3PEYA

S. cerevisiae dbp5 bound to rna and adp bef3
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
391
structure length
391
Chain Sequence
AKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DBP5
publication title A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP(6) in mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 144
structure length 391
sequence length 391
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3peyA02
3IDQA 2C98A 3CF6R 1Z6GA 2IYVA 1E1QD 3H1TA 2RB4A 3GP8A 1S0UA 4OQFA 5JCPA 1Y3AA 3CH5A 2NZJA 4F4JA 4BE7B 1E2HA 4E07A 1TMKA 4GP7A 1T3SA 1AN0A 1CBUA 1Z0IA 5L3QA 4RFVA 4XD7A 4GT1A 4IDPA 4TLEA 4URXR 1OHHD 3K0AA 1U8YA 3SJCA 1T8UA 1EFRA 1Q44A 4PQFA 2RGNA 3QI2A 1XEXB 3WRXC 4NL4H 3AVTA 4QHYA 4NYJR 1F48A 2OFOA 3BOSA 3HWSA 3Q5EA 1CJMA 1VG8A 5AJZA 1U8ZA 4KSCA 3WXMA 3SC3A 4FD2A 3VTKA 2QPTA 4F4CA 4AKGA 1ZP6A 4TLBA 3IGFA 1Z0DA 2WWXA 3GFTA 3VR2A 2GEUA 3KX2A 2A5JA 1CKEA 1Z22A 4MGKR 1OF1A 3EIQA 4V0LA 2ZVPX 3K0EA 2FSIA 4B2LA 3M1IA 2DCUA 1BYIA 3RLFA 4OQNA 4DVGA 3CW2A 3LO5A 4PSKA 3TSWA 3ZQJA 2QMOA 1OIVA 1I2DA 1LS1A 1FMJA 1FTSA 1SHKA 2W6JA 5DISB 4LJ9A 4EFNA 4KO8A 3OF5A 1XD2B 1KNXA 2YVUA 3AUYA 4DIDA 3RRNA 2Z4RA 1E0JA 5JWOA 2RGDA 4A4DA 1UJ2A 4RFSB 4DUGA 5F9HA 1OJLA 1OIWA 4Q1EA 3UXMA 1S8FA 3BH6A 5H1YA 5B58C 2IYTA 3EAQA 3K1JA 3WYFA 1E9SA 1Z0FA 3SZRA 4A6PA 4CEHA 1E79A 3AQ4A 4TMVA 3X2SA 1NVVQ 1P2VA 1OXXK 2WWWA 1R0WA 2H1LA 1ONBA 1UBCA 5FUXA 3RYTC 3KTAB 1W36D 3ASYA 1EK0A 3QXSA 1KY2A 3FE2A 2ODNA 1LTQA 5JMTA 3VU9B 2XB2A 3ICQB 5D3QA 621PA 3NHBA 1SVOA 2FMXA 2W6ID 3PUZA 1DAMA 3NKVA 4D80A 4DDTA 4B6FA 1Z5ZA 4EDHA 5L3SB 3EWAA 3B9QA 3THXA 4MGZR 3SOPA 1XTJA 2QPAA 4XSHA 4LBZA 5DGXA 2GJ8A 4ZCMA 2VHQA 5IHPA 3UIEA 1E32A 3W90A 3QE0A 3BB1A 3R7WA 3W6NA 2AFHE 3QOFA 3GLFB 4Q7LA 5CM8B 4GI7A 5JHHB 3O8RA 2VP4A 3FMFA 3TUIC 1U0JA 4HAZA 4LSGA 3RSOA 1YQTA 2ANBA 4LJ4A 4PPGA 4A0GA 1Q1BA 3LQRA 1COWD 5GADl 1ZNZA 3K70B 2R6CA 2RGEA 4DLRA 4YLGA 3TR0A 4FINA 1G7TA 4ZIRA 1W0KD 4JLVA 4UNRA 4DKXA 1QBKC 1ZAKA 4RSGA 2WM9B 2OESA 4BFZA 3R8CA 1FPMA 4C30A 2VHCA 2ZPTX 1W4BA 5DIFA 4TYYA 2QAGC 3TUJC 1FMLA 3WRYC 1LFDB 3WNBA 1CF4A 1GRQA 1Z07A 3HPQA 3DOFA 2HUPA 4EPRA 4DZZA 1HA3A 1XXHB 3PENA 4UJ5A 2DFNA 2HJGA 5BW8A 3SQXA 3U60B 1HURA 5AUQA 2BHRA 3B1XA 3PUYA 1TQ2A 1X3SA 2PT5A 1TU4A 4P4UA 4C2UA 3O8BA 2E9SA 4HDCA 3EPHA 3WP1B 3ZDQA 3LW8A 4GMXA 1OYYA 1ZD1A 2DPXA 2PCJA 3RS4A 4QGFA 4I1SA 5JJKA 1IY2A 4A0HA 1JQJC 2CL6X 2ATXA 2WJIA 2WJGA 2YC2C 1PUJA 3FB4A 5E7IA 1QHNA 4EUNA 4PQRA 2HF8A 4PC6A 4PHFA 4DT1B 1KKLA 1NG9A 1NBME 4D0GA 2AHOA 1XJ0A 2OXCA 3E2IA 1DG1G 3C15C 4KBFA 4B3FX 1G20E 2XNDD 3GD7A 1V43A 1CTQA 5FFMA 1YR6A 2YWEA 3QG5A 3W9YA 4WZ6A 3EIHA 2GTPA 1E2JA 1RW4A 1D9XA 2WIAA 2GK6A 3A4LA 4IXNA 3W5JA 5IT5A 4YC7A 3GLIE 2ZR7A 5CB8A 3KKMA 2ZRNA 1KJWA 2CNWD 2W83A 3EG5A 2ONJA 4GBMA 5K8IA 2BMEA 3PXGA 4GDFA 1KO7A 2AWNA 4C0JA 1L4YA 4I99A 3SJAA 2QAGA 4C0KA 1XPUA 3MAAC 1SHZA 3L8YA 1E0KA 4OHYA 2VO1A 2BM1A 3ETLA 1Q1EA 1Z0JA 4DLWA 4B32A 4IDOA 3MWLA 1A2BA 2CMKA 1ESMA 4C3ZA 3B5JA 4RZUA 2WMOB 2ZSEA 5J5CA 2XZOA 4NU0A 5G3ZA 2W00A 5FUVA 1E6CA 2C95A 4PPQA 4F4IA 2W2XA 2G0NA 5FOXA 3GMTA 4Q02A 4Q00A 1SKYE 1Q3TA 1ZD8A 2XJ4A 2F55A 2KB0A 1F2TB 2V1XA 5FPKA 2QORA 1Q20A 2MSEB 4YQFA 4QGHA 1HT1E 4RZ3A 3WYGA 1H8EA 4PX9A 2QSZA 4KXFB 1LB1B 2DWPA 4CYMA 2ANCA 4KYUA 1YU9A 4HSEA 3T1OA 3KQUA 3CPEA 2A7QA 6Q21A 4XWAA 1MRNA 1T91A 5FBLB 4R71A 3ZS9A 3HPRA 4LYHA 4WXPA 3SJZA 4PO1A 2YOHA 2ZYUX 4FMCF 4JBXA 2R62A 2V7QD 2X19A 4LJ6A 4EPTA 1SKQA 2ORWA 3SI7A 4Q4LA 3IO3A 3SYNA 2JJ1D 2ZJ5A 3W8RA 5FTLA 3U44B 1VDZA 2GRJA 3KFVA 2OSBA 2MMGA 2QGZA 2ZI3A 4F93B 1G6HA 2RH5A 1N6HA 3P1JA 5EXPA 1IJFA 4M1TA 4IFEA 2A5GA 4MRNA 2AWOA 1MO5A 4OI2A 1AA9A 3EZ2A 1LV7A 3TGPA 4KU4A 4OBEA 1W36B 1SVIA 1JEEA 2ZJAA 1D5CA 2NGRA 4TLAA 3GLGA 2IYRA 2AK2A 3JVUA 1P9WA 1Q0UA 1WP9A 5E7MA 3FMPB 1E2MA 2VHTA 2OILA 4M1WA 1W4AA 2GCPA 4RKFA 1HY3A 1DS6A 2IC5A 2N1BA 4FMCB 4HZIA 3VFDA 1XPRA 2ZI6A 4XJXA 5KSOA 2NPIA 1G3UA 1ETUA 1LVGA 4IVPA 4NMMA 5SZKB 2IX3A 4M4SA 2IYYA 3U3OA 1ZVQA 1RIFA 2VLIA 1IN4A 3FGNA 2WWFA 4B3GA 1XF9A 1G16A 4L15A 3PCRB 1FL9A 3ZZUA 4YONB 1DARA 4D0NA 2ZAMA 4AKEA 4UNPA 4IDNA 1XEWX 4Q7KA 2EYUA 5JCZA 5JI2E 4D4JA 1QHXA 1MO3A 2IEYA 4E5UA 2R8RA 3AEZA 5JS8A 5FUWA 5CDFE 1MO4A 1N6IA 4JLNA 2X1VA 1G5PA 1EESA 4EPXA 1KO1A 1DE0A 3C41J 2IK8A 2JDID 1ZD9A 1XJCA 4LGMA 1KJYA 2BKEA 1GRNA 1W2GA 2J0SA 1XTKA 3IPXA 4GFDA 4JL6A 3FKSD 4OHWA 2YV5A 4RCZA 5CB6A 1GSIA 3CNNA 2PJZA 3U3MA 4LJ8A 3I8XA 1WE2A 4RD2A 1U0HC 1YKSA 4PHGA 1EWQA 1M7HA 1IN7A 1BO6A 4NHOA 4KITB 3MSXA 3GJ4A 1VKJA 2H7VA 2WHXA 5JWRA 3T1TA 1ELOA 2JCSA 4LHVA 4CEIB 2UKDA 5KDLA 1PZNA 2YC4C 4OJKA 1E3MA 2OFXA 2VQSA 1GNQA 2HCBA 1E1RD 2XXAB 4LUCA 3WHLA 5F3WB 1HV8A 2RGAA 3NH9A 3IUYA 3L8ZA 3LRPA 3D6TB 3OIYA 1PJRA 2ZYVX 4BFSA 2BV3A 4QHSA 1W47A 3T35A 1NBMD 4EIWA 5KSPA 4P3YA 5LB4A 1CR0A 2PCLA 3T5GA 2FX3A 3T15A 4YXWD 5ELXA 4CIDA 1UBGA 5LD2B 2JLWA 4IEEA 2QE7A 1WMSA 2O0KA 1MOZA 3SFZA 2OAP1 4G1UC 2YNMA 1RRPA 3QPUA 3CZPA 4ASUA 1TPZA 1T3HA 1P60A 1OB5A 2QQEA 3V00A 1FOEB 4LC1A 1VECA 2G1KA 3LH5A 2NPFA 4F38A 3MLEA 1DEKA 4Q9JA 2D06A 4DEXA 1HTWA 2ZAOA 4D6PA 2C9YA 1QVAA 4U7DA 3ZVLA 4P32A 5K8UA 1EFUA 4LOAA 4LWZA 5EE1A 5C4MA 1Q12A 3CZQA 3CH4B 1E9EA 2VH5R 2H16A 2BMDA 2OZEA 2OLKA 1N5JA 4D0LB 4O2RA 4TMWA 4W7SA 4ARZA 2RGCA 5AWFC 1E9CA 2F43B 2AD1A 3NIBA 2QP3A 3T34A 3B85A 1NMXA 1E0AA 2ZS9A 4E03A 1JR3A 2QN6A 3CWZA 1W7AA 1E2EA 1SZPA 4FCTA 3QEJA 3GJ3A 4XVRA 5FTKA 1E2NA 3CUEF 2CLDX 3W5IA 2ZIAA 2AN9A 4JLOA 1JAHA 1Y63A 1NKTA 1OXSC 3EA0A 2OCAA 1LF5A 2PBRA 1XCGB 2JLQA 5CJ2A 1TUEA 4HUTA 2OG2A 4ZKEA 4R7ZA 4CW7A 4PC1A 2BCGY 1BMFA 2J0QA 1NRJB 1NSTA 1VYUA 5F2EA 4S35A 1G1MA 3GFPA 2HXYA 1E99A 2CCJA 5IF9A 2IUSA 5J4KA 3BE4A 3MWKA 1N2CE 2BMJA 4XD7D 4UXIA 5FTMA 4KFRA 3UWKA 4KVGA 1P3JA 4TT3A 3WYAA 2ZRPA 4KFUA 3QF4A 4TWZA 2EFGA 2JATA 1EFRD 2NO6A 2HV8A 3GJ0A 2VPPA 4AYTA 1WBBA 4TMXA 4FN5A 1TEVA 2HYDA 2O8BA 4OQLA 4RKEA 3KB1A 2A5YB 4YMWA 3NDPA 2VTKA 4PANA 2JAQA 1GWNA 2GXAA 4B3CA 2ODEA 2ZR0A 1K8RA 4Q9LA 4BLRA 4IRUB 1KMHA 2Z43A 4JJZA 2P6NA 2QBYB 3U2QA 2ASEA 4M1YA 4CF7A 2IYZA 1GP2A 2PX3A 5FOUA 2UZIR 4L5BA 3EASA 3VR3A 1Z8FA 1P72A 3GJ6A 1U94A 4JVNA 2D2EA 5TY0A 3WMGA 3VX4A 3GJ5A 1SXJC 1DOAA 2VBCA 4OI1A 1UKEA 2ZU0C 4IVQA 4DUGD 3R20A 1EX6A 3B2EA 3F3YA 2XTZA 4HB3A 3KKOA 3LDAA 4X8LA 2ZSBA 2ZJ8A 4L4UA 4LCBA 5KPDA 5JS7A 1TF7A 2VHUA 1J2JA 3L0PA 1CJTC 3AVQA 4K8OA 2P65A 3THWB 1E79D 3ZQ6A 5KO2A 3A4NA 3KQNA 5DI3B 2ORIA 4TL8A 5EE5B 4B44A 4M9ZA 3VAAA 4C0QC 3G82C 1R0XA 3THYB 1W0JA 1KHTA 2GF9A 3FFAA 3UKDA 3C5HA 3Q8XB 5H70A 4OKSA 1EFCA 2OE2A 4URVR 2IYLD 2O8CA 4XH9B 2ERYA 2H18A 1T6NA 2J0UB 4GZMA 3FMOB 3DL0A 1KK3A 4IXMA 1G3RA 4EPYA 1II8A 1NKSA 2RGXA 5DYIA 3OIUA 1AGPA 4D2IA 3DMDA 3O47A 4BWYA 2SHKA 3K53A 2EWWA 2O0JA 2GXUA 3SYKA 4V0ME 4O3MA 4BQSA 4BLTA 4EAQA 4DBLC 4GOJA 2YWHA 1SXJA 1G8GA 4Q4HB 4DJTA 5KPJA 4MYCA 4OHXA 1U90A 4C0SA 5EJEA 4TMZA 1XU4A 3C7KA 1AQUA 2O8EA 1M34E 1HYQA 1E9DA 1ZM3A 3K09C 4FI3C 3RDPA 1YRBA 2Q6TA 4MUAA 3QUSA 1S1MA 2PT7A 3KXIA 4ESVA 4MRRA 3MWYW 2BDTA 3WBJA 1N6PA 1C1YA 3KJHA 1P9RA 3P4YA 3W8NA 4Q1FA 4PC7A 2GJ9A 2ODWA 2IBMA 3HR7A 4PHTA 1F3OA 2WJJA 2J59A 1JXMA 3GPLA 2EFDB 3CO5A 3GLHE 2GHIA 5EE0A 1DVRA 4Q4AB 1YHNA 4IFBA 2VSXA 2R2AA 3RC3A 4QFMA 4LJAA 1J90A 1TEXA 3I3SR 4JYCA 2J7KA 3AF1A 4BFVA 2EWVA 1ZM7A 3FHCB 4A8JB 2FH5B 1G17A 3RRMA 4ACAA 2WOOA 3DZDA 2VIIA 4CEJA 5HPYB 4JS0A 2VF8A 4DCTA 4XVUA 2Q3MA 3IQXA 1YZKA 2NO0A 3X1DA 2R6AA 4QOSA 2WJHA 3BB3A 4HZUB 4BPBA 3UWOA 5JEDA 4TYWA 2FPLA 1OT3A 1E2DA 3I5XA 3UMRA 1KO5A 4MRPA 4TL9A 1QVRA 1U9IC 3OEEA 4P4SA 2OHFA 2QMUA 3FDIA 1YZQA 3Q7PA 4G0NA 2QM8A 4AD8A 2FFAA 1OXVA 2CK3D 4L9SA 3DM5A 4EJSB 3K09A 2W2TA 1SVKA 2C5LA 1ZINA 3OESA 3SN6A 5J4HA 1G4AE 3Q7QA 4TTPA 2Z6VA 3Q3JB 2OCPA 2F1HA 2GCNA 2QI9C 3B8HA 3B1VA 4LYJA 1Q3HA 1TX4B 3NEJA 4AY2A 4G01B 2QRZA 2IF2A 1HH4A 4A6XA 3SDZA 3ND8A 1VCNA 1W4RA 4I1OA 2IUUA 3K0AB 3CRW1 2OBNA 3ASZA 4CT4B 2X2EA 1M7GA 3AVOA 5EP2A 3ZZTA 1CR4A 1NF3A 1R5BA 3KQKA 4X8HA 4W5WA 2BCJQ 1ZNWA 3BB4A 3FFBA 4OI4A 1R5OA 4HAWA 3TRFA 1X6VA 5JSZB 1FW6A 1QF9A 2FU5C 2CVHA 5EP4A 2CL0X 5FOWA 4MKGA 2IW3A 3QF7A 3C5CA 3CX8A 2GBLC 4CZ2A 2HCJB 4NCJA 2XB4A 2WWYA 2GILA 4BZPA 1XDBA 3DZ8A 3LA6A 2D7DA 1U9IA 3R9XA 4C7OA 1G5TA 3NDBB 3NH6A 1H8ED 1XTSA 3QKRB 4M0LA 4HATA 4KAXA 4EFLA 3REFA 1VHLA 3EIEA 4LY6A 1Z28A 4HI0E 4DC9A 3L0OA 5FI0B 3LQQA 4Q1CA 4TYPA 1NY6A 3DO6A 4DDVA 3T61A 1NN5A 3OAAA 1D2EA 3ONWA 3V4FA 1TU3A 4KBGA 4BFTA 3QXCA 1ZM4A 2GZHA 1JR6A 2ZRGA 4CRWB 1DADA 1P7CA 1AQYA 5L3VA 3NG1A 4JZKA 2QP4A 3ADKA 3HJNA 1I2MA 3B9PA 1S96A 4JLMA 1GM5A 1EXMA 1T0HB 4GSYA 1AGRA 1E96A 1W48A 3IHLA 1XTQA 5FBVB 1A2KC 2JGNA 3FKQA 1G3MA 4QNMA 1NVXQ 4A82A 4CEHB 3BAFA 2ZU6A 3OFNA 5FH9A 4NZYA 1OXUA 1RKBA 1VCOA 3A8TA 1T9HA 3CM0A 3CR8A 4URZR 3BS4A 5KYKA 4DLVA 2CVFA 2PH1A 2F3RA 1NP6A 1MR3F 3H4MA 4B74A 2P3SA 1G7SA 4HLCA 4MGYR 1VCMA 3IBYA 5KHOC 3I4LA 2JLYA 2PX0A 4Q4JA 2GBLA 3Q5DA 5KDOA 1XMIA 4LRWA 1NLZA 1IHUA 3CF2A 5BQ5A 2BBOA 3THXB 3GFOA 4LV6A 3RNLA 1OE0A 4B2IA 2FDCA 3FYHA 1FUKA 1XEXA 4IVRA 1JNYA 3CRVA 1KK2A 3AH8A 2H92A 3VHXA 1S3GA 4DSUA 3R7WB 1IXSB 4WXRA 4IW3B 3PV0A 4NPHA 1MO6A 3A36A 4US2R 1RC8A 4TQUS 5TB5A 2F1IA 4NTZA 4V0NA 4ZV4A 1NIJA 3AF3A 2ZETA 4TYQA 5G40A 1CS4C 5DHFA 3TAHA 3CX6A 5FPTA 2ZUCA 5GJVC 5HKKA 3AKYA 2HLDD 2OBMA 1XB2A 4US0R 3SS8A 4UNNA 5HCNA 3ADBA 5AUPB 4BFUA 1QDEA 4IOKA 4EKDA 5CYPA 1M7BA 2IS2A 5HZKA 3RAPR 2KWIA 1XD2A 2IXEA 1QHIA 2RGGA 4BUJA 3PJRA 2JLSA 3A1UA 2C2HA 3BWDD 3U61B 1XBTA 3B82A 1FUUA 4NYJQ 4BFYA 3SR0A 4LJ5A 3PG5A 3QXJA 4RFSA 3U5ZB 2QG6A 2OEPA 5AJVB 2IHYA 3K70C 1TF2A 4FIDA 3MJHA 5HTKA 1UKZA 2ZI9A 1HT2E 1OB2A 2FV8A 1K5GA 4TTRA 1O87A 2Z4SA 3K9HA 1RFLA 1NVUQ 4HB2A 3LFUA 3NBZC 4Q47A 1G21E 3I8SA 3KTAA 2RAPA 1CJKC 3OEHD 3ND9A 1KOFA 3ECCA 1RZ3A 2AL7A 2J3EA 1J7KA 3VU9A 2JLXA 2Z0MA 1VTKA 3TE6A 2XZLA 4HB4A 5LBIA 2IS6A 1E0SA 2OAQ1 1XRJA 4FXPA 3ZD6A 3A6PC 1UBEA 2WSSA 2WWHA 4A9AA 2ZSDA 4NCIA 4KLNA 3KUCA 5L3SA 1OYWA 2CCKA 1AK2A 2J7PD 4TL6A 2QE7D 4U5XA 3T12A 5EP1A 2YOFA 3QBVA 2JLVA 3QKTA 2JLUA 1LNZA 5FPHA 2IYWA 4M9SA 3K0FA 1XD8A 3RS2A 4H9GA 3TJZA 3GLFA 1HUQA 3HYTA 4NCNA 4DLSA 1VMAA 1QHHB 5L3RA 2KI5A 4G5QA 3WY9A 4LK2A 3HR8A 4AIIA 2QRNA 1YJ5A 5UKDA 3U3RA 4ZDJA 4HLDA 1BS1A 4JKIA 1AS0A 1P62B 3B1ZA 1T5LA 5EXXA 3SE0A 2J41A 5B57C 2BJWA 2G77B 2QT1A 2VA8A 2RGBA 2AK3A 2I1QA 2ZJ2A 3D7MA 2BBWA 3PQCA 1IBRA 1MRSA 1VIAA 3I1FA 1JR3D 3UATA 5GJWC 3QVUA 2HXSA 3CR7A 3KL4A 3BERA 3B6EA 2MMCA 3QJYA 1VYVA 3TW8B 3RRZA 3ZIAA 4BLPA 4Z54A 4N0EA 4FWIB 3SQWA 3TR5A 1GIAA 3MJRA 3WNCA 1N0WA 4LV8B 4BFXA 2XOKA 3LY5A 4UQOA 3BIFA 1M6NA 3K8YA 2WSMA 1RRFA 1IOZA 3LXRA 4C0HA 3DKVA 1Z6AA 3U7FB 1P2TA 4KJZA 3WP0A 1H8HD 1KIMA 3C4JA 1BMFD 5CIWA 5DE3A 1RPZA 2JLZA 3CONA 2ZJOA 4RD0A 4DT1A 2JLRA 2W2VA 5KOYA 2BVNA 2NMVA 3PEUA 5FBRB 4RCYA 4DLTA 1XZQA 3DPUA 2BOVA 1OFIA 4AG6A 4XTCS 1OH7A 1QG2A 4RZXA 4TSFD 721PA 2XTMA 4POAA 3AF4A 2QT0A 3EC2A 2FFBA 4JLKA 4LYFA 2DHRA 1KI9A 5C18A 3I72A 4TQAA 1IONA 1Z06A 1QHSA 2P6UA 4URYR 3IIJA 3HU1A 3IEVA 3PUXA 5JFGA 4NYIR 2C77A 1PLKA 1BYUA 4PXAA 2REBA 3I5YA 1VG0B 4B71A 2ZM5A 1CRPA 4ITRC 1OHHA 5HZHA 1QHGA 2QL6A 3OE7D 4DLYA 3AKCA 2OO7A 4AC9A 1XFAA 1ZUNB 3BK7A 3KKQA 2X77A 3PITA 2ZRBA 1A4RA 5DO9A 5E95A 4BRUA 1W36C 1I4TD 3FHTA 2ZRDA 3L2OB 2O8FB 4TLDA 1IN6A 1OKKA 1NL3A 2CE7A 4QG7A 5KNDA 5E3HA 1CU1A 1VYTA 3O8CA 2P0EA 5DI9A 2GCOB 4BLQA 5LPNA 4FW9A 1XEWY 1C9KA 2ZUDA 1GNPA 1F2TA 4IOMA 4GP6A 4EPWA 2XGJA 4DCUA 2O5VA 3U7HB 3MRSA 3QKSB 4DSNA 5J4LA 1ZRHA 2GESA 4KFTA 4YMTA 5FPSA 4D26A 2WKRA 1Z29A 2ZROA 4UXHA 1UDWA 1S2MA 2KBEA 3QSYA 1WXQA 1U8AA 4RZ2A 3MG9A 2JIZD 3QENA 4D4MA 4BLOA 4C0BA 521PA 1OH6A 1W0JD 1ZUHA 2QTFA 4NH0A 4ON9A 4JVMA 1KMQA 3CNLA 3Q72A 5KTYA 2CL7X 4A2PA 5F9FA 5CM9C 3GLHB 1KZ7B 2P67A 1N5LA 2VP6A 4PHHA 4CDGA 1UEIA 4OK3A 3CKLA 2MSCB 2FWRA 3EZ6A 2PMKA 2DWQA 3K9GA 1QHYA 2HF9A 1G5RA 2CJWB 1NNEA 4Z8YA 2CBZA 2PEYA 4LZZA 4EQ6B 1Q1QA 2KSQA 2VP5A 3L43A 4JVLA 1CRQA 4B75A 4DDWA 3EX7C 3D3QA 1NLYA 3V9PA 1GAJA 1E94E 2CE2X 1NJGA 2OM2A 3EZ7A 2WPDA 2OFWA 2IYUA 1SXJD 1GG2A 1PUIA 4Q9KA 1KK1A 5HE8A 5BN5A 1F2UA 2W6IA 1G7CA 1JJVA 4NYMR 3F0TA 3FMIA 2J5XA 2ZS8A 2JJ8A 2REXB 1KSHA 4URWR 2HYIC 2PJRA 3TQFA 1AS2A 1L2TA 2F6RA 1CR1A 1TQ6A 4MKFA 4MDFA 2QEQA 2XSZD 2B7CA 1JAIA 2FFQA 2IA5A 2ZE5A 2ZSFA 5GVRA 2CLCX 4M1OA 2D62A 4BASA 1MKYA 1OV4A 2FOLA 3EC1A 4LX0A 5DH9A 3W6PA 2GJAA 4C0LA 5BN4A 2GAOA 2OLJA 1R8SA 3QXXA 4RD4A 1AS3A 4V0KA 4FCWA 1CJUC 5LD2C 1TUIA 4P0TA 1HEIA 3OIVA 1D9ZA 4F92B 1KI7A 1AKYA 2DB3A 2W58A 3L0SA 4H1VA 1XWIA 4JLJA 5KUTA 5IK2A 3TKLA 1E2PA 4PZLA 4G5RA 1R5NA 4V0OA 4NBSA 4RD1A 3OEED 2FNAA 1UKVY 3OZXA 2FJUA 2QROA 2AR7A 3UANA 1ZIOA 3ADCA 3TK1A 1FNNA 4B35A 4GZLA 5C2JB 4JL5A 2GJSA 4KHZA 4LHYA 4CEIA 421PA 4RVCA 2ZJZA 1N6LA 2NZ8A 3TMKA 2ZI5A 4QBGB 5G53C 2XXAA 2DFTA 3DOEA 5SZJA 5FL7A 5HR5A 2DY1A 3PVSA 3PEWA 4QJ3A 1E2LA 1UAAA 2IWHA 3BD9A 3S1AB 4WOPA 1R2QA 3SBEA 4N0DA 4D25A 2KE5A 4NONA 4Q9IA 4PSAA 2YOGA 2H5EA 2JEOA 1DAHA 1BKDR 4NKRA 3AVUA 1V5WA 1X8KA 2Q9AA 3UMSA 2QM7A 1S1CA 3AVWA 3AF2A 1O3YA 2DWOA 5DNYB 4KI0A 1E4VA 5IDVA 1MABB 1W2HA 2A5FA 2BMFA 2CNWA 3A1VA 1YZLA 1UPTA 3B78A 4X8MA 3AVXA 1XMSA 2PLRA 5JHGB 2ZANA 4PAQA 3CRMA 2WBLC 3F8TA 3KXLA 4HLUC 5FTJA 4ZI2A 1XCMA 1E9BA 2FZLA 1WA5A 1UEJA 4CT5A 4Y0AA 3B7GA 121PA 2LCFA 2YWGA 2ZYWX 2V6JA 4R98A 5EXTA 3EZFA 2EFCB 4PR0A 4F91B 4TZ0A 2J9RA 2ZTSA 2OBLA 3I61A 3NEYA 3IPYA 2I3BA 1KI8A 4LPKA 2BBTA 3P20A 3R9IA 4MYUA 2AKAB 2F1JA 2V4ZA 4HDOB 1R8QA 3UG7A 4Q66C 4IOLA 4UKDA 5F98A 1CLUA 3QY0A 2IF0A 3B60A 1GL9B 2J46A 3TNFA 3EPLA 1NJFA 2W0SA 2QQ0A 2O8DA 4KLZA 1XCPA 3K0CC 1JALA 2W6JD 1P5ZB 1KDOA 2ZRCA 4TQ9A 1SVMA 1E98A 3T06B 4QGAA 4GOXA 4CGZA 2XTNA 3WNDA 3M0EA 4NCKA 4UNQA 2CHQA 1G18A 1Z47A 1KI6B 4G5GA 1G4UR 2PLFA 2ZXUA 4OJQA 3LAWA 3AUXA 1YR8A 3GEEA 5KDDA 1OIXA 3W3ZB 4BGDA 1II8B 3BORA 1NLFA 2GA8A 4OQXA 4R2HA 4A2WA 3SU8A 3U4QB 4Q21A 3C16C 3C8UA 1FX0A 4L16A 2ZRMA 4OK5A 1Z08A 1ZM9A 5JJIA 3GLGE 5E4FA 4ZCLA 2V9PA 4WW0A 3GCGA 1RE0A 1OFHA 3P4XA 4DSOA 1M1YE 4IJMA 3FVQA 4KYIB 2P6RA 2YJTD 2WV9A 3EWSA 1RJ9B 4M9QA 2QY9A 4MKHA 2NOAA 2GZDA 2ZSAA 2GK7A 5HKKD 1G19A 2WMNB 4OYHA 4V03A 2QBYA 3FTQA 2CCGA 5BN3A 3KQLA 4Q1DA 3VKHA 5FR1A 1J8MF 1US8A 2HJVA 2NTYC 2YKGA 1YVDA 4G3XA 3WHKA 4F7WA 1GITA 2CEAA 3K0CA 4Q7MB 1KZGB 1JQLB 4N1AA 3C14C 1IXZA 1DELA 2V3CC 1WQ1R 3K9NA 5HCIA 3E1SA 1JI0A 1YZNA 2CHVA 4PAMA 2VEDA 2GAAA 4QL3A 2GNOA 1P75A 5A0FA 1UKYA 2ECKA 2C78A 3W3AA 3DMNA 4MKIA 2OCYC 4PO8A 1TQ4A 2JA1A 2E87A 3EW9A 3BC1A 2EW1A 1P6XA 2D4HA 2N46A 3P27A 3PUWA 3HU3A 4M9XA 1CEEA 1VG1A 5DSZA 3KJGA 4B47A 4O0MA 2IUTA 1OW3B 2ZRAA 4JKYA 3LBIA 4DSTA 3U3JA 3GQBA 3L0IB 1EG7A 1D6JA 3LXXA 4HUQB 1A5TA 4BLSA 4A8JC 1L4UA 2UZ3A 4HLQB 2IL1A 3EPJA 1WCV1 1N5IA 1S9HA 4YDHB 2P2LA 1NMYA 4Q7JB 2J0UA 3N70A 3X1YA 4LJ7A 1KDPA 5D3MA 1AIPA 1KAOA 5CLLA 1EFTA 1BH2A 2H8KA 1ZYUA 4UXJA 3A4MA 1RRGA 3UG6A 1M74A 3VR6A 1JECA 5TXGA 4QHTA 3LW7A 4W5HA 2YWFA 4U02A 4H1UA 2ZE7A 1F6BA 4JT2A 3G5UA 1P61B 3RWMB 4LPSA 3H86A 5DYGA 5B64A 4Q4HA 2ZQ5A 3ZS8A 1NBMA 2RHDA 3MCAA 2HT6A 4EJSC 3IBGA 3K70D 1JXOA 2RMKA 4E09A 2B8TA 4ZI3A 1PVOA 3AGPA 2R44A 1KGDA 2R9VA 4DLZA 2C9CA 1EWRA 4ZDKA 3GLIA 3N2IA 1A1VA 1WDTA 3RVBA 5FL3A 4PZZA 4YMUA 1PLLA 2KJQA 4JBYA 4PFSA 4XIGS 2PZGA 1P2SA 3X1WA 1KNQA 5L3QB 3AP3A 2GETA 5DI3A 3PR1A 3SBDA 4Q4AA 2OXRA 4TTQA 4TMKA 1KTVA 5J47A 4B43A 4ESHA 2XOKD 2QSYA 2ZS7A 4LYAA 2ZITA 4W5JA 1G8YA 3L82B 4TMTA 3M6AA 4RD3A 5J4VA 5GVSA 3ZVMA 2EQBA 1GL6A 4LHXA 2BKUA 3PEYA 1JJ7A 3LX8A 4LBVA 1RVDA 1JR3E 2F9LA 4Q5IA 3BH0A 2VP0A 1KAGA 4C0AC 2G83A 5KSZA 1KSFX 3BJIC 3AKDA 1SVWA 4Z51A 4DLUA 2FF7A 4O2LA 1GOTA 1CULC 2QMHA 1NVVR 1Z6XA 1AZSC 2VYFA 1JEDA 2ZRKA 4DIEA 2VP2A 4WZBE 3QIAA 4EJSA 1DPFA 3NVAA 4HEJA 5B30A 1UM8A 5KU1A 3BRWD 1G7RA 4UJ3A 2ZR9A 2GKSA 4EFMA 1CR2A 3CF0A 4B3XA 1N0VC 3W6OA 5KNBA 1ESNA 3PIRA 5G3YA 4M8NE 1NN1A 3O8DA 5AR1A 1NI3A 3P32A 4Q4JB 1ZNXA 2Z5FA 1M8PA 2ZRJA 3NC1C 1AM4D 1AJEA 3ZD7A 1DAEA 3AP2A 5H8WA 1R0ZA 1E9FA 1W4CA 4TLCA 3ZGXA 1W46A 1G291 2QA5A 1HQYE 4AKIA 3U6BA 1DO0A 1GTVA 2WAXA 2AKYA 2QZ4A 4Z1MA 3BXZA 1OKKD 2WAYA 3ZYCA 1YE8A 5JSZA 4MDEA 1E2IA 4Q1AA 3VX3A 3B1YA 1M2OB 5EE3A 3EZ9A 4BZQA 5IRCD 5P21A 1N6OA 2GVZC 3AKEA 5E7JA 1IY0A 2WVJA 2IYSA 2QNRA 5JWHA 3QKRA 5CIQA 5G41A 1DAGA 1A82A 4BZXA 1XZPA 4MGIR 3ZJYA 4AK9A 3KUDA 4JSYA 1IN8A 3KKNA 2WZQA 4AI6A 3DHWC 3ZZ0A 1WRBA 1RRCA 1YRAA 3TIFA 2MSDB 1KSGA 3IKJA 3GJ7A 3QG1A 3VR1A 2V8OA 5A5GA 4Q9HA 1TNDA 3BGWA 3M4YA 4HYYA 4BFWA 4XWKA 4R2IA 1N0UA 5FI1B 4TN1A 3LBNA 3KFXA 4WA7A 1OSNA 3TW4A 3SNHA 3I92A 2EU8A 5CYOA 5CDFA 1MV5A 4OI0A 3ZVRA 4D81A 4GRAA 2VF7A 1EFHA 5DLQC 3IHWA 4A15A 2I4IA 5DN6A 4ZIRB 1T0JB 5JI3E 1TADA 1P73A 2DYKA 2GJKA 2REOA 5C1BA 5L8VA 1LS6A 1R0YA 2A2ZA 2FPMA 3NC0C 2QENA 3H2YA 2JJ2A 2BEJA 2A3RA 3BBPA 4QJ4A 4L8GA 1H65A 1KYIA 5BXQC 2WPDD 2D74A 4XOIA 2W0MA 5A4JA 1XD9A 3A58B 4JMPA 3W34A 4A0RA 2G6BA 1F60A 4WBSA 4BRWA 3LX5A 1Z2AA 1NMZA 3NBXX 1NVWQ 4II7A 2EFHB 4PSVA 1IAQA 1S3SA 2ZI7A 4PPNA 3TBKA 4WAUA 5FTNA 2R6GA 2WKQA 2PZFA 2X8AA 4PAOA 4XSGA 3WBKA 2EYQA 4P31A 1NY5A 2WTUA 1WBDA 3AGQA 3MMPA 5BYKA 3LV8A 4JLPA 4A1FA 5BWMA 4IDQA 5LB2A 3K0FB 1CXZA 5EP3A 5GJBA 2F3TA 1SXJE 1KO4A 2RHMA 3AB3A 3RS7A 4LBWA 2FGJA 3RABA 1JPJA 3RANA 4ERNA 1TL7C 2QTVB 1R6BX 3B13B 1CJVC 4MH0R 4M1MA 1NG1A 4QKQA 1J8YF 1DTSA 1S9DA 4Q01A 2YYZA 4TZ6A 5TARA 8OHMA 5AJXA 4K81B 4B3DA 1I4DD 2ZRHA 3RS0A 1G8FA 3VKWA 4B48A 1G8PA 1KDRA 1GVNB 2FSHA 3VNVA 5J40A 4ASUD 5IK2D 1MH1A 1LY1A 4IEIA 2ODBA 1EGAA 3QVVA 4QNRA 2ZEJA 5EE9A 3VKGA 2Q0HA 1N6NA 2QAGB 3QXHA 4M1KA 1VCIA 4QC2A 5KSYA 2H57A 4LV5B 4Q03A 2ZJBA 2ZRLA 1KDTA 1G41A 2KBFA 4DHEA 1GKYA 1PLJA 3JZMA 3RRYA 1FQKA 1J99A 1II0A 2G3YA 4L9WA 1J70A 3T1QA 2Q9BA 1XNJA 3LVQE 3RC8A 1X86B 1ZU4A 5FL7D 1QZXA 2IYXA 2FEMA 2HT1A 4QGGA 3X1XA 3AVYA 1UADA 1KI2A 3Q85A 2LKDA 1XPOA 4TYNA 4BEBA 2GXSA 1KK0A 1UFQA 3I62A 1HE8B 1AZTA 1XXHA 4WZAE 5CK5A 2CHGA 3QNUA 2GEDA 2CK3A 1XP8A 3K9LA 2CDNA 1IJEA 4LI0A 2A30A 2WJYA 4M21A 3G0HA 4PC3A 3A1SA 1W49A 4ZO4A 2IS4A 3MUFA 4NE2A 2FA9A 2WKPA 5TVKA 1EX7A 3WMEA 5JJLA 2FGKA 3MGCA 4HB0A 3LD9A 3D8BA 1GZSA 5AJYA 2GZAA 3ZH9B 1IM2A 1QHHA 3LNCA 2IS1A 1U0LA 4KV9A 1GRRA 2AXPA 2ZJYA 2C8VA 4N3NA 2ATVA 3Q9LA 3VNUA 4YDSA 1IQPA 4TT3D 1T8TA 4LBYA 4OL0A 3GEIA 1E1QA 2H17A 1CP2A 2RKOA 3V4RA 1DAKA 221PA 3KQHA 1W5TA 1ZM2A 1X8JA 4HAYA 5FOVA 3GLGB 2B21A 2XEXA 3A37A 5JZVA 1OLOA 1ZC3A 4QJ5A 1B0UA 1SULA 1E2FA 4XWOA 4HDQB 4S2EA 2G88A 1D8TA 2AFIE 4MQBA 3MFYA 2VSOA 1VHTA 3LVRE 2HDNB 1GKUB 4GOKA 3RS5A 5CITA 3PEVA 4R9UC 4GMDA 4D4LA 4JBWA 2B92A 2WWIA 4JJKA 3JVVA 3BFXA 2F9MA 2IEZA 2EFEB 2NO1A 4CVNA 3ICEA 5B2ZA 4XVQA 2GEVA 3U3KA 3BH7A 3AVPA 4QM6A 4B3BA 3QQ5A 2QU8A 3LLUA 1Q22A 1FZQA 3IO5A 3GEHA 2YZ2A 3DM9B 1N6RA 3B1WA 4Q48A 3EPKA 3H0KA 4IOJA 2PL3A 2EVWX 3KJEA 2PEZA 2NO9A 3IEUA 5TDHA 2J87A 2CXXA 3N2EA 2IT1A 2WJVA 2FSGA 2ONKA 5AUNB 1K6MA 1Z0AA 1RYFA 4UNSA 1AKEA 1IXRC 2ORVA 4OK6A 3CX7A 4C9BA 2IXGA 4BECA 3GJXC 4QBIA 1N5KA 4I81A 1F2UB 1W44A 2VRWA 5AK0A 4B76A 1G8HA 3E5HA 3E70C 3U44A 3VQTA 4AKHA 1D2NA 2L0XA 3QPVA 2OT3B 4QBFA 1SQ5A 1II9A 3R9WA 4AYXA 1OH5A 1DAFA 2VSFA 1XX6A 2BWJA 2C96A 1MT0A 4DB2A 2O8FA 2V54A 1LF0A 3HYRA 4Q1BA 1ZNYA 2QUZA 4JVSB 1T5IA 2GCOA 2J1LA 4V0MA 4B73A 1GDDA 2IWRA 2Q3HA 4WVFA 3SYLA 1B23P 2ZE8A 5AUOB 2JASA 1GNRA 2AXNA 4NYIQ 4RJLA 1SGWA 3THOA 3QKSA 2HLDA 5EXSA 3QKUA 3QBTA 2QTHA 5K8TA 3K0SA 1VIYA 4G5SA 1WB9A 3NWJA 3IIMA 3NHAA 4JLDA 4KSBA 2NIPA 3NBFA 5KNCA 2DBYA 5FBQB 5EQTA 4HAXA 3TSZA 3J81k 4V02A 1KO8A 5CJPA 2NQ2C 4X8OA 3ZVNA 3GLHA 4OHZA 3TQCA 2LWIA 4DCNA 2P5SA 2DR3A 1COWA 4KCGA 3KKPA 1NN0A 4AWXA 4Z8XA 1TQDA 4B34A 1W0KA 4OQMA 3JZAA 4NCHA 4ZDWA 4ARZB 5J4YA 1Z0KA 2ZRIA 4AYWA 2CJWA 1HQCA 1ZUIA 1NN3A 4EQ6A 2Q3FA 3H84A 3OEHA 1ZU5A 2B6HA 1SVLA 2D3WA 2WICA 4NP6A 4XTRA 2UVQA 5EUMA 4ACBA 4QBHA 2GF0A 1OPXA 1R10A 2FE4A 3A1WA 1GUAA 2BIFA 4AG5A 2XNSA 4B2PA 2FEOA 3NXSA 3FHOA 1X1SA 3AV0B 4IDHA 2LKCA 4URUR 4MITA 2WIBA 2XAUA 3AM1A 1YR7A 1PV4A 2BM0A 1RYHA 2J7PA 3IILA 5TV2A 2WOJA 5FOSA 4HAVA 1ODFA 4YMSA 3VMFA 3GLFE 3SJBA 2GDJA 2ZE6A 5EZ5A 1JB1A 4LHZA 5EZ6B 1TAGA 1YZTA 1E2KA 3KB2A 2XNDA 2G1JA 3GJ8A 4MRVA 1E2QA 4I1UA 2K5UA 3QF4B 5HE9A 5JRJA 3TVDA 2OCBA 2QAJA 3TAUA 4PQYA 2BJVA 1FQJA 1ZJ6A 1DO2A 4JLBA 4BEJA 1ZIPA 3A1TA 4NYMQ 3OIWA 3DEFA 5M04A 3RSLA 1W5SA 2O8BB 1YR9A 1A7JA 2C03A 1D2MA 2FPKA 2BEKA 3BFKA 2OV2A 1KJZA 1UF9A 2QP9X 1XXHE 3I73A 5K8LA 2F7SA 1FTNA 1WF3A 5FPYA 1GFIA 1KMHB 1N6KA 3CLVA 2C9OA 5AJWA 1P4SA 4EPVA 3IQWA 2O52A 1IY1A 3RHFA 4A36A 4MYHA 1G64A 4PTLA 2O8DB 4Q18A 4I4LA 2QPOA 2F43A 1XMVA 3EA5A 3OAAD 3PUVA 1H8HA 4GPTA 4C4PA 3P26A 4KVAA 4ZDIA 1YZGA 1Z63A 2V1UA 4ILEA 2AD5A 5C4GB 1G3QA 1YZUA 2B8WA 1ANKA 2FG5A 3S1AA 4ABYA 4DEYA 2A5DA 4PC2A 2B7BA 3CWQA 2G9NA 2BC9A 3F5FA 2R6FA 2PZEA 4TSFA 1DAIA 2ERXA 2V55B 5JLJA 3OFND 4PO9A 4NDZA 4RD6A 2E1RA 1FX0B 1Q57A 3CRRA 3DKPA 3HU2A 2J45A 2P5TB 4JIMA 1TTTA 4Z1MD 1MABA 4A0FA 1G9XA 5C46F 3DDCA 1XEFA 4MA4A 3TLXA 1E69A 2FZ4A 4D4KA 2V7QA 2XX3A 1R7RA 2ZRFA 3CBQA 4M2LA 2JJ1A 3EXAA 4A2QA 4PZYA 3U6KA 1W1WA 2O8CB 1BOFA 4HLUA 3FWYA 2C99A 3VHLB 3OE7A 3CPJB 2NO7A 1DG3A 4ZPXA 2R6DA 3VR4A 2AX4A 4Q19A 2VP9A 5EUQB 2TMKA 2FN4A 1US8B 5BYJA 3T1VA 4A92A 4IKEA 1KY3A 1E4YA 1JPNA 4DRZA 2QGNA 1IN5A 3KJIA 1N25A 5FOTA 3CNOA 3AVVA 1Q1ZA 5JEEA 5ANRB 1SXJB 2BBSA 1OFUX 3U7GA 5JECA 3UPUA 4WIAA 3LBHA 2WWGA 2O8EB 2XZPA 3RS3A 3EARA 4I1VA 1KSJA 1JBKA 2J0VA 2FSFA 4M22A 4DXAA 2XITA 5DN6D 3TSOA 3DVLA 1K5DA 1U99A 2I1VB 2CLSA 821PA 3QEOA 1BIFA 1FP7A 4LJYA 4M53A 5FBWB 4QM7A 2JIZA 2G0TA 3ADDA 1GKIA 4TL7A 1GL7A 1ZBDA 4P33A 2IHBA 2JJ2D 1FFHA 1P9NA 2DFKB 1QRAA 2GXQA 2Q9CA 3HDTA 4QXAA 5H68A 1KKMA 3X1ZA 2IXFA 1T4GA 4ZCIA 2Z83A 4GNKA 1KI6A 1XTIA 2F1RA 5TMPA 1FNMA 3AP1A 2JDIA 4KODA 3UK6A 2XJ9A 2O0HA 4RY2A 1ZW6A 4DCSA 4CEJB 3QPWA 5D3MB 1XTRA 1GILA 3U4QA 3THWA 3CB4A 3FKSA 1SVSA 4PPFA 4J0QA 4JYBA 4FWTA 2N42A 1S4QA 4P4TA 2D7CA 5CLQA 1Z2CA 4FCVA 3RWOA 3THYA 1I4LD 3SFVA 5GJCA 1E9RA 1R4AA 3WMFA 4M1SA 3FOZA 1OFTA 4JLAA 1E9AA 3D31A 4P4SB 5SZHB 1P2UA 1OH8A 5LDDC 1RJ9A 1Z6TA 4OHVA 4AURA 2WSSD 2RCNA 4IHQA 2A9KA 5JRZA 2Y8EA 3R8FA 3U7EB 1TF5A 1LW7A 2ZUBA 3TH5A 1ZCAA 1KI3A 1FP6A 1VPLA 4QRHA 1DBSA 1E1RA 3SHWA 3UMFA 3GLIB 3SHFA 1F5NA 2GVDC 1C4OA 2D2FA 2FFHA 2XSZA 3LLMA 1N3BA 2Q21A 3TUZC 3KXKA 2GWHA 4W9MC 3CRQA 5FR2A 2YHSA 3FPAA 1KI1A 4DDUA 4D82A 3ZLJA 3N5CA 4E22A 1QG4A 1X1RA 4DWJA 3PFIA 4B6EA 4JL8A 4U00A 1G6OA 4LC0A 1XMJA 1ZMXA 1G3IA 4YXWA 4Y0VA 1X8LA 5JBQA 3MWJA 4JSTA 3MD0A 2DFLA 5FUYA 3AF0A 4YMVA 1U98A 1VG9B 3BFVA 2IYQA 1Z83A 1ZC4A 3CPHA 4DB4A 4C2TA 4FMBB 3IIKA 4HAUA 5SZIA 1UBFA 4FMDF 3REGA 5DHAA 2QMEA 1CIPA 2YINC 4GL2A 3I32A 3TVTA 2OUKA 1U2RA 4DCVA 1SKYB 1Z6YA 4HUQA 1UDXA 2C04A 3ZIAD 4K46A 3NBYC 4MYTA 3SEAA 3KDSE 4C7OB 2ZYTX 3HP1A 1NSFA 1KI4A 4KFSA 4LDJA 1HE1C 2RGNC 1Q21A 3CIOA 2VL7A 2HEIA 3KZ1E 4A8JA 2V6IA 1L8QA 3NTUA 2ZVQX 4MRSA 2NG1A 2VHJA 5CK4A 3T5DA 3OHMA 4ZKDA 4O25A 2R65A 4HZUA 1T3LA 4US1R 1ZCBA 1OXTA 4DLXA 3VR5A 4MUBA 1Z3IX 2ZI4A 4G5OA 2A78A 4LHWA 4FMDB 1NIPA 4JT4A 3LWNA 4B33A 2PMDA 2X2FA 1U81A 1XJQA 1L7VC 2ZREA 1E2GA
chains in the Genus database with same CATH superfamily
3QU2A 3IDQA 1Y4UA 2V5UA 1P8JA 1Z6GA 4LY3A 1TAHA 1E1QD 2FPXA 3BMCB 3VO8A 1A69A 2ZR8A 1UBNA 5EXDA 3AG5A 3D43A 3DOIA 1ADYA 3NDJA 5AI0A 1VA5A 1VJ5A 3CH5A 4CQLA 2C2XA 5JS1A 2JLAA 4YQEA 1L7OA 1R6VA 1K7SN 3MW8A 4TRNA 4CMCA 5BVGB 4E07A 4MUGA 3OQ6A 1T3SA 3JAWB 4X3CA 4RPKA 3FCUB 2WT4A 5L3QA 3S8EA 1YTUA 1LK5A 2QIPA 2HF2A 4BMPB 4XD7A 4GT1A 2LCQA 3JD2A 2ZT6A 1PS9A 1PJ8A 1KC1A 1TQ8A 1Z3CA 3MF4A 3I28A 3PNBA 4CV0A 3RRJA 4EBFA 2XRYA 3F1LA 2AXQA 1E6LA 3D8HA 1Q6ZA 4PBTA 3ED1A 5G0TA 4PQFA 1HMYA 1T43A 2RGNA 3FB1A 2MYTA 1KAEA 4QHYA 3PRYA 4I5EA 1FMCA 1ZWLA 2PZMA 3ZCTA 3EULA 1PN3A 2WYVA 4NU5A 4J6EA 3D7RA 1CJMA 3RFFA 2B37A 4BB0A 3X1KA 4X85A 1XQVA 3WOHA 3AG6A 3VGPA 4Z4EA 2F8MA 3NIFB 4C6HA 4YJDA 4X95A 4AB1A 3L6OO 4D42A 1ZP6A 1K3TA 1JA9A 1CCWA 1TK3A 4C7MA 1YI8A 4ZT6A 3LC2O 3VR2A 3KZCA 5K2MA 3KX2A 5BWOA 2JANA 1CKEA 1Z22A 1LBEA 4LXUA 2L19A 3EIQA 3RVSA 4B2LA 2FZCA 4D5EA 1GNTA 3CW2A 3LO5A 4PSKA 3DTNA 1POWA 1LS1A 2W6JA 1FMJA 1T26A 3IKMB 1U8XX 4NBRA 1PWZA 4YJ3B 5DISB 4LJ9A 4XRRA 1DJMA 3H75A 1NI4A 1LV8A 1JG3A 2Z4RA 3GYBA 3MS2A 3OZIA 4NU8X 2I4LA 3IL2A 1RI2A 3PQ6A 1Z5WA 4BWFB 4CBVA 3SDBA 1QP4A 2FFRA 4J0HA 4ZVRA 4AMVA 1IUPA 2OZPA 3RUIA 2JGMA 1OAOC 5H1YA 5BT8A 3DNMA 2IYTA 4KQKA 1RHJA 3D3EA 4I9GA 1GRCA 1HFKA 1ORDA 4XWGA 3FNRA 3GDGA 3IOMA 3TQQA 2Q49A 1PJZA 2WWWA 4Y9UA 5B58T 1JLHA 2LUOA 1ONBA 3U5ZB 2B2XA 3DL4A 2X42A 5FUXA 1W36D 1HEUA 2MCFA 1Z39A 2FMUA 1EK0A 3Q15C 3Q7IA 6AT1A 3FE2A 1N8SA 2ODNA 2J5QA 1KJ8A 2YVLA 3JWJA 1M2OA 3DDZX 5LYJF 4FXOA 1PX2A 5HKLA 5TVGA 1G1AA 1JU3A 2NUPB 2RHJA 3ICQB 3VDQA 1CS0B 4L8LA 1SUAA 2AE1A 4M7WA 5I9MA 2W6ID 1O6ZA 4INJA 3RE1A 1DAMA 2GO7A 3TIXB 3TZHA 3UYKA 1D4FA 4IMRA 5D7BA 1E3LA 4B6FA 1PYGA 1Z5ZA 4D80A 4DDTA 4TV8A 5LQMA 5ISMA 4ARAA 1H5NA 4EZBA 1GA6A 1XTJA 1YA6A 3F9CA 4GX0A 3R6WA 4LBZA 5TJHA 4LF9B 3NATA 1XYGA 4H3HB 4RIFA 5KNCD 2G04A 3M9XA 3FSJX 1SEPA 2AGVA 2DTXA 3BB1A 4E7OA 2PYZA 2R1UA 3JQFA 4H59A 4N40A 2UYQA 1Q0RA 4GI7A 5CT9A 5AVSA 1B8PA 1VFPA 2VP4A 3TUIC 3ADOA 3CMCO 1ECJA 1SHUX 1U0JA 4CMKA 1BJTA 3UJ6A 3RSOA 3O8QB 3PR2B 1QP7A 3RQSA 4F12A 3LQRA 2VJAA 2EP8A 4B5LA 3UK0A 1S89A 1TLFA 2DUNA 2PUTA 1OROA 3CO0S 3D2LA 3IT0A 1YVEI 2PD4A 3N6XA 4FINA 4J16C 5A05A 4ZIRA 5KKCA 5J3JA 1QBKC 2BKLA 1DG9A 1KGSA 2VAWA 4OATA 4RSGA 2CHEA 3JQ8B 1SOVA 4ONEA 1LQUA 4BFZA 3CVJA 5A4AA 1FPMA 4FNOA 2ZPTX 1IG3A 2E2WA 5DIFA 2H00A 1DV2A 3AY0A 4YRQA 3B53X 1FMLA 2H07A 3WRYC 3LQKA 4Z3OA 1PX0A 2ISSD 2P1ZA 1H1DA 1QK3A 1U3VA 5JO9A 1XXHB 3MEQA 2KMLA 2SICE 4Y6SA 4JXXA 4YTEA 4G1CA 3O2SB 2NT4A 2BHRA 2GX6A 4ZWNA 3PUYA 1TQ2A 1KYXA 2DH5A 2E9SA 3ZCSA 4HDCA 3EPHA 3WP1B 1BRTA 2IPXA 1I1OA 3RS4A 2ZTVA 1NT4A 3EXIA 5GONB 3UMVA 2BE9A 4CMJA 4DIBA 1IY2A 5CA1F 5HOEA 1JQJC 4G8DA 5CLFA 1SU6A 3MJTA 2YIMA 2WLSA 1N2ZA 1FXSA 2VZ9A 1SC6A 1DOZA 1FNSA 2GQ0A 1KKLA 4H31A 3VVLA 2VK4A 1CG6A 1NBME 2VAXA 1JDZA 2AHOA 1PGOA 2WU8A 5C3UA 4JVOA 2H1RA 2JCYA 4KBFA 4RU1A 1HTTA 4I66A 4UASA 2WIDA 3JQDA 2IV3A 1V43A 5CD9A 3FPFA 1ZGJA 3W9YA 3ZDDA 4ZYWA 3KK0A 4WZ6A 1P17A 3EIFA 5C7YA 1RW4A 3I4CA 3EG9A 1D9XA 2WIAA 4OA5A 3HRKA 5IT5A 1LPMA 4AU1A 3O4JA 4YC7A 2PAAA 3F5MA 1F8XA 2ZR7A 4HGZA 3IUPA 5EHZA 3O0TA 1USIA 3KKMA 4E2WA 1T8SA 4HK4A 3CW8X 2ZRNA 3EG5A 2W83A 4UHFA 2ECQA 4QDZA 3PU6A 4YP1A 3OPNA 3ROXA 1F9EA 3RSZA 3S6JA 3PXGA 3W6UA 1C1XA 3U1VA 2XUOA 1L5SA 3GXBA 3JQBC 3RFTA 1HFEL 3QYAA 1ZH8A 3LY9A 2V96A 1KEUA 1QRSA 2WYHA 2ADOA 3LECA 3K31A 3NP9A 4YCSA 5A5FA 2QPLA 2B78A 4BZWA 5AD1A 4L5AA 4MLCA 1F12A 2KYRA 2O3QA 1SHZA 4OSEA 1VBNA 2RB5A 2D3TA 2ZTHA 4IDEA 1URPA 4OHYA 2VO1A 2WR8A 4BVJA 5E6UB 1Z0JA 4PCVA 4MVJH 2VTBA 2HDHA 2IBTA 1QX3A 1A2BA 3JR7A 2CMKA 2DAPA 2NZWA 2VZ0A 2BZ0A 4C3ZA 4NQZA 3EPRA 4RZUA 2QD5A 3H42B 2XZOA 3L9XA 5J5CA 4KB5A 5G3ZA 2VT3A 2ZUTA 4LTDA 1QF6A 1CUZA 1RWBA 1E6CA 2C95A 1FY2A 1YCGA 4F4IA 1RQGA 2W2XA 2G0NA 1IG0A 3LRTA 3ZIDA 4AZSA 1KFBB 4Q02A 4Q9NA 2O7QA 3EVNA 1OUMA 5AI5A 5EJGA 3PK0A 4XASA 2XJ4A 4BVFA 2Q2QA 5JNUA 1F2TB 1Z0UA 1RRVA 5ALYA 2MSEB 2QYTA 4YQFA 5K7SA 5K0GA 3L7MA 3WYGA 1LB1B 1CK4A 2QDXA 3BMOB 2Z8XA 1FLNA 5EMHA 1PCXA 3RT9A 1M8GA 2PLNA 2X22A 4UATA 3T1OA 4JGBA 5D5PA 3QU9A 5DWVA 3VKUA 4BVGA 6Q21A 2QB5A 3L0ZA 4R71A 3OJCA 5GM2A 1N0IA 4FBMA 5FF9A 1CUEA 2P4EA 1R64A 2UUBB 4WXPA 1RXCA 3SJZA 5JAUA 4PO1A 4LCEA 2DX7A 3EBOA 4OMFG 3IPRA 4JBXA 1RZUA 4LJ6A 4EPTA 3M33A 2C7PA 1QAMA 2ORWA 5DHPA 4Q4LA 1WPQA 2RGWA 4GR9A 2ZJ5A 4U7FA 4G6ZA 4WKCA 3W8RA 3HDYA 3U44B 1IMOA 3K7EA 4FQ8A 1HG0A 1POXA 3NYIA 2OSBA 2LW7A 4Y2UA 4F93B 1NUHA 2I55A 3OHSX 3V1YA 3NDIA 5CA0B 2RH5A 3EJWA 4TTTS 1M8KA 5GINE 4GO1A 3ZCUA 5TS2A 2PKRA 2Q2NA 3FZYA 2HMYB 4M1TA 6REQB 1LDBA 1AA9A 1M6VB 1A7KA 2YR0A 1RWXA 3SDSA 1YJCA 7ADHA 1QV6A 1RJDA 3VYSB 4JJIA 1U0BB 4TLAA 1UDCA 2H7XA 2IYRA 1P9WA 1Q0UA 5E7MA 4J75A 3FMPB 3WWEA 5A06A 1E2MA 1HTBA 1E3WA 2QRUA 1GUYA 2OVFA 3QXGA 4KN9S 3UHJA 2VQFB 3U40A 1GUDA 3CXUA 1AQ6A 1X13A 2GCPA 4RKFA 3F7NA 3GG9A 1LSSA 1UQTA 1Q11A 2J9GA 4WN3A 3RG8A 1SRRA 2IOQA 1G3UA 1LVGA 1UJMA 1TRHA 4P38A 4UVGA 4DMCA 2IX3A 4BJ5A 3AJRA 3IKLA 3BPSA 2FLVA 3FGNA 3GMSA 3ONFA 4POOA 1XF9A 4B3GA 3O3MB 4WOKA 1R0KA 4WOBA 2B1GA 3X2FA 4E2ZA 3N8HA 8LDHA 3IAHA 3NOXA 3K9WA 2R1TA 3ZZUA 4YONB 4D0NA 2ZAMA 3IAAA 4YWJA 1B6SA 1SPXA 4MGHA 1P4AA 1TUBA 3FVVA 1QE0A 4D4JA 4E5UA 2IEYA 4DRXB 5ITZB 1IHOA 5CDFE 3F78A 1F7VA 2X1VA 3MLBA 3U4AA 1EESA 5CH3A 4EPXA 2AR0A 1FDVA 1KO1A 1B4DA 4RL4A 1OCEA 2BKEA 4BLWA 2J0SA 4AJIA 5A5VA 3IPXA 4P92A 5H80A 3FKSD 4W7IA 5JADA 4TGLA 3H1EA 1ZVJA 3V97A 2LBPA 1FXWA 1MIOA 1TK9A 1TW2A 1UQRA 2OSVA 2PJZA 1QDUA 1U4SA 4DLBA 3I8XA 1WE2A 3QPCA 4RD2A 3WK9A 1S2GA 1U0HC 4ML3A 4OHCA 1M73E 1L5YA 1M7HA 1IN7A 1VL0A 2BMVA 2BKVA 5CUQA 3RARA 3FOEC 2YZMA 1VBKA 1FDUA 1L7MA 2A7XA 5HG0A 1GQSA 1KEKA 1GQQA 4CEIB 1WV0A 2G17A 2POCA 2YC4C 3PC8C 4OJKA 2OFXA 4B5KA 4EA6A 2P9JA 1E1RD 1IEQA 2BUBA 3V4SA 5I7WA 3L7JA 4I55A 3O7WA 1VMIA 3VR6D 3F73A 2Q4OA 4QSHA 3TEMA 3NH9A 4BEWA 3IUYA 4IDAA 5CFPA 1VE9A 1GSAA 1UQUA 3LRPA 3R77A 3OIYA 1PF7E 1PJRA 5BWCA 3B48A 1W47A 3WHIA 3Q0EA 1XZDA 1IIRA 4LVCA 2PMEA 2YUTA 3UV6A 1MG0A 2JAXA 2GH1A 1UZNA 5KNDH 5I7AA 2XE7A 4P7KA 1TM2A 1T9AA 2Q41A 2FX3A 3OD5A 1PZMA 4YRDA 3L49A 4RUKA 3T15A 4CIDA 1PW7A 2P79A 4DWWA 4F2HA 5IBPA 1KWKA 2PUBA 4M6WA 2DP4E 2O0KA 1MOZA 4E4TA 1Z7BA 1PQWA 2EKLA 2QN8A 5LP6A 1BA2A 2FOIA 2DGDA 4BQRA 1T3HA 3V00A 2RHTA 3CTMA 4AROA 4D1YA 2PGDA 2G1KA 1Z68A 2QLNA 1U80A 3MLEA 4MW2A 3V8RA 5LZ9A 2D06A 2QN3A 1HTWA 3B9RA 5JVDA 2ZBVA 4EELA 2C9YA 5CNJA 4P4NA 4ITUA 5HHTA 1G59A 1KEZA 4G07A 4M0PA 2EZ8A 1T10A 2IXAA 5E1MA 1M5UA 3CZQA 2CZQA 4X1KA 2H16A 3OJFA 1RQ7A 2NU8A 3WGUA 2VBFA 3R5KA 2MSWA 4D0LB 2VZ8A 3PPWA 1QPGA 1SCAA 4TMWA 2RGCA 1EINA 3GRZA 1X7XB 4KK4A 2F43B 4V2IA 4ZU3A 5AWFC 3TFQA 3TTYA 4EB0A 2AD1A 1H1TA 2AE2A 2PSSA 4FOPA 5EOVA 3ZK8A 5HZGA 4F84A 3QEKA 1FUIA 2XMQA 3GARA 2P1RA 4WTOA 3NTLA 1EZ1A 1XZHA 3NVDA 2ZS9A 4FFMA 1VGVA 2QN6A 3SZUA 4E03A 1S4MA 1Y9JA 4RF2A 5IBRA 1YACA 2GKGA 3ZV6A 5FAKA 5TPWA 4PZEA 4XVRA 2X9VA 3JD1A 5FTKA 5LOVF 2JAHA 3Q6NA 1W9MA 4OLAA 4CNQA 4IAOA 4JLOA 4X41A 4DV1B 3UFBA 1CQWA 2CWDA 1LF5A 4PW0A 1QGZA 1XCGB 2P9GA 3DBRB 2DR0A 1UT6A 1JHXA 1O6FA 5CJ2A 2OG2A 3I09A 5CVUA 3NYRA 3KJNA 4HFMA 1SJ9A 2J85A 4R7ZA 5CW1A 1R9NA 1XTUA 4CW7A 2PVPA 2PQ0A 4GLJA 1MHPA 3MJVA 3TUJC 3LWBA 1VYUA 3Q4GA 1YFKA 2I3DA 3DD5A 3V2IA 3WGLA 1JKFA 1G1MA 3N0VA 3ZBUA 5EJ5A 2GN4A 1F4VA 1X87A 1C50A 2L82A 2Y1CA 4B3JA 5JZ9A 3QNWA 3VPHA 4D96A 2P2GA 1CZUA 2PZKA 2Q4DA 2YJ6A 4E32A 3T7KA 1I4WA 4LXHA 3VO1A 5LQAA 1U2QA 1TIKA 1JJIA 2EFGA 2AZXA 1EFRD 2E48A 4QVGA 3LO8A 2Y27A 3GJ0A 2V03A 4FP9A 3QX8A 4EKYA 3S8MA 5FULA 5JSFA 1WBBA 3AJ8A 3IUSA 1SCNE 3DONA 3I5AA 4WXYB 2P40A 1TEVA 3E3LA 1DCTA 5DZSA 3QP9A 2FR8C 3QYJA 2HYDA 5C8ZA 2JGDB 4GYWA 4FFDA 4E0BA 1EEXB 2Q3BA 4WKNA 4YMWA 3EH2A 4FYYA 3EQ8A 3TJRA 2CF5A 2JAQA 4PYMA 2GXAA 4P5PA 1NW6A 4TT8A 3BCUA 2JVJA 3HMKA 3L07A 4F5WA 4JYAB 4R9NA 5FUQA 1UOOA 3JQGA 4IRUB 5CB4F 2XA9A 2ZSIA 3ILXA 4EG1A 3LKZA 4IINA 4WNAB 3HY6A 1DL5A 3GGCA 5EMNA 5LWHA 2UUAB 2Z5GA 1GP2A 3MPOA 5C8YA 1U1GA 4L5CA 2VPWA 5EKDA 1B2LA 3D8NA 2O2GA 2UZIR 3HKDA 1WB6A 1Z8FA 2WUGA 3GJ6A 1BHO1 2A9VA 1Z2PX 1IBKB 4RJ2A 2JJYA 3R0ZA 5H83A 3PNVA 2CJXA 2FX5A 1QNFA 1DOAA 4OI1A 1KAQA 5HM8A 2VXOA 1J24A 1CUAA 1SFRA 2GD1O 1DJQA 3R20A 4UM7A 4DUGD 1EX6A 2C07A 3F3YA 4CM4B 9ABPA 3MZ0A 4NK4A 2FW7A 1FFWA 2HHAA 2FRVA 1KQ3A 1UBLS 4L4UA 3LXUX 3G0GA 3RC9A 5HRAA 1E7WA 1J2JA 3QBDA 4RA9A 1NXWA 4HNAA 2QZ9A 3OUUA 2YZGA 2VKTA 1XC7A 2XTAA 3DS8A 5F5NA 3KQNA 1GV1A 1Z5OA 2ORIA 2YN2A 3FBGA 4XDYA 5DWQA 4KFCA 1S7CA 4M9ZA 1WZUA 3PD0A 1R0XA 4OKNA 4EEZA 3THYB 3QWFA 2OXIA 1TT5B 2PGXA 3FFAA 2OA0A 3UKDA 1U8EA 2GN1A 3F1KA 3MGBA 1OA0A 4QO8A 4EW6A 3A9VA 3OPQA 4FYMA 4JWKA 3RSGA 4R2LA 4QOFA 3F47A 2XWSA 1HNNA 3DMGA 1K6JA 2IYLD 2OC4A 3GDOA 3JW8A 1UXIA 3OZGA 5P8WA 2D5IA 1GVHA 1PTKA 2V9ZA 3L6CA 2ERYA 4JI7B 1YO6A 2XYQA 5L9AA 2J0UB 1L7QA 3EOZA 3CZ5A 4GKBA 1KK3A 3WYNA 1G3RA 1TKRA 1Z9BA 1DC3A 2XWQA 3OIUA 4ZJUA 1UMBA 1B3BA 2I3AA 2W42A 4D2IA 2J08A 2WU0A 4FJ2A 3O47A 4RH3A 3K53A 2O05A 2QLTA 2PU5A 3LGXA 4PSCA 3GZNA 4ZEXA 3HCFA 4V0ME 2CXUA 4G0QA 2W48A 1T2FA 1V4VA 1Q0LA 4B82A 3R7SA 4EAQA 1Z6PA 2BHLA 1SXJA 2QJWA 4MYCA 3DMHA 1G9SA 4TQGA 1BHQ1 4TMZA 1V5EA 3L84A 1XU4A 1AQUA 3RAEC 1HYQA 1E9DA 3K09C 4FZRA 4FI3C 4ZOAA 3IVAA 3RDPA 2Q6TA 3VSAA 1CDEA 4MWEA 1HL3A 1OFUA 1SCUB 3HYCA 1RR6A 3AJDA 3KXIA 4RENA 1EK2A 5ALNA 4ZMRA 3U16A 1DJLA 1L4FA 4XJTA 4QDXA 4HT3B 3W8NA 5LL6P 4D4HA 4Q1FA 4LF8B 2ODWA 1XAIA 3HR7A 1F3OA 2VQDA 3G8CA 3OKFA 2WJJA 4L2IB 3E9CA 1P0MA 1C7RA 2EGUA 1U28A 1HT3A 3PBKA 4YRPA 1EIZA 2Z56A 3EZXA 3H6HA 1DVRA 4EZIA 4LA4A 5F7JA 2B1IA 3IB6A 4NX2A 3TMAA 2ODQA 2LVBA 3VYWA 2EWVA 4BFVA 3RWBA 3FHCB 2P68A 4JFRA 4MPDA 3RRMA 1TZBA 4DGSA 1U02A 3P9ZA 4R2XA 3DZFA 5HPYB 2VF8A 1H3EA 3LLSA 1I1HA 2Q3MA 3E3AA 5HK9A 3ZLTA 2NO0A 2H52A 4YDQA 2WJHA 1G2IA 5M7EA 5LC1A 3WFIA 1GGHA 4BPBA 4HD8A 3CFYA 4Q4CA 5FO0A 5JEDA 1QHEA 3ZHOA 4G0PA 2IPOA 2C5HA 1MJNA 2D1QA 2VOEA 4RA6A 3X43A 1JKMA 3FDIA 1UPBA 5CHEA 4DMKA 2OCGA 1HF3A 1MAHA 2SKEA 1L1FA 4ADSG 2FFAA 5IM4A 1OXVA 4UMFA 3AK4A 2XRFA 3JYOA 2IODA 4KMOA 4E3ZA 3FNQA 3IE2A 5TIIA 1P2DA 2PO7A 1RKUA 1G4AE 3WO1A 1VHQA 1JKJB 4BMDA 2OQ2A 3RH0A 2OCPA 5T8KA 1JMYA 4LYDA 2C4KA 3ROGA 5C53B 3SKYA 1MB4A 5FB3A 2QYSA 3VJKA 1I6KA 1JZTA 4MIEA 3ZZ1A 1UAGA 3ZZNA 4A6XA 3AM5A 3ND8A 2DTDA 4A8TA 5B1HA 4BN4A 1KYTA 2IVFA 4IQGA 3V2HA 4I1OA 3B6IA 5BUCA 2YWXA 2GPBA 3CRW1 4PAWA 2OBNA 1QRUA 3NTXA 3RS9A 3TNYA 4OIFA 4QPNA 4Z6KA 3ANSA 3HZHA 1X8XA 5E4JA 3AVOA 3FAZA 1EX1A 1CR4A 1R5BA 3I8OA 3EUAA 1XRQA 2VTEA 4K9PA 3FFBA 3TRFA 1X6VA 4KWIA 5A04A 1QF9A 5ESXA 3FNBA 4N7JA 4AM8A 1PL8A 2CL0X 4U2DA 4MKGA 3F71A 3MPUA 2IW3A 5FOWA 4K6HA 3LIPA 2ODAA 3HV0A 4I3GA 3V7NA 3ZXIA 4BVLA 2GPTA 1DRWA 1H3NA 2PA3A 2XB4A 2HMTA 1L8XA 4LY9A 4OGLA 3RSFA 4EVRA 2WWYA 3LIIA 1XDBA 4GD3Q 3EVFA 3GCXA 3OOWA 3RSHA 1XHFA 2AFIA 3KSDO 3L6DA 3AIIA 3REFA 2YDYA 1SUCA 4I1IA 3ILHA 4MW6A 4LY6A 1Z28A 1FYWA 1LX7A 1N2XA 3G2JA 4HI0E 4ZQIA 3UKOA 1EUYA 2PL5A 4CM9D 3FLEA 3WL3A 1NC1A 4H60A 4UBOA 1J8VA 3IDSA 4RVGA 3CLTD 5B3KA 5E6SA 1ZIYA 2BTQA 3D8RA 4M9RA 4XVCA 5K01A 5FFFA 3WAJA 1KYQA 1JR6A 2ZRGA 3BWYA 4KTTE 4F1JA 2QP4A 4QRDA 4JR2A 5HMMA 3Q3HA 1VRWA 3IHLA 2OZVA 5K9ZA 4QNMA 1DSSG 5DEIA 5L4SA 4UHCA 5JXGA 1PVDA 1NM5C 4Y7CA 2WK1A 2C9MA 5FH9A 3B20A 1VBMA 1VCOA 1VKRA 1YBFA 1DZIA 3PC3A 1M0SA 1U7HA 3LOPA 1K06A 1H22A 2V7EA 3KBOA 3Q0TA 4DYHA 1FRVA 3FUVA 4DLVA 3TIIA 5KYKA 1MX9A 1AA6A 4M0EA 1TUGA 1JT2A 1MR3F 4Q34A 4P3PA 4B74A 2CJFA 4IV5A 4ZZ3A 1XU9A 2HKIA 4L0QA 2AG8A 2NX2A 1P77A 2B9VA 3PXDA 5CX1B 2ROQA 3I4LA 1BFUA 4MVYA 3ZE9A 1K1EA 4A2CA 4DMMA 2JLYA 2TS1A 1A9XA 1YB6A 1D0SA 4DZZA 2AJDA 3FLAA 3OJXA 1WY5A 3THXB 1C3JA 4LV6A 3BRSA 5F1OA 1OE0A 1S8OA 1Z25A 3D1LA 4B81A 1OTXA 1RLIA 1V4NA 3EMVA 4KQ9A 5BR7A 3DFIA 1FUKA 4IVRA 5FQOA 4KR9A 3JZDA 4KQMA 2G9ZA 2CYCA 1OYVA 2NUBA 3LK7A 2O3RA 4O08A 3VHXA 4PQGA 3LCUA 1IXSB 1TJPB 2AOUA 1KC3A 2ET6A 2VPTA 4IW3B 1SBZA 1V3TA 3A36A 3K2BA 4MQFA 4TSKA 5BOVA 5TB5A 1NQTA 4IVNA 3TM4A 4TYQA 3I1JA 3ZE6A 5CLJA 1YNSA 1CS4C 2CFTA 5D00A 2ZB7A 3ZUGA 2GS9A 3FI0A 3PRHA 1UINA 3I2KA 4UOEA 2ZUCA 5I7OA 3ENQA 4C08A 2CSXA 2JZOA 3AM3A 1XB2A 4EX7A 2VPYA 3SS8A 3KOOA 3I05A 3S7TA 5AUPB 1QDEA 2V6FA 4IIUA 4L6CA 4U2EA 4B6RA 3AIKA 2KWIA 1IULA 3WA6A 4BMNA 1BGXT 1XFDA 3TQSA 1XD2A 1SY7A 4JU8A 4E5MA 5FOQA 2C2HA 2MIIA 3EBLA 3BWDD 3KB8A 1B0AA 1DBWA 2B0CA 3MGAA 4PEVA 4YI5A 5EWMB 5IPFA 1FFGA 5C1PA 2C84A 5EIAA 5FWYB 1JHYA 2IHYA 5HTKA 3MJHA 3VDXA 1UKZA 1JHRA 4Y6QA 4XDZA 1AQJA 1PKXA 1VL2A 3PDUA 2X0FA 1OB2A 1WL8A 1G5FA 2EDCA 2HU2A 3ICOA 3KEMA 3K9HA 4YXFA 5AW2A 3U4IA 3LF2A 4ECEA 2VF2A 5DOZA 4CODB 3D0QA 2JLBA 3R44A 4Q47A 4WK2B 4CLOB 5IJ9B 1G21E 1AGXA 2GTIA 4QWWA 3ECCA 2BMAA 4ZZ1A 1ES9A 1J7KA 1L4BA 2FETA 2J3EA 2EJVA 2JGFA 3PFCA 3QWHA 2ZOSA 4ZRMA 1SOWA 4HB4A 3TE6A 2XZLA 4RE5A 3PTZA 4M60A 5LBIA 2OAQ1 5IP5A 1XRJA 2PUGA 3ZD6A 4RZHA 2XNHA 4R9VA 4YJHA 2OGWA 1VP9A 4MS4B 4A9AA 4AMGA 3MXOA 4WI1A 4F2DA 3G88A 3RJMA 5L3SA 3D2AA 4LRUA 3AXSA 4BNDA 3K16A 5EJ7A 1DCFA 1FUYB 1N2OA 1JB9A 1JNXX 2ZYAA 2HWKA 3OPYI 3QBVA 2JLUA 1VBFA 2CLMB 3IR6A 2WJZB 1J00A 1EB9A 2QOEA 3B3AA 1QIEA 4UHBA 3S68A 2W9XA 3KYCA 4Z7OB 3GLFA 4IX1A 3P9IA 3WWDA 1FU7A 1QTIA 1VMAA 3FF4A 2NXNA 3AZPA 4G5QA 4JFAA 4TXNA 3RYIB 1TVEA 3WY9A 1EVEA 3HR8A 4BN0A 2CLOB 5L4NA 2AUNA 3H9QA 3IIIA 3BF7A 1SPBS 4HDKB 1O6BA 3NRJA 1N2CB 2VJMB 4KXWA 2QRNA 1Y8ZA 3IAXA 4P0QB 4ZDJA 3JWIA 4HLDA 5AVUA 2VQ6A 3CT4A 3TDNA 1T5LA 1RLOA 5EXXA 2P0AA 3CKKA 4I5FA 1K08A 5B57C 1BXGA 2XVXA 2VA8A 2RGBA 1N9KA 1I3OA 2AK3A 2I1QA 3G8YA 2HC9A 3IP8A 2YN0A 3D7MA 5IZCA 2G9VA 1G2QA 1NZFA 2GHTA 2OKGA 3CUWA 5EMLA 1JR3D 3KWJA 4L28A 5J9FA 3QVUA 1JN0A 2A1IA 2Y1DA 3CR7A 3QJYA 4BLPA 2OVBA 3G5MA 4Z54A 4EYOA 4HRYA 1GIAA 4AO8A 3N39C 4LV8B 5K6AA 4UQOA 3BIFA 2JA2A 3K8YA 4YNBA 4L4SA 4RGYA 1QH1A 5JARA 5JANA 3AEYA 3DFFA 3FR8A 3L0DA 3T0FA 3DKVA 4C0HA 3U7FB 5CLGA 1G8KA 2HWYA 1P2TA 3R5HA 4G0MA 3H4TA 2IOYA 3IURA 4NJMB 3A6GA 4BNVA 1EQUA 3C4JA 4I8XA 3M4ZA 3H2BA 3M6XA 2HWUA 4KNYA 3PLNA 4RD0A 3BIXA 3DTVB 1X74A 2C3PA 5GZ6A 2H63A 5ENVA 4B31A 2DU8A 1FC0A 4NOJA 4ODIA 3PEUA 2WEKA 3TQIA 4C1BA 5WRFA 4MRAA 1CY1A 3N2GB 1EVJA 4Q0MA 1ECCA 4S1WA 4MGEA 1B6GA 1E0DA 4HWGA 3MWDB 2ZG6A 2ETVA 1X1CA 4TSFD 2PS3A 4JXKA 1AMNA 1QZZA 1E2BA 1RS0A 3WGJA 1JE1A 3JRWA 4RZSA 1WP4A 1X7YA 3E7DA 2DHRA 3WIDA 1NV8A 1DQYA 2EATA 3ELDA 1IZ9A 3HA5A 4TQAA 5DCUA 5B3JC 1K8YB 5MHTA 3IIJA 1HQDA 1W2WB 3PUHA 1LD3A 3HU1A 4IDBA 1QIIA 5JFGA 1NBIA 2GN6A 4YAJA 5EJMA 5IH7A 2P9BA 2FZVA 2GNPA 2CHUA 1NKVA 4ITRC 5BPHA 2OP0A 1ZSVA 3KJFA 1QHGA 3HBLA 5HZHA 2IVZA 2FKAA 4OFWA 3VR4D 4DLYA 2HRBA 3AKCA 4RVFA 2Y71A 4B7XA 3PITA 3D0RA 3EODA 4W1RA 4LGCA 1A4RA 1EJBA 4BMYA 2BTOA 4DBZA 4N01A 1YMQA 2V5VA 3VR3D 2O8FB 1OKKA 2CD9A 3KJZA 3G1WA 1FK8A 4MK4A 3JD3A 3DWIA 3NUZA 4UD6A 3BGIA 4RO0A 3S55A 1SUBA 3WB2A 1MZVA 3C5VA 2ZUDA 1AGNA 1MC4A 3P0RA 2K6GA 5TSDA 4G65A 1BNCA 2XGJA 3RW9A 1OASA 2HGZA 5CVEA 3CRZA 3MRSA 2H2DA 3QEAZ 4RFLA 4DSNA 4XB2A 1E1NA 1K4KA 3ABIA 4HQFA 4JD5A 1DC8A 3DMYA 4D26A 4B47A 2IQ5A 1K6XA 2DG2A 2OXEA 2ZROA 4ETWA 5DNWA 1UDWA 4BP8A 1V8BA 1MMFB 1USUA 3BTSA 5CR9A 1SZDA 1ULBA 2A9PA 3QENA 1B3RA 1AKNA 1K98A 1T6YA 4BLOA 2B7LA 4C7JA 4D4MA 1KVUA 3SEFA 1ZUHA 2QTFA 5CXSA 4ON9A 1PE0A 4E4RA 3ZU5A 1JHZA 2WI8A 2F62A 4WWHA 4ER3A 5C32A 1RXWA 1EA7A 1NTOA 4A2PA 5F9FA 4QYIB 2AJCA 1Y1RA 3GLHB 1YDHA 1YAJA 2AC4A 1N5LA 2NYRA 2VP6A 4LG1A 4CDGA 2D1TA 3GYGA 3VH3A 3CKLA 2FWRA 2N9UA 1FBTA 3RU3A 2X15A 1V4BA 2W6QA 3D7NA 3K9GA 4F8JA 2G76A 4IFTA 2G8LA 3ZNQA 1NNSA 5K51A 2DPMA 5DHTA 4IZHA 2VCEA 1C9DB 5JD4A 2ZAYA 1KFKB 5EKUA 1F0KA 3SF0A 3LHFA 2QM0A 2CBZA 2PEYA 5DYYA 1ESDA 6NULA 5LIRA 2VP5A 3RSCA 4JVLA 1CRQA 2DUJA 1BVRA 2A0YA 4K0KB 1GAJA 3BMNB 2CE2X 1NJGA 1ADBA 2I2BA 3KS9A 4DQVA 4HMPA 3T9CA 2WG2A 3B1FA 2IYUA 5A1TA 5HE8A 5HKOA 1O5TA 3QU4A 4B79A 4F96A 3ESBA 1N4DA 1ZVKA 2W6IA 3S2ZA 2WUVA 4QECA 1UBRS 1SQ6A 1P4GA 3V4VB 3GGJA 1YC2A 4NMHA 5C34B 2JJ8A 2BYTA 2MOKA 4MWSA 3UUFA 3HFGA 4YY3B 4EY8A 2F6RA 2HQRA 2X1MA 1TAQA 3HJBA 4I9HA 3WO0A 5IZ4A 1JAIA 2VPIA 4EVIA 1QYIA 1W19A 3ORHA 3Q6IA 4GQAA 1XDGA 4MVJM 1C3OB 1K88A 4OQQA 1OFVA 3W6PA 1PR1A 2CYAA 2OLJA 1R8SA 1CV2A 2KLBA 1PAUA 3ICPA 4MO2A 2QJOA 3SSMA 4M8LA 4EJMA 1CJUC 3J80A 4L9AA 1H4VB 2R47A 3VZDA 4P0TA 4FDTA 2H1IA 4CV2A 2MYUA 4EHKA 1N5RA 2WB2A 3DDUA 1J2RA 3EF1A 4HNHA 4ND5A 4QOEA 4QPZA 5E1OA 5AVTA 5KQMA 1KDYA 2WZDA 4DDMA 1FVXA 2Q8NA 3L0SA 5KUTA 4DW8A 3HBJA 1E4EB 1CF2O 1D4ZA 3H1BA 5IK2A 3K30A 5EPUA 1R5NA 4R3NA 3W06A 3R5FA 3OEED 5ARCA 4A5OA 1JR4A 2EV9A 2FJUA 2GN0A 4YMLA 4JQYA 5SY6A 1XZMA 3ESQA 1LI4A 3ZCVA 1I1NA 4QUIA 2WF9A 3OETA 2BTEA 1MEJA 2GJSA 1BVYF 4BO8A 1AKTA 4RVCA 1E63A 1XAJA 1N6LA 2NZ8A 1EWYA 1S02A 2VK1A 4X94A 4MJLA 4CIWA 2B9EA 1P7PA 4QBGB 1H6BA 4Z0HO 4CMBA 5LA6B 2R1VA 3DOEA 2HCFA 2H4WA 5H5JA 2CUKA 5B53A 1EUCA 1W35A 3PVSA 2WDPA 3VPFA 1CQJB 1BSVA 1QH8A 2QTWB 3V6MA 4AJHA 2I80A 3E9EA 4E5VA 5FO1A 3DV0B 2WUFA 1NQAO 2HIGA 4N0DA 4NNJA 1RJGA 2KE5A 4RZIA 4NONA 1BAPA 3R3VA 1TJ5A 4MWGA 3DXFA 3F4LA 2YOGA 2JEOA 3FPKA 4Q9IA 1BKDR 4YPOA 1H3FA 4R05A 1JHMA 2OGTA 3RYHA 1X8KA 4H6XA 1GAWA 2QM7A 3PGLA 3BICA 2F8TA 4GR5A 2GA9A 3V42A 3ETJA 1J97A 4FJ1A 4LOKA 5IXSA 3NGXA 2AH5A 5A02A 2NAPA 1O0BA 2RH8A 5IDVA 1MABB 3A1VA 1FSGA 3KEQA 4W8HA 3V8EA 1AH2A 1LLDA 1IDOA 2QXTA 5HIJA 1ZXLA 1XMSA 2I7DA 5LMNB 4DR7B 5ECWA 5JHGB 2P35A 2XYGA 3NI2A 3ZGZA 4UVEA 3W5HA 2HOQA 1E1DA 1UZLA 2O1EA 4GOND 4LKOA 3A1DA 4E13A 2FEKA 2J3HA 2HEGA 4NESA 3V4OA 3K6KA 1IEXA 4DCMA 4ZD6A 5U9CA 4CT5A 1J21A 4D92A 3UXHA 3R6LA 2ZYWX 2V6JA 4RADA 1J2UA 2H6EA 1CWUA 3V3KA 1DRJA 4DG9A 3FPBA 4PR0A 3RVJA 4HVCA 1TGYA 2J9RA 4F91B 1HYHA 5HRCA 4TZ0A 2P2DA 4EUHA 3IPYA 1K92A 2I3BA 1KI8A 2RK6A 3B6JA 3WKEA 4NEHB 2FUG1 5KQLA 4CQMD 3EFOA 3R9IA 1KP2A 3AFOA 1TYBE 2F1JA 3GT4A 2WJ6A 4FGKA 3NV7A 3RJZA 3S29A 1I3LA 3K72B 4DMLA 1R8QA 3EEIA 4LYYA 4MUEA 4UKDA 4XFJA 5ER6A 3THRA 3UG7A 4DV4B 2RSLA 4I8DA 5B3LA 3GJYA 3NHRA 4UDOA 4LRYA 1GL9B 4YCCA 5F2OA 2O8DA 5FWXB 1FYVA 1XCPA 4KLZA 1JALA 1P5ZB 2C3UA 1KDOA 2N47A 2QZPA 4LDQA 4CF4A