3PF5A

Crystal structure of bs-cspb in complex with ru6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title RNA single strands bind to a conserved surface of the major cold shock protein in crystals and solution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/rna
total genus 11
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3pf5A00
1PHJA 4NB3A 1VQCA 3GTJH 3RNUA 4JI2Q 3I4MG 4R4QA 4PZ8A 4FDBA 4DV4L 2D0OA 4DKAC 2JA5G 2E2HH 2KHIA 3PF4A 1G6PA 4DR1Q 1IYJB 1PA6A 1PFSA 1Q82C 4JI4L 1VQEA 3D31A 4KHPQ 3J81c 2AWOA 4LF9Q 3J7ZC 4A75A 2VNUD 4UP9A 4HIDA 1VQ7A 4YY3L 3I4NH 4YWMA 4BY7H 1SMXA 4PZ6A 2QEXA 4BA2I 1Z9FA 1S3OA 2PMZE 2Z6KC 5IWAL 1XNQQ 2NVYH 4YCWA 1M1KC 1IBMQ 1N33Q 1IZ6A 1TWGH 4JI7Q 3CD6A 3GTKH 3H0GH 5JEAJ 4DR3Q 1Y1WH 4IFDJ 5IY0A 3AFPA 4GNXA 3EBEA 5HY6A 2JA7G 4A3CG 2ZJPA 3H3VI 2NZOA 1I94Q 4OX9L 2K14A 2RCNA 1GD7A 1R9TH 4X64Q 4P73A 4DV3L 1GO3E 3T1HQ 2WB1G 3NEMA 2CQOA 4IPHA 2NVXH 4MZ9A 3HOUG 3CXCA 1CSPA 3CP0A 4DR2L 3M4OH 4B3RQ 4Y52H 1PH4A 4RMFA 1WI5A 4P72A 5C44G 1YNXA 1N36L 4GKKL 2HQLA 4C2MH 4WJ4A 3A0JA 1NBWA 4DUZQ 1LM0A 1GKHA 3T1YQ 1VQ5A 5LMNL 2MFIA 4A3MH 2R7DA 4JYAQ 4B3TQ 4LF8L 2HHHL 2UUAL 4IFDG 1H95A 2PQAB 4DV7L 4DV2L 2VS1A 2JJQA 1YHAA 3CCJA 3CCQA 1J5EL 2DUDA 4C3HH 1HZBA 2L15A 2AMCB 1IXRA 2R6GA 2AKWB 2VY3A 5IYDG 4JI3Q 2VUMH 2N3SA 3HKZE 1VQGA 4DUYL 1KD1C 3S1QH 2OTJA 1CKOA 1Q8KA 3FKIH 4PG3A 4Y7NH 5ELOA 2FXQA 4DAYB 3CCMA 3HOZH 4JOIA 1TWFH 4P74A 1S72A 1XPOA 3CMEA 3E9IA 1PYSB 4A76A 3K0XA 1K8GA 4ME3A 5IE8A 3JAMc 1WFQA 4GKJQ 2OWOA 4BBSH 2JA6H 4DR6Q 3K80C 3UE1A 2R92H 2CFMA 3A5ZB 4GN5A 2ASBA 2K5HA 4A3BG 1K8AC 3J81j 4YWKA 3S1NH 4JI5Q 1UE7A 1C7YA 3ICEA 4IFDI 2UXBQ 3CCVA 3NELA 3J80i 4DV6Q 4WJ3M 3W1GA 2ZTCA 4LFAQ 4AIMA 5IP7H 5M3MH 3G6EA 1M90C 4DAMA 5GQOA 2V1CC 4YHHL 2B63G 2VW9A 1YVCA 2GVAA 4XIGS 1OXTA 1UE6A 4JI8Q 4LFBQ 1FL0A 3HOXH 1G291 4GNXB 5AJ3Q 4NXNL 1E7ZA 4LUVA 1YITA 4HJ7A 1NMGA 2YYZA 4JG2A 3I56A 1IBKL 4DR7Q 4L5SA 1HR0Q 4R4IA 3CPFA 4JBMA 2Z0SA 4IPDA 4GOPC 4JI2L 4MNOA 5M5XH 2ID0A 4A3IG 3HOVH 5IYCG 4DR1L 2WAQE 1C9OA 3U4VA 4ALPA 1X3EA 1KC8C 3CCLA 4UP8A 1QUQA 1PH6A 1KQSA 1HR0W 4KHPL 5HGQA 4LF9L 2KCMA 4EX5A 3G48A 1HZCA 1K9MC 2NN6G 1SR3A 2JK8A 2N8NA 5GADC 4OXPA 4HJAA 4LF6Q 1XNQL 2GVBA 3STBC 1A63A 4X62Q 1IBML 3JC66 3K8AA 4JI7L 1N33L 4JV5Q 1YBYA 1HNZQ 1VQ8A 4GS3A 3GTLH 4A3DG 4DR3L 4DV5Q 1IBLQ 3S2DH 2I5LX 1PH5A 1MIUA 1JB7A 1I94L 3HOWH 4X64L 4JC0A 1PV4A 1VQHA 4NPSA 2A8VA 1Q86C 3T1HL 4HJ5A 4APVA 2PI2E 4AQYQ 3I7FA 4B3RL 1DGSA 4BBRG 4BY7G 3UE0A 1Z47A 3E0EA 2NN6I 5IP9H 3OW2A 3NENA 5FJ8H 4L5TA 4DUZL 2AWNA 3T1YL 1VQ9A 1VQDA 1Y1WG 4B3TL 4JBWA 2F4VQ 1SRUA 4JYAL 3CC7A 2BH8A 1E3PA 2HIXA 3H15A 3RZOH 1VCIA 1JT8A 1GVPA 2IHEA 3SGIA 1WYDA 3Q8DA 4A3JH 2K5NA 1E1TA 4JI3L 1KAWA 4POGA 2WP8J 1Q1BA 4JI6Q 4IJLA 3KDFA 3RR5A 4JI1Q 1KIXA 1VQ6A 3I2ZA 1CKMA 1QVCA 2UUCQ 2D62A 2YV5A 1OXVA 1EYGA 4A3FH 3KJOA 1LTLA 4GKJL 4DR6L 4A3MG 4HJ9A 5LMUQ 5FLXc 4IJHA 1VQPA 1QUQB 1VQ4A 1N34L 4JBKA 1JMCA 1KXLA 4A3LH 4JI5L 1LYLA 5C0XJ 4A3KH 2UXBL 2XTIA 2MO1A 2ZM6Q 4YCUA 4DV6L 1NJIC 2Z6KA 5DLQE 1VQNA 4LFAL 2VUMG 1XPUA 1XMQQ 4R4OA 1X9NA 4BXXH 1K0RA 3FKIG 3NBHB 3STBD 4LFBL 4JI8L 2KBNA 4DV1Q 2RHQB 1D8LA 3HOZG 5AJ3L 1T9HA 1E22A 3ULJA 4IOCA 4R1JA 2JA5H 3GTOH 4X65Q 3CQZH 5JEAG 2I5MX 1VQLA 2ATWA 4LF4Q 3UDGA 4O2DA 2JQOA 1E1OA 4OWTB 1HR0L 2JA6G 2R92G 4BBSG 3GTMH 2ZTDA 3TREA 3DLLA 4DPGA 3PO2G 5GAGC 3UDFA 2MO0A 3MEFA 3IRBA 5M3MG 3S24A 3A5UA 3W5OA 1D7QA 4RG1A 2HT1A 1RIPA 1W3SA 5BR8Q 4LF6L 3HOXG 3GTQH 4GLXA 2IT1A 3L7ZC 1N32Q 2MQHA 3CCRA 3BJUA 2JA7H 4X62L 4DR5Q 4JV5L 3KYHC 1Y14B 1HNZL 5ELNA 2ES2A 3PIPA 1XPRA 1N34Q 4P75A 4NXMQ 4DV5L 1UWVA 1IBLL 3G4SA 2CWAA 1EQRA 2OCEA 3TEHB 1BBUA 3S14H 1X54A 2VZAA 4LF7Q 1B8AA 1XJVA 1RL2A 3HKZG 2UXCQ 1ASYA 3W1BA 1J6QA 1IL2A 3HOVG 3KDFB 2LXKA 4IPGA 1L0WA 2YTVA 1O7IA 4QJFA 1YI2A 2RHSB 3RLFA 3HOYH 1YHQA 3F1ZA 2YU9H 2Y0SG 5C44H 1Q12A 2GN5A 1JE5A 5C0XI 4AQYL 1VQIA 1FJGQ 1SE8A 3ZJYC 3CCSA 3CC4A 4IOAA 2E2IH 1CUKA 1Y1VH 3CC2A 2CKZB 2A1AA 3HKSA 3M9BA 1OXUA 1VQMA 1TWCH 2RF4A 4LW1A 2JEAI 3KFUA 4PZ7A 3OTOQ 3LGJA 3L2PA 2F4VL 2JA8H 1EOVA 4LF5Q 3GTGH 4IPCA 4AYBE 1PH9A 4YWLA 3PV0A 5JJIA 3B6YA 5IYBH 3S15H 4X6AH 1UE1A 3J80c 3HOWG 3CAMA 4A3EH 4B3MQ 3GDEA 1VQAA 3MXNB 3M85A 2KHJA 5M5WH 4QGUA 4JI6L 1EWIA 4QY7A 1GM5A 3M4PA 4JI1L 1HNWQ 1A0IA 4GOPA 2UUCL 2VQFQ 4JI0Q 2NVTH 3S17H 2F52A 4IO9A 5IP9G 1L1OA 4KHZA 3A74A 5FJ8G 1P16A 1YHBA 4HIMA 1A62A 1V9PA 5C3EH 5K36G 4DK3C 5LMUL 2VQEQ 2K5VA 2R93H 1FVIA 1WJJA 1X55A 1AE3A 3ULPA 1HNXQ 1JJGA 1I6HH 1NMFA 1WCMH 2ZJRA 2ZM6L 4GN4B 4OWXB 4A4IA 1K3RA 2AHOB 1XMQL 2UUBQ 2UU9Q 1A8VA 5M3FH 4BY1H 3KF8B 1EIFA 3I4NG 3TRZA 1TWAH 2NZHA 2H5XA 4DV1L 3U4ZA 2B29A 3J7A5 1Q81C 1BVSA 4UP7A 3CPWA 2IHFA 3H0GG 1EIYB 4X65L 4A3FG 3F8TA 3PUXA 1V43A 3WWVA 2PI2A 4LF4L 1NY4A 2I5HA 2ZTEA 4L5QA 4TVAB 4UPAA 2E2JH 4DR4Q 2IY5B 3UDIA 3PO3H 3OYYA 3U58A 2EQSA 3EIVA 4A3LG 1TWHH 2JEBI 2LXJA 5EAYA 4HIKA 4LFCQ 1VQOA 3CCEA 4A3KG 2R7FA 1B70B 3U50C 1PH2A 3BZCA 1ASZA 3E9HA 4A93H 1L2FA 4DNIA 3GO5A 1B7YB 1N8RC 2OQKA 1HJPA 4LWCA 2K75A 3DM3A 4B3SQ 3GTPH 4BXXG 4KLKA 1AE2A 2R7ZH 1PH7A 2UXDQ 4OO1G 5BR8L 5FLMH 4YCVA 4R4TA 1N32L 2KCTA 3ER0A 4DR5L 1YIJA 1UE5A 3VDYA 1VQKA 1QVFA 5C4XH 3KF6A 1HZAA 4NXML 1PH3A 4O0AA 4BA1I 4GNXC 1OXSC 3F2BA 2BH2A 4LF7L 1G51A 2UXCL 2XGTA 3K81C 1HZ9A 1P8LA 1EFWA 4DV0Q 2EXDA 2B3GA 1X3FA 1X6OA 1XNRQ 2D0PA 4BBRH 4X66Q 2WB1E 4K0KQ 4GOPB 3AQQA 1JJCB 3RLNA 3CCUA 1HH2P 2YTYA 1KL9A 2YTXA 1L1OB 3H3VH 3FP9A 1FJGL 4C3IH 1MJEA 2E5LQ 2N49A 3K7AH 1W2BA 3I4MH 4QQBX 1SLJA 2JE6I 1QZHA 5E7NA 3M7NA 3K7UC 4OO1I 1PH1A 1XMOQ 1SROA 4PMWA 2WFWA 1VQJA 2BA0A 3OTOL 2Q2TA 4DR7L 5JJKA 4LF5L 3TS0A 1EQQA 2KENA 5C0XG 1QZGA 4JBJA 1KRTA 4C3JH 1PVOA 4B3ML 5IP7G 1WOCA 3BZKA 3S16H 3S2HH 3HOYG 1FGUA 1UEBA 4EQ5A 1I5FA 3PSIA 2MNAA 1HNWL 1BKBA 3TS2A 1CKNA 3JAMi 1I3QH 4JOIC 1K73C 2VQFL 4A3CH 4JI0L 4DV4Q 1YZ6A 2ALYB 3AEVA 3M3YH 1E24A 2F3IA 4UY8C 1Y1VG 2DGYA 4L5RC 1VQFA 4JI4Q 2CCZA 1CSQA 1TXYA 2Q2HA 3PUVA 4OONA 2K50A 3GD7A 2HIVA 4GN3B 3S1RH 2VQEL 2JA8G 3ULLA 1Q1EA 3HOUH 4A3GH 1QVGA 4TQUS 1KRSA 1HNXL 4YY3Q 5IYBG 2OTLA 4HJ8A 3G71A 1SN8A 5IT9c 3CMAA 3F2CA 4A3EG 1YJ9A 3S1MH 5IWAQ 1PH8A 3RN5A 3TQYA 1OXXK 4LUZA 3PF5A 2N78A 2Y0SE 1YJNA 2UU9L 2UUBL 4MTNA 3RLOA 2IX1A 1AH9A 1U0LA 1X56A 3KF6B 3PIOA 1KHIA 1MKHA 3I4OA 1LUZA 4OX9Q 1K83H 1NTGA 5JJLA 4R4CA 2PNHA 5IYDH 3UDXA 3PO2H 2K4KA 4DV3Q 1X3GA 4DR4L 3KLWA 1SFOH 5C3EG 4A3GG 2JA9A 3BU2A 4DR2Q 2QGQA 1N9WA 3AYHB 2R93G 4LFCL 3PUZA 2BA1A 1WCMG 4GLAC 2VL6A 1N36Q 2OQ0A 3ERSX 4GKKQ 1YEZA 1X65A 4J15A 3AFQA 4AH6A 5M3FG 1U5KA 4BY1G 4B3SL 2CWPA 5LMNQ 2E8GA 3EN2A 3HFZB 3M4QA 3RZDH 2UXDL 4LF8Q 2HHHQ 2UUAQ 3KJPA 2ZJQA 4LUOA 5GROA 4A3BH 4DV7Q 3PUYA 4DV2Q 1PYBA 1J5EQ 4AYBG 5GAHC 3D0FA 2WAQG 5J3BA 1L1OC 4DK6C 5LMNW 3PUWA 4OWWB 4DUYQ 4JCVE 3RN2A 2Q2UA 2B63H 3PO3G 4H02A 1NE3A 4A3JG 4QIWE 3KOJA 3PGZA 4DV0L 1XNRL 1CKNB 3CF5A 4K0KL 4X66L 5C4JH 5H1SE 1YJWA 4A93G 3FHWA 4HIOA 2IX0A 1MJCA 4KI0A 2A19A 3CW2C 4LNQA 1OTCA 4GLVB 2E5LL 4P71A 2R7ZG 1Q46A 5FLMG 4A3IH 1VS0A 5IYCH 2NVQH 1Q7YC 1BBWA 4XTCS 1XMOL 1C0AA 5C4XG 3J81i 2PQAA 1I50H 2I0QA 2LSSA 4YHHQ 5M5YH 2QA4A 2EIFA 1JJ2A 4POFA 2C35B 1S40A 3I55A 2Q2IA 5GAEC 4QL5A 4NXNQ 1VQBA 3F2DA 1IBKQ 3PCOB 1XTDA 4A3DH 1V1QA 1EUJA 3L0OA 2K52A
chains in the Genus database with same CATH superfamily
4NB3A 4DF7A 2F03A 3TSSA 3I4MG 4R4QA 1G6PA 4HEDA 2E2HH 3E0JA 1F9PA 2KCNA 4BY1B 3D31A 1RTOA 2AWOA 4LF9Q 1JR0D 4A75A 4L6TB 4UP9A 2ENBA 5LHY1 3I4NH 4BY7H 5F2DA 4PZ6A 1TKWB 5IWAL 1GUGA 2QDBA 1M1KC 4YCWA 1IBMQ 1N33Q 4JI7Q 3RZOB 5C3WA 4IUQA 5KEEA 5FO8B 3VR5A 1TWHB 4A3JB 2ZJPA 2NZOA 3IKJA 1GD7A 5J1ZA 4FXKC 4WJWA 3KLSX 1C8CA 1BCPB 4P73A 1S4ZA 5KNCA 1ML0D 4DV3L 1STNA 1GO3E 1SYFA 3FMCA 5IGGA 2NVXH 4B3RQ 1CM9A 4Y52H 1SNPA 3M4YA 1TS2A 4P72A 4GKKL 2HQLA 4WJ4A 1IL8A 1NBWA 3A0JA 4DUZQ 2I46A 5LMNL 4B3TQ 3BZDB 4DV7L 2VS1A 3NQIA 3CCQA 4WORA 2O5JC 1NCVA 1HZBA 2BDOA 2EYLA 4C3HH 1QE6A 3R2TA 2AMCB 1HPCA 2AKWB 3QR8A 1HRJA 4GZYC 3OIQA 1RKNA 1CKOA 3FKIH 2PW5A 3V2TA 4G57A 3L9AX 4R8IA 1TS3A 3CQZB 1QJOA 1XPOA 1PYSB 2SOBA 4ZAIA 4IUNA 3UE1A 2CFMA 5JVH3 1FNVA 4C3JB 3S1NH 3ICEA 4FVMA 3S16B 2DY8A 4IFDI 2UXBQ 2F3VA 3NELA 1FNWA 4DV6Q 5CGKA 3T13A 4WJ3M 1NUCA 1M90C 3G6EA 3GTQB 2JA7B 1YVCA 1OXTA 1UE6A 1G291 1ICFB 5EBCA 4NXNL 4LUVA 4O42A 1IBKL 2YYZA 4RWSC 2B2UC 4NKLA 4KKTA 3CPFA 4JBMA 5M5XH 1BO0A 5C44B 3HOVH 4KJNA 3U4VA 2K5DA 2N88A 1HR0W 1KQSA 4LK1C 5HGQA 4LF9L 2QF7A 1HZCA 1K9MC 1EYDA 1SR3A 2N8NA 5GADC 2ZT9C 4HJAA 3VR4A 4HTHA 1A63A 2JA8B 1IBML 3K8AA 1N33L 4JI7L 3VYTA 3MXUA 2JSOA 1A15A 3S2DH 5CV8A 4PNYA 1ZYRD 5KYIA 1RF2D 4XQNA 5M5WB 4PMBA 2C9OA 2WACA 1EFID 4APVA 2PI2E 3SR1A 1SYBA 1D2BA 4G4KA 2X69A 3HZXA 4B3RL 3BVZA 1DGSA 4BY7G 2N55A 2NN6I 5C3EB 4OEMB 4IURA 4K8IA 3NENA 4DUZL 2AWNA 4WFN3 1V1OA 1SNQA 5E3FA 4B3TL 3C46A 2KQ3A 3Q8DA 2K5NA 3K5OA 2NTTA 2NYZD 2B2WA 1ILPA 1Q1BA 3KLSA 2UUCQ 1H9KA 2D62A 1FR3A 4WRDA 1Y8NB 4A3FH 3Q24A 2JN4A 3P1HA 4HCEA 4HJ9A 1QOHA 3DXJC 5LMUQ 1N34L 1JMCA 1B9NA 1I4PA 4A3KH 2UXBL 2XTIA 2Z8LA 4C3HG 1HUNA 4YCUA 4DV6L 2Z6KA 5DLQE 2NWGA 4HAEA 1XPUA 1KLGD 1BCPD 1U4LA 3BYTB 3FKIG 4OO1H 1PRTB 1D8LA 1STBA 5ELCA 1T9HA 1E22A 4XYOA 2JA5H 3GTOH 1TVXA 5ISRA 1VQLA 4CDDC 5BN3A 1A3TA 3UDGA 4O2DA 4OWTB 1LTSD 4B9WA 3GTMH 4BBRB 1ZYRC 1RCVD 3DLLA 1JOKA 4PQXA 3GTKB 1HQRD 4FF3A 4HN7A 3IRBA 3KBGA 4XDXA 1W3SA 2IT1A 3L7ZC 1R9TB 1BDOA 1CQVA 3KF8A 4DR5Q 3KYHC 3I90A 3PIPA 3S15H 3G4SA 1X54A 1YNND 2VZAA 4KD4A 1GUTA 4LF7Q 3S2HB 1RL2A 1J6QA 3Q0AA 3DUZA 3KDFB 2X6GA 4OELB 1L0WA 3HOVG 5AFWA 2YTVA 4H13C 2EOTA 2H1EA 1K8MA 1Q12A 2F0SA 2Y0SG 3M3YB 5C0XI 1FJGQ 1RD9D 1ZXTA 2EYPA 2CW0D 1ESRA 3CC4A 1G6ZA 1CUKA 2VUMB 4ULLA 1EU3A 3CC2A 2A1AA 3M9BA 1VQMA 1OXUA 2PMZB 1TWCH 4LW1A 2IX3A 2K5WA 1EZ8A 4DR7Q 1BNZA 5A35A 4LF5Q 4IPCA 1E0BA 2A68C 4RFBA 5IYBH 3PIO3 1A2TA 5IODA 3J80L 3VA5A 4BBSB 3A8KE 2F0DA 4ZK9B 3H09A 2VB3X 1EWIA 1BCPC 2UUCL 4JI0Q 2NVTH 2F52A 1JB3A 1SFOB 1DOLA 1QNUA 3A74A 2KJXA 4HIMA 2AQ1B 3R93A 1AW7A 5HURA 1STAA 2K5VA 5LMUL 4I7ZC 5FO9B 1NMFA 1DOKA 2KOLA 2QILA 4PMCA 3V96A 4GN4B 4OWXB 1E2WA 1K3RA 3J7AF 1F2LA 3CRLC 3NTKA 3I91A 1EY6A 1BF4A 1CFMA 3OW7A 5J22A 4A3FG 3PUXA 1JOQA 2PI2A 1MI2A 5A2QL 1EOTA 2K7VA 5DEHA 2EVBA 3PO3H 1BR9A 2EQSA 4EQPA 1VQOA 4A3KG 2R7FA 1PH2A 5KRUA 3BZCA 4A93H 3E9HA 1B7YB 1N8RC 2OQKA 2EJMA 1A3VA 4KLKA 1II3A 2R7ZH 1PH7A 1HUMA 4OO1G 1G8ZD 4YCVA 4IZ8A 4DR5L 3MFYA 5C4XH 1B2TA 4DXGA 1PH3A 2DNCA 4CJ0B 4LF7L 1G51A 4ZKCB 3K81C 1HZ9A 2XIWA 1I4RA 3FDTA 1PXUA 4A3DB 3E6ZX 1ENCA 1LT3D 1X3FA 1S5CD 4HMJA 4KHVA 1HH2P 2YTYA 2Z4IA 5KNBA 1FJGL 3I3CA 4C3IH 2E5LQ 3K7AH 4N8FA 1SLJA 2JE6I 4QB4A 4EQNA 1PRTD 5IIFA 2BA0A 4DR7L 1Y8OB 5JJKA 4LF5L 3TS0A 1QZGA 4JBJA 1PMRA 5IP7G 1M8AA 2F0LA 4MN3A 2HDMA 1V1PA 4Q0FA 3C1FA 1SMYD 3IFDA 1DM0B 1K73C 4A3CH 4JI0L 3FPUB 4UY8C 2DGYA 1ILQA 2CCZA 3PUVA 1H9SB 3OSOA 1KDCA 2K50A 3S1RH 2HUGA 2KEEA 1D5MC 1Q1EA 3RUZA 1WTOA 1QVGA 3HOUH 4TQUS 4KN7C 4YY3Q 5IYBG 2OTLA 3G71A 1EEID 2RKSA 1SN8A 1QCBD 5IT9c 3F2CA 4F87A 1PH8A 3TQYA 1YJNA 1KTKA 3RLOA 3MXPA 1AH9A 4IFDH 2BDNA 2VB2X 3I4OA 1LUZA 3LNNA 4OX9Q 1NTGA 2EJFC 3GV3A 3EVQA 4Y7NB 3PO2H 2K4KA 5CMDA 5FK9C 2IW3A 4DR2Q 2QGQA 3PUZA 1JWUD 2KA7A 4GLAC 5I9OA 2XN9C 1HA5A 1YEZA 1X65A 4N9PA 1GXDC 1I4GA 4RCOA 3RZDH 3EN2A 3HFZB 3M4QA 2B2TA 3TMEA 2UUAQ 3KJPA 4A3BH 5GROA 1LTAD 2OXPA 1DOMA 4ZUIA 5M3MB 4DV2Q 5GAHC 1I6VC 2WAQG 4CDCC 1LTGD 3A7LA 1PRTC 2VXWA 5C6AA 4JCVE 2B63H 3SDZA 3PO3G 1I4XA 2E2IB 1YJWA 5C4JH 4A93G 5I4DA 3K57A 5FO7B 3CW2C 2R7ZG 1OTCA 2E5LL 4ZLTF 1SNMA 1Q46A 2TSSA 2K6AA 1VS0A 5IYCH 4RA8A 5C4ZA 4JK1C 5I2XA 1VMPA 5C4XG 5IOCA 2PQAA 3DHQA 3P20A 2NN6H 2C35B 3K0YA 2F0HA 4RGNA 3S17B 3ERQA 1BUVT 4DAYA 1UUPA 1SYDA 2K52A 1VQCA 3MTSA 3ITPA 3OIPA 1Q8IA 3OWEB 4C3IG 4DN4M 3GTJH 4PZ8A 1WCMB 2D0OA 1O7LA 4RH6A 4IQZA 2KHIA 3PF4A 4XYQA 1DCZA 3OHXC 1IYJB 1PFSA 1Q82C 2B8GA 1SE2A 1VF7A 3DWAA 1T5XD 2VNUD 4YY3L 4YWMA 3J81L 2A6HD 1SMXA 2QEXA 3VR3A 2P5ZX 2HCIA 3CD6A 3OMCA 1IZ6A 3MFGA 5DAUA 3H0GH 4OIKA 2E2JB 3GQBA 4DR3Q 1Y1WH 1D5ZC 5IY0A 3AFPA 3EBEA 3C3LA 1CZGA 4A3CG 1JC7A 1HXYD 3H3VI 4OX9L 1PZKD 2K14A 2RCNA 4X64Q 1PFNA 3ND8A 3WOEA 4DU9A 2IJ0A 1GUOA 3HOUG 4F88A 4DR2L 3Q22A 4BWGB 2EYOA 2LS01 4IUTA 3PMFA 3TDQA 1BCPF 1LM0A 1GJXA 2MFIA 4A3MH 4JYAQ 2UUAL 4IFDG 1XYIA 4QMGA 4DV2L 2DUDA 1NSNS 4TSSA 3E3XA 2N3SA 3S1QH 3X3NA 2OTJA 4ZUJA 1HFGA 3I4MB 4ZYSA 1YNJC 4DAVA 1SSOA 2F0OA 1S72A 3CMEA 3E9IA 3JAMc 4GKJQ 1WFQA 1NR2A 2K5QA 2JA6H 4DR6Q 2R92H 1R4QB 2K5HA 4A3BG 1K8AC 1C7YA 2B2YA 5D3DA 3CCVA 1JWMD 3J80i 3W1GA 1JOOA 1SE4A 1B1ZA 2ZTCA 3BVMA 1STYA 2RSNA 2B63G 2VW9A 4XIGS 5CBAE 1DXMA 2K04A 3HOXH 3N52A 5AJ3Q 1E7ZA 1YITA 5BN5A 2M2LA 4BS9A 3L3OC 1HR0Q 2O5IC 2B2TC 2TMPA 4FYDA 2Q8RE 5IYCG 4CBVA 1C9OA 1NR4A 3CCLA 2V4DA 1PH6A 2LMCB 1JORA 1K28A 2QW7A 4LMQD 3G48A 2NN6G 4OXPA 4KJOA 2GVBA 3STBC 3NHHA 3NBHA 3GTLH 4DR3L 4A3EB 1JB7A 3JAME 3HOWH 1SEBD 3FRPB 4X64L 4DAPA 2A8VA 1Q86C 3SE0A 2SNSA 4HJ5A 4AQYQ 3DMUA 2L4NA 3UE0A 1AFPA 1Z47A 5I9PA 4B9XA 2E75C 5FJ8H 1VQ9A 3NXWA 5KGUA 5EBDA 1I6HB 3MZ5A 5K36H 3LWUA 1Y1WG 4JBWA 4JYAL 1SRUA 2BH8A 1E3PA 1EYAA 2HIXA 3RZOH 3AU7A 1VCIA 1JT8A 1GVPA 1CA5A 1S5ED 4A3JH 2K32A 1E1TA 2EY1A 3SXHA 1KAWA 4POGA 3RR5A 3J80E 1VF5C 2A73B 3I2ZA 1NNXA 1QVCA 2YV5A 3A55A 5JPNC 2RVLA 4GKJL 3OOCA 5FKAC 4DR6L 1LTID 1ZEQX 4A3MG 1WD0A 4V0BA 1XWEA 4JBKA 5FLXc 4A3LH 1GUSA 4JPBW 1LYLA 5HGTA 3GTPB 1XMQQ 4OHJA 1QNKA 5AJ3L 5IGEA 3NTIA 3ULJA 5I6WA 4IOCA 2BE5C 2WIIB 3CQZH 5CC4A 5JEAG 2I5MX 3PQIA 1EIGA 1HR0L 2JA6G 1GUWA 2R92G 4BY7B 3I8ZA 1TIID 1PRTF 2AUJD 5A2QE 3SK4A 1XX8A 3CU7A 3S24A 1G91A 1STHA 4RG1A 3RD4A 4C1NI 1RIPA 2PO4A 3GTQH 3HOXG 2FINB 2BOSA 5ELFA 3TP5A 4V190 3CCRA 2JA7H 4HSVA 2J0TD 4X3SA 3CRKC 3NTHA 5ELNA 1S5DD 1N34Q 4P75A 4NXMQ 2NVXB 1UWVA 1EQRA 2Z9HA 3URYA 1B8AA 2F0WA 2KCCA 3G6JB 3W1BA 5LL6X 1IL2A 2LXKA 4IPGA 2RHSB 5FLXE 2YU9H 5C44H 1JE5A 4AQYL 1EY4A 2L12A 1V8QA 4IOAA 4C3HB 4IUVA 4A3GB 1EZ6A 1PTOH 3HKSA 2RF4A 2EJGC 3FKIB 4S3SA 3LGJA 3OTOQ 3L2PA 2JA8H 3GTGH 1UE1A 3HOWG 3CAMA 3GDEA 3M85A 5M5WH 4QY7A 4HCSA 1HNWQ 2ZXPA 3D4DA 4GOPA 4FF4A 4KTAA 1U9RA 1EY0A 3NSWA 4IO9A 1F9RA 4KHZA 5FJ8G 1FNUA 1V9PA 5C3EH 5K36G 2B39A 1X55A 1AE3A 3HGBA 1EU4A 1PYWD 3ULPA 1EY8A 1HNXQ 1HA6A 1JE4A 2HDLA 4Z9CB 2PZWA 4N9TA 2AHOB 1XMQL 5M3FH 3I4NG 3KF8B 1TWAH 3K6OA 5JAVA 5M5XB 3J7A5 3HOVB 1BVSA 4UP7A 3CPWA 2IHFA 3FPPA 5JPMC 3O13A 2Y0SB 3F8TA 1V43A 3KBXA 2RA4A 1NY4A 3HP3A 4UPAA 3OYYA 4A3LG 4RCNA 2MUYA 3NK9A 5E1FA 3U50C 1B70B 1HQMC 1L2FA 4DNIA 3GO5A 4LWCA 1HJPA 1ESFA 4A3IB 4B3SQ 1ET6A 2UXDQ 4X3KA 5FLMH 4R4TA 1YIJA 2C5CA 2A68D 4NXML 4O0AA 4BA1I 3F2BA 4K6LA 2BH2A 5T1GA 1O78A 3G7LA 1PDQA 4DV0Q 1SJED 1X6OA 4BBRH 2WB1E 5JJZA 1JJCB 3K5MA 1PZJD 1KL9A 2YTXA 1I4HA 3H3VH 3FP9A 5EKKA 2OF1A 3R3OA 4QIWB 1QZHA 4PMWA 2WFWA 3OTOL 2PZTA 2NVYB 1TWGB 3K59A 4A3FB 3S2HH 4K5XA 4CDFC 4EQ5A 1K3BC 3PSIA 3LWEA 1HNWL 1BKBA 1QWYA 1CKNA 1I3QH 3M3YH 4DV4Q 1E24A 2F3IA 1WTPA 2F1MA 4JI4Q 1MD2D 3QB3A 3P7JA 3GD7A 2G9DA 4X3UA 2JA8G 1H9RA 3MXGA 1KRSA 1HNXL 1ZKOA 2F0PA 1J9OA 3S1MH 3J7YW 1YJ9A 3GTOB 1C48A 1QILA 4MTNA 4CJ2C 2IX1A 1U0LA 1KHIA 1MKHA 1U4RA 1SBBB 1I4QA 3R8BA 2E76C 5JJLA 5IYDH 3UDXA 4H0LC 4CKBA 3HOZB 2PCFB 1Y8PB 3KLWA 1SFOH 5C3EG 1K0SA 3CHBD 1AP0A 1HTPA 3WOFA 1N36Q 2OQ0A 3ERSX 3A8IE 2L0CA 2QKIC 5M3FG 5ELBA 4B3SL 2E8GA 2UXDL 3HEJA 4LUOA 1SXTA 4FXGC 3QIAA 2BCOA 1GHKA 1VMCA 5CV5A 4OWWB 4DUYQ 1D6EC 1V1PB 4DV0L 5CV4A 2EPBA 2KVMA 3CF5A 1RJTA 4ODGA 5H1SE 4KY6A 4UAIA 3RMHA 3V05A 4HIOA 4KI0A 2A19A 4GLVB 3U9SA 5FLMG 2HQEA 1F9SA 1BBWA 3QOLA 2CVRA 1X32A 3NUCA 1WTVA 4YHHQ 5M5YH 1EL0A 2QA4A 2EIFA 3NQTA 2NVTB 1GHJA 3DEPA 2LFNA 1VQBA 2B2WC 3PCOB 4A3DH 3L0OA 4JI2Q 3N6RA 4DV4L 4FDBA 2JA5G 4DKAC 2ICIA 4JI4L 1VQEA 4KHPQ 2FMCA 4U68A 3J7ZC 4HIDA 1VQ7A 5J39A 2K28A 4BA2I 5D14A 1Z9FA 2WAQB 2Z6KC 1XNQQ 2F3WA 1DJRD 5JEAJ 2FMMA 3PO3B 4EQOA 3I4LA 4GNXA 1MBYA 5HY6A 4RKLA 4A93B 3D4WA 4ZKBB 4KY5A 2A5HA 3T1HQ 3TP6A 2WB1G 3NEMA 2R7ZB 4H7BA 4RHSA 3CXCA 3M4OH 3A7AB 2K05A 4LJZC 3UI2A 1ENAA 1WI5A 2IPKD 4RMFA 1YNXA 2A69D 3U9OA 4C2MH 1N36L 5C4XB 1EWCA 4P2CB 5IGDA 3T1YQ 1VQ5A 2R7DA 4B08A 3D3RA 1H95A 2PQAB 2F4IA 1SYEA 1YHAA 2JJQA 3CCJA 1BQQT 4RGTA 2L15A 2VY3A 5IYDG 4JI3Q 2WKDA 1WVLA 3HKZE 1KD1C 3D8GA 4DUYL 2EYJA 1Q8KA 4PG3A 3K7AB 2IL8A 4Y7NH 1ONLA 5ELOA 2FXQA 4DAYB 5COYA 3CCMA 5BN4A 4JOIA 1TWFH 1D1IA 4P74A 3EJIA 4RAUC 2WKCA 4A76A 3BDLA 4DXFA 3K0XA 3OWFA 2GA4B 5EKIA 4ME3A 5LL6S 2OWOA 4NW2A 3K80C 4GN5A 3TP8A 2ASBA 1CZWA 3J81j 4YWKA 1UE7A 3MA2B 3SVMA 1KAAA 1SE3A 1O7YA 4AIMA 5M3MH 1SNDA 5GQOA 4YHHL 1AN8A 2GVAA 2WINB 1DD2A 4HJ7A 1NMGA 3S14B 1FGBD 3I56A 4L5SA 1ICWA 1CHQD 4R4IA 1PZID 2Z0SA 4IPDA 3TZUA 4JI2L 5D3IB 1B50A 3HOYB 2ID0A 4X3TA 2A74C 1X3EA 4OIJA 1QUQA 2RSOA 4KHPL 3QG1A 4EX5A 4LAAA 2EY5A 1RODA 1R4PB 2DNEA 4LF6Q 2RDFA 1XNQL 2A69C 3JC66 1BOSA 1VQ8A 1LACA 1HNZQ 4GS3A 4A3DG 2JYOA 3SEBA 4DV5Q 4U673 2I5LX 1MIUA 2PW7A 5KYLA 1Z7TA 4JC0A 4KD3A 1PV4A 4NDXA 3T1HL 1YNJD 1CT1D 4KV6A 1XTCD 4A3BB 1SAPA 2PNRC 3E0EA 5IP9H 3OW2A 1LTBD 3T1YL 4L5TA 4FF1A 1VQDA 2B63B 2F4VQ 2D9UA 3CC7A 1B3QA 5C4JB 5D65A 2IHEA 3SGIA 1WYDA 2L5TA 3T56B 2DN8A 5TSSA 4JI3L 2WP8J 3ZYYX 4CKCA 5DM63 4K5WA 4K6DA 4JI6Q 4AYBB 3K5LA 2D5DA 3VR2A 4PV1C 2F0QA 1OXVA 4CHTB 4JVZA 3KJOA 3TZDA 4QCLA 4IJHA 1VQPA 1VQ4A 3CKIB 1RHPA 1EY5A 2ZM6Q 1NJIC 2L9HA 1KDBA 4R4OA 4BXXH 1K0RA 3GTJB 3F2UA 3NBHB 3STBD 3MXNA 4TKOB 3H91A 1SNOA 3W3AA 5IGCA 4R1JA 2ATWA 2JQOA 1E1OA 5IGBA 2LKVA 4H44C 4L63B 1OO9B 2EXZA 3PO2G 3UDFA 4HMIA 2DY7A 1IKLA 5M3MG 1Y1WB 3W5OA 2RBMA 3X3MA 5JVG3 5BR8Q 4LF6L 2EY2A 4GLXA 1N32Q 1CTMA 1HNZL 2ES2A 4MIUA 2JXMB 5C5MA 4DV5L 2CWAA 3TEHB 1BBUA 1S5BD 3OPOA 5DNFA 3HKZG 5C0XH 2UXCQ 1ASYA 5C5LA 2F0JA 1O7IA 3MEHA 1YI2A 2XWJB 3RLFA 2F0TA 4M1UB 1YHQA 3F1ZA 5E4WC 1K8OA 1VQIA 1KNAA 2QEJC 3CCSA 1EYCA 3QOJA 5K5PA 4RGMA 2HCCA 1Y1VH 4FNFA 3S1QB 2JEAI 4PZ7A 2F4VL 5DM73 3NWTA 4YWLA 1PH9A 5JJIA 3B6YA 3TN2A 3J80c 4A3EH 3I73A 4B3MQ 2KHJA 3Q6SA 4R9WA 3I70A 4JI6L 1K83B 1GM5A 2BE5D 2Q8IB 5IP9G 4G7ZC 1L1OA 2OEOA 4I7AA 1X3PA 3T51B 1HFNA 3A54A 1G2SA 1FVIA 5EJWA 1KLUD 2R93H 3HOXB 1JJGA 1F2ZA 1I6HH 1Y69U 1STEA 2G5DA 2ZM6L 4A4IA 1LTRD 2MGSA 2UUBQ 2ZXRA 2L1BA 2UU9Q 4BY1H 2FFKB 3T16A 2H5XA 1PFBA 2B29A 3U4ZA 1GOZA 1TS5A 1T5EA 3H0GG 1EIYB 2L11A 3HRZC 3WWVA 1A3UA 1WD1A 2IY5B 3UDIA 5I6YA 2XRQD 1TWHH 2JEBI 5EAYA 4HIKA 3CCEA 4YIJA 1B4OA 4KKUA 3GTPH 4BXXG 1G2TA 2NVQB 3J7AV 1SNCA 5BR8L 3K5NA 1VDZA 1N32L 2KCTA 3ER0A 1I50B 3VDYA 1VQKA 3KF6A 5CV7A 3SK6A 1OXSC 2UXCL 3NP8A 1P8LA 4QUCA 2AUKA 3ONAB 1LT4D 1XNRQ 4K0KQ 3GP7A 4ZQ3A 4GOPB 3AQQA 1F2YA 1PFMA 3RLNA 3CCUA 2RQXA 2A6EC 2E2HB 1A6XA 1W2BA 3D6CA 3Q23A 3M7NA 1PH1A 1SROA 1SJHD 3I4NB 5ELEA 1WTRA 4NP5A 1VQJA 1CQFA 1DYQA 2Q2TA 5EQ0A 2KENA 2KECA 5C0XG 2EYMA 4C3JH 4B3ML 3BZKA 3S16H 1FGUA 3DM1A 2Z4HA 5EPJA 1Z6HA 1BXTA 4N8X1 2MNAA 4G7HC 3TS2A 4ABNA 3AMUA 1EY7A 3W2DA 1YZ6A 3AEVA 1Y1VG 4L5RC 1VQFA 1CSQA 2K33A 4OONA 3TRZA 4GN3B 4A3GH 4K14A 2EY6A 2F0FA 2B2YC 4HJ8A 1DZ1A 1EQVA 4A3EG 4DFAA 3RN5A 4LUZA 2Y0SE 1HCZA 2UUBL 2UU9L 4KK7A 5IT9L 1X56A 2CH4A 4UDUC 4R4CA 2PNHA 1TS4A 1MSHA 1J8IA 2AQ3B 2JA9A 3BU2A 2R93G 1N9WA 4ILWA 2R61A 4J15A 1GUNA 1AEXA 4AH6A 1TT2A 1U5KA 4BY1G 2CWPA 1F9QA 2Z1CA 1CA6A 3S1NB 4LF8Q 1E2ZA 2HHHQ 1XXGA 2ZJQA 2PYKA 4O1NA 4F7XA 1J5EQ 2YU9B 5J3BA 1L1OC 5LMNW 2Q2UA 1KDAA 1CHPD 4A3JG 4QIWE 3PGZA 1XNRL 1CKNB 4K0KL 1PTOB 2OT2A 4K2LA 3TP7A 4DNTB 3OMGA 4K5VA 2H4OA 3GTGB 1MJCA 4LNQA 1ET9A 4A3IH 3FEWX 2F0IA 3BG3A 1Q7YC 2KHSA 3A8JE 1C0AA 3J81i 2I0QA 2LSSA 4K2KA 1JJ2A 4POFA 1JICA 2NB0A 5NUCA 1S40A 2Q2IA 2MHVA 4FO2A 3F2DA 3S2DB 4UHVA 1XTDA 4KKSA 1IHZA 1V1QA 1EUJA 1PHJA 1AZPA 3RNUA 2SDFA 4G7OC 4DR1Q 4CGYB 1PA6A 4IUPA 3T53B 5M3FB 1EY9A 5JOBA 1TWAB 3J81c 1O80A 3BYYB 5CV9A 5CORA 4C3JG 1S3OA 2PMZE 2E2DC 2NVYH 3GTKH 1TWGH 1RTNA 4TRDA 2XSCA 1IKMA 4IFDJ 1KABA 2PPBC 1EWHA 2JA7G 2J7ZA 4J8QA 1I94Q 1R9TH 4DGZA 4KN4C 4NMZA 5CR3A 4DNRB 4A3GG 2CQOA 4IPHA 2LY7A 4MZ9A 2JP1A 1CSPA 3CP0A 4ID6A 3SHLA 3DWQA 1PH4A 1L0XB 5C44G 1UNSA 2XVSA 1GKHA 3EFXD 4A3KB 4LF8L 2HHHL 1SYCA 5I2YA 1J5EL 4HR7B 5M9OA 2AQ2B 2Q8TA 2R6GA 1IXRA 4J1MA 4XT3B 2VUMH 1VQGA 1TY2A 1NAPA 1JQYD 3QJYA 1Q3LA 5C3XA 1QB5D 3D6WA 5CBEE 2JA5B 3HOZH 3J81E 1HTLD 4MHEA 2F0UA 3GTMB 1K8GA 5IE8A 3DWPA 4BBSH 1M4VA 3A5ZB 3VYUA 4C1NK 3JAML 3BDCA 4FXDA 4CKEA 4JI5Q 4LFAQ 5IP7H 4DAMA 5EGTA 1I3QB 2V1CC 4ZCKA 4LFBQ 3M7GA 1F2MA 4JI8Q 1LABA 2CH4W 1FL0A 4EGVA 3S15B 3MAQA 4GNXB 5CV6A 4JG2A 2SEBD 1H9JA 2WB1B 5G3LF 3TBIB 1IYVA 1MSGA 4GOPC 2KEDA 4MNOA 1CK1A 3VYSA 4A3IG 3S1MB 1B44D 1WTHA 4DR1L 2DJGC 2M9VA 2WAQE 4ALPA 1KC8C 4UP8A 2MPMA 2KCMA 1LO5D 2RDGA 4CJ1B 2XRSD 4JW0A 2JK8A 1TWCB 1DONA 2XNAC 1O7ZA 1EIHA 4X62Q 4JV5Q 1YBYA 1JCKB 1PTOD 1IBLQ 2K01A 1PH5A 2PZUA 3HG9A 1I94L 1Q90A 5FOBB 1TQOA 1VQHA 2NBFA 4NPSA 3T4AC 3I7FA 2F0GA 5E4XA 4BBRG 3SK5A 4EVOA 1L0YB 1SYGA 1JWSD 3H15A 1S5FD 4Q5VA 1MGSA 2MJ8A 1YNNC 2NTSA 3EA6A 4DK0A 4ME5A 2RCFA 1LTTD 1UEAB 4IJLA 3KDFA 4JI1Q 1KIXA 3EQLC 3KLRA 1VQ6A 1CKMA 1LLRD 2F0KA 1EYGA 2CW0C 1EEFD 1LTLA 2WV6D 2EE1A 2O4XA 3S9WA 2KUMA 5M5YB 1QUQB 3H94A 1KXLA 4QUFA 4JI5L 5C0XJ 5FLXL 2MO1A 1VQNA 2VUMG 4LFAL 1X9NA 1C4QA 1FYCA 4LFBL 4JI8L 1D5XC 2KBNA 4DV1Q 2RHQB 3HOZG 1KNEA 4X65Q 1WTXA 4L8JA 4RHRA 4LF4Q 4BBSG 1PTOC 2NZ1D 2ZTDA 3KK7A 3TREA 3P75A 2ICEC 4DPGA 3IAYA 1U4MA 5GAGC 2MO0A 4C3IB 3MEFA 4CDEC 3A5UA 1RDPD 1D7QA 2HT1A 1F77A 2MQHA 3BJUA 4X62L 4JV5L 1Y14B 1B3AA 1QG7A 1STGA 1XPRA 4QF4A 1IBLL 3M4OB 3MWYW 2OCEA 3S14H 1XJVA 1W6JA 4MTKA 1AZQA 4C2MB 3MVVA 4FF2A 4QJFA 2EZVA 2K1BA 1PLFA 3HOYH 1B53A 2GN5A 2I07B 3NBIA 3MHBA 1SE8A 3ZJYC 4R8NA 3C2PA 2E2IH 3S1RB 2CHBD 2CKZB 3R2IA 3HOUB 3KFUA 1WTQA 1EOVA 4AYBE 3PV0A 5EPLA 1TWFB 1IW7D 2B2VA 4C56C 4F8MA 4X6AH 5KIXA 2EDGA 1VQAA 3MXNB 1B9MA 5EKLA 4QGUA 3M4PA 4JI1L 1A0IA 3IFTA 2VQFQ 1TY0A 3PO2B 3S17H 4I65A 4DK1A 1P16A 1YHBA 2DJFC 3BS1A 1A62A 4DK3C 2VQEQ 4OGQC 1WJJA 2O2LD 2EYFA 1X3QA 3VR6A 2ZJRA 1WCMH 2MP1A 3RZDB 2F0NA 1A8VA 1EIFA 2NZHA 3HKZB 4DV1L 2F0EA 5IT9E 1Q81C 3H3VC 3BDOA 1LT5D 1SMYC 2R3ZA 4J6HA 4X65L 3DEOA 5EPKA 4LF4L 2I5HA 2ZTEA 1SDFA 4L5QA 4TVAB 1TR5A 2E2JH 4DR4Q 3NPPA 1HHVA 3U58A 2FHTA 3EIVA 2LXJA 2D2CC 4FP5D 4LFCQ 2X6LA 1ASZA 1H9SA 3BVGA 1WTWA 2K75A 3DM3A 3QO2A 1AE2A 4ZRZA 3QWNA 3C1EA 1UE5A 1QVFA 2EYHA 1HZAA 3H6MA 4IALA 4GNXC 5T1IA 2ZXOA 2XGTA 2HD3A 2Z6BA 1EFWA 4RKBA 2E74C 1IW7C 2B3GA 3EROA 2EXDA 2QDLA 5L37A 2D0PA 4X66Q 1L1OB 4IN3A 1MJEA 2N49A 3I4MH 4QQBX 3SK8A 5E7NA 2SNMA 3K7UC 2CQAA 4OO1I 3NWSA 2PQEA 1XMOQ 2QCPX 4XXEA 2M00A 2RDHA 1E2VA 1EQQA 1KRTA 3H0GB 1PVOA 4E6IA 1WOCA 3HOYG 1UEBA 1FD7D 1I5FA 1CI3M 2L55A 3JAMi 4XQQA 4JOIC 2K03A 2VQFL 2J4XA 2ALYB 5CYUA 3VA7A 3VYRA 1ENFA 1TXYA 3D4RA 2F0VA 2Q2HA 4IUUA 2HIVA 2XWBB 2VQEL 3KUPA 3ULLA 3MC0B 2IWHA 3CMAA 2F0MA 5IWAQ 4A3MB 1OXXK 3PF5A 2N78A 5G3LD 1LT6D 1TU2B 5JEAH 2G9HD 3ND9A 3KF6B 3PIOA 3AB9A 1K83H 3HS0C 4DA2A 4RGOS 4DR4L 4DV3Q 1X3GA 2NUCA 3I72A 3AYHB 3FVQA 3PIP3 4LFCL 2B2VC 1WCMG 2BA1A 2VL6A 4OL7A 2A6ED 2JA6B 4GKKQ 2R92B 1D1KA 2A6HC 5IGFA 2B2UA 3AFQA 5LMNQ 2FJ2A 3GV6A 3K58A 1LV9A 4DV7Q 3PUYA 1PYBA 4XT1B 4AYBG 1BBXC 3D0FA 3NE5B 4DK6C 4K8JA 3PUWA 4KY7A 3RN2A 3LX0A 3E5SA 4H02A 1NE3A 2B8FA 3KOJA 1Y1VB 4X66L 4M8AA 3FHWA 3A56A 2IX0A 5ELDA 1IYUA 4P71A 4HSPA 1W6KA 2NVQH 1UAPA 1PTOF 3IL8A 4XTCS 1XMOL 1I50H 1U4PA 5C4HA 4KMUC 3I55A 3GTLB 1A2UA 5GAEC 1EQTA 1H9MA 4QL5A 4NXNQ 4XQJA 1IBKQ 1MHWC 5KNDA 3WDNA 3HOWB 2R93B
chains in the Genus database with same CATH topology
1PHJA 4NB3A 1VQCA 3GTJH 3RNUA 4JI2Q 3I4MG 4R4QA 4PZ8A 4FDBA 4DV4L 2D0OA 4DKAC 2JA5G 2E2HH 2KHIA 3PF4A 1G6PA 4DR1Q 1IYJB 1PA6A 1PFSA 1Q82C 4JI4L 1VQEA 3D31A 4KHPQ 3J81c 2AWOA 4LF9Q 3J7ZC 4A75A 2VNUD 4UP9A 4HIDA 1VQ7A 4YY3L 3I4NH 4YWMA 4BY7H 1SMXA 4PZ6A 2QEXA 4BA2I 1Z9FA 1S3OA 2PMZE 2Z6KC 5IWAL 1XNQQ 2NVYH 4YCWA 1M1KC 1IBMQ 1N33Q 1IZ6A 1TWGH 4JI7Q 3CD6A 3GTKH 3H0GH 5JEAJ 4DR3Q 1Y1WH 4IFDJ 5IY0A 3AFPA 4GNXA 3EBEA 5HY6A 2JA7G 4A3CG 2ZJPA 3H3VI 2NZOA 1I94Q 4OX9L 2K14A 2RCNA 1GD7A 1R9TH 4X64Q 4P73A 4DV3L 1GO3E 3T1HQ 2WB1G 3NEMA 2CQOA 4IPHA 2NVXH 4MZ9A 3HOUG 3CXCA 1CSPA 3CP0A 4DR2L 3M4OH 4B3RQ 4Y52H 1PH4A 4RMFA 1WI5A 4P72A 5C44G 1YNXA 1N36L 4GKKL 2HQLA 4C2MH 4WJ4A 3A0JA 1NBWA 4DUZQ 1LM0A 1GKHA 3T1YQ 1VQ5A 5LMNL 2MFIA 4A3MH 2R7DA 4JYAQ 4B3TQ 4LF8L 2HHHL 2UUAL 4IFDG 1H95A 2PQAB 4DV7L 4DV2L 2VS1A 2JJQA 1YHAA 3CCJA 3CCQA 1J5EL 2DUDA 4C3HH 1HZBA 2L15A 2AMCB 1IXRA 2R6GA 2AKWB 2VY3A 5IYDG 4JI3Q 2VUMH 2N3SA 3HKZE 1VQGA 4DUYL 1KD1C 3S1QH 2OTJA 1CKOA 1Q8KA 3FKIH 4PG3A 4Y7NH 5ELOA 2FXQA 4DAYB 3CCMA 3HOZH 4JOIA 1TWFH 4P74A 1S72A 1XPOA 3CMEA 3E9IA 1PYSB 4A76A 3K0XA 1K8GA 4ME3A 5IE8A 3JAMc 1WFQA 4GKJQ 2OWOA 4BBSH 2JA6H 4DR6Q 3K80C 3UE1A 2R92H 2CFMA 3A5ZB 4GN5A 2ASBA 2K5HA 4A3BG 1K8AC 3J81j 4YWKA 3S1NH 4JI5Q 1UE7A 1C7YA 3ICEA 4IFDI 2UXBQ 3CCVA 3NELA 3J80i 4DV6Q 4WJ3M 3W1GA 2ZTCA 4LFAQ 4AIMA 5IP7H 5M3MH 3G6EA 1M90C 4DAMA 5GQOA 2V1CC 4YHHL 2B63G 2VW9A 1YVCA 2GVAA 4XIGS 1OXTA 1UE6A 4JI8Q 4LFBQ 1FL0A 3HOXH 1G291 4GNXB 5AJ3Q 4NXNL 1E7ZA 4LUVA 1YITA 4HJ7A 1NMGA 2YYZA 4JG2A 3I56A 1IBKL 4DR7Q 4L5SA 1HR0Q 4R4IA 3CPFA 4JBMA 2Z0SA 4IPDA 4GOPC 4JI2L 4MNOA 5M5XH 2ID0A 4A3IG 3HOVH 5IYCG 4DR1L 2WAQE 1C9OA 3U4VA 4ALPA 1X3EA 1KC8C 3CCLA 4UP8A 1QUQA 1PH6A 1KQSA 1HR0W 4KHPL 5HGQA 4LF9L 2KCMA 4EX5A 3G48A 1HZCA 1K9MC 2NN6G 1SR3A 2JK8A 2N8NA 5GADC 4OXPA 4HJAA 4LF6Q 1XNQL 2GVBA 3STBC 1A63A 4X62Q 1IBML 3JC66 3K8AA 4JI7L 1N33L 4JV5Q 1YBYA 1HNZQ 1VQ8A 4GS3A 3GTLH 4A3DG 4DR3L 4DV5Q 1IBLQ 3S2DH 2I5LX 1PH5A 1MIUA 1JB7A 1I94L 3HOWH 4X64L 4JC0A 1PV4A 1VQHA 4NPSA 2A8VA 1Q86C 3T1HL 4HJ5A 4APVA 2PI2E 4AQYQ 3I7FA 4B3RL 1DGSA 4BBRG 4BY7G 3UE0A 1Z47A 3E0EA 2NN6I 5IP9H 3OW2A 3NENA 5FJ8H 4L5TA 4DUZL 2AWNA 3T1YL 1VQ9A 1VQDA 1Y1WG 4B3TL 4JBWA 2F4VQ 1SRUA 4JYAL 3CC7A 2BH8A 1E3PA 2HIXA 3H15A 3RZOH 1VCIA 1JT8A 1GVPA 2IHEA 3SGIA 1WYDA 3Q8DA 4A3JH 2K5NA 1E1TA 4JI3L 1KAWA 4POGA 2WP8J 1Q1BA 4JI6Q 4IJLA 3KDFA 3RR5A 4JI1Q 1KIXA 1VQ6A 3I2ZA 1CKMA 1QVCA 2UUCQ 2D62A 2YV5A 1OXVA 1EYGA 4A3FH 3KJOA 1LTLA 4GKJL 4DR6L 4A3MG 4HJ9A 5LMUQ 5FLXc 4IJHA 1VQPA 1QUQB 1VQ4A 1N34L 4JBKA 1JMCA 1KXLA 4A3LH 4JI5L 1LYLA 5C0XJ 4A3KH 2UXBL 2XTIA 2MO1A 2ZM6Q 4YCUA 4DV6L 1NJIC 2Z6KA 5DLQE 1VQNA 4LFAL 2VUMG 1XPUA 1XMQQ 4R4OA 1X9NA 4BXXH 1K0RA 3FKIG 3NBHB 3STBD 4LFBL 4JI8L 2KBNA 4DV1Q 2RHQB 1D8LA 3HOZG 5AJ3L 1T9HA 1E22A 3ULJA 4IOCA 4R1JA 2JA5H 3GTOH 4X65Q 3CQZH 5JEAG 2I5MX 1VQLA 2ATWA 4LF4Q 3UDGA 4O2DA 2JQOA 1E1OA 4OWTB 1HR0L 2JA6G 2R92G 4BBSG 3GTMH 2ZTDA 3TREA 3DLLA 4DPGA 3PO2G 5GAGC 3UDFA 2MO0A 3MEFA 3IRBA 5M3MG 3S24A 3A5UA 3W5OA 1D7QA 4RG1A 2HT1A 1RIPA 1W3SA 5BR8Q 4LF6L 3HOXG 3GTQH 4GLXA 2IT1A 3L7ZC 1N32Q 2MQHA 3CCRA 3BJUA 2JA7H 4X62L 4DR5Q 4JV5L 3KYHC 1Y14B 1HNZL 5ELNA 2ES2A 3PIPA 1XPRA 1N34Q 4P75A 4NXMQ 4DV5L 1UWVA 1IBLL 3G4SA 2CWAA 1EQRA 2OCEA 3TEHB 1BBUA 3S14H 1X54A 2VZAA 4LF7Q 1B8AA 1XJVA 1RL2A 3HKZG 2UXCQ 1ASYA 3W1BA 1J6QA 1IL2A 3HOVG 3KDFB 2LXKA 4IPGA 1L0WA 2YTVA 1O7IA 4QJFA 1YI2A 2RHSB 3RLFA 3HOYH 1YHQA 3F1ZA 2YU9H 2Y0SG 5C44H 1Q12A 2GN5A 1JE5A 5C0XI 4AQYL 1VQIA 1FJGQ 1SE8A 3ZJYC 3CCSA 3CC4A 4IOAA 2E2IH 1CUKA 1Y1VH 3CC2A 2CKZB 2A1AA 3HKSA 3M9BA 1OXUA 1VQMA 1TWCH 2RF4A 4LW1A 2JEAI 3KFUA 4PZ7A 3OTOQ 3LGJA 3L2PA 2F4VL 2JA8H 1EOVA 4LF5Q 3GTGH 4IPCA 4AYBE 1PH9A 4YWLA 3PV0A 5JJIA 3B6YA 5IYBH 3S15H 4X6AH 1UE1A 3J80c 3HOWG 3CAMA 4A3EH 4B3MQ 3GDEA 1VQAA 3MXNB 3M85A 2KHJA 5M5WH 4QGUA 4JI6L 1EWIA 4QY7A 1GM5A 3M4PA 4JI1L 1HNWQ 1A0IA 4GOPA 2UUCL 2VQFQ 4JI0Q 2NVTH 3S17H 2F52A 4IO9A 5IP9G 1L1OA 4KHZA 3A74A 5FJ8G 1P16A 1YHBA 4HIMA 1A62A 1V9PA 5C3EH 5K36G 4DK3C 5LMUL 2VQEQ 2K5VA 2R93H 1FVIA 1WJJA 1X55A 1AE3A 3ULPA 1HNXQ 1JJGA 1I6HH 1NMFA 1WCMH 2ZJRA 2ZM6L 4GN4B 4OWXB 4A4IA 1K3RA 2AHOB 1XMQL 2UUBQ 2UU9Q 1A8VA 5M3FH 4BY1H 3KF8B 1EIFA 3I4NG 3TRZA 1TWAH 2NZHA 2H5XA 4DV1L 3U4ZA 2B29A 3J7A5 1Q81C 1BVSA 4UP7A 3CPWA 2IHFA 3H0GG 1EIYB 4X65L 4A3FG 3F8TA 3PUXA 1V43A 3WWVA 2PI2A 4LF4L 1NY4A 2I5HA 2ZTEA 4L5QA 4TVAB 4UPAA 2E2JH 4DR4Q 2IY5B 3UDIA 3PO3H 3OYYA 3U58A 2EQSA 3EIVA 4A3LG 1TWHH 2JEBI 2LXJA 5EAYA 4HIKA 4LFCQ 1VQOA 3CCEA 4A3KG 2R7FA 1B70B 3U50C 1PH2A 3BZCA 1ASZA 3E9HA 4A93H 1L2FA 4DNIA 3GO5A 1B7YB 1N8RC 2OQKA 1HJPA 4LWCA 2K75A 3DM3A 4B3SQ 3GTPH 4BXXG 4KLKA 1AE2A 2R7ZH 1PH7A 2UXDQ 4OO1G 5BR8L 5FLMH 4YCVA 4R4TA 1N32L 2KCTA 3ER0A 4DR5L 1YIJA 1UE5A 3VDYA 1VQKA 1QVFA 5C4XH 3KF6A 1HZAA 4NXML 1PH3A 4O0AA 4BA1I 4GNXC 1OXSC 3F2BA 2BH2A 4LF7L 1G51A 2UXCL 2XGTA 3K81C 1HZ9A 1P8LA 1EFWA 4DV0Q 2EXDA 2B3GA 1X3FA 1X6OA 1XNRQ 2D0PA 4BBRH 4X66Q 2WB1E 4K0KQ 4GOPB 3AQQA 1JJCB 3RLNA 3CCUA 1HH2P 2YTYA 1KL9A 2YTXA 1L1OB 3H3VH 3FP9A 1FJGL 4C3IH 1MJEA 2E5LQ 2N49A 3K7AH 1W2BA 3I4MH 4QQBX 1SLJA 2JE6I 1QZHA 5E7NA 3M7NA 3K7UC 4OO1I 1PH1A 1XMOQ 1SROA 4PMWA 2WFWA 1VQJA 2BA0A 3OTOL 2Q2TA 4DR7L 5JJKA 4LF5L 3TS0A 1EQQA 2KENA 5C0XG 1QZGA 4JBJA 1KRTA 4C3JH 1PVOA 4B3ML 5IP7G 1WOCA 3BZKA 3S16H 3S2HH 3HOYG 1FGUA 1UEBA 4EQ5A 1I5FA 3PSIA 2MNAA 1HNWL 1BKBA 3TS2A 1CKNA 3JAMi 1I3QH 4JOIC 1K73C 2VQFL 4A3CH 4JI0L 4DV4Q 1YZ6A 2ALYB 3AEVA 3M3YH 1E24A 2F3IA 4UY8C 1Y1VG 2DGYA 4L5RC 1VQFA 4JI4Q 2CCZA 1CSQA 1TXYA 2Q2HA 3PUVA 4OONA 2K50A 3GD7A 2HIVA 4GN3B 3S1RH 2VQEL 2JA8G 3ULLA 1Q1EA 3HOUH 4A3GH 1QVGA 4TQUS 1KRSA 1HNXL 4YY3Q 5IYBG 2OTLA 4HJ8A 3G71A 1SN8A 5IT9c 3CMAA 3F2CA 4A3EG 1YJ9A 3S1MH 5IWAQ 1PH8A 3RN5A 3TQYA 1OXXK 4LUZA 3PF5A 2N78A 2Y0SE 1YJNA 2UU9L 2UUBL 4MTNA 3RLOA 2IX1A 1AH9A 1U0LA 1X56A 3KF6B 3PIOA 1KHIA 1MKHA 3I4OA 1LUZA 4OX9Q 1K83H 1NTGA 5JJLA 4R4CA 2PNHA 5IYDH 3UDXA 3PO2H 2K4KA 4DV3Q 1X3GA 4DR4L 3KLWA 1SFOH 5C3EG 4A3GG 2JA9A 3BU2A 4DR2Q 2QGQA 1N9WA 3AYHB 2R93G 4LFCL 3PUZA 2BA1A 1WCMG 4GLAC 2VL6A 1N36Q 2OQ0A 3ERSX 4GKKQ 1YEZA 1X65A 4J15A 3AFQA 4AH6A 5M3FG 1U5KA 4BY1G 4B3SL 2CWPA 5LMNQ 2E8GA 3EN2A 3HFZB 3M4QA 3RZDH 2UXDL 4LF8Q 2HHHQ 2UUAQ 3KJPA 2ZJQA 4LUOA 5GROA 4A3BH 4DV7Q 3PUYA 4DV2Q 1PYBA 1J5EQ 4AYBG 5GAHC 3D0FA 2WAQG 5J3BA 1L1OC 4DK6C 5LMNW 3PUWA 4OWWB 4DUYQ 4JCVE 3RN2A 2Q2UA 2B63H 3PO3G 4H02A 1NE3A 4A3JG 4QIWE 3KOJA 3PGZA 4DV0L 1XNRL 1CKNB 3CF5A 4K0KL 4X66L 5C4JH 5H1SE 1YJWA 4A93G 3FHWA 4HIOA 2IX0A 1MJCA 4KI0A 2A19A 3CW2C 4LNQA 1OTCA 4GLVB 2E5LL 4P71A 2R7ZG 1Q46A 5FLMG 4A3IH 1VS0A 5IYCH 2NVQH 1Q7YC 1BBWA 4XTCS 1XMOL 1C0AA 5C4XG 3J81i 2PQAA 1I50H 2I0QA 2LSSA 4YHHQ 5M5YH 2QA4A 2EIFA 1JJ2A 4POFA 2C35B 1S40A 3I55A 2Q2IA 5GAEC 4QL5A 4NXNQ 1VQBA 3F2DA 1IBKQ 3PCOB 1XTDA 4A3DH 1V1QA 1EUJA 3L0OA 2K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHJ A;  4NB3 A;  1VQC A;  3GTJ H;  3RNU A;  4JI2 Q;  3I4M G;  4R4Q A;  4PZ8 A;  4FDB A;  4DV4 L;  2D0O A;  4DKA C;  2JA5 G;  2E2H H;  2KHI A;  3PF4 A;  1G6P A;  4DR1 Q;  1IYJ B;  1PA6 A;  1PFS A;  1Q82 C;  4JI4 L;  1VQE A;  3D31 A;  4KHP Q;  3J81 c;  2AWO A;  4LF9 Q;  3J7Z C;  4A75 A;  2VNU D;  4UP9 A;  4HID A;  1VQ7 A;  4YY3 L;  3I4N H;  4YWM A;  4BY7 H;  1SMX A;  4PZ6 A;  2QEX A;  4BA2 I;  1Z9F A;  1S3O A;  2PMZ E;  2Z6K C;  5IWA L;  1XNQ Q;  2NVY H;  4YCW A;  1M1K C;  1IBM Q;  1N33 Q;  1IZ6 A;  1TWG H;  4JI7 Q;  3CD6 A;  3GTK H;  3H0G H;  5JEA J;  4DR3 Q;  1Y1W H;  4IFD J;  5IY0 A;  3AFP A;  4GNX A;  3EBE A;  5HY6 A;  2JA7 G;  4A3C G;  2ZJP A;  3H3V I;  2NZO A;  1I94 Q;  4OX9 L;  2K14 A;  2RCN A;  1GD7 A;  1R9T H;  4X64 Q;  4P73 A;  4DV3 L;  1GO3 E;  3T1H Q;  2WB1 G;  3NEM A;  2CQO A;  4IPH A;  2NVX H;  4MZ9 A;  3HOU G;  3CXC A;  1CSP A;  3CP0 A;  4DR2 L;  3M4O H;  4B3R Q;  4Y52 H;  1PH4 A;  4RMF A;  1WI5 A;  4P72 A;  5C44 G;  1YNX A;  1N36 L;  4GKK L;  2HQL A;  4C2M H;  4WJ4 A;  3A0J A;  1NBW A;  4DUZ Q;  1LM0 A;  1GKH A;  3T1Y Q;  1VQ5 A;  5LMN L;  2MFI A;  4A3M H;  2R7D A;  4JYA Q;  4B3T Q;  4LF8 L;  2HHH L;  2UUA L;  4IFD G;  1H95 A;  2PQA B;  4DV7 L;  4DV2 L;  2VS1 A;  2JJQ A;  1YHA A;  3CCJ A;  3CCQ A;  1J5E L;  2DUD A;  4C3H H;  1HZB A;  2L15 A;  2AMC B;  1IXR A;  2R6G A;  2AKW B;  2VY3 A;  5IYD G;  4JI3 Q;  2VUM H;  2N3S A;  3HKZ E;  1VQG A;  4DUY L;  1KD1 C;  3S1Q H;  2OTJ A;  1CKO A;  1Q8K A;  3FKI H;  4PG3 A;  4Y7N H;  5ELO A;  2FXQ A;  4DAY B;  3CCM A;  3HOZ H;  4JOI A;  1TWF H;  4P74 A;  1S72 A;  1XPO A;  3CME A;  3E9I A;  1PYS B;  4A76 A;  3K0X A;  1K8G A;  4ME3 A;  5IE8 A;  3JAM c;  1WFQ A;  4GKJ Q;  2OWO A;  4BBS H;  2JA6 H;  4DR6 Q;  3K80 C;  3UE1 A;  2R92 H;  2CFM A;  3A5Z B;  4GN5 A;  2ASB A;  2K5H A;  4A3B G;  1K8A C;  3J81 j;  4YWK A;  3S1N H;  4JI5 Q;  1UE7 A;  1C7Y A;  3ICE A;  4IFD I;  2UXB Q;  3CCV A;  3NEL A;  3J80 i;  4DV6 Q;  4WJ3 M;  3W1G A;  2ZTC A;  4LFA Q;  4AIM A;  5IP7 H;  5M3M H;  3G6E A;  1M90 C;  4DAM A;  5GQO A;  2V1C C;  4YHH L;  2B63 G;  2VW9 A;  1YVC A;  2GVA A;  4XIG S;  1OXT A;  1UE6 A;  4JI8 Q;  4LFB Q;  1FL0 A;  3HOX H;  1G29 1;  4GNX B;  5AJ3 Q;  4NXN L;  1E7Z A;  4LUV A;  1YIT A;  4HJ7 A;  1NMG A;  2YYZ A;  4JG2 A;  3I56 A;  1IBK L;  4DR7 Q;  4L5S A;  1HR0 Q;  4R4I A;  3CPF A;  4JBM A;  2Z0S A;  4IPD A;  4GOP C;  4JI2 L;  4MNO A;  5M5X H;  2ID0 A;  4A3I G;  3HOV H;  5IYC G;  4DR1 L;  2WAQ E;  1C9O A;  3U4V A;  4ALP A;  1X3E A;  1KC8 C;  3CCL A;  4UP8 A;  1QUQ A;  1PH6 A;  1KQS A;  1HR0 W;  4KHP L;  5HGQ A;  4LF9 L;  2KCM A;  4EX5 A;  3G48 A;  1HZC A;  1K9M C;  2NN6 G;  1SR3 A;  2JK8 A;  2N8N A;  5GAD C;  4OXP A;  4HJA A;  4LF6 Q;  1XNQ L;  2GVB A;  3STB C;  1A63 A;  4X62 Q;  1IBM L;  3JC6 6;  3K8A A;  4JI7 L;  1N33 L;  4JV5 Q;  1YBY A;  1HNZ Q;  1VQ8 A;  4GS3 A;  3GTL H;  4A3D G;  4DR3 L;  4DV5 Q;  1IBL Q;  3S2D H;  2I5L X;  1PH5 A;  1MIU A;  1JB7 A;  1I94 L;  3HOW H;  4X64 L;  4JC0 A;  1PV4 A;  1VQH A;  4NPS A;  2A8V A;  1Q86 C;  3T1H L;  4HJ5 A;  4APV A;  2PI2 E;  4AQY Q;  3I7F A;  4B3R L;  1DGS A;  4BBR G;  4BY7 G;  3UE0 A;  1Z47 A;  3E0E A;  2NN6 I;  5IP9 H;  3OW2 A;  3NEN A;  5FJ8 H;  4L5T A;  4DUZ L;  2AWN A;  3T1Y L;  1VQ9 A;  1VQD A;  1Y1W G;  4B3T L;  4JBW A;  2F4V Q;  1SRU A;  4JYA L;  3CC7 A;  2BH8 A;  1E3P A;  2HIX A;  3H15 A;  3RZO H;  1VCI A;  1JT8 A;  1GVP A;  2IHE A;  3SGI A;  1WYD A;  3Q8D A;  4A3J H;  2K5N A;  1E1T A;  4JI3 L;  1KAW A;  4POG A;  2WP8 J;  1Q1B A;  4JI6 Q;  4IJL A;  3KDF A;  3RR5 A;  4JI1 Q;  1KIX A;  1VQ6 A;  3I2Z A;  1CKM A;  1QVC A;  2UUC Q;  2D62 A;  2YV5 A;  1OXV A;  1EYG A;  4A3F H;  3KJO A;  1LTL A;  4GKJ L;  4DR6 L;  4A3M G;  4HJ9 A;  5LMU Q;  5FLX c;  4IJH A;  1VQP A;  1QUQ B;  1VQ4 A;  1N34 L;  4JBK A;  1JMC A;  1KXL A;  4A3L H;  4JI5 L;  1LYL A;  5C0X J;  4A3K H;  2UXB L;  2XTI A;  2MO1 A;  2ZM6 Q;  4YCU A;  4DV6 L;  1NJI C;  2Z6K A;  5DLQ E;  1VQN A;  4LFA L;  2VUM G;  1XPU A;  1XMQ Q;  4R4O A;  1X9N A;  4BXX H;  1K0R A;  3FKI G;  3NBH B;  3STB D;  4LFB L;  4JI8 L;  2KBN A;  4DV1 Q;  2RHQ B;  1D8L A;  3HOZ G;  5AJ3 L;  1T9H A;  1E22 A;  3ULJ A;  4IOC A;  4R1J A;  2JA5 H;  3GTO H;  4X65 Q;  3CQZ H;  5JEA G;  2I5M X;  1VQL A;  2ATW A;  4LF4 Q;  3UDG A;  4O2D A;  2JQO A;  1E1O A;  4OWT B;  1HR0 L;  2JA6 G;  2R92 G;  4BBS G;  3GTM H;  2ZTD A;  3TRE A;  3DLL A;  4DPG A;  3PO2 G;  5GAG C;  3UDF A;  2MO0 A;  3MEF A;  3IRB A;  5M3M G;  3S24 A;  3A5U A;  3W5O A;  1D7Q A;  4RG1 A;  2HT1 A;  1RIP A;  1W3S A;  5BR8 Q;  4LF6 L;  3HOX G;  3GTQ H;  4GLX A;  2IT1 A;  3L7Z C;  1N32 Q;  2MQH A;  3CCR A;  3BJU A;  2JA7 H;  4X62 L;  4DR5 Q;  4JV5 L;  3KYH C;  1Y14 B;  1HNZ L;  5ELN A;  2ES2 A;  3PIP A;  1XPR A;  1N34 Q;  4P75 A;  4NXM Q;  4DV5 L;  1UWV A;  1IBL L;  3G4S A;  2CWA A;  1EQR A;  2OCE A;  3TEH B;  1BBU A;  3S14 H;  1X54 A;  2VZA A;  4LF7 Q;  1B8A A;  1XJV A;  1RL2 A;  3HKZ G;  2UXC Q;  1ASY A;  3W1B A;  1J6Q A;  1IL2 A;  3HOV G;  3KDF B;  2LXK A;  4IPG A;  1L0W A;  2YTV A;  1O7I A;  4QJF A;  1YI2 A;  2RHS B;  3RLF A;  3HOY H;  1YHQ A;  3F1Z A;  2YU9 H;  2Y0S G;  5C44 H;  1Q12 A;  2GN5 A;  1JE5 A;  5C0X I;  4AQY L;  1VQI A;  1FJG Q;  1SE8 A;  3ZJY C;  3CCS A;  3CC4 A;  4IOA A;  2E2I H;  1CUK A;  1Y1V H;  3CC2 A;  2CKZ B;  2A1A A;  3HKS A;  3M9B A;  1OXU A;  1VQM A;  1TWC H;  2RF4 A;  4LW1 A;  2JEA I;  3KFU A;  4PZ7 A;  3OTO Q;  3LGJ A;  3L2P A;  2F4V L;  2JA8 H;  1EOV A;  4LF5 Q;  3GTG H;  4IPC A;  4AYB E;  1PH9 A;  4YWL A;  3PV0 A;  5JJI A;  3B6Y A;  5IYB H;  3S15 H;  4X6A H;  1UE1 A;  3J80 c;  3HOW G;  3CAM A;  4A3E H;  4B3M Q;  3GDE A;  1VQA A;  3MXN B;  3M85 A;  2KHJ A;  5M5W H;  4QGU A;  4JI6 L;  1EWI A;  4QY7 A;  1GM5 A;  3M4P A;  4JI1 L;  1HNW Q;  1A0I A;  4GOP A;  2UUC L;  2VQF Q;  4JI0 Q;  2NVT H;  3S17 H;  2F52 A;  4IO9 A;  5IP9 G;  1L1O A;  4KHZ A;  3A74 A;  5FJ8 G;  1P16 A;  1YHB A;  4HIM A;  1A62 A;  1V9P A;  5C3E H;  5K36 G;  4DK3 C;  5LMU L;  2VQE Q;  2K5V A;  2R93 H;  1FVI A;  1WJJ A;  1X55 A;  1AE3 A;  3ULP A;  1HNX Q;  1JJG A;  1I6H H;  1NMF A;  1WCM H;  2ZJR A;  2ZM6 L;  4GN4 B;  4OWX B;  4A4I A;  1K3R A;  2AHO B;  1XMQ L;  2UUB Q;  2UU9 Q;  1A8V A;  5M3F H;  4BY1 H;  3KF8 B;  1EIF A;  3I4N G;  3TRZ A;  1TWA H;  2NZH A;  2H5X A;  4DV1 L;  3U4Z A;  2B29 A;  3J7A 5;  1Q81 C;  1BVS A;  4UP7 A;  3CPW A;  2IHF A;  3H0G G;  1EIY B;  4X65 L;  4A3F G;  3F8T A;  3PUX A;  1V43 A;  3WWV A;  2PI2 A;  4LF4 L;  1NY4 A;  2I5H A;  2ZTE A;  4L5Q A;  4TVA B;  4UPA A;  2E2J H;  4DR4 Q;  2IY5 B;  3UDI A;  3PO3 H;  3OYY A;  3U58 A;  2EQS A;  3EIV A;  4A3L G;  1TWH H;  2JEB I;  2LXJ A;  5EAY A;  4HIK A;  4LFC Q;  1VQO A;  3CCE A;  4A3K G;  2R7F A;  1B70 B;  3U50 C;  1PH2 A;  3BZC A;  1ASZ A;  3E9H A;  4A93 H;  1L2F A;  4DNI A;  3GO5 A;  1B7Y B;  1N8R C;  2OQK A;  1HJP A;  4LWC A;  2K75 A;  3DM3 A;  4B3S Q;  3GTP H;  4BXX G;  4KLK A;  1AE2 A;  2R7Z H;  1PH7 A;  2UXD Q;  4OO1 G;  5BR8 L;  5FLM H;  4YCV A;  4R4T A;  1N32 L;  2KCT A;  3ER0 A;  4DR5 L;  1YIJ A;  1UE5 A;  3VDY A;  1VQK A;  1QVF A;  5C4X H;  3KF6 A;  1HZA A;  4NXM L;  1PH3 A;  4O0A A;  4BA1 I;  4GNX C;  1OXS C;  3F2B A;  2BH2 A;  4LF7 L;  1G51 A;  2UXC L;  2XGT A;  3K81 C;  1HZ9 A;  1P8L A;  1EFW A;  4DV0 Q;  2EXD A;  2B3G A;  1X3F A;  1X6O A;  1XNR Q;  2D0P A;  4BBR H;  4X66 Q;  2WB1 E;  4K0K Q;  4GOP B;  3AQQ A;  1JJC B;  3RLN A;  3CCU A;  1HH2 P;  2YTY A;  1KL9 A;  2YTX A;  1L1O B;  3H3V H;  3FP9 A;  1FJG L;  4C3I H;  1MJE A;  2E5L Q;  2N49 A;  3K7A H;  1W2B A;  3I4M H;  4QQB X;  1SLJ A;  2JE6 I;  1QZH A;  5E7N A;  3M7N A;  3K7U C;  4OO1 I;  1PH1 A;  1XMO Q;  1SRO A;  4PMW A;  2WFW A;  1VQJ A;  2BA0 A;  3OTO L;  2Q2T A;  4DR7 L;  5JJK A;  4LF5 L;  3TS0 A;  1EQQ A;  2KEN A;  5C0X G;  1QZG A;  4JBJ A;  1KRT A;  4C3J H;  1PVO A;  4B3M L;  5IP7 G;  1WOC A;  3BZK A;  3S16 H;  3S2H H;  3HOY G;  1FGU A;  1UEB A;  4EQ5 A;  1I5F A;  3PSI A;  2MNA A;  1HNW L;  1BKB A;  3TS2 A;  1CKN A;  3JAM i;  1I3Q H;  4JOI C;  1K73 C;  2VQF L;  4A3C H;  4JI0 L;  4DV4 Q;  1YZ6 A;  2ALY B;  3AEV A;  3M3Y H;  1E24 A;  2F3I A;  4UY8 C;  1Y1V G;  2DGY A;  4L5R C;  1VQF A;  4JI4 Q;  2CCZ A;  1CSQ A;  1TXY A;  2Q2H A;  3PUV A;  4OON A;  2K50 A;  3GD7 A;  2HIV A;  4GN3 B;  3S1R H;  2VQE L;  2JA8 G;  3ULL A;  1Q1E A;  3HOU H;  4A3G H;  1QVG A;  4TQU S;  1KRS A;  1HNX L;  4YY3 Q;  5IYB G;  2OTL A;  4HJ8 A;  3G71 A;  1SN8 A;  5IT9 c;  3CMA A;  3F2C A;  4A3E G;  1YJ9 A;  3S1M H;  5IWA Q;  1PH8 A;  3RN5 A;  3TQY A;  1OXX K;  4LUZ A;  3PF5 A;  2N78 A;  2Y0S E;  1YJN A;  2UU9 L;  2UUB L;  4MTN A;  3RLO A;  2IX1 A;  1AH9 A;  1U0L A;  1X56 A;  3KF6 B;  3PIO A;  1KHI A;  1MKH A;  3I4O A;  1LUZ A;  4OX9 Q;  1K83 H;  1NTG A;  5JJL A;  4R4C A;  2PNH A;  5IYD H;  3UDX A;  3PO2 H;  2K4K A;  4DV3 Q;  1X3G A;  4DR4 L;  3KLW A;  1SFO H;  5C3E G;  4A3G G;  2JA9 A;  3BU2 A;  4DR2 Q;  2QGQ A;  1N9W A;  3AYH B;  2R93 G;  4LFC L;  3PUZ A;  2BA1 A;  1WCM G;  4GLA C;  2VL6 A;  1N36 Q;  2OQ0 A;  3ERS X;  4GKK Q;  1YEZ A;  1X65 A;  4J15 A;  3AFQ A;  4AH6 A;  5M3F G;  1U5K A;  4BY1 G;  4B3S L;  2CWP A;  5LMN Q;  2E8G A;  3EN2 A;  3HFZ B;  3M4Q A;  3RZD H;  2UXD L;  4LF8 Q;  2HHH Q;  2UUA Q;  3KJP A;  2ZJQ A;  4LUO A;  5GRO A;  4A3B H;  4DV7 Q;  3PUY A;  4DV2 Q;  1PYB A;  1J5E Q;  4AYB G;  5GAH C;  3D0F A;  2WAQ G;  5J3B A;  1L1O C;  4DK6 C;  5LMN W;  3PUW A;  4OWW B;  4DUY Q;  4JCV E;  3RN2 A;  2Q2U A;  2B63 H;  3PO3 G;  4H02 A;  1NE3 A;  4A3J G;  4QIW E;  3KOJ A;  3PGZ A;  4DV0 L;  1XNR L;  1CKN B;  3CF5 A;  4K0K L;  4X66 L;  5C4J H;  5H1S E;  1YJW A;  4A93 G;  3FHW A;  4HIO A;  2IX0 A;  1MJC A;  4KI0 A;  2A19 A;  3CW2 C;  4LNQ A;  1OTC A;  4GLV B;  2E5L L;  4P71 A;  2R7Z G;  1Q46 A;  5FLM G;  4A3I H;  1VS0 A;  5IYC H;  2NVQ H;  1Q7Y C;  1BBW A;  4XTC S;  1XMO L;  1C0A A;  5C4X G;  3J81 i;  2PQA A;  1I50 H;  2I0Q A;  2LSS A;  4YHH Q;  5M5Y H;  2QA4 A;  2EIF A;  1JJ2 A;  4POF A;  2C35 B;  1S40 A;  3I55 A;  2Q2I A;  5GAE C;  4QL5 A;  4NXN Q;  1VQB A;  3F2D A;  1IBK Q;  3PCO B;  1XTD A;  4A3D H;  1V1Q A;  1EUJ A;  3L0O A;  2K52 A; 
#chains in the Genus database with same CATH topology
 4NB3 A;  4DF7 A;  2F03 A;  3TSS A;  3I4M G;  4R4Q A;  1G6P A;  4HED A;  2E2H H;  3E0J A;  1F9P A;  2KCN A;  4BY1 B;  3D31 A;  1RTO A;  2AWO A;  4LF9 Q;  1JR0 D;  4A75 A;  4L6T B;  4UP9 A;  2ENB A;  5LHY 1;  3I4N H;  4BY7 H;  5F2D A;  4PZ6 A;  1TKW B;  5IWA L;  1GUG A;  2QDB A;  1M1K C;  4YCW A;  1IBM Q;  1N33 Q;  4JI7 Q;  3RZO B;  5C3W A;  4IUQ A;  5KEE A;  5FO8 B;  3VR5 A;  1TWH B;  4A3J B;  2ZJP A;  2NZO A;  3IKJ A;  1GD7 A;  5J1Z A;  4FXK C;  4WJW A;  3KLS X;  1C8C A;  1BCP B;  4P73 A;  1S4Z A;  5KNC A;  1ML0 D;  4DV3 L;  1STN A;  1GO3 E;  1SYF A;  3FMC A;  5IGG A;  2NVX H;  4B3R Q;  1CM9 A;  4Y52 H;  1SNP A;  3M4Y A;  1TS2 A;  4P72 A;  4GKK L;  2HQL A;  4WJ4 A;  1IL8 A;  1NBW A;  3A0J A;  4DUZ Q;  2I46 A;  5LMN L;  4B3T Q;  3BZD B;  4DV7 L;  2VS1 A;  3NQI A;  3CCQ A;  4WOR A;  2O5J C;  1NCV A;  1HZB A;  2BDO A;  2EYL A;  4C3H H;  1QE6 A;  3R2T A;  2AMC B;  1HPC A;  2AKW B;  3QR8 A;  1HRJ A;  4GZY C;  3OIQ A;  1RKN A;  1CKO A;  3FKI H;  2PW5 A;  3V2T A;  4G57 A;  3L9A X;  4R8I A;  1TS3 A;  3CQZ B;  1QJO A;  1XPO A;  1PYS B;  2SOB A;  4ZAI A;  4IUN A;  3UE1 A;  2CFM A;  5JVH 3;  1FNV A;  4C3J B;  3S1N H;  3ICE A;  4FVM A;  3S16 B;  2DY8 A;  4IFD I;  2UXB Q;  2F3V A;  3NEL A;  1FNW A;  4DV6 Q;  5CGK A;  3T13 A;  4WJ3 M;  1NUC A;  1M90 C;  3G6E A;  3GTQ B;  2JA7 B;  1YVC A;  1OXT A;  1UE6 A;  1G29 1;  1ICF B;  5EBC A;  4NXN L;  4LUV A;  4O42 A;  1IBK L;  2YYZ A;  4RWS C;  2B2U C;  4NKL A;  4KKT A;  3CPF A;  4JBM A;  5M5X H;  1BO0 A;  5C44 B;  3HOV H;  4KJN A;  3U4V A;  2K5D A;  2N88 A;  1HR0 W;  1KQS A;  4LK1 C;  5HGQ A;  4LF9 L;  2QF7 A;  1HZC A;  1K9M C;  1EYD A;  1SR3 A;  2N8N A;  5GAD C;  2ZT9 C;  4HJA A;  3VR4 A;  4HTH A;  1A63 A;  2JA8 B;  1IBM L;  3K8A A;  1N33 L;  4JI7 L;  3VYT A;  3MXU A;  2JSO A;  1A15 A;  3S2D H;  5CV8 A;  4PNY A;  1ZYR D;  5KYI A;  1RF2 D;  4XQN A;  5M5W B;  4PMB A;  2C9O A;  2WAC A;  1EFI D;  4APV A;  2PI2 E;  3SR1 A;  1SYB A;  1D2B A;  4G4K A;  2X69 A;  3HZX A;  4B3R L;  3BVZ A;  1DGS A;  4BY7 G;  2N55 A;  2NN6 I;  5C3E B;  4OEM B;  4IUR A;  4K8I A;  3NEN A;  4DUZ L;  2AWN A;  4WFN 3;  1V1O A;  1SNQ A;  5E3F A;  4B3T L;  3C46 A;  2KQ3 A;  3Q8D A;  2K5N A;  3K5O A;  2NTT A;  2NYZ D;  2B2W A;  1ILP A;  1Q1B A;  3KLS A;  2UUC Q;  1H9K A;  2D62 A;  1FR3 A;  4WRD A;  1Y8N B;  4A3F H;  3Q24 A;  2JN4 A;  3P1H A;  4HCE A;  4HJ9 A;  1QOH A;  3DXJ C;  5LMU Q;  1N34 L;  1JMC A;  1B9N A;  1I4P A;  4A3K H;  2UXB L;  2XTI A;  2Z8L A;  4C3H G;  1HUN A;  4YCU A;  4DV6 L;  2Z6K A;  5DLQ E;  2NWG A;  4HAE A;  1XPU A;  1KLG D;  1BCP D;  1U4L A;  3BYT B;  3FKI G;  4OO1 H;  1PRT B;  1D8L A;  1STB A;  5ELC A;  1T9H A;  1E22 A;  4XYO A;  2JA5 H;  3GTO H;  1TVX A;  5ISR A;  1VQL A;  4CDD C;  5BN3 A;  1A3T A;  3UDG A;  4O2D A;  4OWT B;  1LTS D;  4B9W A;  3GTM H;  4BBR B;  1ZYR C;  1RCV D;  3DLL A;  1JOK A;  4PQX A;  3GTK B;  1HQR D;  4FF3 A;  4HN7 A;  3IRB A;  3KBG A;  4XDX A;  1W3S A;  2IT1 A;  3L7Z C;  1R9T B;  1BDO A;  1CQV A;  3KF8 A;  4DR5 Q;  3KYH C;  3I90 A;  3PIP A;  3S15 H;  3G4S A;  1X54 A;  1YNN D;  2VZA A;  4KD4 A;  1GUT A;  4LF7 Q;  3S2H B;  1RL2 A;  1J6Q A;  3Q0A A;  3DUZ A;  3KDF B;  2X6G A;  4OEL B;  1L0W A;  3HOV G;  5AFW A;  2YTV A;  4H13 C;  2EOT A;  2H1E A;  1K8M A;  1Q12 A;  2F0S A;  2Y0S G;  3M3Y B;  5C0X I;  1FJG Q;  1RD9 D;  1ZXT A;  2EYP A;  2CW0 D;  1ESR A;  3CC4 A;  1G6Z A;  1CUK A;  2VUM B;  4ULL A;  1EU3 A;  3CC2 A;  2A1A A;  3M9B A;  1VQM A;  1OXU A;  2PMZ B;  1TWC H;  4LW1 A;  2IX3 A;  2K5W A;  1EZ8 A;  4DR7 Q;  1BNZ A;  5A35 A;  4LF5 Q;  4IPC A;  1E0B A;  2A68 C;  4RFB A;  5IYB H;  3PIO 3;  1A2T A;  5IOD A;  3J80 L;  3VA5 A;  4BBS B;  3A8K E;  2F0D A;  4ZK9 B;  3H09 A;  2VB3 X;  1EWI A;  1BCP C;  2UUC L;  4JI0 Q;  2NVT H;  2F52 A;  1JB3 A;  1SFO B;  1DOL A;  1QNU A;  3A74 A;  2KJX A;  4HIM A;  2AQ1 B;  3R93 A;  1AW7 A;  5HUR A;  1STA A;  2K5V A;  5LMU L;  4I7Z C;  5FO9 B;  1NMF A;  1DOK A;  2KOL A;  2QIL A;  4PMC A;  3V96 A;  4GN4 B;  4OWX B;  1E2W A;  1K3R A;  3J7A F;  1F2L A;  3CRL C;  3NTK A;  3I91 A;  1EY6 A;  1BF4 A;  1CFM A;  3OW7 A;  5J22 A;  4A3F G;  3PUX A;  1JOQ A;  2PI2 A;  1MI2 A;  5A2Q L;  1EOT A;  2K7V A;  5DEH A;  2EVB A;  3PO3 H;  1BR9 A;  2EQS A;  4EQP A;  1VQO A;  4A3K G;  2R7F A;  1PH2 A;  5KRU A;  3BZC A;  4A93 H;  3E9H A;  1B7Y B;  1N8R C;  2OQK A;  2EJM A;  1A3V A;  4KLK A;  1II3 A;  2R7Z H;  1PH7 A;  1HUM A;  4OO1 G;  1G8Z D;  4YCV A;  4IZ8 A;  4DR5 L;  3MFY A;  5C4X H;  1B2T A;  4DXG A;  1PH3 A;  2DNC A;  4CJ0 B;  4LF7 L;  1G51 A;  4ZKC B;  3K81 C;  1HZ9 A;  2XIW A;  1I4R A;  3FDT A;  1PXU A;  4A3D B;  3E6Z X;  1ENC A;  1LT3 D;  1X3F A;  1S5C D;  4HMJ A;  4KHV A;  1HH2 P;  2YTY A;  2Z4I A;  5KNB A;  1FJG L;  3I3C A;  4C3I H;  2E5L Q;  3K7A H;  4N8F A;  1SLJ A;  2JE6 I;  4QB4 A;  4EQN A;  1PRT D;  5IIF A;  2BA0 A;  4DR7 L;  1Y8O B;  5JJK A;  4LF5 L;  3TS0 A;  1QZG A;  4JBJ A;  1PMR A;  5IP7 G;  1M8A A;  2F0L A;  4MN3 A;  2HDM A;  1V1P A;  4Q0F A;  3C1F A;  1SMY D;  3IFD A;  1DM0 B;  1K73 C;  4A3C H;  4JI0 L;  3FPU B;  4UY8 C;  2DGY A;  1ILQ A;  2CCZ A;  3PUV A;  1H9S B;  3OSO A;  1KDC A;  2K50 A;  3S1R H;  2HUG A;  2KEE A;  1D5M C;  1Q1E A;  3RUZ A;  1WTO A;  1QVG A;  3HOU H;  4TQU S;  4KN7 C;  4YY3 Q;  5IYB G;  2OTL A;  3G71 A;  1EEI D;  2RKS A;  1SN8 A;  1QCB D;  5IT9 c;  3F2C A;  4F87 A;  1PH8 A;  3TQY A;  1YJN A;  1KTK A;  3RLO A;  3MXP A;  1AH9 A;  4IFD H;  2BDN A;  2VB2 X;  3I4O A;  1LUZ A;  3LNN A;  4OX9 Q;  1NTG A;  2EJF C;  3GV3 A;  3EVQ A;  4Y7N B;  3PO2 H;  2K4K A;  5CMD A;  5FK9 C;  2IW3 A;  4DR2 Q;  2QGQ A;  3PUZ A;  1JWU D;  2KA7 A;  4GLA C;  5I9O A;  2XN9 C;  1HA5 A;  1YEZ A;  1X65 A;  4N9P A;  1GXD C;  1I4G A;  4RCO A;  3RZD H;  3EN2 A;  3HFZ B;  3M4Q A;  2B2T A;  3TME A;  2UUA Q;  3KJP A;  4A3B H;  5GRO A;  1LTA D;  2OXP A;  1DOM A;  4ZUI A;  5M3M B;  4DV2 Q;  5GAH C;  1I6V C;  2WAQ G;  4CDC C;  1LTG D;  3A7L A;  1PRT C;  2VXW A;  5C6A A;  4JCV E;  2B63 H;  3SDZ A;  3PO3 G;  1I4X A;  2E2I B;  1YJW A;  5C4J H;  4A93 G;  5I4D A;  3K57 A;  5FO7 B;  3CW2 C;  2R7Z G;  1OTC A;  2E5L L;  4ZLT F;  1SNM A;  1Q46 A;  2TSS A;  2K6A A;  1VS0 A;  5IYC H;  4RA8 A;  5C4Z A;  4JK1 C;  5I2X A;  1VMP A;  5C4X G;  5IOC A;  2PQA A;  3DHQ A;  3P20 A;  2NN6 H;  2C35 B;  3K0Y A;  2F0H A;  4RGN A;  3S17 B;  3ERQ A;  1BUV T;  4DAY A;  1UUP A;  1SYD A;  2K52 A;  1VQC A;  3MTS A;  3ITP A;  3OIP A;  1Q8I A;  3OWE B;  4C3I G;  4DN4 M;  3GTJ H;  4PZ8 A;  1WCM B;  2D0O A;  1O7L A;  4RH6 A;  4IQZ A;  2KHI A;  3PF4 A;  4XYQ A;  1DCZ A;  3OHX C;  1IYJ B;  1PFS A;  1Q82 C;  2B8G A;  1SE2 A;  1VF7 A;  3DWA A;  1T5X D;  2VNU D;  4YY3 L;  4YWM A;  3J81 L;  2A6H D;  1SMX A;  2QEX A;  3VR3 A;  2P5Z X;  2HCI A;  3CD6 A;  3OMC A;  1IZ6 A;  3MFG A;  5DAU A;  3H0G H;  4OIK A;  2E2J B;  3GQB A;  4DR3 Q;  1Y1W H;  1D5Z C;  5IY0 A;  3AFP A;  3EBE A;  3C3L A;  1CZG A;  4A3C G;  1JC7 A;  1HXY D;  3H3V I;  4OX9 L;  1PZK D;  2K14 A;  2RCN A;  4X64 Q;  1PFN A;  3ND8 A;  3WOE A;  4DU9 A;  2IJ0 A;  1GUO A;  3HOU G;  4F88 A;  4DR2 L;  3Q22 A;  4BWG B;  2EYO A;  2LS0 1;  4IUT A;  3PMF A;  3TDQ A;  1BCP F;  1LM0 A;  1GJX A;  2MFI A;  4A3M H;  4JYA Q;  2UUA L;  4IFD G;  1XYI A;  4QMG A;  4DV2 L;  2DUD A;  1NSN S;  4TSS A;  3E3X A;  2N3S A;  3S1Q H;  3X3N A;  2OTJ A;  4ZUJ A;  1HFG A;  3I4M B;  4ZYS A;  1YNJ C;  4DAV A;  1SSO A;  2F0O A;  1S72 A;  3CME A;  3E9I A;  3JAM c;  4GKJ Q;  1WFQ A;  1NR2 A;  2K5Q A;  2JA6 H;  4DR6 Q;  2R92 H;  1R4Q B;  2K5H A;  4A3B G;  1K8A C;  1C7Y A;  2B2Y A;  5D3D A;  3CCV A;  1JWM D;  3J80 i;  3W1G A;  1JOO A;  1SE4 A;  1B1Z A;  2ZTC A;  3BVM A;  1STY A;  2RSN A;  2B63 G;  2VW9 A;  4XIG S;  5CBA E;  1DXM A;  2K04 A;  3HOX H;  3N52 A;  5AJ3 Q;  1E7Z A;  1YIT A;  5BN5 A;  2M2L A;  4BS9 A;  3L3O C;  1HR0 Q;  2O5I C;  2B2T C;  2TMP A;  4FYD A;  2Q8R E;  5IYC G;  4CBV A;  1C9O A;  1NR4 A;  3CCL A;  2V4D A;  1PH6 A;  2LMC B;  1JOR A;  1K28 A;  2QW7 A;  4LMQ D;  3G48 A;  2NN6 G;  4OXP A;  4KJO A;  2GVB A;  3STB C;  3NHH A;  3NBH A;  3GTL H;  4DR3 L;  4A3E B;  1JB7 A;  3JAM E;  3HOW H;  1SEB D;  3FRP B;  4X64 L;  4DAP A;  2A8V A;  1Q86 C;  3SE0 A;  2SNS A;  4HJ5 A;  4AQY Q;  3DMU A;  2L4N A;  3UE0 A;  1AFP A;  1Z47 A;  5I9P A;  4B9X A;  2E75 C;  5FJ8 H;  1VQ9 A;  3NXW A;  5KGU A;  5EBD A;  1I6H B;  3MZ5 A;  5K36 H;  3LWU A;  1Y1W G;  4JBW A;  4JYA L;  1SRU A;  2BH8 A;  1E3P A;  1EYA A;  2HIX A;  3RZO H;  3AU7 A;  1VCI A;  1JT8 A;  1GVP A;  1CA5 A;  1S5E D;  4A3J H;  2K32 A;  1E1T A;  2EY1 A;  3SXH A;  1KAW A;  4POG A;  3RR5 A;  3J80 E;  1VF5 C;  2A73 B;  3I2Z A;  1NNX A;  1QVC A;  2YV5 A;  3A55 A;  5JPN C;  2RVL A;  4GKJ L;  3OOC A;  5FKA C;  4DR6 L;  1LTI D;  1ZEQ X;  4A3M G;  1WD0 A;  4V0B A;  1XWE A;  4JBK A;  5FLX c;  4A3L H;  1GUS A;  4JPB W;  1LYL A;  5HGT A;  3GTP B;  1XMQ Q;  4OHJ A;  1QNK A;  5AJ3 L;  5IGE A;  3NTI A;  3ULJ A;  5I6W A;  4IOC A;  2BE5 C;  2WII B;  3CQZ H;  5CC4 A;  5JEA G;  2I5M X;  3PQI A;  1EIG A;  1HR0 L;  2JA6 G;  1GUW A;  2R92 G;  4BY7 B;  3I8Z A;  1TII D;  1PRT F;  2AUJ D;  5A2Q E;  3SK4 A;  1XX8 A;  3CU7 A;  3S24 A;  1G91 A;  1STH A;  4RG1 A;  3RD4 A;  4C1N I;  1RIP A;  2PO4 A;  3GTQ H;  3HOX G;  2FIN B;  2BOS A;  5ELF A;  3TP5 A;  4V19 0;  3CCR A;  2JA7 H;  4HSV A;  2J0T D;  4X3S A;  3CRK C;  3NTH A;  5ELN A;  1S5D D;  1N34 Q;  4P75 A;  4NXM Q;  2NVX B;  1UWV A;  1EQR A;  2Z9H A;  3URY A;  1B8A A;  2F0W A;  2KCC A;  3G6J B;  3W1B A;  5LL6 X;  1IL2 A;  2LXK A;  4IPG A;  2RHS B;  5FLX E;  2YU9 H;  5C44 H;  1JE5 A;  4AQY L;  1EY4 A;  2L12 A;  1V8Q A;  4IOA A;  4C3H B;  4IUV A;  4A3G B;  1EZ6 A;  1PTO H;  3HKS A;  2RF4 A;  2EJG C;  3FKI B;  4S3S A;  3LGJ A;  3OTO Q;  3L2P A;  2JA8 H;  3GTG H;  1UE1 A;  3HOW G;  3CAM A;  3GDE A;  3M85 A;  5M5W H;  4QY7 A;  4HCS A;  1HNW Q;  2ZXP A;  3D4D A;  4GOP A;  4FF4 A;  4KTA A;  1U9R A;  1EY0 A;  3NSW A;  4IO9 A;  1F9R A;  4KHZ A;  5FJ8 G;  1FNU A;  1V9P A;  5C3E H;  5K36 G;  2B39 A;  1X55 A;  1AE3 A;  3HGB A;  1EU4 A;  1PYW D;  3ULP A;  1EY8 A;  1HNX Q;  1HA6 A;  1JE4 A;  2HDL A;  4Z9C B;  2PZW A;  4N9T A;  2AHO B;  1XMQ L;  5M3F H;  3I4N G;  3KF8 B;  1TWA H;  3K6O A;  5JAV A;  5M5X B;  3J7A 5;  3HOV B;  1BVS A;  4UP7 A;  3CPW A;  2IHF A;  3FPP A;  5JPM C;  3O13 A;  2Y0S B;  3F8T A;  1V43 A;  3KBX A;  2RA4 A;  1NY4 A;  3HP3 A;  4UPA A;  3OYY A;  4A3L G;  4RCN A;  2MUY A;  3NK9 A;  5E1F A;  3U50 C;  1B70 B;  1HQM C;  1L2F A;  4DNI A;  3GO5 A;  4LWC A;  1HJP A;  1ESF A;  4A3I B;  4B3S Q;  1ET6 A;  2UXD Q;  4X3K A;  5FLM H;  4R4T A;  1YIJ A;  2C5C A;  2A68 D;  4NXM L;  4O0A A;  4BA1 I;  3F2B A;  4K6L A;  2BH2 A;  5T1G A;  1O78 A;  3G7L A;  1PDQ A;  4DV0 Q;  1SJE D;  1X6O A;  4BBR H;  2WB1 E;  5JJZ A;  1JJC B;  3K5M A;  1PZJ D;  1KL9 A;  2YTX A;  1I4H A;  3H3V H;  3FP9 A;  5EKK A;  2OF1 A;  3R3O A;  4QIW B;  1QZH A;  4PMW A;  2WFW A;  3OTO L;  2PZT A;  2NVY B;  1TWG B;  3K59 A;  4A3F B;  3S2H H;  4K5X A;  4CDF C;  4EQ5 A;  1K3B C;  3PSI A;  3LWE A;  1HNW L;  1BKB A;  1QWY A;  1CKN A;  1I3Q H;  3M3Y H;  4DV4 Q;  1E24 A;  2F3I A;  1WTP A;  2F1M A;  4JI4 Q;  1MD2 D;  3QB3 A;  3P7J A;  3GD7 A;  2G9D A;  4X3U A;  2JA8 G;  1H9R A;  3MXG A;  1KRS A;  1HNX L;  1ZKO A;  2F0P A;  1J9O A;  3S1M H;  3J7Y W;  1YJ9 A;  3GTO B;  1C48 A;  1QIL A;  4MTN A;  4CJ2 C;  2IX1 A;  1U0L A;  1KHI A;  1MKH A;  1U4R A;  1SBB B;  1I4Q A;  3R8B A;  2E76 C;  5JJL A;  5IYD H;  3UDX A;  4H0L C;  4CKB A;  3HOZ B;  2PCF B;  1Y8P B;  3KLW A;  1SFO H;  5C3E G;  1K0S A;  3CHB D;  1AP0 A;  1HTP A;  3WOF A;  1N36 Q;  2OQ0 A;  3ERS X;  3A8I E;  2L0C A;  2QKI C;  5M3F G;  5ELB A;  4B3S L;  2E8G A;  2UXD L;  3HEJ A;  4LUO A;  1SXT A;  4FXG C;  3QIA A;  2BCO A;  1GHK A;  1VMC A;  5CV5 A;  4OWW B;  4DUY Q;  1D6E C;  1V1P B;  4DV0 L;  5CV4 A;  2EPB A;  2KVM A;  3CF5 A;  1RJT A;  4ODG A;  5H1S E;  4KY6 A;  4UAI A;  3RMH A;  3V05 A;  4HIO A;  4KI0 A;  2A19 A;  4GLV B;  3U9S A;  5FLM G;  2HQE A;  1F9S A;  1BBW A;  3QOL A;  2CVR A;  1X32 A;  3NUC A;  1WTV A;  4YHH Q;  5M5Y H;  1EL0 A;  2QA4 A;  2EIF A;  3NQT A;  2NVT B;  1GHJ A;  3DEP A;  2LFN A;  1VQB A;  2B2W C;  3PCO B;  4A3D H;  3L0O A;  4JI2 Q;  3N6R A;  4DV4 L;  4FDB A;  2JA5 G;  4DKA C;  2ICI A;  4JI4 L;  1VQE A;  4KHP Q;  2FMC A;  4U68 A;  3J7Z C;  4HID A;  1VQ7 A;  5J39 A;  2K28 A;  4BA2 I;  5D14 A;  1Z9F A;  2WAQ B;  2Z6K C;  1XNQ Q;  2F3W A;  1DJR D;  5JEA J;  2FMM A;  3PO3 B;  4EQO A;  3I4L A;  4GNX A;  1MBY A;  5HY6 A;  4RKL A;  4A93 B;  3D4W A;  4ZKB B;  4KY5 A;  2A5H A;  3T1H Q;  3TP6 A;  2WB1 G;  3NEM A;  2R7Z B;  4H7B A;  4RHS A;  3CXC A;  3M4O H;  3A7A B;  2K05 A;  4LJZ C;  3UI2 A;  1ENA A;  1WI5 A;  2IPK D;  4RMF A;  1YNX A;  2A69 D;  3U9O A;  4C2M H;  1N36 L;  5C4X B;  1EWC A;  4P2C B;  5IGD A;  3T1Y Q;  1VQ5 A;  2R7D A;  4B08 A;  3D3R A;  1H95 A;  2PQA B;  2F4I A;  1SYE A;  1YHA A;  2JJQ A;  3CCJ A;  1BQQ T;  4RGT A;  2L15 A;  2VY3 A;  5IYD G;  4JI3 Q;  2WKD A;  1WVL A;  3HKZ E;  1KD1 C;  3D8G A;  4DUY L;  2EYJ A;  1Q8K A;  4PG3 A;  3K7A B;  2IL8 A;  4Y7N H;  1ONL A;  5ELO A;  2FXQ A;  4DAY B;  5COY A;  3CCM A;  5BN4 A;  4JOI A;  1TWF H;  1D1I A;  4P74 A;  3EJI A;  4RAU C;  2WKC A;  4A76 A;  3BDL A;  4DXF A;  3K0X A;  3OWF A;  2GA4 B;  5EKI A;  4ME3 A;  5LL6 S;  2OWO A;  4NW2 A;  3K80 C;  4GN5 A;  3TP8 A;  2ASB A;  1CZW A;  3J81 j;  4YWK A;  1UE7 A;  3MA2 B;  3SVM A;  1KAA A;  1SE3 A;  1O7Y A;  4AIM A;  5M3M H;  1SND A;  5GQO A;  4YHH L;  1AN8 A;  2GVA A;  2WIN B;  1DD2 A;  4HJ7 A;  1NMG A;  3S14 B;  1FGB D;  3I56 A;  4L5S A;  1ICW A;  1CHQ D;  4R4I A;  1PZI D;  2Z0S A;  4IPD A;  3TZU A;  4JI2 L;  5D3I B;  1B50 A;  3HOY B;  2ID0 A;  4X3T A;  2A74 C;  1X3E A;  4OIJ A;  1QUQ A;  2RSO A;  4KHP L;  3QG1 A;  4EX5 A;  4LAA A;  2EY5 A;  1ROD A;  1R4P B;  2DNE A;  4LF6 Q;  2RDF A;  1XNQ L;  2A69 C;  3JC6 6;  1BOS A;  1VQ8 A;  1LAC A;  1HNZ Q;  4GS3 A;  4A3D G;  2JYO A;  3SEB A;  4DV5 Q;  4U67 3;  2I5L X;  1MIU A;  2PW7 A;  5KYL A;  1Z7T A;  4JC0 A;  4KD3 A;  1PV4 A;  4NDX A;  3T1H L;  1YNJ D;  1CT1 D;  4KV6 A;  1XTC D;  4A3B B;  1SAP A;  2PNR C;  3E0E A;  5IP9 H;  3OW2 A;  1LTB D;  3T1Y L;  4L5T A;  4FF1 A;  1VQD A;  2B63 B;  2F4V Q;  2D9U A;  3CC7 A;  1B3Q A;  5C4J B;  5D65 A;  2IHE A;  3SGI A;  1WYD A;  2L5T A;  3T56 B;  2DN8 A;  5TSS A;  4JI3 L;  2WP8 J;  3ZYY X;  4CKC A;  5DM6 3;  4K5W A;  4K6D A;  4JI6 Q;  4AYB B;  3K5L A;  2D5D A;  3VR2 A;  4PV1 C;  2F0Q A;  1OXV A;  4CHT B;  4JVZ A;  3KJO A;  3TZD A;  4QCL A;  4IJH A;  1VQP A;  1VQ4 A;  3CKI B;  1RHP A;  1EY5 A;  2ZM6 Q;  1NJI C;  2L9H A;  1KDB A;  4R4O A;  4BXX H;  1K0R A;  3GTJ B;  3F2U A;  3NBH B;  3STB D;  3MXN A;  4TKO B;  3H91 A;  1SNO A;  3W3A A;  5IGC A;  4R1J A;  2ATW A;  2JQO A;  1E1O A;  5IGB A;  2LKV A;  4H44 C;  4L63 B;  1OO9 B;  2EXZ A;  3PO2 G;  3UDF A;  4HMI A;  2DY7 A;  1IKL A;  5M3M G;  1Y1W B;  3W5O A;  2RBM A;  3X3M A;  5JVG 3;  5BR8 Q;  4LF6 L;  2EY2 A;  4GLX A;  1N32 Q;  1CTM A;  1HNZ L;  2ES2 A;  4MIU A;  2JXM B;  5C5M A;  4DV5 L;  2CWA A;  3TEH B;  1BBU A;  1S5B D;  3OPO A;  5DNF A;  3HKZ G;  5C0X H;  2UXC Q;  1ASY A;  5C5L A;  2F0J A;  1O7I A;  3MEH A;  1YI2 A;  2XWJ B;  3RLF A;  2F0T A;  4M1U B;  1YHQ A;  3F1Z A;  5E4W C;  1K8O A;  1VQI A;  1KNA A;  2QEJ C;  3CCS A;  1EYC A;  3QOJ A;  5K5P A;  4RGM A;  2HCC A;  1Y1V H;  4FNF A;  3S1Q B;  2JEA I;  4PZ7 A;  2F4V L;  5DM7 3;  3NWT A;  4YWL A;  1PH9 A;  5JJI A;  3B6Y A;  3TN2 A;  3J80 c;  4A3E H;  3I73 A;  4B3M Q;  2KHJ A;  3Q6S A;  4R9W A;  3I70 A;  4JI6 L;  1K83 B;  1GM5 A;  2BE5 D;  2Q8I B;  5IP9 G;  4G7Z C;  1L1O A;  2OEO A;  4I7A A;  1X3P A;  3T51 B;  1HFN A;  3A54 A;  1G2S A;  1FVI A;  5EJW A;  1KLU D;  2R93 H;  3HOX B;  1JJG A;  1F2Z A;  1I6H H;  1Y69 U;  1STE A;  2G5D A;  2ZM6 L;  4A4I A;  1LTR D;  2MGS A;  2UUB Q;  2ZXR A;  2L1B A;  2UU9 Q;  4BY1 H;  2FFK B;  3T16 A;  2H5X A;  1PFB A;  2B29 A;  3U4Z A;  1GOZ A;  1TS5 A;  1T5E A;  3H0G G;  1EIY B;  2L11 A;  3HRZ C;  3WWV A;  1A3U A;  1WD1 A;  2IY5 B;  3UDI A;  5I6Y A;  2XRQ D;  1TWH H;  2JEB I;  5EAY A;  4HIK A;  3CCE A;  4YIJ A;  1B4O A;  4KKU A;  3GTP H;  4BXX G;  1G2T A;  2NVQ B;  3J7A V;  1SNC A;  5BR8 L;  3K5N A;  1VDZ A;  1N32 L;  2KCT A;  3ER0 A;  1I50 B;  3VDY A;  1VQK A;  3KF6 A;  5CV7 A;  3SK6 A;  1OXS C;  2UXC L;  3NP8 A;  1P8L A;  4QUC A;  2AUK A;  3ONA B;  1LT4 D;  1XNR Q;  4K0K Q;  3GP7 A;  4ZQ3 A;  4GOP B;  3AQQ A;  1F2Y A;  1PFM A;  3RLN A;  3CCU A;  2RQX A;  2A6E C;  2E2H B;  1A6X A;  1W2B A;  3D6C A;  3Q23 A;  3M7N A;  1PH1 A;  1SRO A;  1SJH D;  3I4N B;  5ELE A;  1WTR A;  4NP5 A;  1VQJ A;  1CQF A;  1DYQ A;  2Q2T A;  5EQ0 A;  2KEN A;  2KEC A;  5C0X G;  2EYM A;  4C3J H;  4B3M L;  3BZK A;  3S16 H;  1FGU A;  3DM1 A;  2Z4H A;  5EPJ A;  1Z6H A;  1BXT A;  4N8X 1;  2MNA A;  4G7H C;  3TS2 A;  4ABN A;  3AMU A;  1EY7 A;  3W2D A;  1YZ6 A;  3AEV A;  1Y1V G;  4L5R C;  1VQF A;  1CSQ A;  2K33 A;  4OON A;  3TRZ A;  4GN3 B;  4A3G H;  4K14 A;  2EY6 A;  2F0F A;  2B2Y C;  4HJ8 A;  1DZ1 A;  1EQV A;  4A3E G;  4DFA A;  3RN5 A;  4LUZ A;  2Y0S E;  1HCZ A;  2UUB L;  2UU9 L;  4KK7 A;  5IT9 L;  1X56 A;  2CH4 A;  4UDU C;  4R4C A;  2PNH A;  1TS4 A;  1MSH A;  1J8I A;  2AQ3 B;  2JA9 A;  3BU2 A;  2R93 G;  1N9W A;  4ILW A;  2R61 A;  4J15 A;  1GUN A;  1AEX A;  4AH6 A;  1TT2 A;  1U5K A;  4BY1 G;  2CWP A;  1F9Q A;  2Z1C A;  1CA6 A;  3S1N B;  4LF8 Q;  1E2Z A;  2HHH Q;  1XXG A;  2ZJQ A;  2PYK A;  4O1N A;  4F7X A;  1J5E Q;  2YU9 B;  5J3B A;  1L1O C;  5LMN W;  2Q2U A;  1KDA A;  1CHP D;  4A3J G;  4QIW E;  3PGZ A;  1XNR L;  1CKN B;  4K0K L;  1PTO B;  2OT2 A;  4K2L A;  3TP7 A;  4DNT B;  3OMG A;  4K5V A;  2H4O A;  3GTG B;  1MJC A;  4LNQ A;  1ET9 A;  4A3I H;  3FEW X;  2F0I A;  3BG3 A;  1Q7Y C;  2KHS A;  3A8J E;  1C0A A;  3J81 i;  2I0Q A;  2LSS A;  4K2K A;  1JJ2 A;  4POF A;  1JIC A;  2NB0 A;  5NUC A;  1S40 A;  2Q2I A;  2MHV A;  4FO2 A;  3F2D A;  3S2D B;  4UHV A;  1XTD A;  4KKS A;  1IHZ A;  1V1Q A;  1EUJ A;  1PHJ A;  1AZP A;  3RNU A;  2SDF A;  4G7O C;  4DR1 Q;  4CGY B;  1PA6 A;  4IUP A;  3T53 B;  5M3F B;  1EY9 A;  5JOB A;  1TWA B;  3J81 c;  1O80 A;  3BYY B;  5CV9 A;  5COR A;  4C3J G;  1S3O A;  2PMZ E;  2E2D C;  2NVY H;  3GTK H;  1TWG H;  1RTN A;  4TRD A;  2XSC A;  1IKM A;  4IFD J;  1KAB A;  2PPB C;  1EWH A;  2JA7 G;  2J7Z A;  4J8Q A;  1I94 Q;  1R9T H;  4DGZ A;  4KN4 C;  4NMZ A;  5CR3 A;  4DNR B;  4A3G G;  2CQO A;  4IPH A;  2LY7 A;  4MZ9 A;  2JP1 A;  1CSP A;  3CP0 A;  4ID6 A;  3SHL A;  3DWQ A;  1PH4 A;  1L0X B;  5C44 G;  1UNS A;  2XVS A;  1GKH A;  3EFX D;  4A3K B;  4LF8 L;  2HHH L;  1SYC A;  5I2Y A;  1J5E L;  4HR7 B;  5M9O A;  2AQ2 B;  2Q8T A;  2R6G A;  1IXR A;  4J1M A;  4XT3 B;  2VUM H;  1VQG A;  1TY2 A;  1NAP A;  1JQY D;  3QJY A;  1Q3L A;  5C3X A;  1QB5 D;  3D6W A;  5CBE E;  2JA5 B;  3HOZ H;  3J81 E;  1HTL D;  4MHE A;  2F0U A;  3GTM B;  1K8G A;  5IE8 A;  3DWP A;  4BBS H;  1M4V A;  3A5Z B;  3VYU A;  4C1N K;  3JAM L;  3BDC A;  4FXD A;  4CKE A;  4JI5 Q;  4LFA Q;  5IP7 H;  4DAM A;  5EGT A;  1I3Q B;  2V1C C;  4ZCK A;  4LFB Q;  3M7G A;  1F2M A;  4JI8 Q;  1LAB A;  2CH4 W;  1FL0 A;  4EGV A;  3S15 B;  3MAQ A;  4GNX B;  5CV6 A;  4JG2 A;  2SEB D;  1H9J A;  2WB1 B;  5G3L F;  3TBI B;  1IYV A;  1MSG A;  4GOP C;  2KED A;  4MNO A;  1CK1 A;  3VYS A;  4A3I G;  3S1M B;  1B44 D;  1WTH A;  4DR1 L;  2DJG C;  2M9V A;  2WAQ E;  4ALP A;  1KC8 C;  4UP8 A;  2MPM A;  2KCM A;  1LO5 D;  2RDG A;  4CJ1 B;  2XRS D;  4JW0 A;  2JK8 A;  1TWC B;  1DON A;  2XNA C;  1O7Z A;  1EIH A;  4X62 Q;  4JV5 Q;  1YBY A;  1JCK B;  1PTO D;  1IBL Q;  2K01 A;  1PH5 A;  2PZU A;  3HG9 A;  1I94 L;  1Q90 A;  5FOB B;  1TQO A;  1VQH A;  2NBF A;  4NPS A;  3T4A C;  3I7F A;  2F0G A;  5E4X A;  4BBR G;  3SK5 A;  4EVO A;  1L0Y B;  1SYG A;  1JWS D;  3H15 A;  1S5F D;  4Q5V A;  1MGS A;  2MJ8 A;  1YNN C;  2NTS A;  3EA6 A;  4DK0 A;  4ME5 A;  2RCF A;  1LTT D;  1UEA B;  4IJL A;  3KDF A;  4JI1 Q;  1KIX A;  3EQL C;  3KLR A;  1VQ6 A;  1CKM A;  1LLR D;  2F0K A;  1EYG A;  2CW0 C;  1EEF D;  1LTL A;  2WV6 D;  2EE1 A;  2O4X A;  3S9W A;  2KUM A;  5M5Y B;  1QUQ B;  3H94 A;  1KXL A;  4QUF A;  4JI5 L;  5C0X J;  5FLX L;  2MO1 A;  1VQN A;  2VUM G;  4LFA L;  1X9N A;  1C4Q A;  1FYC A;  4LFB L;  4JI8 L;  1D5X C;  2KBN A;  4DV1 Q;  2RHQ B;  3HOZ G;  1KNE A;  4X65 Q;  1WTX A;  4L8J A;  4RHR A;  4LF4 Q;  4BBS G;  1PTO C;  2NZ1 D;  2ZTD A;  3KK7 A;  3TRE A;  3P75 A;  2ICE C;  4DPG A;  3IAY A;  1U4M A;  5GAG C;  2MO0 A;  4C3I B;  3MEF A;  4CDE C;  3A5U A;  1RDP D;  1D7Q A;  2HT1 A;  1F77 A;  2MQH A;  3BJU A;  4X62 L;  4JV5 L;  1Y14 B;  1B3A A;  1QG7 A;  1STG A;  1XPR A;  4QF4 A;  1IBL L;  3M4O B;  3MWY W;  2OCE A;  3S14 H;  1XJV A;  1W6J A;  4MTK A;  1AZQ A;  4C2M B;  3MVV A;  4FF2 A;  4QJF A;  2EZV A;  2K1B A;  1PLF A;  3HOY H;  1B53 A;  2GN5 A;  2I07 B;  3NBI A;  3MHB A;  1SE8 A;  3ZJY C;  4R8N A;  3C2P A;  2E2I H;  3S1R B;  2CHB D;  2CKZ B;  3R2I A;  3HOU B;  3KFU A;  1WTQ A;  1EOV A;  4AYB E;  3PV0 A;  5EPL A;  1TWF B;  1IW7 D;  2B2V A;  4C56 C;  4F8M A;  4X6A H;  5KIX A;  2EDG A;  1VQA A;  3MXN B;  1B9M A;  5EKL A;  4QGU A;  3M4P A;  4JI1 L;  1A0I A;  3IFT A;  2VQF Q;  1TY0 A;  3PO2 B;  3S17 H;  4I65 A;  4DK1 A;  1P16 A;  1YHB A;  2DJF C;  3BS1 A;  1A62 A;  4DK3 C;  2VQE Q;  4OGQ C;  1WJJ A;  2O2L D;  2EYF A;  1X3Q A;  3VR6 A;  2ZJR A;  1WCM H;  2MP1 A;  3RZD B;  2F0N A;  1A8V A;  1EIF A;  2NZH A;  3HKZ B;  4DV1 L;  2F0E A;  5IT9 E;  1Q81 C;  3H3V C;  3BDO A;  1LT5 D;  1SMY C;  2R3Z A;  4J6H A;  4X65 L;  3DEO A;  5EPK A;  4LF4 L;  2I5H A;  2ZTE A;  1SDF A;  4L5Q A;  4TVA B;  1TR5 A;  2E2J H;  4DR4 Q;  3NPP A;  1HHV A;  3U58 A;  2FHT A;  3EIV A;  2LXJ A;  2D2C C;  4FP5 D;  4LFC Q;  2X6L A;  1ASZ A;  1H9S A;  3BVG A;  1WTW A;  2K75 A;  3DM3 A;  3QO2 A;  1AE2 A;  4ZRZ A;  3QWN A;  3C1E A;  1UE5 A;  1QVF A;  2EYH A;  1HZA A;  3H6M A;  4IAL A;  4GNX C;  5T1I A;  2ZXO A;  2XGT A;  2HD3 A;  2Z6B A;  1EFW A;  4RKB A;  2E74 C;  1IW7 C;  2B3G A;  3ERO A;  2EXD A;  2QDL A;  5L37 A;  2D0P A;  4X66 Q;  1L1O B;  4IN3 A;  1MJE A;  2N49 A;  3I4M H;  4QQB X;  3SK8 A;  5E7N A;  2SNM A;  3K7U C;  2CQA A;  4OO1 I;  3NWS A;  2PQE A;  1XMO Q;  2QCP X;  4XXE A;  2M00 A;  2RDH A;  1E2V A;  1EQQ A;  1KRT A;  3H0G B;  1PVO A;  4E6I A;  1WOC A;  3HOY G;  1UEB A;  1FD7 D;  1I5F A;  1CI3 M;  2L55 A;  3JAM i;  4XQQ A;  4JOI C;  2K03 A;  2VQF L;  2J4X A;  2ALY B;  5CYU A;  3VA7 A;  3VYR A;  1ENF A;  1TXY A;  3D4R A;  2F0V A;  2Q2H A;  4IUU A;  2HIV A;  2XWB B;  2VQE L;  3KUP A;  3ULL A;  3MC0 B;  2IWH A;  3CMA A;  2F0M A;  5IWA Q;  4A3M B;  1OXX K;  3PF5 A;  2N78 A;  5G3L D;  1LT6 D;  1TU2 B;  5JEA H;  2G9H D;  3ND9 A;  3KF6 B;  3PIO A;  3AB9 A;  1K83 H;  3HS0 C;  4DA2 A;  4RGO S;  4DR4 L;  4DV3 Q;  1X3G A;  2NUC A;  3I72 A;  3AYH B;  3FVQ A;  3PIP 3;  4LFC L;  2B2V C;  1WCM G;  2BA1 A;  2VL6 A;  4OL7 A;  2A6E D;  2JA6 B;  4GKK Q;  2R92 B;  1D1K A;  2A6H C;  5IGF A;  2B2U A;  3AFQ A;  5LMN Q;  2FJ2 A;  3GV6 A;  3K58 A;  1LV9 A;  4DV7 Q;  3PUY A;  1PYB A;  4XT1 B;  4AYB G;  1BBX C;  3D0F A;  3NE5 B;  4DK6 C;  4K8J A;  3PUW A;  4KY7 A;  3RN2 A;  3LX0 A;  3E5S A;  4H02 A;  1NE3 A;  2B8F A;  3KOJ A;  1Y1V B;  4X66 L;  4M8A A;  3FHW A;  3A56 A;  2IX0 A;  5ELD A;  1IYU A;  4P71 A;  4HSP A;  1W6K A;  2NVQ H;  1UAP A;  1PTO F;  3IL8 A;  4XTC S;  1XMO L;  1I50 H;  1U4P A;  5C4H A;  4KMU C;  3I55 A;  3GTL B;  1A2U A;  5GAE C;  1EQT A;  1H9M A;  4QL5 A;  4NXN Q;  4XQJ A;  1IBK Q;  1MHW C;  5KND A;  3WDN A;  3HOW B;  2R93 B; 
#chains in the Genus database with same CATH homology
 1PHJ A;  4NB3 A;  1VQC A;  3GTJ H;  3RNU A;  4JI2 Q;  3I4M G;  4R4Q A;  4PZ8 A;  4FDB A;  4DV4 L;  2D0O A;  4DKA C;  2JA5 G;  2E2H H;  2KHI A;  3PF4 A;  1G6P A;  4DR1 Q;  1IYJ B;  1PA6 A;  1PFS A;  1Q82 C;  4JI4 L;  1VQE A;  3D31 A;  4KHP Q;  3J81 c;  2AWO A;  4LF9 Q;  3J7Z C;  4A75 A;  2VNU D;  4UP9 A;  4HID A;  1VQ7 A;  4YY3 L;  3I4N H;  4YWM A;  4BY7 H;  1SMX A;  4PZ6 A;  2QEX A;  4BA2 I;  1Z9F A;  1S3O A;  2PMZ E;  2Z6K C;  5IWA L;  1XNQ Q;  2NVY H;  4YCW A;  1M1K C;  1IBM Q;  1N33 Q;  1IZ6 A;  1TWG H;  4JI7 Q;  3CD6 A;  3GTK H;  3H0G H;  5JEA J;  4DR3 Q;  1Y1W H;  4IFD J;  5IY0 A;  3AFP A;  4GNX A;  3EBE A;  5HY6 A;  2JA7 G;  4A3C G;  2ZJP A;  3H3V I;  2NZO A;  1I94 Q;  4OX9 L;  2K14 A;  2RCN A;  1GD7 A;  1R9T H;  4X64 Q;  4P73 A;  4DV3 L;  1GO3 E;  3T1H Q;  2WB1 G;  3NEM A;  2CQO A;  4IPH A;  2NVX H;  4MZ9 A;  3HOU G;  3CXC A;  1CSP A;  3CP0 A;  4DR2 L;  3M4O H;  4B3R Q;  4Y52 H;  1PH4 A;  4RMF A;  1WI5 A;  4P72 A;  5C44 G;  1YNX A;  1N36 L;  4GKK L;  2HQL A;  4C2M H;  4WJ4 A;  3A0J A;  1NBW A;  4DUZ Q;  1LM0 A;  1GKH A;  3T1Y Q;  1VQ5 A;  5LMN L;  2MFI A;  4A3M H;  2R7D A;  4JYA Q;  4B3T Q;  4LF8 L;  2HHH L;  2UUA L;  4IFD G;  1H95 A;  2PQA B;  4DV7 L;  4DV2 L;  2VS1 A;  2JJQ A;  1YHA A;  3CCJ A;  3CCQ A;  1J5E L;  2DUD A;  4C3H H;  1HZB A;  2L15 A;  2AMC B;  1IXR A;  2R6G A;  2AKW B;  2VY3 A;  5IYD G;  4JI3 Q;  2VUM H;  2N3S A;  3HKZ E;  1VQG A;  4DUY L;  1KD1 C;  3S1Q H;  2OTJ A;  1CKO A;  1Q8K A;  3FKI H;  4PG3 A;  4Y7N H;  5ELO A;  2FXQ A;  4DAY B;  3CCM A;  3HOZ H;  4JOI A;  1TWF H;  4P74 A;  1S72 A;  1XPO A;  3CME A;  3E9I A;  1PYS B;  4A76 A;  3K0X A;  1K8G A;  4ME3 A;  5IE8 A;  3JAM c;  1WFQ A;  4GKJ Q;  2OWO A;  4BBS H;  2JA6 H;  4DR6 Q;  3K80 C;  3UE1 A;  2R92 H;  2CFM A;  3A5Z B;  4GN5 A;  2ASB A;  2K5H A;  4A3B G;  1K8A C;  3J81 j;  4YWK A;  3S1N H;  4JI5 Q;  1UE7 A;  1C7Y A;  3ICE A;  4IFD I;  2UXB Q;  3CCV A;  3NEL A;  3J80 i;  4DV6 Q;  4WJ3 M;  3W1G A;  2ZTC A;  4LFA Q;  4AIM A;  5IP7 H;  5M3M H;  3G6E A;  1M90 C;  4DAM A;  5GQO A;  2V1C C;  4YHH L;  2B63 G;  2VW9 A;  1YVC A;  2GVA A;  4XIG S;  1OXT A;  1UE6 A;  4JI8 Q;  4LFB Q;  1FL0 A;  3HOX H;  1G29 1;  4GNX B;  5AJ3 Q;  4NXN L;  1E7Z A;  4LUV A;  1YIT A;  4HJ7 A;  1NMG A;  2YYZ A;  4JG2 A;  3I56 A;  1IBK L;  4DR7 Q;  4L5S A;  1HR0 Q;  4R4I A;  3CPF A;  4JBM A;  2Z0S A;  4IPD A;  4GOP C;  4JI2 L;  4MNO A;  5M5X H;  2ID0 A;  4A3I G;  3HOV H;  5IYC G;  4DR1 L;  2WAQ E;  1C9O A;  3U4V A;  4ALP A;  1X3E A;  1KC8 C;  3CCL A;  4UP8 A;  1QUQ A;  1PH6 A;  1KQS A;  1HR0 W;  4KHP L;  5HGQ A;  4LF9 L;  2KCM A;  4EX5 A;  3G48 A;  1HZC A;  1K9M C;  2NN6 G;  1SR3 A;  2JK8 A;  2N8N A;  5GAD C;  4OXP A;  4HJA A;  4LF6 Q;  1XNQ L;  2GVB A;  3STB C;  1A63 A;  4X62 Q;  1IBM L;  3JC6 6;  3K8A A;  4JI7 L;  1N33 L;  4JV5 Q;  1YBY A;  1HNZ Q;  1VQ8 A;  4GS3 A;  3GTL H;  4A3D G;  4DR3 L;  4DV5 Q;  1IBL Q;  3S2D H;  2I5L X;  1PH5 A;  1MIU A;  1JB7 A;  1I94 L;  3HOW H;  4X64 L;  4JC0 A;  1PV4 A;  1VQH A;  4NPS A;  2A8V A;  1Q86 C;  3T1H L;  4HJ5 A;  4APV A;  2PI2 E;  4AQY Q;  3I7F A;  4B3R L;  1DGS A;  4BBR G;  4BY7 G;  3UE0 A;  1Z47 A;  3E0E A;  2NN6 I;  5IP9 H;  3OW2 A;  3NEN A;  5FJ8 H;  4L5T A;  4DUZ L;  2AWN A;  3T1Y L;  1VQ9 A;  1VQD A;  1Y1W G;  4B3T L;  4JBW A;  2F4V Q;  1SRU A;  4JYA L;  3CC7 A;  2BH8 A;  1E3P A;  2HIX A;  3H15 A;  3RZO H;  1VCI A;  1JT8 A;  1GVP A;  2IHE A;  3SGI A;  1WYD A;  3Q8D A;  4A3J H;  2K5N A;  1E1T A;  4JI3 L;  1KAW A;  4POG A;  2WP8 J;  1Q1B A;  4JI6 Q;  4IJL A;  3KDF A;  3RR5 A;  4JI1 Q;  1KIX A;  1VQ6 A;  3I2Z A;  1CKM A;  1QVC A;  2UUC Q;  2D62 A;  2YV5 A;  1OXV A;  1EYG A;  4A3F H;  3KJO A;  1LTL A;  4GKJ L;  4DR6 L;  4A3M G;  4HJ9 A;  5LMU Q;  5FLX c;  4IJH A;  1VQP A;  1QUQ B;  1VQ4 A;  1N34 L;  4JBK A;  1JMC A;  1KXL A;  4A3L H;  4JI5 L;  1LYL A;  5C0X J;  4A3K H;  2UXB L;  2XTI A;  2MO1 A;  2ZM6 Q;  4YCU A;  4DV6 L;  1NJI C;  2Z6K A;  5DLQ E;  1VQN A;  4LFA L;  2VUM G;  1XPU A;  1XMQ Q;  4R4O A;  1X9N A;  4BXX H;  1K0R A;  3FKI G;  3NBH B;  3STB D;  4LFB L;  4JI8 L;  2KBN A;  4DV1 Q;  2RHQ B;  1D8L A;  3HOZ G;  5AJ3 L;  1T9H A;  1E22 A;  3ULJ A;  4IOC A;  4R1J A;  2JA5 H;  3GTO H;  4X65 Q;  3CQZ H;  5JEA G;  2I5M X;  1VQL A;  2ATW A;  4LF4 Q;  3UDG A;  4O2D A;  2JQO A;  1E1O A;  4OWT B;  1HR0 L;  2JA6 G;  2R92 G;  4BBS G;  3GTM H;  2ZTD A;  3TRE A;  3DLL A;  4DPG A;  3PO2 G;  5GAG C;  3UDF A;  2MO0 A;  3MEF A;  3IRB A;  5M3M G;  3S24 A;  3A5U A;  3W5O A;  1D7Q A;  4RG1 A;  2HT1 A;  1RIP A;  1W3S A;  5BR8 Q;  4LF6 L;  3HOX G;  3GTQ H;  4GLX A;  2IT1 A;  3L7Z C;  1N32 Q;  2MQH A;  3CCR A;  3BJU A;  2JA7 H;  4X62 L;  4DR5 Q;  4JV5 L;  3KYH C;  1Y14 B;  1HNZ L;  5ELN A;  2ES2 A;  3PIP A;  1XPR A;  1N34 Q;  4P75 A;  4NXM Q;  4DV5 L;  1UWV A;  1IBL L;  3G4S A;  2CWA A;  1EQR A;  2OCE A;  3TEH B;  1BBU A;  3S14 H;  1X54 A;  2VZA A;  4LF7 Q;  1B8A A;  1XJV A;  1RL2 A;  3HKZ G;  2UXC Q;  1ASY A;  3W1B A;  1J6Q A;  1IL2 A;  3HOV G;  3KDF B;  2LXK A;  4IPG A;  1L0W A;  2YTV A;  1O7I A;  4QJF A;  1YI2 A;  2RHS B;  3RLF A;  3HOY H;  1YHQ A;  3F1Z A;  2YU9 H;  2Y0S G;  5C44 H;  1Q12 A;  2GN5 A;  1JE5 A;  5C0X I;  4AQY L;  1VQI A;  1FJG Q;  1SE8 A;  3ZJY C;  3CCS A;  3CC4 A;  4IOA A;  2E2I H;  1CUK A;  1Y1V H;  3CC2 A;  2CKZ B;  2A1A A;  3HKS A;  3M9B A;  1OXU A;  1VQM A;  1TWC H;  2RF4 A;  4LW1 A;  2JEA I;  3KFU A;  4PZ7 A;  3OTO Q;  3LGJ A;  3L2P A;  2F4V L;  2JA8 H;  1EOV A;  4LF5 Q;  3GTG H;  4IPC A;  4AYB E;  1PH9 A;  4YWL A;  3PV0 A;  5JJI A;  3B6Y A;  5IYB H;  3S15 H;  4X6A H;  1UE1 A;  3J80 c;  3HOW G;  3CAM A;  4A3E H;  4B3M Q;  3GDE A;  1VQA A;  3MXN B;  3M85 A;  2KHJ A;  5M5W H;  4QGU A;  4JI6 L;  1EWI A;  4QY7 A;  1GM5 A;  3M4P A;  4JI1 L;  1HNW Q;  1A0I A;  4GOP A;  2UUC L;  2VQF Q;  4JI0 Q;  2NVT H;  3S17 H;  2F52 A;  4IO9 A;  5IP9 G;  1L1O A;  4KHZ A;  3A74 A;  5FJ8 G;  1P16 A;  1YHB A;  4HIM A;  1A62 A;  1V9P A;  5C3E H;  5K36 G;  4DK3 C;  5LMU L;  2VQE Q;  2K5V A;  2R93 H;  1FVI A;  1WJJ A;  1X55 A;  1AE3 A;  3ULP A;  1HNX Q;  1JJG A;  1I6H H;  1NMF A;  1WCM H;  2ZJR A;  2ZM6 L;  4GN4 B;  4OWX B;  4A4I A;  1K3R A;  2AHO B;  1XMQ L;  2UUB Q;  2UU9 Q;  1A8V A;  5M3F H;  4BY1 H;  3KF8 B;  1EIF A;  3I4N G;  3TRZ A;  1TWA H;  2NZH A;  2H5X A;  4DV1 L;  3U4Z A;  2B29 A;  3J7A 5;  1Q81 C;  1BVS A;  4UP7 A;  3CPW A;  2IHF A;  3H0G G;  1EIY B;  4X65 L;  4A3F G;  3F8T A;  3PUX A;  1V43 A;  3WWV A;  2PI2 A;  4LF4 L;  1NY4 A;  2I5H A;  2ZTE A;  4L5Q A;  4TVA B;  4UPA A;  2E2J H;  4DR4 Q;  2IY5 B;  3UDI A;  3PO3 H;  3OYY A;  3U58 A;  2EQS A;  3EIV A;  4A3L G;  1TWH H;  2JEB I;  2LXJ A;  5EAY A;  4HIK A;  4LFC Q;  1VQO A;  3CCE A;  4A3K G;  2R7F A;  1B70 B;  3U50 C;  1PH2 A;  3BZC A;  1ASZ A;  3E9H A;  4A93 H;  1L2F A;  4DNI A;  3GO5 A;  1B7Y B;  1N8R C;  2OQK A;  1HJP A;  4LWC A;  2K75 A;  3DM3 A;  4B3S Q;  3GTP H;  4BXX G;  4KLK A;  1AE2 A;  2R7Z H;  1PH7 A;  2UXD Q;  4OO1 G;  5BR8 L;  5FLM H;  4YCV A;  4R4T A;  1N32 L;  2KCT A;  3ER0 A;  4DR5 L;  1YIJ A;  1UE5 A;  3VDY A;  1VQK A;  1QVF A;  5C4X H;  3KF6 A;  1HZA A;  4NXM L;  1PH3 A;  4O0A A;  4BA1 I;  4GNX C;  1OXS C;  3F2B A;  2BH2 A;  4LF7 L;  1G51 A;  2UXC L;  2XGT A;  3K81 C;  1HZ9 A;  1P8L A;  1EFW A;  4DV0 Q;  2EXD A;  2B3G A;  1X3F A;  1X6O A;  1XNR Q;  2D0P A;  4BBR H;  4X66 Q;  2WB1 E;  4K0K Q;  4GOP B;  3AQQ A;  1JJC B;  3RLN A;  3CCU A;  1HH2 P;  2YTY A;  1KL9 A;  2YTX A;  1L1O B;  3H3V H;  3FP9 A;  1FJG L;  4C3I H;  1MJE A;  2E5L Q;  2N49 A;  3K7A H;  1W2B A;  3I4M H;  4QQB X;  1SLJ A;  2JE6 I;  1QZH A;  5E7N A;  3M7N A;  3K7U C;  4OO1 I;  1PH1 A;  1XMO Q;  1SRO A;  4PMW A;  2WFW A;  1VQJ A;  2BA0 A;  3OTO L;  2Q2T A;  4DR7 L;  5JJK A;  4LF5 L;  3TS0 A;  1EQQ A;  2KEN A;  5C0X G;  1QZG A;  4JBJ A;  1KRT A;  4C3J H;  1PVO A;  4B3M L;  5IP7 G;  1WOC A;  3BZK A;  3S16 H;  3S2H H;  3HOY G;  1FGU A;  1UEB A;  4EQ5 A;  1I5F A;  3PSI A;  2MNA A;  1HNW L;  1BKB A;  3TS2 A;  1CKN A;  3JAM i;  1I3Q H;  4JOI C;  1K73 C;  2VQF L;  4A3C H;  4JI0 L;  4DV4 Q;  1YZ6 A;  2ALY B;  3AEV A;  3M3Y H;  1E24 A;  2F3I A;  4UY8 C;  1Y1V G;  2DGY A;  4L5R C;  1VQF A;  4JI4 Q;  2CCZ A;  1CSQ A;  1TXY A;  2Q2H A;  3PUV A;  4OON A;  2K50 A;  3GD7 A;  2HIV A;  4GN3 B;  3S1R H;  2VQE L;  2JA8 G;  3ULL A;  1Q1E A;  3HOU H;  4A3G H;  1QVG A;  4TQU S;  1KRS A;  1HNX L;  4YY3 Q;  5IYB G;  2OTL A;  4HJ8 A;  3G71 A;  1SN8 A;  5IT9 c;  3CMA A;  3F2C A;  4A3E G;  1YJ9 A;  3S1M H;  5IWA Q;  1PH8 A;  3RN5 A;  3TQY A;  1OXX K;  4LUZ A;  3PF5 A;  2N78 A;  2Y0S E;  1YJN A;  2UU9 L;  2UUB L;  4MTN A;  3RLO A;  2IX1 A;  1AH9 A;  1U0L A;  1X56 A;  3KF6 B;  3PIO A;  1KHI A;  1MKH A;  3I4O A;  1LUZ A;  4OX9 Q;  1K83 H;  1NTG A;  5JJL A;  4R4C A;  2PNH A;  5IYD H;  3UDX A;  3PO2 H;  2K4K A;  4DV3 Q;  1X3G A;  4DR4 L;  3KLW A;  1SFO H;  5C3E G;  4A3G G;  2JA9 A;  3BU2 A;  4DR2 Q;  2QGQ A;  1N9W A;  3AYH B;  2R93 G;  4LFC L;  3PUZ A;  2BA1 A;  1WCM G;  4GLA C;  2VL6 A;  1N36 Q;  2OQ0 A;  3ERS X;  4GKK Q;  1YEZ A;  1X65 A;  4J15 A;  3AFQ A;  4AH6 A;  5M3F G;  1U5K A;  4BY1 G;  4B3S L;  2CWP A;  5LMN Q;  2E8G A;  3EN2 A;  3HFZ B;  3M4Q A;  3RZD H;  2UXD L;  4LF8 Q;  2HHH Q;  2UUA Q;  3KJP A;  2ZJQ A;  4LUO A;  5GRO A;  4A3B H;  4DV7 Q;  3PUY A;  4DV2 Q;  1PYB A;  1J5E Q;  4AYB G;  5GAH C;  3D0F A;  2WAQ G;  5J3B A;  1L1O C;  4DK6 C;  5LMN W;  3PUW A;  4OWW B;  4DUY Q;  4JCV E;  3RN2 A;  2Q2U A;  2B63 H;  3PO3 G;  4H02 A;  1NE3 A;  4A3J G;  4QIW E;  3KOJ A;  3PGZ A;  4DV0 L;  1XNR L;  1CKN B;  3CF5 A;  4K0K L;  4X66 L;  5C4J H;  5H1S E;  1YJW A;  4A93 G;  3FHW A;  4HIO A;  2IX0 A;  1MJC A;  4KI0 A;  2A19 A;  3CW2 C;  4LNQ A;  1OTC A;  4GLV B;  2E5L L;  4P71 A;  2R7Z G;  1Q46 A;  5FLM G;  4A3I H;  1VS0 A;  5IYC H;  2NVQ H;  1Q7Y C;  1BBW A;  4XTC S;  1XMO L;  1C0A A;  5C4X G;  3J81 i;  2PQA A;  1I50 H;  2I0Q A;  2LSS A;  4YHH Q;  5M5Y H;  2QA4 A;  2EIF A;  1JJ2 A;  4POF A;  2C35 B;  1S40 A;  3I55 A;  2Q2I A;  5GAE C;  4QL5 A;  4NXN Q;  1VQB A;  3F2D A;  1IBK Q;  3PCO B;  1XTD A;  4A3D H;  1V1Q A;  1EUJ A;  3L0O A;  2K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...