZA 3PNOA 3QHQA 3HVUA 2RKWA 3O3CA 5CLFA 3CF4A 3DZJA 3JQ9A 3ZUGA 1WY5A 1CU1A 2BKEA 4IVQA 3M6AA 1ZCAA 3LK7A 4UCXA 4BZZA 1M8JA 4MDFA 3K96A 5A0TA 1PWZA 10MHA 4DRXB 1UBUS 3O1JC 4JJKA 1CYDA 1N9ZA 1GZ7A 4AKTA 1NDHA 5CR9A 1ZZEA 1YUMA 4YMHA 2C9YA 2WU3A 4NI5A 1U2PA 5A0VA 1ULSA 4YRGA 1LLQA 3HYRA 4FQ5A 2M6KA 1F2VA 1SHTX 4RHXA 3U1TA 5JR3A 4X95A 4RQAA 3NIDB 3VKGA 4L4SA 2BUAA 3OCZA 4P81A 2YWJA 2JAPA 4LJ6A 4OG2A 3SS9X 4LRSB 2NU8B 2W9XA 3VSBA 2AG6A 2P68A 2QRKA 1V96A 2NSHA 2PMWB 2YUTA 4TS9A 4P7FA 4ZXPA 2QLMA 5DULA 3RI3A 5F35A 3SQDA 4U7JA 2WJ4A 3BD8A 2C61A 1EB8A 4O4HB 1SAYA 1K98A 1XJ0A 1XTRA 1CUFA 1MEEA 1K8ZB 2CF6A 2QB5A 2PKXA 5ITZA 1ZK4A 1ECJA 2PEZA 1PTKA 1IN6A 5K0CA 1R6DA 4GYWA 3U7QB 5I7WA 2B6NA 5FFMA 1E2IA 3ITKA 2R79A 4I55A 3GH1A 3PYLA 5HR5A 1ECGA 4MV6A 3BIOA 2WIAA 3JYQA 3GROA 3IAXA 2R47A 3OESA 1TA4A 1P4HA 3ABZA 1QM5A 1WXQA 4KZKA 1N5RA 3OLYA 1VKZA 3IILA 5TPZD 3ZE7A 5CB4A 6ADHA 3I45A 3OQVA 1IWBB 1Z0UA 2E4ZA 1J0AA 2EATA 3FVQA 3R7SA 3HPQA 5JYEA 3IKMB 3LM8A 4AL4A 2VDMB 1DRVA 1QZXA 5BV0A 2F1HA 3MTDA 3TUJC 5F9HA 2DPMA 1G1AA 1FS4A 3SMVA 1ONPA 3OF5A 4OQ4A 2DKOA 4XIYA 2CUKA 2L0XA 2P30A 3ENZA 3KSMA 1KZ1A 3VR6H 4D4JA 3BG5A 5BMVF 4WE3A 2FKAA 4M6WB 2R86A 3W3ZB 5ALOA 5K9ZA 2EP5A 1E6KA 1OX4A 4Q4AA 2MSLA 3CIFA 1DAEA 2VA9A 3TBKA 3Q85A 5LLTA 2IS2A 2GZ2A 2ECPA 2O8DB 3TQHA 1NOIA 4WGFA 5C5CA 1PGJA 2OYCA 2DQSA 2EP7A 4JEIA 1Z29A 4C08A 1O8BA 1R0SA 1QK4A 4BLUA 3C3XA 1HQCA 4KBGA 3CKKA 4J91A 1U3WA 4R1NA 1Z35A 3HKBB 4WLOA 4V39A 1NONA 4RQTA 1GWNA 4R41A 3DM5A 2HBYA 4BPBA 3ESBA 3B2EA 3A4YA 1Z28A 3BTVA 5EUQB 2X8BA 5EHXA 4QX6A 1NMYA 4RTSA 3I5UA 2QL6A 2C1EA 1KRXA 4WI1A 3BB4A 3W05A 2QK4A 4OL0A 4RGYA 4LDPA 4L50A 3VYUB 1XYYA 3WO1A 3L7OA 4X00A 2Q7XA 2VF5X 4X63A 4TZ0A 2UYOA 4Z4CA 1U1FA 5E38A 5AO9A 2BFFA 2D8AA 1GRCA 1E1DA 2RHJA 2GYYA 2EGUA 2H2AA 2VDKB 2ADFA 2Q2NA 5HJEA 1E5LA 1Y8RB 5K3DA 1UBKS 2J4FA 2AHRA 1W46A 1SCUA 5FBZA 3OOSA 4IRUB 4MCHA 4C7JA 1SN7A 4ZYTA 2IHNA 3GGOA 4GX0A 4K3VA 4K88A 3GFQA 3A05A 4W7IA 5A4MS 2KM1A 4UEJA 4ZO8A 4A0HA 6PFKA 3QBTA 2C2GA 1E1CB 3QELA 2Q5CA 2H4ZA 2ZRHA 1GTL1 5HE9A 2G9RA 4N0EA 3JQGA 2EZ4A 3RR2A 1A1SA 4E7PA 1E9EA 2E0IA 1SG9A 3K0KA 3MJFA 4UFNA 1ZMOA 2GX6A 3CLUD 3E5HA 3IR6A 1U94A 4IRMA 4ND1A 4EOGA 1U2GC 4COKA 1SXJD 1M9NA 1Z6AA 3FG9A 2CV2A 2GA9A 1U3GA 2H85A 4GX1A 5AW5A 3ADKA 1PUXA 3QTTA 3R7BA 1TF5A 4ZVPA 2IP4A 1NBIA 1C2TA 3FCXA 4XIIA 4LGMA 4GPD1 5FRDA 3ZWVA 4M1EA 2I3AA 2ORIA 3LFUA 4CMIA 1XLVA 5KYNA 4NICA 1I4DD 1S4MA 2OV4A 3HDQA 4FTWA 3STVA 4LF4B 4KAJA 2WJ6A 4DUGD 1G8PA 2Q3LA 5K3AA 2WA2A 5F7XA 4MV3A 1ORVA 3O0DA 4EHKA 1OH7A 1I2DA 1OBHA 3I04A 4JI8B 1CQWA 1Q74A 4H1TA 4L4YA 4F2HA 3A32A 4UOQA 4CMAA 1STOA 1YDMA 3UPDA 1FW6A 2BGJA 5JO9A 1FSGA 2V45A 3KUXA 4G36A 5KTKA 3DOIA 2J5RA 2MYTA 1ZJYA 1RZ3A 4D92A 5B36A 3Q6IA 3DMNA 1YL5A 1MBZA 2I4RA 4J9VA 1JLRA 4QUGA 3ICVA 1DJQA 1U0FA 1DRJA 3ZNOA 3IMFA 3RYTC 2C0CA 3NBYC 4OK5A 3RK4A 1IFXA 2VRCA 2XZTA 2WD7A 4XX0A 3PJEA 3UMJA 4Y98A 3I9V6 1O4WA 4WQMA 1XB2A 3ORHA 2V5AA 2DTDA 2AD5A 4X60A 1AKYA 2VNJA 1NU6A 3SZLA 1JH8A 3C39A 3HFGA 3H2ZA 3MIIA 1NR7A 2P4HX 4MKIA 2QJWA 3L1UA 2B3DA 2J85A 4C43A 1Y3CE 2Y05A 4E51A 3NO4A 3U26A 3OSUA 1LLUA 3FPAA 2ZT7A 1C0PA 3KLPX 4NHOA 1L1FA 4D3SA 3L93A 4US0R 1N5DA 5EMJA 2CFOA 2YC2C 2CBZA 4IH4A 3S6JA 3CUYA 3PUKA 1L5HA 3B2QA 2XMPA 1F60A 3WV5A 2PCLA 4H1HA 4GPZA 1EINA 1FFSA 4NZMA 4O63O 4NBWA 4GLLA 4ICIA 3K0CC 5B1SA 2PZKA 5DBIA 4CF4A 1RHKA 2LCIA 2A35A 3CBGA 1X6VA 3A1UA 2GARA 1USVA 4GPBA 1M1NB 1C1XB 3U5ZB 4IICA 1RQLA 3ANNA 2J7PD 3KSUA 5CNKA 3LA6A 1UANA 3O7MA 1UXJA 3NHKA 2H4FA 5KNLA 4FMDF 1NQOA 3K0FA 4O4JA 1SU6A 5EXSA 4DHEA 2NN3C 4JBYA 4RWEA 3LF2A 3D8TA 1SOWA 1X9IA 1NASA 1A9PA 3MTGA 3H2IA 3BRCA 3FKQA 4F8JA 3LC2O 3TYXA 2B21A 3C4JA 3JWJA 1A5SB 1TADA 3KQVA 3IL2A 1YXMA 4Y6LA 5FA8A 2X6QA 4KAFA 4B3IA 2P2SA 3A1TA 5LOVA 5JDCC 2ZDGA 1FMTA 5AK4A 2OYSA 1DWPA 2ZBFA 1ID8A 5TSDA 1N2BA 3DEHA 4DJJA 1QTIA 5GINE 1F8GA 3F6YA 3IT2A 3IX7A 4C01A 3OIUA 1A8QA 2JGDB 4FMBB 1EFLA 4OUDA 4G8DA 1U1DA 3OM8A 1DGQA 1JLHA 1WPQA 2OCPA 5LYYA 4QM6A 3MBKA 3PGKA 4Y2HA 1XX6A 4B9AA 1GLVA 2ACKA 3JRNA 4EKGA 4I9UA 1N8KA 2HDHA 1FMLA 4XIFA 5AVKA 2FQYA 2AGVA 2NU6B 5F51A 2VNKA 4FZRA 1Y1TA 2VK8A 1RWXA 1RKXA 2MDTA 4OSOA 3CZCA 4PGMA 2VSFA 4HWRA 1K5DA 2WMDA 3A26A 3OTWA 1KAQA 1ZH6A 4HGZA 4XYMA 5LB4A 2R2AA 3D5EA 3T4EA 3CEAA 3O1LA 3KU4A 2H51A 4UU0A 5F98A 4AO8A 5JPCA 1Z3CA 1P45A 1M6EX 5JY6A 4WSOA 3GCWA 4HKTA 3HL0A 4TV9B 5ELLA 5JSQA 1H1TA 3D4LA 1EZZA 3R0VA 3KHUA 4NEGA 1SMKA 4F85A 4R8SA 1R50A 4YAJA 1DT3A 1PLLA 3FF4A 3I04M 2AOXA 5HKBA 2C5LA 4QNRA 3E9MA 3RBVA 4LJ8A 4YAUA 3TQSA 1YDFA 1P8AA 3LU1A 2FDXA 4ZRDA 3KZMA 4BQNA 4K6OA 1RKUA 2W2QA 3ASZA 2GHQA 2JIPA 3B3QA 3PUVA 1CFJA 1TJ4A 1I33A 2I1WA 3R6TA 4QL3A 3U3KA 3DTVD 4II7A 3CR3C 4C7BA 4CDMA 1IEVA 2J4CA 1UKCA 3OQPA 2PKYX 4EW6A 3GPIA 3RSSA 3VU0A 5IT5A 1BD4A 1NLMA 3MWGA 4QOJA 3PR2B 4V3BA 5J5AA 2NADA 3KEQA 4MYCA 5JISA 4NBVA 3TL2A 2WICA 3WB9A 1CR6A 4JJGA 2REQB 4HYEA 4N6OA 4XQGA 1XCBA 5KX5B 3SX0A 1BSVA 3Q6MA 1P0QA 4HNRA 1BKSB 2MR5A 4TSKA 5ECGC 1AX9A 4XXHA 2W2NA 3SHTA 2EZUA 4YN3A 2DB3A 2R1ZA 1N2ZA 2ZBGA 1EUZA 2Y0EA 2RGDA 2QN9A 2YJ3A 3FMGA 5EZYF 1DC4A 1M6HA 1AOXA 5BQPA 2GA8A 3MCZA 4PNEA 3H8SA 1ZOIA 3GMIA 4F6CA 1U8TA 3KXPA 3BJZA 3DGFC 3BSWA 4H7KA 5FPTA 1FDTA 2WAXA 5HZHA 2Q7OE 3HVRA 2VHTA 2ZETA 4ARZB 1VIDA 3A4IA 3UXHA 2WBLC 3TEMA 4IH1A 5A3QA 4V1CB 1T1IA 3T5AA 4ND7A 2O48X 1NJFA 2H7XA 2A0KA 2HC9A 2IXFA 2C0PA 3HGTA 3L77A 4EAQA 1HDGO 4B7AA 1AV7A 5E1BA 3PJDA 3LPDA 1W4ZA 5KMGA 2ZRFA 2IP2A 1NA5A 3C7AA 4CM1A 3H0EA 5I4BA 2CHQA 4IJ5A 4ZXFA 4IGFA 3ZI7A 2J7KA 3A0RB 3KQMA 1U3VA 2KMLA 3A1CA 4YCAA 4OUKX 1E3DA 4PHTA 4ZDWA 5GPBA 3NUZA 3I1IA 3TLAA 4LVOA 3ENQA 3FHOA 4P4SB 1YL7A 1A7UA 2IGTA 1T2AA 3FGOA 3RVRA 3ZDZB 1ISHA 1JIQA 1QQ5A 4M9ZA 4HDQB 4TLBA 4MI6A 1U2DA 3SJZA 1Z7WA 1GTZA 2DBRA 3LIIA 2FCAA 2IXBA 3P2EA 2GPBA 3VYTB 1YQEA 3AZOA 3HJFA 3MAGA 3KE9A 4YIHA 3F96A 3AEUA 3BKXA 3NU1A 3ADOA 4LHXA 2NO1A 3UTDA 2WP8J 3JAKA 4IDCA 2NMVA 2X0IA 2ZI4A 4BJHB 3ANXA 1QFXA 2REXB 1NWCA 3QNMA 1AC5A 1KH3A 3CG4A 3K09C 4Q3KA 5FHRA 1DCMA 4UUPA 1BW9A 1NPDA 1V35A 2I33A 4OKNA 4U2DA 4IJQA 3NTUA 1E2NA 3LHSA 3PFNA 2JFPA 2WJAA 3F2IA 4CLRB 2HRRA 4X71A 4IXDA 1UXHA 3SIRA 2IOFA 1JTEA 1QGUB 5JHHB 3E81A 5EOVA 3SCZA 2CW5A 2GN2A 2ORWA 2ZRIA 3GLUA 3GLKA 3PKIA 2EEPA 2I87A 2C31A 3GFFA 3OA0A 4YRTA 5DM1A 5I45A 2JLUA 3GFBA 4BO1A 1U0OC 3U7RA 1KXJA 1M8PA 3CZAA 1W87A 1S3FA 1ZBQA 1BE0A 4DQ0A 4L72A 4BO5A 1FDSA 2CVHA 3CF0A 3VZSA 4GOND 1Y8CA 1U8YA 3DEZA 4YRDA 2BHNA 3GEHA 1PZXA 3O2SB 4A0QA 1XNQB 3ZC3A 5HQ3A 1G20B 3ORRA 1OCEA 5DMHA 3KJGA 1QWSA 3K4PA 3O8QB 4RZ2A 4X8MA 3KPUA 5LD2B 3JWEA 4OPMA 2ZIUB 4CMBA 2J3QA 3M2PA 3ESDA 1QPBA 1EYZA 1NIJA 2ZYRA 4MB0A 4HLNA 5E4JA 3P9SA 1L5KA 5BMVB 1XP8A 1VPEA 1T2DA 1FOEB 2J0EA 2QT0A 4TMWA 2FX3A 4JXJA 2OD7A 5FOVA 1D4OA 1TQ6A 2EHJA 2JHCA 2YHSA 1JDPA 3BHJA 3L7IA 2JFFA 4IOMA 4IMIB 4MA0A 1T9AA 2XVXA 3T7KA 4A6PA 3OZUA 1Q0ZA 4JKIA 4X91A 3A1DA 1T4DA 1QORA 3ANYB 3DC2A 3WZLA 4B6PA 2YTZA 3HQ4O 1HFKA 1HYQA 1CP2A 4XD2A 1UJNA 1GPNA 3L8FA 2A84A 4M1OA 4QAJA 1VXOA 1BDIA 1IYZA 2SECE 1GGVA 2EX0A 2GEKA 2FF5A 3DBOB 4V0RA 3R7FA 5CPBA 2YCBA 4YI5A 2YFYA 1S6YA 4F5ZA 2DPHA 3OJXA 1PR2A 3GEDA 1YZ3A 5EJ4A 1QBGA 3ETLA 3VKFA 5HYVA 2X58A 2YXNA 2Y67A 4KC0A 1DG9A 3N39C 3N2GA 3GZNB 3ND8A 4RV4A 3U81A 1UM8A 1QF9A 1DEHA 1LY1A 1T4GA 2XDQA 1G2PA 3L7KA 4L8VA 5FWXB 2PIAA 2WUGA 4BNLA 1RJ9A 1XVLA 3GZJA 3LUFA 3BZUA 2OCIA 3CZQA 4LZLA 1II9A 5JS2A 1BE1A 4HDAA 1KK0A 3IJPA 1TZJA 2MYPA 1KVSA 3KVOA 3T34A 4DF3A 1GEEA 2ACEA 5IYZF 1OTXA 2QZSA 3CS3A 3EIEA 4UDYX 3I2FA 2WWRA 3VKHA 2GILA 4EO7A 1E32A 4AZSA 2WSSD 3VXKA 3GLIE 4BAZA 5AKGA 2Z6UA 1X1EA 2PJZA 3DE5X 3ZX4A 1M6VA 4DY6A 5LQUA 2XW6A 2X4IA 3VMMA 4F8EA 4NMHA 5MN5A 5GIPE 1U0BB 4X20B 1VBFA 3CTMA 2WDZA 2WVHA 4F2GA 3JZAA 4G0OA 3K31A 4QODA 1SQFA 2BFAA 3GAAA 3MAJA 4XH9B 3TZBA 1OWNA 3WLOA 3VPDA 4F3RA 3TRHA 3KPYA 1YI1A 4JOSA 1JLMA 4DILA 2JLBA 2MYNA 1II0A 1Z2EA 2FGKA 2J33A 3DMFA 3PTLA 1RSZA 1KP9A 5CU7A 4ZT4A 2VUSA 4YMVA 2VT3A 5FXMA 1W36C 3TMYA 4NECA 4B43A 2H2HA 3DNFA 2OZEA 3S8EA 2RBKA 4XUGB 4F6RB 5CB8A 2Z58A 4P5PA 3PIRA 3GJZA 3PHBE 4PW0A 5K4GA 2WAAA 3GGJA 2MMCA 4LYDA 5JCXA 2H3EA 4UOZA 5LP6F 1H6AA 1OTYA 4HDNA 4ZCMA 3V6MA 2OVBA 3HSYA 1H2XA 5J1SB 1M33A 4Z51A 2WSBA 1W0KA 2H6EA 1VL0A 3B2NA 1PAUA 4G37A 4TS4A 1DAKA 5F5NA 1TXGA 2J3KA 4D82A 5I48A 2YRXA 1TT7A 4ZIRB 2LUOA 2VG8A 3F6SA 1GLGA 5DW3A 4G0PA 4TYPA 4CV0A 4KODA 2GXSA 2PH1A 2NT3A 2RHRA 3ASUA 3WJAA 4PLYA 4F1JA 4R0MA 1H6DA 4FFRA 4TT3A 3QLJA 4HDSA 4O2AA 5ALNA 1V3QE 1PO7A 2FFQA 2NQTA 1HLFA 4TVSA 1UBOS 3JTEA 2J3JA 2VP6A 1NKSA 3R0IA 2Z8XA 2R8OA 2I67A 2V7EA 2E9SA 1VG8A 3I0ZA 3Q3VA 3V80A 4I2NA 4JCCA 3AFMA 3IP6A 4LRQA 1T35A 3H99A 1QOQB 4TYNA 5DT9A 4BQSA 1V2GA 3L82B 4JR1A 2P1DA 3SBOA 2WG1A 1E9FA 4L6AA 1HA3A 1I2AA 1T1RA 1X13A 2ZKLA 2ZVDA 3Q9LA 1H0SA 2C4VA 2JZOA 5SICE 3ADDA 3AEZA 4MVCA 3KJQA 4M2LA 4P2BA 4XSHA 3NJ8A 1EDZA 3GIWA 2C58A 4J1TA 2VR1A 1OBCA 3MLEA 1MVLA 4L16A 1T0BA 3WIEA 3F47A 5JVDF 5EIHA 2FEWB 1JIKA 1I5OA 1AHNA 5JH7B 3CPEA 3PRYA 4JH0A 2H4JA 2PLRA 3L7YA 4NULA 3RS7A 3FSRA 3KPWA 3EEOA 3W90A 3WL4A 1C9YA 3E3NA 3OPMA 3ZBUA 1TQ2A 1VMKA 4F1KA 1PD0A 2C8VA 4FMDB 3BIJA 5DCWA 4XI9A 3WLRA 4BRUA 1HNWB 3IIMA 2O23A 5F78A 9ABPA 2BEWA 4X3CA 1JLSA 5CFRA 4GZ6A 1QZTA 1WCXA 4W7HA 1SCQA 5EYPA 2RHDA 1E4EB 2RHHA 2Y0BA 1K68A 1EFDN 4YRIA 2IWHA 2HGZA 5LM3A 1BU8A 3EQ9A 4LMBA 5EE9A 1CULC 3W34A 2OGZA 2YHUA 4WK0B 1QH1A 1ECFA 2WAYA 4PLCA 4QWMA 3SZMA 3MWLA 3VZPA 3OZXA 2BZ1A 1KMHA 3CX6A 4QPPA 4A6EA 4A8HA 2YFKA 1G6HA 4EJMA 1QJ4A 3QOXA 4M1SA 2F8TA 2DLNA 1YB6A 2JA2A 2BY4A 3R0QA 4U9UA 2XXAB 5HFJA 7ADHA 3VYWA 1D4FA 4UEQA 3RYFA 4PS0A 3NXSA 4NCXA 5KOJA 1OROA 5LLDA 3ROXA 2IZ1A 1W35A 1C9DB 4REQB 1M2WA 1Q7CA 1P33A 2I6GA 2ZTSA 3V1NA 4HNVA 4ALLA 4FONA 1OSNA 1OH6A 4NDZA 2VTKA 2HQOA 3P4UA 1Y3HA 4TV8A 3TZQA 5AUNB 2B5OA 3FSGA 4K6CA 4LXTA 3KD3A 3LT1A 4NZZA 1SHJA 1T43A 3HA3A 3FB4A 2HFJA 2WWVD 5HHTA 4KNYA 3FIUA 4RA6A 3U6KA 3LXUX 2GZDA 3OVMA 2PKEA 4JWKA 4MRPA 4XIJA 3UAWA 1SKMA 3P9QA 4H59A 1TJPB 3STHA 3O7WA 5JAUA 1OXMA 1TC1A 2I71A 2NT4A 3HSKA 4ZTZB 1KDTA 4GU5A 1O0BA 4GXNA 1DXOA 1NFRA 1N1DA 3DXZA 3K6KA 3IXQA 4N1AA 2IW3A 5I51A 1NF3A 2QRQA 1HDXA 2GKGA 3DLPX 4MIEA 5CTJA 1U7PA 4MRNA 1ZNYA 1O96A 1ZNZA 4TZKA 3E5MA 3EODA 4ISCA 5E9JA 4AZ0A 1NE7A 3X43A 3EW9A 3FSJX 5CYFA 4YJFA 2QPAA 2VWGA 3EJ6A 3EVFA 4DCPA 1VLLA 1QHYA 2R1VA 3VR2A 2WF5A 4C5CA 5TGTA 1ZJWA 4X1KB 2H4XA 4IOJA 1GFSA 1D04A 1VM6A 1Z2CA 2ZBDA 3E9DA 4YRMA 2BGWA 1I2CA 4QOGA 5DX1A 3SG0A 4ER6A 4U6SA 3LKZA 1ZGAA 2AS0A 3C6KA 3U7HB 3UK7A 1BAPA 2AWOA 2BKXA 2K87A 1ND5A 5K0FA 5COBA 1PJ3A 5EZYB 4EZIA 5JT1A 1K7YA 1LTHR 2EFHB 1EX9A 3QLVC 3HR7A 1I3KA 1R0RE 2XH8A 3F67A 4XUCA 2X8JB 4BJ5A 3MM4A 4PYMA 2ZAMA 1LS1A 1F6DA 1NW5A 5T7BA 1Z63A 2V4ZA 2BTEA 3AUXA 4NV3A 4MRMB 2C0QA 6LDHA 2F8SA 4AW9A 2HQBA 1HYHA 3ACDA 1X39A 2WU1A 4HUQA 1C3OA 1D1PA 2O7RA 2BGGA 2R6GA 2EBHX 3CXRA 3SBXA 1V7QA 1E63A 4LXQA 2HNBA 4ZP1A 1SB8A 3PIDA 3HCPA 1XZNA 4C2UA 3C8UA 1EH5A 3I2KA 3TKLA 3RTBA 1H1LB 5EIFA 5T5QA 1KYVA 3D6VA 3OLWA 2W2KA 1GPWB 3U39A 4A5SA 2BMDA 3FGZA 2JI4A 3EZ6A 2YOHA 1RR6A 1L3IA 3QVUA 3OEED 4BL5A 1UMBB 4D8WA 2GCOA 1YK1A 4MYDA 4Y1RA 2RAUA 4B7ZA 1VI2A 4FR0A 1D1SA 1W4RA 4D9BA 5LQSA 3WFZA 1Q1EA 4OQDA 2VRBA 1BOFA 3N75A 3S2YA 2YWFA 2RJ3A 3UJDA 1ECBA 2B1RA 2P4SA 3JVDA 3MTAA 3EVTA 2Y4NA 3QXGA 1VHLA 4ZAFA 1DKOA 3ZHOA 3VR4H 5CBPB 1FRQA 4LBZA 3SX2A 3TNJA 4WA8A 2PKRA 1E9BA 3AVPA 4HAXA 4P22A 1XKLA 2FG7C 3QY0A 1U7HA 2QTCA 3ZD8A 1TEHA 1YQ9A 3HR4A 4WUVA 3A1NA 3C85A 4RV9A 4EQ6B 3CW9A 5A4KA 1T0JB 3IOCA 3QEMA 5KVCA 3BFKA 3HGQA 3WA6A 1V41E 3RS2A 1YV9A 4G5HA 2H0RA 3LFTA 3VAYA 3LD9A 1QZZA 1XYGA 3FH0A 1GP2A 3MTQA