3PF2A

The crystal structure of the major pilin gbs80 of streptococcus agalactiae 35kda c-terminal fragment
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
317
structure length
317
Chain Sequence
VTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQDALDKATANTDDAAFLEIPVASTINEKAVLGKAIENTFELQYDHTPDKADNPKPSNPPRKPEVHTGGKRFVKKDSTETQTLGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFEIKGLAYAVDANAEGTAVTYKLKETKAPEGYVIPDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cell wall surface anchor family protein
publication title A Model for Group B Streptococcus Pilus Type 1: The Structure of a 35-kDa C-Terminal Fragment of the Major Pilin GBS80.
pubmed doi rcsb
source organism Streptococcus agalactiae serogroup v
total genus 79
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16569 GramPos_pilinBB Gram-positive pilin backbone subunit 2, Cna-B-like domain
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pf2A02
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pf2A01
1I9JH 1YNTB 2NLJA 4J3SA 1Q0XH 3LKRB 1FO0B 1FL3B 4WTZA 1QUNA 3GMLB 3UTTE 1TTGA 4YHIB 2ATPB 1KEGH 3C60C 2NY6D 4GS7C 2FECI 4MD4B 2EDNA 4HUMB 3VFUA 1ROWA 4KRPD 2G9HB 1C5DA 4JFDB 1NEZA 3RKPA 1MLBA 1YPZE 3MRRA 4YIQA 5CP7B 5D1QA 1GYAA 1K9TA 4P2OD 3AM8A 3AAZB 2IPUK 5C09A 1AJ7H 4AMKL 1I1AA 4TPRL 3C09B 4JHWH 3KPRB 1KENH 3NMEA 4OF6A 4AQOA 4J7RA 4YXKH 1R0AL 5E99L 5IKCA 2YPKA 3E3QE 2FEEL 2YXMA 3PWJB 2H8PB 4M8QA 2JIXD 1CICC 2NY1D 5DJ8A 3HLAA 3TJEL 1WK0A 1TXKA 2NY5L 2HTKD 3I50H 1AFVH 5EU5A 5L9DL 1N64L 5T3ZL 1MHHA 1J9CT 1Q9KA 5DI8B 1FORH 3LKSB 4M3JA 2FNBA 3UTTB 2CGRL 1EFQA 1RUAH 3GI9H 1KC5L 4I1NB 1MWAB 4M48L 1MJ7H 3MRHA 1NKRA 5I15L 3LPWA 2W9DL 1KB5L 2EKSB 4OZFB 1DLHB 4JREC 3NA9L 2AJYH 5AD0A 4JPWH 2VAAB 4ONGL 1ZXQA 2VKWA 4DVBA 1RZGA 2XQBH 4AIZA 3QIUA 4IOIB 1T1ZA 4O2CB 1DQLL 5DMGC 3QG7L 3T0WA 2DIAA 1QSEB 5DC4B 4YHLH 4MCZA 1P5UA 2ZCKL 3VFNA 4YDJB 2YK1H 2GY5A 3NCFB 2OXGA 4UDUB 4JY4B 2DQIH 4QCIA 3P0VL 4KDTA 5L0QB 4MA3B 1HSAA 1EZVX 2HT4C 4D0BA 1ONQA 5EULV 1LVEA 4ZTPH 4UINL 1S5HB 5EG6C 2RQ8A 3ARGD 4RNRB 4GUPB 4IOSD 2AJSH 3UTSD 4FZEH 4K9EC 5CCKH 3VG9C 1MI5E 3D39A 1NC2D 5JW4M 4JRXB 1QYGH 1F3JB 5BO1L 1UB6B 3S5LA 4AH2A 2GQHA 2ARJB 2R2BA 4NJAL 1HZHL 2W91A 1DANT 3FONA 3UMTA 2EKJA 2B1HH 4YR6A 5KJRL 4JPIB 4UTAH 2R4RH 3WL9A 4ODSH 4OUUB 4H88L 4UV7L 1KEML 4G6JL 4GRLD 3LN4B 4LSUH 2N4IA 3O3DA 2NY6C 4KUCD 4XRCA 1Y18A 3IVKA 1WV7T 1KFAL 1YN6A 4JFFA 4KRPC 5I17A 1JFQL 3P11H 3MOAL 1A1MB 2FZ3B 1EO8H 4FFZL 4PGEA 3ECBA 3SDYH 5TH2B 1C5BL 4QHKI 4NC2B 1W0WB 1FG9C 3A67H 1B2WH 1IM9D 3AY4C 4JHAL 4CMMA 5IIEA 1FLTX 3RZWA 3I75A 4IGBD 3BP7B 5DD6A 4ZS7H 3SGDH 2NY0B 5BRZD 3BT2H 4L3CB 3DO7A 5DQJB 5JIPA 3G5VB 4NN7B 4H8WC 5F7MC 1MUJA 2W9LA 2IMNA 3MMEA 2B0SH 5IMOA 2PYEB 3HE7B 1NMAH 2YD2A 4F33A 3MREB 3F8UB 3QPXH 4YDLC 2NY1C 5TGBB 2HTKC 4XP6L 3C8HA 1T04A 1FZKB 4Q0XH 1HH6A 2C7UB 4NDMB 1SJEB 4LHUB 4X6BB 4XPTH 1A21A 5FECA 3GMMB 3S88L 2C3VA 1QZ1A 1XF4A 1ADQH 1NCDH 2NW3B 1A2YA 4KJQC 1OAQH 3TT1L 3BEWA 5KANI 3P0YL 3DECA 3RNKB 4EUPG 1NC4A 4RWYH 2Q7YB 4N8VA 1HWGB 2DBLH 3NZ8A 1EGJL 4JRWA 4YHYB 3DX9B 2YKLL 4CVZA 5T33H 1ZS8B 2DQDL 3L5XL 2C3GA 2FATH 3JWDC 3TYFB 5EC1B 2CMRL 2FX8H 1TZHB 1OAZH 1EIBA 4NCDA 4ETQB 1DDHA 2W0PA 5J6GA 2HT3C 1MNUH 3MV7A 2HAZA 2MCG1 2AERT 2DQTH 4HPYH 1AO7D 3FMGH 3QULA 1OSPH 1U8NB 2XTJB 1MCSA 4PP2A 1N6QL 2NPLX 2GUOA 3MGOA 3ARGC 1FP5A 5DRWA 1KIRA 5IQ7H 4H25B 4OV5B 4JJ5A 5DFVD 2NXYD 3CDFA 4MJ6A 3NCYP 1MREH 1E27A 3WUWA 3T0BA 4DZ8B 5GGTA 2HVKB 2P24A 1JK8B 3PWUB 1BOGB 4IRSD 3O0RL 3CH1B 4G42A 4GRLC 2X5PA 4I0PD 2R9HD 4I9WD 1IGJB 3V5HA 3OPUA 3BKJH 2H6PB 1VACB 3CLFL 1CXIA 4Y16A 3IDIB 1NMCB 2XXMB 4LKXB 4WW2A 5D7LE 3CDCA 3PV6A 1JZ5A 2ESVD 1PZ5B 4OD1L 3VG0H 4GXUN 3IGAA 4AENB 3C5ZA 3OGCB 4Y4FB 4IGBC 3GJFA 1BZ7B 2P5WD 4L1HA 3KPSD 1FVCB 5E8PA 5FYLH 4D9RD 4E5XB 2RGSA 3G6AA 5ENWB 2ZJSH 1YEDA 4WI2A 3BH8A 3TO4B 4R0LA 2P1YA 4GG6A 3SDXF 5DJ0B 3KJ4C 3FQUB 3PXHA 5D1XD 2CRYA 1KJ2H 5T1KA 1N5YH 3L95A 1AR1D 4F3FB 3GZKA 1VB9A 2YA1A 2HH0H 1AD9A 3PWVA 4ELME 3F7VA 4PRHE 3D2UD 1FFPA 3MRFB 4XCFL 1EHAA 3OJ2C 2WLYA 4LK4A 2X4OA 3L5WB 4DEPB 1HH9B 2GCYA 5FUZL 5JOEA 4I18C 4KK8D 4F7TA 4MZ3A 4X7CC 5DK2A 4JQVC 4S2SB 1T3FA 3W0WA 3LVEA 2J5LC 2DN7A 5JMOC 4C56D 1NAMH 2H9GB 3ULSA 5B38B 1EXUA 3GSWA 3JWOC 2ARJQ 4AEHH 1G9ML 3QEHA 2XWJA 4LLMB 5HVHC 1FAIH 3HNSL 5HGAA 5JA8B 1CFQB 5DRNB 1RZ8A 1CYGA 4Q9BA 1ES0B 3QJFB 5CSBA 5DS8A 3UTQB 1MCNA 3QDJA 2VL5A 4ENED 2NTSP 1B6DA 5FM8A 3ARFA 5DFVC 4ZSOB 1ZA6B 5L2KD 4WHYH 1AGCB 2NXYC 5D71H 1JWUB 1GZQA 1NUGA 3QXDB 1FGNL 2P46B 5I0DA 5M94B 4JFOA 3EYVA 4HIXH 1FNGB 4X7TA 4Y88A 2PTVA 3WIIH 1N4XH 3ES6A 4FZ8H 5IEKB 1BEYL 2VXTH 4CVXA 1E28A 1C08A 4IRSC 3G08A 4GAJL 4I0PC 3T2OA 2DM2A 5DUPL 2R9HC 5ALBL 2WIMA 5TE4H 4GRWF 2NCMA 1XCQA 3X12A 3NTCL 1EHNA 2JB6B 3QHZH 2BVYA 4L8BB 5CJOH 1BVLB 3BGMA 3BKYH 1K8DA 3BIKA 2X4RB 4ZS6C 4XWGL 3QNXB 4XXDA 1I9EA 4FQQA 4WU7A 4K2UL 4OIBA 3J7HA 3GJEB 1XGRB 3N85H 3P9LB 5K9QG 1CR9H 3M17B 4GJTB 1QRKA 4YAQA 1XZ0B 5GRJL 2OP4H 4YXLL 3GEWB 3N1QC 4JPVL 5HPMA 4HG4J 4AG4L 3WIHH 3FB8A 3VFVB 3SKMB 3JXAA 3STBA 1DLFH 1N7MH 1RJLA 3A6CH 4J2XA 3BQUD 3I3DA 5D1XC 5EA0H 1A47A 4HKJA 1AR1C 4D9QE 4RAVA 1S7SA 5HYJA 2HFEB 2MNUA 1JF1A 3QUML 2WIIA 1NANI 2ZCLH 2KBGA 4UDTA 4K3EL 4QEGA 3C2SA 5E70A 1MIMH 4JO1L 2AKRA 5DJ2A 1MCPL 2GJZB 5J4MA 4KK8C 5TDOB 1WIPA 1F4YH 3EFFA 3H7BA 1E4KC 1CN4A 3C5SB 4Y4HD 2EH7L 1JN6B 1MCOL 1SYVB 3BJ91 4QXTA 2VE6A 3V4VH 2MTPA 1VENA 1OGAA 3AU1A 3MBEA 5KZCD 1S9XA 3SDCD 1G7PB 1YMMD 1MRFL 2FJGB 5F9JA 1D5IL 2ZNXA 3NIFF 2GAZB 5AEAA 3VI4F 3UYRH 4ENEC 4QYOB 2P49B 2VSDA 4XNZC 5J56B 4U1NA 3CFBA 1KBGL 1N6UA 3WHXA 4JFHD 3RA7L 1U8MA 1FE8H 2WUBL 3BRDA 3X17A 2FB4H 3RZCA 1CLOH 5FYJL 3IFPA 4JFYB 3MLVL 4JFEA 3OAUH 2HJLB 2GTZB 3NIDF 3VFPA 3DIFA 1JGVL 4NP4H 4G9DB 1U8IB 4P4KD 4KI1A 1C16A 2XWTB 1NCCH 2YC1B 5JPNA 3MRBA 3PF2A 1EMTL 2D9CA 4P3CH 4Y19B 1UJ3C 4NBXB 3BEVA 4E9LA 5I1GL 3B2UD 1OTTD 5FYJD 2YD7A 2DM7A 1CFSA 5F9OL 1NEZB 5D1ZB 2OXHA 2HKHH 4Z7QE 4OV6F 3MJ6A 2DYPD 3BP5B 3TO2B 4FQXB 1ZLWK 4G7VH 1CE6A 5I75B 1EVUA 1MRCH 3C6LA 3BDYH 2IADA 3CVHH 4PRNB 5CWSA 5BXFB 4MXVF 4PR5A 5F7DA 4LHUG 3CVIH 1AD0A 3UJJH 3T3ME 1KXQE 5DJAB 1QFHA 4PGCA 3KXFD 1T0NA 4NKIH 3JTSA 3UCRA 3SO5A 1JPFB 2EICA 4ZDHA 1GGTA 4ZFFA 4P2QB 3BQUC 2NX5D 4WI8A 3S96B 1PQZB 1IQWL 3WLWD 4AJ0A 4Z7NF 1T66D 3BRGC 5DMIH 4YGAB 1MAMH 4KTEL 1PX3A 2RHEA 1IAOA 1U92B 4MSWA 2Z8SA 4Q97A 2OR9L 4Y1AD 3BUYB 4PY8I 3IJSB 4WJ5A 4X83A 5I73B 3WXVH 1I8IA 2VKXA 1LP9A 5JDJA 1MCWW 1RZGB 1XFPA 4Y4HC 3IDJA 4BQ6A 4ZO8A 4IOFD 5C0AD 2R23A 3CFJB 5E8EB 3T08A 4JFFE 2VC2H 3V0AC 1XGYL 4XNXL 2XY2A 4KV5F 3SDCC 3K0WA 4OLWH 1JP5A 1B0RA 4D0BB 4IIQA 4LCUA 1F02I 4IRJD 1NJ9A 3BP6A 4NKMA 4UI2A 3BPOC 4U1MB 4L8SA 2X4QA 2X1QA 1IAII 4P3WA 2F5BL 3OTTA 2OZ4L 3ZE2E 1ZGLM 1FGVH 5J11B 3VGAB 3FT3B 3CZFA 5IM7B 4PGZA 3ME0A 3GK8H 4P4KC 4QTIH 4BELD 3H2WA 4O5LH 2HRLA 5JNYB 5KVEL 2Q6WB 2CKBA 4LRIA 3V0WL 2B5IB 3LN9A 5H2BA 3B2UC 2Y36H 1OTTC 4F7PB 3QUYA 4JFFB 1J7VR 2X4UA 3BYYA 1RPQA 1SYSA 4O51A 1EJOH 2AJ3B 3I85A 5IHUH 1Q1JH 1IGIL 3LKPA 4MAUL 5A2LH 1JYWA 4XP1H 1JL8A 4LMQE 4MYWB 3WIFA 1AXTL 5DD6B 5E8DH 1HHHA 2OR8A 2G75B 1UWGL 1GOHA 1CE1H 3CC5A 4BFBD 3MMEB 4RAUA 2RCSH 5DGRA 5GS1C 3MV7E 1FLRH 1NKOA 4F33B 3H9HB 1OTUD 1NL0H 4GT7A 4N0RA 4Q74A 1A6PA 5FGSA 1DQMH 4TSBL 4PGBA 1KUMA 4UTBH 1IJ9A 1S8DB 2Q8BH 3TLRA 3WLWC 5DC9B 1T66C 1FZJB 2VDLH 1GH7A 4F7CB 3PG2A 2WUCH 5H35B 1SHMA 3BPLB 2AQ3A 4YZFF 4C4KT 3MV8A 4YFLI 3ULVL 4AK1A 3BO8A 4MDIA 3X11B 4LHJB 5LAXB 4RX4D 4ZAKB 4HUNB 1K5NB 2FIKA 4DKEL 4IOFC 2NZ9D 3OHXA 3KWWB 3T0ED 5KTEL 3RY6C 4I3SL 1C12A 1S7UB 4GW4A 1D5MB 2ZOKA 4NO3B 4FQ1H 1WWCA 3MRLA 4GLRH 4QRUA 3RWGA 3N1PC 4IRZH 4I2XA 4JKPL 2OK0L 1DL7H 5F1IA 3LEYL 4PP2B 2R0LL 4IRJC 2HJKB 1OPGH 1R3HA 3OG6B 5FA3B 5IVNA 2DM3A 1K3ZA 4JM2B 3ULUE 2BOBA 1INEH 3UJIL 3MRIB 3LB6D 1NQBA 4ORGA 2BNUA 3GHBL 1QR1B 1DANU 4Y5YA 1HN1A 1P9MC 4GG6E 3VFTB 5CILH 1DBAL 1KIQA 1U3HB 4N8CH 1KPUB 2F54A 4NUJB 4XNQB 4XBEH 4QHNB 4HBCH 2YWZA 2XZAH 3HE6B 1YN7A 4WI9A 1DBJL 2XN9A 1BD2D 1UA6L 3DX8A 5MI0B 3V5HB 1MFBH 5DLMH 3I6KA 4YC2C 3DTXB 5C0IB 5IR1B 3EJYD 3FFDA 1JNNH 1ETZB 4Z7WA 3O3AB 3DX6A 1KTDB 1IC5L 4M6NL 1ORQA 5HVFB 5EU4B 3FQXA 4K7FA 3C8DA 3CMOL 3W0WE 2GFBB 2P8MA 4RRPG 1BWMA 4WHTB 3DVFA 1BLNA 5ITBH 5DWUH 3IETA 2BNQA 4MA1B 3QUXA 3BP4B 4YGVB 2NY3B 5GGTH 1NGWA 4PJHA 1QLFB 2KPNA 4JDTH 2P5EB 3DVIA 1FZMA 3U7YL 4XC1H 5D7JD 3QDJE 2XI9A 5BJTA 2AJVL 4MNQD 1CXFA 1IKNA 5CGMA 2D31B 2EYSB 1XGTA 5JXEA 1UKTA 4BH8A 4H5SB 4X99B 5CZVH 4JVWA 4NWUH 4PJDA 3GJFH 3QUZB 3ZT7A 3RPIA 2FO4A 5MP6H 1ZTXH 1KELL 3ULUH 1RVFL 1RMFL 1T3FB 4TQEL 4FQLL 4BQ9A 3OB0K 3T0EC 2AP2A 2NW2B 4WUKH 1RU9H 4ZTOH 3OKEA 2BDNL 4LCWD 2YSSB 1SJXA 5E2UH 1HHKB 5F44A 1LEKA 5HDQL 5M95B 2DOCA 5E4IA 3RUGF 2XWJB 1RIUL 4UIKL 5HGAB 2X05A 4N9OB 3WE6A 1FBIL 4O02H 4MQXD 4BH7A 4LLQA 2M26A 4GRMB 4ODUA 4Z95H 1JNJA 1IAMA 5F96L 4ERSH 2NY7L 4J3XA 5MEQA 4BUGA 2B39A 3LB6C 2X10A 4URTB 1A6VL 4HLJA 3WFDL 1Z9OA 4D0CA 2X4PA 4R9HA 5I1JL 1G84A 4JFOB 1HCVA 4OF5A 1CK0L 3TZVD 4PV8A 1T2XA 4DK3A 1NEZG 5D7KE 4KJYA 3NCMA 4BQBA 3BN3B 1WC7A 2P7TA 4YDIL 3D9AL 4U6XA 5HYJE 1TVBA 3V8CA 3TH2T 2FSEB 4FABH 1NGYB 2IQAB 2DD8L 1V3JA 2BHYA 1K4DA 2AK4D 3L3JB 1FVDB 3IDYC 3SPVA 1C8PA 5KS9A 1P2CB 3EJYC 4QHLB 3FN3A 3TA3D 3LQZB 2JK5B 3WEXB 5LGHL 1VFBB 3ALXA 4WFED 1CLYH 2J8UB 5IF0A 3GO1L 4I77H 3N1GC 1W72A 3T2PA 3AB0B 5GXBB 1OGAE 3KPLA 4ORZC 3R06A 1NCTA 1YEFH 1GCFA 5CGYD 1JGUH 1W0YT 2BHUA 1ITCA 5I18H 4WTXA 12E8H 5L88H 1NGQL 1D6VL 2YPLE 4S1RH 4WVRA 2CIIB 4MXWH 3DUSB 5CMAA 2Y5EA 2X4NB 1B4JH 1MLCA 5D7JC 4AM0A 2A6DB 2CJUH 4ZUSA 3ARDA 1EHLH 4BSJA 3FQRB 3WFCL 4LCIH 3WO3B 5SWSA 4Z78A 1ZLSH 3P2TA 1Q8MA 3LAFA 1W8OA 1SBSH 2PUQT 3TIDB 3ARRA 2HFGL 2ICCA 2I9TB 2V9RA 1P5VA 3RKDD 4JFZH 4KUCF 2BFVL 5FGCE 1MFDL 4JFEE 2FBJH 4NZRH 3RVVD 2AW2A 3WKML 4LNRB 4YFDB 1I7RB 2VNCA 1UZ8A 2DJUA 2D03L 4XP5H 2XTLA 4HH9B 3RWJA 1X44A 3LH2L 5KVGH 3TBSB 1M6OA 4WWKB 2ICWB 2IG2L 4HCRL 5E2JA 5ISZA 1EX0A 4K8RL 5D5MF 3GKZA 5CINH 4L3EA 1QLEL 3WO4B 4RISL 5CBAA 3OX8B 3VFSA 4BSWA 2YPLB 1BJ1H 4S0TD 4MQXC 3EOTH 1G7HA 3TCLB 3S5LG 5GRVK 5GGRY 1UWXH 1QQDB 3TNMB 1P7QA 1DQDH 5JQHC 5FEBA 4K8RD 1JNLH 2OQJA 4X80H 2IBGA 5D96C 4GW1A 1P4BH 2WANA 1IT9H 2GSIB 4XGZB 1IEAA 5DHVB 4PG2A 1U8MB 2PN5A 3FQNB 5FGCB 5DC0A 4JFEB 3TZVC 1Q72H 1ZLUK 5HGBA 1XGQA 1RIVL 3DI3B 3SOBL 1A4KB 1C16B 3NFSL 1FNLA 1EZVY 2AGJH 4X5WB 3JV4A 5CFHA 4KGJA 3UTPD 4CW1B 1WEJH 4PRAA 4X6EA 2R2EB 2R0WH 1LP9E 3BDBA 4K94H 3RTQA 5JW5A 1J87A 1KXVC 4NQXB 1GGIH 3QJHB 1CL7L 2VLLB 4M1DH 4XVJH 4PJXF 4HUKB 4Q9QL 4Z7VB 4P9HH 5IB5B 5CGYC 1X5ZA 3GSRA 1X5IA 1KLUA 2E6QA 4BFIB 4PJIF 1IEBB 4JFXA 1I7ZB 1LO3H 3H9SE 3V0VA 3X3FH 1TPXC 4PJ8A 3RGVA 5TQ2H 4N8VG 1H15B 1GGYA 3WNNA 1EAPB 2L7UA 1K2DA 1F6AB 2V7NB 1R3KB 5B8CC 1DFBL 2Z35B 2O5YH 3GSNA 1CD8A 3QO1A 1KN4H 1SVZA 4MD0A 2AABH 5HHMD 1ACYH 3CLEH 1IC4L 4LEOA 3RVVC 1V3KA 3MV01 4MJID 5EC2A 4XBGB 3QFJA 1YEHH 2H41A 2UY7A 4ODVH 5AG9A 4RMQA 5GGRB 1UXWA 1WZLA 3RP1A 4IEFB 2ZCHL 3MLRL 4ETYA 3KLAA 3L3DA 2H32A 2IFFL 2VLKD 5ICYB 1A9EB 1INQB 1MQKH 1WT5C 2BC4A 4AYFA 2ILLA 5EPMB 1A9BA 2XKNB 4Y7MA 1Z6JT 3H9SB 1G9NL 5HI4D 3EO0B 4UILH 5B39A 5I16A 2QQKH 3QNYB 4K8RC 2P8LB 3RBSA 1G6RA 3RY5A 3MUJA 1P4LB 4N0YL 5EU7E 1T89A 3PXJA 3QI9D 3P30L 8FABB 1G1YA 4PRIB 4XHQA 4MA8H 2YRLA 1UZ6F 5CEYB 3PIQB 4WFFD 2FJFA 4OCSH 3BWAB 3HB3D 1G7IB 3G6DH 5D72L 4PJ7E 4FHBD 2VLJB 5E08L 3HAEA 5DD0L 3MNWA 2RIKA 3AVEA 3GSUB 3X14B 5CJBA 3MV8E 5J0BA 4U6YA 1FN4A 2GT9A 1GIGH 2FX9L 2YUXA 2PTTB 5JR1H 5KSUA 3ILPA 3LKPB 4XBPB 4PJGF 32C2B 3U36B 1AKJD 3D85D 5DURD 3VE0A 1HYRC 4YHZH 1HK6A 1JHKH 4M7LL 1K8IA 5I8EA 3U4AA 3GSQB 2CO6B 3BPCB 3N50A 2GK0A 5T1LB 4I2XE 2MQCA 4P3DB 4TVPE 1WFUA 5TPWH 4LSQH 4PGBB 2CKBH 4G8IA 1WBZA 2Z8WC 2C5DC 4FNLH 5JDSA 2R0KL 2UY6A 4X5LA 5IOPA 3MCLH 3BPNB 1VDGA 3SE8H 2BX5A 1TJGH 2QQLH 4PJ7B 1PYWA 1ZHLA 1GZPB 5F7FA 1KN2H 1YNKL 3LHPL 5C0GB 1BBJB 5SWZD 1F3DJ 4C4KO 1DQTA 4WFHE 3L3KB 3WHE0 5DTFB 4M93B 2F54E 1J1XL 5DVMA 4FQCH 2OI9B 3U46B 4Q6IC 3SGKC 2YD6A 1LEGB 1TQBB 2E6JA 4PGDA 3L3HA 1IBGH 2CRMA 4QRTA 2GSGA 3NFNA 2XN9E 4DGVH 2MHAB 1IRAY 3HNVH 1C12B 1A1NB 1YEGL 3A6BH 1GRWA 2QKIA 2R8SH 2E3VA 1L7TL 4FQIH 3GSOB 2BVPA 4XH2B 5IB3B 4HT1H 4Y5XC 1ZSDA 4PJ5D 4P5TD 4OLUL 4MJ5A 2IBZX 1QFWL 2LU7A 5IROC 4A6YH 4DWHA 3NABL 1IGTA 1LD9A 2R1YB 2PXYA 1WQVT 2RB8A 1YJDH 3D0LB 3MUZ1 4NBZB 5FO7B 3QXVA 5IFAL 2O5ZH 5JORB 3RIAF 3QI9C 2BNQE 4LLVB 4WEMB 1OP3K 1F45A 1QRNA 4UUJA 3QUKB 5LKNA 3HS0B 3T2QA 3P9MA 4HFUH 5C08D 3HB3C 5IMKA 2HWZH 3MJ8A 5DQ9B 2ZUXA 1EJ6A 3SE3C 2XN9B 2WP3O 5EWIL 5E4EC 4LCYA 4M7ZB 5KSBF 1X5GA 4L4TE 3TM6A 4W4OA 5I66A 4WCYL 4JKWA 5BZDA 2EDEA 4TVPH 1OB1B 3BH9A 1B0WA 5DO2D 1NGZB 1I4FB 5EO9A 1QFUH 1LQSR 4PY7A 1NCBH 1ZT1B 3GSVA 2Q87A 3FQXB 3GGWB 5I30L 3EDDA 1R3JA 5E0QA 2VXVL 3P4MB 3R0NA 4HS8H 3THMH 4L5FH 4NUGH 4M7KL 2BNQB 1YY8B 1F4AA 5FYKH 4W4NA 2GITA 1JWSA 4M6ML 1NFDB 3HUJF 4PJ9A 1RULL 2VTFA 3ZTJG 4WY7H 2XXCB 2AV7A 5HHOA 5LG1A 2HFFA 1K85A 1K4CA 3OL2A 3EDEA 3SJVE 1JMXA 4KZDL 3WKNA 2JELH 1U8KA 2ZOLA 4L4TB 3PHQA 5GISH 4JZOB 5E6ZA 3RWHA 5TE6L 5EIVA 3AXLA 4MX7B 5T1MB 5IV2B 4X0KA 1T20B 4EDXB 3L7EA 5EFIB 3OKKA 3PQYA 1NLDL 2ICWI 3Q6GH 2F53E 2V5SA 3CSPA 1CFVL 2H1PH 4DUXA 3D48R 1RZKL 4ODWB 1C7SA 5KS9E 1DQQA 2FGWH 4M6OL 1F6FB 3OKNB 1ZAGA 1KPVA 5C8JA 3WE6B 4R4BB 2F74A 4LLQB 4HIEA 4P5TC 4WO4D 4Z77A 4ODUB 5IFJB 4IDJL 3W11D 9CGTA 3S3JA 3JV6A 1T5WA 3LEVL 1O7VA 5TE7H 3GBNH 5ALCL 3QWRA 4N0CD 4MAYB 1J1OH 5T3ZE 3SE4C 1J0IA 3SJVB 3IU4L 4UMGA 4AT6A 1RZIA 3KYNB 1T83A 3T65B 4P2OB 4WGWB 5GSVA 5MERA 3T0DA 4E41A 5DJZA 1IKFL 5FUOL 1T7XA 4BSVA 4OZIF 2XNAB 2APTA 3OPZH 5FHAL 5BMFL 2UWEE 3MUGA 4U6XB 4O2FA 3SY0A 2F5AL 1R5IA 3K8MA 1TETH 3CK0H 4KMLB 5SWSE 4DVRL 1V7ML 5D7SL 5AYUH 4HULB 5MHSD 2F53B 3RWIA 2HLAA 5DO2C 1U8OB 4G8GA 2DQHH 1CI5A 4K3DL 1MCLA 3VXOA 4GMTH 1CTOA 1ZLVK 1IAIM 4NQEA 3QA3A 5JXAH 2NZIA 3KPMA 2JB5H 5HTSA 2I26N 5B4MD 1W72B 5ISZE 4LBEB 3R06B 2R2HA 3DUUB 4L3EE 3VXQA 1X6NA 4JRYD 1FL5A 4MNGA 1UM5H 3WFHB 4PJFF 3F65A 4FXKA 5FO9A 3EYQD 2YMXH 4ZUSB 1KB5B 3C6SA 2UWEB 3ARDB 2DB8A 3L3OB 3KYOA 2BVOA 1DVFC 2JCCB 1A7BA 1A3QA 5AZ2H 1XT5A 1U58A 5EU3A 5C7XL 2MQ0A 3HR5A 3S35H 1QO3A 2V7HB 3MLSL 1G7MA 3WXWH 4MA7H 3ARGB 4FFYH 3VRLE 5BV7H 5MEPA 4RGNE 3STZB 5ERWB 4KTDL 3ZL4L 3EBAA 1QP1A 1MHPL 2WM0A 1X7QB 3KLHD 4WGVB 4NNXB 4IMKA 1M6OB 3I02B 3HI6L 4LGRB 1V5JA 1JHLL 4NO0A 5EU6D 1I8KA 2C1PB 3HI1B 1TQCC 3HN3A 3O45B 4EZMA 1J05A 3WBDA 1YMHA 3SDXA 5F6IC 4WO4C 4U1HB 3N1FC 2BNRD 3W11C 1I9JL 2WMPA 1RZKC 1TCRB 4G7YH 1Q0XL 4N0CC 1SJHB 4BQCA 5AAMA 5K9OA 2X9WA 1UB5A 1IM9B 2YZ8A 4F7EB 3IDUA 3SKOA 3CXHJ 3HC3H 1NCUA 2NNAB 4ZXBB 1OAYH 3CSBA 5D5MB 4RGNB 2OKMA 4L3AA 1IL1A 2VLRA 2E9JA 3VGDA 1FNEB 2IH1A 2WINB 1CDJA 2ZUQC 5JLZA 1AJ7L 4V1DD 1BIIB 3DV6A 4NT6A 5IVZB 4JHWL 1QFOA 4WIQA 4F9PA 2G5RA 3TC9A 5INDB 3L7FB 1T0MB 3QFJE 1G6VK 4KVCH 5C07A 3V79C 1J1PH 5ID1A 5CD5D 1YEIL 4AEFA 3BUTA 4KY1H 5B4MC 1XIWA 3I50L 5F6HJ 4HXAH 4X7SH 1AFVL 4LPWA 4EI5B 3PJSB 4OCRH 4LVEA 4N9GB 4OI7A 1FORL 1KLUB 5F1NB 1FFRA 3VXME 1ZANH 1IC1A 1ZHNB 3BX7C 3FTGB 5GGSA 3GI9L 2VZ3A 5T3XD 1LILA 4RGOH 1MJ7L 25C8H 4L4VA 5CJXC 5JIHA 5IP4A 3EYQC 4YDKH 2V2XB 5KSAB 4GKNB 2SEBA 1V3LA 5FV2A 4P46C 4RA0C 4RMUA 2CRZA 1M71B 2DQFA 3GMQA 2AJYL 2IPUG 4JPWL 3ZHLA 5A16B 5HVHB 1IAKA 3VD4A 2XZCL 5DZLA 4Y2DA 2XQBL 4JFDD 2BVQA 1URLA 3IYLW 2D4FA 4NWTH 2C3WA 1KXTB 3CFCH 2CDEB 4YHLL 3KPQB 5ICXB 3G5XA 4NRXB 2YK1L 4X98B 1I7TA 2QQNH 4OZHF 2DQIL 2EYTB 3BHBA 1V7NH 3KPRD 4PJIB 3KLHC 2NXYB 4NOBA 2XICA 2FR4B 2H32B 4ZTPL 5CS7A 3WNPA 4K7PL 3EOAB 1U8JB 1YNLH 4MNHA 4JQIL 4DCQA 4YPGA 2AJSL 5CLTA 4U1GC 3VXMB 1BQHA 1BFSA 3FQWB 5CCKL 2CR3A 2EECA 4Z0XA 4RGMB 1M7IA 3NZHH 4IRSB 1QYGL 3DI2B 3UTTD 5I1LA 1AP2A 1DTUA 4X7DC 3GSNH 1TTFA 2WW8A 3SDAA 4UBDD 3H42H 2B1HL 4UTAL 2R4RL 1CZ8H 2KUTA 4EOWH 4JVPA 3B6SB 2ESVB 1JGDA 4O2EB 4ODSL 4HS3B 5FUCC 4LSUL 4KQ3H 4R3SA 3VRIA 5EZLB 4U6TA 1NCAH 2R69L 1RHHB 3Q3GA 3QWOB 4ODHH 4U1KA 3P11L 5C6PB 1EO8L 5FM5O 4RZCA 2CUMA 3SDYL 3PL6A 1HQRB 4HQQL 4U6HA 4LLUA 3MUY1 2VIRB 3A67L 3O3UN 1XR8A 1B2WL 2LVCA 5IB4B 5DZAA 5J9PA 3GUTB 2UYLB 4YLQT 4ZS7L 4XAWH 3BT2L 4P23B 3VMPA 1Y6MR 2P45B 1NSNH 4YE4H 5D1XB 2B0SL 4EN3B 3EO1A 4NQUA 4P2RA 3TH3T 3V4PH 5KVMC 1G6RH 4FTVA 5CD5C 1V05A 3QPXL 1MRDH 3QAZB 3VDAA 3H0TA 1GSMA 4Q0XL 3BZ4A 3HRZA 5I9QB 2EIEA 4JDVB 4HK3N 3W9EA 5E2TH 5IUSA 3OJDA 4XPTL 1YDPB 43C9A 5LCVH 2X6MA 1ADQL 3CX2A 3SGJC 1NCDL 3CFEA 2B4CC 1OAQL 3HAEH 3ZKXB 5KG9A 5DR5H 2EC8A 1YECH 4XPAL 5B22A 4RWYL 1DJSA 4C56B 2MWCA 4HK0A 2ADFH 5T33L 4U0RB 1FAKT 2FATL 5K59F 4OFQA 3VXRA 1KSRA 2YEZA 2FX8L 4U3CA 1ZGLP 4MDJB 2QTEA 3FO9B 1IEHA 1EEUA 1MNUL 5D2LA 1FG2B 2NY0D 3L3HB 4RSVA 1E4XI 2GSGB 2DQTL 2XA8H 1WUNT 3FMGL 2CLVB 1JGEB 1OSPL 3HE7D 3NN8A 3B5TA 3DOSA 3DGGA 1YQVH 4U1JA 3FJTA 5IQ7L 3O81A 4QHMA 1T7WA 4LHUD 4Z5RA 2FHCA 4TRPH 1BECA 1MREL 1IGTB 3QEQA 5L8KB 2WWMD 5AYQA 3SKNB 4UBDC 4MS8C 3BGAA 4JHZA 3GMRB 1AXSB 3VFMA 3HZMA 3O4LB 3D1MC 1F58H 4M9PA 4MZ2A 4G8EB 3BKJL 4Z8FH 5DRXA 3PGCA 5HPOA 15C8L 1JPGB 4XZUB 3ZHDA 1X5JA 5HHOE 4JDZA 1D5XB 4R4FH 5EZOH 1VADA 1VFOA 3O11A 3E3QC 1U93B 2H2SD 5ESVB 5L0QC 3NACH 3OKMA 2ZJSL 4GAGH 2FEEI 4HHAB 3PQYE 5ETUA 1H5BB 4FA8A 1ZVSA 4ZPTA 1E4WL 1KJ2L 1N5YL 4GKZA 5HY9A 3NCCB 1S5IH 1I3VA 3SCMA 2HH0L 5HYSB 4Z7OF 5J06A 4ZODA 3QUMB 1T5XB 4U7SA 5EZJA 3O6FB 4XPGH 5CEZH 4MQTB 3PDGA 5FK9A 1T21A 3I6GB 2ADIA 4Y8DC 2LTQB 4HLZH 1BX2A 3VXPB 1RIHH 1DBMH 2GJ6A 2Z31B 5IK3A 3PHQB 4M62H 4RQQA 5F3BB 4OLYL 2JJTC 4E41E 1Y6KR 5IW6B 3RBGA 1NAML 1UM6H 3QHTC 4WFGE 4Y4FD 4AEHL 2XQYK 2NY0C 3V6ZB 3OQ3B 1FAIL 3OKKB 2X1XR 4FFWD 4WDIB 5HJ3A 4NN7C 3QCUH 4PG9A 1CGUA 1JGLH 1M4KA 2WWKT 3HE7C 3PWPE 1J0JA 3HUJB 1FCCA 2IWGA 3C9NB 1S9VA 4YUEH 5DEGB 5ITFA 3RDTA 1SEBA 1UCBH 3ARBB 4L8DA 4NQEE 5D71L 3HMXH 4D8PA 2G5BA 4QRRA 4HIXL 2WWMC 3E6FB 5F9AC 3WIIL 4FZ8L 1XCTB 4XNMB 1S7QB 5E7FA 1ITBB 5GRYA 2BSRB 1UACL 3B43A 4MNGE 5EORH 4YHYC 4W6WB 3C60A 4JFPA 5TE4L 3ROLA 4YBQD 2E6PA 4ONFH 3QHZL 1QVOB 5GIRA 2A9NL 3RWEB 5J1AB 3OAYH 5CJOL 3BKYL 1AGDA 4K23H 2Z91A 4OQTA 5HHXH 1Z2KA 1CT8B 3V5KB 3B9EA 3QIBD 3N85L 3PWPB 3OB8A 1CR9L 1KJVA 1Z0NA 2H2SC 1M1SA 2HLAB 2YA0A 2AJXH 5DRZB 4NKDB 2OM5A 5SWQB 3TT3H 2WV3A 5J3HD 5E24E 4CDGC 1WSST 4HX1B 3MRQA 1TVDA 1FFQA 5DJ6A 3KPMB 3WIHL 1CICA 1QBBA 2IEPA 4G3YH 1DLFL 2EIZA 1N7ML 2BY3A 4KAQH 3HNTH 1ZEAH 1LEIA 5JW3H 5EA0L 4Y1AB 1A3LL 5GGQH 3FN0L 1BFVH 5FGBC 1DSFH 5FCUL 4OGAD 3QPQD 4XP4H 3VFWB 4DN4L 4HWEH 1HI6B 2ZCLL 3SDXE 3UTZA 5GGVH 1BZ9A 1MCFA 1IQDA 5FO9B 3B8YA 2CPCA 4LQFL 5CGTA 4OB5H 4F37K 5FXCH 3HCVA 4K7PX 2PYFB 4R90H 1DN0B 5ADPH 3QT2A 1O7SA 1F4YL 3IDMA 4LASH 4JN2A 1NMCC 4B7IA 2AJUL 3RL2A 4JKKA 4JCLA 3V4VL 4P49A 2OL3A 4Y4FC 2I27N 2X70B 1HILB 4FFWC 4HJGA 3QIWB 2RFXA 3EFDH 5DYOA 1JTPA 2FYYA 3RVXD 1I75A 2EE9A 5GSRA 3DX7A 4PTUB 2HG5A 3RHWF 3TO4C 1M7DB 3F7YA 4NHCH 5C6TH 3RL1B 4UNTA 3UYRL 3FT2A 3E6HB 3SGEI 4NO0B 1I8KB 2AEWA 2OYPA 5GS2H 4I0CC 5C07E 1W0VA 4AQ1B 1LMKA 1RK0A 1FE8L 3FRPA 4OGXH 2FB4L 1WBXB 1ZT4B 3EDKA 3FB5B 4ZOEA 5GHWH 2Z93A 2Q86B 4ZO7A 4NP4L 1S78D 3HAEG 3FB7A 4YC2B 1QACA 2D7OA 3G6JF 5ICZB 3D18B 4P3CL 4DEPC 1XR9B 5EOQH 5C0DB 1A5FL 3U0TB 1BAFH 4EIZC 1QNZH 1TDQA 3K46A 3CFKA 4PJAB 5D8JH 1JUFB 5E8NA 1CGSH 1HHJB 2CSPA 1QEWA 4UU9B 2HKHL 3FRUA 5KSVA 1WCBB 3TBWA 1LE9A 4NKOA 4XPHH 3QIBC 2IPKA 4G7VL 5DEFB 3UTOA 1A22B 4GRWE 1TCMA 3BRFA 1MRCL 1JYXA 4NT6B 3KPPA 5J3HC 3RUGA 3CVIL 4HS6A 1UH3A 3I9GH 3UJJL 3TNNA 3CCHB 3W9DA 4FXGA 1JF5A 5C07B 3HZKA 3NFPA 5ID1B 4NKIL 3ZDYF 2JIXA 1I1FB 4D9QD 1ACZA 4HKZA 3VCLB 4S1SH 1G7LA 4M6AA 5MEOA 3OWEA 4PJBF 5TF1H 1VFAB 4OGAC 3EGSB 1NBZA 5DMIL 3QPQC 1MAML 3W5MA 3OJMB 3BAEL 1LK2B 3VXTA 5DK0B 3DURB 4Y5VB 3OB0H 4L29A 4CVWA 1FV1A 4F8TA 4KH2A 1X5LA 5GPRA 4Y19D 5D9SB 4YXHH 2G2RA 4U1SB 3RX5A 4X6CF 5CSGA 1ZA3A 3RWFB 2CIKA 3PGDA 3DROB 5D1ZD 1HWHB 1SY6A 4KKCD 4Z1PA 5D1QD 2VC2L 1ZHBB 4G80B 4ZFZB 4FQXD 4BKLA 2LABA 3RU8H 1P7KA 2EXYD 1I1RA 5HHPB 4OLWL 1WTGT 2J88H 3RVXC 4FQJH 1IGML 2B1AH 4YPGB 3UTSA 2NYYD 4IHOA 5EIQA 4LEXH 1OM3H 4P2QD 5E00B 3LQAC 1X9QA 3FQTA 4EJ1C 1NC2A 1HXMA 4FTVE 1RUQL 3VXNB 1Q38A 2K7QA 1S7RB 1FGVL 5JOPE 5C0BE 1Z5LB 1OHQA 4PREA 4GRWH 3GK8L 4QTIL 5EUOF 1S78C 2Z4QA 2FDBP 4TNVF 5K9KB 4GRLA 3DYPA 1UQSA 3BD5A 4YHNA 1SQ2N 1KPRB 2Y36L 5CSZB 5DJYA 3BN9D 4U1KB 4HLZG 1GPOH 4XVSH 4A2MA 4FMFA 5FDWA 3BZFB 3NIDE 3REWB 3ZO0A 1EJOL 1M05A 4LLUB 5IHUL 1Q1JL 1YYLH 3GMPB 4M7JH 4XP1L 3L6FB 5CD3B 4IGBA 5F72S 3VXRE 5DK3A 5E8DL 3IJYB 1D7FA 4L9LB 5BRZA 5EN2B 5IG7B 4S0SD 1CE1L 3QCTH 2IBZY 3MRJA 1XGPA 5BQ7A 2RCSL 1CU4H 5D2LE 1HQ4B 1FLRL 4WWID 1IC7H 4MNQB 5HYSG 1KTKE 4N0UB 1NL0L 4NIKB 2DWDA 1P6FA 1DQML 5JMRA 4LLYA 4D2NA 4LKCA 4GKOA 4UTBL 5C0BB 4PS4L 5I2IB 5IMMA 2BP3A 3OJDB 1T2QL 1TZIB 5TDPA 1BJ1J 2VDLL 3MJ9A 1Q94A 4LPUA 5IWLA 2WUCL 5ESAB 4F7MB 3KJ6H 3VGBA 2VDPH 3IJHA 4NSKA 5IEHA 3DSFL 3NCBB 3O2WL 3QEQE 1H8SA 4LCWB 5HYIA 4Z7NE 1T1XB 2YZ1A 4HK0B 3NPSB 4LSVH 4JFFD 1X5XA 1JV5B 4I18A 1BF2A 4K3GA 4NQCB 2L4OA 5D1ZC 4JQVA 3SE9H 4KKCC 3AMLA 4OLEA 1GGCH 1HSBB 1LO0H 3W39A 3KNBB 3X13A 4C54A 5D1QC 3GMNA 4ISVA 4FQXC 4H1LB 5I75C 4JO2L 3V6FB 5D2LB 1U6AL 2EXYC 3R8QA 5HHQB 3U2SA 1X4XA 4IRZL 3LPGA 4NRZB 3FOLA 2H3NA 1AO7A 1UVQA 2ZNWA 1DL7L 4PJXA 1OPGL 1X5HA 1IGCH 3TZVB 2HRPH 2NYYC 1Q9WA 5IBUB 2DWEB 2XACC 4KV5E 1INEL 4UQ3A 3BZEA 1WICA 4OIIH 4QXWA 3ELAT 4GSDH 1B0GA 4XCNA 5E5MA 5CILL 1FVEB 2WQ8A 4TTDD 4N8CL 4R26H 4XBEL 1JIBA 2NTFB 3QXAA 4HBCL 4HZLA 5IJVB 3HG1E 4OFIA 3VFMB 2XZAL 1S3KH 2X4TB 4I0PA 2R4SH 3IXTA 1BBDH 3TA3B 4X6DE 5I73C 4KPHL 1IFHL 3BN9C 3WV0A 4NC1E 1MFBL 4ZAKD 5DLML 4CVUA 3KAAA 4OT1H 4UT7H 1JNHA 1Y0LA 3C2AH 5DT1H 4BZYA 2DKSA 1B3JA 3MFFA 1MCKA 3TN0B 2AQ2A 3FOMB 2P5WA 1OWWA 3KPSA 3ZE1E 4F2MA 5CHNB 5HHNA 5ITBL 1J12A 5DWUL 1EVTC 1N26A 2ADGA 1EPFA 4WUUA 4XAKE 4NRYA 1Y6NR 5I8OH 3FO1B 5H94A 5GGTL 1QD0A 4JM2D 1MJUH 3CSYA 2P8PA 1AGBA 4IMLA 4JDTL 4PJCB 4NNYB 3O8XA 1TNMA 1T7YA 2BCKB 4XC1L 3VJ6A 4PIRF 4PJEF 3HG1B 5E6IB 4PRBA 3D2UA 1U3HD 3KVQA 3AUVA 2R1XA 1MAKA 4X6DB 4BK4A 1H0DA 1FL6B 4M5ZH 2Y5TB 2OSLA 3HE6D 5BW7C 5CZVL 4NZJA 2FX7H 2B5IC 4Y0GA 3TIEB 4OM0H 5ECJE 1EEZB 1L0QA 1D6EA 5K33A 5I76B 2ADIB 2EDTA 4W81A 2X4SB 4J8RA 5MP6L 5IB2B 1GXEA 1ZTXL 1E4KA 4YZFE 3ULUL 2ITCB 1FYHB 4WUKL 4JAMB 1UH2A 3OMZA 3LZFH 4POZD 2CK0H 3D0VB 5E2UL 1A4JA 2VLME 2DIBA 2J12B 5DMYA 4H0HB 1OD9A 3MACH 1N0LA 1WFNA 4HD9A 1HXYB 1YUHB 4O02L 4PJGA 2K9UA 3O6KH 2ATKA 2X44D 1NFIB 1KIUA 4YBLB 3O2DA 2J4WL 4Z95L 2CDFB 2YRZA 4OGYH 3SHSA 4DKFL 4ERSL 5ABDE 1KLFA 5FF6A 4NO2A 5SV4A 5L2KA 2B8OT 2M1KA 2P5ED 3GRWA 1KG0A 5T1KD 3FT4B 3QDHA 2NXZB 2C3XA 1HEZB 4U33A 4TTDC 5FB8B 4XNUH 1MVUB 1N3NB 3JBG7 3VXUB 2VYRE 2E7LC 2C1OA 3MRCB 2X7LB 4Q2ZB 2Q76A 3UBXB 3BKMH 5CEXB 4FABL 3OKLA 1UJ3A 3QUZD 4CJ1A 4ZAKC 3LD8C 1HHIA 3JUZA 3KYMB 2B20A 5A43C 3QQ3B 1LDSA 3RWCA 1FYTB 5EUKA 4ACPA 1R5VA 1J8HA 1CLYL 5L2JA 4MCYA 5IQ9A 4X6FA 3JWNC 4LSSL 4H0GA 1UC6A 4PGJA 5I18L 2Q3ZA 5L88L 1CFTB 2Z92B 3BOVA 3LKOA 3QXUA 1CD1A 4S1RL 4MXWL 4JM2C 2GTWA 1LO5B 2ZUYA 3MJ7B 3MNZA 1B4JL 3QH3A 4XCEA 5HHMB 2IBBA 5HYQB 2CJUL 1EHLL 3QDGE 2PO6B 1OF2B 3VFRA 4WI5A 4LCIL 3U4BL 1N8ZB 5EDXA 1U3HC 5ACZA 5IVXA 1ZLSL 4P0DA 3LSOB 1SBSL 2EDLA 1IQDB 4OQTH 4JANA 4JFZL 4UV4L 2V2TB 3HE6C 3B9DA 4UNUA 3ZHKA 2D7NA 4X9FA 3B9KB 5DEZA 5MI0C 4NZRL 3GBLA 5EOCL 5HGDB 2VLKB 3D69A 4PV9A 4HIJB 4Y4HA 4ZNCD 4XP5L 5KSBA 1IZKA 2VZSA 2MPAH 3R1GH 5SX4H 4QY8B 4QXUH 5KVGL 1PKQB 4POZC 2YUZA 3MV9B 3BKCH 5CINL 5I1AA 4FG6D 3SDCA 4NOFA 3UX9B 1ZK9A 1CLZH 3B3IA 1YMMA 3RWDB 2FJHB 2RFXB 1BFOB 3EOTL 3F12B 2EH8H 4WNQB 1RZJL 3BIAX 2W0FB 3F58H 4QGTA 1PLGH 1DQDL 4MA1C 2Y1VA 2NY3C 4X80L 3RUGE 2A6KB 3QDGB 1P4BL 3TBTA 2HVJB 5JUEH 4GFTB 3WSQH 2ORBH 5JHLH 3KPNB 2YA2A 4P4KA 2IGFH 4XNYH 1HNFA 3HFMH 3WJLC 5FKPA 2OL3H 2BRQA 3QUZC 4GXUM 3GJFK 3VGFA 5IW1A 2PTUA 3T8XA 5DD5L 2Z0BA 1EH9A 1AKJB 1DE4B 5KSVB 4HFWA 1A6TA 2DYPA 3MOBH 2R0WL 4WWKD 5C0CA 2QSCL 3MBED 2YWYA 5LWYH 2XWBB 4K94L 2OJEB 4PUBH 1FNFA 4K9EH 3ZMRA 1GGIL 5EBMB 5I71B 2YPLD 4M1DL 4XVJL 1P1ZB 5H37H 3FKUS 4P9HL 3OZ9L 3VD3A 5GS1A 2DDQH 3KXFA 4C57C 5F7HA 3OKDA 2EYRA 1LO3L 3X3FL 4RMTA 1PKOA 5TQ2L 1P4IH 2NX5A 4R8WL 3MLTA 7CGTA 1PBYA 1BVKB 2DTMH 3U4EB 3UTSE 3K1KC 4JFED 2A73A 3WDJA 2VJXA 2O5YL 5BOPA 3U0PA 1ED3A 3CFDB 1KN4L 3O3EB 1RSFA 3I6LE 2AABL 1EAJA 2J1KA 1ACYL 4OZIA 3CLEL 3MSPA 4H1LG 1NDGB 4LARH 1VA9A 1QHPA 2IAMB 4MQ7B 2HP4A 2E8YA 4ONOA 2VWEE 3MOQA 1YEHL 4H8WH 1MCDA 4ODVL 4L8CA 1I9RH 4G9FB 3N06B 5C0AA 3VRJB 1S9WB 3RY6A 1S7WA 3D87B 1RI8A 4PJ5B 4NPYB 3QQ9D 4OFDA 1MQKL 4MHHG 3V8OA 4PY8J 4ZPVA 3C6LD 3AB0C 5EOTA 1JZ3A 5BS0A 4UILL 3TYGH 5E99H 2LVEA 2ERJB 4IRJA 5BRZE 4MHHI 2QQKL 1REIA 4U4BA 3TJEH 5D93B 1FZOB 5C08B 1KTLB 5E5UB 2VOTA 2DRUA 3O6LH 3D25A 4OF3A 3RI5K 4PJFA 1U8PA 1RZJC 3OJVC 1MHCB 4OKDA 4MA8L 2HN7A 2CDGA 3JWDH 4OCSL 2W65A 4HH8A 1NGXA 1KB5H 3G6DL 3K8KA 4KKBD 4TULL 5EIIA 3P4NA 4G6MH 3ZT5A 2OS7A 4U1IA 3LRGA 3NBNA 5JPMA 1QOKA 4JFQA 1CF8H 5MENB 3L3GB 3BVNA 4HBQA 4J4PD 1GIGL 5HGGS 1EFXB 4P57B 5F71A 2QSTA 4XP9H 1N0XH 2RJMA 5JR1L 4WWKC 1KCSH 5EO1B 3MBEC 2A6JA 3WO4C 1H8OA 1MH5A 3V2AR 1XF5A 2DAVA 6FABH 3H9SD 2GEEA 3PWNB 5CBEA 4YNYB 1JHTB 5E9DE 3QRFM 1JI2A 2DL2A 2DWDB 3PHOB 1WZ1L 5SV3A 5TPWL 1AO7E 3ZDZF 4P5MB 4HWZB 2CKBL 4I0KA 4FNLL 4PJXE 4JY5L 3MCLL 3SE8L 2ICEB 1TJGL 2QQLL 3MLWH 4PRID 1KN2L 2W1NA 1A64A 3JVGC 3IDNB 3LEXB 2I07B 1HZHH 2VXQL 3H6JA 1NGPH 2ED7A 5GRUL 4EQ2A 5D70L 1K6QH 1F4XL 1OVZA 2N7BA 3FO2B 2CQVA 3CH8A 3IJHB 5D7IE 1U91A 5JQ6H 5DZNA 3WS3A 1OP9A 1BFTA 1KFAH 4NQVB 4FQCL 4RX4A 3QUYD 4YHKH 4U6VH 2EDJA 5J1TC 1IBGL 1C5BH 4DGVL 4MD5B 3T0EA 4GAYB 4I9WE 4ELKA 3HNVL 1UM4H 3A6BL 5BVJB 5CIPA 3QQ9C 4EEEA 2J2ZA 2R8SL 5C0JB 3MLYL 4ODTL 1CFNB 2DJ4A 4HDIA 4JVUA 5E8OA 3TVMB 5FOBB 3VGEA 1OSZB 1HINL 4BQ8A 5E9DB 5CJ5A 5EBLA 4HT1L 3JTTB 2EZ0D 3PWLA 4HMEA 2ARWA 3KPSE 4G6FD 5T1LD 4YJZL 4OZGA 5F88A 1YJDL 4QNPF 4DGYH 3UBXG 1WF5A 2O5ZL 2AJZB 4WUUE 3L9RA 1C7TA 3OV6A 2IANE 5D7IB 5DD3L 3UBXI 2HWZL 4KKBC 3MV8D 5J8OA 5HYEA 3QFDB 3MNVA 1R3LA 3GSXB 4N1CA 3DGCR 3JWOH 3E1F1 3DXAB 4OAWA 4M4PA 1UZ6E 4E0RA 3IDGA 2DLEA 3MLZH 2P47B 4J4PC 4TVPL 2ZUWA 1MCJA 1EK3A 2X1OA 2APFA 1KJ3H 3MCKA 4OZHA 5L7XH 1QFUL 3UC0H 3LRHA 3F5WB 1NCBL 1J0KA 3B9VA 1FIGH 1CL7I 4Z76A 1EA9C 5HGHB 2JJUA 3OKOA 1KT2A 4TVPD 3THML 4IS6B 4NUGL 1VKXA 1T22A 3WHE1 2BXYA 1ZVHA 4X5XA 5FYKL 3TBYB 4PJGE 2VXUH 2IANB 1KACB 4NHUA 2AXFB 2H26A 3O8XB 5GQBA 5D7JA 4C83A 3IFOB 1J0YA 4Y4KB 4WY7L 4X7FC 5JO5A 2X9XA 4WFHD 1NMBL 1I1YA 4OM1H 2XKUA 4X4XB 4M61A 2CXKA 2JELL 5GISL 4MGXA 2R15A 3WN5B 2XN9D 1WTLA 1D6EB 5EO0B 1QSFE 5EU6B 4C55A 5KVDH 2EDXA 4DUWA 3ARWA 4GH7B 3EYSH 3Q6GL 3LKQB 5C0EA 3AGVA 1A0QL 2H1PL 2BNRB 4TUJA 4QTHB 1Q9OB 1ORSA 3TPUA 2EEBA 3NCJL 3CUPB 3C5JA 3PNWA 5H37G 4U05A 2EZ0C 4XPFH 1UG9A 1BM3H 3FRPG 3MROB 4HIHA 1I8MB 1J8HE 4FQHA 4ZUWB 4WV1B 1CDUA 2IJ0C 1QA9B 3OSKA 1FNSH 2BNQD 1UKSA 3BW9B 4LAJH 1PDKA 4CDHA 2D0GA 3MRDB 4QHUB 3MRGA 5TE7L 5TQ0H 3GBNL 1IILE 1J1OL 4YDVB 4Z0BH 2JJSC 3BPNC 4R96B 2OJZH 1AGFB 4QRSA 1XF2B 3MGTA 1BHGA 5JXED 3BE1H 2P48B 3OPZL 1A6ZB 4L4TD 1QSFB 3KLSA 2AV1B 5T5FH 1MOEA 3S4SB 4M93C 5ANME 3KGRA 5IVXE 3CK0L 3DMMB 3QDMB 3QISA 4PYHA 5AYUL 5HDOA 1G0XA 2OI9C 3HKFA 1TQBC 4ZFOA 3EAKA 5DUBA 1YYMH 1DUZB 1KGCD 5CLWA 1WBYB 3RNQB 2VO5A 2PNDA 2DQHL 3IXAB 4D0DB 3O2DH 1QR4A 4GMTL 1EEYB 4IJ3B 4O4YH 5D6CB 5LXGL 1F3DH 3MTRA 1YEJH 5KSBE 5JXAL 4MCYB 3HTLX 4X6FB 3RY4A 2JB5L 3GRWH 3DETD 2BERA 1BPVA 2MMXA 4ZUVA 1YQ2A 2X2YA 5KN5A 1YMME 4WI4A 5TFSL 1UM5L 1BMGA 3O9WB 4KXZI 1XH3A 4TNWK 4MAYD 3QH3B 2CLRB 3SJVD 1RK1B 2YMXL 3QEUB 2QJDA 4JKLA 5B8CA 1ZE3C 2OTUB 5FKAB 1R5WB 3U9UA 5ANMB 2FO1A 1N2RA 1BEYH 3MYJA 2BSSA 2E7MA 4TSCH 3DVNA 4Z7QF 3VXSB 5AZ2L 1JCKA 4JJHA 2KH2B 5E2WH 2MJWA 2MCPL 3V6OE 3S35L 3P73B 1LE5B 1UENA 4M7ZC 4YHOH 3WXWL 2F53D 4RWHA 2WBJA 3MRKA 4ZUUB 4MA7L 1OAUH 2EDDA 5BV7L 1W72L 4IM8A 4QWWD 2DMKA 3IKCB 2W9EH 3T3MF 1KJMA 3Q6FA 4RFEB 5IHZB 2BSTB 1WT5A 1FDLH 2VABA 5I1AB 4OZ4B 1B4RA 4LVHB 3P77A 4XHJD 2IALB 4GBXB 5C0CE 3MV11 3ZT6A 1T1YB 1ND0A 1QFWI 2X40A 5T3ZD 3S8WA 1AGEA 1YPZB 2ZSWB 3BFOA 4G7YL 5F7YC 4X4YB 3CDGA 2Z9TA 2VZTA 1RURL 3IRZA 2A6IB 2UV3A 3ARDD 2WBWB 2NX5E 3N1MC 5SWSD 5GZOD 5JXEC 3HC3L 1AHWB 2VDKH 3O41B 3UPRB 2J7LA 1OAYL 1BF8A 1MIEH 4GG8B 1U8QA 3V7MA 3MA7A 3G5ZB 1ZGLA 1Q9LB 1VGKB 2IH3A 4QXGH 1B6UA 2R0ZH 4DOHE 4BZ1L 4YHPB 3BESR 4J1UA 1MHEB 5C1MB 3DRQA 5IB1B 3CXDL 2FIRT 2I5YH 3BISA 3E2HB 4HJ0D 2Y9RT 5ESQB 4KVCL 3T2NL 1J1PL 5AUMB 2BVEA 5C0AE 3JZ7A 2PCPA 5BCAA 3VFOA 3DETC 4NYLB 2V2WA 4E42B 4JEGB 4U0QB 4HXAL 2ZSVA 4OCRL 3ZKSD 2GI7A 4LF3B 3ZE2F 4W68A 3TJHD 1ZANL 1YEEH 4RGOL 4OF0A 5BS0E 25C8L 4LDEB 4MAYC 1VSCA 4IBLT 4YDKL 5I1DB 1WWAX 3IAPA 4OLVH 4J3TA 3ZDXF 3KPOB 5FYJH 1NDMB 4P2OC 3MLVH 3LKNA 4XMPH 1ED3B 3CPLB 1JGVH 4PJFE 4ZXBD 4KMQA 5C2BH 1VPOH 4RGND 1EMTH 5J57B 3QO0B 1OGTA 4NWTL 4UQ2B 4HKBB 3CFCL 1MI5B 3ETBF 4MJIA 5I1GH 3VWKB 1HNGA 4Q6IA 3SGKA 1TITA 1GHFL 3DBXA 4LHQB 4QWWC 4HKXA 2EDFA 1V7NL 4R7NB 5DJXA 4TUOA 1ZKAA 4OBSA 1FCGA 1WCQA 3RTQD 1H3UA 2X41A 1UCTA 4XHJC 5C2UB 4GW5B 5BV7C 5FYLE 2NY5C 4YBHA 4Y5XA 3TV3L 4EI5D 4GKSA 3NZHL 3T77B 4JM2F 5E94A 4OI8A 1AE6H 1S7TB 3GSNL 1ZT7B 1KLGA 1LDPH 4KFZC 1I3RA 2BMKA 5JHDE 2J6EA 1CZ8L 4LFHG 3QI9A 2Y07H 5KSAD 3LDBB 1CGXA 2VUOA 3OXSA 3ARDC 2UVEA 4KQ3L 4KTEH 2GJJA 4AEEA 5GZOC 4ODHL 2WAHA 4XVUD 5K9JH 3IB4A 4POUB 1G7JB 3SE3A 5EB9A 1JPST 1QBMH 3MLUH 3IF1A 3QZWA 2AEPH 3P4OA 4Z7UE 1NSNL 4YE4L 4HJ0C 4JY6A 2A6JB 2FWOB 3V4PL 5TDNB 1G6RL 1RHFA 3L5JA 1MRDL 2EEDA 3VXMD 4LAQL 4N0FB 3D85A 4XCYB 3VU2A 4KU1A 2DQUL 4JLRA 1WLHA 3RRQA 4NM8H 5E2TL 5JHDB 3TJHC 4PRPA 5INCA 1KJ2B 3D5OF 5LCVL 3MRNB 3H7LA 4DTGH 5I8CB 4X9BA 1GOGA 4OCLC 4MWFB 5DR5L 1QBAA 1FPTL 2Y06H 4OD2B 3V5DB 4HEPG 4LL9A 4HUVB 4OZGE 5JIIA 2I9LB 2ADFL 5SWZA 4ZXBC 1UEYA 1XGUB 2XFXB 4RGNC 2HTLD 4TYUA 1X5FA 1TVHB 2ADJA 2CKNA 2DMBA 4R7DB 4Z7UB 4NO5A 3WLBB 4PB0L 6CGTA 3EYFB 3QHFH 1I7UB 1NAMB 1RJYB 4P23D 3C8KA 5C0FB 4EVNA 5LGJB 2XA8L 5F89A 4N5UA 4AIXA 5F21B 1IGIH 1MFAH 4EN3D 2NQCA 3OR7B 1S7XB 3H3BC 3WD5H 1BIHA 3RTQC 3GB7B 1CGWA 1D5ZB 1AI1H 4HDIB 1YQVL 4Q6YA 3M1BA 3IU3A 3VI3F 4EI5C 5I1KH 2FCBA 5JW4Q 3PWLB 1S7VB 3D3VA 4P5TA 5DQDL 4X8JB 5D7LB 2AEQL 1N59B 2OR7A 4PJBA 5J6HA 4PRDB 2VQ1B 1F8TH 4QF1A 3MYZA 4ZYKA 5C86A 5DMKB 3S4SG 4DZBB 5KSAC 4JHBA 3DRTA 3GIVB 3L9RB 3RFZC 1OARL 1GC1L 1F58L 1HHGA 4QOKA 1HDMA 3QIBB 5BZWA 4QRPA 4XVUC 4I3RL 3G5YB 5GGUA 4X6CA 5CIPH 4R4FL 5DJDA 3LV3B 3SO3B 4F58H 4KVNH 3KDMA 3MXWH 4DKEH 3CJJA 4FQ2L 1FFOB 4ELMB 1AQKH 5KTEH 2Y7QA 3ZYOA 4PRHB 5L6YH 4OCYH 2J8UF 2WQRA 4K71B 1JZ7A 4GAGL 5B3NA 3OXRB 1J0ZA 3EO9H 3DVGA 1T2JA 1QLRB 2N1KA 5GRXG 4FMKA 1OAKH 5FV1L 5FO8B 1UXSB 4WW1B 4PTTA 4GOSA 2OK0H 1IARB 4RGMC 1S9YA 3TBVA 2PW1A 3S35X 4GQ9L 2VUYA 3FCTA 4OCXL 5C6WH 5HHVH 1DUYA 2A74B 4EI6B 3UPCA 2CD0A 4NHUB 1AQDB 5E2VH 2PXYD 3UJIH 1FJ1A 3O4LD 4XPGL 5EUOA 1ZWIA 1IZJA 4LDOB 1I9IH 2LQRA 1DBAH 2BY0A 4LLWA 4M61B 1DVFA 3PDOA 1RIHL 1FSKC 2W60A 2HTLC 4M62L 2CLZA 3LRSA 4OLZH 4RIRA 4WU5A 4M7LT 5K9QI 5IJKC 4P23C 4YO0A 4H26A 2O61A 4DUVA 3QCUL 4LIQE 1MCHA 2QBWA 4EN3C 5DD1H 3HPLB 5C0EB 1JGLL 3HZVA 4M6NH 5GZND 3CMOH 3QAZC 1ZHKB 5DSCA 3PP3H 2VITA 2XPGA 4YUEL 1PSKL 3EIFA 1NBYB 3V10A 5I9QC 1OD7A 3VW3H 2X89D 4WO4A 4K3HA 4CNIB 4LSRL 5A2FA 3QG6B 5F7UA 5IT2H 4OIAA 3O3BA 3EDJA 3MX0A 2FL5B 2OTWB 3IDXH 2R2CA 3QRGH 3U7YH 3ZKXC 3O6FD 1DQJB 1QKZL 3ARYA 4UIMA 1MJJA 5HHOD 5EORL 3DV4A 2GK2A 4K55A 3I3EA 4ONFL 2XQYG 4U0RC 3OR6A 4X9GA 3T1FA 2R1WA 2Z31D 4K23L 3WNMA 1CG9B 4OKVA 4EUPA 4LLDB 4PP1D 2ZUSA 1GC1C 5C09E 3ARZA 1CGYA 3SGDI 3MA9H 1G9MC 3MC0A 1RJZA 4FQLH 2AJXL 4NZTH 2W59A 3CVHB 3U30B 3SKJH 4PLKD 5EBWB 4JZNB 4NQDA 2WOYA 2Z8VC 4Z7VF 2NLJB 1UKQA 4KAQL 1UFUA 3MRMA 3HNTL 4HUXA 5AZEL 1ZEAL 5JW3L 4CUCA 4KKAD 3ARBD 5GGQL 1BFVL 4JRYA 4NQSA 1DSFL 1YZZA 5DUML 4XCCH 2NY7H 4XP4L 5C9JA 3VFUB 1IM3A 1H9VA 5CJXA 3QWRD 2YR3A 5GGVL 3ROOA 1C5DB 1MLBB 4OB5L 3MRRB 4P46A 4YIQB 4LIQH 5I1JH 5D1QB 4KQ4H 4R90L 1CDIA 1KF9B 5D2NA 2FEDD 4LASL 5C09B 1I1AB 5HDLA 3ZE0E 1LP9F 2PKDA 3QNZA 5IKCB 2DD8H 2YPKB 5DF0A 3GI8H 4KMTL 2FD6H 1U41A 4M8QB 4ALAL 1L7IH 3PWPD 4LU5L 4W4OC 5DJ8B 3HLAB 3EOBA 1AC0A 3FB6A 5IESH 3L3IA 1KJMB 2AK1H 1SMOA 3EFDL 5EU5B 1MHHB 2QADD 1CDCA 1Q9KB 2RBLA 5LGHH 2C3HA 4NHCL 5C6TL 5GZNC 4NQED 4NZUH 1TJHL 4ONHA 1T1WA 4Z9KB 3MRHB 3D39E 1H5BC 4HC1A 1SEQH 3S98A 4OGXL 1NGQH 2Y23A 4HV8A 2B7DT 2NMSA 5AD0B 4ZQKA 3RJDA 3LY6A 4I4WA 4PJEA 5GHWL 3TESA 4DVBB 4XB8A 4AIZB 4G5ZH 3O6FC 3QIUB 1T1ZB 3Q0HA 2YRPA 4AY0A 5EOQL 4NN6B 1JZ2A 2XKSA 2BJMH 4MCZB 2AXGA 3VFNB 1TFHA 2LTQC 3BXNA 1QNZL 3S97C 5D8JL 4QCIB 2Z31C 1CGSL 1HSAB 1R24A 1ONQB 4PP1C 3STLA 2PW2A 1KCLA 4V1DA 3QIWD 4HIIA 3DRQB 5FA4A 4MJIE 3D39B 4PLKC 1LNUA 1VERA 4K8RH 4P5KA 3S5LB 4AH2B 5E1AA 3HC0A 4NO0D 1FRGH 2R2BB 1CWVA 3FONB 3IFNH 7FABH 4YR6B 4S1SL 4KKAC 3ARBC 3WL9B 4HF5H 1JPSH 4LGSB 4MB4A 5TF1L 5DDHA 4C59B 4CMHB 3O3DB 4JB9H 1YNTA 4XRCB 1Y18B 3IVKB 3LKRA 3P3YA 1YN6B 1FO0A 5I17B 5JZ7D 2JLLA 1FL3A 4PGEB 3ECBB 4PJ7F 1A7NH 5ACLA 3GMLA 3W2DH 1T80A 4HWNA 4BJLA 2APVA 4HMCA 4M1CD 3WCYA 4YHIA 4Y2OA 2ATPA 3RJQB 4MD4A 4CMMB 5IIEB 1OLLA 3I75B 1Z3GH 2G9HA 2CUHA 3DO7B 4JFDA 3OAYK 1MUJB 3NFSH 5E7BA 5CP7A 5F6HI 5DA4A 5IMOB 3LS4H 3AAZA 3RU8L 1EHXA 1T04B 1KCVH 1HH6B 3KPRA 4WHYG 2J88L 4XVTH 4ZNEA 3EYUH 3INUH 5CUSL 5C07D 3PWJA 4FQJL 5FECB 2H8PA 2B1AL 2C3VB 4R97B 4BFGA 1XF4B 4A6YA 1XIWD 1OM3L 1A2YB 3BEWB 2V17H 1NC4B 4N8VB 5DI8A 5IBTH 3NZ8B 3UTTA 4YWGH 2DIJA 2YS4A 3W5NA 4EDWL 1BJMA 4CVZB 1MWAA 1HOCA 3LD8B 4MQSB 4PRPE 2EKSA 5F7EH 4OZFA 1DLHA 2R56H 3ULVD 1DDHB 5J6GB 3S6CA 3ESVF 2VAAA 3MV7B 4XVSL 4JN1H 1A7OH 4IOIA 4O2CA 1BREA 5HDBF 5FFLA 1WJ3A 3G9VA 3QULB 1QSEA 1YYLL 3B5HA 4M7JL 5DVOA 5SWZE 2GUOB 3MGOB 4YDJA 4UDUA 4JY4A 5DRWB 4ZD3L 1KIRB 3QZWB 3QIWC 4JJ5B 3QCTL 4MA3A 2ZCHH 5F3HA 1CU4L 2ZG3A 3PUCA 4MJ6B 1IC7L 1S5HA 4RNRA 2NY4D 4GUPA 1E27B 3WUWB 2GKIA 3HC4H 4JO4L 2J6EH 3BSZH 2P24B 2EE6A 2WP3T 2AI0H 4JRXA 1RZ7H 1F3JA 4PRPB 1UB6A 4G42B 1NFDF 4AEIH 2DQCH 4KHXH 3RPKA 4YFEA 3ZDYE 3K2MC 5JZ7C 3DNKA 4RFOL 2V5RA 3D3VE 3KJ6L 4JPIA 4Y16B 4WW2B 1I85C 3JV5A 2VDPL 3P30H 3PV6B 4M1CC 4OUUA 2DLFH 3HPJA 3LN4A 3OAZK 4GO6B 3IGAB 3EDFA 3C5ZB 3K1DA 4TN9A 3GJFB 4LSVL 1A1MA 2FZ3A 5E8PB 5TH2A 3SE9L 4QOKE 3MLXH 1W0WA 3G6AB 2BOCA 1GGCL 1LO0L 1YEDB 3RQ3A 2JJTA 5GRVL 3ZKQD 4LPCA 3BH8B 4OUOA 4R0LB 4QRPE 1OTUC 2I60H 3BP7A 2JJWA 4GG6B 5DQJA 3G5VA 3JV0A 2Q1EA 5HI5D 5T1KB 2O5XH 2PYEA 3L95B 3MREA 1AD9B 4FTVD 3PWVB 2HRPL 3F7VB 1XIWC 1FFPB 1FZKA 1H3PH 5JOPD 2C7UA 4NDMA 5C0BD 1IGFH 1SJEA 5DVLA 2E9BA 4LHUA 4X6BA 2X4OB 4GSDL 3GMMA 2GCYB 5J6HB 4NNPH 4R26L 2NW3A 4F7TB 1XAUA 3K81A 4Y5VC 2NZ9C 5DK2B 3RNKA 3W0WB 1A7PH 3S34H 4M1GH 3ULVC 2R4SL 1BBDL 3DX9A 3QDAA 3ULSB 2WSKA 1B9ZA 3AC0A 1ZS8A 1EXUB 2XZZA 3GSWB 4XPBH 3QEHB 4QRPB 3TYFA 4NQCD 5EUOE 1JVKA 4OT1L 3GKWL 4UT7L 1TZHA 3C2AL 1RZ8B 1MFCH 3PABA 5DT1L 1BZQK 1J1XH 3T09A 5DS8B 3AS2A 2VSCA 1QFWM 2VL5B 3QDJB 4WTZG 1OY3B 1F97A 3ARFB 3ZKMD 4O9HL 3B4NA 3BZDA 1U8NA 3O2VH 5A40E 1GZQB 1E6JH 2NY4C 5DHXB 3EYVB 1L7TH 1GJIA 4X7TB 5I8OL 3ES6B 1MJUL 4H25A 4OV5A 4CVXB 1E28B 4KKNA 1C08B 3G08B 1H8NA 4OLUH 5FGBA 2D7TL 3ARXA 5GS0L 3NABH 3MPCA 1XCQB 1DUYB 5F1OB 3X12B 5ADOH 4R2GB 3UZVB 5F8RC 2UWEF 2HVKA 3BGMB 3MBXH 1JK8A 1K8DB 3BIKB 3PWUA 1BOGA 1RUML 4HG4K 4XXDB 3SQOH 4CAGA 4CKVX 2FX7L 4FQQB 4WU7B 2JCCF 1CQKA 4OM0L 1IGJA 5GS0D 2H6PA 1VACA 5T1DL 4DKDC 2ZKHH 3IDIA 1WAAF 3GM8A 4LKXA 4CN6A 2HKFH 1PZ5A 3LZFL 4LRNL 4OF8A 4YAQB 2CK0L 4AENA 2AS5M 4U49A 3OGCA 4Y4FA 5HPMB 1JPTH 3TN0D 4L9LC 3FB8B 4WCYH 3Q1SL 2PF6A 3MACL 1FVCA 3I2CH 3PGFH 1RJLB 1I3GH 1QSZA 5TJWK 4E5XA 5ENWA 5HI5C 3O6KL 4HKJB 1NCWH 2FLBT 5DFTA 3TO4A 4RAVB 1S7SB 5HYJB 4OGYL 1JF1B 4P2YA 5IGXH 2WIIB 2PR4H 2VXVH 4X4MA 4UDTB 5DJ0A 1MFNA 4NQDE 1PGRB 4QLRA 4EQ3A 1U2CA 2AKRB 5AWNL 4F3FA 4OCMC 5BVPH 3HG1D 5DJ2B 3SCMD 5E6ID 3EYOA 3LIZL 3SDDA 5CJ8A 3MRFA 4Q58C 3EFFB 4OBRA 4RFNB 3H7BB 4JRYE 5HI3D 2YBRA 4QXTB 2VE6B 3BKML 2Z1PA 1HH9A 2NR6D 1OGAB 3AU1B 3MBEB 1CQYA 3VRLF 3NPSC 1S9XB 2DKUA 3OR6B 4OFYD 2OCFD 1CDHA 1MCRA 4S2SA 3RX7A 5F9JB 3ARSA 2H9GA 5D2NE 5B38A 1FH5L 4LLMA 3UDWC 1KOAA 3ZKMC 4PB9L 4U1NB 1CFQA 4XAKD 5I8KL 4I13B 3CFBB 5DRNA 3IAGC 3WHXB 1ES0A 2P44B 3QJFA 4Y8AA 2BZDA 1DBKH 3RZCB 1RZKH 3UTQA 3IFPB 5HVWA 4FN0A 3VFPB 3DIFB 4ZSOA 1ZA6A 1AGCA 4ZG1A 2FH8A 4LOUD 5JPNB 3MRBB 1JWUA 4OTXH 3QXDA 4IDJH 2NXZD 3BEVB 1FNGA 1QTYT 1Z9MA 5IEKA 5ALCH 3VXUD 1CFSB 4OQTL 4EUPH 4GXVH 3TF7C 3KPTA 3TA3C 5GRZA 1RUKH 4N90D 2CR6A 4WEBH 4XC3H 4BZ2H 5GS0C 3QCVH 1CE6B 3ZYZA 2JB6A 4L8BA 3C6LB 1BVLA 2IADB 2VLMD 5CWSB 5FUCE 2X4RA 4HWBA 2F5AH 4PR5B 5F7DB 2MPAL 3QNXA 3R1GL 1BGXH 1AD0B 4QXUL 4DVRH 1FYTD 3QNZB 3GJEA 1XGRA 4PGCB 3BKCL 3P9LA 1T0NB 3TN0C 3JTSB 4GLRI 1UYWH 3M17A 4ZDHB 4MJ2A 1CLZL 4ZFFB 1X4ZA 4MB5A 4K3DH 3BD4A 1CTNA 1XZ0A 1G0DA 1CLCA 1OL0A 1PLGL 3RVUD 1T1WB 3VFVA 3SKMA 1IAOB 4MSWB 3RKDC 4RRPA 5JUEL 2LU4A 1WIUA 4DN3H 2CK2A 3SCMC 4WJ5B 5E6IC 2HFEA 2PO6D 5EBGA 4LMQI 3WSQL 4ZQKB 5JHLL 2WZAA 1I8IB 4WHDA 3QR2A 1LP9B 5EZIH 3IDJB 5HI3C 2IGFL 4XNYL 2R23B 2OL3L 2FHFA 5T3XE 3B9KD 2NR6C 1EDQA 4U2ZA 5I74B 1EBPA 2GJZA 4HW6A 3QZWG 2D9QB 5TDOA 5IBLD 3C5SA 2FLRT 3U6RA 1B0RB 2CXGA 1SYVA 4N1EA 2GIYA 4IIQB 3MOBL 4LCUB 3MV9D 5LWYL 3WUWG 1G7QA 1NJ9B 3BP6B 4NKMB 1GGBH 3U9PH 4HC1H 1G7PA 4L8SB 1MHPH 4AL8H 1U3ZA 2FJGA 4DJMA 2X4QB 1Z9SA 2F58L 1A1OA 2MFNA 4H0IA 1F90L 4LSTL 2GAZA 4YBLC 1KULA 5B3JF 4KUZH 4QYOA 3KPRE 3CZFB 4IDLA 3ALPA 3QDGD 3FO0L 1GL4B 1P4IL 4CU7A 2HJFA 4LOUC 4LQ1A 2CKBB 3EUUA 1JZ6A 3KHQA 2NXZC 4JFYA 4MVBD 4XMKH 5H2BB 2F6AA 2HJLA 1F00I 2LV4A 2GTZA 3QUYB 2X4UB 2QR0A 4K3JH 3ZTNH 4G9DA 1U8IA 2XWTA 4LPTA 1SYSB 4O51B 4ZFGH 2YC1A 4Y19A 4JG0H 4LARL 3M07A 5F1KC 3NPZB 3WIFB 1HHHB 4H8WL 1BOYA 5D1ZA 1I9RL 2JTDA 3CC5B 3Q48A 4DW2H 3BMVA 3LS5H 4RAUB 5I1IL 3BP5A 3TO2A 4FQXA 4G6FB 4JG1H 1I8LC 2D3VA 5BXFA 4PRNA 1QSEE 2RAMA 5CKAA 3NH7H 3TYGL 5DJAA 2N7AA 3GMOA 5T3XH 3P0GB 3RVUC 1FO0H 1YEIH 1JPFA 2B4CH 3BYTA 4A6YB 3I3BA 4P2QA 4W6XB 1J5OL 3S96A 3MV8B 3O6LL 3VA2C 1PQZA 4HZAA 3T3PE 3BO8B 4QRQA 4MDIB 2BRRH 2PO6C 5FYKE 1HOCB 3JWDL 1U92A 4QGYA 2FIKB 4JRXE 1SY6L 4KJQD 3OHXB 3BUYA 1JRHL 4G6ML 2FH6A 3B9KC 3IJSA 1CDGA 4GW4B 1II4E 1P84J 1HCFX 2ZOKB 1FNAA 2IAMD 1CF8L 5IBLC 2XZCH 1OT1A 3MRLB 4QRUB 3RWGB 4G9FD 4Z7WE 3UO1H 4I2XB 4XP9L 1N0XL 3CFJA 5HI4C 5E8EA 5F1IB 1KCSL 3UPAA 1A02N 2LE9A 4NFBA 1R3HB 2HT3D 4TSAH 1QSVA 1U95A 6FABL 2BOBB 5I6XC 4ORGB 5F3HB 4WI3A 2BNUB 4K7PH 1G9NC 4Y5YB 1MWAH 4JQIH 4PJHE 2JKXA 1KIQB 2CRIA 2A77L 1WGOA 2F54B 4U1MA 1NANH 3VGGA 4OZFH 2PYEE 4OCWL 3IFLL 3F6IA 1NPUA 1YN7B 4UT9L 3MCG1 3I6LD 1NUFA 3MLWL 4WI7A 3DX8B 4MVBC 1PEWA 3FT3A 5F7KC 5IM7A 4Q9RH 5JNYA 1NGPL 3I6KB 2Q6WA 3FAXA 1K6QL 4FQPA 4PJDE 3WS6C 5BW7A 3HPJB 3FFDB 5JQ6L 4Z7WB 3DX6B 2R69H 1G0YR 2QV2A 1A7QH 1JMZA 4F7PA 3HMWH 4CRPA 1ORQB 4CU8A 4YHKL 4K7FB 5MEND 4U6VL 2P8MB 1OCWH 4HQQH 4FFVD 1EFXD 2AJ3A 3FL7A 2BOCB 1UM4L 3V95A 1BLNB 5LBSH 2QHRH 4LP4A 3IETB 4NZDA 2YXFA 3V4UH 2LAGB 3RAJH 3QUXB 2G75A 5F7WC 1NGWB 4M5YH 4S1QH 5I71C 4PJHB 3QBTB 4KRNA 1SMAA 1FZMB 4MMXC 2DQJL 3MJ9L 4PBWD 5BJTB 3H9HA 3HMXA 3DYMA 2UZIH 3A0OA 4ZO6A 1XGTB 2XTJE 4DGYL 1S8DA 5H8DA 5KANG 4BH8B 1FFNA 1LHZA 1FZJA 4PJDB 3UJTL 4F7CA 4M43H 5H35A 3RPIB 2FO4B 2K3TA 2E7LA 3PP4H 4RMVA 4XPAH 4UT6H 4YK4B 3OKEB 3KYKH 4F9LA 3X11A 3EKCA 3JWOL 1JF6A 1LEKB 5LAXA 2DICA 2IAMC 4ZAKA 1K5NA 3MLZL 4Q7DA 3KWWA 4KROB 2VAJA 4BH7B 3PABB 1S7UA 1KJ3L 5L7XL 4LCCA 1D5MA 3UC0L 2ZPKH 4NO3A 1FIGL 3TVMD 5MEQB 2Q7NA 5E9DD 4B5EA 1A6WH 1C5CL 2VDRH 2DLIA 2ZP0T 5E1HB 2YD4A 2ERJC 2HJKA 4D0CB 2X4PB 5FA3A 2BXZA 2Y72A 5D93C 4NFDA 4PV8B 4JM2A 2VXUL 5F7NC 4KJYB 3QXTA 5CZKA 3MRIA 1WC7B 2P7TB 4TUKH 1TVBB 2DQEH 1QR1A 2UZYB 3OBAA 3VFTA 3BIBX 2VR9A 4X4ME 4LP5A 2QL1A 4OM1L 1K4DB 1U3HA 4NUJA 1KPUA 3BI9X 4XNQA 4KJWD 4KZEH 4QHNA 3SPVB 3ZDZE 5KS9B 3HE6A 2VWEC 4LFHD 3CD4A 5E95B 1EUTA 3DXAD 4FP8H 15C8H 5KVDL 5IF0B 1FIEA 4TTGA 5ILTH 2E27H 3DTXA 5C0IA 5IR1A 5BV7B 4FFVC 2HFTA 3QEGH 5F97E 2Q8AH 4ZS6D 3KPLB 3AS0A 4JGUA 3EYSL 1ETZA 1E6OL 3O3AA 1KTDA 3SBWA 1DEEA 1NUDA 2YD9A 4KGLA 5EU4A 5J89A 2GFBA 5F9WB 3HI5H 4OD3H 4NJ9H 5CMAB 4XPFL 1NLBL 1BM3L 4KI5D 4WHTA 1MLCB 1IAIH 4AM0B 2WBKA 2BSED 1FNSL 4WUUD 3BP4A 4YGVA 5J7CC 4RCAA 2XZQH 1NH6A 1LO2H 2IAND 5SWSB 4Z78B 1UEMA 5TQ0L 2E8ZA 4M00A 1QLFA 2P5EA 3KYAA 4YHMH 2A83A 4Z0BL 1E4WH 3O8XD 4B53A 2OJZL 3S3SA 4Y4KD 5FHBH 1J0HA 3EYOB 2D31A 4ZSOE 5IWLC 3IT8D 3SDDB 2HLFD 2EYSA 3WFEH 3BE1L 5GJTH 1UZ8B 2DLTA 2F19H 4QNPE 4H5SA 2YBRB 4X99A 5T5FL 3RWJB 3WJLA 4RBPK 4PJAF 5ISZB 3QUZA 4L3EB 3KR3H 1JJUA 5CBAB 3VFSB 1YYML 4BSWB 4JGJA 2NW2A 1G7HB 4OLYH 2YSSA 3O2DL 1HHKA 1P7QB 1U8LA 4O4YL 3NIGF 1YEJL 5CZXD 2OQJB 3TVMC 1JZ4A 3O6MH 4GW1B 5DHYA 2DQGH 3GRWL 1OQXA 5C0ND 1IEAB 5DZOA 1HKFA 4GRMA 4G8FA 2LFGA 1KEGL 5A2IH 4L9DA 5HGBB 1XGQB 1YEKH 5FM5M 1RJCA 5FYKU 1R6VA 4KJWC 3ULVF 2P42B 2IPTH 3JV4B 4TSCL 4WTWA 1QG3A 1UACH 1QSFD 1KENL 1LK3H 4PRAB 4X6EB 2FSEA 4G6KH 5E2WL 3DMMD 1NGYA 4YXKL 3QDMD 2IQAA 4YHOL 3RTQB 5JW5B 3L3JA 1FVDA 1OAUL 5M7QA 2A9NH 2J3SA 4MJ4A 3KS0J 1P2CA 4D3CH 2W9EL 4QHLA 2DI7A 4HEME 4D94A 3GSRB 3LQZA 1JTOA 2D0FA 2JK5A 5I1EH 3WEXA 1VFBA 1VEOA 4JM4H 1FDLL 1J8HD 2J8UA 4JFXB 2QQQA 1RUAL 4JCMA 3V0VB 4PJ8B 3RGVB 4DGIH 4KI5C 2EO9A 1L0XA 5C9KA 1K2DB 3MR9A 2WK2A 4U7MA 2CIIA 1X5YA 3DUSA 3O9WD 3GSNB 3QO1B 4OZFG 2X4NA 3VMOA 1RUPH 3O8XC 1A3LH 4MD0B 3S7GA 3FN0H 1D9KA 5J13B 2A6DA 4Y4KC 5FCUH 1YC8A 4LEOB 1VGEH 3FQRA 4CADA 2HLFC 4DN4H 5EC2B 2VDKL 3TIDA 3QFJB 2I9TA 4HWBH 1MSPA 4LQFH 3VXSD 2ITDA 1UXWB 1PEZA 5F7LB 3WN5C 1MIEL 2XYCA 3KLAB 3L3DB 1MF2H 4XWOD 4KWUA 2XV6B 3GNMH 4LNRA 4LLAA 2EIBA 4QXGL 2BC4B 2R0ZL 1I7RA 1PZUB 4C58B 2ZWLT 4FZEL