3PF9A

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
molecule keywords Cinnamoyl esterase
total genus 88
structure length 251
sequence length 251
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pf9A00
1CUFA 3D0KA 4AZ0A 4X94A 4ZXFA 1K5PA 3HRHA 4H35A 4Y2YA 1CLEA 5HQ3A 3KWJA 1QIDA 2IIVA 2Y6VA 4WCVA 2RGUA 5IVKA 4UHDA 4Y2TA 1CUXA 3T52A 2B20A 4Q34A 4PSDA 1IZ7A 3FVRA 4OCZA 1XZMA 1R50A 3DL7A 1L7QA 1BROA 2ZJ7A 2HA4A 4ZREA 2VJAA 5JZBA 3H1AA 5ALGA 5ALEA 1XRRA 2WJ4A 4BP8A 3ANTA 1JT2A 1QTIA 2BGRA 2VEOA 3IBTA 5ALYA 4FMPA 5DLPA 5AH0A 2WHPA 4YK7A 3SX4A 4Y2UA 3TRDA 5LZ7A 3DOIA 1MJ5A 2VAVA 1FFCA 2V97A 4AXBA 1ZD2P 4K5QA 1XZEA 2ONCA 1UT6A 4KE7A 2RAUA 1LZKA 1LBSA 1W75A 1CRLA 2WKWA 1LPOA 1OCEA 4F60A 3ED1A 2GYUA 3A2MA 4H0CA 5C8XA 1VA4A 2HA2A 2XMSA 3D2AA 3VXKA 5LP1A 2C7BA 4RE5A 1DX6A 1AGYA 5ALKA 4P08A 2H7CA 3BIWA 3WKDA 3M81A 4ZV7A 5EHZA 3I6ZA 4UBLA 4LHEA 2C5GA 2R8BA 3D3NA 3O4HA 4INZA 2OPHA 2XMRA 4X95A 3WL7A 4X6XA 1XQVA 5JAOA 4OB6A 6YASA 5CH8A 3VISA 2RI6A 1JMKC 2WTMA 4I3FA 5AI4A 3DYVA 2V9ZA 2AXEA 1O6FA 3S8YA 5YASA 4UBIA 4X71A 4PSCA 1P0QA 5FPPA 1HDEA 4J3JA 5D3KA 4AN0A 4BDTA 5LYYA 4BVKA 1AQLA 1YAJA 1GQSA 1XQXA 5DYTA 5JALA 4ARBA 1YB7A 5EI5A 1TRHA 3BWXA 4MWTA 1U4NA 3G0DA 4QDUA 2XUPA 3WWDA 4HXGA 3AFIA 4H7FA 4AZ3A 2ZYHA 5EGNA 4Q3LA 5JAUA 1S8OA 2WUGA 4UHBA 4QDXA 1VZ2A 5C81A 4CIAA 1FFAA 4BYMA 4HXFB 4X6UA 1QONA 3CCCA 5AK5A 5BWBA 3GELA 1G5FA 2HM7A 4FBLA 5DNUA 2FJPA 5AIBA 4Y7DA 1IUOA 3UUFA 2JGLA 1SC9A 1R4ZA 2JGMA 1YASA 2XUOA 2WSLA 4WY8A 3FOBA 1XZCA 4MEAA 3R3YA 4W1RA 3IVMA 2GZSA 4ZRDA 3HLKA 2JGFA 3CXUA 4KE6A 5C8ZA 2WU3A 1EB9A 2DR0A 2WIDA 5ISMA 4BBZA 4DNQA 3M82A 3BJRA 2J3DA 3R3VA 2QOEA 2VT7A 2I3DA 5JIBA 4I19A 3G9UA 1NU6A 4KEAA 5D6OA 2G63A 1CUHA 4KYVA 1CUYA 5BWCA 2QJWA 1USWA 3BF7A 1E89A 3ZPXA 3VDXA 4DNPA 1Z68A 2WFLB 1X70A 3WK9A 3WLAA 1XKLA 4C4XA 1XRPA 2C4HA 4HS9A 3WL5A 4BDSA 1IMJA 1A88A 2WILA 3F67A 1A8QA 4LXGA 4UHHA 3BDVA 3O9MA 3K6KA 1UOOA 4BAGA 3Q0TA 4X7BA 2RHWA 2QXUA 2QVBA 1XRMA 5JATA 5AI9A 4BC1A 1MTZA 1G66A 3G7NA 5AP9A 1QIHA 3HYSA 5JAHA 2XUAA 4BCDA 4J0CA 5CT8A 5AKYA 2OGTA 4GI1A 4QDTA 1H2WA 1GKKA 3VJMA 1KEZA 1XZKA 3BF8A 5SYMA 2C58A 3WYDA 4Y2PA 1UZAA 2G4LA 4FOLA 1LPPA 3YASA 3E4DA 4LXHA 3WKCA 4E46A 1UXOA 3LIIA 1ZD5A 1TCBA 4Y2RA 1EDEA 4MXDA 4UUQA 1H2XA 3STUA 2ZVDA 3WWPA 3PI6A 4IHAA 4J0DA 5JD5A 3I1IA 3D59A 4IH1A 2QMQA 3K9BA 1W6RA 2B9VA 1JU3A 1JJFA 2DQYA 4TGLA 4FHZA 3PF9A 3FWHA 2WLSA 4OU5A 2WFZA 3QYJA 2OQVA 1MAAA 4FDMA 2PSJA 4DMKA 4WJLA 1N8SA 2DHCA 3KSRA 4FTWA 5HFNA 1K8QA 1BCRA 2JEZA 5AKKA 1XLUA 1XQYA 3DKRA 3OPMA 1B6GA 5H3HA 1DWOA 4DNOA 1FSSA 2CKMA 4GECA 1Q0RA 2YASA 2YH2A 1QIIA 3H17A 4YASA 5HCUA 1XRQA 3VJLA 1ZJ4A 5A2GA 2I3ZA 3WK5A 3NWOA 5ALRA 1LGYA 4OB8A 1YAHA 5EHNA 3OG9A 3TJMA 1SOMA 1MNAA 3LCRA 4J0KA 5FDFA 3IIIA 3RARA 1LBTA 2XMGA 4CI9A 4AX4A 2DCMA 3MGAA 4BE9A 5ALMA 5K5EA 3GZJA 2VJCA 3WK6A 3BXPA 3G9TA 1T2NA 4UBJA 3WJ1A 5FP0A 2BAGA 3W05A 1T4MA 3C6BA 4TVKA 2J4CA 1YB6A 4B81A 5EIEA 2ZJ6A 5JAPA 1ZGCA 2WM2A 4P92A 4U2EA 1QFSA 5CXXA 5CH3A 3STYA 2JF0A 2DHEA 3HSSA 3PE6A 3Q8WA 4H18A 2ACEA 5A7GA 1P0MA 3W9BA 2QKYA 1THGA 5JASA 5AKXA 4UBOA 5AK3A 4LKOA 5AOBA 4L0CA 3IUJA 3HXKA 3W9UA 2PX6A 3IUNA 1MT3A 2PM8A 4X00A 5CT9A 3CN7A 3AZOA 5ALXA 3F97A 4MYSA 2CEKA 4BZZA 5JD6A 5ALQA 2XUIA 5LLSA 4N5HX 3E1GA 1R9NA 2CZQA 1EK2A 1CUVA 1K63A 1KU6A 3L1IA 4DTCA 2V98A 5ALFA 4W63A 4B9EA 4EZIA 2X8BA 3ESDA 5I8PA 4B7ZA 4B9AA 4B84A 2Y2UA 3FSGA 4G8BA 4BTVA 4S0XA 4M0EA 3BL8A 2RONA 1UOPA 4BZWA 1HQDA 2XMDA 3O9VA 3D2BA 3PF8A 5A6VA 3FCXA 4FLFA 3L1HA 5E4TA 2LIPA 2H1IA 4K2AA 3OM8A 3I2JA 2EDCA 4BCBA 5CH5A 3H0CA 3ESCA 1E8DA 3JWEA 4BE4A 1QTRA 1ZI6A 2OCIA 4W9RA 3G8YA 4HRYA 4KE9A 1SCKA 4BP9A 1C4XA 1XLWA 2X5XA 3A2LA 1CR6A 5FOQA 1XZLA 1BN7A 1IUNA 2OAEA 1HLGA 1VJ5A 5EIHA 3WK4A 4QE3A 4L72A 1XZJA 2ZYSA 1QZ3A 4MJ3A 3C5WP 2ZYIA 3JYHA 1W52X 4BATA 4XWGA 2HA5A 3WIBA 4EHBA 3CCBA 4GDMA 4X97A 1XFDA 4AO7A 4JH0A 4M0MA 2H7XA 5CXUA 5FUMA 2HADA 4U2CA 3STXA 4CCYA 1MPXA 4WY5A 3C5VA 1EVQA 4D9JA 1UKCA 3QMVA 4DMFA 3RKSA 4KAFA 4GEGA 4E11A 2VF2A 3EQ7A 3FLBA 1ACJA 3C8DA 4EY5A 1HPLA 1CEXA 2OCGA 4LIPD 4DLNA 1ORWA 1N5MA 1L7RA 2HU8A 2UZ0A 4JYPA 2C5FA 5EIAA 4DSZA 1XROA 2JBWA 2CBGA 3ZI7A 1EX9A 3SC2A 2XQJA 1QIFA 4WDRA 3ZLTA 4HAIA 1GZ7A 2XUHA 3AIMA 4U2FA 2XQIA 3UMJA 1EA5A 5HK9A 2XUGA 2HA0A 3R3ZA 2OCKA 4QDOA 5HFAA 3EQ9A 2WG1A 4GLBA 5LZ8A 3ZLVA 4AB1A 4X90A 1BN6A 3DS8A 1QLWA 3C70A 3F98A 5AI6A 3C6YA 5JANA 3ZWQA 4XJVA 1RWQA 2O2HA 1PJAA 3I2GA 1H23A 3DNMA 1XZGA 3GUUA 4WFKA 5DYWA 2HL6A 2XMZA 5EHQA 3H1BA 3U0VA 2PSEA 1F0PA 4Q3KA 1VKHA 2B4KA 2VSQA 3AIOA 1CUAA 5JYCA 1XKTA 4B6GA 4LXIA 2ECFA 2HRRA 3R0VA 1N1MA 2HU5A 2XMBA 1E8MA 1ZIXA 1WM1A 3R41A 4JUIA 1QIEA 3DJYA 5JZSA 3SK0A 3WWCA 1ZOIA 2BFNA 2V96A 4BVJA 2PU7A 3VKFA 5T4HA 4WFIA 1AX9A 1CUUA 4IH4A 2HA3A 4BRZA 1EI9A 1R88A 2PVSA 4IH9A 4Z49A 1HKHA 2FJ0A 1THTA 1VZ3A 4FFVA 2HFKA 4OU4A 3ILSA 4A5SA 5DNWA 1AUOA 1BEEA 1BE0A 3FYUA 2GZRA 5BOVA 5E4JA 5JADA 1LPAB 3MVEA 3I2HA 3DCNA 3G0GA 5DTJA 1F0NA 1J2EA 3P2MA 5AI5A 1P0IA 3F8SA 2ROQA 2OG1A 1F6WA 2R11A 3QPAA 4B0OA 1SCQA 5CT6A 1RYYA 1OILA 1EVEA 3ICWA 2XDWA 2OCLA 2CB9A 2XB6A 3KD2A 1CIJA 3GBSA 4FKBA 1ODTC 2DSNA 4BRSA 1M33A 1U8EA 2WUEA 3G9XA 2O2GA 3DKKA 4KR0A 2XI4A 5K3EA 5IVIA 4BVLA 4B80A 3DOHA 3G0BA 4G5XA 4QA9A 3V1MA 3WQHA 5ALIA 3ZV7A 4NS4A 5I7UA 1NU8A 5CURA 4OPMA 2VJDA 4PF1A 3DD5A 1DQZA 3WI7A 1QGED 2QUAA 4RPCA 1MX9A 4G8DA 5DYYA 1ACLA 1A8UA 3A6ZA 1FFBA 3PDCA 5K3BA 1CUEA 1X2BA 3D7RA 3BE8A 4QEKA 2OXEA 2HHAA 1TIBA 3O95A 4UFNA 3AILA 2QZPA 2JGIA 2W22A 3RK4A 5LZ4A 2B61A 5D7BA 5AM5A 1Q0ZA 4PNZA 4UHFA 5BV7A 3AJAA 3M83A 4KRXA 1WB6A 2QJRA 1ORVA 2G5PA 4HRXA 3C87A 5A7HA 3N2ZB 4H7HA 5AOCA 4UBNA 1HL7A 4KACA 3F96A 5HK8A 4XX1A 1R1DA 4H7IA 5C7YA 3V48A 1CUBA 1MAHA 2C0QA 3WJ2A 1YS1X 3V1LA 3WL8A 4EB0A 1LLFA 1CUJA 2IX9A 2HRQA 3FLAA 3I28A 4UHEA 2PBLA 3BIXA 2E3JA 3QZUA 3WK7A 4ITVA 4UBMA 1D07A 1ZI9A 4DMHA 1X2EA 2CUTA 5K3AA 2DQZA 5FV4A 1F8UA 3AZQA 2AJDA 1GT6A 1R9MA 3W04A 4EY7A 4X93A 5ALDA 1HBJA 2WFLA 5CT5A 4KJXA 1CUGA 3HJUA 1XLVA 1WHTA 1VE6A 4CG1A 3C6XA 3B12A 3UUEA 1GPNA 1Y7HA 2WIFA 1TCAA 1RP1A 1BS9A 1ODSA 1QIKA 5IH7A 3LP5A 3HEAA 3AINA 4J0IA 1E5TA 3BJMA 4CFSA 4JEIA 1Y37A 2QRUA 3EQ8A 3U1TA 3GFFA 1CUCA 2GBIA 2QTBA 2OQIA 3PUHA 4NMWA 1AC5A 4UFPA 1CQZA 1ODCA 3KXPA 3I2IA 4BTLA 5AKEA 2HDWA 1ZIYA 3S2ZA 2WUFA 5KBYA 3AIKA 4K6HA 4DGQA 5ALUA 2PL5A 2BUBA 3LIPA 3ZLUA 4CG2A 4H7DA 1YS2X 3DYIA 5HZGA 3WL6A 3QMMA 3G0IA 2VATA 4GBGA 3VJKA 4U2DA 1E3QA 1P0PA 5ALZA 4X91A 4W1QA 4ZI5A 1AKNA 5AJHA 3N0TA 5HQ3B 1PFQA 2WIGA 3O0DA 1CUDA 2HU7A 1XZIA 1GPKA 4JYMA 4LYEA 3IUMA 4QLAA 4BB0A 3QITA 4ZV9A 3EBLA 5LZ9A 3I2FA 3DEAA 3H2JA 4YPVA 4Q82A 1DWPA 4DIUA 1JI3A 2O7VA 3FLEA 2OGSA 4G9EA 4FLMA 2WJ6A 2XMCA 1QIJA 2Z8XA 2AJCA 1VE7A 5ALJA 5ALLA 1YR2A 1JMYA 1XZBA 1W76A 2DHDA 2JGEA 4C4YA 1DT3A 4Y9SA 1CUSA 2WG0A 4CCYB 4EY4A 2BCEA 2QUBA 4DYHA 1GKLA 3QPDA 5A71A 4Y2VA 1EDBA 3PUIA 2Y6UA 4QDZA 4H7EA 5EFZA 4QWWA 3DL4A 3QH4A 1UWCA 2HFJA 4HVTA 1UK8A 5ALPA 1MN6A 4PV7A 1GXSA 2XQGA 1E8NA 4G4GA 3EF3A 3STVA 4W1PA 5E2IA 2PPLA 2QR5A 1CFJA 1N5RA 1WCYA 2QXTA 2ES4A 2WIKA 3B3QA 4UPDA 2AJBA 1O6GA 2WG2A 3H2HA 2XT0A 4J7AA 4QZVA 1E66A 4C88A 1MO2A 1YCDA 2JEYA 3QM1A 1GPLA 1ZICA 2WTNA 4W1SA 3R3XA 3LLCA 3FCYA 3A2NA 4RGYA 3WKBA 2QT9A 2GBCA 2PUHA 2OAGA 3IDAA 4MQMA 1WHSA 4Q05A 1QFMA 1WOMA 3R3WA 3H19A 3WK8A 3G9ZA 4MWSA 4PQEA 5HF6A 3QBJA 5HKAA 1DWQA 4G8CA 3WWEA 1ETHA 5LZ5A 2RIPA 2VQ6A 5T4BA 1J06A 3I1YA 3I6MA 2D0DA 4U2BA 4OYLA 4PW0A 3C8HA 4N8EA 3NOXA 1UK9A 1AURA 5KREA 3V9AA 4CG3A 4EY6A 2W6CX 2PSHA 3DDUA 4GHWA 1EHYA 5ALWA 2P8SA 4CIBA 4XVCA 5ALSA 4A23A 3G02A 4J03A 5ALOA 1OXMA 1QO9A 4X85A 4PSUA 3C45A 1EXWA 1QO7A 1ISPA 1LZLA 5FRDA 2BUAA 5IVDA 4QWMA 3H2GA 2Y2VA 1VXRA 2GBFA 3AUKA 4C89A 4ETWA 1QJ4A 2WJ3A 2DFPA 2ZSHA 5E4YA 5AM2A 5T4EA 1FJ2A 4DMCA 3EIOA 3CN9A 2PSFA 2J4FA 3O4GA 2EDAA 2YXPX 4N8SA 1I6WA 4K6KA 4KRYA 4OB7A 2WU4A 4MYDA 2VJBA 2Z8ZA 3C6ZA 1QIMA 4UFOA 2PKYX 1TCCA 3QVMA 1C7JA 4OD0A 1QIGA 1C7IA 2HA6A 4FBMA 3O4JA 2ORYA 2BJHA 5F4ZA 1LPBB 4O08A 2ZSIA 1DX4A 1WB5A 2Z3WA 4E14A 5I9IA 1G42A 4L3WA 3FSGD 2XE4A 3OURA 1BCSA 5AK6A 2YYSA 3E3AA 2I78A 4P93A 1QE3A 3R40A 4BAZA 1U65A 3DLTA 1VLQA 4N8DA 3A70A 3G0CA 5AM3A 2EEPA 1JU4A 4ARAA 5AOAA 2PSDA 2OLEA 5AK4A 5CBKA 5AKIA 3H2IA 4OUKX 2FUKA 4J0HA 1DINA 1ZI8A 2NW6A 2QS9A 5CTAA 5D3ZA 5AKLA 3BDIA 5JD4A 1WB4A 1TQHA 3ESAA 5KWJA 5ALNA 5ESRA 3LS2A 3FYUC 5K3FB 3HZOA 2WIJA 1Y7IA 4GXNA 1IUPA 5AKGA 4XIIA 4G4IA 4Y2SA 4Y2XA 3WYNA 1EB8A 4RNCA 4F0JA 1UKAA 4K6GA 4DSAA 3D4LA 4RE6A 4N5IX 2ACKA 3D5EA 3MUNA 1LPMA 2XUDA 1UFOA 5DNVA 4X3CA 3WA6A 1KU0A 1CVLA 1DU4A 3IA2A 4MQLA 5AICA 3PFBA 4KAAA 3DQZA 1ZJ5A 2XLBA 5DJ5A 1MU0A 3HABA 5LKRA 4B0PA 5A7FA 2QM0A 5AKHA 4X6YA 3H04A 3IULA 2D5LA 1ZGBA 2CMFA 4L9AA 5CRIA 4QLOA 1W1IA 4NVRA 3FAKA 2ZYRA 2JGKA 2VAXA 4G4JA 5AM1A 3NGMA 1NX9A 2WHQA 3PFCA 1A8SA 3RLIA 1CUWA 4WDQA 3TGLA 2BGNA 1UKBA 4FFWA 5CW2A 1XZDA 2AJ8A 4B82A 4HTAA 2XUQA 2WQZA 2Z3ZA 2K2QB 4AQDA 5CMLA 1CUZA 4DM7A 3C43A 3WZLA 1ZD3A 5J3JA 5ALTA 2VTVA 3KDAA 1GQRA 2BUCA 4EBBA 4M0FA 3WA7A 2RHTA 4E15A 3R3UA 5ALVA 3KWFA 4B85A 2Q0XA 1B41A 1XRLA 2G5TA 4C6HA 1MX1A 1IZ8A 2X76A 5C8VA 5HF9A 1WPXA 1G4HA 4FLEA 1XRNA 3K2IA 3QMWA 3I6YA 5HF8A 1LNSA 1EK1A 1L7AA 3ANSA 1JJBA 4ZWNA 3WIOA 5FPQA 4BAUA 1TAHA 1VA5A 2WHRA 3WZMA 3JW8A 2C0PA 4Y2JA 1PV1A 1XQWA 2ZJFA 5A62A 3W06A 1QOZA 1YA8A 1H22A 2VT6A 4FNGA 1K4YA 3GROA 2HIHA 5AI0A 2XQFA 4LYDA 4G9GA 4C87A 5DTIA 1VXOA 2O2IA 1Q83A 5AHXA 2GYWA 4V2IA 4HZGA 2WUDA 3V1NA 3IUQA 1TK3A 1DQYA 1DT5A 3WKAA 1SCIA 5CT4A 1U2EA 4KE8A 1BEZA 2JGJA 4A16A 1W4LA 3STWA 4YX9A 3B5EA 2XUKA 4EUSA 2Y1KA 5KWIA 2J3QA 5JZ9A 4DNFA 2PUJA 3T4UA 1VOTA 1UOQA 3D2CA 4WFJA 4NZZA 4EY8A 1XZAA 3TEJA 4AO6A 2JIDA 3WMRA 1BRTA 1K6EA 4FNMA 3FYUB 2O7RA 4OSEA 3GA7A 3M3DA 2H7YA 3WWOA 5K3FA 7YASA 1JJIA 3FNBA 1Q84A 4KAJA 4AN1A 3OTQA 4MEBA 4C4ZA 1EH5A 1IVYA 5FXMA 4UHCA 1GGVA 1H2YA 1LPSA 1CUIA 3PICA 2VA9A 3OC0A 5AM4A 4F21A 2AJLI 1AZWA 4I4CA 5LIPA 3IURA 1EINA 4H7JA 3H18A 2WFMA 5ALHA 5AIAA 3SWWA 4GW3A 4Q1VA 5AM0A 2CJPA 3F9CA 2XUFA 3I2KA 3MUOA 4IQ4A 2XMQA 5IVHA 3KOOA 1CQWA 5IKXA 1TKRA 1JKMA 4QNNA 2H9YA 2GBGA 1LPNA 4GWLA 4PO3X 1DTEA 4TPKA 2HA7A 2PU5A 3QPCA 5LKAA 4EA6A 5LZ2A 3STTA 3ICVA 3FBWA 4J0GA 3H2KA 5HKBA 4BC0A 4AMYA 1J1IA 1ZD4A 3HC7A 2FX5A 4IO0A 2IITA 4ROTA 2WHPB 3X3HA 4HXEB 5AO9A 3IB3A 5K3CA 3HI4A 1SFRA 3VVMA 1R3DA 4CCWA 3AZPA 3OOSA 5FLKA 1BU8A 3HACA 5K3DA 4Q3OA 5EHXA 3E0XA 4H7KA 1A7UA 4P9NA 4C01A 3NUZA 1MNQA 3WKEA 1JFRA 5FKJA 1WPRA 1MX5A 1AMNA 1YSCA 3V1KA 3ESBA 4JNCA 2I03A 4FWBA 2XQKA 4ZGBA 1XZFA 4J0JA 5AKJA 4UBKA 1CV2A 4B83A 1UK7A 3O4IA 2Z5GA 2OGZA 1CPYA 1UK6A 3FVTA 1FFEA 4AMZA 2BKLA 1EDDA 4G1FA 5AKZA 4Y2QA 4AO8A 3RM3A 5HF5A 4BCCA 4H77A 5SYNA 1YA4A 1J07A 3W2TA 2XUJA 2XLCA 2GYVA 1H2ZA 4X92A 5JARA 1XZHA 4F5ZA 4U2GA 3L1JA 4OYYA 3FYTA 3VVLA 1FFDA 5T4FA 5DWDA 5AI8A
chains in the Genus database with same CATH superfamily
1FUUA 3DVAB 3HI6A 1Z62A 3PWSA 4ZANA 5JLAA 1ZNWA 2D5AA 2QZJA 3DEYX 1JHMA 3D0KA 3KTOA 4HEA6 4URZR 4EHAA 4X8OA 2O8CA 1RKVA 3MWDA 3QPBA 2P62A 5CYFA 4CKXA 2W4IA 3HRHA 3LPDA 4H35A 4JUAA 4Y2YA 3SEAA 2CBZA 3ZU3A 1RC8A 3C8UA 2EZUA 2GO1A 4C0XA 1FLDA 2R6HA 3H0KA 3H65A 5K09A 1YR8A 3KWJA 3E35A 2FPIA 1QIDA 4WCVA 4PLGA 2MHCA 1YMQA 2DKOA 3J81k 5JDIC 5JJCA 2WVAA 4HH1A 1IJBA 1YH3A 3TBFA 3BRSA 4DIOA 2B37A 4ETNA 1US8A 2XXJA 4BX8A 4GI2A 3E3NA 1SBZA 3AF5A 3N59A 3MCZA 1CUXA 4NENB 4Q03A 3UJHA 5AVKA 2IXGA 2C5AA 2PZMA 4Q34A 3UJCA 4N7RA 1QXSA 3DM5A 5EZYB 2FEOA 1IZ7A 3W8RA 3WGTA 1N3BA 1U11A 2FRXA 4OCZA 1XZMA 1NL3A 2GKGA 4YREA 4MYUA 3AF3A 1N9GB 1JAIA 1O6BA 1RAHA 3D1VA 1LA2A 3ZZNA 3Q1KA 1SKBA 3NHBA 4K9PA 5HKLA 3I04A 3H9CA 4ITUA 4W4TA 1WTAA 3OTGA 1CB7A 5I8ZA 4F46A 4ONEA 1ORRA 1ZMRA 4C1NA 1WZ2A 3WLTA 5ALGA 1HNWB 2AKEA 1XRRA 1P31A 2MJLA 2WJ4A 5TXGA 2XT9A 3ZCPA 4N12A 1SXPA 1A9YA 1D0IA 2OOSA 5SV2A 1IRIA 4BP8A 3LDAA 1Z39A 3PFKA 4GH5A 4BGVA 1DTSA 2ERYA 2ICAA 5FWYB 4C1BA 1G8GA 3E70C 4QNRA 4GPEA 4M98A 2BR5A 2AN9A 2LDBA 4I4TB 3QU2A 1TIKA 4ZAWA 2MINB 4CM8A 5C8YB 2PE5A 4M1KA 3AHEA 3NHZA 1LBEA 1J09A 2BGRA 2FZ4A 1OPXA 1Z4OA 2VZ8A 3ND8A 3TQHA 1NXOA 1IBLB 4XVRA 4ZD6A 1OKKA 4I1OA 2BFPA 4LF6B 1E1CA 1QRAA 1C1XB 4MPJA 3SX4A 2MU1A 4L6CA 3O8OA 1YV9A 3K72B 2EERA 1FYVA 2H0QA 2OLJA 3LCMA 1MJ5A 3RYTC 3D6AA 3T9AA 1JU9A 1YJXA 1JDNA 1QHSA 4F4DA 3ND6A 2LV8A 4K5QA 1XN4A 1SKMA 2QLNA 4KK4A 5JXJA 1H1LA 3MT0A 1T1JA 3PWZA 4LC1A 2H4WA 3O75A 1ID1A 1THMA 2W2TA 2C61A 2KQUA 3UMRA 2ZJYA 1FNNA 1C30B 3CGWA 3LP8A 2J30A 4KE7A 2O8BA 4MLCA 1NMQA 4ESEA 1LI4A 3SKXA 2ZITA 4HB2A 2OSBA 1LZKA 1LBSA 2J9FA 3U1VA 5HCNA 1CRLA 2C9ZA 3HY3A 1P74A 4G0OA 2WKWA 5ITZB 3K70D 4YLEA 2JLYA 4F60A 4FEEA 5CFMA 1GQYA 3MHTA 3IPCA 1V3UA 2CNDA 2YWCA 3ELUA 4HPJB 1FPQA 3DVLA 3ER6A 3BE5A 1VA4A 2XMSA 1V7PC 4YMLA 4HDOB 4FYWA 4UVGA 3BWDD 4RWEA 4DHWA 4EEZA 3AVWA 3WGJA 1ZJZA 1BDHA 2C7BA 3IAUA 3LU1A 3FJYA 3OEEA 2ZYDA 3EZFA 1YB5A 2WU1A 2AUTA 3KR2A 3WV4A 1SOAA 2ZIWB 4YCNA 3M1YA 1KI3A 5IKEA 2I9KA 2XGGA 2A14A 4L1KA 4CFZA 3MILA 1H3EA 1OU4A 5FFNA 4PG6A 4RV5A 2P5TB 1TQDA 1JQDA 3HA3A 2C9CA 5KOJB 1FLAA 4PHCA 5BR8B 1Y5NA 2GK3A 2XVMA 3NDPA 3GT3A 3JQ9A 4OATA 3TR5A 2XCRB 4DR5B 2O8EB 1UM9A 3ITNA 1K0UA 1E7RA 2CLEB 1RZUA 2OBBA 5KWSA 5JJKA 2EWVA 4MVXA 1N0UA 2KB0A 5CPBA 5GOZA 4HWTA 6YASA 1U8CB 4N41A 4XA8A 2D06A 3PC4A 4PG7A 3ZC3A 1SUBA 1RAIA 2PZJA 3NBXX 3LQ2A 3PJDA 3LW7A 4CMAA 2VBCA 3GQBB 4RVFA 1R6UA 2GHRA 2V7PA 3TXXA 2IEZA 3DLHA 4WOBA 3WGLA 2A3NA 1UDWA 4CZ2A 4URHA 2HMVA 4DCPA 4UVDA 3DYVA 3AWDA 3VO9A 4F7DA 3RVDA 4N7MA 3DDWA 3HMQA 1WDTA 2MSWA 5ECGC 4V1CB 3HHPA 2C3OA 2W6ZA 3OSZA 1CEYA 4M22A 4PSCA 4B3GA 1M6EX 3D8NA 3P94A 1NW6A 1G8MA 3T7AA 1USKA 4O2BF 5FORA 2D4AA 3H5VA 2W7TA 4M9ZA 2I3BA 2QU7A 1SZCA 4S24A 4FGZA 1LNZA 5LYYA 4BO3A 5JZMA 1EWQA 4OUDB 5LMUB 1Y6QA 2XMPA 2X7HA 3Q87B 2W93A 5A5GA 1JF8A 3N05A 1L8LA 5CITA 1IN8A 4IMIB 2I2FA 1KOLA 4ARBA 4DT1A 3F9RA 3SEFA 3KS9A 1I10A 4OHPA 1YL7A 3JWPA 4RGQA 1U3GA 2AC2A 2J5BA 4HH4A 4D80A 3G2KA 1F4PA 2H65A 3PLNA 4EJ6A 1YQGA 3UPDA 3H9BA 2IEYA 3GT4A 3AXTA 2KMLA 3OLCX 2BFAA 4LRQA 4YRBA 2XHEA 4ETMA 1WSDA 4MWTA 1YZHA 4JI1B 1U4NA 3K7EA 4H6PA 1I0ZA 1FL9A 4AU1A 2ZTMA 4XVUA 2HK8A 1K86A 4ID9A 3WGQA 5JH7F 4B35A 2YN2A 1NYRA 3AFIA 1LDNA 1SUPA 1Z13A 1T43A 2K7ZA 1L1QA 1XYVA 2P5SA 2ZW9A 2ET6A 4WACA 2NU8B 5HTKA 2FMUA 2I6TA 3TDMA 3TGWA 1T2DA 2NZVG 2MYPA 2YXEA 4UHBA 3WLIA 4F85A 1P4HA 1XL0A 3BEOA 4EMBA 2X5JO 5LA6A 4KOAA 5AK5A 4NBNA 2GBLA 4H3HB 5EA2A 4Z3KA 4FM9A 1H66A 2YS7A 5KDLA 4YJGB 4B40A 4UEWA 1CY0A 4DA6A 3Q7QA 3DFKA 2OV6A 4WD3A 4BV9A 1U7UA 2NSJA 2ADFA 4MUNA 4AIIA 3PK0A 5DNUA 3R5JA 2FJPA 4GKVA 5AIBA 1IUOA 1X94A 3WSVA 4TLDA 1PNOA 3MCUA 3AL2A 4B5LA 2VK1A 3W4KA 3MOIA 3AY7A 4DUGA 3OFVA 2XNSA 2GH1A 4IFTA 5IG2A 4QFMA 3BXXA 4K1XA 1CQPA 4DV4B 1SIOA 1SU8A 1MOZA 4I4LA 4JJFA 2F8MA 5LLDA 2C9BA 1EK5A 4R2HA 4KR7A 3EC2A 4WA8A 4KUGA 1M0WA 1BMFD 1UDRA 1XZCA 1Z4JA 4I55F 1WXGA 4RK1A 3WAKA 4XTRA 3AEXA 4I7EA 4P84A 4YP0A 4E88A 4GSLA 1KC3A 1U0SY 3EXIB 3LKVA 2PKCA 3M1AA 2GZSA 1ZK3A 4LE1A 2JGFA 3CXUA 2IXBA 4ZI7F 3TLKA 4O0LA 3HU5A 1R00A 1RLOA 4NIMA 2GA8A 4Z4IA 3ZZMA 2WIDA 3LKZA 3QW2A 4YV0A 5ISMA 2PXAA 1NVUQ 5ICCA 1APBA 1XVLA 3TQQA 4FI3C 2D1RA 2QUHA 2YJNA 2J3DA 5A3VA 3FWPA 2ZBRA 2QOEA 2J3IA 2EG9A 1T8UA 1U0OC 4PYIA 4UM7A 2XVZA 4D3FA 1FDTA 2FF5A 3K53A 3OJCA 4JL8A 3KDSE 3GJ8A 3UFXB 2G06A 3DJFA 2CXOA 3O8DA 1GAWA 4GX1A 4R84A 1P75A 1JHOA 1CUYA 1ZISA 1QE5A 3DC2A 1J21A 2E9SA 1W4BA 2ZB2A 4X54A 3FPEA 3QYPA 4PZ9A 1M7GA 3VDXA 3P26A 3GDWA 4AQYB 4JROA 3R0XA 1X70A 1R0ZA 3Q2KA 4XB1A 5PNTA 3BERA 3VHQA 4B8WA 1BJRE 1KORA 3P52A 4D9FA 2NGRA 1NN1A 1PZHA 1WNFA 3BRWA 2ZS9A 2VPWA 3U7EB 1IRXA 1CU1A 3ABOB 4YCSA 1MBZA 1XRPA 2ZP1A 4E7PA 1KEEB 4KX5A 4MRMB 3P9QA 4PANA 4KO2S 4R71A 1QAQA 4DCNA 3GP3A 2PVCA 1UPFA 2UVPA 3H2ZA 3H75A 5B7QA 4TWBA 4UHHA 1E3LA 2H92A 5DGXA 1QS0B 1MX3A 1JR2A 1HTBA 3DMYA 4MAAA 4PAGA 4QBHA 3RAEC 5I9MA 4BNNA 1BTOA 1IAVA 5U9CA 3LY5A 2IRWA 1QDEA 5KX5A 4Q7QA 1P7VA 3HBFA 3SX0A 1E1RD 4BNJA 3K9HA 3OFND 1IH8A 1Y33E 4QPCA 2OE2A 4K03A 1TX4B 2UZ3A 3C2QA 2RGDA 5K9ZA 3MBKA 2GPAA 4X1YB 1EP1B 4EP1A 4AMBA 3ETCA 3HKEA 4XQ9A 4WZ6A 4NY1A 4XLTA 3GFSA 3T9CA 1CY8A 3L05A 1XRMA 2WKPA 3ZGVA 5DRYA 1G66A 3FBGA 3TLJA 4BC1A 4CR6A 3VKGA 1AKQA 1WS6A 2V7WA 4BPBA 3QVXA 2WYUA 3HYSA 2PJRA 1JVBA 4IOJA 3ZNQA 3CVVA 2XUAA 3UAVA 3Q3EA 4RJTA 5KNDH 3T6KA 3WFZA 2H16A 1VIAA 3CX8A 1JHQA 2K7FA 3FZGA 4CFYA 3VR5A 3UOAB 1PT6A 3WB0A 5CT8A 1CYDA 3PA8A 5E3JA 2XB4A 4QDTA 1E20A 5K0EA 3H0EA 1R64A 1H2WA 3HSKA 2VDWA 3HFSA 2QTRA 1GKKA 3KT0A 4K86A 3RVNA 5A1JA 1XZKA 1XA3A 3FCAA 3QUSA 2JFNA 1XPUA 5EFOA 3BF8A 5ITWA 5SYMA 2NAPA 4JQCA 1YZLA 5IUKC 3WYDA 2F43A 3BIOA 2YIDA 3EODA 4CIDA 4OP2A 4UEKA 5DZSA 5CDTA 2HHLA 2IUFA 2YZ7A 3DDHA 4KLRA 3QF4A 3O31A 5JTTA 1R8JA 3FB4A 1PX2A 1I1OA 3NTOA 4MZXA 3ON5A 5AK0A 1RRGA 4KAXA 3ZXUB 1ZXBA 5AXDA 2COKA 2Q2WA 3IB6A 5GONF 1T1EA 4E46A 1UXOA 3IIJA 5EKDA 4YYZA 5IFLA 2X6RA 4RTSA 1UBTS 2P9GA 3SZUA 1RLTA 4REOA 4FEGA 5EXSA 1Z6QA 4IKEA 1VBNA 1KZGB 1ZY2A 4D8XA 5B2FA 3LPAA 3MW8A 5LQKA 1EDEA 4LJ8A 4UUQA 1W5FA 1TZJA 2VDUE 2PMKA 3ZCRA 4BFUA 1W25A 1KAGA 4IHAA 3WYBA 4D9BA 2JAXA 3U44B 10MHA 3FMFA 1KERA 1WQ3A 2YMPA 4J0DA 1P6XA 1QOPB 2LW7A 4MDFA 2JFHA 1T5OA 2ZPAA 4TVSA 1B2RA 1T91A 1G41A 3D59A 3PJEA 2QVCA 1E2IA 4CJXA 1GUDA 1VL6A 1WMEA 4DN6A 1I4DD 3ZHOA 3UHOA 3MGBA 4K8OA 1PJSA 3AERA 3BGDA 4YRMA 4YT2A 1OI4A 3ZWDA 1JU3A 2OCAA 4FI3F 3DNFA 3GMDA 4NI5A 2FG6C 3V8PA 3VPFA 4TMKA 3OX4A 1SUSA 4QSMA 2UYHA 2PRIA 3G1UA 2FPGB 5K0SA 2WLSA 5T6BA 4EDHA 1NAIA 1TVCA 4XLLA 4J3NA 2W6MA 2TMYA 4XPIA 5H4HA 2IZ6A 4V02A 3JVDA 4WV3A 2VAWA 3GZ4A 3OLVA 4TYWA 3DMGA 2PSJA 1W5AA 1XJCA 4DC1A 2GCNA 3PYLA 3CO0S 2H8GA 2SBTA 2Z2YA 4MYHA 2XCSB 4FTWA 4MICA 2X9GA 4GT1A 2H1OA 1ZC3A 3GDHA 2J3EA 1NMSA 1RI3A 1X42A 2VBGA 5AKKA 2PUCA 2AC4A 5BQ5A 3KPWA 1X86B 3O8LA 3OZUA 2IWRA 1T4DA 4CIWA 2VQEB 3TEMA 5HJ5A 1OXKB 5H3HA 1DWOA 1NXSA 4RXUA 1OX4B 3DMDA 5CUQA 1O6CA 2R62A 4UUPA 3I5MA 3QWAA 3E9EA 5EXEA 1XD9A 1W8DA 2IYRA 2NV6A 3HO6A 2FYTA 3RUFA 3MTGA 4IEEA 4A8PA 5L40A 4TS9A 1SCBA 3CUYA 1EHCA 1XUOA 4YASA 2N75A 1UDAA 3ETEA 3NVMB 3S3TA 1XRQA 4D0RA 2I66A 4NEQA 1XDSA 2IZ7A 1TF7A 3NHJA 2YKGA 1XOIA 4PQYA 5EHGA 1MO6A 1QNLA 2O5RA 3J80A 4PX2A 3NWOA 3PD1A 4WK2B 2GXSA 4GIBA 2GS9A 1G1AA 4BIMA 5D3MA 2HBRA 2PX4A 3IPXA 1I1NA 1X1AA 3N3AC 4YRRA 2RI0A 4HEQA 5IJ0A 4QOSA 5EHNA 1P7WA 1MVOA 2V4MA 3ZZ0A 1JEYB 2HYDA 5BYAA 1L5HB 4YRFA 5ICFA 2PL9A 2AR9A 3TJMA 1ZXXA 3NP9A 3OY2A 4AWBA 3GLGB 2JNWA 3PITA 4AF8A 1VYUA 4AJNA 1Z25A 4IF4A 2ZBPA 4R8SA 1LBTA 1PTJA 1E63A 3COWA 4NU0A 3SFVA 5BPHA 2EX4A 1JALA 3ROQA 3SCZA 4PG5A 2Z5VA 4CI9A 4AX4A 3INTA 5E1BA 1P5RA 3MWEA 2DCMA 2LIVA 1XDWA 4PCLA 2VHYA 1L4HA 3OZDA 4BE9A 5IASA 2IHYA 2Q3EA 1E2GA 1JH9A 1LCIA 3EMDA 2OYSA 3BFJA 3GZJA 3K35A 4XVHA 2P3SA 3U0BA 1N4DA 1ZGZA 3G9TA 3DTTA 4OJNA 1T2NA 2XIQA 2FDXA 3CSUA 1MJGM 3FW1A 3GWZA 4PNPA 5DM70 2BAGA 3W05A 4OYRA 1NUQA 3A58B 3C6BA 1WUTA 4PE5B 1FJHA 2XZOA 4BMXA 4F6CA 2FEKA 1DRVA 4HQOA 1HDIA 4WE3A 5FUYA 1NSFA 1D7AA 3WFJA 5C1BA 1D1TA 3OCZA 1DBVO 4LY9A 2RBGA 2XTJA 4OL0A 3VC2A 4HPWA 3U13A 5JAPA 3RV4A 4F92B 5JISA 1ZGCA 4D42A 2HSGA 1YB4A 2G8NA 1JAXA 2MSLA 2ID4A 4NMLA 3W5BA 1IONA 1QFSA 2DUNA 2JHPA 3FRIA 2O4UX 4NX2A 4O2RA 4NABA 2HSEA 2VRNA 2FSSA 5CXXA 1IBSA 4TRJA 1E2PA 4D81A 1MOPA 3HSSA 3R6GA 5BXQC 5A7GA 2HCBA 2OEPA 3JX9A 1P5FA 3H83A 1PDWA 1SNYA 1U90A 1DC7A 2G17A 2VT3A 2XNJA 2H2AA 4W9NA 2IX3A 1EUYA 5J2TA 2BC9A 2GJ4A 4RZXA 4GR5A 1UQTA 2PQMA 4MV0A 3SDSA 4C0BA 1E79D 4OFWA 5AOBA 4DPMA 3UJPA 1MA0A 4AY4A 1TYBE 3AR4A 4A0HA 2WKRA 3OTIA 3TLYA 3OF5A 2Z6AA 3HXKA 4BX3A 3W9UA 5IN5A 4KXMA 4RLQA 4QJ4A 2EXXA 2ONJA 6CHYA 1S3IA 4X00A 3VHXB 3BBLA 1Z6GA 2EFHB 3LGSA 4LV5B 1M8JA 5CT9A 5F2KA 4A0SA 2YRFA 5JNWA 3ZK8A 1NSTA 4TS3A 4OJKA 3AZOA 5GIPE 3OEWA 4G85A 3F97A 3TIGA 3MWYW 4OAQA 2GPJA 4P98A 1G2IA 3A6HA 4P7BA 4MS3B 4MO9A 2BJVA 1JP7A 4YJGA 1KI1A 3KCNA 3OTWA 5DOVA 4L27A 2O1WA 1ZNZA 4Q7MB 3NDIA 4QQ8A 3A11A 2B8EA 4NG5A 2XDAA 2QRVA 4OIFA 4RK6A 5GGYA 4M0DA 4XEHA 5ELLA 5ERYA 5EESA 3HUDA 3HZHA 3LXUX 3GD7A 1E6WA 4D3DA 4N5HX 1TTTA 3SVLA 1NBHA 1J9ZA 2HRDA 2BRUA 3RF7A 3HKDA 2CSUA 4U7DA 1QO0D 1R9NA 5LC1A 4B3DA 1XC7A 5J43A 4NCNA 1KU6A 1PZGA 2I4IA 4CQMB 2O7SA 3ADKA 4Z7NB 2V8BA 3I6IA 2P65A 3KKQA 4MRRA 1PI3A 3O8OB 2FPXA 3KWMA 4Z0TA 1FS6A 2PKQP 4OTZA 4DTCA 1X1RA 1EG2A 2FRDC 4X7MA 2QZ9A 1C4OA 1BWSA 1GU7A 2V98A 3EZ9A 3INNA 3KXLA 3U4MA 1BX3A 2IYUA 3A9CA 3JD0A 4XCXA 5ALFA 3L8MA 2RAPA 3IILA 4EZIA 4P4SA 1I4LD 2Y0BA 3B9RA 2HREA 5KSPA 1KZ1A 1MC5A 3KQTA 3TTYA 1U04A 1BMTA 2X8BA 4RYDA 4BRWA 2E1PA 3HJNA 2EJTA 4CDMA 5IT9A 3GPDG 1U0LA 2JHCA 3KKLA 3UT5A 3O26A 1MOSA 1S9DA 4RZHA 2B83A 2DWQA 4Q4DA 1EIWA 5EGSA 3KQLA 1ZKMA 3UWDA 2OKGA 1E4YA 2I6FA 4URFA 3IV9A 3QYFA 4KMSA 4NZ9A 4YA6A 3QI2A 4B84A 4DXDA 3AUJB 1HT1E 2Y2UA 3L7BA 5D1NA 4JI4B 1ESDA 1P77A 1YB1A 3A1VA 1PTJC 4WPGA 4BTVA 5CA0B 2OB2A 3E8MA 3N1UA 3ZDYB 1N9GA 2C2ZA 2EKPA 3NAZA 4M0EA 4OQNA 1IIRA 3DAPA 4BZWA 2BSXA 1K98A 1EVZA 1H8ED 5FHQA 5TF0A 3UMGA 4EMSA 4G1UC 1A4UA 1ZBQA 3GLKA 4LZOA 3FCXA 4FLFA 2JRLA 3P5BA 3PSAA 3I9MA 4IVPA 1L7PA 2LIPA 1ZZGA 2MMGA 3ND7A 4XX0B 1VGVA 1EFDN 2IPMA 3ZVKA 1DXQA 1OROA 1TMGE 3VC7A 2V0GA 3SSNA 2Z4RA 4GMFA 4WX2B 5CH5A 5KYGA 4B17A 1N2CB 2I99A 3HJCA 4KO8A 3SXUB 1E8DA 2GN9A 3AERB 5LYJB 1AUVA 1CR0A 1HYQA 4YAKA 4G5FA 4UDOA 3K15A 1EGHA 2V0CA 1A95A 4FN5A 4HN4B 4R5HA 3P4UA 4KE9A 1SCKA 4B3FX 4MVJI 2PX2A 2J67A 1P1HA 1G6KA 3T3DA 5IJWA 3IQDB 1XHEA 4Q93A 2A1UA 1DIGA 3OJLA 4DXHA 3ZK7A 1V71A 1CR6A 1FTSA 4QAQA 5AJXA 5EKSA 1QHYA 1JVNA 1ZM2A 3VSCA 5FOQA 5C1DA 4JMLA 4A6DA 1VJ5A 1DOZA 3MSXA 4F1WA 3JYOA 2IZ5A 2J0EA 1OC2A 1M34B 3HR4A 5A4KA 5HOEA 4DLTA 2IQ5A 4EEXA 3ANNA 3UIEA 3QELB 2MR5A 4D9HA 2D5IA 3VR6H 1AKRA 3EYWA 2VP6A 3HUUA 2QRGA 4XDHA 3WJ7A 4XYGA 4OKNA 5K8VA 1ENYA 1PL6A 3SF8B 3IALA 5L45A 3C48A 3JYHA 1NOKA 4RHYA 1GCIA 4ALMA 2HA5A 2OZPA 2YZMA 3X2SA 3U7GA 1Q92A 2HR1A 2A9KA 4GRIA 2ID8A 4B09A 2HMTA 4KSYA 3VYWA 4F06A 3IRUA 4JH0A 5CXUA 3I62A 2DPLA 2HADA 4RX1A 3HB0A 1U8AA 3QPWA 2H59A 2WVJA 4DY6A 3KETA 3ZHZA 4M86A 1BW9B 3E84A 1BJKA 1FTWA 4WY5A 1UKCA 4D9JA 2D4HA 2F4NA 4HDQB 5ICEA 4QQFA 1H8HD 2DKFA 1NBMA 1GEGA 1YGYA 4KAFA 5E1DA 4RHTA 4GEGA 2OCYC 3PV0A 3K2QA 5AQ1A 1HMYA 1RC0A 3C8DA 4FKMA 2LCFA 3O2NA 5KVSA 1UKEA 1AHNA 2A0WA 3MS2A 3II6X 4UXIA 4WXYB 3LUFA 3T9EA 3F73A 5DHUA 2OVFA 5FL7D 4DCUA 3JQRA 4ZKDA 4UUOA 2I7XA 5C80A 2OCGA 4UXJA 4MGEA 3SC2B 3B2EA 3CLRC 3D8TA 1K8XB 5E7MA 1YQWA 2HF8A 1SG0A 3PC8A 2PD6A 3PE4A 2N47A 3DWEX 4D0LB 4DLNA 2G71A 4CW7A 1G3MA 3LOQA 1WUHS 3I0NA 5T8KA 3GG2A 3RYIB 2NOAA 5L3QB 1YJ8A 1J7JA 3HGQA 5J5AA 3TOXA 3HXQA 4WVLA 2R6JA 1WO8A 2O19A 2WB2A 5KUTA 4TT8A 3TQIA 2JLSA 5BV2P 3GT0A 5FI5A 4DSZA 5REQA 3RS3A 1XROA 1ZVQA 4ES6A 2F00A 3MHPA 2JBWA 3IT3A 4G5YA 5EMNA 3HGMA 4ZO7A 3HP4A 3DT6A 5BNZA 2P6RA 1E3JA 2GCPA 3AHJA 3I9LA 1TM7E 3SIRA 3L06A 4RK4A 1FX0A 1IEVA 1EX9A 3BMNB 3TTXA 3V4ZA 2BDUA 3SICE 1BDBA 3PEFA 4NV0A 4MV8A 3HA2A 2VCEA 2WMYA 4HNSA 4KR9A 3SHFA 3ZY2A 3V5NA 2PUGA 2A0FA 2AOUB 1QZZA 2FN9A 2HH9A 2PHZA 2ZRQA 4X20A 1W46A 2IHKA 1V8ZA 5ER9A 3ZDFA 3BB4A 5L3SA 3VA7A 5HK9A 3K0FA 2C1XA 2VYCA 2AG5A 4FSHA 3UAXA 1SVNA 2Y76A 2FR8A 4DADA 1YVDA 1G0NA 3JPWA 3VYUB 1RJGA 1QF7A 4HQFA 4GGOA 4IYJA 3T1YB 3WICA 1JLHA 1NXQA 3E2MA 1G2PA 1KO4A 2FPIB 4TT3A 4KKXB 3IKMB 2PLNA 3LYHA 4IZOA 2J0QA 5K7SA 1D0VA 2ECQA 3R7FA 3TL2A 1KZ6A 2B8WA 1TTQB 1TQ2A 4X90A 3KV3O 2YL2A 4N39A 4BQRA 5IVPA 2VYNA 4B87A 3ZLJA 2POQX 2JJQA 1B8PA 3QNWA 3SJCA 4EECA 5K05A 4G0QA 4H1VA 4JJKA 4BQPA 3T3NA 2A3RA 4WKPA 3UB2A 1NBAA 4IWXA 3PUKA 4QREA 1NT4A 4QQKA 4UNSA 5GJBA 1Z5GA 3ZCTA 2G5GX 1YQQA 2FX2A 1N2XA 5EIXA 1AKYA 4LRWA 4CR7A 5J4HA 1DAIA 2F6RA 3SXPA 2ENUA 3CKLA 1W581 4MGZR 4FYVA 3DNMA 1MC8A 4KN5A 3PEYA 3RU2A 3SJ7A 1S2OA 1SBIA 1HDZA 1E6UA 1XZGA 3U5TA 5B6JA 1EYZA 1DKPA 1P2GA 2OG2A 2PMBA 1FMFA 1ZH2A 3EN0A 1DCTA 3SIXA 2A9RA 3EDRA 3AHFA 4JK3A 2W42A 3NYRA 2A5GA 1CK4A 2PUTA 4M53A 2D59A 1DBSA 2VJOA 2I34A 2CNBA 4NV3A 2PSEA 2CMHA 4OXQA 1ARZA 1F0PA 1YBVA 5JH7B 1WBDA 2WK1A 5ELXA 1R0BA 4P4SB 2G9ZA 1K2WA 5D5PA 3BL6A 3P0JA 3AIOA 5TLSA 1Z7BA 2NVBA 4NYJQ 4C4AA 2CLHB 2N1BA 4CDNA 4WNIA 2G9QA 1UFVA 3MD9A 5JYCA 4B6GA 1Y6FA 1RQRA 2ECFA 3B78A 2YQZA 3CZPA 4RD0A 4K3UA 4MW1A 1L4YA 2EJBA 4AY3A 4R8MA 2R1TB 5F1YA 1BGVA 2WD7A 3PDHA 5IBRA 2XMBA 5LP6A 2ODAA 1E8MA 1ZIXA 2SCUA 4RIHA 1C14A 1CD5A 3NHSA 4OI4A 5LXTB 1R7RA 3ZCXA 1BWRA 3DZFA 2V6BA 3Q40A 2W2KA 3A04A 2QI9C 1Z4LA 3JTEA 1G20B 4F2GA 1CVIA 1IATA 3IBSA 3WWCA 1NLUA 4DSNA 2C5BA 3SI7A 4I55A 2AQKA 3DLBA 2HN9A 3L6EA 3ENNA 1OVGA 3F3MA 1JFLA 4IUYA 4WUTA 4WFIA 1RM5A 4R2MA 1EFRA 3NFYA 2IPLA 2HA3A 3QKWA 4WLEA 1WSBA 1Y3CE 3FTNA 3O1IC 4L95C 2PVSA 3UV6A 5JO9A 3TUJC 3FIJA 4X66B 5KPJA 4RTRA 4WZBE 1NQWA 2A86A 1SBHA 3OJOA 2P4UA 4DLRA 2R1TA 1KI8A 4UMEA 3PNMA 4ERXA 3VU3A 2E18A 1X38A 2GZ1A 3OE7D 2FMTA 2HFKA 1Z0ZA 4OXXA 2G25A 4LOIA 2X5KO 3DFZA 1P1RA 2PT7A 2GZRA 2R87A 3E9RA 3KKNA 3ONVA 4LDNA 3PX3A 5F73A 5H9VA 3BILA 1N4AA 3TCXB 3EQZA 3W78A 3SG0A 1P81A 2XRMA 1MMFB 4MRNA 5EE0A 2IOFK 3NTVA 3K1ZA 2I91A 1SCNE 2X1MA 3AP1A 3D7NA 2LP4Y 3I2HA 3DCNA 1Q3TA 4ZYTA 2PFSA 3P0RA 1Y8CA 1G55A 1YE5A 1QX4A 3ZW9A 1CRZA 1JBEA 4PAOA 4ZEOA 1XTSA 2HF9A 2IDKA 4LDQA 4TZTA 4JWTA 2H9AA 3WXMA 4B4KA 4YMWA 2PRYA 4BNWA 1KEWA 3C7KA 2OFFA 1OYOA 4C4OA 3DEJA 3M5WA 3CS3A 2R96A 3CLSD 2AWNA 4NK4A 4RKWA 2H00A 5TEVA 3FLMA 1F6WA 1YI8A 2CLDX 2EP5A 3K1TA 1DAKA 3C24A 1VYHA 2Z9DA 1M6HA 1SEVA 1Y9JA 3P9YA 1FS4A 4OP1A 4UU1A 4QSHA 3VYSB 4A8JA 5CB4F 1GTMA 1RQLA 3MAAC 4KWHA 1SKYB 4NV1A 3ZVMA 1FFWA 2EWMA 1W87A 1KAOA 3FF1A 3LWZA 1Y3DE 4O29A 4RSMA 1RPTA 3FETA 5DLYA 5EPEA 2B94A 4N9WA 2NXJA 4OAPA 1MVNA 4BKMA 4BRSA 2J09A 3LBYA 4IUCS 4F3RA 4YR7A 1TF5A 1NUSA 5CDFA 3CBQA 4KPEC 2JDIA 1BGXT 1O87A 3G9XA 9MHTA 3JAWA 3IOMA 3PUZA 3FTCA 1GU0A 1HGXA 2XI4A 3ICEA 2EW8A 3GFQA 3TW8A 1R5OA 3HEBA 2W98A 4EWLA 5BN1A 3IURA 4QA9A 2W4QA 2HMWA 3KEMA 3LWBA 3P2KA 1W47A 4YLGA 2AQHA 2PJDA 3T95A 4HQRA 1NASA 5CURA 4PRLA 2IYNA 3A1DA 1Q91A 1ZPDA 2VHXA 2VJDA 3DZDA 3QHPA 1Z7WA 1ANKA 2A9JA 2R97A 2ZSEA 3DD5A 4GXRA 4HGQA 1DE0A 1DQZA 4QQRA 1E7WA 3TL3A 4BN5A 2VHCA 1SR8A 2F8SA 4HS4A 4N40A 1T35A 2Q5LA 1GZDA 1JG1A 4YGYA 2ZUUA 4MX8A 1G5IA 2HJ9A 1P3JA 4WOKA 4X7PA 1PP4A 1UBHS 1EHIA 1RQNA 2EZTA 2YV5A 3KZNA 2PWYA 3N8HA 4NHOA 1Y4AE 4PICA 5FOUA 1E9VA 3VTKA 1UMCB 4EMUA 1J25A 2Q1XA 1OLOA 1FFBA 1F2DA 3A6ZA 4MQ5A 3PJRA 1HETA 2YHBA 3BXGA 1GPH1 4G5SA 3HXMA 5I4KA 1NV8A 1WTCA 2EJUA 3G82C 2X9QA 1XFAA 3MB8A 4QD3A 5DBEX 3ZH2A 4RW0A 1RAFA 2B3DA 1FF9A 1RADA 2C4KA 4V3CA 2HHAA 3ROEA 4AD8A 1JHDA 1JHVA 2DG2A 1L0BA 3M2PA 4R2WA 4UFNA 3MT9A 2WW8A 1ADCA 1LU9A 5D84A 1GG5A 1O54A 2JGIA 3HCCA 3PGLA 3TSAA 3V8MA 4XASA 2ZWMA 4QATA 1XRJA 2ATIA 4ZYXA 5BRAA 3ET5A 3EK2A 5DULA 2NUAB 2X5OA 3RVMA 3NI2A 2O8CB 2Q9AA 1ZKDA 4FGWA 3AUUA 4DIKA 5A4JA 4WLOA 2CDBA 3VKUA 1EJ2A 3CZRA 1VSQA 1Q74A 5FO0A 1Q0ZA 1BYUA 3IT1A 3TIFA 1PN3A 4U6NA 2GASA 1K1EA 1RMTA 1RXCA 2P9BA 2ZXUA 2Y1WA 2M6RA 4EOGA 1N6LA 4ARCA 2P78A 3HR7A 3VJRA 2C9OA 2C54A 1WB6A 4CTOA 1KRWA 1M73E 1BYIA 1S1MA 3DO6A 5CB8A 2VDPB 3CZ5A 3H3XA 4PLYA 3DE4X 1K06A 2NYUA 1XTBA 3N2ZB 3TZBA 4H7HA 3DZJA 4DHEA 2HIMA 5CFQA 2B92A 3KBBA 5IF9A 1HL7A 2O3UA 4ZVOA 1GG9A 3DVRX 3TKYA 4NEHB 1OY1A 3NBUA 4LECA 4CKWA 1NT2A 2ZDQA 2RHGB 3SYNA 5I6DA 2HHJA 3K5WA 1LDGA 3OSUA 4UTZA 2GA9A 5CLIA 3TJRA 1CUBA 1MAHA 2C0QA 2I8CA 2G0NA 4LVCA 3PUYA 3WL8A 4PZUA 4I5DA 1QP7A 4EB0A 4DQXA 2FPPA 1GT91 3N2GA 2IX9A 3QVJA 1QBKC 4L07A 2WA1A 4UUNA 3AEKA 3FLAA 2FFQA 2PBLA 3QVUA 1ULZA 3WS7A 1G5TA 2E3JA 4X24A 1GUZA 4ITVA 5EE3A 1OWNA 3OMLA 4UBMA 3WK7A 4GC5A 5KOHB 2AEFA 1QG2A 4OJYA 1OH5A 1CY6A 1N2GA 3BGOS 1ZI9A 1IY1A 3CRW1 3KJEA 5DEIA 2JFBA 4HGRA 1X2EA 4ZAXA 1AN0A 1V8OA 4YRGA 4XWWA 2NZYA 3ETJA 3RODA 1HQYE 3CY6A 3GC6A 5FV4A 2OILA 3LHFA 4M8LA 1ID8A 2DBRA 5FNVA 3HCOA 2GNOA 1QCYA 3COJA 3IUSA 3MS7A 4WQMA 1XXHB 4OLAA 3COSA 4J91A 1PJCA 2H11A 1FB5A 1GSHA 1OA0A 1PQUA 4KJXA 3UV3A 5AFSA 1CUGA 5JV5A 1P60A 2XTNA 2RGGA 1ZUD1 4EG0A 4KPYA 3N70A 3MCWA 3ZWBA 5AJUA 1S1CA 1HK7A 1VE6A 1V6AA 4Q9LA 2Y4OA 4EPVA 3SE0A 1NR5A 3IP5A 2DMRA 4D6YA 4CXMA 2ZGVA 1QF9A 1SQFA 7MHTA 1J00A 2WIFA 1OX6A 1U6KA 2YIJA 4RADA 1BS9A 1VMIA 4WCFC 3ZZ1A 2QL6A 4OKIA 1NPDA 2ZBFA 4BLQA 5IJ0B 2EW2A 2R7KA 3LWNA 1DHRA 3LP5A 4U8HA 5F9FA 1Y98A 1U6IA 3C1AA 3NYQA 4RPLA 3AINA 4J0IA 5FWAA 4DC0A 1NW7A 1E5TA 3H9GA 3IEPA 1TKCA 5F1KA 1SOUA 3SVZA 4AK9A 2VHQA 4CFSA 2Q3BA 1IPHA 1ZM9A 4JEIA 2NU8A 2WDZA 4I9UA 3IQIX 5AJZA 2CVFA 4FDLA 2HDNB 1WUKS 3KHUA 2QRUA 1FP2A 3EHDA 2ZR9A 4LHWA 4PGAA 2QTBA 3L0CA 3LX8A 4GEKA 5ELMA 5AW9A 2OQIA 4DEYA 2BWJA 1E9AA 4RPHA 2DECA 2WKQA 4BP1A 3GEIA 5B4TA 1XPOA 5I01A 2RHJA 2XZPA 5J5CA 3L6RA 1PFUA 1T34A 3DFUA 2IF2A 1KS9A 1NF9A 1GARA 1P1KA 2P8JA 1CQZA 2CD9A 2W6QA 3AEQB 2IXAA 3GVCA 3RS5A 3QE9Y 3NXKA 3KXPA 5DHSA 2VYVA 1HM5A 1QGYA 2XGSA 5AKEA 3OUUA 1RCTE 3P0IA 5JUWA 5AMXA 4QO8A 4AJKA 3HJFA 5KBYA 4KZPA 2VJLA 4MI9A 2BZGA 2FEMA 2G28A 4I4TA 4CLHA 4QG7A 4BQFA 1U0BB 3H4TA 1Y48E 2HF2A 2XWJI 4EHKA 3IT2A 2Z9BA 3LIPA 3ZLUA 3PDUA 3U56A 3KU4A 2YN4A 1QMGA 4A36A 3PNPA 1VKRA 1ORIA 2M6KA 2JJ8A 1KAMA 2VR1A 1IC6A 4XE5A 2C29D 1E2BA 1DKRA 1E4VA 3BSSA 4BLRA 5MFZA 2A4MA 4U5XA 3QJ5A 1GFZA 1NP6A 3GZNA 3AJ8A 2H08A 3K20A 1UC9A 1IBRA 2H48A 4G26A 4P86A 4IOLA 4DBVO 3JZFA 3P27A 1Q7GA 4WK0B 2DC1A 3D4BA 1O0SA 1DOHA 5ALZA 1PJ3A 5J9FA 3FDIA 3NCHA 1ZCJA 4X91A 1QJCA 4W1QA 4BN0A 5EUBA 1VI2A 5KSOA 4G07A 2FW0A 1XCOA 2OORA 4E1AA 5CJ2A 2GJ9A 2WIGA 4KR2A 4IDPA 2XBMA 1CUDA 2RG1A 1XZIA 4RD3A 2H1SA 5EJ4A 1Q0LA 3R5TA 2I4TA 4G0VA 3BTOA 3CRVA 2IXTA 5GOTA 1BNCA 3AEUB 4C2TA 2RGNA 1P0CA 1KDRA 3PQ3A 1H2FA 2JZCA 1JDTA 3HUEA 3LFUA 1V5EA 4LXQA 4MA5A 3U48A 3ZD8A 2A7XA 2IYXA 2BFBB 1RYNA 4FDTA 4C5BA 4YMUA 4ZV9A 5BW5A 4US2R 5JXIA 2Y9MB 3ZU5A 5FWXB 3QKSB 1BHQ1 3DEAA 3BICA 4KU4A 1KVRA 3NX4A 5F78A 4ZEMA 4C05A 5CLHA 1TYEB 3DMTA 4J6FA 1GA4A 3LO8A 1Y89A 4J4HA 2AMVA 1FQOA 4I8DA 2MTBA 3FRJA 5DNDA 5DHAA 4C7OA 3H1PA 2X40A 4DIUA 5IDWA 5A9TA 5IF3A 5TV2A 5LMZA 4W5QA 4JYAB 3MINA 2VHWA 3NZEA 1JR3E 2GZ3A 2OGSA 4G9EA 1SXJE 4XGQA 1HZJA 1ZOPA 2Z8XA 4NONA 1IZ9A 2B1QA 3E7DA 1BHSA 1DAMA 4Q47A 1PJZA 3AL0C 2AJCA 1VE7A 3HP1A 3GRYA 3SR3A 1G64A 2P1DA 1M74A 1YR2A 4JU8A 5ALLA 1KOGA 1DJLA 3G88A 1Y81A 2XODA 4BO6A 2H07A 4RH0A 4M1SA 4F5EA 1QM5A 2EOAA 4C4YA 4FD2A 1POWA 3MT8A 3LFTA 4ZCRA 1EU1A 2BEKA 2RAVA 1OLXA 2IGBA 4UU8A 1CUSA 2WG0A 4B7UA 4DCGA 5I4IA 1GCAA 3CUUA 1TAUA 4EY4A 1B4DA 4BVHA 1KDZA 4G25A 4YAFA 5KYNA 4DG8A 3UJ9A 3GEMA 3OE7A 5TQJA 2OHFA 1TJ4A 2FY8A 2F55A 4CMJA 1N5JA 4GI5A 1LDBA 4R0VA 1DEHA 3N2YA 4PIMA 1Y1KE 3DVSX 3ZWVA 4Y2VA 1XTZA 1VHDA 3U80A 3E48A 1PDOA 1EDBA 2MYUA 4KIUA 3U9SA 3EGOA 4ODIA 4LE0A 1NVAA 3AF1A 3M6FA 3TVDA 4JC5A 5L8VA 4QDZA 4H7EA 3QKRB 5EFZA 1X7XA 3OPYB 4GRDA 1TM5E 3HA5A 4NKRA 4YMSA 3WP1B 4G81A 1VLMA 2Z1MA 2ZIXA 3VZQA 1SKAA 3NW9A 4GLLA 1EUCB 3EGEA 2YVQA 1OLSA 2A33A 5CGQB 1ORTA 5E8RA 4JBNA 3L0DA 4CQNA 3MB5A 2D0PB 1C3OA 3KJXA 1P1CA 1UK8A 3OU7A 2OY0A 5IC6A 1XJQA 4LY0A 3U3ZA 1EKXA 3MXTA 2R44A 1KPIA 1J20A 1GXSA 3WY9A 2DXIA 1SBYA 3LQ4A 3NIDB 2YYAA 3QEOA 4W1PA 5CG2A 2PPLA 2QR5A 5E2IA 2RGNC 3U09A 3P2JA 3JATA 4QXPA 1M8GA 1XXHA 3G5TA 3LTEA 1WMDA 2C78A 1QYCA 2OD7A 4ZQFA 3PP8A 1R0RE 1HDXA 3TG2A 3A0RB 2RH9B 3G68A 3EEOA 1WRBA 3A6DA 1XEXB 2I6UA 4YS6A 4BE7B 5JPCA 1Z26A 2CXPA 2IYTA 2AJBA 2R65A 3MMXA 4BLVA 1YUMA 3QG1A 4PS1A 2BZ1A 3HCEA 3C8MA 1K6XA 5B6PA 3P2OA 4RJIA 1BJTA 3GJ5A 4I1UA 1KI4A 1A9XB 4FHGA 1O95A 3PFHA 4J07A 4G1VA 4YUXA 1RQXA 3K8OE 2G0TA 4C88A 3VPDA 3GYGA 1T9ZA 4ER7A 2CCJA 1OYYA 4L08A 3OJXA 1VG8A 5B1IA 2FMFA 1ITZA 1YJAA 3A37A 5BRNA 5BXYA 1GPLA 1U02A 4V1CI 1CRPA 3EXEB 5JHHB 2Y1OA 1Z06A 3UM9A 4EJSA 1OZHA 1YRBA 3HUTA 2P6MA 4R41A 2BL4A 3FCYA 3FZEA 2XTAA 2WT4A 4HDNB 4K1LA 4G4SP 4RGYA 3T61A 1AK9A 1USUA 2BKEA 2JGRA 3FPBA 3PCTA 3WDLA 1H65A 4XD2A 1XBTA 3MBOA 5HKKA 4URWR 2GAAA 1QZTA 3TXAA 2GEUA 3IDAA 1AF4A 3I2YX 4I3GA 3CNLA 4Q05A 2PQ0A 4Z54A 5F7OA 3RQIA 2ZQZA 1QFMA 4DDHA 1Z2DA 2VJQA 2CMGA 1YONA 4IUDS 1A7KA 1NUHA 2VJMA 3PR2B 4QXRA 4CDGA 1Z0JA 2WAYA 3OFKA 5TS2A 5DCWA 4QPDA 2AYYA 5E6UB 5HKAA 1DWQA 4L7QA 5L3QA 4OVKA 1YCFA 1KEVA 4G8CA 3R5HA 1MR3F 4IWNA 1ETHA 3WHPA 5FLYA 3KKKA 1IXYA 4W5HA 3LX5A 4A10A 1KO1A 4FX5A 5T4BA 2UXCB 2BEWB 5IAGA 3DYBA 3I6MA 3VV3A 4E4RA 2BBWA 1E9DA 1IEWA 4KQ6A 4HEJA 3IRVA 4JDUA 4ZOLA 5DMXA 1LK0A 2C4VA 4IO1A 1QVRA 1J0DA 2H4FA 3JQ7B 3KVOA 3PNYA 1U0EA 4MARA 4RIIA 4UTXA 4IRXA 1C3VA 2WVHA 5LBIA 3ZXYA 1UAYA 4RKEA 3QWFA 1OAAA 2VDJA 3SKVA 1UK9A 2HTEA 3D4NA 3W5UA 3I30X 5IMSA 4OO3A 5EZ5A 1XCJA 2PSHA 2KYRA 2EC5A 1GFWA 4TRRA 1J33A 4GHWA 4KXXA 3SZ3A 3U9LA 2P9HA 4DJJA 1B6TA 3L7IA 5GY7A 2Z0MA 1CKEA 1XK6A 2G9UA 3M7IA 4DLWA 1XD2A 2JFOA 1USIA 3ZHVA 5KQLA 2IE0A 2P8SA 5CCDA 4CIBA 2O2DA 5IKOA 1T4CA 4A23A 4CM4A 1RD4A 3OZVA 2IIQA 2AH5A 3RYHB 1M72A 1YMVA 5KTSA 4BEJA 1XYGA 5AVUA 3SOPA 1S01A 2VUHB 3T06B 3UGKA 3WIVA 3JWGA 5A3JA 1CJBA 3QELA 4E1BA 2UDPA 2GN2A 1Y3IA 4BNYA 2G9RA 3CH4B 4MHSA 1E2UA 1OE0A 1SC1A 1OT5A 3EBPA 3LAWA 5D86A 1L9XA 2DZDA 4WUVA 5TPWA 1ISPA 1A3CA 1C0EA 1LZLA 1N2BA 1T2VA 2BUAA 2H1VA 2OVBA 2QTVB 2W6JD 3PTZA 5FOXA 1B76A 3L7LA 4HJXA 3G5MA 5LXTF 4FGKA 3SSOA 5CB4A 5FUWA 5HMMA 4I81A 4EI9A 2A2ZA 1Y8RB 4DKXA 1VRCA 3Q7IA 2AF4C 3I0ZA 1QYXA 4WHMA 4RY0A 4X60A 1FP7A 1GUAA 4OSOA 4R1QA 5J5VA 2C5SA 2GBFA 3G2IA 4NK5A 3NOQA 4HD8A 2GZMA 3O4FA 4TQGA 1QU2A 3FTQA 1YR3A 3TIIA 3N0XA 4ETWA 1QJ4A 4TMTA 3TQSA 2Z2IA 2ZT8A 1HEIA 3KT6A 4KHZA 1Q7BA 5AM2A 2ZSHA 3ZJUA 1IM5A 2PUVA 2H1LA 4DMCA 3O0TA 1KIMA 521PA 5LQNA 1MW9X 2W0MA 4TUYB 1JZTA 4BLWA 1VHLA 2EDAA 2NXEA 4O4HB 5ESWA 2PRKA 1DBRA 5IYZF 1R4AA 3M6WA 3FSRA 2WU4A 1LWOA 1P2SA 2VS1A 2J4DA 3C6ZA 4YQEA 4I5GA 2XBUA 3DKVA 2PKYX 3GK3A 4HY3A 1AKVA 4M0UA 4BFWA 1DAEA 1VYVA 3DO8A 5CJPA 1V3VA 2ATVA 4YXWA 4XYEA 1NJ1A 1X7GA 2IYWA 3M4JA 3N6XA 4JB3A 4TYPA 1A9TA 4OD0A 4P0TA 5EEHA 1Q0SA 4QIHA 1WHTB 1ZJYA 2C20A 1GAQA 1H42A 1NC3A 1RYZA 2GTHA 4G0YA 5CK5A 4NXNB 6PFKA 2FU5C 3KOYA 5E6SB 4GDFA 1JPVA 5EIBC 1H9BA 2BHLA 2HGSA 2J41A 2ORYA 2WNIA 2LGJA 4F11A 4N18A 3KB2A 4G3XA 4QXQA 1JEYA 5D5HA 3ZXXA 3DKPA 1O2DA 4GPD1 3I8OA 3DKIA 2P4EA 5DX0A 4LXUA 4H1WA 2WJPA 2MYTA 3AR9A 4IDNA 1NP3A 1DX4A 2HTFA 2ZUFA 3L84A 2QVGA 5D3MB 4B44A 1PT9A 2SICE 1DBQA 5I3CA 5I9IA 3E3MA 1KZHA 4JC8A 4K0RA 4N47A 3JVUA 3VAZA 3K8ZA 4L3WA 1F0KA 4OBBA 4P4LA 1DJMA 1G59A 2ZJOA 3VBCA 1PIWA 2YYSA 3E3AA 1G8SA 2I78A 3NC1C 4OKSA 1QE3A 3UWPA 3OT4A 2WTEA 3ZX4A 4CMBA 1BZYA 1SCUB 3U4AA 1RPJA 4C6TA 3KKZA 1QH8A 2ZDGA 1FNBA 3USCS 5LQCA 1OV4A 2RHMA 1ZOLA 3A4NA 3R40A 1U80A 1QYWA 3HV0A 3LYAA 1QHFA 1U65A 1EDZA 2J31A 5ERXA 4FR0A 2YC4C 5C7OO 3GUVA 3HLYA 5BSWA 4H7PA 4PRZA 1AQYA 2YMMA 2CFCA 1LD3A 1UXGA 3SQDA 5BRJA 5FPTA 1FJGB 1BE6A 4AT1A 4NZYA 4P3OA 5JCZA 5JO0A 1Z6ZA 4LCEA 3N2IA 1SEPA 5KKCA 5LOVB 3WG9A 2WPDA 3IUBA 2OLEA 2A5FA 2IZOA 5ARDA 2FEAA 1L6RA 3IR5A 4TV8A 2QV7A 4M0KA 2Q3HA 4JXZA 4OUKX 1PWZA 3QKSA 2ETXA 1O1YA 3MWGA 4KTVE 221PA 3AU9A 4R2KA 5BNFA 4WTOA 1QRSA 2F90A 5FL7A 2NW6A 2QS9A 4H4CA 1K6JA 1OI7A 1V11B 4DT1B 3Q8MA 3BDIA 1IUKA 1D6JA 1JIKA 3AEUA 2FCAA 3ED5A 5H3LA 3TLCA 5JD4A 3AQIA 1WB4A 5G0WA 4UMDA 4IBOA 4URXR 1BOFA 3HHEA 3UT0A 4NMHA 1TQHA 3ESAA 2Q0HA 5CX1A 1CZUA 3VPXA 4FIDA 5KWJA 2MMCA 3AESB 3D3EA 1A9ZA 3GD5A 1N8KA 4EG1A 1Y8ZA 2GJAA 3KVYA 5K3FB 3HZOA 1O57A 3L0YA 4G1BA 2PY6A 2EFYA 1IQUA 2ZI6A 4F9TA 4Y2SA 1M2EA 3AR7A 2DP4E 1OHHD 1QRDA 2CXNA 1EB8A 4FYYA 3H7IA 4FHCA 4R5MA 1UKAA 3E5NA 3GA0A 4OQ4A 1R4MA 4O2LA 1E2DA 3S28A 2W6PA 1CNFA 3CMCO 3D4LA 4HWGA 4BNVA 3BM5A 4B3JA 4NH4A 4PGHA 1UM8A 2ZCUA 3BE4A 3I32A 1K8ZB 1MRZA 2Q3DA 4Q00A 1B6SA 1CR1A 2JIPA 3RTEA 3X44A 4IJ5A 3U4DA 5HJEA 1UFOA 1CC1S 3QPVA 1HC7A 3BJIC 1RPZA 4S05A 5BV1A 1QVZA 4BBAA 4HMPA 1XEFA 2CL0X 2X7XA 4HTFA 4PWZA 4BKRA 1V45E 3RADC 9ABPA 3U40A 4J4TA 1V1MB 3X1MA 5JS7A 4W5RA 3TIXB 821PA 3VPAA 1QG6A 4RKQA 1TI7A 3HABA 3U3RA 3G2QA 4CTJA 4ZMSA 5C1PA 2XVAA 4GFDA 3DR3A 4FHDA 5HMLA 1XHFA 4B0PA 2XXAB 1H6DA 1IMOA 3PPIA 4PC7A 3P20A 3I6QA 1ABBA 3HN7A 1H0KA 2MSEB 1WD7A 4YO8A 2DU8A 1WU8A 1SXJD 2CVZA 5HDBB 2W90A 5TT0A 5ESXA 2R00C 4LRSB 2XE6A 3H04A 1P1JA 2VF8A 4J6EA 4LBVA 2XCOA 3A31A 4LMAA 4QHTA 2Z95A 1P9NA 2JI6A 4WKGA 3PHJA 1ML3A 4A1FA 2EZ4A 2EBUA 3AUAA 3IT0A 5CRIA 2HC9A 2ZBUA 1CQIB 4CKZA 5JU6A 3EARA 3K92A 3NXSA 1JA9A 1W1IA 3UN1A 2RSLA 2O0MA 3L4KA 3ENZA 4E5PA 5BQ3A 3UNXA 2E89A 2ID9A 3OIGA 4PLWA 1SMKA 2RGAA 4EGCB 1C41A 2SNIE 3IBYA 2GYYA 3E0QA 3BMQB 5LDDC 1PU2A 4KFTA 5AXCA 5BQPA 1YS4A 3K9FC 5B7GA 4FFNA 5HQTA 4RTLA 3L79A 4YJHA 2YNMC 1EWRA 4I46A 2I8AA 4WDQA 4WZBB 5AJTA 4ALLA 4CLRB 3TAHA 1JAHA 2BGNA 4G5QA 3E1SA 3QKIA 3ZBQA 4F38A 5A5VA 3H11A 5CW2A 3GJQA 3PNBA 4NMXB 2EF0A 2EQ5A 1XZDA 1YRHA 1E5VA 2R9VA 1I4TD 2AJ8A 2H4ZA 3VO8A 3EXHC 1VHWA 2ZYAA 5JY1A 2XUQA 1E2QA 2YTZA 5BMVB 3IAXA 1RI2A 1MGOA 4AQDA 5CMLA 2PGOA 3KAPA 3H99A 2GZAA 2P9YA 2H0AA 2HLHA 5AW8A 3ZGXA 1RP7A 3GLIA 3E2IA 4W5WA 4RTJA 4BJ3A 1Z6YA 1BXZA 1R0YA 5ALTA 1CQJA 3WGVA 7MDHA 5L4SA 1SKUA 4GMHA 2VTVA 3KDAA 3U16A 1AJEA 3L4JA 3O2JA 3FNQA 1OXXK 3NBYC 3PA6A 1NVEA 2QN2A 4PU0A 4EBBA 3JAMA 1N2HA 5A6SB 3NHRA 1QCZA 2CFTA 1OGJA 3EFOB 3CVYA 4L5AA 5DGCA 4GGPA 4OHCA 5I9SA 1GGJA 5EMJA 3AV3A 3H6HA 1OJ7A 1KRHA 3J7AC 1VFNA 1ZGGA 1V48A 3FOWA 4YP6A 1U6JA 4PGMA 5HRCA 3B1KA 1QYDA 3BPSA 3DOFA 3UA4A 3EVCA 1QH9A 3AVUA 4KMRA 1UT8A 2Z04A 3A6KA 1URPA 5CGZA 4GP9A 4ZAGA 4CI0B 1MX1A 1XZNA 2H5LA 2HX1A 4ZHQB 2BGWA 2MIIA 4L5YA 5HF9A 1N0IA 3K3PA 3ZW7A 5C53B 1Z83A 1CQJB 1G4HA 1H4QA 3QMWA 4DLVA 1XTRA 3MUFA 1NKTA 4M7RA 4R0MA 2DQSA 4KYUA 1LNSA 4FBGA 1T0BA 4Z7OB 1L7AA 4Q3CA 4EKDA 1MH1A 3FNIA 2O8VA 3TQCA 4TL8A 3W5CA 4K46A 1CVRA 5KQMA 5CLQA 1AGPA 4LJKA 4HEHA 3CZAA 4GQIA 4C5CA 4RPJA 4J29A 4C7MA 3DOEA 3VNVA 1GLGA 1NN0A 1U1DA 1VA5A 3H2SA 4LGMA 2WHRA 1NQVA 4MRSA 4RJKA 1NVGA 1PG5A 2GI4A 4RA9A 3WZMA 1E5XA 5EJAA 1Z2PX 1HT2E 4ZDIA 3K31A 1FDVA 2C0PA 4U3JB 1IFXA 1HG0A 2UYGA 3UHPA 2YYYA 4MR7A 1XQ9A 2ZB7A 4K05A 3A1SA 4J4BA 2BFDB 2ODQA 1G8AA 4P7KA 4WOPA 3TQTA 2CF5A 1UOEA 3T4EA 3ZCSA 1WXFA 1C9DB 3LRXA 4EENA 1ICEA 4H6XA 3OF2A 5AESA 1K4YA 1MA3A 2ACVA 3GROA 2I8LA 5ARBA 3KQUA 2HIHA 5AI0A 3MJCA 4YO7A 1UZUA 1CEEA 1ZOSA 1P5ZB 4KBFA 3RYIA 4CNQA 2QG4A 3EE6A 3B8HA 1VIDA 1RS0A 1XF9A 1XAHA 2VHUA 4Z3DA 4C87A 1MJGA 3A32A 2YNMA 4A0FA 3P9CA 2O2IA 1VCIA 1YVRA 5AVSA 1C8LA 4M9SA 1RJFA 4WRRA 1K8RA 3LTNC 4TQ9A 1XP5A 2QYOA 3AR5A 1ZSNA 3FDZA 1WAMA 5EMMA 1Y7LA 1V35A 1D5CA 3SBXA 3IUQA 3QY0A 1O6ZA 3DE3X 4L4UA 2REXB 1DT5A 4N54A 3CVJA 4BVBA 5HVNA 1ONPA 1YS6A 5A4MS 1ZK1A 2H2IA 1NFFA 4RY2A 4DV6B 1BKDR 2HNBA 4B3XA 1J0EA 4XPZA 1AO3A 1FMJA 2ZBGA 4D0SA 1M54A 1Y6ZA 2ZXEA 2FI1A 4LJ4A 2CHEA 4FE4A 2F8TA 4M9CA 1A04A 3CH7A 3PWTA 5JCOA 4F8JA 2OFWA 3B5IA 3KYCB 1V4NA 3ZV3A 2QG9A 4YX9A 1GPJA 1Y8QA 1KHHA 1JFTA 2JCYA 5FTJA 1I2CA 4MVJA 2XUKA 4KFCA 1DEOA 1MIOA 2Z4SA 3COZA 4MWDA 1SELA 3OT5A 4S1VA 3U3KA 3TMAA 4MP8A 1W0JA 4DNFA 4QM7A 4DE5A 1R0SA 3TBKA 1FUKA 2IP2A 3NKVA 4JJ8A 5EVCA 3PGXA 2JIOA 3GNLA 5HG0A 4B3RB 3UAZA 1LKZA 3AU8A 1FLVA 2V59A 3H4MA 4DZRA 1BMDA 1DAFA 1XL1A 1PUIA 4O4JB 2D2VA 2Y1LA 3NU1A 4AO6A 5LNK6 1XMIA 2JIDA 4KQEA 1OC4A 4YFVA 3WMRA 3E6AA 1K6EA 5C2JB 4FNMA 2JGDB 3B1ZA 1O08A 1WW8A 3FYUB 2ZRKA 2QNIA 1X3LA 121PA 1YJ5A 2B4AA 1SGWA 2Q6KA 2QYHA 3FKJA 3ADOA 1J8FA 4ND2A 4OSEA 4UJ5A 2X9LA 5CB6A 4AY6A 3WWOA 4AJ9A 3KXIA 2B3TA 3PT5A 3C3MA 1UKZA 3A2KA 4BLSA 2WSSA 2QB5A 1Z9BA 4S2EA 1WUIS 2HV8A 4B6QA 5WRFA 1GZ6A 2FSUA 1Q84A 3DV0B 3IAEA 3IVCA 4LOJA 5BWNA 5TC4A 4PTYA 4EJFA 5A6SA 3BRWD 1U1FA 5DYGA 1DFHA 1H2BA 2FSFA 2QTNA 2VHZA 3LYLA 4S1TA 1EH5A 2QX9A 3RBXA 3NIBA 4ZCLA 1XT6A 5FXMA 4TTJA 1TUGA 3IHWA 4IIDA 1GGVA 1H2YA 2P1RA 3V6LA 5M04A 1ENZA 2DHRA 1I3MA 1L4FA 3AOEA 1LPSA 2FZ5A 3AP2A 3C98A 3HVHA 4MUFA 3E58A 1ZUNB 2LKDA 2YCLA 5AM4A 2VBIA 2WLTA 3WLHA 4D57A 3SXJA 5FBZA 3OD5A 2IU0A 4R9NA 2AJLI 4IVRA 1O9HA 3EX7C 1DTWB 3SR0A 1Q77A 4YRAA 2Z6UA 3MPOA 4LHXA 4MW0A 1QGZA 3JALA 4PBTA 5EWMA 4CE6A 1T5SA 3DE2X 4FC6A 2UUOA 3L4EA 4LYYA 3DBLA 2OM6A 4QOEA 3RTGA 2JI8A 4Q1VA 2O14A 2CJPA 4EITA 1N7IA 5CNJA 2ZJZA 1FZTA 2ATCA 3RDPA 1WMSA 1BD3A 2GM9A 2YN0A 3KKMA 1E1MA 4RHFA 4WNYA 4LJ7A 5AHOA 3RE1A 3TFQA 4DZZA 4QOIA 1J97A 4KXUA 2XMQA 5HZHA 1SJ9A 1SU7A 2OZKA 3DDSA 3U3DA 4A0RA 1ONSA 2QXYA 5FBQB 3FY4A 5IDXA 1CQWA 2AMLA 5IKXA 1TKRA 1RHUA 4YRPA 2FHPA 4YDRA 3LP6A 3RCBA 4DLAA 1H9CA 1XAJA 3O94A 4W8OA 4JQYA 1ZL2A 3WGOA 4R8RA 1ZN2A 4PO3X 2ZRIA 2WJGA 1RKBA 3G13A 1Z22A 5TMBA 4C7JA 5JCOC 2BFMA 1IOLA 2PU5A 1PSZA 1T13A 1V16A 1R12A 1KSJA 3STTA 2ZWIA 3ICVA 2Z2ZA 4J0GA 1V9LA 3TOSA 4PYKA 4AMYA 5ABPA 1AT1A 3BH0A 3DZKA 1R37A 1R9JA 3K6RA 5IZ4A 1ZD4A 1WD5A 2LD4A 1QG4A 2OQ2A 4ZA2A 3BSWA 3LBAA 3HC7A 1V5GA 2ZJ8A 4RK7A 4IO0A 2O54A 1GOTA 3FHJA 3VR3A 1MKYA 3DAOA 1OZ0A 1YR9A 4O5AA 3ZDEA 2WHXA 1FDIA 4RHEA 5J4VA 4QX6A 3VR4H 2YC2C 1EMDA 2HGZA 2P0YA 4OH7A 2E21A 4HXEB 5IABA 5AO9A 1GHTA 1VJDA 2DT5A 4ZOBA 3R7SA 1M34E 3MUEA 5GV7A 5MHTA 4FZVA 1Z18A 3LT2A 2BFBA 3P9ZA 2I2AA 4FW9A 1M1YA 1RABA 2CFRA 5FLKA 5T41A 5K8IA 4ZT5A 3IPRA 1D2AA 3UC9A 4HLNA 2A0UA 5FPHA 1WA5A 3NUZA 1MNQA 3U4QB 3R44A