3PF5A

Crystal structure of bs-cspb in complex with ru6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/rna
molecule keywords Cold shock protein cspB
total genus 11
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pf5A00
3CCEA 4DV7L 4DV2L 3I2ZA 3F1ZA 2JA8H 4JI0L 4LF4L 3I7FA 2ZJRA 3RNUA 4BBSH 2F52A 4X62Q 5C44H 2L15A 4RG1A 1YJWA 1IBLL 1XTDA 1VQEA 1EFWA 4JI1L 1N36L 2NVQH 4GOPB 4IJHA 4QGUA 1VQJA 1Y1VG 1XMQQ 4GN3B 2D0OA 1YVCA 3KFUA 2ASBA 3GTOH 1L1OB 2VQFQ 1MJCA 5FLMG 3ULPA 4A3KG 1QZHA 1VQCA 1EQRA 4LF4Q 2VQFL 4DR5L 1GD7A 1SMXA 4JI6L 2RHSB 3LGJA 4DKAC 4LF8L 4PG3A 5IE8A 3GO5A 1GM5A 4MZ9A 1Q1BA 2E5LL 4LF8Q 1FL0A 1I5FA 4JC0A 2I5HA 2RHQB 1DGSA 3HOUH 1L1OC 3J81j 4BY7G 1Y1VH 5ELOA 3J81c 1J5EL 1UEBA 4C3JH 5LMNQ 4JI3L 3SGIA 5FJ8G 5J3BA 4OX9Q 1YITA 1I50H 1VQAA 4KI0A 4DR7L 4IOAA 3GTLH 1C0AA 1LTLA 3CC4A 1YIJA 4XTCS 1WFQA 3MXNB 1IYJB 3ZJYC 4DV5Q 3JAMi 4IFDG 1HZCA 4QL5A 4R4OA 1S40A 3T1HL 1VQLA 2F3IA 3CCVA 4A3FH 1PH9A 1JJCB 2VY3A 2Z6KC 3UE1A 2JA8G 4DUZL 2LXJA 1P8LA 4TVAB 3KDFA 4DR4Q 4BA2I 4LFCL 4P74A 4NXNL 2Z0SA 4JOIC 1X54A 3HFZB 2KCMA 4DR1L 2UXCQ 3I4NH 1QUQA 2K50A 5LMNW 1K3RA 3S1RH 2WB1E 2OQ0A 4JI5L 1QVCA 1WJJA 1PFSA 3EIVA 4YCVA 4EQ5A 1PHJA 1XNRL 2Q2TA 1MKHA 4LW1A 3CPFA 4WJ3M 2WAQE 3TEHB 3KF6A 2KBNA 3U58A 4A3MH 4A3EH 4A76A 2JA7H 2ZTDA 3BU2A 4DV0Q 4GOPC 4LF5Q 1SLJA 4L5TA 4NPSA 2JA5H 2AKWB 4BXXH 2LSSA 1SN8A 2N8NA 2UUBQ 2GVAA 2K5NA 1N33L 1WOCA 5AJ3Q 2HQLA 3OYYA 3L2PA 1KAWA 4HIOA 4A75A 2E8GA 2VUMG 3CPWA 5IYDG 5BR8Q 1Y1WH 3OTOL 3M4QA 2AWOA 1PV4A 4NB3A 3IRBA 1SR3A 2OWOA 1PH4A 2QEXA 2VZAA 3G6EA 1K9MC 5IYCH 4GNXA 1I94L 3PO2G 1PVOA 3PIOA 4A3FG 1MIUA 4HJAA 3KF8B 3PUZA 3BZCA 5IWAQ 1X9NA 2PMZE 2OTLA 4H02A 4R4CA 4PMWA 2VUMH 3PV0A 4JI5Q 1Q7YC 3A74A 4A3EG 3FKIH 3A5UA 1VQOA 3RN5A 4KHPL 1UE6A 1CSPA 4BBRG 3HOUG 2ZTEA 1XJVA 4BXXG 4GLVB 5C0XI 3H0GH 4JI0Q 4DNIA 2A19A 1B8AA 2MNAA 1KRTA 1QZGA 1VQBA 3NENA 1IL2A 4A3CG 2R7FA 1EIYB 1RL2A 4A3GH 4JI1Q 3T1HQ 4DV3L 2DUDA 3NEMA 1KD1C 2PQAA 4AQYQ 4C3IH 3HKZE 1CKNA 4O2DA 2IX1A 2K4KA 1PYBA 3PUXA 3J7ZC 4LFCQ 1PH2A 1NJIC 1D8LA 4LF9L 4HJ9A 1E1TA 4OXPA 4JI2Q 5IP7G 3GTPH 2QA4A 4LF7Q 1EOVA 3UDFA 4X66Q 2K14A 1N36Q 5GROA 3DLLA 2F4VQ 3H0GG 1YHAA 3L0OA 4BA1I 2CCZA 4JI4Q 1KIXA 5C4XH 4BBSG 1SE8A 2E2IH 4KHPQ 2UU9Q 4EX5A 4MTNA 3HOWG 1PH7A 1CKOA 1K0RA 1JMCA 1KXLA 3STBD 3HOZH 1LM0A 5LMUQ 1NTGA 1MJEA 3W1BA 2N3SA 4AIMA 1UE7A 4L5SA 3PUYA 4X66L 3GD7A 4ALPA 1U5KA 1IBKL 2JEAI 4JV5L 1WCMH 3CF5A 1E1OA 1TWGH 4IPGA 1FJGQ 2UU9L 1VCIA 2LXKA 1GVPA 2EXDA 3CMAA 4DR1Q 2UUAQ 1N33Q 4JV5Q 4K0KL 2UXCL 4APVA 4DK3C 2MQHA 5JJLA 1X3GA 1BBUA 3I4MH 4BY7H 2ATWA 1VQDA 1HJPA 1XMOL 2Q2UA 1VQMA 3H3VI 1Q81C 3KJPA 4JCVE 5AJ3L 1Q86C 1WI5A 3B6YA 1V1QA 5IP9H 5M5WH 4HJ8A 5GAGC 1PYSB 5JEAG 4BY1H 4QY7A 4GLAC 3W5OA 2NVTH 2R92H 1YJNA 4DV6Q 3AYHB 1ASYA 4GKJQ 1O7IA 1IBLQ 1KHIA 1TXYA 1PH1A 2E2JH 2HHHQ 1V43A 4UP7A 4LF6Q 1HZ9A 2UUAL 4K0KQ 3NBHB 1HNZL 2UUCL 3JAMc 3PO2H 3D0FA 3M85A 2JA6H 4IJLA 3PUVA 1NMFA 1N34Q 1VQ6A 2UXDL 5C4XG 4OWTB 4OO1G 4PZ7A 4GN5A 1M1KC 3PGZA 5H1SE 5C44G 2JA9A 3TS2A 4A3BG 4LNQA 5DLQE 3TQYA 1Z47A 4L5QA 1VQIA 4JG2A 4A4IA 4OX9L 1VQKA 4JI7L 4A3BH 4ME3A 1T9HA 1I3QH 4DAYB 2VQEQ 4X6AH 4A93G 1HNXQ 1J6QA 2V1CC 1I94Q 4XIGS 5C3EH 3M7NA 2XTIA 4KHZA 1HNXL 3RZOH 3G71A 3U4VA 3U4ZA 2YTXA 3PCOB 4B3ML 3G48A 4UP9A 1QVGA 5IWAL 2UXBQ 3RLNA 1S72A 2VS1A 4YWKA 4A3CH 4P73A 4GNXC 3BZKA 2OTJA 1HNZQ 2UUCQ 2OQKA 2B63H 4C3HH 1TWFH 1TWHH 3ERSX 2MFIA 3CXCA 4NXML 3CCLA 4IPHA 2B63G 3FKIG 1IBML 3HKSA 3H3VH 1EYGA 1RIPA 1CKMA 5E7NA 2ZTCA 1IXRA 3OTOQ 4A3DG 5M3FH 1G51A 3CC7A 2K5VA 4GKKL 5HY6A 4B3TQ 2ID0A 1UE1A 4HIMA 1XPOA 2YV5A 3W1GA 2NZOA 4X64Q 2YU9H 4DR3L 3M4OH 1I6HH 1A63A 3K8AA 1L0WA 2GN5A 3STBC 4JBMA 4DR4L 1B7YB 2KENA 1HR0Q 4A93H 2BH8A 2CQOA 3CCUA 1HR0L 4OWXB 3S14H 1X65A 2ALYB 3I4NG 5EAYA 2JEBI 1L2FA 1NBWA 4GN4B 4LFBL 4X64L 5FLMH 4A3KH 3GTGH 2KHIA 1PH3A 4AH6A 4JYAL 2VNUD 4HJ7A 4KLKA 3HOWH 4DR6L 5M5XH 5GAHC 3KYHC 3CCSA 1G291 3ULLA 4LFAQ 1OXXK 4LF7L 3CMEA 2RF4A 4X62L 4JI3Q 2ZM6Q 1HNWL 3UDXA 3S1MH 1Q82C 2XGTA 2ZJQA 2EIFA 3CCRA 2WB1G 1VS0A 3PF4A 3MEFA 5IYBH 1PH6A 2Z6KA 3AQQA 3CQZH 4B3RQ 3CP0A 1VQNA 1X3FA 3CW2C 2A8VA 4B3SL 1HR0W 4L5RC 2DGYA 1JT8A 3HOXG 1E7ZA 1KRSA 2BA0A 1NE3A 5LMUL 2R92G 1K83H 4LF5L 2N78A 2PNHA 5HGQA 4LUZA 3I4MG 3CAMA 1G6PA 4JI8Q 3E9IA 2Y0SG 4JYAQ 1E24A 4A3LH 5M3FG 4DR2Q 1CKNB 1OXTA 4R1JA 2I5MX 3H15A 1Z9FA 2K5HA 3I55A 1XNQQ 3AEVA 1UWVA 1GKHA 4IFDJ 5IYBG 3M4PA 1PH8A 4IPCA 4JBKA 3S16H 5JJKA 1Q12A 3RLOA 3BJUA 1XPRA 3CD6A 3L7ZC 1K8GA 1KL9A 3HOXH 1TWAH 3KOJA 4DUYL 1S3OA 4HIKA 2VQEL 3TS0A 2HT1A 1H95A 1WYDA 5IY0A 3HOVH 4JI4L 1FJGL 3HOZG 3S2DH 2JJQA 1N9WA 5C0XG 1SFOH 2IHEA 3EN2A 4QQBX 5K36G 4J15A 1X6OA 2I0QA 1LYLA 2UXBL 1V9PA 1BBWA 5C4JH 1UE5A 1VQ8A 3TRZA 4PZ8A 1AE3A 2RCNA 4R4TA 5FJ8H 4DK6C 3UDGA 1KQSA 4DR2L 2HHHL 5GAEC 3VDYA 4LF6L 1VQPA 4O0AA 1EWIA 5GADC 1HZBA 3S17H 3KJOA 4RMFA 4DUZQ 1FGUA 2K75A 3J80i 1CUKA 4DV1Q 3CCMA 1E22A 4P72A 4QJFA 1QVFA 3J7A5 1B70B 3F2CA 3S2HH 2B3GA 3A5ZB 5IP7H 1YHQA 5M5YH 4JI2L 1NY4A 2R7ZH 3PO3H 1BVSA 4WJ4A 5IYDH 2N49A 1JE5A 4A3GG 1YJ9A 2CKZB 1XMOQ 2AHOB 2D0PA 3GTJH 3M9BA 2E5LQ 2QGQA 3RN2A 4YY3L 1VQFA 4C2MH 4DV4L 3T1YL 2WP8J 3HOVG 1N32L 4DV1L 1M90C 4R4QA 1GO3E 4GS3A 4YWLA 1EQQA 1J5EQ 4IPDA 4A3LG 1OXSC 4A3DH 2AWNA 4A3IH 4DPGA 3GDEA 4UY8C 3K7UC 4P71A 3ER0A 4QIWE 2ZJPA 4DR3Q 1K73C 3K7AH 4HIDA 4NXNQ 1A62A 1VQ9A 1AH9A 3PUWA 3S24A 2JE6I 4PZ6A 1YHBA 4TQUS 1A0IA 2HIVA 1NMGA 4IO9A 3S1NH 5M3MG 4IOCA 4DR5Q 2YTYA 2NVXH 2PI2A 3CCJA 4OONA 3TREA 1YI2A 4IFDI 4LFBQ 4FDBA 3PF5A 4YCWA 3S15H 1TWCH 3K80C 1XMQL 1X56A 2CWAA 2D62A 2JK8A 4DR6Q 2OCEA 1WCMG 2I5LX 2R7DA 2GVBA 2IHFA 1XPUA 4POFA 3ICEA 4X65Q 1Y1WG 1R9TH 2HIXA 4YWMA 1A8VA 2JQOA 2YTVA 4X65L 4UPAA 4JI8L 4DV3Q 4DV6L 2YYZA 3I4OA 1YNXA 3OW2A 1XNRQ 2Y0SE 1HZAA 1CSQA 2NVYH 3DM3A 5ELNA 4YY3Q 2NN6G 4DV4Q 1VQ5A 2R93G 1LUZA 4DV5L 3GTQH 4BY1G 4GLXA 5JEAJ 4YHHL 3U50C 3F2DA 4GNXB 1Q1EA 4POGA 1JJ2A 2IT1A 4JOIA 4P75A 4DV7Q 2B29A 3A0JA 3HOYG 4MNOA 1C7YA 1Y14B 2IX0A 2WAQG 3HOYH 5GQOA 2ES2A 1YZ6A 1N34L 3F8TA 3KLWA 2UXDQ 4DV0L 4AYBE 1EUJA 1Q46A 1X55A 2CWPA 2VL6A 4HJ5A 4Y52H 1PA6A 1K8AC 2ZM6L 1HNWQ 2AMCB 1OXUA 5JJIA 1C9OA 3NELA 1HH2P 1L1OA 1OTCA 2F4VL 1VQHA 4UP8A 3RLFA 2E2HH 1E3PA 1PH5A 4GOPA 4AYBG 1KC8C 3CCQA 5IYCG 5FLXc 2BH2A 1JJGA 5C3EG 1IBMQ 3KF6B 4JI7Q 2WFWA 2K52A 3E9HA 1SRUA 3RR5A 4LFAL 1W3SA 3D31A 2VW9A 4LUOA 4DV2Q 1Q8KA 3FP9A 3JC66 3RZDH 4OO1I 5IT9c 4LWCA 3HKZG 1P16A 1N32Q 2Q2HA 4LUVA 3UE0A 1OXVA 1QUQB 1W2BA 4B3SQ 1D7QA 3PIPA 5LMNL 3CC2A 5BR8L 1ASZA 3K81C 4DUYQ 2IY5B 1EIFA 2H5XA 4JBWA 4A3IG 1YBYA 1VQ4A 2JA5G 4GKKQ 3KDFB 4GKJL 3J80c 1SROA 3AFPA 1IBKQ 3Q8DA 4JBJA 2R93H 2JA6G 3AFQA 4A3JG 1N8RC 2UUBL 2Q2IA 2JA7G 2FXQA 3T1YQ 5IP9G 4A3MG 4YCUA 2C35B 4R4IA 2BA1A 2NN6I 1VQ7A 1JB7A 3EBEA 4JI6Q 3UDIA 1X3EA 4YHHQ 5C0XJ 4B3TL 3WWVA 2R7ZG 1IZ6A 3PO3G 1YEZA 2NZHA 4BBRH 4AQYL 1VQGA 4OWWB 1XNQL 3ULJA 1FVIA 2KHJA 3GTMH 4A3JH 2KCTA 4B3MQ 4NXMQ 2CFMA 4B3RL 4LF9Q 1U0LA 4DAMA 3I56A 3GTKH 2MO1A 3FHWA 3G4SA 2EQSA 2A1AA 3J81i 3F2BA 3M3YH 2PI2E 2PQAB 5M3MH 3PSIA 2MO0A 3K0XA 1AE2A 1BKBA 2R6GA 3E0EA 3S1QH 4DR7Q 4Y7NH
chains in the Genus database with same CATH superfamily
1U4RA 2QDBA 3I2ZA 5FO8B 2JA8H 1IL8A 4FF1A 1SNOA 4KY5A 3I7FA 4HCEA 1PYWD 4RG1A 4OGQC 1N36L 2SDFA 4IJHA 4QGUA 3BDOA 1YVCA 3GTOH 1L1OB 2K5QA 3K0YA 2VQFQ 2JXMB 4RA8A 2RDGA 3H3VC 1GD7A 3GP7A 3DMUA 4A3DB 4DKAC 5IE8A 3GO5A 2DJFC 2G9HD 1F9QA 1Y1WB 4JC0A 1B9NA 3K7AB 4C3JB 2K32A 1XTCD 2NUCA 2EY1A 4B9XA 3J81j 4XT1B 5ELOA 3J81c 1UEBA 2C9OA 1HRJA 2NWGA 1BCPB 2GA4B 3QR8A 1LTLA 5A2QL 1YIJA 4EQNA 1WD1A 1S40A 2F3WA 5E4XA 1GOZA 1O78A 4ZCKA 2JYOA 4TVAB 1EYDA 2M00A 4LFCL 2KECA 2SOBA 4RAUC 4OIKA 1X54A 2F0UA 4OIJA 3RUZA 1LTBD 4DR1L 4XYQA 3I4NH 4KJOA 1JE4A 2CVRA 4CGYB 3A55A 4ZKBB 3IL8A 1QVCA 1WJJA 4YCVA 2WINB 4TRDA 2Y0SB 3S1QB 3CPFA 3BYYB 3M3YB 3TEHB 1RJTA 1FD7D 1EEID 4GZYC 1G2TA 1CHQD 4DV0Q 2FMMA 5KIXA 4A3FB 2AKWB 2BDOA 2LSSA 2GVAA 4ZYSA 2HQLA 1KAWA 4HIOA 2PCFB 4A3IB 2F1MA 3FMCA 3CPWA 1Y1WH 1RF2D 3OTOL 1X3QA 2AWOA 2IJ0A 3IRBA 2DY7A 2VZAA 1I94L 2ZXRA 4L6TB 1I3QB 1MIUA 2L5TA 3MFGA 1TQOA 1BCPD 2DN8A 2FINB 4PMWA 3J81L 4MIUA 3A74A 2A6EC 4A3EG 2PW7A 3A5UA 1UE6A 2MUYA 4KY7A 1MSHA 2KCCA 3FEWX 1R9TB 3FKIB 4GLVB 1ICFB 1PFMA 1VQBA 4A3CG 3TSSA 2K7VA 3T1HQ 1RCVD 4DV3L 1CKNA 2K4KA 2F0MA 4H7BA 4C3IG 4TKOB 2PYKA 2Q8TA 2WB1B 3SVMA 1E1TA 4OXPA 3GTPH 5I6YA 3RD4A 4X66Q 2K14A 4IUTA 2F4VQ 4JI4Q 3L0OA 3HOZB 2E2IH 3HOWG 3MXNA 4DAPA 3LX0A 1KXLA 3OIPA 3STBD 4A3JB 1R4PB 2EE1A 1BO0A 4N9PA 4X66L 3GD7A 1WTQA 2JEAI 4IPGA 3CMAA 2UUAQ 2EXDA 1N33Q 2WKCA 4UHVA 4IUVA 4EQOA 1QOHA 3PIP3 1UNSA 2MQHA 2EJMA 4BY7H 1VQDA 1SJED 2G9DA 1VQMA 3H3VI 1HUNA 5C44B 2X69A 1Q86C 2B8FA 4K6LA 5IP9H 1QILA 3J7AF 4BY1H 4QY7A 3S16B 2KEDA 3QB3A 1TWCB 2QILA 2LMCB 2E2JH 1U9RA 3W2DA 3A56A 4UP7A 3C1EA 2L1BA 3S1NB 3M85A 4IJLA 5C4XG 1VQ6A 4OWTB 4GN5A 3PGZA 3TS2A 4A3BG 1A3TA 1Z47A 1MD2D 1VQIA 4OX9L 4ME3A 1J6QA 5CV5A 1S5ED 3SK5A 3VYSA 4F88A 1I94Q 1TKWB 1SYCA 4KHZA 3RZOH 4HN7A 3U4VA 2YTXA 3U4ZA 3J80L 1JWMD 3TBIB 5IWAL 4RHRA 1S72A 1EYCA 4KD4A 4YWKA 3MFYA 4FF2A 1GUWA 4P73A 3K57A 1TS4A 1H9SA 2OQKA 3ERSX 4CKEA 1IBML 1Y69U 3H3VH 1CKMA 5E7NA 3QG1A 2C5CA 4A3DG 1LT4D 4YIJA 1STAA 4B3TQ 1UE1A 3ITPA 1JCKB 3W1GA 2ZXOA 4DR3L 3M4OH 1E2ZA 1L0WA 3STBC 4LJZC 5JOBA 4F87A 2ICIA 1HR0Q 4Y7NB 3CCUA 1HR0L 2JEBI 1L2FA 1TR5A 5CV6A 2B63B 1SE2A 1M8AA 5ELFA 1KTKA 1KAAA 1STYA 3P7JA 5ISRA 1PH3A 2VNUD 2RKSA 1SNPA 2X6LA 4DU9A 3HOYB 1T5XD 3ULLA 1WVLA 4X62L 3UDXA 2ZJQA 1I6VC 3CCRA 1CHPD 5IYBH 1F9PA 3CQZH 2XIWA 2A8VA 4L5RC 1A3UA 1ZKOA 2F0NA 3S9WA 5LMUL 3QIAA 1NE3A 2R92G 4LF5L 2PNHA 3IFDA 2Y0SG 4K2LA 4JYAQ 1E24A 5M3FG 2F0EA 4R8IA 1YNNC 4H0LC 3H15A 1YNND 1XNQQ 3AEVA 1DZ1A 2BE5C 1UWVA 2AUJD 4IFDJ 3S16H 1PH8A 1Q12A 1K8GA 1KL9A 3TZDA 5C6AA 3GTGB 2HUGA 4HIKA 4ID6A 2HT1A 1H95A 3E6ZX 3HS0C 2BE5D 3HOVH 1TWAB 2A74C 1N9WA 2EXZA 4RGNA 3FRPB 2O4XA 3C3LA 3VYUA 5C4JH 1UE5A 1PTOB 2RCNA 5FJ8H 3UDGA 4DR2L 3FDTA 3URYA 1EIHA 4S3SA 5GAEC 3OW7A 1EWIA 4IUPA 5EPJA 3S17H 1J9OA 4RMFA 2K04A 5FO7B 3KJOA 1LO5D 1CUKA 1FNVA 1B9MA 5C5MA 4JVZA 3CCMA 4DV1Q 2KA7A 1QVFA 3J7A5 1B70B 3S2HH 5IP7H 5M5YH 3PO3H 1HTPA 1JE5A 2CKZB 4EQPA 2D0PA 1CTMA 2E5LQ 1E0BA 1VQFA 4C2MH 1SBBB 4MN3A 4DV1L 2EYPA 1BDOA 3GTJB 1J5EQ 3I73A 4DNRB 4DPGA 1G6ZA 2D9UA 3ER0A 4X3TA 1PZID 1V1OA 4FXDA 1STNA 1QJOA 1A62A 2JE6I 4A3GB 2XRSD 1YHBA 1A0IA 2K01A 4DR5Q 2EJFC 4IFDI 4CJ1B 3HOXB 1MI2A 1GHKA 1TWCH 4PQXA 4CBVA 1X32A 4DR6Q 2R7DA 2E2HB 3HP3A 1EY0A 1W6KA 1PRTD 4X65Q 1Y1WG 2HIXA 1A8VA 5IT9L 2YU9B 1JOOA 1TWGB 5L37A 4DV3Q 2YYZA 3I4OA 3A7AB 1SAPA 2PZUA 1LV9A 3SK6A 2Y0SE 3DM3A 5C3XA 1HA5A 1VQ5A 4GLXA 3Q24A 2EOTA 1O7LA 4XQQA 4AYBB 4FXKC 4GNXB 1IKMA 4DAYA 5TSSA 1FNWA 1GHJA 1G8ZD 4MNOA 2EYLA 3VYRA 3HRZC 1N34L 2JSOA 4DV0L 4HEDA 1EUJA 4K2KA 1OXUA 3HOUB 1HH2P 2KJXA 2XN9C 4C3HG 4C1NI 1KC8C 4R9WA 5FLXc 5E1FA 1JJGA 5C3EG 1WTVA 2P5ZX 1CZGA 3E9HA 5LL6X 4JI7Q 4KKTA 2VW9A 4V190 2EYOA 4DV2Q 1Q8KA 3FP9A 3JC66 4OO1I 3GQBA 3HKZG 3OSOA 1OXVA 1DOKA 5BR8L 1ASZA 3K81C 3V05A 4DUYQ 5NUCA 4A3IG 1S5FD 3KDFB 1K83B 1SROA 1U4LA 3AFPA 3Q8DA 4IUQA 1PRTB 2JA7G 1MBYA 2NN6I 1JB7A 4JI6Q 3VR5A 4B3TL 1KDCA 5EJWA 3WWVA 5BN4A 2R7ZG 3GTMB 1YEZA 3GTLB 2SNMA 5HURA 1SNQA 4NMZA 2KHJA 1TIID 1PRTC 5J1ZA 3VR4A 3J7YW 4B3RL 1C8CA 1U0LA 2KQ3A 2MHVA 3GTQB 4FF3A 1SNDA 4EGVA 1AE2A 3ZYYX 1AZQA 5EKLA 2PNRC 4Q5VA 2O5JC 2F0OA 3D8GA 1HQRD 3RNUA 1HTLD 4NDXA 1BCPC 2L15A 5BN5A 1XTDA 2RQXA 4G7HC 3NK9A 2NVQH 2AQ1B 1IYVA 1EWHA 1SXTA 2IW3A 1VQJA 3D4DA 2F0QA 5FLMG 2VQFL 2VXWA 4DR5L 3V96A 4JI6L 3ERQA 4B9WA 5M3FB 2WV6D 4LF8L 1SE4A 1EIGA 4WORA 1Q1BA 1I5FA 2EVBA 2RHQB 1L1OC 4BY7G 1J5EL 3T16A 3BVZA 3SGIA 2HCIA 5J3BA 3M7GA 1FNUA 1ET9A 1V1PB 1CQVA 3DXJC 3A54A 5KGUA 4N9TA 1ESRA 3CU7A 3WOEA 3VR3A 3H94A 4QL5A 3T1HL 2F3IA 5J22A 3CCVA 4A93B 1JJCB 2VY3A 2Z6KC 3UE1A 2JA8G 4XQJA 3J80E 2B2UC 2Z0SA 4JOIC 3OOCA 1DXMA 1QUQA 2K50A 3I8ZA 5LMNW 2B2VA 4RHSA 5I6WA 4G57A 3EIVA 4EQ5A 1XNRL 2Q2TA 1TY0A 1DD2A 4HTHA 1SMYD 2WAQE 1SMYC 4N8FA 3U58A 2OF1A 4JPBW 2ZTDA 3BU2A 2B2WA 5E4WC 4IALA 4GOPC 2PW5A 2F0TA 1LT5D 3W3AA 4L5TA 4NPSA 4DA2A 1SN8A 2VB3X 1WOCA 5AJ3Q 3L2PA 4A75A 1PV4A 1NUCA 4NB3A 5DM73 2OWOA 2QEXA 5C4HA 1TT2A 1UAPA 5JVH3 5C0XH 3PIOA 1S4ZA 4CDCC 1X9NA 2PMZE 3G7LA 2OTLA 4G4KA 5G3LF 1HCZA 1Q7YC 2VB2X 4KHPL 4A3KB 3HOUG 2KCNA 1XJVA 4JI0Q 3EA6A 4MTKA 1B8AA 2MNAA 1KRTA 1QZGA 1CM9A 2DNCA 1B3QA 3NENA 1IL2A 1EIYB 1RL2A 3I4MB 1EZ6A 4HMIA 2DUDA 3LNNA 2K28A 4C3IH 3HKZE 1SYDA 1DYQA 5G3LD 3PUXA 3J7ZC 4LFCQ 3VR2A 1H9JA 3ND8A 4LF7Q 4CJ2C 2LFNA 1EY9A 3Q23A 1YHAA 4BA1I 2CCZA 3TP7A 5C4XH 4KHPQ 4QB4A 1BOSA 4ILWA 1K0RA 3HG9A 3MEHA 3TDQA 3W1BA 4AIMA 1CFMA 3PUYA 2EYJA 5K36H 3I4LA 3E3XA 3MXPA 2IWHA 2F03A 1WCMH 2A68D 2LXKA 4JV5Q 4K0KL 2UXCL 2PZTA 3EJIA 2N88A 1FGBD 3IFTA 3I4MH 3SDZA 1HJPA 2Q2UA 5C5LA 3NUCA 1U4MA 5AJ3L 5M9OA 4ME5A 2OEOA 3B6YA 4R8NA 4KK7A 4V0BA 5M5WH 5GAGC 3MZ5A 1SE3A 4FO2A 4GLAC 2NVTH 4ODGA 1Q3LA 3AYHB 4GKJQ 4KHVA 1KHIA 3MC0B 1HZ9A 4K0KQ 2FHTA 1HNZL 2UUCL 3PO2H 1NMFA 2UXDL 2F3VA 4I65A 4PZ7A 1M1KC 5H1SE 2JA9A 4BBRB 2WAQB 4LNQA 4L5QA 5D14A 5ELEA 4X6AH 4DAYB 2XTIA 1HNXL 3G71A 3PCOB 4B3ML 4O1NA 3BDLA 2IX3A 4UP9A 1AZPA 1S5BD 2UXBQ 1AFPA 3MAQA 1HFNA 4GNXC 1GUOA 3EVQA 4XYOA 1TWFH 4NXML 2MFIA 3T13A 4IPHA 3CCLA 1CQFA 2SEBD 1KABA 3BS1A 1QNUA 3CC7A 2K5VA 4GKKL 2OT2A 2ID0A 4HIMA 1XPOA 4X64Q 2YU9H 2E2DC 1I6HH 1A63A 4RCNA 1B1ZA 5J39A 1EY6A 5CV9A 4DR4L 1STHA 2RVLA 1F9RA 2F0LA 3R2TA 1X65A 3OWFA 1GUGA 2CHBD 4LFBL 2KHIA 4AH6A 1LTTD 4N8X1 1PTOD 2ZT9C 1JQYD 4MHEA 5FOBB 1TY2A 4LFAQ 5COYA 4JI3Q 2NB0A 2ZM6Q 4DK0A 1Q82C 2N55A 1VS0A 3PF4A 3MEFA 2HD3A 4B3RQ 3AQQA 3HZXA 3VA5A 1G2SA 3CRKC 4K5XA 5A2QE 1VQNA 1MGSA 2DGYA 2RSNA 3HOXG 1ET6A 3SK4A 2N78A 1DJRD 4KN4C 1CKNB 4ULLA 2I5MX 1BF4A 5IYBG 3M4PA 2NVTB 5JJKA 2L4NA 1VMCA 4Z9CB 3CD6A 3R2IA 3T53B 1SNCA 3KOJA 4PV1C 4DUYL 2VQEL 2Z8LA 3S2DH 1SFOH 5ELCA 2IHEA 2RDFA 2EJGC 3EN2A 1JR0D 4J15A 5K36G 1LYLA 3MWYW 1V9PA 4F7XA 2UXBL 3NE5B 4OEMB 5I2XA 4IUUA 4O0AA 1KLUD 2E76C 2K75A 1UUPA 3KBXA 4QMGA 1HHVA 1E22A 4P72A 3K6OA 3F2CA 4WJ4A 1YHQA 1PZKD 1NY4A 2R7ZH 1BVSA 2N49A 1YJ9A 1XMOQ 2AHOB 3IKJA 2QGQA 2E75C 4DV4L 1N32L 3HOVG 5BN3A 2G5DA 1M90C 2BOSA 4R4QA 1DONA 3UI2A 1X3PA 1XWEA 1ML0D 3GDEA 3BDCA 2ZJPA 1K73C 1IW7C 3MVVA 4HIDA 4NXNQ 2Q8IB 2NVYB 3S24A 3K5NA 4PZ6A 1TS2A 2KUMA 4TQUS 2A6HC 2PI2A 3CCJA 3TREA 3S15H 3K80C 1X56A 2D62A 2OCEA 1WCMG 2I5LX 3P1HA 2IHFA 4POFA 3ICEA 2RA4A 2JQOA 4X65L 4JI8L 3KLSX 2HCCA 3OW2A 1XNRQ 3A8KE 3NTIA 1EU4A 3D6CA 3BG3A 2NN6G 4DV4Q 2F0GA 2K33A 1LUZA 4DV5L 3GTQH 5JEAH 1FR3A 3F2DA 3U50C 1JJ2A 1SJHD 1D5XC 1PZJD 4DNTB 4F8MA 2WAQG 2ES2A 1YZ6A 3F8TA 3KLWA 4CKBA 1C48A 4AYBE 1Q46A 4WJWA 4Y52H 1PA6A 1K8AC 1HNWQ 5JJIA 1C9OA 3NELA 1JC7A 1L1OA 2F4VL 1VQHA 2B2TC 1NR2A 5KYIA 3K58A 3NWSA 5IYCG 3SHLA 1IBMQ 4OELB 1EEFD 1I6HB 3VA7A 2Z4IA 3RR5A 3MA2B 4BY7B 4LUOA 5IT9c 3RMHA 2F0WA 2Q2HA 4LUVA 1JICA 3UE0A 1QUQB 3N6RA 1D7QA 3AMUA 4GKJL 1VQ4A 5CBEE 1IBKQ 1F2LA 1BXTA 3NBIA 2Q2IA 3T1YQ 4A3MG 4YCUA 2QKIC 5DNFA 2A6HD 1VQ7A 1EY7A 2CQAA 3BVGA 1DCZA 1X3EA 5IGCA 5C0XJ 1KNEA 2PMZB 2Z9HA 2NZHA 4AQYL 1XNQL 2D5DA 1B3AA 1AP0A 3GTPB 4LF9Q 2L11A 3GTKH 2MO1A 4X3UA 3FHWA 5C3EB 1LTGD 1JOQA 2PI2E 3X3MA 5C4JB 2MO0A 1BKBA 3S1QH 1NR4A 4Y7NH 3CCEA 4X3KA 1A6XA 3F1ZA 3HKZB 2CH4A 1PTOC 2ZJRA 5EPKA 2F52A 3A8IE 4X62Q 1YJWA 1VQEA 1EFWA 4JI1L 4QUCA 2D0OA 2NVQB 3NQTA 5M5WB 2ASBA 1HPCA 1MJCA 3ULPA 4A3KG 1QZHA 1EQRA 4LF4Q 2NVXB 5CMDA 1KLGD 1RHPA 1GUNA 4XDXA 1GM5A 3MXGA 2D2CC 4LF8Q 2E5LL 1FL0A 1RTNA 2F0PA 2A6ED 5I9OA 1TS5A 1Y1VH 4C3JH 5LMNQ 2MJ8A 3I91A 4RFBA 1I50H 1VQAA 4KI0A 4DR7L 4IOAA 3GTLH 1C0AA 2R93B 1E2VA 3CC4A 2R3ZA 4XTCS 3O13A 1WFQA 1VDZA 1IYJB 1ZXTA 3GV6A 3KUPA 1A2UA 4DV5Q 5IT9E 5EBCA 5KRUA 4IFDG 3PQIA 2JN4A 1VQLA 4A3FH 2F0DA 2L9HA 4DUZL 2LXJA 1P8LA 3KDFA 1ILPA 3L9AX 4P74A 1SSOA 4NXNL 3I4NB 2LKVA 2M9VA 2NBFA 3HFZB 4M1UB 2KCMA 5ELDA 2UXCQ 2H1EA 1K3RA 1H9RA 3R8BA 2WB1E 4JI5L 5EQ0A 1KNAA 1PHJA 4LW1A 3HOVB 2EZVA 2F0SA 2JA7H 2K1BA 2NTSA 4LF5Q 4O42A 1Z7TA 4J8QA 5KNDA 1JWUD 4BWGB 1N33L 3OMGA 4HSVA 3OYYA 2F4IA 3S1MB 1GUTA 5IYDG 1GUSA 2QF7A 5BR8Q 4CDDC 3M4QA 5CV8A 2EDGA 3ONAB 3SXHA 1D5MC 4B08A 1PH4A 3Q22A 2IPKD 1OO9B 4GNXA 1PVOA 1TU2B 4A3FG 1XX8A 1R4QB 3BZCA 2JA5B 1QNKA 2VUMH 1D2BA 3PV0A 2KOLA 2JA6B 3FKIH 2B2YC 4BBRG 2ZTEA 4BXXG 4UDUC 4DNIA 2A19A 2EY2A 2XWJB 4A3GH 4CKCA 5IGFA 4JI1Q 1KD1C 2PQAA 1D5ZC 4AQYQ 1Z6HA 2PO4A 4O2DA 4KD3A 1B44D 4RH6A 3WOFA 1PH2A 1D8LA 4LF9L 4JI2Q 1EY5A 2EYMA 5IP7G 1SEBD 2QA4A 2AUKA 1EOVA 3UDFA 3NWTA 5LHY1 4C2MB 5AFWA 2FFKB 3H0GG 1KIXA 1SE8A 2UU9Q 2L0CA 1I4PA 1II3A 3C2PA 1JMCA 1B53A 2M2LA 3CHBD 3E5SA 1JB3A 3HOZH 1MJEA 1Q90A 1V1PA 4KJNA 4IN3A 4L5SA 2PPBC 1YNJD 1U5KA 1J8IA 1RD9D 2NYZD 1IBKL 1WD0A 4JV5L 4JK1C 1FJGQ 2UU9L 3TMEA 3S2HB 2B39A 3AU7A 4APVA 3D6WA 5JJLA 2ZXPA 3V2TA 1BBUA 2ATWA 1Q81C 4A3MB 2NN6H 3KJPA 4JCVE 2K6AA 1WI5A 2XWBB 4HJ8A 1WTXA 5JEAG 2R92H 1O7IA 1IBLQ 2HHHQ 1TXYA 3I72A 4LF6Q 1LTSD 1V43A 2LS01 4XT3B 1K0SA 3GV3A 2UUAL 1A2TA 3JAMc 3D0FA 2JA6H 4HAEA 3NTHA 3PUVA 2XNAC 2EY5A 4OO1G 5C44G 4QCLA 4LAAA 1BBXC 4JG2A 1VQKA 4JI7L 1I3QH 4RGMA 1HNXQ 2WIIB 1QB5D 3M7NA 5JJZA 2EY6A 3DEPA 3NP8A 1QVGA 4I7AA 5FO9B 3BZKA 1HNZQ 3NBHA 2UUCQ 2F0KA 2B63H 1TWHH 1S5CD 2B63G 1RIPA 1IXRA 2ZTCA 3MHBA 3I70A 5M3FH 1XXGA 1YNJC 2NZOA 3QOLA 1Y8PB 3CRLC 1KDAA 3K8AA 1IKLA 2GN5A 4NP5A 1B7YB 4PNYA 2KENA 4UAIA 2BH8A 1JOKA 4FXGC 3I4NG 5EAYA 1ENAA 4GN4B 4IURA 4BBSB 5FLMH 3GTGH 4ZQ3A 4JYAL 3R3OA 4HJ7A 4KLKA 1EZ8A 4DR6L 3AB9A 5M5XH 5CC4A 5GAHC 3KYHC 1I50B 3CCSA 4HSPA 4IFDH 1OXXK 4LF7L 2NZ1D 3CMEA 4ZKCB 3SR1A 2XGTA 2EIFA 2F0FA 3TN2A 2KVMA 1DOMA 1T5EA 5DEHA 4ZAIA 3JAML 1PH6A 3OHXC 3CW2C 1HR0W 3HEJA 5A35A 5IGDA 2DY8A 1E7ZA 2BA0A 3CQZB 1G6PA 3CAMA 5JAVA 4A3LH 2K5HA 5DM63 4JBKA 4K5WA 2F0IA 3HOXH 2I07B 4IQZA 4KMUC 3TS0A 5IY0A 3HOZG 2AQ3B 4JI4L 3C46A 2JJQA 2CH4W 2R61A 4KY6A 2F0HA 5C0XG 1TS3A 2MGSA 2EPBA 3RZDB 1SNMA 1X6OA 5IGGA 2I0QA 1PLFA 3Q0AA 1BBWA 1ILQA 4ZUJA 5M3MB 3TRZA 3MXUA 4R4TA 4P2CB 4DK6C 4DXGA 2JP1A 2HHHL 4LF6L 3HGBA 3D3RA 3H09A 5FLXE 5GADC 1FGUA 3J80i 2B2UA 4H13C 2Z1CA 4A3GG 2HQEA 4X3SA 4G7OC 1WTPA 1BQQT 3GTJH 4FF4A 3M9BA 4ZRZA 1EFID 4KTAA 3T1YL 1I4XA 1B4OA 1RKNA 4KKSA 4GS3A 4YWLA 2FMCA 1EY4A 2B2WC 2AWNA 5CBAE 2J0TD 2Z6BA 4UY8C 4P71A 4QIWE 3K7AH 1D1KA 2CW0D 1TVXA 1AH9A 3PUWA 4U68A 1U4PA 3S1RB 5D3DA 3S15B 2HIVA 1NMGA 4IO9A 3S1NH 3OIQA 4IOCA 2K5DA 4DGZA 3L3OC 2QW7A 2NVXH 4LFBQ 4OONA 1YI2A 3J7AV 1M4VA 4YCWA 1XMQL 1FYCA 3S14B 1H9KA 4E6IA 1XPUA 3EROA 3Q6SA 3T51B 1R9TH 1UEAB 2QDLA 4YWMA 5JVG3 4UPAA 4DV6L 4FP5D 2I46A 1HZAA 2RCFA 1CSQA 1F9SA 2R93G 1BUVT 3P20A 5CYUA 5JEAJ 4POGA 4JOIA 4DV7Q 1VF5C 2IX0A 1LTAD 3HOYH 5GQOA 4PMCA 2DNEA 2UXDQ 5EPLA 3M4YA 2HDLA 3NHHA 1EY8A 2VL6A 2CWPA 1BNZA 4HJ5A 5IODA 2WKDA 1A3VA 3PO3B 1OTCA 1AEXA 3NSWA 4UP8A 5FKAC 5M5XB 4GOPA 2MPMA 4AYBG 3I3CA 2BH2A 4C1NK 2JA7B 1LT6D 3VR6A 2WFWA 2K52A 2MP1A 1W3SA 1KDBA 5CR3A 3WDNA 1WTOA 2A68C 3RZDH 2KEEA 1NAPA 4RGTA 3KLSA 3SE0A 1VMPA 1DM0B 1W2BA 2IL8A 2Z4HA 3CC2A 3M4OB 5D3IB 2H5XA 4JBWA 5ELBA 3J80c 2R93H 4FNFA 1N8RC 3A7LA 1B50A 1VF7A 3R93A 1F77A 2Q8RE 1H9SB 3EBEA 3T4AC 3UDIA 4YHHQ 1IZ6A 3K59A 1IW7D 1VQGA 1LTID 4L63B 1FVIA 3GTMH 2KCTA 3I56A 3RZOB 3KLRA 3G4SA 1K8OA 5CV4A 2A1AA 1PRTF 3F2BA 3K0XA 4DR7Q 2R6GA 3E0EA 4DN4M 3VYTA 4BY1B 4DV7L 4DV2L 4JI0L 2LY7A 4RKLA 1EOTA 4LF4L 4BBSH 5C44H 2B2YA 1IBLL 3BZDB 4FYDA 1EQVA 1L0XB 4GOPB 3CKIB 2TSSA 1Y1VG 1XMQQ 4GN3B 3KFUA 3QOJA 1E2WA 5JPNC 3S2DB 1VQCA 3D4WA 1SMXA 4DFAA 1Y8NB 2RHSB 3D4RA 3LGJA 4EVOA 4PG3A 4MZ9A 3I90A 2I5HA 1DGSA 3HOUH 1BCPF 5I2YA 1LLRD 2WACA 2X6GA 4JI3L 5FJ8G 4IUNA 4OX9Q 1YITA 1RDPD 3QO2A 1QE6A 3MXNB 3ZJYC 4CDFC 2O5IC 3JAMi 1PTOH 1HZCA 4R4OA 3EQLC 3ND9A 1PH9A 2A73B 1PMRA 3TP8A 2DJGC 4DR4Q 4BA2I 2RBMA 1SYBA 1CK1A 3DWAA 2NTTA 4QIWB 3S1RH 2OQ0A 1PFSA 5I9PA 1I4RA 1MKHA 4WJ3M 2A69D 1PFBA 3KF6A 2PQEA 2KBNA 4A3MH 5LL6S 4A3EH 4A76A 2JA8B 2XVSA 5D65A 1SLJA 1D6EC 4ZUIA 2JA5H 1RTOA 4BXXH 2N8NA 2UUBQ 1STEA 2K5NA 4C3HB 2E8GA 2VUMG 5E3FA 2J7ZA 3EFXD 1SR3A 4DXFA 3SEBA 3DWPA 1PTOF 4K8JA 3G6EA 1K9MC 5IYCH 3BYTB 1O7ZA 3PO2G 1LTRD 4RGOS 4HJAA 3K5OA 3KF8B 3PUZA 5IWAQ 4H02A 4RKBA 1EL0A 4R4CA 4JI5Q 1EYAA 1JWSD 1CI3M 1Q8IA 1VQOA 3RN5A 3T56B 1CSPA 3DHQA 1ENCA 5C0XI 3H0GH 2SNSA 2R7FA 4I7ZC 1IYUA 1K3BC 3NEMA 5K5PA 3NTKA 3K5LA 2IX1A 4KV6A 1PYBA 1NJIC 4HJ9A 2F0JA 1F2ZA 1N36Q 5GROA 3DLLA 1HXYD 4BBSG 3U9SA 4EX5A 4MTNA 5IIFA 1PH7A 1CKOA 5C4XB 3BVMA 1LM0A 5LMUQ 1NTGA 2N3SA 4ZLTF 5IOCA 1UE7A 4J6HA 2O2LD 4ALPA 4C3JG 2KHSA 3CF5A 1E1OA 1TWGH 1A15A 1Y8OB 1B2TA 1F2MA 1VCIA 2BDNA 1GVPA 4DR1Q 1CA6A 5CV7A 2L55A 4DK3C 1X3GA 3J81E 5FLXL 4RWSC 1XMOL 4XQNA 2EYHA 2EYFA 1V1QA 3DEOA 3NPPA 1PYSB 1PDQA 3W5OA 1YJNA 4DV6Q 1ASYA 3H0GB 3LWUA 1PH1A 1SYFA 3NBHB 2B2TA 2H4OA 2AQ2B 4H44C 3G6JB 1PXUA 1N34Q 1GJXA 3E0JA 5DLQE 3TQYA 5T1IA 4A4IA 4NW2A 4A3BH 1T9HA 2VQEQ 3KK7A 4A93G 1ONLA 2V1CC 4XIGS 5C3EH 4K6DA 5KNBA 1MHWC 3U9OA 3G48A 3RLNA 2F0VA 5CORA 1WTRA 2VS1A 4DAVA 1V8QA 1QG7A 4A3CH 1Y1VB 2OTJA 4C3HH 1H9MA 3CXCA 3FKIG 1STGA 3HKSA 1EYGA 1IHZA 2HDMA 3OTOQ 1G51A 1RODA 3FPPA 5HY6A 1HFGA 1JORA 2YV5A 4RCOA 4G7ZC 3OWEB 3TP6A 4JBMA 4A93H 2CQOA 4OL7A 5CGKA 1ICWA 4HMJA 4OWXB 3S14H 2QEJC 2ALYB 1NBWA 5HGTA 2RDHA 1DOLA 4X64L 4A3KH 3SK8A 3X3NA 5IGBA 1ZYRD 1HQMC 3HOWH 4XXEA 1NNXA 1G291 1D1IA 3H6MA 4Q0FA 4FVMA 2RF4A 5EGTA 3C1FA 1HNWL 3S1MH 1I4QA 3IAYA 3DM1A 1SYEA 2WB1G 3QJYA 1STBA 2TMPA 2E74C 2Z6KA 1C4QA 3CP0A 3FPUB 1X3FA 4B3SL 1JT8A 5EBDA 2A69C 1KRSA 1ENFA 1K83H 4C56C 5HGQA 3I4MG 1QWYA 4LUZA 1O7YA 2B2VC 3E9IA 4JI8Q 4DR2Q 1OXTA 4KKUA 3P75A 4R1JA 2E2IB 4A3BB 1Z9FA 1WTWA 3I55A 4JW0A 1GKHA 2V4DA 4IPCA 3RLOA 3BJUA 1XPRA 3L7ZC 1TWAH 3PO2B 1S3OA 4LMQD 1W6JA 1WYDA 1FJGL 4QQBX 2VUMB 1G91A 5KYLA 4HR7B 2QCPX 4PMBA 1VQ8A 4PZ8A 1AE3A 1TWHB 1KQSA 1WTHA 3VDYA 4K5VA 1VQPA 4ABNA 1HZBA 4DUZQ 3NXWA 1XYIA 1S5DD 4QJFA 3TP5A 2K03A 4QF4A 2B3GA 3A5ZB 1TWFB 4JI2L 5IYDH 1AW7A 3F2UA 4WFN3 2RSOA 1EWCA 3RN2A 4YY3L 2J4XA 2WP8J 3FVQA 3JAME 1GO3E 1EQQA 1MSGA 4A3DH 4IPDA 4A3LG 1OXSC 4A3IH 3K7UC 4DR3Q 1ZYRC 2BCOA 3GTOB 4ZK9B 1LACA 4HCSA 1VQ9A 5KNCA 1CZWA 3PMFA 4KN7C 4DF7A 5M3MG 2YTYA 4LK1C 5EKKA 1NCVA 4FDBA 3PF5A 5EKIA 2CWAA 4QUFA 4WRDA 2JK8A 2GVBA 4IZ8A 4OHJA 1SFOB 3QWNA 2B8GA 3OMCA 1K8MA 2YTVA 5F2DA 4NKLA 4J1MA 1YNXA 2CW0C 4TSSA 2NVYH 3NQIA 3PIO3 5ELNA 4CHTB 4YY3Q 3KF8A 5I4DA 2A5HA 4DK1A 4BY1G 2XRQD 5JPMC 4YHHL 1BR9A 1Q1EA 1O80A 1WCMB 1PFNA 2IT1A 4P75A 1LT3D 2B29A 3A0JA 4K14A 3HOYG 1C7YA 1Y14B 1ESFA 4BS9A 3S17B 5T1GA 3LWEA 3K5MA 1X55A 4A3EB 2ZM6L 2AMCB 2K05A 2R7ZB 2ICEC 1CT1D 1F2YA 3RLFA 3TZUA 1E3PA 1I4HA 1PH5A 3MTSA 2E2HH 2R92B 2XSCA 3DWQA 3CCQA 1CA5A 5KEEA 3HOWB 5DAUA 1I4GA 3DUZA 3N52A 1HA6A 3KF6B 1SRUA 4C3IB 4LFAL 5IGEA 2E2JB 3D31A 2FJ2A 5C4ZA 4M8AA 4LWCA 1P16A 4L8JA 1N32Q 1ZEQX 4B3SQ 2PZWA 1EU3A 3PIPA 5LMNL 2ENBA 1K28A 2IY5B 3GTKB 1EIFA 2JA5G 5C3WA 1YBYA 2OXPA 4GKKQ 4OO1H 4JBJA 3H91A 3AFQA 4A3JG 4CDEC 2UUBL 2JA6G 2FXQA 5IP9G 4K8IA 2C35B 1NSNS 4R4IA 2BA1A 1SDFA 3OPOA 3KBGA 3A8JE 3PO3G 4CJ0B 4BBRH 1QCBD 2K5WA 4OWWB 3ULJA 1L0YB 4U673 2L12A 4A3JH 4B3MQ 4NXMQ 2CFMA 5FK9C 1LABA 4DAMA 2EQSA 1HUMA 1GXDC 3J81i 5M5YB 3M3YH 2PQAB 5M3MH 1SYGA 3PSIA 1EQTA 1AN8A
chains in the Genus database with same CATH topology
3CCEA 4DV7L 4DV2L 3I2ZA 3F1ZA 2JA8H 4JI0L 4LF4L 3I7FA 2ZJRA 3RNUA 4BBSH 2F52A 4X62Q 5C44H 2L15A 4RG1A 1YJWA 1IBLL 1XTDA 1VQEA 1EFWA 4JI1L 1N36L 2NVQH 4GOPB 4IJHA 4QGUA 1VQJA 1Y1VG 1XMQQ 4GN3B 2D0OA 1YVCA 3KFUA 2ASBA 3GTOH 1L1OB 2VQFQ 1MJCA 5FLMG 3ULPA 4A3KG 1QZHA 1VQCA 1EQRA 4LF4Q 2VQFL 4DR5L 1GD7A 1SMXA 4JI6L 2RHSB 3LGJA 4DKAC 4LF8L 4PG3A 5IE8A 3GO5A 1GM5A 4MZ9A 1Q1BA 2E5LL 4LF8Q 1FL0A 1I5FA 4JC0A 2I5HA 2RHQB 1DGSA 3HOUH 1L1OC 3J81j 4BY7G 1Y1VH 5ELOA 3J81c 1J5EL 1UEBA 4C3JH 5LMNQ 4JI3L 3SGIA 5FJ8G 5J3BA 4OX9Q 1YITA 1I50H 1VQAA 4KI0A 4DR7L 4IOAA 3GTLH 1C0AA 1LTLA 3CC4A 1YIJA 4XTCS 1WFQA 3MXNB 1IYJB 3ZJYC 4DV5Q 3JAMi 4IFDG 1HZCA 4QL5A 4R4OA 1S40A 3T1HL 1VQLA 2F3IA 3CCVA 4A3FH 1PH9A 1JJCB 2VY3A 2Z6KC 3UE1A 2JA8G 4DUZL 2LXJA 1P8LA 4TVAB 3KDFA 4DR4Q 4BA2I 4LFCL 4P74A 4NXNL 2Z0SA 4JOIC 1X54A 3HFZB 2KCMA 4DR1L 2UXCQ 3I4NH 1QUQA 2K50A 5LMNW 1K3RA 3S1RH 2WB1E 2OQ0A 4JI5L 1QVCA 1WJJA 1PFSA 3EIVA 4YCVA 4EQ5A 1PHJA 1XNRL 2Q2TA 1MKHA 4LW1A 3CPFA 4WJ3M 2WAQE 3TEHB 3KF6A 2KBNA 3U58A 4A3MH 4A3EH 4A76A 2JA7H 2ZTDA 3BU2A 4DV0Q 4GOPC 4LF5Q 1SLJA 4L5TA 4NPSA 2JA5H 2AKWB 4BXXH 2LSSA 1SN8A 2N8NA 2UUBQ 2GVAA 2K5NA 1N33L 1WOCA 5AJ3Q 2HQLA 3OYYA 3L2PA 1KAWA 4HIOA 4A75A 2E8GA 2VUMG 3CPWA 5IYDG 5BR8Q 1Y1WH 3OTOL 3M4QA 2AWOA 1PV4A 4NB3A 3IRBA 1SR3A 2OWOA 1PH4A 2QEXA 2VZAA 3G6EA 1K9MC 5IYCH 4GNXA 1I94L 3PO2G 1PVOA 3PIOA 4A3FG 1MIUA 4HJAA 3KF8B 3PUZA 3BZCA 5IWAQ 1X9NA 2PMZE 2OTLA 4H02A 4R4CA 4PMWA 2VUMH 3PV0A 4JI5Q 1Q7YC 3A74A 4A3EG 3FKIH 3A5UA 1VQOA 3RN5A 4KHPL 1UE6A 1CSPA 4BBRG 3HOUG 2ZTEA 1XJVA 4BXXG 4GLVB 5C0XI 3H0GH 4JI0Q 4DNIA 2A19A 1B8AA 2MNAA 1KRTA 1QZGA 1VQBA 3NENA 1IL2A 4A3CG 2R7FA 1EIYB 1RL2A 4A3GH 4JI1Q 3T1HQ 4DV3L 2DUDA 3NEMA 1KD1C 2PQAA 4AQYQ 4C3IH 3HKZE 1CKNA 4O2DA 2IX1A 2K4KA 1PYBA 3PUXA 3J7ZC 4LFCQ 1PH2A 1NJIC 1D8LA 4LF9L 4HJ9A 1E1TA 4OXPA 4JI2Q 5IP7G 3GTPH 2QA4A 4LF7Q 1EOVA 3UDFA 4X66Q 2K14A 1N36Q 5GROA 3DLLA 2F4VQ 3H0GG 1YHAA 3L0OA 4BA1I 2CCZA 4JI4Q 1KIXA 5C4XH 4BBSG 1SE8A 2E2IH 4KHPQ 2UU9Q 4EX5A 4MTNA 3HOWG 1PH7A 1CKOA 1K0RA 1JMCA 1KXLA 3STBD 3HOZH 1LM0A 5LMUQ 1NTGA 1MJEA 3W1BA 2N3SA 4AIMA 1UE7A 4L5SA 3PUYA 4X66L 3GD7A 4ALPA 1U5KA 1IBKL 2JEAI 4JV5L 1WCMH 3CF5A 1E1OA 1TWGH 4IPGA 1FJGQ 2UU9L 1VCIA 2LXKA 1GVPA 2EXDA 3CMAA 4DR1Q 2UUAQ 1N33Q 4JV5Q 4K0KL 2UXCL 4APVA 4DK3C 2MQHA 5JJLA 1X3GA 1BBUA 3I4MH 4BY7H 2ATWA 1VQDA 1HJPA 1XMOL 2Q2UA 1VQMA 3H3VI 1Q81C 3KJPA 4JCVE 5AJ3L 1Q86C 1WI5A 3B6YA 1V1QA 5IP9H 5M5WH 4HJ8A 5GAGC 1PYSB 5JEAG 4BY1H 4QY7A 4GLAC 3W5OA 2NVTH 2R92H 1YJNA 4DV6Q 3AYHB 1ASYA 4GKJQ 1O7IA 1IBLQ 1KHIA 1TXYA 1PH1A 2E2JH 2HHHQ 1V43A 4UP7A 4LF6Q 1HZ9A 2UUAL 4K0KQ 3NBHB 1HNZL 2UUCL 3JAMc 3PO2H 3D0FA 3M85A 2JA6H 4IJLA 3PUVA 1NMFA 1N34Q 1VQ6A 2UXDL 5C4XG 4OWTB 4OO1G 4PZ7A 4GN5A 1M1KC 3PGZA 5H1SE 5C44G 2JA9A 3TS2A 4A3BG 4LNQA 5DLQE 3TQYA 1Z47A 4L5QA 1VQIA 4JG2A 4A4IA 4OX9L 1VQKA 4JI7L 4A3BH 4ME3A 1T9HA 1I3QH 4DAYB 2VQEQ 4X6AH 4A93G 1HNXQ 1J6QA 2V1CC 1I94Q 4XIGS 5C3EH 3M7NA 2XTIA 4KHZA 1HNXL 3RZOH 3G71A 3U4VA 3U4ZA 2YTXA 3PCOB 4B3ML 3G48A 4UP9A 1QVGA 5IWAL 2UXBQ 3RLNA 1S72A 2VS1A 4YWKA 4A3CH 4P73A 4GNXC 3BZKA 2OTJA 1HNZQ 2UUCQ 2OQKA 2B63H 4C3HH 1TWFH 1TWHH 3ERSX 2MFIA 3CXCA 4NXML 3CCLA 4IPHA 2B63G 3FKIG 1IBML 3HKSA 3H3VH 1EYGA 1RIPA 1CKMA 5E7NA 2ZTCA 1IXRA 3OTOQ 4A3DG 5M3FH 1G51A 3CC7A 2K5VA 4GKKL 5HY6A 4B3TQ 2ID0A 1UE1A 4HIMA 1XPOA 2YV5A 3W1GA 2NZOA 4X64Q 2YU9H 4DR3L 3M4OH 1I6HH 1A63A 3K8AA 1L0WA 2GN5A 3STBC 4JBMA 4DR4L 1B7YB 2KENA 1HR0Q 4A93H 2BH8A 2CQOA 3CCUA 1HR0L 4OWXB 3S14H 1X65A 2ALYB 3I4NG 5EAYA 2JEBI 1L2FA 1NBWA 4GN4B 4LFBL 4X64L 5FLMH 4A3KH 3GTGH 2KHIA 1PH3A 4AH6A 4JYAL 2VNUD 4HJ7A 4KLKA 3HOWH 4DR6L 5M5XH 5GAHC 3KYHC 3CCSA 1G291 3ULLA 4LFAQ 1OXXK 4LF7L 3CMEA 2RF4A 4X62L 4JI3Q 2ZM6Q 1HNWL 3UDXA 3S1MH 1Q82C 2XGTA 2ZJQA 2EIFA 3CCRA 2WB1G 1VS0A 3PF4A 3MEFA 5IYBH 1PH6A 2Z6KA 3AQQA 3CQZH 4B3RQ 3CP0A 1VQNA 1X3FA 3CW2C 2A8VA 4B3SL 1HR0W 4L5RC 2DGYA 1JT8A 3HOXG 1E7ZA 1KRSA 2BA0A 1NE3A 5LMUL 2R92G 1K83H 4LF5L 2N78A 2PNHA 5HGQA 4LUZA 3I4MG 3CAMA 1G6PA 4JI8Q 3E9IA 2Y0SG 4JYAQ 1E24A 4A3LH 5M3FG 4DR2Q 1CKNB 1OXTA 4R1JA 2I5MX 3H15A 1Z9FA 2K5HA 3I55A 1XNQQ 3AEVA 1UWVA 1GKHA 4IFDJ 5IYBG 3M4PA 1PH8A 4IPCA 4JBKA 3S16H 5JJKA 1Q12A 3RLOA 3BJUA 1XPRA 3CD6A 3L7ZC 1K8GA 1KL9A 3HOXH 1TWAH 3KOJA 4DUYL 1S3OA 4HIKA 2VQEL 3TS0A 2HT1A 1H95A 1WYDA 5IY0A 3HOVH 4JI4L 1FJGL 3HOZG 3S2DH 2JJQA 1N9WA 5C0XG 1SFOH 2IHEA 3EN2A 4QQBX 5K36G 4J15A 1X6OA 2I0QA 1LYLA 2UXBL 1V9PA 1BBWA 5C4JH 1UE5A 1VQ8A 3TRZA 4PZ8A 1AE3A 2RCNA 4R4TA 5FJ8H 4DK6C 3UDGA 1KQSA 4DR2L 2HHHL 5GAEC 3VDYA 4LF6L 1VQPA 4O0AA 1EWIA 5GADC 1HZBA 3S17H 3KJOA 4RMFA 4DUZQ 1FGUA 2K75A 3J80i 1CUKA 4DV1Q 3CCMA 1E22A 4P72A 4QJFA 1QVFA 3J7A5 1B70B 3F2CA 3S2HH 2B3GA 3A5ZB 5IP7H 1YHQA 5M5YH 4JI2L 1NY4A 2R7ZH 3PO3H 1BVSA 4WJ4A 5IYDH 2N49A 1JE5A 4A3GG 1YJ9A 2CKZB 1XMOQ 2AHOB 2D0PA 3GTJH 3M9BA 2E5LQ 2QGQA 3RN2A 4YY3L 1VQFA 4C2MH 4DV4L 3T1YL 2WP8J 3HOVG 1N32L 4DV1L 1M90C 4R4QA 1GO3E 4GS3A 4YWLA 1EQQA 1J5EQ 4IPDA 4A3LG 1OXSC 4A3DH 2AWNA 4A3IH 4DPGA 3GDEA 4UY8C 3K7UC 4P71A 3ER0A 4QIWE 2ZJPA 4DR3Q 1K73C 3K7AH 4HIDA 4NXNQ 1A62A 1VQ9A 1AH9A 3PUWA 3S24A 2JE6I 4PZ6A 1YHBA 4TQUS 1A0IA 2HIVA 1NMGA 4IO9A 3S1NH 5M3MG 4IOCA 4DR5Q 2YTYA 2NVXH 2PI2A 3CCJA 4OONA 3TREA 1YI2A 4IFDI 4LFBQ 4FDBA 3PF5A 4YCWA 3S15H 1TWCH 3K80C 1XMQL 1X56A 2CWAA 2D62A 2JK8A 4DR6Q 2OCEA 1WCMG 2I5LX 2R7DA 2GVBA 2IHFA 1XPUA 4POFA 3ICEA 4X65Q 1Y1WG 1R9TH 2HIXA 4YWMA 1A8VA 2JQOA 2YTVA 4X65L 4UPAA 4JI8L 4DV3Q 4DV6L 2YYZA 3I4OA 1YNXA 3OW2A 1XNRQ 2Y0SE 1HZAA 1CSQA 2NVYH 3DM3A 5ELNA 4YY3Q 2NN6G 4DV4Q 1VQ5A 2R93G 1LUZA 4DV5L 3GTQH 4BY1G 4GLXA 5JEAJ 4YHHL 3U50C 3F2DA 4GNXB 1Q1EA 4POGA 1JJ2A 2IT1A 4JOIA 4P75A 4DV7Q 2B29A 3A0JA 3HOYG 4MNOA 1C7YA 1Y14B 2IX0A 2WAQG 3HOYH 5GQOA 2ES2A 1YZ6A 1N34L 3F8TA 3KLWA 2UXDQ 4DV0L 4AYBE 1EUJA 1Q46A 1X55A 2CWPA 2VL6A 4HJ5A 4Y52H 1PA6A 1K8AC 2ZM6L 1HNWQ 2AMCB 1OXUA 5JJIA 1C9OA 3NELA 1HH2P 1L1OA 1OTCA 2F4VL 1VQHA 4UP8A 3RLFA 2E2HH 1E3PA 1PH5A 4GOPA 4AYBG 1KC8C 3CCQA 5IYCG 5FLXc 2BH2A 1JJGA 5C3EG 1IBMQ 3KF6B 4JI7Q 2WFWA 2K52A 3E9HA 1SRUA 3RR5A 4LFAL 1W3SA 3D31A 2VW9A 4LUOA 4DV2Q 1Q8KA 3FP9A 3JC66 3RZDH 4OO1I 5IT9c 4LWCA 3HKZG 1P16A 1N32Q 2Q2HA 4LUVA 3UE0A 1OXVA 1QUQB 1W2BA 4B3SQ 1D7QA 3PIPA 5LMNL 3CC2A 5BR8L 1ASZA 3K81C 4DUYQ 2IY5B 1EIFA 2H5XA 4JBWA 4A3IG 1YBYA 1VQ4A 2JA5G 4GKKQ 3KDFB 4GKJL 3J80c 1SROA 3AFPA 1IBKQ 3Q8DA 4JBJA 2R93H 2JA6G 3AFQA 4A3JG 1N8RC 2UUBL 2Q2IA 2JA7G 2FXQA 3T1YQ 5IP9G 4A3MG 4YCUA 2C35B 4R4IA 2BA1A 2NN6I 1VQ7A 1JB7A 3EBEA 4JI6Q 3UDIA 1X3EA 4YHHQ 5C0XJ 4B3TL 3WWVA 2R7ZG 1IZ6A 3PO3G 1YEZA 2NZHA 4BBRH 4AQYL 1VQGA 4OWWB 1XNQL 3ULJA 1FVIA 2KHJA 3GTMH 4A3JH 2KCTA 4B3MQ 4NXMQ 2CFMA 4B3RL 4LF9Q 1U0LA 4DAMA 3I56A 3GTKH 2MO1A 3FHWA 3G4SA 2EQSA 2A1AA 3J81i 3F2BA 3M3YH 2PI2E 2PQAB 5M3MH 3PSIA 2MO0A 3K0XA 1AE2A 1BKBA 2R6GA 3E0EA 3S1QH 4DR7Q 4Y7NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE A;  4DV7 L;  4DV2 L;  3I2Z A;  3F1Z A;  2JA8 H;  4JI0 L;  4LF4 L;  3I7F A;  2ZJR A;  3RNU A;  4BBS H;  2F52 A;  4X62 Q;  5C44 H;  2L15 A;  4RG1 A;  1YJW A;  1IBL L;  1XTD A;  1VQE A;  1EFW A;  4JI1 L;  1N36 L;  2NVQ H;  4GOP B;  4IJH A;  4QGU A;  1VQJ A;  1Y1V G;  1XMQ Q;  4GN3 B;  2D0O A;  1YVC A;  3KFU A;  2ASB A;  3GTO H;  1L1O B;  2VQF Q;  1MJC A;  5FLM G;  3ULP A;  4A3K G;  1QZH A;  1VQC A;  1EQR A;  4LF4 Q;  2VQF L;  4DR5 L;  1GD7 A;  1SMX A;  4JI6 L;  2RHS B;  3LGJ A;  4DKA C;  4LF8 L;  4PG3 A;  5IE8 A;  3GO5 A;  1GM5 A;  4MZ9 A;  1Q1B A;  2E5L L;  4LF8 Q;  1FL0 A;  1I5F A;  4JC0 A;  2I5H A;  2RHQ B;  1DGS A;  3HOU H;  1L1O C;  3J81 j;  4BY7 G;  1Y1V H;  5ELO A;  3J81 c;  1J5E L;  1UEB A;  4C3J H;  5LMN Q;  4JI3 L;  3SGI A;  5FJ8 G;  5J3B A;  4OX9 Q;  1YIT A;  1I50 H;  1VQA A;  4KI0 A;  4DR7 L;  4IOA A;  3GTL H;  1C0A A;  1LTL A;  3CC4 A;  1YIJ A;  4XTC S;  1WFQ A;  3MXN B;  1IYJ B;  3ZJY C;  4DV5 Q;  3JAM i;  4IFD G;  1HZC A;  4QL5 A;  4R4O A;  1S40 A;  3T1H L;  1VQL A;  2F3I A;  3CCV A;  4A3F H;  1PH9 A;  1JJC B;  2VY3 A;  2Z6K C;  3UE1 A;  2JA8 G;  4DUZ L;  2LXJ A;  1P8L A;  4TVA B;  3KDF A;  4DR4 Q;  4BA2 I;  4LFC L;  4P74 A;  4NXN L;  2Z0S A;  4JOI C;  1X54 A;  3HFZ B;  2KCM A;  4DR1 L;  2UXC Q;  3I4N H;  1QUQ A;  2K50 A;  5LMN W;  1K3R A;  3S1R H;  2WB1 E;  2OQ0 A;  4JI5 L;  1QVC A;  1WJJ A;  1PFS A;  3EIV A;  4YCV A;  4EQ5 A;  1PHJ A;  1XNR L;  2Q2T A;  1MKH A;  4LW1 A;  3CPF A;  4WJ3 M;  2WAQ E;  3TEH B;  3KF6 A;  2KBN A;  3U58 A;  4A3M H;  4A3E H;  4A76 A;  2JA7 H;  2ZTD A;  3BU2 A;  4DV0 Q;  4GOP C;  4LF5 Q;  1SLJ A;  4L5T A;  4NPS A;  2JA5 H;  2AKW B;  4BXX H;  2LSS A;  1SN8 A;  2N8N A;  2UUB Q;  2GVA A;  2K5N A;  1N33 L;  1WOC A;  5AJ3 Q;  2HQL A;  3OYY A;  3L2P A;  1KAW A;  4HIO A;  4A75 A;  2E8G A;  2VUM G;  3CPW A;  5IYD G;  5BR8 Q;  1Y1W H;  3OTO L;  3M4Q A;  2AWO A;  1PV4 A;  4NB3 A;  3IRB A;  1SR3 A;  2OWO A;  1PH4 A;  2QEX A;  2VZA A;  3G6E A;  1K9M C;  5IYC H;  4GNX A;  1I94 L;  3PO2 G;  1PVO A;  3PIO A;  4A3F G;  1MIU A;  4HJA A;  3KF8 B;  3PUZ A;  3BZC A;  5IWA Q;  1X9N A;  2PMZ E;  2OTL A;  4H02 A;  4R4C A;  4PMW A;  2VUM H;  3PV0 A;  4JI5 Q;  1Q7Y C;  3A74 A;  4A3E G;  3FKI H;  3A5U A;  1VQO A;  3RN5 A;  4KHP L;  1UE6 A;  1CSP A;  4BBR G;  3HOU G;  2ZTE A;  1XJV A;  4BXX G;  4GLV B;  5C0X I;  3H0G H;  4JI0 Q;  4DNI A;  2A19 A;  1B8A A;  2MNA A;  1KRT A;  1QZG A;  1VQB A;  3NEN A;  1IL2 A;  4A3C G;  2R7F A;  1EIY B;  1RL2 A;  4A3G H;  4JI1 Q;  3T1H Q;  4DV3 L;  2DUD A;  3NEM A;  1KD1 C;  2PQA A;  4AQY Q;  4C3I H;  3HKZ E;  1CKN A;  4O2D A;  2IX1 A;  2K4K A;  1PYB A;  3PUX A;  3J7Z C;  4LFC Q;  1PH2 A;  1NJI C;  1D8L A;  4LF9 L;  4HJ9 A;  1E1T A;  4OXP A;  4JI2 Q;  5IP7 G;  3GTP H;  2QA4 A;  4LF7 Q;  1EOV A;  3UDF A;  4X66 Q;  2K14 A;  1N36 Q;  5GRO A;  3DLL A;  2F4V Q;  3H0G G;  1YHA A;  3L0O A;  4BA1 I;  2CCZ A;  4JI4 Q;  1KIX A;  5C4X H;  4BBS G;  1SE8 A;  2E2I H;  4KHP Q;  2UU9 Q;  4EX5 A;  4MTN A;  3HOW G;  1PH7 A;  1CKO A;  1K0R A;  1JMC A;  1KXL A;  3STB D;  3HOZ H;  1LM0 A;  5LMU Q;  1NTG A;  1MJE A;  3W1B A;  2N3S A;  4AIM A;  1UE7 A;  4L5S A;  3PUY A;  4X66 L;  3GD7 A;  4ALP A;  1U5K A;  1IBK L;  2JEA I;  4JV5 L;  1WCM H;  3CF5 A;  1E1O A;  1TWG H;  4IPG A;  1FJG Q;  2UU9 L;  1VCI A;  2LXK A;  1GVP A;  2EXD A;  3CMA A;  4DR1 Q;  2UUA Q;  1N33 Q;  4JV5 Q;  4K0K L;  2UXC L;  4APV A;  4DK3 C;  2MQH A;  5JJL A;  1X3G A;  1BBU A;  3I4M H;  4BY7 H;  2ATW A;  1VQD A;  1HJP A;  1XMO L;  2Q2U A;  1VQM A;  3H3V I;  1Q81 C;  3KJP A;  4JCV E;  5AJ3 L;  1Q86 C;  1WI5 A;  3B6Y A;  1V1Q A;  5IP9 H;  5M5W H;  4HJ8 A;  5GAG C;  1PYS B;  5JEA G;  4BY1 H;  4QY7 A;  4GLA C;  3W5O A;  2NVT H;  2R92 H;  1YJN A;  4DV6 Q;  3AYH B;  1ASY A;  4GKJ Q;  1O7I A;  1IBL Q;  1KHI A;  1TXY A;  1PH1 A;  2E2J H;  2HHH Q;  1V43 A;  4UP7 A;  4LF6 Q;  1HZ9 A;  2UUA L;  4K0K Q;  3NBH B;  1HNZ L;  2UUC L;  3JAM c;  3PO2 H;  3D0F A;  3M85 A;  2JA6 H;  4IJL A;  3PUV A;  1NMF A;  1N34 Q;  1VQ6 A;  2UXD L;  5C4X G;  4OWT B;  4OO1 G;  4PZ7 A;  4GN5 A;  1M1K C;  3PGZ A;  5H1S E;  5C44 G;  2JA9 A;  3TS2 A;  4A3B G;  4LNQ A;  5DLQ E;  3TQY A;  1Z47 A;  4L5Q A;  1VQI A;  4JG2 A;  4A4I A;  4OX9 L;  1VQK A;  4JI7 L;  4A3B H;  4ME3 A;  1T9H A;  1I3Q H;  4DAY B;  2VQE Q;  4X6A H;  4A93 G;  1HNX Q;  1J6Q A;  2V1C C;  1I94 Q;  4XIG S;  5C3E H;  3M7N A;  2XTI A;  4KHZ A;  1HNX L;  3RZO H;  3G71 A;  3U4V A;  3U4Z A;  2YTX A;  3PCO B;  4B3M L;  3G48 A;  4UP9 A;  1QVG A;  5IWA L;  2UXB Q;  3RLN A;  1S72 A;  2VS1 A;  4YWK A;  4A3C H;  4P73 A;  4GNX C;  3BZK A;  2OTJ A;  1HNZ Q;  2UUC Q;  2OQK A;  2B63 H;  4C3H H;  1TWF H;  1TWH H;  3ERS X;  2MFI A;  3CXC A;  4NXM L;  3CCL A;  4IPH A;  2B63 G;  3FKI G;  1IBM L;  3HKS A;  3H3V H;  1EYG A;  1RIP A;  1CKM A;  5E7N A;  2ZTC A;  1IXR A;  3OTO Q;  4A3D G;  5M3F H;  1G51 A;  3CC7 A;  2K5V A;  4GKK L;  5HY6 A;  4B3T Q;  2ID0 A;  1UE1 A;  4HIM A;  1XPO A;  2YV5 A;  3W1G A;  2NZO A;  4X64 Q;  2YU9 H;  4DR3 L;  3M4O H;  1I6H H;  1A63 A;  3K8A A;  1L0W A;  2GN5 A;  3STB C;  4JBM A;  4DR4 L;  1B7Y B;  2KEN A;  1HR0 Q;  4A93 H;  2BH8 A;  2CQO A;  3CCU A;  1HR0 L;  4OWX B;  3S14 H;  1X65 A;  2ALY B;  3I4N G;  5EAY A;  2JEB I;  1L2F A;  1NBW A;  4GN4 B;  4LFB L;  4X64 L;  5FLM H;  4A3K H;  3GTG H;  2KHI A;  1PH3 A;  4AH6 A;  4JYA L;  2VNU D;  4HJ7 A;  4KLK A;  3HOW H;  4DR6 L;  5M5X H;  5GAH C;  3KYH C;  3CCS A;  1G29 1;  3ULL A;  4LFA Q;  1OXX K;  4LF7 L;  3CME A;  2RF4 A;  4X62 L;  4JI3 Q;  2ZM6 Q;  1HNW L;  3UDX A;  3S1M H;  1Q82 C;  2XGT A;  2ZJQ A;  2EIF A;  3CCR A;  2WB1 G;  1VS0 A;  3PF4 A;  3MEF A;  5IYB H;  1PH6 A;  2Z6K A;  3AQQ A;  3CQZ H;  4B3R Q;  3CP0 A;  1VQN A;  1X3F A;  3CW2 C;  2A8V A;  4B3S L;  1HR0 W;  4L5R C;  2DGY A;  1JT8 A;  3HOX G;  1E7Z A;  1KRS A;  2BA0 A;  1NE3 A;  5LMU L;  2R92 G;  1K83 H;  4LF5 L;  2N78 A;  2PNH A;  5HGQ A;  4LUZ A;  3I4M G;  3CAM A;  1G6P A;  4JI8 Q;  3E9I A;  2Y0S G;  4JYA Q;  1E24 A;  4A3L H;  5M3F G;  4DR2 Q;  1CKN B;  1OXT A;  4R1J A;  2I5M X;  3H15 A;  1Z9F A;  2K5H A;  3I55 A;  1XNQ Q;  3AEV A;  1UWV A;  1GKH A;  4IFD J;  5IYB G;  3M4P A;  1PH8 A;  4IPC A;  4JBK A;  3S16 H;  5JJK A;  1Q12 A;  3RLO A;  3BJU A;  1XPR A;  3CD6 A;  3L7Z C;  1K8G A;  1KL9 A;  3HOX H;  1TWA H;  3KOJ A;  4DUY L;  1S3O A;  4HIK A;  2VQE L;  3TS0 A;  2HT1 A;  1H95 A;  1WYD A;  5IY0 A;  3HOV H;  4JI4 L;  1FJG L;  3HOZ G;  3S2D H;  2JJQ A;  1N9W A;  5C0X G;  1SFO H;  2IHE A;  3EN2 A;  4QQB X;  5K36 G;  4J15 A;  1X6O A;  2I0Q A;  1LYL A;  2UXB L;  1V9P A;  1BBW A;  5C4J H;  1UE5 A;  1VQ8 A;  3TRZ A;  4PZ8 A;  1AE3 A;  2RCN A;  4R4T A;  5FJ8 H;  4DK6 C;  3UDG A;  1KQS A;  4DR2 L;  2HHH L;  5GAE C;  3VDY A;  4LF6 L;  1VQP A;  4O0A A;  1EWI A;  5GAD C;  1HZB A;  3S17 H;  3KJO A;  4RMF A;  4DUZ Q;  1FGU A;  2K75 A;  3J80 i;  1CUK A;  4DV1 Q;  3CCM A;  1E22 A;  4P72 A;  4QJF A;  1QVF A;  3J7A 5;  1B70 B;  3F2C A;  3S2H H;  2B3G A;  3A5Z B;  5IP7 H;  1YHQ A;  5M5Y H;  4JI2 L;  1NY4 A;  2R7Z H;  3PO3 H;  1BVS A;  4WJ4 A;  5IYD H;  2N49 A;  1JE5 A;  4A3G G;  1YJ9 A;  2CKZ B;  1XMO Q;  2AHO B;  2D0P A;  3GTJ H;  3M9B A;  2E5L Q;  2QGQ A;  3RN2 A;  4YY3 L;  1VQF A;  4C2M H;  4DV4 L;  3T1Y L;  2WP8 J;  3HOV G;  1N32 L;  4DV1 L;  1M90 C;  4R4Q A;  1GO3 E;  4GS3 A;  4YWL A;  1EQQ A;  1J5E Q;  4IPD A;  4A3L G;  1OXS C;  4A3D H;  2AWN A;  4A3I H;  4DPG A;  3GDE A;  4UY8 C;  3K7U C;  4P71 A;  3ER0 A;  4QIW E;  2ZJP A;  4DR3 Q;  1K73 C;  3K7A H;  4HID A;  4NXN Q;  1A62 A;  1VQ9 A;  1AH9 A;  3PUW A;  3S24 A;  2JE6 I;  4PZ6 A;  1YHB A;  4TQU S;  1A0I A;  2HIV A;  1NMG A;  4IO9 A;  3S1N H;  5M3M G;  4IOC A;  4DR5 Q;  2YTY A;  2NVX H;  2PI2 A;  3CCJ A;  4OON A;  3TRE A;  1YI2 A;  4IFD I;  4LFB Q;  4FDB A;  3PF5 A;  4YCW A;  3S15 H;  1TWC H;  3K80 C;  1XMQ L;  1X56 A;  2CWA A;  2D62 A;  2JK8 A;  4DR6 Q;  2OCE A;  1WCM G;  2I5L X;  2R7D A;  2GVB A;  2IHF A;  1XPU A;  4POF A;  3ICE A;  4X65 Q;  1Y1W G;  1R9T H;  2HIX A;  4YWM A;  1A8V A;  2JQO A;  2YTV A;  4X65 L;  4UPA A;  4JI8 L;  4DV3 Q;  4DV6 L;  2YYZ A;  3I4O A;  1YNX A;  3OW2 A;  1XNR Q;  2Y0S E;  1HZA A;  1CSQ A;  2NVY H;  3DM3 A;  5ELN A;  4YY3 Q;  2NN6 G;  4DV4 Q;  1VQ5 A;  2R93 G;  1LUZ A;  4DV5 L;  3GTQ H;  4BY1 G;  4GLX A;  5JEA J;  4YHH L;  3U50 C;  3F2D A;  4GNX B;  1Q1E A;  4POG A;  1JJ2 A;  2IT1 A;  4JOI A;  4P75 A;  4DV7 Q;  2B29 A;  3A0J A;  3HOY G;  4MNO A;  1C7Y A;  1Y14 B;  2IX0 A;  2WAQ G;  3HOY H;  5GQO A;  2ES2 A;  1YZ6 A;  1N34 L;  3F8T A;  3KLW A;  2UXD Q;  4DV0 L;  4AYB E;  1EUJ A;  1Q46 A;  1X55 A;  2CWP A;  2VL6 A;  4HJ5 A;  4Y52 H;  1PA6 A;  1K8A C;  2ZM6 L;  1HNW Q;  2AMC B;  1OXU A;  5JJI A;  1C9O A;  3NEL A;  1HH2 P;  1L1O A;  1OTC A;  2F4V L;  1VQH A;  4UP8 A;  3RLF A;  2E2H H;  1E3P A;  1PH5 A;  4GOP A;  4AYB G;  1KC8 C;  3CCQ A;  5IYC G;  5FLX c;  2BH2 A;  1JJG A;  5C3E G;  1IBM Q;  3KF6 B;  4JI7 Q;  2WFW A;  2K52 A;  3E9H A;  1SRU A;  3RR5 A;  4LFA L;  1W3S A;  3D31 A;  2VW9 A;  4LUO A;  4DV2 Q;  1Q8K A;  3FP9 A;  3JC6 6;  3RZD H;  4OO1 I;  5IT9 c;  4LWC A;  3HKZ G;  1P16 A;  1N32 Q;  2Q2H A;  4LUV A;  3UE0 A;  1OXV A;  1QUQ B;  1W2B A;  4B3S Q;  1D7Q A;  3PIP A;  5LMN L;  3CC2 A;  5BR8 L;  1ASZ A;  3K81 C;  4DUY Q;  2IY5 B;  1EIF A;  2H5X A;  4JBW A;  4A3I G;  1YBY A;  1VQ4 A;  2JA5 G;  4GKK Q;  3KDF B;  4GKJ L;  3J80 c;  1SRO A;  3AFP A;  1IBK Q;  3Q8D A;  4JBJ A;  2R93 H;  2JA6 G;  3AFQ A;  4A3J G;  1N8R C;  2UUB L;  2Q2I A;  2JA7 G;  2FXQ A;  3T1Y Q;  5IP9 G;  4A3M G;  4YCU A;  2C35 B;  4R4I A;  2BA1 A;  2NN6 I;  1VQ7 A;  1JB7 A;  3EBE A;  4JI6 Q;  3UDI A;  1X3E A;  4YHH Q;  5C0X J;  4B3T L;  3WWV A;  2R7Z G;  1IZ6 A;  3PO3 G;  1YEZ A;  2NZH A;  4BBR H;  4AQY L;  1VQG A;  4OWW B;  1XNQ L;  3ULJ A;  1FVI A;  2KHJ A;  3GTM H;  4A3J H;  2KCT A;  4B3M Q;  4NXM Q;  2CFM A;  4B3R L;  4LF9 Q;  1U0L A;  4DAM A;  3I56 A;  3GTK H;  2MO1 A;  3FHW A;  3G4S A;  2EQS A;  2A1A A;  3J81 i;  3F2B A;  3M3Y H;  2PI2 E;  2PQA B;  5M3M H;  3PSI A;  2MO0 A;  3K0X A;  1AE2 A;  1BKB A;  2R6G A;  3E0E A;  3S1Q H;  4DR7 Q;  4Y7N H; 
#chains in the Genus database with same CATH topology
 1U4R A;  2QDB A;  3I2Z A;  5FO8 B;  2JA8 H;  1IL8 A;  4FF1 A;  1SNO A;  4KY5 A;  3I7F A;  4HCE A;  1PYW D;  4RG1 A;  4OGQ C;  1N36 L;  2SDF A;  4IJH A;  4QGU A;  3BDO A;  1YVC A;  3GTO H;  1L1O B;  2K5Q A;  3K0Y A;  2VQF Q;  2JXM B;  4RA8 A;  2RDG A;  3H3V C;  1GD7 A;  3GP7 A;  3DMU A;  4A3D B;  4DKA C;  5IE8 A;  3GO5 A;  2DJF C;  2G9H D;  1F9Q A;  1Y1W B;  4JC0 A;  1B9N A;  3K7A B;  4C3J B;  2K32 A;  1XTC D;  2NUC A;  2EY1 A;  4B9X A;  3J81 j;  4XT1 B;  5ELO A;  3J81 c;  1UEB A;  2C9O A;  1HRJ A;  2NWG A;  1BCP B;  2GA4 B;  3QR8 A;  1LTL A;  5A2Q L;  1YIJ A;  4EQN A;  1WD1 A;  1S40 A;  2F3W A;  5E4X A;  1GOZ A;  1O78 A;  4ZCK A;  2JYO A;  4TVA B;  1EYD A;  2M00 A;  4LFC L;  2KEC A;  2SOB A;  4RAU C;  4OIK A;  1X54 A;  2F0U A;  4OIJ A;  3RUZ A;  1LTB D;  4DR1 L;  4XYQ A;  3I4N H;  4KJO A;  1JE4 A;  2CVR A;  4CGY B;  3A55 A;  4ZKB B;  3IL8 A;  1QVC A;  1WJJ A;  4YCV A;  2WIN B;  4TRD A;  2Y0S B;  3S1Q B;  3CPF A;  3BYY B;  3M3Y B;  3TEH B;  1RJT A;  1FD7 D;  1EEI D;  4GZY C;  1G2T A;  1CHQ D;  4DV0 Q;  2FMM A;  5KIX A;  4A3F B;  2AKW B;  2BDO A;  2LSS A;  2GVA A;  4ZYS A;  2HQL A;  1KAW A;  4HIO A;  2PCF B;  4A3I B;  2F1M A;  3FMC A;  3CPW A;  1Y1W H;  1RF2 D;  3OTO L;  1X3Q A;  2AWO A;  2IJ0 A;  3IRB A;  2DY7 A;  2VZA A;  1I94 L;  2ZXR A;  4L6T B;  1I3Q B;  1MIU A;  2L5T A;  3MFG A;  1TQO A;  1BCP D;  2DN8 A;  2FIN B;  4PMW A;  3J81 L;  4MIU A;  3A74 A;  2A6E C;  4A3E G;  2PW7 A;  3A5U A;  1UE6 A;  2MUY A;  4KY7 A;  1MSH A;  2KCC A;  3FEW X;  1R9T B;  3FKI B;  4GLV B;  1ICF B;  1PFM A;  1VQB A;  4A3C G;  3TSS A;  2K7V A;  3T1H Q;  1RCV D;  4DV3 L;  1CKN A;  2K4K A;  2F0M A;  4H7B A;  4C3I G;  4TKO B;  2PYK A;  2Q8T A;  2WB1 B;  3SVM A;  1E1T A;  4OXP A;  3GTP H;  5I6Y A;  3RD4 A;  4X66 Q;  2K14 A;  4IUT A;  2F4V Q;  4JI4 Q;  3L0O A;  3HOZ B;  2E2I H;  3HOW G;  3MXN A;  4DAP A;  3LX0 A;  1KXL A;  3OIP A;  3STB D;  4A3J B;  1R4P B;  2EE1 A;  1BO0 A;  4N9P A;  4X66 L;  3GD7 A;  1WTQ A;  2JEA I;  4IPG A;  3CMA A;  2UUA Q;  2EXD A;  1N33 Q;  2WKC A;  4UHV A;  4IUV A;  4EQO A;  1QOH A;  3PIP 3;  1UNS A;  2MQH A;  2EJM A;  4BY7 H;  1VQD A;  1SJE D;  2G9D A;  1VQM A;  3H3V I;  1HUN A;  5C44 B;  2X69 A;  1Q86 C;  2B8F A;  4K6L A;  5IP9 H;  1QIL A;  3J7A F;  4BY1 H;  4QY7 A;  3S16 B;  2KED A;  3QB3 A;  1TWC B;  2QIL A;  2LMC B;  2E2J H;  1U9R A;  3W2D A;  3A56 A;  4UP7 A;  3C1E A;  2L1B A;  3S1N B;  3M85 A;  4IJL A;  5C4X G;  1VQ6 A;  4OWT B;  4GN5 A;  3PGZ A;  3TS2 A;  4A3B G;  1A3T A;  1Z47 A;  1MD2 D;  1VQI A;  4OX9 L;  4ME3 A;  1J6Q A;  5CV5 A;  1S5E D;  3SK5 A;  3VYS A;  4F88 A;  1I94 Q;  1TKW B;  1SYC A;  4KHZ A;  3RZO H;  4HN7 A;  3U4V A;  2YTX A;  3U4Z A;  3J80 L;  1JWM D;  3TBI B;  5IWA L;  4RHR A;  1S72 A;  1EYC A;  4KD4 A;  4YWK A;  3MFY A;  4FF2 A;  1GUW A;  4P73 A;  3K57 A;  1TS4 A;  1H9S A;  2OQK A;  3ERS X;  4CKE A;  1IBM L;  1Y69 U;  3H3V H;  1CKM A;  5E7N A;  3QG1 A;  2C5C A;  4A3D G;  1LT4 D;  4YIJ A;  1STA A;  4B3T Q;  1UE1 A;  3ITP A;  1JCK B;  3W1G A;  2ZXO A;  4DR3 L;  3M4O H;  1E2Z A;  1L0W A;  3STB C;  4LJZ C;  5JOB A;  4F87 A;  2ICI A;  1HR0 Q;  4Y7N B;  3CCU A;  1HR0 L;  2JEB I;  1L2F A;  1TR5 A;  5CV6 A;  2B63 B;  1SE2 A;  1M8A A;  5ELF A;  1KTK A;  1KAA A;  1STY A;  3P7J A;  5ISR A;  1PH3 A;  2VNU D;  2RKS A;  1SNP A;  2X6L A;  4DU9 A;  3HOY B;  1T5X D;  3ULL A;  1WVL A;  4X62 L;  3UDX A;  2ZJQ A;  1I6V C;  3CCR A;  1CHP D;  5IYB H;  1F9P A;  3CQZ H;  2XIW A;  2A8V A;  4L5R C;  1A3U A;  1ZKO A;  2F0N A;  3S9W A;  5LMU L;  3QIA A;  1NE3 A;  2R92 G;  4LF5 L;  2PNH A;  3IFD A;  2Y0S G;  4K2L A;  4JYA Q;  1E24 A;  5M3F G;  2F0E A;  4R8I A;  1YNN C;  4H0L C;  3H15 A;  1YNN D;  1XNQ Q;  3AEV A;  1DZ1 A;  2BE5 C;  1UWV A;  2AUJ D;  4IFD J;  3S16 H;  1PH8 A;  1Q12 A;  1K8G A;  1KL9 A;  3TZD A;  5C6A A;  3GTG B;  2HUG A;  4HIK A;  4ID6 A;  2HT1 A;  1H95 A;  3E6Z X;  3HS0 C;  2BE5 D;  3HOV H;  1TWA B;  2A74 C;  1N9W A;  2EXZ A;  4RGN A;  3FRP B;  2O4X A;  3C3L A;  3VYU A;  5C4J H;  1UE5 A;  1PTO B;  2RCN A;  5FJ8 H;  3UDG A;  4DR2 L;  3FDT A;  3URY A;  1EIH A;  4S3S A;  5GAE C;  3OW7 A;  1EWI A;  4IUP A;  5EPJ A;  3S17 H;  1J9O A;  4RMF A;  2K04 A;  5FO7 B;  3KJO A;  1LO5 D;  1CUK A;  1FNV A;  1B9M A;  5C5M A;  4JVZ A;  3CCM A;  4DV1 Q;  2KA7 A;  1QVF A;  3J7A 5;  1B70 B;  3S2H H;  5IP7 H;  5M5Y H;  3PO3 H;  1HTP A;  1JE5 A;  2CKZ B;  4EQP A;  2D0P A;  1CTM A;  2E5L Q;  1E0B A;  1VQF A;  4C2M H;  1SBB B;  4MN3 A;  4DV1 L;  2EYP A;  1BDO A;  3GTJ B;  1J5E Q;  3I73 A;  4DNR B;  4DPG A;  1G6Z A;  2D9U A;  3ER0 A;  4X3T A;  1PZI D;  1V1O A;  4FXD A;  1STN A;  1QJO A;  1A62 A;  2JE6 I;  4A3G B;  2XRS D;  1YHB A;  1A0I A;  2K01 A;  4DR5 Q;  2EJF C;  4IFD I;  4CJ1 B;  3HOX B;  1MI2 A;  1GHK A;  1TWC H;  4PQX A;  4CBV A;  1X32 A;  4DR6 Q;  2R7D A;  2E2H B;  3HP3 A;  1EY0 A;  1W6K A;  1PRT D;  4X65 Q;  1Y1W G;  2HIX A;  1A8V A;  5IT9 L;  2YU9 B;  1JOO A;  1TWG B;  5L37 A;  4DV3 Q;  2YYZ A;  3I4O A;  3A7A B;  1SAP A;  2PZU A;  1LV9 A;  3SK6 A;  2Y0S E;  3DM3 A;  5C3X A;  1HA5 A;  1VQ5 A;  4GLX A;  3Q24 A;  2EOT A;  1O7L A;  4XQQ A;  4AYB B;  4FXK C;  4GNX B;  1IKM A;  4DAY A;  5TSS A;  1FNW A;  1GHJ A;  1G8Z D;  4MNO A;  2EYL A;  3VYR A;  3HRZ C;  1N34 L;  2JSO A;  4DV0 L;  4HED A;  1EUJ A;  4K2K A;  1OXU A;  3HOU B;  1HH2 P;  2KJX A;  2XN9 C;  4C3H G;  4C1N I;  1KC8 C;  4R9W A;  5FLX c;  5E1F A;  1JJG A;  5C3E G;  1WTV A;  2P5Z X;  1CZG A;  3E9H A;  5LL6 X;  4JI7 Q;  4KKT A;  2VW9 A;  4V19 0;  2EYO A;  4DV2 Q;  1Q8K A;  3FP9 A;  3JC6 6;  4OO1 I;  3GQB A;  3HKZ G;  3OSO A;  1OXV A;  1DOK A;  5BR8 L;  1ASZ A;  3K81 C;  3V05 A;  4DUY Q;  5NUC A;  4A3I G;  1S5F D;  3KDF B;  1K83 B;  1SRO A;  1U4L A;  3AFP A;  3Q8D A;  4IUQ A;  1PRT B;  2JA7 G;  1MBY A;  2NN6 I;  1JB7 A;  4JI6 Q;  3VR5 A;  4B3T L;  1KDC A;  5EJW A;  3WWV A;  5BN4 A;  2R7Z G;  3GTM B;  1YEZ A;  3GTL B;  2SNM A;  5HUR A;  1SNQ A;  4NMZ A;  2KHJ A;  1TII D;  1PRT C;  5J1Z A;  3VR4 A;  3J7Y W;  4B3R L;  1C8C A;  1U0L A;  2KQ3 A;  2MHV A;  3GTQ B;  4FF3 A;  1SND A;  4EGV A;  1AE2 A;  3ZYY X;  1AZQ A;  5EKL A;  2PNR C;  4Q5V A;  2O5J C;  2F0O A;  3D8G A;  1HQR D;  3RNU A;  1HTL D;  4NDX A;  1BCP C;  2L15 A;  5BN5 A;  1XTD A;  2RQX A;  4G7H C;  3NK9 A;  2NVQ H;  2AQ1 B;  1IYV A;  1EWH A;  1SXT A;  2IW3 A;  1VQJ A;  3D4D A;  2F0Q A;  5FLM G;  2VQF L;  2VXW A;  4DR5 L;  3V96 A;  4JI6 L;  3ERQ A;  4B9W A;  5M3F B;  2WV6 D;  4LF8 L;  1SE4 A;  1EIG A;  4WOR A;  1Q1B A;  1I5F A;  2EVB A;  2RHQ B;  1L1O C;  4BY7 G;  1J5E L;  3T16 A;  3BVZ A;  3SGI A;  2HCI A;  5J3B A;  3M7G A;  1FNU A;  1ET9 A;  1V1P B;  1CQV A;  3DXJ C;  3A54 A;  5KGU A;  4N9T A;  1ESR A;  3CU7 A;  3WOE A;  3VR3 A;  3H94 A;  4QL5 A;  3T1H L;  2F3I A;  5J22 A;  3CCV A;  4A93 B;  1JJC B;  2VY3 A;  2Z6K C;  3UE1 A;  2JA8 G;  4XQJ A;  3J80 E;  2B2U C;  2Z0S A;  4JOI C;  3OOC A;  1DXM A;  1QUQ A;  2K50 A;  3I8Z A;  5LMN W;  2B2V A;  4RHS A;  5I6W A;  4G57 A;  3EIV A;  4EQ5 A;  1XNR L;  2Q2T A;  1TY0 A;  1DD2 A;  4HTH A;  1SMY D;  2WAQ E;  1SMY C;  4N8F A;  3U58 A;  2OF1 A;  4JPB W;  2ZTD A;  3BU2 A;  2B2W A;  5E4W C;  4IAL A;  4GOP C;  2PW5 A;  2F0T A;  1LT5 D;  3W3A A;  4L5T A;  4NPS A;  4DA2 A;  1SN8 A;  2VB3 X;  1WOC A;  5AJ3 Q;  3L2P A;  4A75 A;  1PV4 A;  1NUC A;  4NB3 A;  5DM7 3;  2OWO A;  2QEX A;  5C4H A;  1TT2 A;  1UAP A;  5JVH 3;  5C0X H;  3PIO A;  1S4Z A;  4CDC C;  1X9N A;  2PMZ E;  3G7L A;  2OTL A;  4G4K A;  5G3L F;  1HCZ A;  1Q7Y C;  2VB2 X;  4KHP L;  4A3K B;  3HOU G;  2KCN A;  1XJV A;  4JI0 Q;  3EA6 A;  4MTK A;  1B8A A;  2MNA A;  1KRT A;  1QZG A;  1CM9 A;  2DNC A;  1B3Q A;  3NEN A;  1IL2 A;  1EIY B;  1RL2 A;  3I4M B;  1EZ6 A;  4HMI A;  2DUD A;  3LNN A;  2K28 A;  4C3I H;  3HKZ E;  1SYD A;  1DYQ A;  5G3L D;  3PUX A;  3J7Z C;  4LFC Q;  3VR2 A;  1H9J A;  3ND8 A;  4LF7 Q;  4CJ2 C;  2LFN A;  1EY9 A;  3Q23 A;  1YHA A;  4BA1 I;  2CCZ A;  3TP7 A;  5C4X H;  4KHP Q;  4QB4 A;  1BOS A;  4ILW A;  1K0R A;  3HG9 A;  3MEH A;  3TDQ A;  3W1B A;  4AIM A;  1CFM A;  3PUY A;  2EYJ A;  5K36 H;  3I4L A;  3E3X A;  3MXP A;  2IWH A;  2F03 A;  1WCM H;  2A68 D;  2LXK A;  4JV5 Q;  4K0K L;  2UXC L;  2PZT A;  3EJI A;  2N88 A;  1FGB D;  3IFT A;  3I4M H;  3SDZ A;  1HJP A;  2Q2U A;  5C5L A;  3NUC A;  1U4M A;  5AJ3 L;  5M9O A;  4ME5 A;  2OEO A;  3B6Y A;  4R8N A;  4KK7 A;  4V0B A;  5M5W H;  5GAG C;  3MZ5 A;  1SE3 A;  4FO2 A;  4GLA C;  2NVT H;  4ODG A;  1Q3L A;  3AYH B;  4GKJ Q;  4KHV A;  1KHI A;  3MC0 B;  1HZ9 A;  4K0K Q;  2FHT A;  1HNZ L;  2UUC L;  3PO2 H;  1NMF A;  2UXD L;  2F3V A;  4I65 A;  4PZ7 A;  1M1K C;  5H1S E;  2JA9 A;  4BBR B;  2WAQ B;  4LNQ A;  4L5Q A;  5D14 A;  5ELE A;  4X6A H;  4DAY B;  2XTI A;  1HNX L;  3G71 A;  3PCO B;  4B3M L;  4O1N A;  3BDL A;  2IX3 A;  4UP9 A;  1AZP A;  1S5B D;  2UXB Q;  1AFP A;  3MAQ A;  1HFN A;  4GNX C;  1GUO A;  3EVQ A;  4XYO A;  1TWF H;  4NXM L;  2MFI A;  3T13 A;  4IPH A;  3CCL A;  1CQF A;  2SEB D;  1KAB A;  3BS1 A;  1QNU A;  3CC7 A;  2K5V A;  4GKK L;  2OT2 A;  2ID0 A;  4HIM A;  1XPO A;  4X64 Q;  2YU9 H;  2E2D C;  1I6H H;  1A63 A;  4RCN A;  1B1Z A;  5J39 A;  1EY6 A;  5CV9 A;  4DR4 L;  1STH A;  2RVL A;  1F9R A;  2F0L A;  3R2T A;  1X65 A;  3OWF A;  1GUG A;  2CHB D;  4LFB L;  2KHI A;  4AH6 A;  1LTT D;  4N8X 1;  1PTO D;  2ZT9 C;  1JQY D;  4MHE A;  5FOB B;  1TY2 A;  4LFA Q;  5COY A;  4JI3 Q;  2NB0 A;  2ZM6 Q;  4DK0 A;  1Q82 C;  2N55 A;  1VS0 A;  3PF4 A;  3MEF A;  2HD3 A;  4B3R Q;  3AQQ A;  3HZX A;  3VA5 A;  1G2S A;  3CRK C;  4K5X A;  5A2Q E;  1VQN A;  1MGS A;  2DGY A;  2RSN A;  3HOX G;  1ET6 A;  3SK4 A;  2N78 A;  1DJR D;  4KN4 C;  1CKN B;  4ULL A;  2I5M X;  1BF4 A;  5IYB G;  3M4P A;  2NVT B;  5JJK A;  2L4N A;  1VMC A;  4Z9C B;  3CD6 A;  3R2I A;  3T53 B;  1SNC A;  3KOJ A;  4PV1 C;  4DUY L;  2VQE L;  2Z8L A;  3S2D H;  1SFO H;  5ELC A;  2IHE A;  2RDF A;  2EJG C;  3EN2 A;  1JR0 D;  4J15 A;  5K36 G;  1LYL A;  3MWY W;  1V9P A;  4F7X A;  2UXB L;  3NE5 B;  4OEM B;  5I2X A;  4IUU A;  4O0A A;  1KLU D;  2E76 C;  2K75 A;  1UUP A;  3KBX A;  4QMG A;  1HHV A;  1E22 A;  4P72 A;  3K6O A;  3F2C A;  4WJ4 A;  1YHQ A;  1PZK D;  1NY4 A;  2R7Z H;  1BVS A;  2N49 A;  1YJ9 A;  1XMO Q;  2AHO B;  3IKJ A;  2QGQ A;  2E75 C;  4DV4 L;  1N32 L;  3HOV G;  5BN3 A;  2G5D A;  1M90 C;  2BOS A;  4R4Q A;  1DON A;  3UI2 A;  1X3P A;  1XWE A;  1ML0 D;  3GDE A;  3BDC A;  2ZJP A;  1K73 C;  1IW7 C;  3MVV A;  4HID A;  4NXN Q;  2Q8I B;  2NVY B;  3S24 A;  3K5N A;  4PZ6 A;  1TS2 A;  2KUM A;  4TQU S;  2A6H C;  2PI2 A;  3CCJ A;  3TRE A;  3S15 H;  3K80 C;  1X56 A;  2D62 A;  2OCE A;  1WCM G;  2I5L X;  3P1H A;  2IHF A;  4POF A;  3ICE A;  2RA4 A;  2JQO A;  4X65 L;  4JI8 L;  3KLS X;  2HCC A;  3OW2 A;  1XNR Q;  3A8K E;  3NTI A;  1EU4 A;  3D6C A;  3BG3 A;  2NN6 G;  4DV4 Q;  2F0G A;  2K33 A;  1LUZ A;  4DV5 L;  3GTQ H;  5JEA H;  1FR3 A;  3F2D A;  3U50 C;  1JJ2 A;  1SJH D;  1D5X C;  1PZJ D;  4DNT B;  4F8M A;  2WAQ G;  2ES2 A;  1YZ6 A;  3F8T A;  3KLW A;  4CKB A;  1C48 A;  4AYB E;  1Q46 A;  4WJW A;  4Y52 H;  1PA6 A;  1K8A C;  1HNW Q;  5JJI A;  1C9O A;  3NEL A;  1JC7 A;  1L1O A;  2F4V L;  1VQH A;  2B2T C;  1NR2 A;  5KYI A;  3K58 A;  3NWS A;  5IYC G;  3SHL A;  1IBM Q;  4OEL B;  1EEF D;  1I6H B;  3VA7 A;  2Z4I A;  3RR5 A;  3MA2 B;  4BY7 B;  4LUO A;  5IT9 c;  3RMH A;  2F0W A;  2Q2H A;  4LUV A;  1JIC A;  3UE0 A;  1QUQ B;  3N6R A;  1D7Q A;  3AMU A;  4GKJ L;  1VQ4 A;  5CBE E;  1IBK Q;  1F2L A;  1BXT A;  3NBI A;  2Q2I A;  3T1Y Q;  4A3M G;  4YCU A;  2QKI C;  5DNF A;  2A6H D;  1VQ7 A;  1EY7 A;  2CQA A;  3BVG A;  1DCZ A;  1X3E A;  5IGC A;  5C0X J;  1KNE A;  2PMZ B;  2Z9H A;  2NZH A;  4AQY L;  1XNQ L;  2D5D A;  1B3A A;  1AP0 A;  3GTP B;  4LF9 Q;  2L11 A;  3GTK H;  2MO1 A;  4X3U A;  3FHW A;  5C3E B;  1LTG D;  1JOQ A;  2PI2 E;  3X3M A;  5C4J B;  2MO0 A;  1BKB A;  3S1Q H;  1NR4 A;  4Y7N H;  3CCE A;  4X3K A;  1A6X A;  3F1Z A;  3HKZ B;  2CH4 A;  1PTO C;  2ZJR A;  5EPK A;  2F52 A;  3A8I E;  4X62 Q;  1YJW A;  1VQE A;  1EFW A;  4JI1 L;  4QUC A;  2D0O A;  2NVQ B;  3NQT A;  5M5W B;  2ASB A;  1HPC A;  1MJC A;  3ULP A;  4A3K G;  1QZH A;  1EQR A;  4LF4 Q;  2NVX B;  5CMD A;  1KLG D;  1RHP A;  1GUN A;  4XDX A;  1GM5 A;  3MXG A;  2D2C C;  4LF8 Q;  2E5L L;  1FL0 A;  1RTN A;  2F0P A;  2A6E D;  5I9O A;  1TS5 A;  1Y1V H;  4C3J H;  5LMN Q;  2MJ8 A;  3I91 A;  4RFB A;  1I50 H;  1VQA A;  4KI0 A;  4DR7 L;  4IOA A;  3GTL H;  1C0A A;  2R93 B;  1E2V A;  3CC4 A;  2R3Z A;  4XTC S;  3O13 A;  1WFQ A;  1VDZ A;  1IYJ B;  1ZXT A;  3GV6 A;  3KUP A;  1A2U A;  4DV5 Q;  5IT9 E;  5EBC A;  5KRU A;  4IFD G;  3PQI A;  2JN4 A;  1VQL A;  4A3F H;  2F0D A;  2L9H A;  4DUZ L;  2LXJ A;  1P8L A;  3KDF A;  1ILP A;  3L9A X;  4P74 A;  1SSO A;  4NXN L;  3I4N B;  2LKV A;  2M9V A;  2NBF A;  3HFZ B;  4M1U B;  2KCM A;  5ELD A;  2UXC Q;  2H1E A;  1K3R A;  1H9R A;  3R8B A;  2WB1 E;  4JI5 L;  5EQ0 A;  1KNA A;  1PHJ A;  4LW1 A;  3HOV B;  2EZV A;  2F0S A;  2JA7 H;  2K1B A;  2NTS A;  4LF5 Q;  4O42 A;  1Z7T A;  4J8Q A;  5KND A;  1JWU D;  4BWG B;  1N33 L;  3OMG A;  4HSV A;  3OYY A;  2F4I A;  3S1M B;  1GUT A;  5IYD G;  1GUS A;  2QF7 A;  5BR8 Q;  4CDD C;  3M4Q A;  5CV8 A;  2EDG A;  3ONA B;  3SXH A;  1D5M C;  4B08 A;  1PH4 A;  3Q22 A;  2IPK D;  1OO9 B;  4GNX A;  1PVO A;  1TU2 B;  4A3F G;  1XX8 A;  1R4Q B;  3BZC A;  2JA5 B;  1QNK A;  2VUM H;  1D2B A;  3PV0 A;  2KOL A;  2JA6 B;  3FKI H;  2B2Y C;  4BBR G;  2ZTE A;  4BXX G;  4UDU C;  4DNI A;  2A19 A;  2EY2 A;  2XWJ B;  4A3G H;  4CKC A;  5IGF A;  4JI1 Q;  1KD1 C;  2PQA A;  1D5Z C;  4AQY Q;  1Z6H A;  2PO4 A;  4O2D A;  4KD3 A;  1B44 D;  4RH6 A;  3WOF A;  1PH2 A;  1D8L A;  4LF9 L;  4JI2 Q;  1EY5 A;  2EYM A;  5IP7 G;  1SEB D;  2QA4 A;  2AUK A;  1EOV A;  3UDF A;  3NWT A;  5LHY 1;  4C2M B;  5AFW A;  2FFK B;  3H0G G;  1KIX A;  1SE8 A;  2UU9 Q;  2L0C A;  1I4P A;  1II3 A;  3C2P A;  1JMC A;  1B53 A;  2M2L A;  3CHB D;  3E5S A;  1JB3 A;  3HOZ H;  1MJE A;  1Q90 A;  1V1P A;  4KJN A;  4IN3 A;  4L5S A;  2PPB C;  1YNJ D;  1U5K A;  1J8I A;  1RD9 D;  2NYZ D;  1IBK L;  1WD0 A;  4JV5 L;  4JK1 C;  1FJG Q;  2UU9 L;  3TME A;  3S2H B;  2B39 A;  3AU7 A;  4APV A;  3D6W A;  5JJL A;  2ZXP A;  3V2T A;  1BBU A;  2ATW A;  1Q81 C;  4A3M B;  2NN6 H;  3KJP A;  4JCV E;  2K6A A;  1WI5 A;  2XWB B;  4HJ8 A;  1WTX A;  5JEA G;  2R92 H;  1O7I A;  1IBL Q;  2HHH Q;  1TXY A;  3I72 A;  4LF6 Q;  1LTS D;  1V43 A;  2LS0 1;  4XT3 B;  1K0S A;  3GV3 A;  2UUA L;  1A2T A;  3JAM c;  3D0F A;  2JA6 H;  4HAE A;  3NTH A;  3PUV A;  2XNA C;  2EY5 A;  4OO1 G;  5C44 G;  4QCL A;  4LAA A;  1BBX C;  4JG2 A;  1VQK A;  4JI7 L;  1I3Q H;  4RGM A;  1HNX Q;  2WII B;  1QB5 D;  3M7N A;  5JJZ A;  2EY6 A;  3DEP A;  3NP8 A;  1QVG A;  4I7A A;  5FO9 B;  3BZK A;  1HNZ Q;  3NBH A;  2UUC Q;  2F0K A;  2B63 H;  1TWH H;  1S5C D;  2B63 G;  1RIP A;  1IXR A;  2ZTC A;  3MHB A;  3I70 A;  5M3F H;  1XXG A;  1YNJ C;  2NZO A;  3QOL A;  1Y8P B;  3CRL C;  1KDA A;  3K8A A;  1IKL A;  2GN5 A;  4NP5 A;  1B7Y B;  4PNY A;  2KEN A;  4UAI A;  2BH8 A;  1JOK A;  4FXG C;  3I4N G;  5EAY A;  1ENA A;  4GN4 B;  4IUR A;  4BBS B;  5FLM H;  3GTG H;  4ZQ3 A;  4JYA L;  3R3O A;  4HJ7 A;  4KLK A;  1EZ8 A;  4DR6 L;  3AB9 A;  5M5X H;  5CC4 A;  5GAH C;  3KYH C;  1I50 B;  3CCS A;  4HSP A;  4IFD H;  1OXX K;  4LF7 L;  2NZ1 D;  3CME A;  4ZKC B;  3SR1 A;  2XGT A;  2EIF A;  2F0F A;  3TN2 A;  2KVM A;  1DOM A;  1T5E A;  5DEH A;  4ZAI A;  3JAM L;  1PH6 A;  3OHX C;  3CW2 C;  1HR0 W;  3HEJ A;  5A35 A;  5IGD A;  2DY8 A;  1E7Z A;  2BA0 A;  3CQZ B;  1G6P A;  3CAM A;  5JAV A;  4A3L H;  2K5H A;  5DM6 3;  4JBK A;  4K5W A;  2F0I A;  3HOX H;  2I07 B;  4IQZ A;  4KMU C;  3TS0 A;  5IY0 A;  3HOZ G;  2AQ3 B;  4JI4 L;  3C46 A;  2JJQ A;  2CH4 W;  2R61 A;  4KY6 A;  2F0H A;  5C0X G;  1TS3 A;  2MGS A;  2EPB A;  3RZD B;  1SNM A;  1X6O A;  5IGG A;  2I0Q A;  1PLF A;  3Q0A A;  1BBW A;  1ILQ A;  4ZUJ A;  5M3M B;  3TRZ A;  3MXU A;  4R4T A;  4P2C B;  4DK6 C;  4DXG A;  2JP1 A;  2HHH L;  4LF6 L;  3HGB A;  3D3R A;  3H09 A;  5FLX E;  5GAD C;  1FGU A;  3J80 i;  2B2U A;  4H13 C;  2Z1C A;  4A3G G;  2HQE A;  4X3S A;  4G7O C;  1WTP A;  1BQQ T;  3GTJ H;  4FF4 A;  3M9B A;  4ZRZ A;  1EFI D;  4KTA A;  3T1Y L;  1I4X A;  1B4O A;  1RKN A;  4KKS A;  4GS3 A;  4YWL A;  2FMC A;  1EY4 A;  2B2W C;  2AWN A;  5CBA E;  2J0T D;  2Z6B A;  4UY8 C;  4P71 A;  4QIW E;  3K7A H;  1D1K A;  2CW0 D;  1TVX A;  1AH9 A;  3PUW A;  4U68 A;  1U4P A;  3S1R B;  5D3D A;  3S15 B;  2HIV A;  1NMG A;  4IO9 A;  3S1N H;  3OIQ A;  4IOC A;  2K5D A;  4DGZ A;  3L3O C;  2QW7 A;  2NVX H;  4LFB Q;  4OON A;  1YI2 A;  3J7A V;  1M4V A;  4YCW A;  1XMQ L;  1FYC A;  3S14 B;  1H9K A;  4E6I A;  1XPU A;  3ERO A;  3Q6S A;  3T51 B;  1R9T H;  1UEA B;  2QDL A;  4YWM A;  5JVG 3;  4UPA A;  4DV6 L;  4FP5 D;  2I46 A;  1HZA A;  2RCF A;  1CSQ A;  1F9S A;  2R93 G;  1BUV T;  3P20 A;  5CYU A;  5JEA J;  4POG A;  4JOI A;  4DV7 Q;  1VF5 C;  2IX0 A;  1LTA D;  3HOY H;  5GQO A;  4PMC A;  2DNE A;  2UXD Q;  5EPL A;  3M4Y A;  2HDL A;  3NHH A;  1EY8 A;  2VL6 A;  2CWP A;  1BNZ A;  4HJ5 A;  5IOD A;  2WKD A;  1A3V A;  3PO3 B;  1OTC A;  1AEX A;  3NSW A;  4UP8 A;  5FKA C;  5M5X B;  4GOP A;  2MPM A;  4AYB G;  3I3C A;  2BH2 A;  4C1N K;  2JA7 B;  1LT6 D;  3VR6 A;  2WFW A;  2K52 A;  2MP1 A;  1W3S A;  1KDB A;  5CR3 A;  3WDN A;  1WTO A;  2A68 C;  3RZD H;  2KEE A;  1NAP A;  4RGT A;  3KLS A;  3SE0 A;  1VMP A;  1DM0 B;  1W2B A;  2IL8 A;  2Z4H A;  3CC2 A;  3M4O B;  5D3I B;  2H5X A;  4JBW A;  5ELB A;  3J80 c;  2R93 H;  4FNF A;  1N8R C;  3A7L A;  1B50 A;  1VF7 A;  3R93 A;  1F77 A;  2Q8R E;  1H9S B;  3EBE A;  3T4A C;  3UDI A;  4YHH Q;  1IZ6 A;  3K59 A;  1IW7 D;  1VQG A;  1LTI D;  4L63 B;  1FVI A;  3GTM H;  2KCT A;  3I56 A;  3RZO B;  3KLR A;  3G4S A;  1K8O A;  5CV4 A;  2A1A A;  1PRT F;  3F2B A;  3K0X A;  4DR7 Q;  2R6G A;  3E0E A;  4DN4 M;  3VYT A;  4BY1 B;  4DV7 L;  4DV2 L;  4JI0 L;  2LY7 A;  4RKL A;  1EOT A;  4LF4 L;  4BBS H;  5C44 H;  2B2Y A;  1IBL L;  3BZD B;  4FYD A;  1EQV A;  1L0X B;  4GOP B;  3CKI B;  2TSS A;  1Y1V G;  1XMQ Q;  4GN3 B;  3KFU A;  3QOJ A;  1E2W A;  5JPN C;  3S2D B;  1VQC A;  3D4W A;  1SMX A;  4DFA A;  1Y8N B;  2RHS B;  3D4R A;  3LGJ A;  4EVO A;  4PG3 A;  4MZ9 A;  3I90 A;  2I5H A;  1DGS A;  3HOU H;  1BCP F;  5I2Y A;  1LLR D;  2WAC A;  2X6G A;  4JI3 L;  5FJ8 G;  4IUN A;  4OX9 Q;  1YIT A;  1RDP D;  3QO2 A;  1QE6 A;  3MXN B;  3ZJY C;  4CDF C;  2O5I C;  3JAM i;  1PTO H;  1HZC A;  4R4O A;  3EQL C;  3ND9 A;  1PH9 A;  2A73 B;  1PMR A;  3TP8 A;  2DJG C;  4DR4 Q;  4BA2 I;  2RBM A;  1SYB A;  1CK1 A;  3DWA A;  2NTT A;  4QIW B;  3S1R H;  2OQ0 A;  1PFS A;  5I9P A;  1I4R A;  1MKH A;  4WJ3 M;  2A69 D;  1PFB A;  3KF6 A;  2PQE A;  2KBN A;  4A3M H;  5LL6 S;  4A3E H;  4A76 A;  2JA8 B;  2XVS A;  5D65 A;  1SLJ A;  1D6E C;  4ZUI A;  2JA5 H;  1RTO A;  4BXX H;  2N8N A;  2UUB Q;  1STE A;  2K5N A;  4C3H B;  2E8G A;  2VUM G;  5E3F A;  2J7Z A;  3EFX D;  1SR3 A;  4DXF A;  3SEB A;  3DWP A;  1PTO F;  4K8J A;  3G6E A;  1K9M C;  5IYC H;  3BYT B;  1O7Z A;  3PO2 G;  1LTR D;  4RGO S;  4HJA A;  3K5O A;  3KF8 B;  3PUZ A;  5IWA Q;  4H02 A;  4RKB A;  1EL0 A;  4R4C A;  4JI5 Q;  1EYA A;  1JWS D;  1CI3 M;  1Q8I A;  1VQO A;  3RN5 A;  3T56 B;  1CSP A;  3DHQ A;  1ENC A;  5C0X I;  3H0G H;  2SNS A;  2R7F A;  4I7Z C;  1IYU A;  1K3B C;  3NEM A;  5K5P A;  3NTK A;  3K5L A;  2IX1 A;  4KV6 A;  1PYB A;  1NJI C;  4HJ9 A;  2F0J A;  1F2Z A;  1N36 Q;  5GRO A;  3DLL A;  1HXY D;  4BBS G;  3U9S A;  4EX5 A;  4MTN A;  5IIF A;  1PH7 A;  1CKO A;  5C4X B;  3BVM A;  1LM0 A;  5LMU Q;  1NTG A;  2N3S A;  4ZLT F;  5IOC A;  1UE7 A;  4J6H A;  2O2L D;  4ALP A;  4C3J G;  2KHS A;  3CF5 A;  1E1O A;  1TWG H;  1A15 A;  1Y8O B;  1B2T A;  1F2M A;  1VCI A;  2BDN A;  1GVP A;  4DR1 Q;  1CA6 A;  5CV7 A;  2L55 A;  4DK3 C;  1X3G A;  3J81 E;  5FLX L;  4RWS C;  1XMO L;  4XQN A;  2EYH A;  2EYF A;  1V1Q A;  3DEO A;  3NPP A;  1PYS B;  1PDQ A;  3W5O A;  1YJN A;  4DV6 Q;  1ASY A;  3H0G B;  3LWU A;  1PH1 A;  1SYF A;  3NBH B;  2B2T A;  2H4O A;  2AQ2 B;  4H44 C;  3G6J B;  1PXU A;  1N34 Q;  1GJX A;  3E0J A;  5DLQ E;  3TQY A;  5T1I A;  4A4I A;  4NW2 A;  4A3B H;  1T9H A;  2VQE Q;  3KK7 A;  4A93 G;  1ONL A;  2V1C C;  4XIG S;  5C3E H;  4K6D A;  5KNB A;  1MHW C;  3U9O A;  3G48 A;  3RLN A;  2F0V A;  5COR A;  1WTR A;  2VS1 A;  4DAV A;  1V8Q A;  1QG7 A;  4A3C H;  1Y1V B;  2OTJ A;  4C3H H;  1H9M A;  3CXC A;  3FKI G;  1STG A;  3HKS A;  1EYG A;  1IHZ A;  2HDM A;  3OTO Q;  1G51 A;  1ROD A;  3FPP A;  5HY6 A;  1HFG A;  1JOR A;  2YV5 A;  4RCO A;  4G7Z C;  3OWE B;  3TP6 A;  4JBM A;  4A93 H;  2CQO A;  4OL7 A;  5CGK A;  1ICW A;  4HMJ A;  4OWX B;  3S14 H;  2QEJ C;  2ALY B;  1NBW A;  5HGT A;  2RDH A;  1DOL A;  4X64 L;  4A3K H;  3SK8 A;  3X3N A;  5IGB A;  1ZYR D;  1HQM C;  3HOW H;  4XXE A;  1NNX A;  1G29 1;  1D1I A;  3H6M A;  4Q0F A;  4FVM A;  2RF4 A;  5EGT A;  3C1F A;  1HNW L;  3S1M H;  1I4Q A;  3IAY A;  3DM1 A;  1SYE A;  2WB1 G;  3QJY A;  1STB A;  2TMP A;  2E74 C;  2Z6K A;  1C4Q A;  3CP0 A;  3FPU B;  1X3F A;  4B3S L;  1JT8 A;  5EBD A;  2A69 C;  1KRS A;  1ENF A;  1K83 H;  4C56 C;  5HGQ A;  3I4M G;  1QWY A;  4LUZ A;  1O7Y A;  2B2V C;  3E9I A;  4JI8 Q;  4DR2 Q;  1OXT A;  4KKU A;  3P75 A;  4R1J A;  2E2I B;  4A3B B;  1Z9F A;  1WTW A;  3I55 A;  4JW0 A;  1GKH A;  2V4D A;  4IPC A;  3RLO A;  3BJU A;  1XPR A;  3L7Z C;  1TWA H;  3PO2 B;  1S3O A;  4LMQ D;  1W6J A;  1WYD A;  1FJG L;  4QQB X;  2VUM B;  1G91 A;  5KYL A;  4HR7 B;  2QCP X;  4PMB A;  1VQ8 A;  4PZ8 A;  1AE3 A;  1TWH B;  1KQS A;  1WTH A;  3VDY A;  4K5V A;  1VQP A;  4ABN A;  1HZB A;  4DUZ Q;  3NXW A;  1XYI A;  1S5D D;  4QJF A;  3TP5 A;  2K03 A;  4QF4 A;  2B3G A;  3A5Z B;  1TWF B;  4JI2 L;  5IYD H;  1AW7 A;  3F2U A;  4WFN 3;  2RSO A;  1EWC A;  3RN2 A;  4YY3 L;  2J4X A;  2WP8 J;  3FVQ A;  3JAM E;  1GO3 E;  1EQQ A;  1MSG A;  4A3D H;  4IPD A;  4A3L G;  1OXS C;  4A3I H;  3K7U C;  4DR3 Q;  1ZYR C;  2BCO A;  3GTO B;  4ZK9 B;  1LAC A;  4HCS A;  1VQ9 A;  5KNC A;  1CZW A;  3PMF A;  4KN7 C;  4DF7 A;  5M3M G;  2YTY A;  4LK1 C;  5EKK A;  1NCV A;  4FDB A;  3PF5 A;  5EKI A;  2CWA A;  4QUF A;  4WRD A;  2JK8 A;  2GVB A;  4IZ8 A;  4OHJ A;  1SFO B;  3QWN A;  2B8G A;  3OMC A;  1K8M A;  2YTV A;  5F2D A;  4NKL A;  4J1M A;  1YNX A;  2CW0 C;  4TSS A;  2NVY H;  3NQI A;  3PIO 3;  5ELN A;  4CHT B;  4YY3 Q;  3KF8 A;  5I4D A;  2A5H A;  4DK1 A;  4BY1 G;  2XRQ D;  5JPM C;  4YHH L;  1BR9 A;  1Q1E A;  1O80 A;  1WCM B;  1PFN A;  2IT1 A;  4P75 A;  1LT3 D;  2B29 A;  3A0J A;  4K14 A;  3HOY G;  1C7Y A;  1Y14 B;  1ESF A;  4BS9 A;  3S17 B;  5T1G A;  3LWE A;  3K5M A;  1X55 A;  4A3E B;  2ZM6 L;  2AMC B;  2K05 A;  2R7Z B;  2ICE C;  1CT1 D;  1F2Y A;  3RLF A;  3TZU A;  1E3P A;  1I4H A;  1PH5 A;  3MTS A;  2E2H H;  2R92 B;  2XSC A;  3DWQ A;  3CCQ A;  1CA5 A;  5KEE A;  3HOW B;  5DAU A;  1I4G A;  3DUZ A;  3N52 A;  1HA6 A;  3KF6 B;  1SRU A;  4C3I B;  4LFA L;  5IGE A;  2E2J B;  3D31 A;  2FJ2 A;  5C4Z A;  4M8A A;  4LWC A;  1P16 A;  4L8J A;  1N32 Q;  1ZEQ X;  4B3S Q;  2PZW A;  1EU3 A;  3PIP A;  5LMN L;  2ENB A;  1K28 A;  2IY5 B;  3GTK B;  1EIF A;  2JA5 G;  5C3W A;  1YBY A;  2OXP A;  4GKK Q;  4OO1 H;  4JBJ A;  3H91 A;  3AFQ A;  4A3J G;  4CDE C;  2UUB L;  2JA6 G;  2FXQ A;  5IP9 G;  4K8I A;  2C35 B;  1NSN S;  4R4I A;  2BA1 A;  1SDF A;  3OPO A;  3KBG A;  3A8J E;  3PO3 G;  4CJ0 B;  4BBR H;  1QCB D;  2K5W A;  4OWW B;  3ULJ A;  1L0Y B;  4U67 3;  2L12 A;  4A3J H;  4B3M Q;  4NXM Q;  2CFM A;  5FK9 C;  1LAB A;  4DAM A;  2EQS A;  1HUM A;  1GXD C;  3J81 i;  5M5Y B;  3M3Y H;  2PQA B;  5M3M H;  1SYG A;  3PSI A;  1EQT A;  1AN8 A; 
#chains in the Genus database with same CATH homology
 3CCE A;  4DV7 L;  4DV2 L;  3I2Z A;  3F1Z A;  2JA8 H;  4JI0 L;  4LF4 L;  3I7F A;  2ZJR A;  3RNU A;  4BBS H;  2F52 A;  4X62 Q;  5C44 H;  2L15 A;  4RG1 A;  1YJW A;  1IBL L;  1XTD A;  1VQE A;  1EFW A;  4JI1 L;  1N36 L;  2NVQ H;  4GOP B;  4IJH A;  4QGU A;  1VQJ A;  1Y1V G;  1XMQ Q;  4GN3 B;  2D0O A;  1YVC A;  3KFU A;  2ASB A;  3GTO H;  1L1O B;  2VQF Q;  1MJC A;  5FLM G;  3ULP A;  4A3K G;  1QZH A;  1VQC A;  1EQR A;  4LF4 Q;  2VQF L;  4DR5 L;  1GD7 A;  1SMX A;  4JI6 L;  2RHS B;  3LGJ A;  4DKA C;  4LF8 L;  4PG3 A;  5IE8 A;  3GO5 A;  1GM5 A;  4MZ9 A;  1Q1B A;  2E5L L;  4LF8 Q;  1FL0 A;  1I5F A;  4JC0 A;  2I5H A;  2RHQ B;  1DGS A;  3HOU H;  1L1O C;  3J81 j;  4BY7 G;  1Y1V H;  5ELO A;  3J81 c;  1J5E L;  1UEB A;  4C3J H;  5LMN Q;  4JI3 L;  3SGI A;  5FJ8 G;  5J3B A;  4OX9 Q;  1YIT A;  1I50 H;  1VQA A;  4KI0 A;  4DR7 L;  4IOA A;  3GTL H;  1C0A A;  1LTL A;  3CC4 A;  1YIJ A;  4XTC S;  1WFQ A;  3MXN B;  1IYJ B;  3ZJY C;  4DV5 Q;  3JAM i;  4IFD G;  1HZC A;  4QL5 A;  4R4O A;  1S40 A;  3T1H L;  1VQL A;  2F3I A;  3CCV A;  4A3F H;  1PH9 A;  1JJC B;  2VY3 A;  2Z6K C;  3UE1 A;  2JA8 G;  4DUZ L;  2LXJ A;  1P8L A;  4TVA B;  3KDF A;  4DR4 Q;  4BA2 I;  4LFC L;  4P74 A;  4NXN L;  2Z0S A;  4JOI C;  1X54 A;  3HFZ B;  2KCM A;  4DR1 L;  2UXC Q;  3I4N H;  1QUQ A;  2K50 A;  5LMN W;  1K3R A;  3S1R H;  2WB1 E;  2OQ0 A;  4JI5 L;  1QVC A;  1WJJ A;  1PFS A;  3EIV A;  4YCV A;  4EQ5 A;  1PHJ A;  1XNR L;  2Q2T A;  1MKH A;  4LW1 A;  3CPF A;  4WJ3 M;  2WAQ E;  3TEH B;  3KF6 A;  2KBN A;  3U58 A;  4A3M H;  4A3E H;  4A76 A;  2JA7 H;  2ZTD A;  3BU2 A;  4DV0 Q;  4GOP C;  4LF5 Q;  1SLJ A;  4L5T A;  4NPS A;  2JA5 H;  2AKW B;  4BXX H;  2LSS A;  1SN8 A;  2N8N A;  2UUB Q;  2GVA A;  2K5N A;  1N33 L;  1WOC A;  5AJ3 Q;  2HQL A;  3OYY A;  3L2P A;  1KAW A;  4HIO A;  4A75 A;  2E8G A;  2VUM G;  3CPW A;  5IYD G;  5BR8 Q;  1Y1W H;  3OTO L;  3M4Q A;  2AWO A;  1PV4 A;  4NB3 A;  3IRB A;  1SR3 A;  2OWO A;  1PH4 A;  2QEX A;  2VZA A;  3G6E A;  1K9M C;  5IYC H;  4GNX A;  1I94 L;  3PO2 G;  1PVO A;  3PIO A;  4A3F G;  1MIU A;  4HJA A;  3KF8 B;  3PUZ A;  3BZC A;  5IWA Q;  1X9N A;  2PMZ E;  2OTL A;  4H02 A;  4R4C A;  4PMW A;  2VUM H;  3PV0 A;  4JI5 Q;  1Q7Y C;  3A74 A;  4A3E G;  3FKI H;  3A5U A;  1VQO A;  3RN5 A;  4KHP L;  1UE6 A;  1CSP A;  4BBR G;  3HOU G;  2ZTE A;  1XJV A;  4BXX G;  4GLV B;  5C0X I;  3H0G H;  4JI0 Q;  4DNI A;  2A19 A;  1B8A A;  2MNA A;  1KRT A;  1QZG A;  1VQB A;  3NEN A;  1IL2 A;  4A3C G;  2R7F A;  1EIY B;  1RL2 A;  4A3G H;  4JI1 Q;  3T1H Q;  4DV3 L;  2DUD A;  3NEM A;  1KD1 C;  2PQA A;  4AQY Q;  4C3I H;  3HKZ E;  1CKN A;  4O2D A;  2IX1 A;  2K4K A;  1PYB A;  3PUX A;  3J7Z C;  4LFC Q;  1PH2 A;  1NJI C;  1D8L A;  4LF9 L;  4HJ9 A;  1E1T A;  4OXP A;  4JI2 Q;  5IP7 G;  3GTP H;  2QA4 A;  4LF7 Q;  1EOV A;  3UDF A;  4X66 Q;  2K14 A;  1N36 Q;  5GRO A;  3DLL A;  2F4V Q;  3H0G G;  1YHA A;  3L0O A;  4BA1 I;  2CCZ A;  4JI4 Q;  1KIX A;  5C4X H;  4BBS G;  1SE8 A;  2E2I H;  4KHP Q;  2UU9 Q;  4EX5 A;  4MTN A;  3HOW G;  1PH7 A;  1CKO A;  1K0R A;  1JMC A;  1KXL A;  3STB D;  3HOZ H;  1LM0 A;  5LMU Q;  1NTG A;  1MJE A;  3W1B A;  2N3S A;  4AIM A;  1UE7 A;  4L5S A;  3PUY A;  4X66 L;  3GD7 A;  4ALP A;  1U5K A;  1IBK L;  2JEA I;  4JV5 L;  1WCM H;  3CF5 A;  1E1O A;  1TWG H;  4IPG A;  1FJG Q;  2UU9 L;  1VCI A;  2LXK A;  1GVP A;  2EXD A;  3CMA A;  4DR1 Q;  2UUA Q;  1N33 Q;  4JV5 Q;  4K0K L;  2UXC L;  4APV A;  4DK3 C;  2MQH A;  5JJL A;  1X3G A;  1BBU A;  3I4M H;  4BY7 H;  2ATW A;  1VQD A;  1HJP A;  1XMO L;  2Q2U A;  1VQM A;  3H3V I;  1Q81 C;  3KJP A;  4JCV E;  5AJ3 L;  1Q86 C;  1WI5 A;  3B6Y A;  1V1Q A;  5IP9 H;  5M5W H;  4HJ8 A;  5GAG C;  1PYS B;  5JEA G;  4BY1 H;  4QY7 A;  4GLA C;  3W5O A;  2NVT H;  2R92 H;  1YJN A;  4DV6 Q;  3AYH B;  1ASY A;  4GKJ Q;  1O7I A;  1IBL Q;  1KHI A;  1TXY A;  1PH1 A;  2E2J H;  2HHH Q;  1V43 A;  4UP7 A;  4LF6 Q;  1HZ9 A;  2UUA L;  4K0K Q;  3NBH B;  1HNZ L;  2UUC L;  3JAM c;  3PO2 H;  3D0F A;  3M85 A;  2JA6 H;  4IJL A;  3PUV A;  1NMF A;  1N34 Q;  1VQ6 A;  2UXD L;  5C4X G;  4OWT B;  4OO1 G;  4PZ7 A;  4GN5 A;  1M1K C;  3PGZ A;  5H1S E;  5C44 G;  2JA9 A;  3TS2 A;  4A3B G;  4LNQ A;  5DLQ E;  3TQY A;  1Z47 A;  4L5Q A;  1VQI A;  4JG2 A;  4A4I A;  4OX9 L;  1VQK A;  4JI7 L;  4A3B H;  4ME3 A;  1T9H A;  1I3Q H;  4DAY B;  2VQE Q;  4X6A H;  4A93 G;  1HNX Q;  1J6Q A;  2V1C C;  1I94 Q;  4XIG S;  5C3E H;  3M7N A;  2XTI A;  4KHZ A;  1HNX L;  3RZO H;  3G71 A;  3U4V A;  3U4Z A;  2YTX A;  3PCO B;  4B3M L;  3G48 A;  4UP9 A;  1QVG A;  5IWA L;  2UXB Q;  3RLN A;  1S72 A;  2VS1 A;  4YWK A;  4A3C H;  4P73 A;  4GNX C;  3BZK A;  2OTJ A;  1HNZ Q;  2UUC Q;  2OQK A;  2B63 H;  4C3H H;  1TWF H;  1TWH H;  3ERS X;  2MFI A;  3CXC A;  4NXM L;  3CCL A;  4IPH A;  2B63 G;  3FKI G;  1IBM L;  3HKS A;  3H3V H;  1EYG A;  1RIP A;  1CKM A;  5E7N A;  2ZTC A;  1IXR A;  3OTO Q;  4A3D G;  5M3F H;  1G51 A;  3CC7 A;  2K5V A;  4GKK L;  5HY6 A;  4B3T Q;  2ID0 A;  1UE1 A;  4HIM A;  1XPO A;  2YV5 A;  3W1G A;  2NZO A;  4X64 Q;  2YU9 H;  4DR3 L;  3M4O H;  1I6H H;  1A63 A;  3K8A A;  1L0W A;  2GN5 A;  3STB C;  4JBM A;  4DR4 L;  1B7Y B;  2KEN A;  1HR0 Q;  4A93 H;  2BH8 A;  2CQO A;  3CCU A;  1HR0 L;  4OWX B;  3S14 H;  1X65 A;  2ALY B;  3I4N G;  5EAY A;  2JEB I;  1L2F A;  1NBW A;  4GN4 B;  4LFB L;  4X64 L;  5FLM H;  4A3K H;  3GTG H;  2KHI A;  1PH3 A;  4AH6 A;  4JYA L;  2VNU D;  4HJ7 A;  4KLK A;  3HOW H;  4DR6 L;  5M5X H;  5GAH C;  3KYH C;  3CCS A;  1G29 1;  3ULL A;  4LFA Q;  1OXX K;  4LF7 L;  3CME A;  2RF4 A;  4X62 L;  4JI3 Q;  2ZM6 Q;  1HNW L;  3UDX A;  3S1M H;  1Q82 C;  2XGT A;  2ZJQ A;  2EIF A;  3CCR A;  2WB1 G;  1VS0 A;  3PF4 A;  3MEF A;  5IYB H;  1PH6 A;  2Z6K A;  3AQQ A;  3CQZ H;  4B3R Q;  3CP0 A;  1VQN A;  1X3F A;  3CW2 C;  2A8V A;  4B3S L;  1HR0 W;  4L5R C;  2DGY A;  1JT8 A;  3HOX G;  1E7Z A;  1KRS A;  2BA0 A;  1NE3 A;  5LMU L;  2R92 G;  1K83 H;  4LF5 L;  2N78 A;  2PNH A;  5HGQ A;  4LUZ A;  3I4M G;  3CAM A;  1G6P A;  4JI8 Q;  3E9I A;  2Y0S G;  4JYA Q;  1E24 A;  4A3L H;  5M3F G;  4DR2 Q;  1CKN B;  1OXT A;  4R1J A;  2I5M X;  3H15 A;  1Z9F A;  2K5H A;  3I55 A;  1XNQ Q;  3AEV A;  1UWV A;  1GKH A;  4IFD J;  5IYB G;  3M4P A;  1PH8 A;  4IPC A;  4JBK A;  3S16 H;  5JJK A;  1Q12 A;  3RLO A;  3BJU A;  1XPR A;  3CD6 A;  3L7Z C;  1K8G A;  1KL9 A;  3HOX H;  1TWA H;  3KOJ A;  4DUY L;  1S3O A;  4HIK A;  2VQE L;  3TS0 A;  2HT1 A;  1H95 A;  1WYD A;  5IY0 A;  3HOV H;  4JI4 L;  1FJG L;  3HOZ G;  3S2D H;  2JJQ A;  1N9W A;  5C0X G;  1SFO H;  2IHE A;  3EN2 A;  4QQB X;  5K36 G;  4J15 A;  1X6O A;  2I0Q A;  1LYL A;  2UXB L;  1V9P A;  1BBW A;  5C4J H;  1UE5 A;  1VQ8 A;  3TRZ A;  4PZ8 A;  1AE3 A;  2RCN A;  4R4T A;  5FJ8 H;  4DK6 C;  3UDG A;  1KQS A;  4DR2 L;  2HHH L;  5GAE C;  3VDY A;  4LF6 L;  1VQP A;  4O0A A;  1EWI A;  5GAD C;  1HZB A;  3S17 H;  3KJO A;  4RMF A;  4DUZ Q;  1FGU A;  2K75 A;  3J80 i;  1CUK A;  4DV1 Q;  3CCM A;  1E22 A;  4P72 A;  4QJF A;  1QVF A;  3J7A 5;  1B70 B;  3F2C A;  3S2H H;  2B3G A;  3A5Z B;  5IP7 H;  1YHQ A;  5M5Y H;  4JI2 L;  1NY4 A;  2R7Z H;  3PO3 H;  1BVS A;  4WJ4 A;  5IYD H;  2N49 A;  1JE5 A;  4A3G G;  1YJ9 A;  2CKZ B;  1XMO Q;  2AHO B;  2D0P A;  3GTJ H;  3M9B A;  2E5L Q;  2QGQ A;  3RN2 A;  4YY3 L;  1VQF A;  4C2M H;  4DV4 L;  3T1Y L;  2WP8 J;  3HOV G;  1N32 L;  4DV1 L;  1M90 C;  4R4Q A;  1GO3 E;  4GS3 A;  4YWL A;  1EQQ A;  1J5E Q;  4IPD A;  4A3L G;  1OXS C;  4A3D H;  2AWN A;  4A3I H;  4DPG A;  3GDE A;  4UY8 C;  3K7U C;  4P71 A;  3ER0 A;  4QIW E;  2ZJP A;  4DR3 Q;  1K73 C;  3K7A H;  4HID A;  4NXN Q;  1A62 A;  1VQ9 A;  1AH9 A;  3PUW A;  3S24 A;  2JE6 I;  4PZ6 A;  1YHB A;  4TQU S;  1A0I A;  2HIV A;  1NMG A;  4IO9 A;  3S1N H;  5M3M G;  4IOC A;  4DR5 Q;  2YTY A;  2NVX H;  2PI2 A;  3CCJ A;  4OON A;  3TRE A;  1YI2 A;  4IFD I;  4LFB Q;  4FDB A;  3PF5 A;  4YCW A;  3S15 H;  1TWC H;  3K80 C;  1XMQ L;  1X56 A;  2CWA A;  2D62 A;  2JK8 A;  4DR6 Q;  2OCE A;  1WCM G;  2I5L X;  2R7D A;  2GVB A;  2IHF A;  1XPU A;  4POF A;  3ICE A;  4X65 Q;  1Y1W G;  1R9T H;  2HIX A;  4YWM A;  1A8V A;  2JQO A;  2YTV A;  4X65 L;  4UPA A;  4JI8 L;  4DV3 Q;  4DV6 L;  2YYZ A;  3I4O A;  1YNX A;  3OW2 A;  1XNR Q;  2Y0S E;  1HZA A;  1CSQ A;  2NVY H;  3DM3 A;  5ELN A;  4YY3 Q;  2NN6 G;  4DV4 Q;  1VQ5 A;  2R93 G;  1LUZ A;  4DV5 L;  3GTQ H;  4BY1 G;  4GLX A;  5JEA J;  4YHH L;  3U50 C;  3F2D A;  4GNX B;  1Q1E A;  4POG A;  1JJ2 A;  2IT1 A;  4JOI A;  4P75 A;  4DV7 Q;  2B29 A;  3A0J A;  3HOY G;  4MNO A;  1C7Y A;  1Y14 B;  2IX0 A;  2WAQ G;  3HOY H;  5GQO A;  2ES2 A;  1YZ6 A;  1N34 L;  3F8T A;  3KLW A;  2UXD Q;  4DV0 L;  4AYB E;  1EUJ A;  1Q46 A;  1X55 A;  2CWP A;  2VL6 A;  4HJ5 A;  4Y52 H;  1PA6 A;  1K8A C;  2ZM6 L;  1HNW Q;  2AMC B;  1OXU A;  5JJI A;  1C9O A;  3NEL A;  1HH2 P;  1L1O A;  1OTC A;  2F4V L;  1VQH A;  4UP8 A;  3RLF A;  2E2H H;  1E3P A;  1PH5 A;  4GOP A;  4AYB G;  1KC8 C;  3CCQ A;  5IYC G;  5FLX c;  2BH2 A;  1JJG A;  5C3E G;  1IBM Q;  3KF6 B;  4JI7 Q;  2WFW A;  2K52 A;  3E9H A;  1SRU A;  3RR5 A;  4LFA L;  1W3S A;  3D31 A;  2VW9 A;  4LUO A;  4DV2 Q;  1Q8K A;  3FP9 A;  3JC6 6;  3RZD H;  4OO1 I;  5IT9 c;  4LWC A;  3HKZ G;  1P16 A;  1N32 Q;  2Q2H A;  4LUV A;  3UE0 A;  1OXV A;  1QUQ B;  1W2B A;  4B3S Q;  1D7Q A;  3PIP A;  5LMN L;  3CC2 A;  5BR8 L;  1ASZ A;  3K81 C;  4DUY Q;  2IY5 B;  1EIF A;  2H5X A;  4JBW A;  4A3I G;  1YBY A;  1VQ4 A;  2JA5 G;  4GKK Q;  3KDF B;  4GKJ L;  3J80 c;  1SRO A;  3AFP A;  1IBK Q;  3Q8D A;  4JBJ A;  2R93 H;  2JA6 G;  3AFQ A;  4A3J G;  1N8R C;  2UUB L;  2Q2I A;  2JA7 G;  2FXQ A;  3T1Y Q;  5IP9 G;  4A3M G;  4YCU A;  2C35 B;  4R4I A;  2BA1 A;  2NN6 I;  1VQ7 A;  1JB7 A;  3EBE A;  4JI6 Q;  3UDI A;  1X3E A;  4YHH Q;  5C0X J;  4B3T L;  3WWV A;  2R7Z G;  1IZ6 A;  3PO3 G;  1YEZ A;  2NZH A;  4BBR H;  4AQY L;  1VQG A;  4OWW B;  1XNQ L;  3ULJ A;  1FVI A;  2KHJ A;  3GTM H;  4A3J H;  2KCT A;  4B3M Q;  4NXM Q;  2CFM A;  4B3R L;  4LF9 Q;  1U0L A;  4DAM A;  3I56 A;  3GTK H;  2MO1 A;  3FHW A;  3G4S A;  2EQS A;  2A1A A;  3J81 i;  3F2B A;  3M3Y H;  2PI2 E;  2PQA B;  5M3M H;  3PSI A;  2MO0 A;  3K0X A;  1AE2 A;  1BKB A;  2R6G A;  3E0E A;  3S1Q H;  4DR7 Q;  4Y7N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...