3PF5A

Crystal structure of bs-cspb in complex with ru6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/rna
total genus 11
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pf5A00
3CMEA 1I94Q 2VW9A 1IZ6A 2I5LX 3TEHB 4O0AA 2R92G 1YNXA 3GTGH 3ER0A 2HIVA 1IBLQ 4B3SL 1FL0A 4KHZA 3I55A 5C4XH 4GKJL 4BA1I 1PA6A 4JBJA 1NTGA 1SE8A 2I5HA 1I94L 3JC66 1PH9A 1J5EQ 4JBKA 4OO1I 3KF6A 1SRUA 5IE8A 4C3JH 3M4PA 2KCMA 2VS1A 4GLXA 1VQNA 2R92H 4OWTB 2PQAB 3NBHB 2RHSB 1IBLL 4LFBL 1X3FA 4C3HH 1X3EA 2Y0SG 5M3FG 4GNXA 3A5ZB 3UDXA 4HJAA 1EFWA 4A3IG 4NPSA 5GAHC 2UUCQ 3HOUH 1J5EL 1VQ8A 1WI5A 3TRZA 2K5HA 3K8AA 4MTNA 1IBKQ 3STBC 4DV6Q 1X6OA 1G291 5IY0A 4A3MH 4LUZA 4GOPC 1QUQB 1X56A 1MIUA 2JA5H 3GTOH 1TWCH 2I5MX 4JI4Q 2UUCL 4B3ML 1UE5A 5EAYA 3S24A 3UE1A 1QZHA 4A3IH 4BBRG 5C44G 4JI3L 4LF9Q 4APVA 1IBKL 2OQKA 4DV6L 3M3YH 2MO1A 3CAMA 1HNXL 4A3GG 3D31A 5J3BA 3CCSA 1VQMA 4P75A 3I56A 2WB1G 1GD7A 2CWAA 3TQYA 3E9IA 2K50A 3MEFA 5IP7H 3VDYA 2PMZE 1N36L 1VQCA 2ES2A 3KF6B 2Q2IA 4NB3A 1GO3E 3UDGA 2E2IH 4IFDG 4YWLA 1NMFA 1Z9FA 2YTYA 4LF9L 2Z0SA 1KRTA 4GNXB 1NMGA 1BVSA 2A19A 4DR6Q 5JEAJ 3CCLA 3CC7A 1JJGA 1PH3A 4PZ7A 4X64L 4GKKL 1IXRA 4A3BG 4A3CH 4YHHQ 1YHAA 2Q2TA 3W5OA 1YJNA 4JI0Q 5M5YH 4DR6L 1W3SA 5FLXc 4RMFA 4YY3Q 4PMWA 1HNZL 4GN5A 1LYLA 4NXNL 3HKSA 3PO2H 1EOVA 3PF5A 3S2HH 1N33Q 2N8NA 4A93G 5ELNA 3GTJH 1V1QA 4XTCS 4YHHL 5LMNQ 3J80c 1VQPA 3J7A5 2N49A 2UXCL 4JI2Q 3TS0A 4YY3L 4JG2A 4BBSH 4FDBA 1WFQA 4LF6L 4XIGS 1X65A 3PGZA 2AKWB 3RR5A 3HKZE 1B70B 3STBD 4LF5L 3GTKH 1HZAA 5AJ3Q 1YBYA 3JAMc 2EIFA 4X62Q 4OO1G 1HZCA 4JI8Q 1RIPA 2N3SA 2C35B 2IT1A 3B6YA 1K3RA 5M3MH 1LM0A 5FLMH 2ZTEA 1M90C 3KJOA 2YV5A 5AJ3L 4OX9L 1WOCA 3S1MH 1I6HH 3CQZH 1Y1WH 2NN6I 4DV0L 2DUDA 1UE7A 1Q8KA 1RL2A 3HOVG 1SN8A 4JOIA 5C3EH 1S3OA 2PI2E 3NEMA 3D0FA 1P8LA 1WCMH 1EIFA 4R4TA 5GAEC 4AYBG 2IX1A 1VCIA 3GTMH 4A3FH 4P72A 3CCRA 2IX0A 3GTQH 3HOZH 1QZGA 4LWCA 1PH8A 1A0IA 1QVCA 3T1HL 3PSIA 2K4KA 1UEBA 4DUZQ 4HJ8A 4YCVA 1OXUA 4IPDA 4X66L 3H3VI 2PI2A 3HOWG 2NZOA 2KENA 1X54A 3PUYA 1S72A 4PZ6A 4A3KH 2VNUD 1K9MC 2E8GA 3I4MG 1O7IA 4A3DH 1HJPA 3M4QA 4BY1G 1A8VA 4DUZL 3UE0A 2VL6A 1VQFA 1GKHA 2K52A 4IOCA 1YIJA 4B3SQ 3S15H 4DR4Q 2UUBQ 3S2DH 4DNIA 4JI1Q 4GKJQ 3AYHB 5HY6A 1QVGA 3HOWH 5IP9H 2R93G 3GTPH 1PYBA 3G48A 1OXTA 1VQJA 3IRBA 1TWFH 1KAWA 3Q8DA 4DK6C 1AE3A 2AMCB 4BY1H 4LFBQ 1FJGL 4DR4L 4DPGA 1E1TA 1UE6A 2UUBL 5JJKA 5JJLA 4JI1L 3WWVA 3I2ZA 2YTXA 2JQOA 4P74A 1CKMA 5GADC 4LF7Q 3FP9A 1C9OA 3ZJYC 3I4NG 3F2CA 1E3PA 3L0OA 4L5RC 4ALPA 4IJLA 1Y1VG 4DV3L 2YU9H 1I3QH 5C4JH 1KRSA 4PZ8A 2VQFQ 1QVFA 2WP8J 1WJJA 2IHEA 2B3GA 2WFWA 1N32L 4LF7L 1BKBA 1Y14B 2ZJRA 3H0GG 5IYBG 1PHJA 4IOAA 4B3MQ 1YHQA 4DK3C 4JI3Q 1MJEA 1MKHA 4HJ5A 3OYYA 4UP9A 2K75A 2VUMG 3E9HA 1HNXQ 4DV2Q 3M9BA 1UWVA 3H15A 2VQFL 1YJWA 3HOXG 1WYDA 4L5TA 3ULLA 1D8LA 1X9NA 1IBMQ 3S1NH 5LMUL 1N36Q 3S16H 5M3FH 5C0XI 4A3JG 3CMAA 1NY4A 2B29A 2MO0A 1P16A 5IYDG 2OTJA 4JOIC 1U5KA 1KQSA 2RF4A 2Y0SE 1Q46A 4GLVB 1VQDA 4DV2L 4DV7Q 2OCEA 2R7ZG 5BR8Q 4LUOA 1IBML 3HOXH 4OONA 2KCTA 1Z47A 3U58A 1XTDA 2RHQB 4L5SA 1V43A 3A0JA 2I0QA 4X64Q 1M1KC 1XMQL 3PUZA 1VQGA 2BH2A 4GKKQ 4BBRH 5C44H 4QGUA 3CXCA 4DV7L 5DLQE 4GN3B 4IPCA 5BR8L 4A3GH 5C0XJ 2KBNA 1CKOA 3OTOL 3F1ZA 2ZJPA 1HNZQ 1NE3A 4JBMA 1K83H 4GN4B 4NXNQ 1JT8A 2JA9A 1IYJB 1J6QA 4EX5A 4AQYQ 3PO3G 1BBUA 1K8GA 3LGJA 4R1JA 2UXCQ 4JI5L 3CCMA 3M85A 3U4VA 1L1OC 1OXSC 1KHIA 1VQAA 4H02A 2VQEL 5M5WH 4X6AH 3J81j 1K8AC 2MFIA 4YWMA 1PH2A 4A3EG 2DGYA 4LF6Q 4QJFA 2WAQG 4AQYL 4A3BH 1G6PA 1Q7YC 2D62A 3PO3H 2F4VL 4R4OA 2CFMA 3PUVA 4LF5Q 2VZAA 1DGSA 2AWOA 2ATWA 4HIMA 1NBWA 2IHFA 4POFA 2NVXH 2UU9L 3SGIA 3GD7A 4QY7A 4PG3A 1VQIA 1OXVA 4OXPA 3S14H 2NVTH 3E0EA 4A93H 4NXMQ 3BZCA 2ZJQA 3AFQA 3CW2C 4OX9Q 3U4ZA 4X65Q 4HIDA 1SLJA 3I4OA 5IWAL 4DV0Q 2JK8A 4A76A 1Q86C 2V1CC 1H95A 2R6GA 3MXNB 3CD6A 2JA7G 1IL2A 3J81i 4B3RL 4NXML 1W2BA 1L2FA 5GQOA 2GVAA 2HQLA 4DV5Q 1VQ6A 1PH5A 4C3IH 4POGA 1VS0A 4DR5L 4X65L 2UXDQ 4A4IA 1MJCA 1HNWL 4Y52H 2A8VA 1TXYA 2YTVA 1YJ9A 3PUWA 3T1HQ 2Q2HA 2HT1A 2ZTDA 1KL9A 3KDFB 4X66Q 4UP7A 3CCEA 1XMOL 1PH7A 2F52A 4IPGA 3A74A 1AH9A 2R7FA 5JEAG 4DV5L 2R7DA 1TWGH 4KLKA 3KLWA 2UXDL 1KD1C 3T1YQ 3RN2A 3KOJA 3ULPA 4JV5Q 4IO9A 4BXXG 2D0OA 3AFPA 3TREA 4BY7G 3HOVH 3M4OH 1E7ZA 4WJ3M 1C0AA 1XNRQ 3ULJA 3UDIA 3RLOA 4OWXB 3A5UA 1YITA 4JYAQ 2Z6KC 4R4CA 1XJVA 1XNQL 2ID0A 1EQRA 3F2DA 1PFSA 3HFZB 2HHHQ 4LUVA 2XGTA 1OXXK 4DAYB 3T1YL 2AHOB 4JV5L 5FJ8G 4AYBE 5H1SE 2OTLA 1VQOA 3CC4A 2F3IA 1FJGQ 2JA6G 4DV1L 4LF4L 3KFUA 1XNRL 4JYAL 3CF5A 5JJIA 1ASZA 2ZM6L 4UP8A 1PVOA 4JI7L 1L1OA 5IT9c 2MNAA 2HHHL 1BBWA 3CC2A 1ASYA 3I4MH 3CP0A 4DV3Q 2H5XA 1JE5A 1SFOH 3F8TA 4MNOA 1A62A 2BA0A 2JA6H 1N32Q 2QGQA 3KYHC 3PCOB 4QL5A 4DR2L 1N34L 4JI6L 1B8AA 1KC8C 4EQ5A 1CKNA 1VQLA 1NJIC 4DR3L 2ALYB 2JE6I 5K36G 2JA8G 4K0KL 4DR7Q 4AIMA 1VQBA 4IFDJ 4LFCQ 3U50C 4HIOA 4WJ4A 1I50H 3DLLA 5C4XG 3GTLH 1K73C 5LMUQ 3L2PA 4OWWB 3RZDH 1GM5A 4DUYL 2E5LL 1Q82C 3I4NH 1FVIA 3TS2A 4DR7L 4DR1L 1KXLA 4LFCL 1S40A 2JA8H 1Y1VH 3ICEA 1Q1EA 3K7AH 2D0PA 1FGUA 1EYGA 3HOYG 3BZKA 1XPRA 1PYSB 1L1OB 4L5QA 4YCUA 1JMCA 3AEVA 3CCJA 1HZBA 3HOUG 1K0RA 3DM3A 3H0GH 2GN5A 2XTIA 4C2MH 2LXKA 4GS3A 3K81C 5IYBH 2KHIA 4A3MG 1XMQQ 2UXBQ 2E2JH 1PH1A 5M5XH 2OWOA 2PNHA 2VUMH 1X3GA 2JA5G 2JJQA 3OTOQ 2JA7H 1CKNB 2NVQH 1PV4A 3HOYH 3EIVA 2NN6G 3W1GA 3OW2A 4A3JH 4ME3A 1VQ9A 2VY3A 2IY5B 2RCNA 2UXBL 1A63A 1I5FA 5IYDH 2E2HH 1SROA 4R4QA 5E7NA 1LTLA 4UPAA 5IP7G 4JI5Q 1E22A 2JEBI 3I7FA 2R7ZH 2CCZA 2YYZA 1V9PA 3J81c 2VQEQ 3GO5A 2Z6KA 2EQSA 2OQ0A 2QA4A 4LFAQ 1JJCB 1U0LA 1VQEA 4HJ7A 3ERSX 2WB1E 3M7NA 1JJ2A 5IYCG 2F4VQ 5ELOA 1UE1A 1VQKA 2R93H 2ZTCA 3S1RH 2B63G 4JI4L 3K80C 2UU9Q 4LFAL 4A3LG 3UDFA 4DKAC 4A3CG 1JB7A 4JC0A 3RLNA 3CPFA 3H3VH 3GDEA 2A1AA 3KDFA 5IYCH 3CCUA 4RG1A 4YWKA 1N9WA 1VQHA 1KIXA 3PO2G 3S17H 3G71A 2B63H 5IWAQ 2K5NA 2GVBA 1VQ7A 1EWIA 4A3LH 1TWHH 3BU2A 4A3EH 1E24A 2CWPA 3KJPA 1VQ4A 2BA1A 4B3RQ 3J7ZC 4GLAC 4P71A 4BBSG 3NELA 1SMXA 3KF8B 4DR5Q 3HKZG 1YI2A 2K14A 4Y7NH 1HR0Q 2WAQE 1EUJA 4IPHA 3NENA 4LF8Q 2QEXA 1HNWQ 2BH8A 1HH2P 1T9HA 1XPOA 2ASBA 1R9TH 2KHJA 1OTCA 1XMOQ 4MZ9A 2UUAQ 4BA2I 4JI0L 4J15A 1TWAH 4O2DA 1Q12A 1X55A 2CQOA 3AQQA 3PIOA 1SR3A 1YZ6A 3CCVA 1HR0L 4LF8L 1YEZA 4AH6A 3K7UC 3RZOH 4LW1A 5M3MG 4HJ9A 1HR0W 1N33L 4GNXC 2UUAL 5FLMG 5LMNL 5C0XG 4TVAB 3PUXA 4JI2L 1AE2A 1Y1WG 1XNQQ 5LMNW 2Q2UA 3G4SA 4HIKA 4LNQA 2N78A 1E1OA 5C3EG 3K0XA 1WCMG 3PV0A 4KI0A 4JBWA 4DV1Q 4A3FG 4LF4Q 1CSQA 3HOZG 2HIXA 2LSSA 4GOPA 3CPWA 3F2BA 2ZM6Q 1VQ5A 4DV4L 4X62L 4JI7Q 1Q81C 4KHPQ 4JI8L 2FXQA 1EQQA 1G51A 3L7ZC 1GVPA 1D7QA 4P73A 2CKZB 4DAMA 4YCWA 1CUKA 1PH6A 4BXXH 4IFDI 3PIPA 4BY7H 4UY8C 3FHWA 3RN5A 4DR2Q 1N34Q 3G6EA 4A3KG 1N8RC 4JI6Q 2L15A 2JEAI 4A3DG 4KHPL 3FKIG 1L0WA 4DR3Q 3EBEA 4B3TQ 4K0KQ 3PF4A 3EN2A 5HGQA 5GROA 3J80i 4JCVE 5FJ8H 1EIYB 5GAGC 2AWNA 2PQAA 4QIWE 2LXJA 3W1BA 5IP9G 4DV4Q 2MQHA 1CSPA 3S1QH 4DUYQ 1B7YB 2E5LQ 3RNUA 2EXDA 1C7YA 1YVCA 3FKIH 3RLFA 4B3TL 4QQBX 4IJHA 2NZHA 2NVYH 4A75A 4DR1Q 3CCQA 1PH4A 1XPUA 4R4IA 1LUZA 3JAMi 1Q1BA 4GOPB 3BJUA 2K5VA 1HZ9A 4TQUS 1YHBA 1QUQA
chains in the Genus database with same CATH superfamily
3CMEA 1EOTA 2VXWA 2VW9A 2EY2A 3ER0A 5JVG3 4KHZA 4NP5A 5FLXL 1H9SA 2GA4B 4DXFA 1B44D 4ZLTF 1J5EQ 4OO1I 3KF6A 4UHVA 2VS1A 3DEOA 4GLXA 1KDCA 3EFXD 2O2LD 2PQAB 1K3BC 2K04A 4C3HH 2Y0SG 4OL7A 3J80L 1WD0A 3A5ZB 3DUZA 3HRZC 1QNUA 1EFWA 3IAYA 4DV6Q 1CHQD 5BN3A 4B08A 2KHSA 1XX8A 1MIUA 3SR1A 1QB5D 3IKJA 5CMDA 3JAML 3UE1A 4BBRG 4HMIA 4WRDA 1ENFA 1IBKL 3M3YH 1EY7A 4A3DB 1VQMA 4P75A 3I56A 1H9SB 3EJIA 2CWAA 3MEFA 2K50A 4HR7B 1PRTC 1AN8A 3KF6B 1EEID 2E2IH 4YWLA 1Z9FA 3Q0AA 4LF9L 2K5DA 1LTTD 2R61A 3CC7A 1JJGA 1PH3A 1IXRA 2IWHA 4YHHQ 5CV4A 4PMWA 3HKSA 5CV6A 5G3LF 3S2HH 4A93G 3MXUA 5ELNA 1IW7C 3GTJH 4XTCS 4KKUA 3OPOA 1EL0A 1L0XB 2RSOA 4Z9CB 3S1NB 1X65A 2EJFC 4B9XA 2AKWB 2I46A 2EIFA 1HZCA 2H1EA 1S4ZA 1EY4A 3R3OA 1K3RA 4KY6A 2Q8RE 2E2IB 3KJOA 2IL8A 4XQNA 2A69C 3S1MH 3CQZH 3SVMA 4C1NI 1PRTD 1KNEA 1P8LA 5GAEC 3NP8A 4HTHA 2QDLA 5NUCA 4P72A 5IGCA 2IX0A 3CCRA 2B2WC 3HOZH 1QZGA 4LWCA 3TN2A 4DUZQ 1UEBA 1H9KA 2J0TD 4IPDA 3HOWG 1I6VC 1EQTA 4IQZA 3S2HB 1JB3A 3GTJB 3M4QA 4BY1G 1SAPA 3Q22A 1KNAA 2H4OA 1BCPF 1DOLA 1QVGA 2MUYA 1IW7D 4KKTA 3GTPH 1VQJA 1KAWA 1AE3A 4CDCC 1FJGL 4DR4L 1E1TA 2UUBL 1B2TA 2DNCA 1JQYD 2EJMA 1QJOA 2Z6BA 1E3PA 4L5RC 1VDZA 2B8FA 2RBMA 2YU9H 3OMCA 4PZ8A 1QVFA 3S1MB 1N32L 1C8CA 3VR3A 1RJTA 4IOAA 4B3MQ 5IGGA 1YHQA 4ODGA 3M9BA 3H15A 2VQFL 1D8LA 4IUUA 1N36Q 4A3JG 1NY4A 2MO0A 1EY8A 2JSOA 2OTJA 4JOIC 2RF4A 3MTSA 3HOXH 1Z47A 2RHQB 4L5SA 5LL6S 2SEBD 3K0YA 4X64Q 1VQGA 4JPBW 4ME5A 4GKKQ 2QW7A 4BBRH 3VA5A 3BS1A 4QGUA 1JR0D 3GTPB 4OIKA 1CI3M 4DV7L 5DLQE 4IPCA 5KRUA 5EBCA 3OTOL 3F1ZA 4JBMA 1HNZQ 1NR4A 2HCIA 1FD7D 2JA9A 4FO2A 4QMGA 4WJWA 3MXNA 2YU9B 5FK9C 4G7HC 1KHIA 1VQAA 1IL8A 4H02A 4V190 5IGFA 1YNJC 3J81j 1K8AC 2V4DA 3BZDB 4YWMA 2DGYA 1UEAB 2L4NA 1DOKA 2D62A 3PQIA 4R4OA 4G57A 4LF5Q 2RDGA 2VZAA 3K7AB 3VR2A 4HIMA 3GD7A 3X3MA 3M7GA 4OXPA 3H0GB 3E0EA 3DEPA 4A93H 3BZCA 2ZJQA 3GP7A 2DY8A 4X65Q 3I4OA 4J6HA 5IWAL 5ELBA 2JK8A 1Q86C 2V1CC 3HOXB 4KJOA 2R6GA 3MXNB 4KMUC 1TR5A 3EROA 1IL2A 1W2BA 3VYSA 1E0BA 2GVAA 2HQLA 1VQ6A 2E2HB 5BN5A 1HNWL 3QIAA 3PUWA 3T1HQ 3N52A 1LTRD 2R7ZB 3MXGA 2R3ZA 1XMOL 1PTOC 4IPGA 3A74A 2R7DA 1TWGH 1Q90A 4CJ2C 1VMPA 2F4IA 3T1YQ 3ULPA 4JV5Q 4BXXG 2D0OA 2IW3A 3TREA 3S1RB 1HHVA 2Z4HA 4JYAQ 3RLOA 4OWXB 1SE4A 2Z6KC 1XJVA 1XNQL 2ID0A 2HHHQ 3SK6A 5C3XA 2OEOA 4DAYB 2AHOB 3DMUA 5IGBA 3TSSA 2OTLA 1YNJD 5C3WA 1HFNA 1B53A 3MAQA 1XNRL 2F1MA 1STGA 2ZM6L 1PVOA 1L1OA 4A93B 4I65A 1BXTA 4G7ZC 4MN3A 1TQOA 1SFOH 3MHBA 4F8MA 2BA0A 2QGQA 4U68A 3PCOB 1N34L 2HDLA 4JI6L 1B8AA 1NJIC 1MD2D 1V1PA 1TWAB 2ZT9C 1I50H 1RTOA 2MGSA 3FVQA 1PZID 5LMUQ 1GXDC 3L2PA 4OWWB 3RZDH 2F0VA 1RKNA 2E5LL 3I72A 1FVIA 4DR7L 1KXLA 2JA8H 1TWGB 3ICEA 1Q1EA 1I4HA 1EYGA 3BZKA 1B4OA 1L1OB 2IJ0A 1PTOD 3OSOA 3CCJA 1HZBA 1U4RA 1K0RA 4H0LC 3HOUG 4RAUC 2F0GA 4GS3A 2LY7A 2K6AA 5IIFA 1MBYA 2E2JH 1PH1A 2F0MA 5J39A 2OWOA 2PNHA 2JA5G 2NVQH 4Q0FA 4ZUIA 3HOYH 2NN6G 4A3JH 1V1PB 4ME3A 5E7NA 2KEEA 2DNEA 3J7YW 5FO8B 1E22A 4XXEA 3TMEA 1GUGA 2L0CA 2CCZA 3J81c 3GO5A 1B9NA 1WTPA 3NUCA 2WB1E 1KTKA 3NTIA 1I4GA 2ZTCA 1I50B 1JC7A 2OT2A 1H9RA 3D8GA 4NMZA 3RLNA 1LACA 3H3VH 3NXWA 2A68C 3A8IE 4KK7A 5ELEA 5IYCH 2JA8B 3PO2G 3TBIB 2JP1A 4CKEA 1IHZA 4HSVA 1EU3A 1PFBA 1TWHH 4K2KA 4GZYC 1E24A 1VQ4A 4KY5A 3KJPA 2BA1A 2F0DA 2WKDA 2F0NA 4GLAC 2F0KA 4C3JB 4BBSG 2PYKA 5JPNC 5CV5A 2WAQE 2K33A 3NENA 3AU7A 1HH2P 1T9HA 2ASBA 1ONLA 3HOYB 2AQ3B 1DD2A 1QNKA 2WKCA 1AZQA 4BA2I 2B2YC 4X3KA 4A3MB 3PIOA 1CA5A 3CCVA 1YEZA 2O4XA 4HJ9A 4GNXC 3FDTA 3PUXA 2QEJC 3E3XA 3G4SA 3K0XA 3Q6SA 2EE1A 1JWUD 1K28A 2XIWA 4JBWA 4LF4Q 2LSSA 1VQ5A 4ZYSA 2D9UA 1Z6HA 2DN8A 4P73A 4DAMA 4BXXH 4IFDI 3PIPA 1BQQT 4FXKC 2A68D 4A3DG 1PMRA 4DR3Q 5KNCA 1KABA 1WTHA 2F3WA 3X3NA 2KJXA 4QIWE 1TY0A 5IP9G 2MQHA 1WTQA 1JICA 2F0OA 3HGBA 1C7YA 1Y8OB 1YVCA 2F0IA 4B3TL 4QQBX 1UAPA 2NVYH 5CBAE 1PH4A 1RODA 5HURA 3HKZB 1K8MA 2EY1A 1L0YB 4YIJA 4O0AA 2HIVA 4DAPA 1IBLQ 3T53B 1CT1D 4JBJA 1EQVA 1I94L 1PRTB 3JC66 1PH9A 3L9AX 3M4PA 2KCMA 1VQNA 4RGOS 3NBHB 4V0BA 4DNRB 1Y1WB 1I6HB 3P75A 4X3UA 5KGUA 2SDFA 3UDXA 5C3EB 3EA6A 2UUCQ 1BDOA 2EYJA 4RGNA 4EGVA 3HOUH 1VQ8A 1WI5A 4A3FB 3K8AA 3STBC 3DWAA 4LUZA 2CHBD 4CDEC 3WOEA 2JA5H 1JOQA 3M4YA 3NHHA 2I5MX 4JI4Q 4G7OC 4B3ML 1QZHA 1PLFA 1HQMC 4APVA 2ICIA 3CAMA 5J3BA 1IYUA 2KCCA 4UDUC 4RGMA 1GD7A 2NVYB 3GV3A 3K5LA 1N36L 1Y8NB 2PMZE 2B2WA 3K6OA 3S15B 1IYVA 1S5ED 3QO2A 1QE6A 1NMGA 2RCFA 3CCLA 5HGTA 1DCZA 4EVOA 4X64L 2F0WA 4GKKL 4A3BG 5A2QE 2Q2TA 2X69A 3W5OA 4JI0Q 4DR6L 1FR3A 5FLXc 4YY3Q 1HNZL 2EYFA 3C1EA 1LYLA 3A54A 3PO2H 1E2VA 2KVMA 3C1FA 1EOVA 5EKLA 2N8NA 5LMNQ 5KNDA 3J80c 1LABA 3VA7A 1EY9A 1F2YA 3QR8A 5F2DA 4BBSH 2JN4A 1NCVA 1WFQA 1MGSA 1D5ZC 5FO7B 3OIQA 1PDQA 3RR5A 3STBD 4LF5L 1RHPA 1HZAA 2F0QA 4ZKBB 3JAMc 4X62Q 2KEDA 1PXUA 1FYCA 2B2UC 3B6YA 3TP5A 1SDFA 3E5SA 1LM0A 2LMCB 1LO5D 2ZTEA 2YV5A 1F9SA 5AJ3L 1MSHA 2NN6I 2DUDA 1UE7A 1RL2A 1SN8A 4JOIA 2D2CC 3D0FA 1ILQA 2RA4A 2RQXA 3BYTB 4R4TA 1VCIA 3D4DA 3D6CA 2FHTA 2KA7A 1PH8A 1A0IA 1QVCA 2PW5A 3T1HL 3PSIA 4PV1C 5M5WB 3PO2B 2PI2A 2KENA 2FFKB 1HPCA 1D2BA 1S72A 4PZ6A 1K9MC 1O7IA 4A3DH 3UE0A 1GKHA 4BBSB 3S2DH 4DNIA 2QILA 5HY6A 5KYIA 5IP9H 1PYBA 2K05A 2K1BA 1R4PB 3S14B 1B9MA 1IKMA 2QF7A 4L6TB 1SNMA 3Q8DA 3FMCA 4LFBQ 5JJKA 3D4WA 4JI1L 3I2ZA 2JQOA 5FO9B 4WFN3 3ZJYC 1CZWA 2ZXRA 3OWEB 5CV9A 5COYA 4XT1B 1KRSA 4EQOA 1WJJA 1FNUA 2IHEA 2WFWA 3H91A 1SMYC 1HA5A 4LF7L 3H0GG 4KJNA 1MJEA 1NNXA 5CV7A 4HJ5A 2K75A 1HNXQ 4ABNA 4DV2Q 5I2YA 1YJWA 5CC4A 3HOXG 1IBMQ 3S1NH 2BDNA 1LTBD 5CBEE 5LMUL 1WVLA 3S16H 1EY6A 2XRSD 3HOVB 3M4OB 3T4AC 1LTAD 1U5KA 2Y0SE 4IUQA 2OCEA 2R7ZG 5DM73 4OONA 5EPJA 1U4MA 3A0JA 3S2DB 1M1KC 1WTVA 3CXCA 4GN3B 5BR8L 1H9JA 2C9OA 3NWTA 2I07B 1K83H 1O78A 1JWSD 4GN4B 4NXNQ 5FOBB 1LT6D 1IYJB 1ICWA 4PQXA 4R1JA 2UXCQ 2FMCA 3U4VA 1QCBD 1OXSC 1KAAA 1SXTA 3I70A 3P7JA 2MFIA 1PH2A 1TU2B 3SK8A 4QJFA 4AQYL 4A3BH 4DK0A 1JOOA 1Q7YC 1PTOB 3I4NB 1BCPC 3PUVA 5G3LD 1GUNA 1DGSA 1Y1VB 2ATWA 2WINB 1TY2A 2NVXH 3SGIA 3OHXC 3S16B 2F0HA 3KLRA 1HCZA 2NVTH 4NXMQ 3AFQA 3CW2C 3U4ZA 1MSGA 1I4QA 2B39A 5JVH3 3OW7A 3CD6A 4UAIA 3PIO3 3WDNA 4C3IH 4R8NA 2UXDQ 4Y52H 5CORA 3KBXA 2A8VA 1TXYA 1YJ9A 4FYDA 2Q2HA 2HT1A 2ZTDA 1KL9A 1K83B 2OXPA 1PH7A 3K5OA 1MI2A 5JEAG 4DV5L 4HSPA 4K5WA 1KD1C 4ZUJA 4IO9A 2DJGC 3AFPA 1ML0D 1C0AA 1I4XA 4RCNA 3UDIA 3IFDA 3A5UA 1YITA 1B3AA 1PFSA 3HFZB 3MA2B 4A3BB 4LUVA 2XGTA 3PIP3 3CC4A 4RHRA 4LF4L 1UNSA 2NVXB 3CF5A 5FKAC 1ASZA 4A3EB 1A3UA 1BCPD 1BBWA 2A6HC 3CC2A 2NVTB 5I9OA 4DV3Q 2NWGA 3KUPA 4MNOA 4C1NK 3I91A 2JA6H 3KYHC 2FMMA 4QL5A 4ZCKA 4EQ5A 1CKNA 4DR3L 2ALYB 2PNRC 4HMJA 4OEMB 3RMHA 2JA8G 5K36G 3U50C 4FF3A 4WJ4A 4C3IB 1G2TA 3GV6A 1K73C 5D3IB 5J22A 1GM5A 2CW0C 4C3JG 1Q82C 3I73A 2A69D 4LFCL 3K7AH 1BF4A 3R2TA 1Q3LA 2D0PA 3HOYG 1XPRA 1PYSB 4YCUA 2RKSA 3DM3A 3H0GH 1DYQA 4A3MG 5EKIA 2RDFA 2E76C 4IURA 2F0UA 1CKNB 1PV4A 2K28A 3OW2A 4NW2A 2IY5B 2VY3A 1C4QA 2RCNA 2UXBL 1A63A 1SYDA 2E2HH 4LAAA 1M4VA 4R4QA 4UPAA 5IP7G 4JI5Q 2JEBI 3O13A 2R7ZH 2VB2X 4ZAIA 2QA4A 2PW7A 2JA6B 3QWNA 2A6HD 4RGTA 4RWSC 5IYCG 1JJ2A 4MHEA 3MVVA 5ELOA 1VQKA 1MHWC 4NDXA 2A5HA 1M8AA 3S1RH 3TP7A 4JI4L 2UU9Q 4LFAL 4A3CG 2AUKA 4L8JA 1STEA 3CPFA 4K8IA 4KTAA 3TDQA 2J4XA 4LMQD 1F2MA 4XYQA 4RG1A 4YWKA 1CQVA 2CH4W 1CA6A 3GTGB 2F0LA 3G71A 1HFGA 2B63H 5C4XB 2BE5C 5J1ZA 1EWIA 4A3LH 2CW0D 3J7ZC 1FNVA 5C4HA 3HKZG 4DR5Q 2K14A 4Y7NH 3NBIA 1HR0Q 2QEXA 1XPOA 4DAYA 4I7AA 4MZ9A 2QCPX 4JI0L 1F9RA 1TWAH 4RH6A 1OO9B 2L11A 4OELB 1O80A 4O2DA 2CQOA 4LF8L 3BG3A 5CR3A 4AH6A 3RZOH 4LW1A 4DFAA 2UUAL 5LMNL 5C6AA 4TVAB 4WORA 5AFWA 1Y1WG 3V96A 5LMNW 2Q2UA 4HIKA 5C3EG 3FPUB 1A15A 4A3FG 1CSQA 5I2XA 4CJ1B 3CPWA 1UUPA 3QB3A 4X62L 5JEAH 2FXQA 1G51A 3L7ZC 1D7QA 1STHA 3K58A 1PH6A 2HQEA 3FHWA 3RN5A 4DR2Q 2B63B 5ELDA 1PYWD 5A35A 1HA6A 4KHPL 5LL6X 3T51B 4K0KQ 5KEEA 3PF4A 3SE0A 2EYMA 2HD3A 1EIYB 2BE5D 1ET9A 5GAGC 4Y7NB 5M9OA 4DXGA 3W1BA 3EQLC 3W2DA 3Q24A 3G7LA 3F2UA 1DZ1A 3FKIH 2EPBA 2EY5A 4H7BA 4KN4C 2KCNA 1XPUA 4FF1A 2K5VA 4TSSA 1HZ9A 1YHBA 4DV4L 1QUQA 2SOBA 1CM9A 1ILPA 3RZOB 4K14A 1IZ6A 2X6GA 2I5LX 3TEHB 5K36H 3OOCA 1JORA 4DGZA 3I55A 2D5DA 1PA6A 2F03A 1NTGA 1FGBD 1BNZA 2B2TA 2F3VA 2AUJD 3CKIB 1GOZA 5M3MB 3LNNA 1STNA 4C3JH 1LT4D 3C46A 2R92H 4LFBL 1X3EA 1NR2A 3BVZA 4HJAA 1FNWA 5GAHC 1BOSA 1WCMB 3GTMB 1J5EL 1YNNC 1IBKQ 4A3MH 1X6OA 5IY0A 4GOPC 1QUQB 1X56A 3GTOH 1TWCH 5JJZA 1UE5A 2RSNA 5EAYA 4A3IH 1SNPA 4X3SA 4LF9Q 3KK7A 2OQKA 4DV6L 4A3KB 2MO1A 1HNXL 3TZUA 3D31A 1DJRD 3CCSA 3FKIB 2WB1G 3NPPA 5IP7H 2VB3X 1VQCA 2ES2A 2EVBA 2Q2IA 4NB3A 1GO3E 1LTID 2Z0SA 3UI2A 1EIHA 3I90A 1EEFD 2KOLA 5JEAJ 3RUZA 2NZ1D 2F0PA 4ULLA 1DONA 4A3CH 1EU4A 1YJNA 2G5DA 1W3SA 5KIXA 2A6EC 4GN5A 4JVZA 2R92B 5C4JB 4NXNL 1BR9A 1N33Q 4CHTB 1V1QA 4YHHL 4K6LA 4IUNA 4F7XA 2UXCL 4JI2Q 3TS0A 2P5ZX 1CZGA 4JG2A 4E6IA 2E2DC 4DAVA 4FDBA 2EY6A 3GTOB 1TWCB 1J8IA 5M3FB 3GTKH 1B70B 4A3IB 1CFMA 4N8FA 4OO1G 1K0SA 1RIPA 3NQTA 1SSOA 1GHJA 4K5VA 1ESRA 2FJ2A 1WOCA 1I6HH 1Y1WH 1WTWA 4A3GB 1HXYD 1A3VA 1XWEA 3HOVG 5C3EH 1S3OA 2PI2E 3NEMA 4PMCA 4AYBG 3GTQH 4A3FH 5T1GA 3N6RA 2K7VA 2XN9C 1EIGA 3E0JA 4YCVA 3H3VI 3NBHA 3KLSX 2NZOA 3PUYA 1EYCA 1X54A 2G9HD 5IT9E 1AW7A 2VNUD 2E8GA 3I4MG 3DWQA 3VYUA 1A8VA 4DUZL 4R9WA 4XQQA 4B3SQ 2K52A 4IOCA 1YIJA 3S15H 4DR4Q 2UUBQ 4GKJQ 2PPBC 2LKVA 3GTKB 4DK6C 3V05A 4DK1A 3A7LA 4DPGA 2PZWA 1UE6A 3WWVA 2YTXA 4CDDC 4P74A 1CKMA 3R2IA 5GADC 3FP9A 4QCLA 4F87A 3I4NG 3F2CA 4ALPA 1Y1VG 4DV3L 3AMUA 3SHLA 4LK1C 2VQFQ 2B3GA 1KDAA 1X3PA 1J9OA 5EJWA 2MPMA 4DK3C 4XYOA 3GTQB 1JWMD 4JI3Q 1GHKA 4UP9A 5L37A 3E9HA 1SJHD 1UWVA 2EJGC 4L5TA 1LLRD 1WD1A 2B29A 1AFPA 5ELCA 1P16A 3VR4A 2KUMA 2Q8TA 1PFNA 3FRPB 4GLVB 4DV7Q 1BCPB 3CHBD 4LUOA 3ND9A 1S5CD 1XTDA 1ZKOA 2EYPA 3W3AA 2I0QA 3PUZA 2M00A 4EQPA 2F0TA 2F0SA 1CKOA 1EYAA 4EX5A 1J6QA 2DJFC 3QJYA 4ILWA 3BDOA 1VMCA 4JI5L 3CCMA 1L1OC 1KLGD 5M5WH 3QOLA 1EFID 4LF6Q 3ONAB 4N9PA 3I3CA 4A3EG 4ZKCB 3PO3H 1ZXTA 5I4DA 5IT9L 1NBWA 2IHFA 5DEHA 2UU9L 2WIIB 4QY7A 4PG3A 2EZVA 2K5QA 3J80E 3H09A 3S14H 1SNQA 5LHY1 1AZPA 4C3IG 2B2VC 3SK5A 4OX9Q 5M5XB 1SLJA 3CRLC 1TIID 1BO0A 4DV0Q 2JA7B 1H9MA 1PZKD 2BOSA 1H95A 3J81i 3JAME 1L2FA 5GQOA 1PH5A 4POGA 1VS0A 4DR5L 4X65L 5I6WA 4OO1H 2QKIC 4KV6A 4KD3A 1EWCA 2WB1B 2XVSA 4OGQC 3KDFB 4X66Q 4UP7A 2F52A 4OHJA 1AH9A 2R7FA 5EGTA 2XWJB 3HS0C 2R93B 4ZRZA 3HOVH 3M4OH 4WJ3M 1TS4A 1XNRQ 1ICFB 2JYOA 5D65A 3F2DA 3PO3B 1OXXK 5ISRA 3T1YL 4JV5L 1TT2A 5FJ8G 5H1SE 2XWBB 5T1IA 1D5MC 2JA6G 2F3IA 1DOMA 2PZUA 4JYAL 2MHVA 3A7AB 2HHHL 1ASYA 3I4MH 3HZXA 5CV8A 3CP0A 1SE3A 2H5XA 5CYUA 1JE5A 1A62A 2FINB 4DR2L 1R9TB 1KDBA 2CQAA 5I9PA 2JE6I 1II3A 3LWUA 1AP0A 4K0KL 4DR7Q 1O7LA 5C4XG 3MWYW 1CQFA 1W6KA 5EKKA 5A2QL 4RFBA 1QWYA 3H3VC 3A8KE 1PTOH 3I4NH 1Y1VH 4FXDA 1G2SA 4CKCA 3VYRA 1SYBA 4PNYA 3AEVA 1TVXA 2TSSA 2XTIA 3K81C 1XMQQ 2KHIA 3KLSA 4AYBB 5IGDA 2AQ1B 4K8JA 4KN7C 1STYA 2JJQA 4XQJA 3EIVA 2M2LA 1VQ9A 4BY7B 3T56B 5DM63 2L9HA 1SROA 3LWEA 4QIWB 5TSSA 3I4MB 2K01A 1F9QA 2Z1CA 1EZ6A 3I7FA 3TZDA 2AQ2B 2VQEQ 1DM0B 2Z6KA 2EQSA 3KF8A 1JJCB 1U0LA 1VQEA 2Z4IA 1D5XC 1WTXA 1GUSA 2F4VQ 1UE1A 1TKWB 5BN4A 2B63G 4A3LG 3UDFA 1A2TA 4DKAC 2TMPA 4IUTA 1HTPA 3GDEA 1ENCA 2A1AA 1QOHA 1SEBD 3CCUA 1N9WA 1VQHA 1KIXA 3D3RA 1SMYD 3PMFA 2K5NA 2L1BA 2GVBA 1ZEQX 4A3EH 4B3RQ 4NKLA 3C2PA 2K03A 4QUFA 3NELA 1SMXA 3KF8B 1YI2A 2J7ZA 1EUJA 4C3HB 2Z8LA 4L63B 2CVRA 1OTCA 3BVGA 4JK1C 4J15A 2A74C 3NWSA 1Q12A 3AQQA 1D1IA 1SR3A 1R4QB 2PZTA 2ZXPA 2LFNA 5M3MG 1N33L 5FLMG 5C0XG 4JI2L 3D6WA 2LS01 1AE2A 2PMZB 3M3YB 2NTTA 4XT3B 5E3FA 4LNQA 3KBGA 1K8OA 1WCMG 4KI0A 4DV1Q 5ELFA 4FXGC 4H44C 2HIXA 4GOPA 1PRTF 4JI7Q 1Q81C 4BWGB 4YCWA 4XDXA 5C4ZA 2MP1A 3G6EA 4A3KG 1N8RC 3MC0B 3FKIG 4B3TQ 4RCOA 1JE4A 3T13A 2E75C 3Q23A 3EN2A 5HGQA 5GROA 3J80i 4JCVE 5IOCA 3MFYA 5FJ8H 2LXJA 1A3TA 1CSPA 3S1QH 4DUYQ 3RNUA 4DR1Q 4R4IA 1LUZA 3BDCA 1ZYRC 5EPLA 3JAMi 4GOPB 1LTGD 1SJED 4TQUS 1EZ8A 2HDMA 1I94Q 4QB4A 1Z7TA 2R92G 1YNXA 3GTGH 4B3SL 1FL0A 1B1ZA 5C4XH 4GKJL 4BA1I 1SE8A 2B2YA 2I5HA 3GQBA 2PCFB 4JBKA 5KNBA 1SRUA 5IE8A 4RA8A 4DF7A 4HAEA 2EYLA 4OWTB 1O7ZA 2RHSB 1IBLL 3CQZB 1X3FA 4DN4M 4GNXA 5M3FG 4A3IG 4NPSA 1O7YA 1SNDA 3TRZA 2K5HA 2OF1A 4MTNA 3HOZB 3A8JE 4FP5D 1G291 4KHVA 5JPMC 2ZXOA 2UUCL 1AEXA 3S24A 5C44G 4JI3L 1BBXC 5D3DA 3S1QB 1LT3D 4A3GG 4C56C 2X6LA 3TQYA 3E9IA 4BS9A 3MFGA 1V8QA 3VDYA 3UDGA 4IFDG 1NMFA 2YTYA 1KRTA 4IZ8A 4GNXB 2A19A 1BVSA 4S3SA 1TS5A 3V2TA 4DR6Q 3FPPA 2SNMA 3SK4A 1F9PA 1ZYRD 4MIUA 4RKBA 2G9DA 4PZ7A 3R93A 1KLUD 1Y8PB 1E2ZA 4IN3A 1YHAA 5M5YH 2BCOA 4RMFA 4RKLA 1IKLA 4FF4A 2Z9HA 2BDOA 2HCCA 3EVQA 3PF5A 1VQPA 3J7A5 2N49A 3J7AV 4YY3L 2HUGA 2EYHA 4LF6L 4XIGS 4U673 1SYGA 2Y0SB 3NK9A 3PGZA 4K2LA 1I4PA 4QF4A 1A6XA 3HKZE 5AJ3Q 1YBYA 1T5XD 4JI8Q 1F2ZA 5E4XA 3C3LA 1CHPD 2N3SA 3DM1A 2C35B 1S5DD 2IT1A 1X32A 5M3MH 1E2WA 1EWHA 5FLMH 1M90C 1RTNA 1STAA 4BBRB 1D1KA 4F88A 5C0XH 4OX9L 1NSNS 4DV0L 5KYLA 1Q8KA 3RD4A 1WCMH 1EIFA 3GTMH 2IX1A 4N8X1 3OIPA 2XRQD 2EDGA 4G4KA 5M5YB 2K4KA 4HJ8A 1RF2D 3HEJA 4X66L 1OXUA 2IX3A 5E1FA 2XNAC 4IALA 4A3KH 4HN7A 1HJPA 2CH4A 1ET6A 3S9WA 2VL6A 1TS3A 1VQFA 2XSCA 3U9SA 4EQNA 4JI1Q 3AYHB 2A73B 3HOWH 5EQ0A 4QUCA 2F0EA 3G48A 1OXTA 3IRBA 1TWFH 4O1NA 1EY0A 2AMCB 5D14A 4BY1H 3HP3A 2ENBA 1Q8IA 2K32A 5JJLA 2L5TA 4LF7Q 4DNTB 1C9OA 4DU9A 3L0OA 3DWPA 2JXMB 4IJLA 1LT5D 1I3QH 3IFTA 5C4JH 2WP8J 5CGKA 1G91A 3NSWA 2Q8IB 1BKBA 1Y14B 2B8GA 2ZJRA 2B2VA 5IYBG 1PHJA 2M9VA 2NUCA 3MZ5A 1B3QA 1MKHA 1S5FD 3OYYA 1SYFA 1PTOF 4TRDA 2VUMG 3A55A 2JA7G 2B2UA 4FNFA 2DY7A 1WYDA 1WTRA 3ULLA 1VF7A 1X9NA 3P20A 3K59A 5M3FH 5C0XI 3CMAA 1S5BD 3ND8A 1WTOA 4ZQ3A 5IYDG 1SNOA 4K6DA 1KQSA 1Q46A 1VQDA 4DV2L 1LV9A 3K5NA 2WV6D 5BR8Q 3J81E 1IBML 4TKOB 2KCTA 3U58A 1V43A 3E6ZX 2BH2A 1XMQL 3HOWB 2O5IC 5C44H 1HRJA 4LJZC 2R93G 4A3GH 1SYCA 1TWFB 5C0XJ 1QG7A 2KBNA 2ZJPA 1XYIA 1NE3A 1SFOB 4BY1B 1JT8A 1GUOA 4R8IA 4IFDH 2C5CA 4AQYQ 3PO3G 1BBUA 4N9TA 3URYA 3ERQA 3LGJA 1K8GA 3M85A 1F77A 1I3QB 5JAVA 2VQEL 5DAUA 4X6AH 1JOKA 5EPKA 2WAQG 3MEHA 1XXGA 1G6PA 3RZDB 3DXJC 3ZYYX 2F4VL 2CFMA 2AWOA 4K5XA 3OMGA 4POFA 1QILA 1LTSD 1VQIA 1OXVA 1SE2A 3SEBA 1YNND 2E2JB 4HIDA 3I4LA 2NTSA 1GUWA 4A76A 1PFMA 2NVQB 1HTLD 1JCKB 1G8ZD 4A3JB 4B3RL 1X3QA 2RVLA 4M8AA 4NXML 4DV5Q 5C44B 1D6EC 4A4IA 1MJCA 4PMBA 2YTVA 4O42A 2RDHA 2PQEA 3CCEA 1RCVD 4MTKA 1EYDA 4Q5VA 4KLKA 3KLWA 2UXDL 3RN2A 3KOJA 4BY7G 3D4RA 1E7ZA 1HUNA 3ULJA 4R4CA 1EQRA 3LX0A 5IGEA 2A6ED 3A56A 3DHQA 4AYBE 1SNCA 4ZK9B 1VQOA 1FJGQ 4DV1L 3OWFA 4HCSA 4KD4A 3KFUA 3T16A 4P2CB 1TS2A 5JJIA 4UP8A 1SYEA 1TWHB 4JI7L 3J81L 5IT9c 3QOJA 2L12A 2MNAA 1HQRD 3SDZA 4DA2A 3VR6A 3F8TA 3WOFA 1N32Q 4J1MA 4KKSA 1STBA 1GUTA 1KC8C 2KQ3A 1VQLA 3P1HA 4AIMA 1VQBA 4IFDJ 4LFCQ 4HIOA 3DLLA 3GTLH 3J7AF 2IPKD 1ESFA 1C48A 1DXMA 5JOBA 1XTCD 4DUYL 4M1UB 1NAPA 3VR5A 3TS2A 3HG9A 4DR1L 3TP8A 5C5LA 1S40A 4HCEA 4C3HG 3I8ZA 4CDFC 2N88A 1FGUA 3R8BA 4L5QA 4J8QA 2NB0A 1JMCA 1VF5C 2GN5A 3ITPA 4C2MH 1U4LA 2LXKA 5IYBH 2UXBQ 2EOTA 1G6ZA 4CJ0B 1T5EA 3CU7A 4X3TA 5M5XH 2VUMH 1PZJD 1X3GA 3OTOQ 2JA7H 4I7ZC 4B9WA 3W1GA 1W6JA 5IODA 1I5FA 5IYDH 4CBVA 1LTLA 1RD9D 5EBDA 2EYOA 2YYZA 1V9PA 2OQ0A 1ENAA 2O5JC 2NN6H 4LFAQ 4HJ7A 2F0FA 3ERSX 3M7NA 2PO4A 3TP6A 3NQIA 2WACA 2R93H 3U9OA 3GTLB 3K80C 2EXZA 4H13C 3AB9A 3IL8A 1JB7A 4JC0A 1U9RA 5FLXE 1Y69U 3KDFA 3NTHA 4JW0A 1F2LA 3S17H 5IWAQ 1VQ7A 3BU2A 1V1OA 3K5MA 2CWPA 1NUCA 1RDPD 3NE5B 4C2MB 3BYYB 4P71A 1HUMA 4LF8Q 1HNWQ 2VUMB 4IPHA 1EY5A 2BH8A 1U4PA 2NBFA 2E74C 4IUVA 1R9TH 2N55A 1BUVT 2KHJA 1XMOQ 2UUAQ 3HOUB 2B2TC 3CRKC 1X55A 1HR0L 1YZ6A 2MJ8A 4RHSA 4KY7A 3VYTA 2JA5B 3H94A 3K7UC 1HR0W 3BDLA 1XNQQ 1CTMA 1SBBB 2K5WA 2N78A 1E1OA 2NYZD 3PV0A 4FVMA 5E4WC 3HOZG 3L3OC 4IUPA 3F2BA 5C5MA 2ZM6Q 5I6YA 2ICEC 4KHPQ 4JI8L 1EQQA 1GVPA 3SXHA 4CGYB 2CKZB 3NTKA 1A2UA 1CUKA 4CKBA 3S17B 4BY7H 4UY8C 1N34Q 2SNSA 2QDBA 4JI6Q 2F0JA 2L15A 2JEAI 5DNFA 1L0WA 3BVMA 2WAQB 3EBEA 3MXPA 5K5PA 3QG1A 2AWNA 2PQAA 1I4RA 4HEDA 4ID6A 4DV4Q 1B7YB 3K57A 2E5LQ 2EXDA 2KECA 3RLFA 3G6JB 4IJHA 2NZHA 4A75A 4OIJA 4FF2A 3CCQA 1GJXA 1CK1A 3H6MA 1Q1BA 3BJUA 2L55A 3FEWX 1B50A
chains in the Genus database with same CATH topology
3CMEA 1I94Q 2VW9A 1IZ6A 2I5LX 3TEHB 4O0AA 2R92G 1YNXA 3GTGH 3ER0A 2HIVA 1IBLQ 4B3SL 1FL0A 4KHZA 3I55A 5C4XH 4GKJL 4BA1I 1PA6A 4JBJA 1NTGA 1SE8A 2I5HA 1I94L 3JC66 1PH9A 1J5EQ 4JBKA 4OO1I 3KF6A 1SRUA 5IE8A 4C3JH 3M4PA 2KCMA 2VS1A 4GLXA 1VQNA 2R92H 4OWTB 2PQAB 3NBHB 2RHSB 1IBLL 4LFBL 1X3FA 4C3HH 1X3EA 2Y0SG 5M3FG 4GNXA 3A5ZB 3UDXA 4HJAA 1EFWA 4A3IG 4NPSA 5GAHC 2UUCQ 3HOUH 1J5EL 1VQ8A 1WI5A 3TRZA 2K5HA 3K8AA 4MTNA 1IBKQ 3STBC 4DV6Q 1X6OA 1G291 5IY0A 4A3MH 4LUZA 4GOPC 1QUQB 1X56A 1MIUA 2JA5H 3GTOH 1TWCH 2I5MX 4JI4Q 2UUCL 4B3ML 1UE5A 5EAYA 3S24A 3UE1A 1QZHA 4A3IH 4BBRG 5C44G 4JI3L 4LF9Q 4APVA 1IBKL 2OQKA 4DV6L 3M3YH 2MO1A 3CAMA 1HNXL 4A3GG 3D31A 5J3BA 3CCSA 1VQMA 4P75A 3I56A 2WB1G 1GD7A 2CWAA 3TQYA 3E9IA 2K50A 3MEFA 5IP7H 3VDYA 2PMZE 1N36L 1VQCA 2ES2A 3KF6B 2Q2IA 4NB3A 1GO3E 3UDGA 2E2IH 4IFDG 4YWLA 1NMFA 1Z9FA 2YTYA 4LF9L 2Z0SA 1KRTA 4GNXB 1NMGA 1BVSA 2A19A 4DR6Q 5JEAJ 3CCLA 3CC7A 1JJGA 1PH3A 4PZ7A 4X64L 4GKKL 1IXRA 4A3BG 4A3CH 4YHHQ 1YHAA 2Q2TA 3W5OA 1YJNA 4JI0Q 5M5YH 4DR6L 1W3SA 5FLXc 4RMFA 4YY3Q 4PMWA 1HNZL 4GN5A 1LYLA 4NXNL 3HKSA 3PO2H 1EOVA 3PF5A 3S2HH 1N33Q 2N8NA 4A93G 5ELNA 3GTJH 1V1QA 4XTCS 4YHHL 5LMNQ 3J80c 1VQPA 3J7A5 2N49A 2UXCL 4JI2Q 3TS0A 4YY3L 4JG2A 4BBSH 4FDBA 1WFQA 4LF6L 4XIGS 1X65A 3PGZA 2AKWB 3RR5A 3HKZE 1B70B 3STBD 4LF5L 3GTKH 1HZAA 5AJ3Q 1YBYA 3JAMc 2EIFA 4X62Q 4OO1G 1HZCA 4JI8Q 1RIPA 2N3SA 2C35B 2IT1A 3B6YA 1K3RA 5M3MH 1LM0A 5FLMH 2ZTEA 1M90C 3KJOA 2YV5A 5AJ3L 4OX9L 1WOCA 3S1MH 1I6HH 3CQZH 1Y1WH 2NN6I 4DV0L 2DUDA 1UE7A 1Q8KA 1RL2A 3HOVG 1SN8A 4JOIA 5C3EH 1S3OA 2PI2E 3NEMA 3D0FA 1P8LA 1WCMH 1EIFA 4R4TA 5GAEC 4AYBG 2IX1A 1VCIA 3GTMH 4A3FH 4P72A 3CCRA 2IX0A 3GTQH 3HOZH 1QZGA 4LWCA 1PH8A 1A0IA 1QVCA 3T1HL 3PSIA 2K4KA 1UEBA 4DUZQ 4HJ8A 4YCVA 1OXUA 4IPDA 4X66L 3H3VI 2PI2A 3HOWG 2NZOA 2KENA 1X54A 3PUYA 1S72A 4PZ6A 4A3KH 2VNUD 1K9MC 2E8GA 3I4MG 1O7IA 4A3DH 1HJPA 3M4QA 4BY1G 1A8VA 4DUZL 3UE0A 2VL6A 1VQFA 1GKHA 2K52A 4IOCA 1YIJA 4B3SQ 3S15H 4DR4Q 2UUBQ 3S2DH 4DNIA 4JI1Q 4GKJQ 3AYHB 5HY6A 1QVGA 3HOWH 5IP9H 2R93G 3GTPH 1PYBA 3G48A 1OXTA 1VQJA 3IRBA 1TWFH 1KAWA 3Q8DA 4DK6C 1AE3A 2AMCB 4BY1H 4LFBQ 1FJGL 4DR4L 4DPGA 1E1TA 1UE6A 2UUBL 5JJKA 5JJLA 4JI1L 3WWVA 3I2ZA 2YTXA 2JQOA 4P74A 1CKMA 5GADC 4LF7Q 3FP9A 1C9OA 3ZJYC 3I4NG 3F2CA 1E3PA 3L0OA 4L5RC 4ALPA 4IJLA 1Y1VG 4DV3L 2YU9H 1I3QH 5C4JH 1KRSA 4PZ8A 2VQFQ 1QVFA 2WP8J 1WJJA 2IHEA 2B3GA 2WFWA 1N32L 4LF7L 1BKBA 1Y14B 2ZJRA 3H0GG 5IYBG 1PHJA 4IOAA 4B3MQ 1YHQA 4DK3C 4JI3Q 1MJEA 1MKHA 4HJ5A 3OYYA 4UP9A 2K75A 2VUMG 3E9HA 1HNXQ 4DV2Q 3M9BA 1UWVA 3H15A 2VQFL 1YJWA 3HOXG 1WYDA 4L5TA 3ULLA 1D8LA 1X9NA 1IBMQ 3S1NH 5LMUL 1N36Q 3S16H 5M3FH 5C0XI 4A3JG 3CMAA 1NY4A 2B29A 2MO0A 1P16A 5IYDG 2OTJA 4JOIC 1U5KA 1KQSA 2RF4A 2Y0SE 1Q46A 4GLVB 1VQDA 4DV2L 4DV7Q 2OCEA 2R7ZG 5BR8Q 4LUOA 1IBML 3HOXH 4OONA 2KCTA 1Z47A 3U58A 1XTDA 2RHQB 4L5SA 1V43A 3A0JA 2I0QA 4X64Q 1M1KC 1XMQL 3PUZA 1VQGA 2BH2A 4GKKQ 4BBRH 5C44H 4QGUA 3CXCA 4DV7L 5DLQE 4GN3B 4IPCA 5BR8L 4A3GH 5C0XJ 2KBNA 1CKOA 3OTOL 3F1ZA 2ZJPA 1HNZQ 1NE3A 4JBMA 1K83H 4GN4B 4NXNQ 1JT8A 2JA9A 1IYJB 1J6QA 4EX5A 4AQYQ 3PO3G 1BBUA 1K8GA 3LGJA 4R1JA 2UXCQ 4JI5L 3CCMA 3M85A 3U4VA 1L1OC 1OXSC 1KHIA 1VQAA 4H02A 2VQEL 5M5WH 4X6AH 3J81j 1K8AC 2MFIA 4YWMA 1PH2A 4A3EG 2DGYA 4LF6Q 4QJFA 2WAQG 4AQYL 4A3BH 1G6PA 1Q7YC 2D62A 3PO3H 2F4VL 4R4OA 2CFMA 3PUVA 4LF5Q 2VZAA 1DGSA 2AWOA 2ATWA 4HIMA 1NBWA 2IHFA 4POFA 2NVXH 2UU9L 3SGIA 3GD7A 4QY7A 4PG3A 1VQIA 1OXVA 4OXPA 3S14H 2NVTH 3E0EA 4A93H 4NXMQ 3BZCA 2ZJQA 3AFQA 3CW2C 4OX9Q 3U4ZA 4X65Q 4HIDA 1SLJA 3I4OA 5IWAL 4DV0Q 2JK8A 4A76A 1Q86C 2V1CC 1H95A 2R6GA 3MXNB 3CD6A 2JA7G 1IL2A 3J81i 4B3RL 4NXML 1W2BA 1L2FA 5GQOA 2GVAA 2HQLA 4DV5Q 1VQ6A 1PH5A 4C3IH 4POGA 1VS0A 4DR5L 4X65L 2UXDQ 4A4IA 1MJCA 1HNWL 4Y52H 2A8VA 1TXYA 2YTVA 1YJ9A 3PUWA 3T1HQ 2Q2HA 2HT1A 2ZTDA 1KL9A 3KDFB 4X66Q 4UP7A 3CCEA 1XMOL 1PH7A 2F52A 4IPGA 3A74A 1AH9A 2R7FA 5JEAG 4DV5L 2R7DA 1TWGH 4KLKA 3KLWA 2UXDL 1KD1C 3T1YQ 3RN2A 3KOJA 3ULPA 4JV5Q 4IO9A 4BXXG 2D0OA 3AFPA 3TREA 4BY7G 3HOVH 3M4OH 1E7ZA 4WJ3M 1C0AA 1XNRQ 3ULJA 3UDIA 3RLOA 4OWXB 3A5UA 1YITA 4JYAQ 2Z6KC 4R4CA 1XJVA 1XNQL 2ID0A 1EQRA 3F2DA 1PFSA 3HFZB 2HHHQ 4LUVA 2XGTA 1OXXK 4DAYB 3T1YL 2AHOB 4JV5L 5FJ8G 4AYBE 5H1SE 2OTLA 1VQOA 3CC4A 2F3IA 1FJGQ 2JA6G 4DV1L 4LF4L 3KFUA 1XNRL 4JYAL 3CF5A 5JJIA 1ASZA 2ZM6L 4UP8A 1PVOA 4JI7L 1L1OA 5IT9c 2MNAA 2HHHL 1BBWA 3CC2A 1ASYA 3I4MH 3CP0A 4DV3Q 2H5XA 1JE5A 1SFOH 3F8TA 4MNOA 1A62A 2BA0A 2JA6H 1N32Q 2QGQA 3KYHC 3PCOB 4QL5A 4DR2L 1N34L 4JI6L 1B8AA 1KC8C 4EQ5A 1CKNA 1VQLA 1NJIC 4DR3L 2ALYB 2JE6I 5K36G 2JA8G 4K0KL 4DR7Q 4AIMA 1VQBA 4IFDJ 4LFCQ 3U50C 4HIOA 4WJ4A 1I50H 3DLLA 5C4XG 3GTLH 1K73C 5LMUQ 3L2PA 4OWWB 3RZDH 1GM5A 4DUYL 2E5LL 1Q82C 3I4NH 1FVIA 3TS2A 4DR7L 4DR1L 1KXLA 4LFCL 1S40A 2JA8H 1Y1VH 3ICEA 1Q1EA 3K7AH 2D0PA 1FGUA 1EYGA 3HOYG 3BZKA 1XPRA 1PYSB 1L1OB 4L5QA 4YCUA 1JMCA 3AEVA 3CCJA 1HZBA 3HOUG 1K0RA 3DM3A 3H0GH 2GN5A 2XTIA 4C2MH 2LXKA 4GS3A 3K81C 5IYBH 2KHIA 4A3MG 1XMQQ 2UXBQ 2E2JH 1PH1A 5M5XH 2OWOA 2PNHA 2VUMH 1X3GA 2JA5G 2JJQA 3OTOQ 2JA7H 1CKNB 2NVQH 1PV4A 3HOYH 3EIVA 2NN6G 3W1GA 3OW2A 4A3JH 4ME3A 1VQ9A 2VY3A 2IY5B 2RCNA 2UXBL 1A63A 1I5FA 5IYDH 2E2HH 1SROA 4R4QA 5E7NA 1LTLA 4UPAA 5IP7G 4JI5Q 1E22A 2JEBI 3I7FA 2R7ZH 2CCZA 2YYZA 1V9PA 3J81c 2VQEQ 3GO5A 2Z6KA 2EQSA 2OQ0A 2QA4A 4LFAQ 1JJCB 1U0LA 1VQEA 4HJ7A 3ERSX 2WB1E 3M7NA 1JJ2A 5IYCG 2F4VQ 5ELOA 1UE1A 1VQKA 2R93H 2ZTCA 3S1RH 2B63G 4JI4L 3K80C 2UU9Q 4LFAL 4A3LG 3UDFA 4DKAC 4A3CG 1JB7A 4JC0A 3RLNA 3CPFA 3H3VH 3GDEA 2A1AA 3KDFA 5IYCH 3CCUA 4RG1A 4YWKA 1N9WA 1VQHA 1KIXA 3PO2G 3S17H 3G71A 2B63H 5IWAQ 2K5NA 2GVBA 1VQ7A 1EWIA 4A3LH 1TWHH 3BU2A 4A3EH 1E24A 2CWPA 3KJPA 1VQ4A 2BA1A 4B3RQ 3J7ZC 4GLAC 4P71A 4BBSG 3NELA 1SMXA 3KF8B 4DR5Q 3HKZG 1YI2A 2K14A 4Y7NH 1HR0Q 2WAQE 1EUJA 4IPHA 3NENA 4LF8Q 2QEXA 1HNWQ 2BH8A 1HH2P 1T9HA 1XPOA 2ASBA 1R9TH 2KHJA 1OTCA 1XMOQ 4MZ9A 2UUAQ 4BA2I 4JI0L 4J15A 1TWAH 4O2DA 1Q12A 1X55A 2CQOA 3AQQA 3PIOA 1SR3A 1YZ6A 3CCVA 1HR0L 4LF8L 1YEZA 4AH6A 3K7UC 3RZOH 4LW1A 5M3MG 4HJ9A 1HR0W 1N33L 4GNXC 2UUAL 5FLMG 5LMNL 5C0XG 4TVAB 3PUXA 4JI2L 1AE2A 1Y1WG 1XNQQ 5LMNW 2Q2UA 3G4SA 4HIKA 4LNQA 2N78A 1E1OA 5C3EG 3K0XA 1WCMG 3PV0A 4KI0A 4JBWA 4DV1Q 4A3FG 4LF4Q 1CSQA 3HOZG 2HIXA 2LSSA 4GOPA 3CPWA 3F2BA 2ZM6Q 1VQ5A 4DV4L 4X62L 4JI7Q 1Q81C 4KHPQ 4JI8L 2FXQA 1EQQA 1G51A 3L7ZC 1GVPA 1D7QA 4P73A 2CKZB 4DAMA 4YCWA 1CUKA 1PH6A 4BXXH 4IFDI 3PIPA 4BY7H 4UY8C 3FHWA 3RN5A 4DR2Q 1N34Q 3G6EA 4A3KG 1N8RC 4JI6Q 2L15A 2JEAI 4A3DG 4KHPL 3FKIG 1L0WA 4DR3Q 3EBEA 4B3TQ 4K0KQ 3PF4A 3EN2A 5HGQA 5GROA 3J80i 4JCVE 5FJ8H 1EIYB 5GAGC 2AWNA 2PQAA 4QIWE 2LXJA 3W1BA 5IP9G 4DV4Q 2MQHA 1CSPA 3S1QH 4DUYQ 1B7YB 2E5LQ 3RNUA 2EXDA 1C7YA 1YVCA 3FKIH 3RLFA 4B3TL 4QQBX 4IJHA 2NZHA 2NVYH 4A75A 4DR1Q 3CCQA 1PH4A 1XPUA 4R4IA 1LUZA 3JAMi 1Q1BA 4GOPB 3BJUA 2K5VA 1HZ9A 4TQUS 1YHBA 1QUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME A;  1I94 Q;  2VW9 A;  1IZ6 A;  2I5L X;  3TEH B;  4O0A A;  2R92 G;  1YNX A;  3GTG H;  3ER0 A;  2HIV A;  1IBL Q;  4B3S L;  1FL0 A;  4KHZ A;  3I55 A;  5C4X H;  4GKJ L;  4BA1 I;  1PA6 A;  4JBJ A;  1NTG A;  1SE8 A;  2I5H A;  1I94 L;  3JC6 6;  1PH9 A;  1J5E Q;  4JBK A;  4OO1 I;  3KF6 A;  1SRU A;  5IE8 A;  4C3J H;  3M4P A;  2KCM A;  2VS1 A;  4GLX A;  1VQN A;  2R92 H;  4OWT B;  2PQA B;  3NBH B;  2RHS B;  1IBL L;  4LFB L;  1X3F A;  4C3H H;  1X3E A;  2Y0S G;  5M3F G;  4GNX A;  3A5Z B;  3UDX A;  4HJA A;  1EFW A;  4A3I G;  4NPS A;  5GAH C;  2UUC Q;  3HOU H;  1J5E L;  1VQ8 A;  1WI5 A;  3TRZ A;  2K5H A;  3K8A A;  4MTN A;  1IBK Q;  3STB C;  4DV6 Q;  1X6O A;  1G29 1;  5IY0 A;  4A3M H;  4LUZ A;  4GOP C;  1QUQ B;  1X56 A;  1MIU A;  2JA5 H;  3GTO H;  1TWC H;  2I5M X;  4JI4 Q;  2UUC L;  4B3M L;  1UE5 A;  5EAY A;  3S24 A;  3UE1 A;  1QZH A;  4A3I H;  4BBR G;  5C44 G;  4JI3 L;  4LF9 Q;  4APV A;  1IBK L;  2OQK A;  4DV6 L;  3M3Y H;  2MO1 A;  3CAM A;  1HNX L;  4A3G G;  3D31 A;  5J3B A;  3CCS A;  1VQM A;  4P75 A;  3I56 A;  2WB1 G;  1GD7 A;  2CWA A;  3TQY A;  3E9I A;  2K50 A;  3MEF A;  5IP7 H;  3VDY A;  2PMZ E;  1N36 L;  1VQC A;  2ES2 A;  3KF6 B;  2Q2I A;  4NB3 A;  1GO3 E;  3UDG A;  2E2I H;  4IFD G;  4YWL A;  1NMF A;  1Z9F A;  2YTY A;  4LF9 L;  2Z0S A;  1KRT A;  4GNX B;  1NMG A;  1BVS A;  2A19 A;  4DR6 Q;  5JEA J;  3CCL A;  3CC7 A;  1JJG A;  1PH3 A;  4PZ7 A;  4X64 L;  4GKK L;  1IXR A;  4A3B G;  4A3C H;  4YHH Q;  1YHA A;  2Q2T A;  3W5O A;  1YJN A;  4JI0 Q;  5M5Y H;  4DR6 L;  1W3S A;  5FLX c;  4RMF A;  4YY3 Q;  4PMW A;  1HNZ L;  4GN5 A;  1LYL A;  4NXN L;  3HKS A;  3PO2 H;  1EOV A;  3PF5 A;  3S2H H;  1N33 Q;  2N8N A;  4A93 G;  5ELN A;  3GTJ H;  1V1Q A;  4XTC S;  4YHH L;  5LMN Q;  3J80 c;  1VQP A;  3J7A 5;  2N49 A;  2UXC L;  4JI2 Q;  3TS0 A;  4YY3 L;  4JG2 A;  4BBS H;  4FDB A;  1WFQ A;  4LF6 L;  4XIG S;  1X65 A;  3PGZ A;  2AKW B;  3RR5 A;  3HKZ E;  1B70 B;  3STB D;  4LF5 L;  3GTK H;  1HZA A;  5AJ3 Q;  1YBY A;  3JAM c;  2EIF A;  4X62 Q;  4OO1 G;  1HZC A;  4JI8 Q;  1RIP A;  2N3S A;  2C35 B;  2IT1 A;  3B6Y A;  1K3R A;  5M3M H;  1LM0 A;  5FLM H;  2ZTE A;  1M90 C;  3KJO A;  2YV5 A;  5AJ3 L;  4OX9 L;  1WOC A;  3S1M H;  1I6H H;  3CQZ H;  1Y1W H;  2NN6 I;  4DV0 L;  2DUD A;  1UE7 A;  1Q8K A;  1RL2 A;  3HOV G;  1SN8 A;  4JOI A;  5C3E H;  1S3O A;  2PI2 E;  3NEM A;  3D0F A;  1P8L A;  1WCM H;  1EIF A;  4R4T A;  5GAE C;  4AYB G;  2IX1 A;  1VCI A;  3GTM H;  4A3F H;  4P72 A;  3CCR A;  2IX0 A;  3GTQ H;  3HOZ H;  1QZG A;  4LWC A;  1PH8 A;  1A0I A;  1QVC A;  3T1H L;  3PSI A;  2K4K A;  1UEB A;  4DUZ Q;  4HJ8 A;  4YCV A;  1OXU A;  4IPD A;  4X66 L;  3H3V I;  2PI2 A;  3HOW G;  2NZO A;  2KEN A;  1X54 A;  3PUY A;  1S72 A;  4PZ6 A;  4A3K H;  2VNU D;  1K9M C;  2E8G A;  3I4M G;  1O7I A;  4A3D H;  1HJP A;  3M4Q A;  4BY1 G;  1A8V A;  4DUZ L;  3UE0 A;  2VL6 A;  1VQF A;  1GKH A;  2K52 A;  4IOC A;  1YIJ A;  4B3S Q;  3S15 H;  4DR4 Q;  2UUB Q;  3S2D H;  4DNI A;  4JI1 Q;  4GKJ Q;  3AYH B;  5HY6 A;  1QVG A;  3HOW H;  5IP9 H;  2R93 G;  3GTP H;  1PYB A;  3G48 A;  1OXT A;  1VQJ A;  3IRB A;  1TWF H;  1KAW A;  3Q8D A;  4DK6 C;  1AE3 A;  2AMC B;  4BY1 H;  4LFB Q;  1FJG L;  4DR4 L;  4DPG A;  1E1T A;  1UE6 A;  2UUB L;  5JJK A;  5JJL A;  4JI1 L;  3WWV A;  3I2Z A;  2YTX A;  2JQO A;  4P74 A;  1CKM A;  5GAD C;  4LF7 Q;  3FP9 A;  1C9O A;  3ZJY C;  3I4N G;  3F2C A;  1E3P A;  3L0O A;  4L5R C;  4ALP A;  4IJL A;  1Y1V G;  4DV3 L;  2YU9 H;  1I3Q H;  5C4J H;  1KRS A;  4PZ8 A;  2VQF Q;  1QVF A;  2WP8 J;  1WJJ A;  2IHE A;  2B3G A;  2WFW A;  1N32 L;  4LF7 L;  1BKB A;  1Y14 B;  2ZJR A;  3H0G G;  5IYB G;  1PHJ A;  4IOA A;  4B3M Q;  1YHQ A;  4DK3 C;  4JI3 Q;  1MJE A;  1MKH A;  4HJ5 A;  3OYY A;  4UP9 A;  2K75 A;  2VUM G;  3E9H A;  1HNX Q;  4DV2 Q;  3M9B A;  1UWV A;  3H15 A;  2VQF L;  1YJW A;  3HOX G;  1WYD A;  4L5T A;  3ULL A;  1D8L A;  1X9N A;  1IBM Q;  3S1N H;  5LMU L;  1N36 Q;  3S16 H;  5M3F H;  5C0X I;  4A3J G;  3CMA A;  1NY4 A;  2B29 A;  2MO0 A;  1P16 A;  5IYD G;  2OTJ A;  4JOI C;  1U5K A;  1KQS A;  2RF4 A;  2Y0S E;  1Q46 A;  4GLV B;  1VQD A;  4DV2 L;  4DV7 Q;  2OCE A;  2R7Z G;  5BR8 Q;  4LUO A;  1IBM L;  3HOX H;  4OON A;  2KCT A;  1Z47 A;  3U58 A;  1XTD A;  2RHQ B;  4L5S A;  1V43 A;  3A0J A;  2I0Q A;  4X64 Q;  1M1K C;  1XMQ L;  3PUZ A;  1VQG A;  2BH2 A;  4GKK Q;  4BBR H;  5C44 H;  4QGU A;  3CXC A;  4DV7 L;  5DLQ E;  4GN3 B;  4IPC A;  5BR8 L;  4A3G H;  5C0X J;  2KBN A;  1CKO A;  3OTO L;  3F1Z A;  2ZJP A;  1HNZ Q;  1NE3 A;  4JBM A;  1K83 H;  4GN4 B;  4NXN Q;  1JT8 A;  2JA9 A;  1IYJ B;  1J6Q A;  4EX5 A;  4AQY Q;  3PO3 G;  1BBU A;  1K8G A;  3LGJ A;  4R1J A;  2UXC Q;  4JI5 L;  3CCM A;  3M85 A;  3U4V A;  1L1O C;  1OXS C;  1KHI A;  1VQA A;  4H02 A;  2VQE L;  5M5W H;  4X6A H;  3J81 j;  1K8A C;  2MFI A;  4YWM A;  1PH2 A;  4A3E G;  2DGY A;  4LF6 Q;  4QJF A;  2WAQ G;  4AQY L;  4A3B H;  1G6P A;  1Q7Y C;  2D62 A;  3PO3 H;  2F4V L;  4R4O A;  2CFM A;  3PUV A;  4LF5 Q;  2VZA A;  1DGS A;  2AWO A;  2ATW A;  4HIM A;  1NBW A;  2IHF A;  4POF A;  2NVX H;  2UU9 L;  3SGI A;  3GD7 A;  4QY7 A;  4PG3 A;  1VQI A;  1OXV A;  4OXP A;  3S14 H;  2NVT H;  3E0E A;  4A93 H;  4NXM Q;  3BZC A;  2ZJQ A;  3AFQ A;  3CW2 C;  4OX9 Q;  3U4Z A;  4X65 Q;  4HID A;  1SLJ A;  3I4O A;  5IWA L;  4DV0 Q;  2JK8 A;  4A76 A;  1Q86 C;  2V1C C;  1H95 A;  2R6G A;  3MXN B;  3CD6 A;  2JA7 G;  1IL2 A;  3J81 i;  4B3R L;  4NXM L;  1W2B A;  1L2F A;  5GQO A;  2GVA A;  2HQL A;  4DV5 Q;  1VQ6 A;  1PH5 A;  4C3I H;  4POG A;  1VS0 A;  4DR5 L;  4X65 L;  2UXD Q;  4A4I A;  1MJC A;  1HNW L;  4Y52 H;  2A8V A;  1TXY A;  2YTV A;  1YJ9 A;  3PUW A;  3T1H Q;  2Q2H A;  2HT1 A;  2ZTD A;  1KL9 A;  3KDF B;  4X66 Q;  4UP7 A;  3CCE A;  1XMO L;  1PH7 A;  2F52 A;  4IPG A;  3A74 A;  1AH9 A;  2R7F A;  5JEA G;  4DV5 L;  2R7D A;  1TWG H;  4KLK A;  3KLW A;  2UXD L;  1KD1 C;  3T1Y Q;  3RN2 A;  3KOJ A;  3ULP A;  4JV5 Q;  4IO9 A;  4BXX G;  2D0O A;  3AFP A;  3TRE A;  4BY7 G;  3HOV H;  3M4O H;  1E7Z A;  4WJ3 M;  1C0A A;  1XNR Q;  3ULJ A;  3UDI A;  3RLO A;  4OWX B;  3A5U A;  1YIT A;  4JYA Q;  2Z6K C;  4R4C A;  1XJV A;  1XNQ L;  2ID0 A;  1EQR A;  3F2D A;  1PFS A;  3HFZ B;  2HHH Q;  4LUV A;  2XGT A;  1OXX K;  4DAY B;  3T1Y L;  2AHO B;  4JV5 L;  5FJ8 G;  4AYB E;  5H1S E;  2OTL A;  1VQO A;  3CC4 A;  2F3I A;  1FJG Q;  2JA6 G;  4DV1 L;  4LF4 L;  3KFU A;  1XNR L;  4JYA L;  3CF5 A;  5JJI A;  1ASZ A;  2ZM6 L;  4UP8 A;  1PVO A;  4JI7 L;  1L1O A;  5IT9 c;  2MNA A;  2HHH L;  1BBW A;  3CC2 A;  1ASY A;  3I4M H;  3CP0 A;  4DV3 Q;  2H5X A;  1JE5 A;  1SFO H;  3F8T A;  4MNO A;  1A62 A;  2BA0 A;  2JA6 H;  1N32 Q;  2QGQ A;  3KYH C;  3PCO B;  4QL5 A;  4DR2 L;  1N34 L;  4JI6 L;  1B8A A;  1KC8 C;  4EQ5 A;  1CKN A;  1VQL A;  1NJI C;  4DR3 L;  2ALY B;  2JE6 I;  5K36 G;  2JA8 G;  4K0K L;  4DR7 Q;  4AIM A;  1VQB A;  4IFD J;  4LFC Q;  3U50 C;  4HIO A;  4WJ4 A;  1I50 H;  3DLL A;  5C4X G;  3GTL H;  1K73 C;  5LMU Q;  3L2P A;  4OWW B;  3RZD H;  1GM5 A;  4DUY L;  2E5L L;  1Q82 C;  3I4N H;  1FVI A;  3TS2 A;  4DR7 L;  4DR1 L;  1KXL A;  4LFC L;  1S40 A;  2JA8 H;  1Y1V H;  3ICE A;  1Q1E A;  3K7A H;  2D0P A;  1FGU A;  1EYG A;  3HOY G;  3BZK A;  1XPR A;  1PYS B;  1L1O B;  4L5Q A;  4YCU A;  1JMC A;  3AEV A;  3CCJ A;  1HZB A;  3HOU G;  1K0R A;  3DM3 A;  3H0G H;  2GN5 A;  2XTI A;  4C2M H;  2LXK A;  4GS3 A;  3K81 C;  5IYB H;  2KHI A;  4A3M G;  1XMQ Q;  2UXB Q;  2E2J H;  1PH1 A;  5M5X H;  2OWO A;  2PNH A;  2VUM H;  1X3G A;  2JA5 G;  2JJQ A;  3OTO Q;  2JA7 H;  1CKN B;  2NVQ H;  1PV4 A;  3HOY H;  3EIV A;  2NN6 G;  3W1G A;  3OW2 A;  4A3J H;  4ME3 A;  1VQ9 A;  2VY3 A;  2IY5 B;  2RCN A;  2UXB L;  1A63 A;  1I5F A;  5IYD H;  2E2H H;  1SRO A;  4R4Q A;  5E7N A;  1LTL A;  4UPA A;  5IP7 G;  4JI5 Q;  1E22 A;  2JEB I;  3I7F A;  2R7Z H;  2CCZ A;  2YYZ A;  1V9P A;  3J81 c;  2VQE Q;  3GO5 A;  2Z6K A;  2EQS A;  2OQ0 A;  2QA4 A;  4LFA Q;  1JJC B;  1U0L A;  1VQE A;  4HJ7 A;  3ERS X;  2WB1 E;  3M7N A;  1JJ2 A;  5IYC G;  2F4V Q;  5ELO A;  1UE1 A;  1VQK A;  2R93 H;  2ZTC A;  3S1R H;  2B63 G;  4JI4 L;  3K80 C;  2UU9 Q;  4LFA L;  4A3L G;  3UDF A;  4DKA C;  4A3C G;  1JB7 A;  4JC0 A;  3RLN A;  3CPF A;  3H3V H;  3GDE A;  2A1A A;  3KDF A;  5IYC H;  3CCU A;  4RG1 A;  4YWK A;  1N9W A;  1VQH A;  1KIX A;  3PO2 G;  3S17 H;  3G71 A;  2B63 H;  5IWA Q;  2K5N A;  2GVB A;  1VQ7 A;  1EWI A;  4A3L H;  1TWH H;  3BU2 A;  4A3E H;  1E24 A;  2CWP A;  3KJP A;  1VQ4 A;  2BA1 A;  4B3R Q;  3J7Z C;  4GLA C;  4P71 A;  4BBS G;  3NEL A;  1SMX A;  3KF8 B;  4DR5 Q;  3HKZ G;  1YI2 A;  2K14 A;  4Y7N H;  1HR0 Q;  2WAQ E;  1EUJ A;  4IPH A;  3NEN A;  4LF8 Q;  2QEX A;  1HNW Q;  2BH8 A;  1HH2 P;  1T9H A;  1XPO A;  2ASB A;  1R9T H;  2KHJ A;  1OTC A;  1XMO Q;  4MZ9 A;  2UUA Q;  4BA2 I;  4JI0 L;  4J15 A;  1TWA H;  4O2D A;  1Q12 A;  1X55 A;  2CQO A;  3AQQ A;  3PIO A;  1SR3 A;  1YZ6 A;  3CCV A;  1HR0 L;  4LF8 L;  1YEZ A;  4AH6 A;  3K7U C;  3RZO H;  4LW1 A;  5M3M G;  4HJ9 A;  1HR0 W;  1N33 L;  4GNX C;  2UUA L;  5FLM G;  5LMN L;  5C0X G;  4TVA B;  3PUX A;  4JI2 L;  1AE2 A;  1Y1W G;  1XNQ Q;  5LMN W;  2Q2U A;  3G4S A;  4HIK A;  4LNQ A;  2N78 A;  1E1O A;  5C3E G;  3K0X A;  1WCM G;  3PV0 A;  4KI0 A;  4JBW A;  4DV1 Q;  4A3F G;  4LF4 Q;  1CSQ A;  3HOZ G;  2HIX A;  2LSS A;  4GOP A;  3CPW A;  3F2B A;  2ZM6 Q;  1VQ5 A;  4DV4 L;  4X62 L;  4JI7 Q;  1Q81 C;  4KHP Q;  4JI8 L;  2FXQ A;  1EQQ A;  1G51 A;  3L7Z C;  1GVP A;  1D7Q A;  4P73 A;  2CKZ B;  4DAM A;  4YCW A;  1CUK A;  1PH6 A;  4BXX H;  4IFD I;  3PIP A;  4BY7 H;  4UY8 C;  3FHW A;  3RN5 A;  4DR2 Q;  1N34 Q;  3G6E A;  4A3K G;  1N8R C;  4JI6 Q;  2L15 A;  2JEA I;  4A3D G;  4KHP L;  3FKI G;  1L0W A;  4DR3 Q;  3EBE A;  4B3T Q;  4K0K Q;  3PF4 A;  3EN2 A;  5HGQ A;  5GRO A;  3J80 i;  4JCV E;  5FJ8 H;  1EIY B;  5GAG C;  2AWN A;  2PQA A;  4QIW E;  2LXJ A;  3W1B A;  5IP9 G;  4DV4 Q;  2MQH A;  1CSP A;  3S1Q H;  4DUY Q;  1B7Y B;  2E5L Q;  3RNU A;  2EXD A;  1C7Y A;  1YVC A;  3FKI H;  3RLF A;  4B3T L;  4QQB X;  4IJH A;  2NZH A;  2NVY H;  4A75 A;  4DR1 Q;  3CCQ A;  1PH4 A;  1XPU A;  4R4I A;  1LUZ A;  3JAM i;  1Q1B A;  4GOP B;  3BJU A;  2K5V A;  1HZ9 A;  4TQU S;  1YHB A;  1QUQ A; 
#chains in the Genus database with same CATH topology
 3CME A;  1EOT A;  2VXW A;  2VW9 A;  2EY2 A;  3ER0 A;  5JVG 3;  4KHZ A;  4NP5 A;  5FLX L;  1H9S A;  2GA4 B;  4DXF A;  1B44 D;  4ZLT F;  1J5E Q;  4OO1 I;  3KF6 A;  4UHV A;  2VS1 A;  3DEO A;  4GLX A;  1KDC A;  3EFX D;  2O2L D;  2PQA B;  1K3B C;  2K04 A;  4C3H H;  2Y0S G;  4OL7 A;  3J80 L;  1WD0 A;  3A5Z B;  3DUZ A;  3HRZ C;  1QNU A;  1EFW A;  3IAY A;  4DV6 Q;  1CHQ D;  5BN3 A;  4B08 A;  2KHS A;  1XX8 A;  1MIU A;  3SR1 A;  1QB5 D;  3IKJ A;  5CMD A;  3JAM L;  3UE1 A;  4BBR G;  4HMI A;  4WRD A;  1ENF A;  1IBK L;  3M3Y H;  1EY7 A;  4A3D B;  1VQM A;  4P75 A;  3I56 A;  1H9S B;  3EJI A;  2CWA A;  3MEF A;  2K50 A;  4HR7 B;  1PRT C;  1AN8 A;  3KF6 B;  1EEI D;  2E2I H;  4YWL A;  1Z9F A;  3Q0A A;  4LF9 L;  2K5D A;  1LTT D;  2R61 A;  3CC7 A;  1JJG A;  1PH3 A;  1IXR A;  2IWH A;  4YHH Q;  5CV4 A;  4PMW A;  3HKS A;  5CV6 A;  5G3L F;  3S2H H;  4A93 G;  3MXU A;  5ELN A;  1IW7 C;  3GTJ H;  4XTC S;  4KKU A;  3OPO A;  1EL0 A;  1L0X B;  2RSO A;  4Z9C B;  3S1N B;  1X65 A;  2EJF C;  4B9X A;  2AKW B;  2I46 A;  2EIF A;  1HZC A;  2H1E A;  1S4Z A;  1EY4 A;  3R3O A;  1K3R A;  4KY6 A;  2Q8R E;  2E2I B;  3KJO A;  2IL8 A;  4XQN A;  2A69 C;  3S1M H;  3CQZ H;  3SVM A;  4C1N I;  1PRT D;  1KNE A;  1P8L A;  5GAE C;  3NP8 A;  4HTH A;  2QDL A;  5NUC A;  4P72 A;  5IGC A;  2IX0 A;  3CCR A;  2B2W C;  3HOZ H;  1QZG A;  4LWC A;  3TN2 A;  4DUZ Q;  1UEB A;  1H9K A;  2J0T D;  4IPD A;  3HOW G;  1I6V C;  1EQT A;  4IQZ A;  3S2H B;  1JB3 A;  3GTJ B;  3M4Q A;  4BY1 G;  1SAP A;  3Q22 A;  1KNA A;  2H4O A;  1BCP F;  1DOL A;  1QVG A;  2MUY A;  1IW7 D;  4KKT A;  3GTP H;  1VQJ A;  1KAW A;  1AE3 A;  4CDC C;  1FJG L;  4DR4 L;  1E1T A;  2UUB L;  1B2T A;  2DNC A;  1JQY D;  2EJM A;  1QJO A;  2Z6B A;  1E3P A;  4L5R C;  1VDZ A;  2B8F A;  2RBM A;  2YU9 H;  3OMC A;  4PZ8 A;  1QVF A;  3S1M B;  1N32 L;  1C8C A;  3VR3 A;  1RJT A;  4IOA A;  4B3M Q;  5IGG A;  1YHQ A;  4ODG A;  3M9B A;  3H15 A;  2VQF L;  1D8L A;  4IUU A;  1N36 Q;  4A3J G;  1NY4 A;  2MO0 A;  1EY8 A;  2JSO A;  2OTJ A;  4JOI C;  2RF4 A;  3MTS A;  3HOX H;  1Z47 A;  2RHQ B;  4L5S A;  5LL6 S;  2SEB D;  3K0Y A;  4X64 Q;  1VQG A;  4JPB W;  4ME5 A;  4GKK Q;  2QW7 A;  4BBR H;  3VA5 A;  3BS1 A;  4QGU A;  1JR0 D;  3GTP B;  4OIK A;  1CI3 M;  4DV7 L;  5DLQ E;  4IPC A;  5KRU A;  5EBC A;  3OTO L;  3F1Z A;  4JBM A;  1HNZ Q;  1NR4 A;  2HCI A;  1FD7 D;  2JA9 A;  4FO2 A;  4QMG A;  4WJW A;  3MXN A;  2YU9 B;  5FK9 C;  4G7H C;  1KHI A;  1VQA A;  1IL8 A;  4H02 A;  4V19 0;  5IGF A;  1YNJ C;  3J81 j;  1K8A C;  2V4D A;  3BZD B;  4YWM A;  2DGY A;  1UEA B;  2L4N A;  1DOK A;  2D62 A;  3PQI A;  4R4O A;  4G57 A;  4LF5 Q;  2RDG A;  2VZA A;  3K7A B;  3VR2 A;  4HIM A;  3GD7 A;  3X3M A;  3M7G A;  4OXP A;  3H0G B;  3E0E A;  3DEP A;  4A93 H;  3BZC A;  2ZJQ A;  3GP7 A;  2DY8 A;  4X65 Q;  3I4O A;  4J6H A;  5IWA L;  5ELB A;  2JK8 A;  1Q86 C;  2V1C C;  3HOX B;  4KJO A;  2R6G A;  3MXN B;  4KMU C;  1TR5 A;  3ERO A;  1IL2 A;  1W2B A;  3VYS A;  1E0B A;  2GVA A;  2HQL A;  1VQ6 A;  2E2H B;  5BN5 A;  1HNW L;  3QIA A;  3PUW A;  3T1H Q;  3N52 A;  1LTR D;  2R7Z B;  3MXG A;  2R3Z A;  1XMO L;  1PTO C;  4IPG A;  3A74 A;  2R7D A;  1TWG H;  1Q90 A;  4CJ2 C;  1VMP A;  2F4I A;  3T1Y Q;  3ULP A;  4JV5 Q;  4BXX G;  2D0O A;  2IW3 A;  3TRE A;  3S1R B;  1HHV A;  2Z4H A;  4JYA Q;  3RLO A;  4OWX B;  1SE4 A;  2Z6K C;  1XJV A;  1XNQ L;  2ID0 A;  2HHH Q;  3SK6 A;  5C3X A;  2OEO A;  4DAY B;  2AHO B;  3DMU A;  5IGB A;  3TSS A;  2OTL A;  1YNJ D;  5C3W A;  1HFN A;  1B53 A;  3MAQ A;  1XNR L;  2F1M A;  1STG A;  2ZM6 L;  1PVO A;  1L1O A;  4A93 B;  4I65 A;  1BXT A;  4G7Z C;  4MN3 A;  1TQO A;  1SFO H;  3MHB A;  4F8M A;  2BA0 A;  2QGQ A;  4U68 A;  3PCO B;  1N34 L;  2HDL A;  4JI6 L;  1B8A A;  1NJI C;  1MD2 D;  1V1P A;  1TWA B;  2ZT9 C;  1I50 H;  1RTO A;  2MGS A;  3FVQ A;  1PZI D;  5LMU Q;  1GXD C;  3L2P A;  4OWW B;  3RZD H;  2F0V A;  1RKN A;  2E5L L;  3I72 A;  1FVI A;  4DR7 L;  1KXL A;  2JA8 H;  1TWG B;  3ICE A;  1Q1E A;  1I4H A;  1EYG A;  3BZK A;  1B4O A;  1L1O B;  2IJ0 A;  1PTO D;  3OSO A;  3CCJ A;  1HZB A;  1U4R A;  1K0R A;  4H0L C;  3HOU G;  4RAU C;  2F0G A;  4GS3 A;  2LY7 A;  2K6A A;  5IIF A;  1MBY A;  2E2J H;  1PH1 A;  2F0M A;  5J39 A;  2OWO A;  2PNH A;  2JA5 G;  2NVQ H;  4Q0F A;  4ZUI A;  3HOY H;  2NN6 G;  4A3J H;  1V1P B;  4ME3 A;  5E7N A;  2KEE A;  2DNE A;  3J7Y W;  5FO8 B;  1E22 A;  4XXE A;  3TME A;  1GUG A;  2L0C A;  2CCZ A;  3J81 c;  3GO5 A;  1B9N A;  1WTP A;  3NUC A;  2WB1 E;  1KTK A;  3NTI A;  1I4G A;  2ZTC A;  1I50 B;  1JC7 A;  2OT2 A;  1H9R A;  3D8G A;  4NMZ A;  3RLN A;  1LAC A;  3H3V H;  3NXW A;  2A68 C;  3A8I E;  4KK7 A;  5ELE A;  5IYC H;  2JA8 B;  3PO2 G;  3TBI B;  2JP1 A;  4CKE A;  1IHZ A;  4HSV A;  1EU3 A;  1PFB A;  1TWH H;  4K2K A;  4GZY C;  1E24 A;  1VQ4 A;  4KY5 A;  3KJP A;  2BA1 A;  2F0D A;  2WKD A;  2F0N A;  4GLA C;  2F0K A;  4C3J B;  4BBS G;  2PYK A;  5JPN C;  5CV5 A;  2WAQ E;  2K33 A;  3NEN A;  3AU7 A;  1HH2 P;  1T9H A;  2ASB A;  1ONL A;  3HOY B;  2AQ3 B;  1DD2 A;  1QNK A;  2WKC A;  1AZQ A;  4BA2 I;  2B2Y C;  4X3K A;  4A3M B;  3PIO A;  1CA5 A;  3CCV A;  1YEZ A;  2O4X A;  4HJ9 A;  4GNX C;  3FDT A;  3PUX A;  2QEJ C;  3E3X A;  3G4S A;  3K0X A;  3Q6S A;  2EE1 A;  1JWU D;  1K28 A;  2XIW A;  4JBW A;  4LF4 Q;  2LSS A;  1VQ5 A;  4ZYS A;  2D9U A;  1Z6H A;  2DN8 A;  4P73 A;  4DAM A;  4BXX H;  4IFD I;  3PIP A;  1BQQ T;  4FXK C;  2A68 D;  4A3D G;  1PMR A;  4DR3 Q;  5KNC A;  1KAB A;  1WTH A;  2F3W A;  3X3N A;  2KJX A;  4QIW E;  1TY0 A;  5IP9 G;  2MQH A;  1WTQ A;  1JIC A;  2F0O A;  3HGB A;  1C7Y A;  1Y8O B;  1YVC A;  2F0I A;  4B3T L;  4QQB X;  1UAP A;  2NVY H;  5CBA E;  1PH4 A;  1ROD A;  5HUR A;  3HKZ B;  1K8M A;  2EY1 A;  1L0Y B;  4YIJ A;  4O0A A;  2HIV A;  4DAP A;  1IBL Q;  3T53 B;  1CT1 D;  4JBJ A;  1EQV A;  1I94 L;  1PRT B;  3JC6 6;  1PH9 A;  3L9A X;  3M4P A;  2KCM A;  1VQN A;  4RGO S;  3NBH B;  4V0B A;  4DNR B;  1Y1W B;  1I6H B;  3P75 A;  4X3U A;  5KGU A;  2SDF A;  3UDX A;  5C3E B;  3EA6 A;  2UUC Q;  1BDO A;  2EYJ A;  4RGN A;  4EGV A;  3HOU H;  1VQ8 A;  1WI5 A;  4A3F B;  3K8A A;  3STB C;  3DWA A;  4LUZ A;  2CHB D;  4CDE C;  3WOE A;  2JA5 H;  1JOQ A;  3M4Y A;  3NHH A;  2I5M X;  4JI4 Q;  4G7O C;  4B3M L;  1QZH A;  1PLF A;  1HQM C;  4APV A;  2ICI A;  3CAM A;  5J3B A;  1IYU A;  2KCC A;  4UDU C;  4RGM A;  1GD7 A;  2NVY B;  3GV3 A;  3K5L A;  1N36 L;  1Y8N B;  2PMZ E;  2B2W A;  3K6O A;  3S15 B;  1IYV A;  1S5E D;  3QO2 A;  1QE6 A;  1NMG A;  2RCF A;  3CCL A;  5HGT A;  1DCZ A;  4EVO A;  4X64 L;  2F0W A;  4GKK L;  4A3B G;  5A2Q E;  2Q2T A;  2X69 A;  3W5O A;  4JI0 Q;  4DR6 L;  1FR3 A;  5FLX c;  4YY3 Q;  1HNZ L;  2EYF A;  3C1E A;  1LYL A;  3A54 A;  3PO2 H;  1E2V A;  2KVM A;  3C1F A;  1EOV A;  5EKL A;  2N8N A;  5LMN Q;  5KND A;  3J80 c;  1LAB A;  3VA7 A;  1EY9 A;  1F2Y A;  3QR8 A;  5F2D A;  4BBS H;  2JN4 A;  1NCV A;  1WFQ A;  1MGS A;  1D5Z C;  5FO7 B;  3OIQ A;  1PDQ A;  3RR5 A;  3STB D;  4LF5 L;  1RHP A;  1HZA A;  2F0Q A;  4ZKB B;  3JAM c;  4X62 Q;  2KED A;  1PXU A;  1FYC A;  2B2U C;  3B6Y A;  3TP5 A;  1SDF A;  3E5S A;  1LM0 A;  2LMC B;  1LO5 D;  2ZTE A;  2YV5 A;  1F9S A;  5AJ3 L;  1MSH A;  2NN6 I;  2DUD A;  1UE7 A;  1RL2 A;  1SN8 A;  4JOI A;  2D2C C;  3D0F A;  1ILQ A;  2RA4 A;  2RQX A;  3BYT B;  4R4T A;  1VCI A;  3D4D A;  3D6C A;  2FHT A;  2KA7 A;  1PH8 A;  1A0I A;  1QVC A;  2PW5 A;  3T1H L;  3PSI A;  4PV1 C;  5M5W B;  3PO2 B;  2PI2 A;  2KEN A;  2FFK B;  1HPC A;  1D2B A;  1S72 A;  4PZ6 A;  1K9M C;  1O7I A;  4A3D H;  3UE0 A;  1GKH A;  4BBS B;  3S2D H;  4DNI A;  2QIL A;  5HY6 A;  5KYI A;  5IP9 H;  1PYB A;  2K05 A;  2K1B A;  1R4P B;  3S14 B;  1B9M A;  1IKM A;  2QF7 A;  4L6T B;  1SNM A;  3Q8D A;  3FMC A;  4LFB Q;  5JJK A;  3D4W A;  4JI1 L;  3I2Z A;  2JQO A;  5FO9 B;  4WFN 3;  3ZJY C;  1CZW A;  2ZXR A;  3OWE B;  5CV9 A;  5COY A;  4XT1 B;  1KRS A;  4EQO A;  1WJJ A;  1FNU A;  2IHE A;  2WFW A;  3H91 A;  1SMY C;  1HA5 A;  4LF7 L;  3H0G G;  4KJN A;  1MJE A;  1NNX A;  5CV7 A;  4HJ5 A;  2K75 A;  1HNX Q;  4ABN A;  4DV2 Q;  5I2Y A;  1YJW A;  5CC4 A;  3HOX G;  1IBM Q;  3S1N H;  2BDN A;  1LTB D;  5CBE E;  5LMU L;  1WVL A;  3S16 H;  1EY6 A;  2XRS D;  3HOV B;  3M4O B;  3T4A C;  1LTA D;  1U5K A;  2Y0S E;  4IUQ A;  2OCE A;  2R7Z G;  5DM7 3;  4OON A;  5EPJ A;  1U4M A;  3A0J A;  3S2D B;  1M1K C;  1WTV A;  3CXC A;  4GN3 B;  5BR8 L;  1H9J A;  2C9O A;  3NWT A;  2I07 B;  1K83 H;  1O78 A;  1JWS D;  4GN4 B;  4NXN Q;  5FOB B;  1LT6 D;  1IYJ B;  1ICW A;  4PQX A;  4R1J A;  2UXC Q;  2FMC A;  3U4V A;  1QCB D;  1OXS C;  1KAA A;  1SXT A;  3I70 A;  3P7J A;  2MFI A;  1PH2 A;  1TU2 B;  3SK8 A;  4QJF A;  4AQY L;  4A3B H;  4DK0 A;  1JOO A;  1Q7Y C;  1PTO B;  3I4N B;  1BCP C;  3PUV A;  5G3L D;  1GUN A;  1DGS A;  1Y1V B;  2ATW A;  2WIN B;  1TY2 A;  2NVX H;  3SGI A;  3OHX C;  3S16 B;  2F0H A;  3KLR A;  1HCZ A;  2NVT H;  4NXM Q;  3AFQ A;  3CW2 C;  3U4Z A;  1MSG A;  1I4Q A;  2B39 A;  5JVH 3;  3OW7 A;  3CD6 A;  4UAI A;  3PIO 3;  3WDN A;  4C3I H;  4R8N A;  2UXD Q;  4Y52 H;  5COR A;  3KBX A;  2A8V A;  1TXY A;  1YJ9 A;  4FYD A;  2Q2H A;  2HT1 A;  2ZTD A;  1KL9 A;  1K83 B;  2OXP A;  1PH7 A;  3K5O A;  1MI2 A;  5JEA G;  4DV5 L;  4HSP A;  4K5W A;  1KD1 C;  4ZUJ A;  4IO9 A;  2DJG C;  3AFP A;  1ML0 D;  1C0A A;  1I4X A;  4RCN A;  3UDI A;  3IFD A;  3A5U A;  1YIT A;  1B3A A;  1PFS A;  3HFZ B;  3MA2 B;  4A3B B;  4LUV A;  2XGT A;  3PIP 3;  3CC4 A;  4RHR A;  4LF4 L;  1UNS A;  2NVX B;  3CF5 A;  5FKA C;  1ASZ A;  4A3E B;  1A3U A;  1BCP D;  1BBW A;  2A6H C;  3CC2 A;  2NVT B;  5I9O A;  4DV3 Q;  2NWG A;  3KUP A;  4MNO A;  4C1N K;  3I91 A;  2JA6 H;  3KYH C;  2FMM A;  4QL5 A;  4ZCK A;  4EQ5 A;  1CKN A;  4DR3 L;  2ALY B;  2PNR C;  4HMJ A;  4OEM B;  3RMH A;  2JA8 G;  5K36 G;  3U50 C;  4FF3 A;  4WJ4 A;  4C3I B;  1G2T A;  3GV6 A;  1K73 C;  5D3I B;  5J22 A;  1GM5 A;  2CW0 C;  4C3J G;  1Q82 C;  3I73 A;  2A69 D;  4LFC L;  3K7A H;  1BF4 A;  3R2T A;  1Q3L A;  2D0P A;  3HOY G;  1XPR A;  1PYS B;  4YCU A;  2RKS A;  3DM3 A;  3H0G H;  1DYQ A;  4A3M G;  5EKI A;  2RDF A;  2E76 C;  4IUR A;  2F0U A;  1CKN B;  1PV4 A;  2K28 A;  3OW2 A;  4NW2 A;  2IY5 B;  2VY3 A;  1C4Q A;  2RCN A;  2UXB L;  1A63 A;  1SYD A;  2E2H H;  4LAA A;  1M4V A;  4R4Q A;  4UPA A;  5IP7 G;  4JI5 Q;  2JEB I;  3O13 A;  2R7Z H;  2VB2 X;  4ZAI A;  2QA4 A;  2PW7 A;  2JA6 B;  3QWN A;  2A6H D;  4RGT A;  4RWS C;  5IYC G;  1JJ2 A;  4MHE A;  3MVV A;  5ELO A;  1VQK A;  1MHW C;  4NDX A;  2A5H A;  1M8A A;  3S1R H;  3TP7 A;  4JI4 L;  2UU9 Q;  4LFA L;  4A3C G;  2AUK A;  4L8J A;  1STE A;  3CPF A;  4K8I A;  4KTA A;  3TDQ A;  2J4X A;  4LMQ D;  1F2M A;  4XYQ A;  4RG1 A;  4YWK A;  1CQV A;  2CH4 W;  1CA6 A;  3GTG B;  2F0L A;  3G71 A;  1HFG A;  2B63 H;  5C4X B;  2BE5 C;  5J1Z A;  1EWI A;  4A3L H;  2CW0 D;  3J7Z C;  1FNV A;  5C4H A;  3HKZ G;  4DR5 Q;  2K14 A;  4Y7N H;  3NBI A;  1HR0 Q;  2QEX A;  1XPO A;  4DAY A;  4I7A A;  4MZ9 A;  2QCP X;  4JI0 L;  1F9R A;  1TWA H;  4RH6 A;  1OO9 B;  2L11 A;  4OEL B;  1O80 A;  4O2D A;  2CQO A;  4LF8 L;  3BG3 A;  5CR3 A;  4AH6 A;  3RZO H;  4LW1 A;  4DFA A;  2UUA L;  5LMN L;  5C6A A;  4TVA B;  4WOR A;  5AFW A;  1Y1W G;  3V96 A;  5LMN W;  2Q2U A;  4HIK A;  5C3E G;  3FPU B;  1A15 A;  4A3F G;  1CSQ A;  5I2X A;  4CJ1 B;  3CPW A;  1UUP A;  3QB3 A;  4X62 L;  5JEA H;  2FXQ A;  1G51 A;  3L7Z C;  1D7Q A;  1STH A;  3K58 A;  1PH6 A;  2HQE A;  3FHW A;  3RN5 A;  4DR2 Q;  2B63 B;  5ELD A;  1PYW D;  5A35 A;  1HA6 A;  4KHP L;  5LL6 X;  3T51 B;  4K0K Q;  5KEE A;  3PF4 A;  3SE0 A;  2EYM A;  2HD3 A;  1EIY B;  2BE5 D;  1ET9 A;  5GAG C;  4Y7N B;  5M9O A;  4DXG A;  3W1B A;  3EQL C;  3W2D A;  3Q24 A;  3G7L A;  3F2U A;  1DZ1 A;  3FKI H;  2EPB A;  2EY5 A;  4H7B A;  4KN4 C;  2KCN A;  1XPU A;  4FF1 A;  2K5V A;  4TSS A;  1HZ9 A;  1YHB A;  4DV4 L;  1QUQ A;  2SOB A;  1CM9 A;  1ILP A;  3RZO B;  4K14 A;  1IZ6 A;  2X6G A;  2I5L X;  3TEH B;  5K36 H;  3OOC A;  1JOR A;  4DGZ A;  3I55 A;  2D5D A;  1PA6 A;  2F03 A;  1NTG A;  1FGB D;  1BNZ A;  2B2T A;  2F3V A;  2AUJ D;  3CKI B;  1GOZ A;  5M3M B;  3LNN A;  1STN A;  4C3J H;  1LT4 D;  3C46 A;  2R92 H;  4LFB L;  1X3E A;  1NR2 A;  3BVZ A;  4HJA A;  1FNW A;  5GAH C;  1BOS A;  1WCM B;  3GTM B;  1J5E L;  1YNN C;  1IBK Q;  4A3M H;  1X6O A;  5IY0 A;  4GOP C;  1QUQ B;  1X56 A;  3GTO H;  1TWC H;  5JJZ A;  1UE5 A;  2RSN A;  5EAY A;  4A3I H;  1SNP A;  4X3S A;  4LF9 Q;  3KK7 A;  2OQK A;  4DV6 L;  4A3K B;  2MO1 A;  1HNX L;  3TZU A;  3D31 A;  1DJR D;  3CCS A;  3FKI B;  2WB1 G;  3NPP A;  5IP7 H;  2VB3 X;  1VQC A;  2ES2 A;  2EVB A;  2Q2I A;  4NB3 A;  1GO3 E;  1LTI D;  2Z0S A;  3UI2 A;  1EIH A;  3I90 A;  1EEF D;  2KOL A;  5JEA J;  3RUZ A;  2NZ1 D;  2F0P A;  4ULL A;  1DON A;  4A3C H;  1EU4 A;  1YJN A;  2G5D A;  1W3S A;  5KIX A;  2A6E C;  4GN5 A;  4JVZ A;  2R92 B;  5C4J B;  4NXN L;  1BR9 A;  1N33 Q;  4CHT B;  1V1Q A;  4YHH L;  4K6L A;  4IUN A;  4F7X A;  2UXC L;  4JI2 Q;  3TS0 A;  2P5Z X;  1CZG A;  4JG2 A;  4E6I A;  2E2D C;  4DAV A;  4FDB A;  2EY6 A;  3GTO B;  1TWC B;  1J8I A;  5M3F B;  3GTK H;  1B70 B;  4A3I B;  1CFM A;  4N8F A;  4OO1 G;  1K0S A;  1RIP A;  3NQT A;  1SSO A;  1GHJ A;  4K5V A;  1ESR A;  2FJ2 A;  1WOC A;  1I6H H;  1Y1W H;  1WTW A;  4A3G B;  1HXY D;  1A3V A;  1XWE A;  3HOV G;  5C3E H;  1S3O A;  2PI2 E;  3NEM A;  4PMC A;  4AYB G;  3GTQ H;  4A3F H;  5T1G A;  3N6R A;  2K7V A;  2XN9 C;  1EIG A;  3E0J A;  4YCV A;  3H3V I;  3NBH A;  3KLS X;  2NZO A;  3PUY A;  1EYC A;  1X54 A;  2G9H D;  5IT9 E;  1AW7 A;  2VNU D;  2E8G A;  3I4M G;  3DWQ A;  3VYU A;  1A8V A;  4DUZ L;  4R9W A;  4XQQ A;  4B3S Q;  2K52 A;  4IOC A;  1YIJ A;  3S15 H;  4DR4 Q;  2UUB Q;  4GKJ Q;  2PPB C;  2LKV A;  3GTK B;  4DK6 C;  3V05 A;  4DK1 A;  3A7L A;  4DPG A;  2PZW A;  1UE6 A;  3WWV A;  2YTX A;  4CDD C;  4P74 A;  1CKM A;  3R2I A;  5GAD C;  3FP9 A;  4QCL A;  4F87 A;  3I4N G;  3F2C A;  4ALP A;  1Y1V G;  4DV3 L;  3AMU A;  3SHL A;  4LK1 C;  2VQF Q;  2B3G A;  1KDA A;  1X3P A;  1J9O A;  5EJW A;  2MPM A;  4DK3 C;  4XYO A;  3GTQ B;  1JWM D;  4JI3 Q;  1GHK A;  4UP9 A;  5L37 A;  3E9H A;  1SJH D;  1UWV A;  2EJG C;  4L5T A;  1LLR D;  1WD1 A;  2B29 A;  1AFP A;  5ELC A;  1P16 A;  3VR4 A;  2KUM A;  2Q8T A;  1PFN A;  3FRP B;  4GLV B;  4DV7 Q;  1BCP B;  3CHB D;  4LUO A;  3ND9 A;  1S5C D;  1XTD A;  1ZKO A;  2EYP A;  3W3A A;  2I0Q A;  3PUZ A;  2M00 A;  4EQP A;  2F0T A;  2F0S A;  1CKO A;  1EYA A;  4EX5 A;  1J6Q A;  2DJF C;  3QJY A;  4ILW A;  3BDO A;  1VMC A;  4JI5 L;  3CCM A;  1L1O C;  1KLG D;  5M5W H;  3QOL A;  1EFI D;  4LF6 Q;  3ONA B;  4N9P A;  3I3C A;  4A3E G;  4ZKC B;  3PO3 H;  1ZXT A;  5I4D A;  5IT9 L;  1NBW A;  2IHF A;  5DEH A;  2UU9 L;  2WII B;  4QY7 A;  4PG3 A;  2EZV A;  2K5Q A;  3J80 E;  3H09 A;  3S14 H;  1SNQ A;  5LHY 1;  1AZP A;  4C3I G;  2B2V C;  3SK5 A;  4OX9 Q;  5M5X B;  1SLJ A;  3CRL C;  1TII D;  1BO0 A;  4DV0 Q;  2JA7 B;  1H9M A;  1PZK D;  2BOS A;  1H95 A;  3J81 i;  3JAM E;  1L2F A;  5GQO A;  1PH5 A;  4POG A;  1VS0 A;  4DR5 L;  4X65 L;  5I6W A;  4OO1 H;  2QKI C;  4KV6 A;  4KD3 A;  1EWC A;  2WB1 B;  2XVS A;  4OGQ C;  3KDF B;  4X66 Q;  4UP7 A;  2F52 A;  4OHJ A;  1AH9 A;  2R7F A;  5EGT A;  2XWJ B;  3HS0 C;  2R93 B;  4ZRZ A;  3HOV H;  3M4O H;  4WJ3 M;  1TS4 A;  1XNR Q;  1ICF B;  2JYO A;  5D65 A;  3F2D A;  3PO3 B;  1OXX K;  5ISR A;  3T1Y L;  4JV5 L;  1TT2 A;  5FJ8 G;  5H1S E;  2XWB B;  5T1I A;  1D5M C;  2JA6 G;  2F3I A;  1DOM A;  2PZU A;  4JYA L;  2MHV A;  3A7A B;  2HHH L;  1ASY A;  3I4M H;  3HZX A;  5CV8 A;  3CP0 A;  1SE3 A;  2H5X A;  5CYU A;  1JE5 A;  1A62 A;  2FIN B;  4DR2 L;  1R9T B;  1KDB A;  2CQA A;  5I9P A;  2JE6 I;  1II3 A;  3LWU A;  1AP0 A;  4K0K L;  4DR7 Q;  1O7L A;  5C4X G;  3MWY W;  1CQF A;  1W6K A;  5EKK A;  5A2Q L;  4RFB A;  1QWY A;  3H3V C;  3A8K E;  1PTO H;  3I4N H;  1Y1V H;  4FXD A;  1G2S A;  4CKC A;  3VYR A;  1SYB A;  4PNY A;  3AEV A;  1TVX A;  2TSS A;  2XTI A;  3K81 C;  1XMQ Q;  2KHI A;  3KLS A;  4AYB B;  5IGD A;  2AQ1 B;  4K8J A;  4KN7 C;  1STY A;  2JJQ A;  4XQJ A;  3EIV A;  2M2L A;  1VQ9 A;  4BY7 B;  3T56 B;  5DM6 3;  2L9H A;  1SRO A;  3LWE A;  4QIW B;  5TSS A;  3I4M B;  2K01 A;  1F9Q A;  2Z1C A;  1EZ6 A;  3I7F A;  3TZD A;  2AQ2 B;  2VQE Q;  1DM0 B;  2Z6K A;  2EQS A;  3KF8 A;  1JJC B;  1U0L A;  1VQE A;  2Z4I A;  1D5X C;  1WTX A;  1GUS A;  2F4V Q;  1UE1 A;  1TKW B;  5BN4 A;  2B63 G;  4A3L G;  3UDF A;  1A2T A;  4DKA C;  2TMP A;  4IUT A;  1HTP A;  3GDE A;  1ENC A;  2A1A A;  1QOH A;  1SEB D;  3CCU A;  1N9W A;  1VQH A;  1KIX A;  3D3R A;  1SMY D;  3PMF A;  2K5N A;  2L1B A;  2GVB A;  1ZEQ X;  4A3E H;  4B3R Q;  4NKL A;  3C2P A;  2K03 A;  4QUF A;  3NEL A;  1SMX A;  3KF8 B;  1YI2 A;  2J7Z A;  1EUJ A;  4C3H B;  2Z8L A;  4L63 B;  2CVR A;  1OTC A;  3BVG A;  4JK1 C;  4J15 A;  2A74 C;  3NWS A;  1Q12 A;  3AQQ A;  1D1I A;  1SR3 A;  1R4Q B;  2PZT A;  2ZXP A;  2LFN A;  5M3M G;  1N33 L;  5FLM G;  5C0X G;  4JI2 L;  3D6W A;  2LS0 1;  1AE2 A;  2PMZ B;  3M3Y B;  2NTT A;  4XT3 B;  5E3F A;  4LNQ A;  3KBG A;  1K8O A;  1WCM G;  4KI0 A;  4DV1 Q;  5ELF A;  4FXG C;  4H44 C;  2HIX A;  4GOP A;  1PRT F;  4JI7 Q;  1Q81 C;  4BWG B;  4YCW A;  4XDX A;  5C4Z A;  2MP1 A;  3G6E A;  4A3K G;  1N8R C;  3MC0 B;  3FKI G;  4B3T Q;  4RCO A;  1JE4 A;  3T13 A;  2E75 C;  3Q23 A;  3EN2 A;  5HGQ A;  5GRO A;  3J80 i;  4JCV E;  5IOC A;  3MFY A;  5FJ8 H;  2LXJ A;  1A3T A;  1CSP A;  3S1Q H;  4DUY Q;  3RNU A;  4DR1 Q;  4R4I A;  1LUZ A;  3BDC A;  1ZYR C;  5EPL A;  3JAM i;  4GOP B;  1LTG D;  1SJE D;  4TQU S;  1EZ8 A;  2HDM A;  1I94 Q;  4QB4 A;  1Z7T A;  2R92 G;  1YNX A;  3GTG H;  4B3S L;  1FL0 A;  1B1Z A;  5C4X H;  4GKJ L;  4BA1 I;  1SE8 A;  2B2Y A;  2I5H A;  3GQB A;  2PCF B;  4JBK A;  5KNB A;  1SRU A;  5IE8 A;  4RA8 A;  4DF7 A;  4HAE A;  2EYL A;  4OWT B;  1O7Z A;  2RHS B;  1IBL L;  3CQZ B;  1X3F A;  4DN4 M;  4GNX A;  5M3F G;  4A3I G;  4NPS A;  1O7Y A;  1SND A;  3TRZ A;  2K5H A;  2OF1 A;  4MTN A;  3HOZ B;  3A8J E;  4FP5 D;  1G29 1;  4KHV A;  5JPM C;  2ZXO A;  2UUC L;  1AEX A;  3S24 A;  5C44 G;  4JI3 L;  1BBX C;  5D3D A;  3S1Q B;  1LT3 D;  4A3G G;  4C56 C;  2X6L A;  3TQY A;  3E9I A;  4BS9 A;  3MFG A;  1V8Q A;  3VDY A;  3UDG A;  4IFD G;  1NMF A;  2YTY A;  1KRT A;  4IZ8 A;  4GNX B;  2A19 A;  1BVS A;  4S3S A;  1TS5 A;  3V2T A;  4DR6 Q;  3FPP A;  2SNM A;  3SK4 A;  1F9P A;  1ZYR D;  4MIU A;  4RKB A;  2G9D A;  4PZ7 A;  3R93 A;  1KLU D;  1Y8P B;  1E2Z A;  4IN3 A;  1YHA A;  5M5Y H;  2BCO A;  4RMF A;  4RKL A;  1IKL A;  4FF4 A;  2Z9H A;  2BDO A;  2HCC A;  3EVQ A;  3PF5 A;  1VQP A;  3J7A 5;  2N49 A;  3J7A V;  4YY3 L;  2HUG A;  2EYH A;  4LF6 L;  4XIG S;  4U67 3;  1SYG A;  2Y0S B;  3NK9 A;  3PGZ A;  4K2L A;  1I4P A;  4QF4 A;  1A6X A;  3HKZ E;  5AJ3 Q;  1YBY A;  1T5X D;  4JI8 Q;  1F2Z A;  5E4X A;  3C3L A;  1CHP D;  2N3S A;  3DM1 A;  2C35 B;  1S5D D;  2IT1 A;  1X32 A;  5M3M H;  1E2W A;  1EWH A;  5FLM H;  1M90 C;  1RTN A;  1STA A;  4BBR B;  1D1K A;  4F88 A;  5C0X H;  4OX9 L;  1NSN S;  4DV0 L;  5KYL A;  1Q8K A;  3RD4 A;  1WCM H;  1EIF A;  3GTM H;  2IX1 A;  4N8X 1;  3OIP A;  2XRQ D;  2EDG A;  4G4K A;  5M5Y B;  2K4K A;  4HJ8 A;  1RF2 D;  3HEJ A;  4X66 L;  1OXU A;  2IX3 A;  5E1F A;  2XNA C;  4IAL A;  4A3K H;  4HN7 A;  1HJP A;  2CH4 A;  1ET6 A;  3S9W A;  2VL6 A;  1TS3 A;  1VQF A;  2XSC A;  3U9S A;  4EQN A;  4JI1 Q;  3AYH B;  2A73 B;  3HOW H;  5EQ0 A;  4QUC A;  2F0E A;  3G48 A;  1OXT A;  3IRB A;  1TWF H;  4O1N A;  1EY0 A;  2AMC B;  5D14 A;  4BY1 H;  3HP3 A;  2ENB A;  1Q8I A;  2K32 A;  5JJL A;  2L5T A;  4LF7 Q;  4DNT B;  1C9O A;  4DU9 A;  3L0O A;  3DWP A;  2JXM B;  4IJL A;  1LT5 D;  1I3Q H;  3IFT A;  5C4J H;  2WP8 J;  5CGK A;  1G91 A;  3NSW A;  2Q8I B;  1BKB A;  1Y14 B;  2B8G A;  2ZJR A;  2B2V A;  5IYB G;  1PHJ A;  2M9V A;  2NUC A;  3MZ5 A;  1B3Q A;  1MKH A;  1S5F D;  3OYY A;  1SYF A;  1PTO F;  4TRD A;  2VUM G;  3A55 A;  2JA7 G;  2B2U A;  4FNF A;  2DY7 A;  1WYD A;  1WTR A;  3ULL A;  1VF7 A;  1X9N A;  3P20 A;  3K59 A;  5M3F H;  5C0X I;  3CMA A;  1S5B D;  3ND8 A;  1WTO A;  4ZQ3 A;  5IYD G;  1SNO A;  4K6D A;  1KQS A;  1Q46 A;  1VQD A;  4DV2 L;  1LV9 A;  3K5N A;  2WV6 D;  5BR8 Q;  3J81 E;  1IBM L;  4TKO B;  2KCT A;  3U58 A;  1V43 A;  3E6Z X;  2BH2 A;  1XMQ L;  3HOW B;  2O5I C;  5C44 H;  1HRJ A;  4LJZ C;  2R93 G;  4A3G H;  1SYC A;  1TWF B;  5C0X J;  1QG7 A;  2KBN A;  2ZJP A;  1XYI A;  1NE3 A;  1SFO B;  4BY1 B;  1JT8 A;  1GUO A;  4R8I A;  4IFD H;  2C5C A;  4AQY Q;  3PO3 G;  1BBU A;  4N9T A;  3URY A;  3ERQ A;  3LGJ A;  1K8G A;  3M85 A;  1F77 A;  1I3Q B;  5JAV A;  2VQE L;  5DAU A;  4X6A H;  1JOK A;  5EPK A;  2WAQ G;  3MEH A;  1XXG A;  1G6P A;  3RZD B;  3DXJ C;  3ZYY X;  2F4V L;  2CFM A;  2AWO A;  4K5X A;  3OMG A;  4POF A;  1QIL A;  1LTS D;  1VQI A;  1OXV A;  1SE2 A;  3SEB A;  1YNN D;  2E2J B;  4HID A;  3I4L A;  2NTS A;  1GUW A;  4A76 A;  1PFM A;  2NVQ B;  1HTL D;  1JCK B;  1G8Z D;  4A3J B;  4B3R L;  1X3Q A;  2RVL A;  4M8A A;  4NXM L;  4DV5 Q;  5C44 B;  1D6E C;  4A4I A;  1MJC A;  4PMB A;  2YTV A;  4O42 A;  2RDH A;  2PQE A;  3CCE A;  1RCV D;  4MTK A;  1EYD A;  4Q5V A;  4KLK A;  3KLW A;  2UXD L;  3RN2 A;  3KOJ A;  4BY7 G;  3D4R A;  1E7Z A;  1HUN A;  3ULJ A;  4R4C A;  1EQR A;  3LX0 A;  5IGE A;  2A6E D;  3A56 A;  3DHQ A;  4AYB E;  1SNC A;  4ZK9 B;  1VQO A;  1FJG Q;  4DV1 L;  3OWF A;  4HCS A;  4KD4 A;  3KFU A;  3T16 A;  4P2C B;  1TS2 A;  5JJI A;  4UP8 A;  1SYE A;  1TWH B;  4JI7 L;  3J81 L;  5IT9 c;  3QOJ A;  2L12 A;  2MNA A;  1HQR D;  3SDZ A;  4DA2 A;  3VR6 A;  3F8T A;  3WOF A;  1N32 Q;  4J1M A;  4KKS A;  1STB A;  1GUT A;  1KC8 C;  2KQ3 A;  1VQL A;  3P1H A;  4AIM A;  1VQB A;  4IFD J;  4LFC Q;  4HIO A;  3DLL A;  3GTL H;  3J7A F;  2IPK D;  1ESF A;  1C48 A;  1DXM A;  5JOB A;  1XTC D;  4DUY L;  4M1U B;  1NAP A;  3VR5 A;  3TS2 A;  3HG9 A;  4DR1 L;  3TP8 A;  5C5L A;  1S40 A;  4HCE A;  4C3H G;  3I8Z A;  4CDF C;  2N88 A;  1FGU A;  3R8B A;  4L5Q A;  4J8Q A;  2NB0 A;  1JMC A;  1VF5 C;  2GN5 A;  3ITP A;  4C2M H;  1U4L A;  2LXK A;  5IYB H;  2UXB Q;  2EOT A;  1G6Z A;  4CJ0 B;  1T5E A;  3CU7 A;  4X3T A;  5M5X H;  2VUM H;  1PZJ D;  1X3G A;  3OTO Q;  2JA7 H;  4I7Z C;  4B9W A;  3W1G A;  1W6J A;  5IOD A;  1I5F A;  5IYD H;  4CBV A;  1LTL A;  1RD9 D;  5EBD A;  2EYO A;  2YYZ A;  1V9P A;  2OQ0 A;  1ENA A;  2O5J C;  2NN6 H;  4LFA Q;  4HJ7 A;  2F0F A;  3ERS X;  3M7N A;  2PO4 A;  3TP6 A;  3NQI A;  2WAC A;  2R93 H;  3U9O A;  3GTL B;  3K80 C;  2EXZ A;  4H13 C;  3AB9 A;  3IL8 A;  1JB7 A;  4JC0 A;  1U9R A;  5FLX E;  1Y69 U;  3KDF A;  3NTH A;  4JW0 A;  1F2L A;  3S17 H;  5IWA Q;  1VQ7 A;  3BU2 A;  1V1O A;  3K5M A;  2CWP A;  1NUC A;  1RDP D;  3NE5 B;  4C2M B;  3BYY B;  4P71 A;  1HUM A;  4LF8 Q;  1HNW Q;  2VUM B;  4IPH A;  1EY5 A;  2BH8 A;  1U4P A;  2NBF A;  2E74 C;  4IUV A;  1R9T H;  2N55 A;  1BUV T;  2KHJ A;  1XMO Q;  2UUA Q;  3HOU B;  2B2T C;  3CRK C;  1X55 A;  1HR0 L;  1YZ6 A;  2MJ8 A;  4RHS A;  4KY7 A;  3VYT A;  2JA5 B;  3H94 A;  3K7U C;  1HR0 W;  3BDL A;  1XNQ Q;  1CTM A;  1SBB B;  2K5W A;  2N78 A;  1E1O A;  2NYZ D;  3PV0 A;  4FVM A;  5E4W C;  3HOZ G;  3L3O C;  4IUP A;  3F2B A;  5C5M A;  2ZM6 Q;  5I6Y A;  2ICE C;  4KHP Q;  4JI8 L;  1EQQ A;  1GVP A;  3SXH A;  4CGY B;  2CKZ B;  3NTK A;  1A2U A;  1CUK A;  4CKB A;  3S17 B;  4BY7 H;  4UY8 C;  1N34 Q;  2SNS A;  2QDB A;  4JI6 Q;  2F0J A;  2L15 A;  2JEA I;  5DNF A;  1L0W A;  3BVM A;  2WAQ B;  3EBE A;  3MXP A;  5K5P A;  3QG1 A;  2AWN A;  2PQA A;  1I4R A;  4HED A;  4ID6 A;  4DV4 Q;  1B7Y B;  3K57 A;  2E5L Q;  2EXD A;  2KEC A;  3RLF A;  3G6J B;  4IJH A;  2NZH A;  4A75 A;  4OIJ A;  4FF2 A;  3CCQ A;  1GJX A;  1CK1 A;  3H6M A;  1Q1B A;  3BJU A;  2L55 A;  3FEW X;  1B50 A; 
#chains in the Genus database with same CATH homology
 3CME A;  1I94 Q;  2VW9 A;  1IZ6 A;  2I5L X;  3TEH B;  4O0A A;  2R92 G;  1YNX A;  3GTG H;  3ER0 A;  2HIV A;  1IBL Q;  4B3S L;  1FL0 A;  4KHZ A;  3I55 A;  5C4X H;  4GKJ L;  4BA1 I;  1PA6 A;  4JBJ A;  1NTG A;  1SE8 A;  2I5H A;  1I94 L;  3JC6 6;  1PH9 A;  1J5E Q;  4JBK A;  4OO1 I;  3KF6 A;  1SRU A;  5IE8 A;  4C3J H;  3M4P A;  2KCM A;  2VS1 A;  4GLX A;  1VQN A;  2R92 H;  4OWT B;  2PQA B;  3NBH B;  2RHS B;  1IBL L;  4LFB L;  1X3F A;  4C3H H;  1X3E A;  2Y0S G;  5M3F G;  4GNX A;  3A5Z B;  3UDX A;  4HJA A;  1EFW A;  4A3I G;  4NPS A;  5GAH C;  2UUC Q;  3HOU H;  1J5E L;  1VQ8 A;  1WI5 A;  3TRZ A;  2K5H A;  3K8A A;  4MTN A;  1IBK Q;  3STB C;  4DV6 Q;  1X6O A;  1G29 1;  5IY0 A;  4A3M H;  4LUZ A;  4GOP C;  1QUQ B;  1X56 A;  1MIU A;  2JA5 H;  3GTO H;  1TWC H;  2I5M X;  4JI4 Q;  2UUC L;  4B3M L;  1UE5 A;  5EAY A;  3S24 A;  3UE1 A;  1QZH A;  4A3I H;  4BBR G;  5C44 G;  4JI3 L;  4LF9 Q;  4APV A;  1IBK L;  2OQK A;  4DV6 L;  3M3Y H;  2MO1 A;  3CAM A;  1HNX L;  4A3G G;  3D31 A;  5J3B A;  3CCS A;  1VQM A;  4P75 A;  3I56 A;  2WB1 G;  1GD7 A;  2CWA A;  3TQY A;  3E9I A;  2K50 A;  3MEF A;  5IP7 H;  3VDY A;  2PMZ E;  1N36 L;  1VQC A;  2ES2 A;  3KF6 B;  2Q2I A;  4NB3 A;  1GO3 E;  3UDG A;  2E2I H;  4IFD G;  4YWL A;  1NMF A;  1Z9F A;  2YTY A;  4LF9 L;  2Z0S A;  1KRT A;  4GNX B;  1NMG A;  1BVS A;  2A19 A;  4DR6 Q;  5JEA J;  3CCL A;  3CC7 A;  1JJG A;  1PH3 A;  4PZ7 A;  4X64 L;  4GKK L;  1IXR A;  4A3B G;  4A3C H;  4YHH Q;  1YHA A;  2Q2T A;  3W5O A;  1YJN A;  4JI0 Q;  5M5Y H;  4DR6 L;  1W3S A;  5FLX c;  4RMF A;  4YY3 Q;  4PMW A;  1HNZ L;  4GN5 A;  1LYL A;  4NXN L;  3HKS A;  3PO2 H;  1EOV A;  3PF5 A;  3S2H H;  1N33 Q;  2N8N A;  4A93 G;  5ELN A;  3GTJ H;  1V1Q A;  4XTC S;  4YHH L;  5LMN Q;  3J80 c;  1VQP A;  3J7A 5;  2N49 A;  2UXC L;  4JI2 Q;  3TS0 A;  4YY3 L;  4JG2 A;  4BBS H;  4FDB A;  1WFQ A;  4LF6 L;  4XIG S;  1X65 A;  3PGZ A;  2AKW B;  3RR5 A;  3HKZ E;  1B70 B;  3STB D;  4LF5 L;  3GTK H;  1HZA A;  5AJ3 Q;  1YBY A;  3JAM c;  2EIF A;  4X62 Q;  4OO1 G;  1HZC A;  4JI8 Q;  1RIP A;  2N3S A;  2C35 B;  2IT1 A;  3B6Y A;  1K3R A;  5M3M H;  1LM0 A;  5FLM H;  2ZTE A;  1M90 C;  3KJO A;  2YV5 A;  5AJ3 L;  4OX9 L;  1WOC A;  3S1M H;  1I6H H;  3CQZ H;  1Y1W H;  2NN6 I;  4DV0 L;  2DUD A;  1UE7 A;  1Q8K A;  1RL2 A;  3HOV G;  1SN8 A;  4JOI A;  5C3E H;  1S3O A;  2PI2 E;  3NEM A;  3D0F A;  1P8L A;  1WCM H;  1EIF A;  4R4T A;  5GAE C;  4AYB G;  2IX1 A;  1VCI A;  3GTM H;  4A3F H;  4P72 A;  3CCR A;  2IX0 A;  3GTQ H;  3HOZ H;  1QZG A;  4LWC A;  1PH8 A;  1A0I A;  1QVC A;  3T1H L;  3PSI A;  2K4K A;  1UEB A;  4DUZ Q;  4HJ8 A;  4YCV A;  1OXU A;  4IPD A;  4X66 L;  3H3V I;  2PI2 A;  3HOW G;  2NZO A;  2KEN A;  1X54 A;  3PUY A;  1S72 A;  4PZ6 A;  4A3K H;  2VNU D;  1K9M C;  2E8G A;  3I4M G;  1O7I A;  4A3D H;  1HJP A;  3M4Q A;  4BY1 G;  1A8V A;  4DUZ L;  3UE0 A;  2VL6 A;  1VQF A;  1GKH A;  2K52 A;  4IOC A;  1YIJ A;  4B3S Q;  3S15 H;  4DR4 Q;  2UUB Q;  3S2D H;  4DNI A;  4JI1 Q;  4GKJ Q;  3AYH B;  5HY6 A;  1QVG A;  3HOW H;  5IP9 H;  2R93 G;  3GTP H;  1PYB A;  3G48 A;  1OXT A;  1VQJ A;  3IRB A;  1TWF H;  1KAW A;  3Q8D A;  4DK6 C;  1AE3 A;  2AMC B;  4BY1 H;  4LFB Q;  1FJG L;  4DR4 L;  4DPG A;  1E1T A;  1UE6 A;  2UUB L;  5JJK A;  5JJL A;  4JI1 L;  3WWV A;  3I2Z A;  2YTX A;  2JQO A;  4P74 A;  1CKM A;  5GAD C;  4LF7 Q;  3FP9 A;  1C9O A;  3ZJY C;  3I4N G;  3F2C A;  1E3P A;  3L0O A;  4L5R C;  4ALP A;  4IJL A;  1Y1V G;  4DV3 L;  2YU9 H;  1I3Q H;  5C4J H;  1KRS A;  4PZ8 A;  2VQF Q;  1QVF A;  2WP8 J;  1WJJ A;  2IHE A;  2B3G A;  2WFW A;  1N32 L;  4LF7 L;  1BKB A;  1Y14 B;  2ZJR A;  3H0G G;  5IYB G;  1PHJ A;  4IOA A;  4B3M Q;  1YHQ A;  4DK3 C;  4JI3 Q;  1MJE A;  1MKH A;  4HJ5 A;  3OYY A;  4UP9 A;  2K75 A;  2VUM G;  3E9H A;  1HNX Q;  4DV2 Q;  3M9B A;  1UWV A;  3H15 A;  2VQF L;  1YJW A;  3HOX G;  1WYD A;  4L5T A;  3ULL A;  1D8L A;  1X9N A;  1IBM Q;  3S1N H;  5LMU L;  1N36 Q;  3S16 H;  5M3F H;  5C0X I;  4A3J G;  3CMA A;  1NY4 A;  2B29 A;  2MO0 A;  1P16 A;  5IYD G;  2OTJ A;  4JOI C;  1U5K A;  1KQS A;  2RF4 A;  2Y0S E;  1Q46 A;  4GLV B;  1VQD A;  4DV2 L;  4DV7 Q;  2OCE A;  2R7Z G;  5BR8 Q;  4LUO A;  1IBM L;  3HOX H;  4OON A;  2KCT A;  1Z47 A;  3U58 A;  1XTD A;  2RHQ B;  4L5S A;  1V43 A;  3A0J A;  2I0Q A;  4X64 Q;  1M1K C;  1XMQ L;  3PUZ A;  1VQG A;  2BH2 A;  4GKK Q;  4BBR H;  5C44 H;  4QGU A;  3CXC A;  4DV7 L;  5DLQ E;  4GN3 B;  4IPC A;  5BR8 L;  4A3G H;  5C0X J;  2KBN A;  1CKO A;  3OTO L;  3F1Z A;  2ZJP A;  1HNZ Q;  1NE3 A;  4JBM A;  1K83 H;  4GN4 B;  4NXN Q;  1JT8 A;  2JA9 A;  1IYJ B;  1J6Q A;  4EX5 A;  4AQY Q;  3PO3 G;  1BBU A;  1K8G A;  3LGJ A;  4R1J A;  2UXC Q;  4JI5 L;  3CCM A;  3M85 A;  3U4V A;  1L1O C;  1OXS C;  1KHI A;  1VQA A;  4H02 A;  2VQE L;  5M5W H;  4X6A H;  3J81 j;  1K8A C;  2MFI A;  4YWM A;  1PH2 A;  4A3E G;  2DGY A;  4LF6 Q;  4QJF A;  2WAQ G;  4AQY L;  4A3B H;  1G6P A;  1Q7Y C;  2D62 A;  3PO3 H;  2F4V L;  4R4O A;  2CFM A;  3PUV A;  4LF5 Q;  2VZA A;  1DGS A;  2AWO A;  2ATW A;  4HIM A;  1NBW A;  2IHF A;  4POF A;  2NVX H;  2UU9 L;  3SGI A;  3GD7 A;  4QY7 A;  4PG3 A;  1VQI A;  1OXV A;  4OXP A;  3S14 H;  2NVT H;  3E0E A;  4A93 H;  4NXM Q;  3BZC A;  2ZJQ A;  3AFQ A;  3CW2 C;  4OX9 Q;  3U4Z A;  4X65 Q;  4HID A;  1SLJ A;  3I4O A;  5IWA L;  4DV0 Q;  2JK8 A;  4A76 A;  1Q86 C;  2V1C C;  1H95 A;  2R6G A;  3MXN B;  3CD6 A;  2JA7 G;  1IL2 A;  3J81 i;  4B3R L;  4NXM L;  1W2B A;  1L2F A;  5GQO A;  2GVA A;  2HQL A;  4DV5 Q;  1VQ6 A;  1PH5 A;  4C3I H;  4POG A;  1VS0 A;  4DR5 L;  4X65 L;  2UXD Q;  4A4I A;  1MJC A;  1HNW L;  4Y52 H;  2A8V A;  1TXY A;  2YTV A;  1YJ9 A;  3PUW A;  3T1H Q;  2Q2H A;  2HT1 A;  2ZTD A;  1KL9 A;  3KDF B;  4X66 Q;  4UP7 A;  3CCE A;  1XMO L;  1PH7 A;  2F52 A;  4IPG A;  3A74 A;  1AH9 A;  2R7F A;  5JEA G;  4DV5 L;  2R7D A;  1TWG H;  4KLK A;  3KLW A;  2UXD L;  1KD1 C;  3T1Y Q;  3RN2 A;  3KOJ A;  3ULP A;  4JV5 Q;  4IO9 A;  4BXX G;  2D0O A;  3AFP A;  3TRE A;  4BY7 G;  3HOV H;  3M4O H;  1E7Z A;  4WJ3 M;  1C0A A;  1XNR Q;  3ULJ A;  3UDI A;  3RLO A;  4OWX B;  3A5U A;  1YIT A;  4JYA Q;  2Z6K C;  4R4C A;  1XJV A;  1XNQ L;  2ID0 A;  1EQR A;  3F2D A;  1PFS A;  3HFZ B;  2HHH Q;  4LUV A;  2XGT A;  1OXX K;  4DAY B;  3T1Y L;  2AHO B;  4JV5 L;  5FJ8 G;  4AYB E;  5H1S E;  2OTL A;  1VQO A;  3CC4 A;  2F3I A;  1FJG Q;  2JA6 G;  4DV1 L;  4LF4 L;  3KFU A;  1XNR L;  4JYA L;  3CF5 A;  5JJI A;  1ASZ A;  2ZM6 L;  4UP8 A;  1PVO A;  4JI7 L;  1L1O A;  5IT9 c;  2MNA A;  2HHH L;  1BBW A;  3CC2 A;  1ASY A;  3I4M H;  3CP0 A;  4DV3 Q;  2H5X A;  1JE5 A;  1SFO H;  3F8T A;  4MNO A;  1A62 A;  2BA0 A;  2JA6 H;  1N32 Q;  2QGQ A;  3KYH C;  3PCO B;  4QL5 A;  4DR2 L;  1N34 L;  4JI6 L;  1B8A A;  1KC8 C;  4EQ5 A;  1CKN A;  1VQL A;  1NJI C;  4DR3 L;  2ALY B;  2JE6 I;  5K36 G;  2JA8 G;  4K0K L;  4DR7 Q;  4AIM A;  1VQB A;  4IFD J;  4LFC Q;  3U50 C;  4HIO A;  4WJ4 A;  1I50 H;  3DLL A;  5C4X G;  3GTL H;  1K73 C;  5LMU Q;  3L2P A;  4OWW B;  3RZD H;  1GM5 A;  4DUY L;  2E5L L;  1Q82 C;  3I4N H;  1FVI A;  3TS2 A;  4DR7 L;  4DR1 L;  1KXL A;  4LFC L;  1S40 A;  2JA8 H;  1Y1V H;  3ICE A;  1Q1E A;  3K7A H;  2D0P A;  1FGU A;  1EYG A;  3HOY G;  3BZK A;  1XPR A;  1PYS B;  1L1O B;  4L5Q A;  4YCU A;  1JMC A;  3AEV A;  3CCJ A;  1HZB A;  3HOU G;  1K0R A;  3DM3 A;  3H0G H;  2GN5 A;  2XTI A;  4C2M H;  2LXK A;  4GS3 A;  3K81 C;  5IYB H;  2KHI A;  4A3M G;  1XMQ Q;  2UXB Q;  2E2J H;  1PH1 A;  5M5X H;  2OWO A;  2PNH A;  2VUM H;  1X3G A;  2JA5 G;  2JJQ A;  3OTO Q;  2JA7 H;  1CKN B;  2NVQ H;  1PV4 A;  3HOY H;  3EIV A;  2NN6 G;  3W1G A;  3OW2 A;  4A3J H;  4ME3 A;  1VQ9 A;  2VY3 A;  2IY5 B;  2RCN A;  2UXB L;  1A63 A;  1I5F A;  5IYD H;  2E2H H;  1SRO A;  4R4Q A;  5E7N A;  1LTL A;  4UPA A;  5IP7 G;  4JI5 Q;  1E22 A;  2JEB I;  3I7F A;  2R7Z H;  2CCZ A;  2YYZ A;  1V9P A;  3J81 c;  2VQE Q;  3GO5 A;  2Z6K A;  2EQS A;  2OQ0 A;  2QA4 A;  4LFA Q;  1JJC B;  1U0L A;  1VQE A;  4HJ7 A;  3ERS X;  2WB1 E;  3M7N A;  1JJ2 A;  5IYC G;  2F4V Q;  5ELO A;  1UE1 A;  1VQK A;  2R93 H;  2ZTC A;  3S1R H;  2B63 G;  4JI4 L;  3K80 C;  2UU9 Q;  4LFA L;  4A3L G;  3UDF A;  4DKA C;  4A3C G;  1JB7 A;  4JC0 A;  3RLN A;  3CPF A;  3H3V H;  3GDE A;  2A1A A;  3KDF A;  5IYC H;  3CCU A;  4RG1 A;  4YWK A;  1N9W A;  1VQH A;  1KIX A;  3PO2 G;  3S17 H;  3G71 A;  2B63 H;  5IWA Q;  2K5N A;  2GVB A;  1VQ7 A;  1EWI A;  4A3L H;  1TWH H;  3BU2 A;  4A3E H;  1E24 A;  2CWP A;  3KJP A;  1VQ4 A;  2BA1 A;  4B3R Q;  3J7Z C;  4GLA C;  4P71 A;  4BBS G;  3NEL A;  1SMX A;  3KF8 B;  4DR5 Q;  3HKZ G;  1YI2 A;  2K14 A;  4Y7N H;  1HR0 Q;  2WAQ E;  1EUJ A;  4IPH A;  3NEN A;  4LF8 Q;  2QEX A;  1HNW Q;  2BH8 A;  1HH2 P;  1T9H A;  1XPO A;  2ASB A;  1R9T H;  2KHJ A;  1OTC A;  1XMO Q;  4MZ9 A;  2UUA Q;  4BA2 I;  4JI0 L;  4J15 A;  1TWA H;  4O2D A;  1Q12 A;  1X55 A;  2CQO A;  3AQQ A;  3PIO A;  1SR3 A;  1YZ6 A;  3CCV A;  1HR0 L;  4LF8 L;  1YEZ A;  4AH6 A;  3K7U C;  3RZO H;  4LW1 A;  5M3M G;  4HJ9 A;  1HR0 W;  1N33 L;  4GNX C;  2UUA L;  5FLM G;  5LMN L;  5C0X G;  4TVA B;  3PUX A;  4JI2 L;  1AE2 A;  1Y1W G;  1XNQ Q;  5LMN W;  2Q2U A;  3G4S A;  4HIK A;  4LNQ A;  2N78 A;  1E1O A;  5C3E G;  3K0X A;  1WCM G;  3PV0 A;  4KI0 A;  4JBW A;  4DV1 Q;  4A3F G;  4LF4 Q;  1CSQ A;  3HOZ G;  2HIX A;  2LSS A;  4GOP A;  3CPW A;  3F2B A;  2ZM6 Q;  1VQ5 A;  4DV4 L;  4X62 L;  4JI7 Q;  1Q81 C;  4KHP Q;  4JI8 L;  2FXQ A;  1EQQ A;  1G51 A;  3L7Z C;  1GVP A;  1D7Q A;  4P73 A;  2CKZ B;  4DAM A;  4YCW A;  1CUK A;  1PH6 A;  4BXX H;  4IFD I;  3PIP A;  4BY7 H;  4UY8 C;  3FHW A;  3RN5 A;  4DR2 Q;  1N34 Q;  3G6E A;  4A3K G;  1N8R C;  4JI6 Q;  2L15 A;  2JEA I;  4A3D G;  4KHP L;  3FKI G;  1L0W A;  4DR3 Q;  3EBE A;  4B3T Q;  4K0K Q;  3PF4 A;  3EN2 A;  5HGQ A;  5GRO A;  3J80 i;  4JCV E;  5FJ8 H;  1EIY B;  5GAG C;  2AWN A;  2PQA A;  4QIW E;  2LXJ A;  3W1B A;  5IP9 G;  4DV4 Q;  2MQH A;  1CSP A;  3S1Q H;  4DUY Q;  1B7Y B;  2E5L Q;  3RNU A;  2EXD A;  1C7Y A;  1YVC A;  3FKI H;  3RLF A;  4B3T L;  4QQB X;  4IJH A;  2NZH A;  2NVY H;  4A75 A;  4DR1 Q;  3CCQ A;  1PH4 A;  1XPU A;  4R4I A;  1LUZ A;  3JAM i;  1Q1B A;  4GOP B;  3BJU A;  2K5V A;  1HZ9 A;  4TQU S;  1YHB A;  1QUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...