3PF9A

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
total genus 88
structure length 251
sequence length 251
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pf9A00
1MT3A 1F8UA 2C5GA 5K3FB 4DNPA 3G0CA 2VJDA 2XB6A 3DLTA 1N5RA 1IVYA 3V9AA 5JAUA 5D3ZA 2WU4A 4FKBA 4H0CA 4KACA 1MU0A 2E3JA 5JASA 1IZ8A 4U2BA 3I2HA 4AN0A 5ALTA 4GXNA 1Q84A 2OPHA 5K3AA 3BDVA 2HHAA 2DHCA 5ALZA 3N2ZB 2WFMA 3WWOA 4K6HA 1UKBA 4MJ3A 1ETHA 5J3JA 1IUPA 5AKXA 2I3ZA 2DHEA 3VJKA 2Q0XA 1I6WA 2PPLA 4TVKA 3VJMA 3M3DA 1XRNA 5HK8A 1THTA 4O08A 4F5ZA 1O6FA 1ZD2P 1T4MA 2XUOA 2QT9A 2H7XA 1EA5A 3HC7A 2Y2VA 4F60A 3WKEA 1CEXA 4BRZA 1TQHA 4Y2VA 4DM7A 2BCEA 4W1PA 3GFFA 2UZ0A 4EY4A 4GLBA 1XROA 4UFPA 5T4EA 3ESCA 1PJAA 4ETWA 4H7EA 4OCZA 1LPNA 4Q3LA 4Y2YA 5CW2A 5ALPA 5AHXA 1QZ3A 1VZ2A 3FYUC 1R9NA 2W6CX 2RHTA 2WHPB 2G5TA 3V48A 3A2NA 4E11A 1CUJA 5AKIA 4Y7DA 1U2EA 1ZD3A 5LKRA 2WIJA 1VZ3A 3WK7A 5YASA 4ZV7A 4AB1A 3R3UA 2QZPA 1TCCA 4B9EA 2VT7A 1EB8A 2XLBA 5DTJA 1ZJ5A 1EVQA 4ZWNA 4QDZA 3STXA 3P2MA 2J3QA 1GPLA 4J0JA 3QM1A 3WL6A 1TRHA 4RNCA 4AO8A 2HU5A 1YR2A 3C6ZA 3JYHA 3SWWA 3QITA 2D5LA 5ALFA 3VKFA 2VAXA 1QTIA 1O6GA 3WL8A 4GEGA 3TJMA 1BRTA 5AKLA 5DWDA 3H2GA 1EXWA 4BTLA 2HFJA 4B85A 2PVSA 4LXHA 3DQZA 2Z3ZA 2XUPA 5EI5A 4QWMA 4C01A 3B5EA 1XKTA 5AIBA 2CUTA 3VVMA 1G42A 3EQ9A 4KE9A 1G5FA 4HVTA 1EDBA 1QGED 4FMPA 3C5VA 2GBCA 4M0EA 5JZ9A 4ZGBA 4AX4A 5HF5A 4QDUA 1YASA 1GPNA 5AI8A 5BWBA 3PF9A 4BP8A 1QE3A 3IIIA 4HZGA 3A70A 1HDEA 4G5XA 2XE4A 3D7RA 1H2XA 3HI4A 1R3DA 3I2IA 1D07A 2RONA 1YCDA 3HJUA 2OGSA 2HFKA 4PSCA 3O4GA 1DINA 4CCWA 3G9XA 4XIIA 3DYIA 5E4YA 3F96A 1YSCA 2X76A 3DS8A 1TIBA 5FDFA 3IVMA 1AUOA 1BN7A 4QA9A 1IUNA 4L0CA 3D2CA 3OURA 4BDTA 1CUUA 3VDXA 3BWXA 2XMDA 3R41A 4Y2TA 2XUHA 3FOBA 4IO0A 2XT0A 1VOTA 4X6XA 4AQDA 4B82A 4EY7A 4Y2XA 2XMZA 1IUOA 2DQYA 2WG1A 1QIIA 3OC0A 4UBOA 4X95A 1FFDA 3RLIA 1CUGA 5AKZA 1TKRA 5EHQA 1W52X 1EDEA 1XZLA 1YB6A 3LP5A 1ZGCA 3HSSA 2ROQA 5A62A 2ZYRA 3DKRA 5DYTA 1FFCA 1XZJA 2QOEA 4DTCA 4UHHA 1LPSA 4TPKA 2G63A 1GQSA 1X2EA 4U2DA 3FLBA 1XRPA 3F8SA 2HA4A 4HS9A 3LS2A 4G4GA 4B0OA 2WIGA 2ZJFA 1WCYA 5HQ3A 2B20A 5ALOA 1AGYA 3QPAA 4BCBA 3H18A 2BJHA 1AKNA 2C7BA 3STYA 3I6YA 1QONA 4GW3A 5E4JA 5FOQA 1T2NA 3T52A 1E3QA 2JGJA 4L3WA 2QMQA 3W06A 1EK2A 2XMCA 3I2KA 5LIPA 2WIDA 3QH4A 3SK0A 1FFAA 1CUHA 5AOCA 3E3AA 3H17A 1ZI8A 1USWA 1EI9A 4OPMA 2WFLB 4ZI5A 1LNSA 1KEZA 3PF8A 3QPDA 2JBWA 4MEAA 3VISA 4YK7A 2HA3A 3FYTA 4GI1A 1QO9A 4D9JA 4Q3OA 5CT4A 5LZ2A 4C6HA 2XMSA 1ZJ4A 4K6GA 1YA4A 3I1YA 2JGKA 5KWIA 4H77A 1R4ZA 1XZMA 2WU3A 1ZD4A 4X00A 1AMNA 2OGZA 3F97A 2HA2A 4Y2SA 4MEBA 4PV7A 1UT6A 5IVKA 2HRRA 3O4HA 3UUFA 4HXGA 1JKMA 5CT5A 5T4BA 1AQLA 3H2JA 2VJBA 3W2TA 2Y6UA 4CG1A 3ZLTA 1XZAA 1L7AA 4UBMA 4DSAA 1UK7A 1CVLA 1G66A 4ZRDA 1QIHA 1MX9A 1UFOA 5E4TA 3I2GA 1QIDA 3H04A 3QYJA 5AI0A 4DNOA 2FUKA 4K6KA 4JEIA 4MQMA 4H7KA 2QVBA 5D6OA 4H7JA 2AJBA 5AO9A 3U1TA 1UK6A 4DSZA 2O2GA 2QKYA 1BEZA 4BE4A 1MTZA 3HABA 1LBTA 4QZVA 3IA2A 2Z8ZA 3HXKA 3C6BA 1PV1A 1ORWA 4J0KA 4OSEA 1H2WA 4W1SA 5C81A 3DJYA 3FYUA 4HTAA 1DWOA 3WIBA 4CG3A 1CRLA 3WLAA 5JANA 3WK9A 3FSGA 1ZIYA 2RHWA 1A8QA 5BWCA 3IUJA 1JI3A 4GWLA 2WUFA 3WWPA 3GUUA 3QVMA 3OPMA 3H2HA 3ZLVA 1X2BA 4BAUA 3CCBA 4CIAA 1EHYA 2ZVDA 2GYUA 3ANSA 3IUMA 3H1BA 4GHWA 4AMYA 1JMYA 4DMKA 4UHBA 1SOMA 1WOMA 4UPDA 4H18A 3IURA 1MJ5A 5AK4A 3H1AA 4P9NA 4XWGA 4Q05A 3ED1A 4OD0A 3FVRA 4U2GA 2JIDA 2ES4A 2PU7A 5AK5A 1WHTA 4AMZA 3B3QA 1DT5A 2HA5A 1JFRA 3QBJA 1J1IA 3JWEA 3L1IA 3TRDA 2H1IA 4BZWA 4V2IA 5DTIA 2PKYX 4H7IA 2DHDA 5DNWA 5HF8A 5FUMA 2Y2UA 5ALGA 5CMLA 3GZJA 4G9EA 2XI4A 3WKCA 1LPBB 2I3DA 2WSLA 5HCUA 3WZMA 2BGNA 3KOOA 4Y2RA 1OXMA 3HYSA 1CUAA 3RKSA 5T4FA 1XZEA 3KXPA 2Z8XA 1E8MA 5ALLA 3O0DA 5AKJA 4M0MA 3FCXA 3WK4A 4G4JA 5F4ZA 4LIPD 2WM2A 3WYDA 4X91A 1X70A 5ALSA 4J0DA 5FP0A 3NWOA 1JT2A 3G0DA 3C5WP 3KD2A 2I78A 1K5PA 4Q3KA 5JATA 5IKXA 1OCEA 4M0FA 1CLEA 1H2ZA 2XDWA 4J03A 2EEPA 5FKJA 3WKAA 5K3DA 1H2YA 4Y2UA 2B4KA 3WA7A 1LPOA 2PSFA 4MYDA 2HRQA 4N8SA 1THGA 3I6ZA 1E8NA 1ACJA 1ODSA 1CV2A 1JJIA 1B6GA 4YPVA 3BJMA 4WDRA 4JYMA 1R1DA 4LXIA 4MWTA 3O9VA 2BUCA 1DQZA 4LXGA 4GDMA 3WYNA 1HPLA 5AP9A 1F0NA 3D2BA 3M82A 5JAPA 4QLOA 2BKLA 2C0QA 2IIVA 2Z5GA 1UOOA 1TCAA 1K4YA 3ESBA 4DMCA 2BGRA 5CXUA 2WJ4A 1IMJA 4X90A 5SYMA 3EIOA 1Y37A 4NMWA 2PUJA 3I2JA 5ALRA 3SX4A 4TGLA 4KE7A 5AH0A 1W76A 2GBIA 1JU3A 1QLWA 3MGAA 4MXDA 1SCKA 5HQ3B 1CUFA 4BDSA 1CR6A 5AM5A 5FLKA 1FFBA 2PSHA 3PFCA 2AJLI 5D3KA 1U8EA 2WG2A 4DLNA 4JYPA 1XZBA 4HAIA 1QIMA 3H2IA 1R9MA 2WQZA 2GBFA 4OB8A 4Q82A 1XZFA 2YASA 2WTMA 5KREA 1LBSA 4YX9A 4UFOA 5JADA 4BVLA 4B9AA 1J06A 2XQIA 1EH5A 3IUQA 1MX5A 2XMRA 3F9CA 5K3CA 3C45A 5JD4A 3ZPXA 1CUCA 1CUIA 1EDDA 2ZYIA 3WJ1A 4UHFA 4DGQA 5AKHA 2VJCA 3W9UA 4KRYA 1E89A 1CUWA 1UKAA 5LZ8A 4UBNA 5ALVA 2XMGA 2I03A 2RIPA 5FXMA 1ODCA 1ODTC 3WJ2A 4G1FA 3BXPA 3OG9A 3HRHA 4FDMA 1XLVA 3R40A 1LZKA 4PO3X 3G9UA 2XUFA 1BU8A 1Y7HA 3G9TA 3CN9A 3DYVA 4BBZA 2FJPA 3D5EA 2C58A 3V1NA 4RE5A 2GBGA 2QJWA 3G0BA 3AZOA 1PFQA 1W4LA 5JD6A 2HDWA 3FCYA 5A7GA 3L1JA 4PNZA 1ZGBA 4EHBA 1AX9A 1BN6A 3IULA 2X5XA 1RYYA 1N8SA 5K3FA 1QIJA 4XJVA 5IH7A 3WI7A 3G0IA 1F0PA 5KWJA 2PX6A 4H35A 4BAGA 4FLMA 1DQYA 3ICVA 2PM8A 5ALNA 4JNCA 1GXSA 3FAKA 1RP1A 4HRYA 1G4HA 3ESAA 1XRMA 3QZUA 1W75A 4INZA 2O2HA 1XQXA 4EZIA 4ZXFA 2JGFA 1XQYA 5A6VA 1P0MA 4W9RA 2XUGA 2GZSA 3M83A 3DL4A 5FV4A 1EK1A 4XVCA 3PFBA 4HXEB 2OG1A 3ZWQA 1E66A 2WHRA 1TAHA 3PUHA 2H7CA 1LZLA 1MAAA 3FYUB 3QMVA 5JAOA 4UHDA 3HACA 5CBKA 2B61A 5T4HA 4G8DA 5I8PA 1R50A 3O9MA 4H7DA 5JALA 5AIAA 2ACKA 4JH0A 2QUAA 5JYCA 5AI5A 3UMJA 2JGLA 2X8BA 2HA0A 4WDQA 3AJAA 1XFDA 5C8XA 3X3HA 4IH4A 2DR0A 2FX5A 5LZ4A 3R3YA 4U2CA 2QR5A 3R3XA 4BTVA 3WWDA 1CUDA 4WY8A 4AN1A 1J07A 2WHPA 1FFEA 3CCCA 3PDCA 2OXEA 4MQLA 1EB9A 5ALEA 4G8BA 3C70A 1GZ7A 1MX1A 3ILSA 3E0XA 1QFMA 3WIOA 5EFZA 3AIKA 2C5FA 3O95A 5AM1A 4LYDA 2XLCA 3V1KA 1VJ5A 3C6YA 5FPQA 5A71A 2BAGA 3OTQA 4H7FA 2BFNA 4BVKA 3CXUA 4X6YA 4KAJA 1QTRA 2J4FA 1YA8A 3R3VA 1N1MA 3HLKA 1YS1X 1LPPA 3STVA 5AKKA 2C0PA 3T4UA 4PSUA 4X7BA 2VEOA 1CUXA 2VAVA 3STTA 4DIUA 3E4DA 4GBGA 2HU7A 4W1QA 4U2EA 2WTNA 1A7UA 3R3WA 5AOAA 1IZ7A 1QIEA 1XZIA 3EQ8A 4I4CA 1M33A 1HKHA 1Y7IA 2J4CA 3STWA 2QRUA 3MVEA 1A8SA 1K63A 2WUEA 3H0CA 4Y2QA 5I9IA 4PSDA 2WJ3A 1GGVA 4CCYA 4IQ4A 2RGUA 2W22A 3DD5A 2CJPA 3FLEA 1UOQA 4X93A 2LIPA 3S2ZA 5CT8A 2NW6A 1QO7A 4B83A 4PF1A 4J0IA 4N8EA 2VA9A 2XQGA 5ALIA 5AKGA 1S8OA 3MUNA 4BRSA 3AZQA 3LCRA 1JMKC 1QIKA 4FHZA 2RI6A 4J0HA 4N8DA 4E46A 5CRIA 5DJ5A 2C4HA 1L7RA 1HLGA 3DDUA 2OAEA 3IBTA 3FNBA 1UK8A 5DYWA 5JD5A 2XUDA 4LKOA 3W9BA 5AKYA 4X94A 5CT9A 1BCSA 4KJXA 1U65A 3H19A 2AJ8A 4QNNA 1CUEA 3WK6A 1LLFA 4ARAA 1XZGA 4C4XA 5AKEA 2PU5A 5EGNA 4EY5A 2B9VA 2XUKA 2O7VA 4QE3A 3ZLUA 1XZHA 4Y9SA 4KAFA 4KE8A 5CTAA 1GKKA 1XZKA 5LZ5A 3WK8A 3S8YA 4Y2JA 1ISPA 4FFWA 4A5SA 1SCIA 4WCVA 2HM7A 3QMWA 3FLAA 2OLEA 5ISMA 4QLAA 1NU8A 4E14A 2BUBA 2HL6A 5SYNA 2CMFA 5K3BA 2XUIA 4L72A 5ALKA 2CZQA 2CB9A 3RM3A 3V1LA 1DT3A 2WIKA 4FNGA 4Z49A 3Q0TA 1TCBA 1ZI9A 1MPXA 4X3CA 4FLFA 2HA6A 2AJDA 2RAUA 2VTVA 3PI6A 3AIMA 4X6UA 1FSSA 1UXOA 1XQVA 4F0JA 4DMHA 5IVHA 4BC1A 3G0GA 2J3DA 2ZSIA 2R8BA 2OCIA 1W1IA 4BYMA 4UUQA 3IDAA 4BB0A 5CH3A 1SCQA 4W63A 1C7JA 1CQZA 1VA5A 1Q0ZA 1UKCA 2Y1KA 4MWSA 4S0XA 2WLSA 3D3NA 2VQ6A 4KRXA 1GQRA 3DNMA 4LYEA 2XUQA 4AO7A 3HZOA 4WFJA 1LPAB 1CUZA 3CN7A 3WL7A 1KU6A 4EA6A 5ALQA 4B84A 4QDOA 1CUBA 5KBYA 5AM4A 4DNQA 4G9GA 3KWFA 5ALWA 2OCKA 1XLUA 3JW8A 3AFIA 1HQDA 3QMMA 4OU4A 3BE8A 4G8CA 5AM0A 1ZIXA 4E15A 1SFRA 1JU4A 2OCGA 3W04A 1GT6A 4I19A 1JJFA 1MNQA 1WPXA 5ALUA 3C87A 3Q8WA 5ALMA 4QDXA 3WK5A 2AJCA 3HEAA 4UBLA 2DSNA 4CI9A 2QS9A 1XLWA 3PE6A 1E5TA 4B7ZA 3DOIA 1WB6A 1XRRA 2XMBA 4FBMA 5AM2A 4X97A 4UHCA 5LP1A 4XX1A 3C8HA 3UUEA 1U4NA 5AOBA 3SC2A 1WM1A 3A2MA 1AURA 4FLEA 3W05A 4N5IX 1A8UA 3OM8A 3TEJA 3K2IA 4HXFB 2PSEA 4J0GA 4KR0A 1YAJA 5EHXA 3AILA 1EX9A 1ZD5A 3I1IA 4Q34A 3WWCA 2ONCA 5EHNA 4C89A 1QIGA 2BUAA 4B6GA 5IVIA 3K9BA 3WZLA 1WHSA 1VXRA 4J7AA 4AXBA 1MNAA 2QUBA 4KAAA 1Q83A 3YASA 4K2AA 2ZYSA 2JEZA 1MN6A 5EHZA 2Y6VA 4EB0A 4I3FA 4AZ0A 2WUDA 2CKMA 4IHAA 1H23A 2XQFA 5C7YA 1L7QA 2JF0A 3R3ZA 1DTEA 1DU4A 1NU6A 3QPCA 4BAZA 2YXPX 5IVDA 3BDIA 2O7RA 4FTWA 5DLPA 2OCLA 5FPPA 2WKWA 1A88A 2PSJA 4W1RA 3NOXA 5EIHA 2AXEA 1P0IA 1RWQA 1VKHA 3KWJA 5DYYA 3A2LA 3E1GA 1HBJA 5AJHA 4B80A 3MUOA 2WHQA 1GKLA 4C4YA 3EF3A 4L9AA 4RPCA 3LLCA 1F6WA 4JUIA 1AZWA 1CPYA 3RK4A 4ITVA 2XQKA 4J0CA 4WJLA 5LLSA 2XQJA 1VE6A 2WILA 4UFNA 2GYVA 3L1HA 2FJ0A 4J3JA 5DNUA 2P8SA 3LIPA 2ZSHA 3NGMA 4CCYB 4BVJA 3ESDA 4WFKA 1QOZA 4RGYA 4KYVA 4CG2A 5A2GA 1XZDA 2PBLA 2VATA 2O2IA 3I6MA 3FVTA 1JJBA 3WA6A 1AC5A 7YASA 4P93A 1ZI6A 5BOVA 4OB7A 4A23A 3VJLA 3R0VA 3STUA 5CH8A 2OQVA 1VLQA 1W6RA 2ORYA 3ZV7A 1QJ4A 4BZZA 4K5QA 5A7FA 2QM0A 4DYHA 1N5MA 3AUKA 3ANTA 2YYSA 1K8QA 1XZCA 5AI9A 3I2FA 4QWWA 5CT6A 4BC0A 6YASA 2PL5A 3K6KA 2VSQA 4KE6A 4FFVA 4EY6A 2XMQA 1KU0A 4ZV9A 2ZYHA 4OUKX 1NX9A 2VF2A 2WFZA 3DKKA 4NS4A 1C7IA 3WQHA 5LZ7A 2JEYA 2DFPA 5CH5A 4YASA 1MAHA 2WG0A 3AZPA 4BE9A 4ZREA 1DWPA 4OB6A 2V98A 1ZICA 3F67A 4EY8A 4UBIA 5LKAA 4X92A 3LIIA 1YB7A 4FWBA 3DEAA 3D2AA 4PQEA 3BIWA 4Y2PA 2H9YA 2Z3WA 2HU8A 4A16A 3WMRA 2CEKA 3KSRA 4C88A 3F98A 4FNMA 2HADA 1OILA 2HA7A 4KEAA 3DL7A 3WWEA 5JZBA 5K3EA 2EDAA 3C6XA 3H2KA 4BCDA 4N5HX 5AK6A 2OQIA 3G8YA 4G4IA 4BATA 5HKBA 4ROTA 5A7HA 1QFSA 5CURA 2DCMA 3PICA 3FSGD 3O4JA 1LPMA 3B12A 3ICWA 4F21A 2YH2A 3G7NA 4IH9A 5JZSA 3GBSA 3M81A 2JGIA 1BS9A 3TGLA 1ACLA 2VT6A 3V1MA 1UZAA 5HKAA 4FBLA 5ALDA 1QIFA 1CQWA 1TK3A 3D59A 3BL8A 2OGTA 4NZZA 4EBBA 2QXUA 1LGYA 5C8VA 5AM3A 1MO2A 4BP9A 3FWHA 1UWCA 1Q0RA 2IX9A 2G5PA 3EBLA 2QJRA 2JGEA 3BF7A 3IUNA 4OU5A 2EDCA 4BCCA 2ZJ7A 1CUYA 1BE0A 4C87A 4H7HA 3EQ7A 5C8ZA 1P0QA 4P08A 1CIJA 5EIEA 1CUSA 5HK9A 3KDAA 1EVEA 5AI6A 1YS2X 2R11A 2GYWA 3ZI7A 2PSDA 5AI4A 3BJRA 4X71A 1XQWA 1K6EA 3NUZA 2WJ6A 4X85A 4OYYA 2VJAA 5ESRA 5I7UA 3G02A 4CFSA 2K2QB 5ALXA 3WL5A 1UK9A 2H7YA 2XUJA 1CFJA 2QTBA 3GELA 5H3HA 1ORVA 2CBGA 1VE7A 4C4ZA 3WKBA 5HF6A 5LZ9A 2QXTA 2OAGA 4QDTA 2ZJ6A 5LYYA 5JAHA 1SC9A 1R88A 2JGMA 5FRDA 2V9ZA 3O4IA 4Q1VA 4AZ3A 5D7BA 4UBKA 1FJ2A 4P92A 4GECA 1VA4A 3U0VA 5AK3A 4B0PA 1XRQA 4MYSA 5JIBA 4QEKA 4NVRA 1H22A 3DCNA 3GROA 5HZGA 2XUAA 2V97A 5HF9A 1ZOIA 4HRXA 3BIXA 3VVLA 5K5EA 2D0DA 4IH1A 3WKDA 1XKLA 1DWQA 3D0KA 1EINA 1GPKA 4ARBA 4WY5A 5ALYA 2PUHA 4B81A 5ALHA 3N0TA 3DOHA 4U2FA 5DNVA 1HL7A 3FBWA 1VXOA 3C8DA 3IB3A 2WUGA 5AICA 4DNFA 2ACEA 1DX4A 2IITA 1C4XA 5EIAA 1BEEA 2V96A 4FOLA 1WB4A 3VXKA 3A6ZA 1UOPA 1J2EA 5ALJA 3AINA 1E8DA 3AIOA 1B41A 1XRLA 2DQZA 2GZRA 3BF8A 5JARA 3I28A 5E2IA 3G9ZA 4OYLA 4AO6A 2ECFA 4DMFA 1WB5A 2G4LA 5HFNA 1P0PA 3PUIA 1BCRA 3C43A 1Z68A 3D4LA 3RARA 2HIHA 4PW0A 3GA7A 1BROA 4RE6A 4CIBA 1YAHA 1DX6A 3OOSA 2WIFA 1WPRA 5CXXA 4UHEA 4UBJA 4WFIA 4EUSA 1CUVA 2WFLA 5HFAA 5BV7A 4LHEA
chains in the Genus database with same CATH superfamily
1ZEJA 4KXYA 1MT3A 2FJUA 2NADA 2C5GA 3C5HA 1RHUA 4P80A 5THKA 2QGNA 3U4HA 3CKMA 4ALLA 2X6RA 1UEXC 4DNPA 5B4UA 2QTLA 2PZEA 2DQ4A 2XB6A 3I9OA 3NHJA 4DIEA 3J81A 3DLTA 3ORRA 1N5RA 2FKNA 1M1YA 5EXTA 4IIXA 1TM1E 1ZMBA 3JQ6A 1PQPA 4OEHA 2ZB4A 3PQCA 2XA1A 4Y6SA 5JAUA 5KKNB 3JAWA 1RM4A 3RWBA 2EXXA 4Q47A 1P29A 1K5DA 5DNAA 3D3EA 5U4QA 4D8WA 4KACA 1M6NA 4AY4A 1SU4A 1NE2A 1NYRA 3KCNA 3V55A 4B6SA 5CFMA 4DXAA 4F96A 3BQNB 3GP8A 5KYYB 2PWBA 4HYQA 2XRFA 4YQEA 1JHDA 3TOXA 3THXA 2DKFA 2QTCA 1V37A 1Z0JA 3EFBA 4BZXA 1Y1KE 2VUHB 4AN0A 5ULLA 2FOIA 4OX9B 2NOAA 1NF8A 1T10A 2C98A 3S2GA 2GCEA 1QGOA 4URFA 4UM9B 4XGNA 1H8HD 3BDVA 3KXIA 1G6KA 3UW3A 4EEKA 5LSAA 3LY9A 3DLHA 4X5OA 1VBKA 3L0CA 4WA8A 2ZW9A 3J80A 2NP7A 5IKEA 2YHAA 4RIFA 2M98A 2BEWA 4Z3DA 5DGHA 1ZOOA 2YY5A 3RYIA 2X3YA 3M34A 1M8PA 1IIRA 3PXBA 1KI8A 1KO8A 1UH5A 4Q93A 3T12A 2EJTA 4G5QA 3PNBA 1P2FA 3ENVA 5T57A 2HSEA 5AKXA 4Z4HA 1AUQA 2RHRA 3I32A 4WCFC 4NXMB 3DO6A 3VJKA 1E98A 1TM7E 2D1YA 2PPLA 4F5WA 4F71A 1RCTE 1IN4A 4JXXA 4ITUA 1TJ3A 1EFTA 1M74A 1THTA 2ZYUX 4FEAA 4X7PA 2P2NA 2YMPA 2JVIA 1ZD2P 1T4MA 1LS1A 2RBEA 2XUOA 3EQZA 4DUGA 4G0YA 3IVRA 4KQFA 2QT9A 4U63A 5EJEA 1QVVA 2JLWA 3WKEA 1NBEA 1DS6A 1YZVA 1QVAA 2DJIA 2NO0A 3B13B 3B60A 3G0OA 1OFIA 4NBRA 1TQHA 3ZZUA 2XCTB 4DV3B 3DLPX 1FXUA 3C4VA 1Z6PA 3EPPA 4DM7A 1ZIOA 1XEXA 2VDJA 2BCEA 3QJ5A 1XJ0A 3HRIA 2Y27A 4P6VF 4WVFA 4OKIA 5G02A 4GLBA 1SEVA 2P77A 3LO8A 4HFJA 3UV3A 2QXYA 3AR2A 1HG1A 4PIPA 1U0TA 2H92A 2W6IA 3EVDA 3OFNA 4UFPA 3AF5A 3W6UA 3EGOA 1E9RA 1K9VF 1ZN7A 4OAPA 5EC8A 5AUPB 4J1SA 3HJBA 1PJAA 4GR5A 5AHOA 4EHDA 2WYOA 1NLYA 3DT8A 4H7EA 1LPNA 2NU6B 4Q3LA 4Y2YA 5ALPA 3G5MA 4I9GA 1T4CA 1M0EA 1AQYA 3PBKA 3PITA 5CBPA 2FMTA 2I3AA 2PCJA 3Q9NA 1BSVA 2GTIA 2HUPA 5EESA 3AX6A 3SE7A 1R4NB 1R9NA 3NWEA 1RZRD 2FPPB 4FSDA 1PGQA 4MI6A 2G5TA 4Q15A 3EYAA 3EXHA 1T5LA 2OCYC 3K9NA 4NCJA 3V48A 2SCUA 4A92A 1GZ5A 1NVWQ 4P3NA 1MVLA 2BEUB 5E6RA 2YX1A 1WIWA 3T54A 8OHMA 2CXXA 3PA6A 3K05A 4QYSA 4LOJA 2Q46A 5AKIA 4U7DA 3JX9A 2DR2A 4Y7DA 1A27A 3LWBA 3PEEA 3D8HA 1ZD3A 3W0LB 4EHFA 1W94A 4IIFA 3WK7A 4LPSA 3ITDA 5YASA 3FSEA 4OGKA 3HJGA 3IE0A 1VI2A 3PNMA 4PC2A 2VF8A 4UOEA 3FWNA 1KGSA 3LHDA 1BO6A 2R9VA 3SD7A 2R86A 1YE8A 3FGZA 3KKLA 1NMSA 2FMUA 4IJUA 4NR0A 3WNBA 5KVAA 2VSXA 1GQOA 2VT7A 2GHIA 2WKPA 4OSOA 4R1PA 5JVDF 1J09A 2XGJA 2XLBA 5BUQA 1XBTA 1GPUA 3D8TA 5DFAA 4JEMA 1VJ0A 1OXKB 2DAPA 1WQ1R 2AZMA 2C5SA 2ZT6A 2GBPA 3GFOA 1CY0A 2I8LA 1PSDA 2PWPA 3K73O 1RYEA 3PL5A 4M8NE 1C7ZA 4Q18A 4WUTA 5FLYA 2PMDA 3P2MA 5C1PA 5LQMA 4WLEA 5LXTF 3QEOA 2L82A 4HUTA 2CVOA 4XRGA 5JUWA 1QK3A 3D1VA 5BN3A 4FS8A 3UV6A 4AMGA 2GFQA 3ESXA 3PPVA 4B4OA 3QFFA 3WL6A 3HXPA 3N0VA 121PA 1TRHA 1BVYF 2JAXA 4RNCA 3S2FA 5JQGA 3B9RA 1WW3A 4BWVA 4QUEA 1YR2A 5BNWA 1IZ9A 2AB0A 2D1TA 2ZRDA 3SSAA 5BNIA 1LVUA 4RVOA 4UE6A 3E35A 2IH2A 2GAJA 1XVIA 3QLUC 5IC6A 1JKJB 2AR0A 4RS4A 1KVUA 4FUQA 1JDBC 1UWLA 1A5AB 1KMCA 5ALFA 1MJGM 4Q5IA 2EIHA 5KYXB 3ZUPA 3VKFA 1LV8A 4MVCA 4QAQA 2YZNA 4MKRA 3V4VB 3WB9A 2ZEJA 1I1NA 1O6GA 2ABWA 1XRSB 3WL8A 4XWKA 4LF7B 1MKYA 4U5QA 1ZUD1 3A6EA 1AIPA 3HJFA 4P54A 3OQHA 3H2GA 3GD5A 5DWDA 1E9DA 3SDSA 3A25A 4MV0A 5E3HA 2IGBA 2HFJA 3OFKA 3Q7TA 4LYJA 4PZDA 4IHKA 1GGEA 1PO7A 1Y8RA 2QT1A 3CRNA 2X9QA 1E2QA 4AL4A 5FORA 4P4NA 4EQ6A 3BUSA 5HHTA 2D62A 2WJPA 3NH6A 4IG4A 1ZP6A 1ADFA 2ZJ4A 3CM0A 3MT9A 4AZVA 1I5RA 3RRMA 4I9UA 1PQWA 1N4DA 3NCHA 3B5EA 1Y7PA 2H5JA 3NANA 1ECBA 3DLAA 4TQ9A 1DQSA 1ZWKA 5CJPA 3THYB 3K1JA 2YL2A 1DFGA 2IUFA 5JMPA 4OO3A 1J1ZA 3AQIA 4JR2A 1GL7A 1R0ZA 4EUFA 2ZUDA 2WYHA 4HVTA 1Q1BA 5DO9A 3ZK9A 2WVHA 5AT1A 4DJ5X 5I9SA 4ESHA 1B8OA 5CVCA 5AJYA 4AMBA 3LM8A 5IC4A 2JIZA 4RXUA 4NV1A 3KUDA 4YRBA 1W5BA 1RM5A 3A4NA 3VX4A 4E13A 3C5VA 2QPOA 3A1UA 4NG4A 3U7QA 4AJ1A 2BHTA 3LCJA 4LWQA 5KQRA 3RFVA 1H3EA 4MRVA 2ILVA 4FYVA 1APBA 1KMHB 4X6LA 2B94A 4WKOA 1QLJA 1CJBA 1ISRA 4H4EA 2CLFB 4FYMA 4NCAA 1G8FA 1U6IA 1AD2A 1JLLA 4Y0AA 5KNBD 2AFHE 4BX2A 4LEIA 2Q3EA 1HE2A 5L4SA 2LRHA 2IWRA 5EYPB 2UXDB 4ZO4A 1ZOSA 4R2JA 4MEJA 1KI3A 2NACA 1A2OA 4ZHQF 4MB0A 1UPBA 3UC9A 2BHRA 3AEQB 4IW3B 5FI1B 2ODNA 1YULA 3SSOA 3EDQA 2H48A 1BJTA 1OXTA 2IF2A 5A1JA 3GQVA 2ODEA 3W5HA 5JS7A 2PA0A 3F1LA 1QKJA 4V39A 1UZLA 1HNXB 4C0BA 4B4DA 1E0SA 1RS0A 1UMKA 5GGYA 1EXVA 2CHUA 2AFHA 1KJYA 1HE4A 4WK6A 5C8YA 2F3QA 1XDWA 2PGXA 3UICA 3ZQJA 5P21A 1UDRA 3U2QA 4TZ0A 1CG6A 2Q4EA 4Z6KA 2CHFA 1AMOA 5BPFA 1L7XA 1ZS9A 1JHRA 2OGSA 2HFKA 2DHQA 4N9WA 1T5BA 3EEFA 1KIMA 3O4GA 3DE5X 4B4UA 1WKVA 1A3CA 2X8JA 4LC9A 4OHZA 2ZRHA 1KZHA 4CCWA 1OQAA 3CUKA 2DE0X 2ZWOA 3OAAA 1VE9A 1Z2NX 3WSWA 4CL8A 1ZC4A 2CHQA 3A10A 1TC2A 1P44A 4ZU3A 3EC7A 4FD2A 2QLLA 5CD9A 1XEFA 1OYWA 3I9JA 1ZK1A 3DE3X 1YSCA 3TQRA 4PQGA 4RPIA 4YDRA 3WNVA 5G53C 5IDVA 1NI5A 4JP3A 4A8HA 4KQKA 2H5LA 1AUOA 3KE8A 1N2XA 1BN7A 3RK0A 4IV8A 4QA9A 3QBTA 1JZSA 2XBMA 2NO6A 2VK8A 3VDXA 1SD1A 3OIGA 1X8KA 4BGDA 2FMFA 3QWAA 4I2NA 4L6CA 3SYRA 1COZA 5CDGA 2P4SA 3AHIA 1NE7A 1EEHA 3WYBA 3Q6NA 4YRGA 3LI2A 2XT0A 4QPJC 1B93A 3D6TB 4KGVA 4ZYTA 1QSGA 2GI4A 4BO1A 3RTDA 3U81A 2GB4A 5T7BA 1QFJA 4B82A 1IOVA 4RZXA 2YWXA 3IQEA 2B8WA 4Y2XA 4D3XA 3KSBC 2ERYA 2PRJA 2TECE 2XMZA 4ECEA 2PK3A 4YWJA 4Z9AA 4R9NA 3ECSA 3I5AA 2X2EA 3ADKA 4Q37A 3LKDA 3SFTA 4ABTA 5E9AA 1FSGA 1E1NA 2ADMA 3T5TA 3Q1KA 4G41A 2XCQA 3VX3A 1OAOC 4HLCA 5B6IA 2HQ1A 3QF4B 1E62A 4DV6B 4UBOA 3O8DA 4X95A 1UDBA 1CUGA 4I6EA 3IRUA 1TKRA 2WRZA 1KPGA 1ORHA 4QARA 1KTVA 3BXOA 1EDEA 4EB6A 2FDCA 2B0JA 2L19A 1YB6A 3LP5A 1JMVA 3DMTC 1ZK4A 3HSSA 8AT1A 2ROQA 1H8EA 1DIAA 4GI2A 1FYVA 2YWGA 2J6CA 2WMOB 3B48A 4I6GA 1G7CA 4NRDA 2LDBA 3VDRA 3G1TA 3GLSA 3FFAA 4L4RA 5DYTA 3RUHA 2AG5A 4MAFA 1FFCA 2AC7A 1J99A 1ESZA 2ZQYA 4PX5A 4UHHA 4DLKA 4AP5A 4L27A 6GPBA 3UGKA 4YJ2A 2WU8A 2Z4RA 4MQUA 1EHIA 1AK9A 4U2DA 1XRPA 3PE3A 4OI2A 5SY9A 3NNNA 4YXWD 3GFQA 3DXZA 2Q3CA 3EE6A 2QTNA 5KWSA 4L8FA 1X39A 2NQ8A 3AESB 5EJ5A 4ND3A 4C7OA 4PHHA 2ZJFA 4HN9A 3V3KA 5KO2A 3HUTA 1ISMA 1WCYA 4ZCMA 4KO3S 4A4DA 3G85A 2R00C 2GAOA 4B3CA 2A7QA 2WM3A 1JPUA 3UGQA 4AUNA 3IJ5A 3ZVKA 2DJ5A 1AGYA 1JHZA 3DOOA 1SULA 2VDWB 3HKCB 5DM0A 1C7QA 4RMGA 3KTAA 1IAVA 3DH0A 2BJHA 3CLSD 2OBLA 1K08A 5EFOA 3STYA 1VPLA 2Z2YA 3LXMA 4IDFA 2FYTA 1E9BA 2OSBA 3ND7A 2A2ZA 4J90A 4UEJA 4GW3A 1YD7A 3BD9A 3RTAA 3DTVD 3G2HA 4BN4A 1E3QA 4BBJA 1WZNA 5B3AA 3RUDA 1T8UA 5JVDB 1BCRB 4AZWA 5JC8A 4XPIB 1CB0A 4CIVA 5DTMA 4IKEA 3TTYA 2I22A 1EK2A 3LECA 4HNGA 4B34A 4PLVA 3I09A 5A4KA 5I51A 4MI3A 2I55A 2WIAA 4LDNA 4CF5A 5LIPA 4X64B 2WIDA 2Q2NA 1W85B 4JJ4A 5FOTA 5LXTB 3LW8A 5AOCA 1EZZA 3CLRC 3V2UA 2OP1A 1NDHA 1XNGA 2P30A 2QE7A 3H17A 5CDSA 2CK3A 3ZE8A 2ZJ1A 3PUXA 4ZT6A 1EGQA 1PUXA 3I9MA 3PQ7A 4KNYA 3OC6A 1GIAA 2WFLB 4NK5A 2GTHA 3O2QB 2K5UA 3WBKA 4ZI5A 4LHWA 5C8YF 4KMMA 2OECA 1EHCA 2O2ZA 2TRSB 2WHEA 3KQTA 4MEAA 3I53A 1CT9A 1JEEA 3H11A 3KB6A 3VISA 4BNXA 2JA2A 1M1YB 2JARA 4D9JA 2O8DA 2QUZA 5FFMA 3TE7A 3WOVA 4TOIA 4YAEA 5EHIA 2QUIA 2XMSA 3JAWB 4MVJD 4R3WA 4C6HA 1NN3A 4GKVA 2C54A 4FNAA 5JCJA 1NVDA 1L5KA 1VSTA 2ZUBA 3QEJA 1RVDA 4UQOA 3T3PB 3LUBA 1BMDA 4X65B 5JYDA 3ZJUA 3Q87B 5DW0A 3SNKA 3FMGA 3LHSA 2VPPA 3N1UA 4NU6A 3ZHYA 3ZYCA 4CLXA 4ERXA 1AMNA 1PD1A 2ZKLA 4INOA 1HTTA 2HHLA 2HA2A 1XJWA 3DMHA 2H85A 1VDZA 4ZTBA 1RNLA 2HJVA 1N3IA 3LPLA 4MEBA 4XUEA 1XCPA 5F33A 1C9KA 3K0HA 5IVKA 1HI9A 3G2PA 4HF7A 4N40A 2OHXA 4JENA 1IBCA 1U7WA 3L4KA 3DFZA 5F35A 1DTWA 3GUVA 2XH8A 4OGFA 2COUA 1JKMA 1VKZA 2NAFA 3DDZX 4J1QA 5JCOA 1AQLA 4Q4DA 3H2JA 2BEWB 4R2WA 3IP3A 4GR9A 3GLQA 3ZLTA 1T8WA 1XZAA 1L7AA 1TF5A 2IY8A 1FRZA 1QHFA 1ZVJA 2IPOA 2J5QA 2IW3A 3L05A 3OJWA 1SCBA 4GYKA 2H1FA 3HR8A 4KKXB 1N6RA 4P2GA 4CMKA 5JO0A 4YCNA 1C9DB 3DEKA 2E48A 3FETA 4QYWA 4TTRA 1FP4A 1MX9A 2A5LA 5HJEA 3IQFA 5BXQC 4ALMA 3PXEA 2I66A 7ADHA 1NQUA 2HNAA 2GT1A 1NBMD 2ODAA 3CNEA 3PNVA 3Q7EA 5I5EA 1OAAA 2HX1A 1N8TA 3S27A 1M5RA 3KJNA 2F3RA 1Z4JA 2GK6A 2IYXA 3G8CA 4WQMA 3CO5A 3DMFA 1OXBB 4JJ7A 4DNOA 2FSUA 3NTUA 4ZHQB 2IH4A 4HAWA 2MSWA 3KP1A 4MQMA 1CRZA 1N9KA 2JJ1D 3S40A 1XEXB 1EVLA 3IPAA 1DEHA 3AOEC 2FQQA 3ICPA 2ZT5A 5COQA 5F4BA 3U7JA 5C34B 4CKEA 3H5NA 2IZ7A 3R7FA 2QPLA 4ZT3A 2NO7A 1D5WA 2X9GA 4DSZA 1RLJA 5JEDA 2PCLA 3E4CA 2GCIA 1U8YA 1T2EA 1X92A 2QKYA 1OGIA 2GUGA 1P4RA 1QG2A 1FOEB 1ML4A 5CVDA 1BEZA 1JBQA 4G6ZA 3W7BA 3U37A 2V8BA 1I01A 4BWGA 3K1TA 1T4CB 2NV2B 1XSEA 4UTPA 5CBPB 1FDVA 3U7IA 4N03A 2F3SA 3OX4A 3PC3A 5F73A 1MTZA 4HVLA 4KLRA 2C99A 1BXRA 1LRJA 1MC1A 3VPAA 1M1XB 2XCRB 1VIAA 3PYXA 3QU9A 1AKQA 2XA9A 4XCXA 3ZBQA 5LP6F 2WTBA 2WF9A 3EXHB 4OHCA 2SCUB 1SQ0A 2HB6A 3AB3A 2Z8ZA 3IUSA 1W4BA 5E6RB 3HXKA 2WPNA 3NYWA 3B6ZA 2IHKA 5J9FA 4F04A 5KQPA 2EV9A 2V0GA 3E9NA 4N3GA 1JNXX 2DP4E 4Q19A 3B8EA 1YCFA 4TYPA 1M2NA 3TTSA 3EEOA 4W1SA 2X7HA 3ZDFA 4RPLA 1OLOA 3OLQA 3B3JA 2B3TA 4IIBA 4Q7EA 3DJYA 3PEVA 2FSVA 3UGTA 4AJIA 5C81A 1M7BA 4DWWA 5DASA 2VXOA 4JASB 3BXEA 4UZFA 2IYLD 3E61A 2C83A 2Y68A 1GGMA 3FDZA 1QRTA 1V45E 1R5NA 4OL9A 4RDHA 1ZJWA 1VPDA 3A26A 1K88A 3SDBA 3LYAA 4RJLA 3MW8A 5KTSA 3NUGA 3OT4A 1JR4A 1CRLA 2X19A 3AFMA 1GTRA 1PGPA 4MV8A 4MHTA 2G4CA 4WMLA 3WK9A 1O96A 3T06B 5IDYA 1WSWA 1ZIYA 4GVPA 4K9DA 3AY3A 5HKKA 3WGUA 4ZXPA 2IOFA 3BMNA 1IOLA 3GP3A 4CM5A 3IUJA 3UMVA 4M0CA 2J3IA 1ZK3A 3B85A 5BN3B 2W37A 3C24A 1N25A 4QDKA 3LC1O 1JI3A 1JDNA 1V1RB 1LCIA 3E9DA 3EXG2 3DFUA 4D5EA 3TQQA 3G5TA 5F5LA 1YZGA 2C92A 3FNIA 4EPVA 2YYZA 3EDYA 2FV8A 3KKQA 4RGVA 4EG5A 1HQCA 3F46A 1PFVA 1QHHA 4TKUA 2WSSD 1YQXA 3GEHA 3ONDA 4E5DA 4F9GA 1YE5A 4Y1RA 3V7YA 3DW1X 3BS4A 4LTDA 1GD1O 3CCBA 3RS5A 4EL5A 1GL9B 4WY2A 1Y9DA 1HTBA 3SHVA 4DUYB 1FTYA 5B1SA 2B82A 5HIKA 1CJUC 3LK7A 3ANMA 4Q1DA 1EAYA 4XFKA 1ZXXA 3AUJB 1P3DA 3R8CA 4AMYA 4CDGA 2R65A 3B1FA 5L95A 4ARCA 2W6PA 3WQRA 2OC4A 4UHBA 3FX2A 1AQ6A 3IILA 1NYQA 2MR5A 2G09A 3N2NA 1AS0A 2OMEA 3LLMA 5F1YA 4CEHA 2H2IA 1MJ5A 1WPGA 3H1AA 3PXGA 3X0DA 5L40A 4G8JA 5TGDA 3ED1A 3F78A 3WHKA 2JIDA 5F2KA 1Y8RB 4CV0A 2R6ZA 1K1EA 2ES4A 1M66A 4Y9DA 2WWVD 3BD8A 5AK5A 1DKLA 3GX1A 1R00A 1INLA 3FPGA 3P9SA 3NRBA 5IW8A 1AGXA 2VRCD 4RL4A 3RKRA 3UKDA 2R1VA 2VP5A 3ZCRA 4J0QA 2HA5A 2YOFA 1JFRA 3QBJA 5CAEA 2HPVA 2XWSA 4W4TA 4R8LA 1NF9A 3V4FA 1G2OA 4BQSA 1IWPB 2NV6A 4C0KA 5AQ1A 4MDEA 1CETA 1E1CA 3FTPA 3FHLA 4O2RA 4OA8A 4V2IA 3S0JA 4BZWA 3K70C 3FD8A 2P2GA 2CVQA 1RACA 3T35A 4TS4A 3NP9A 4YONB 3BM5A 4AMVA 1P5FA 4IJWA 1KSJA 3W34A 4BNTA 1EFAA 1U4OA 4WD3A 3KLMX 1O0CA 1G8AA 3KJQA 4L75A 5AVTA 1CW2B 4EVRA 1JE1A 4FIDA 3GLTA 3AM4A 5CMLA 3WSTA 4NZMA 4KMSA 4UAVA 2OXTA 3O8LA 4B2LA 5IP5A 2BFDB 4HDCA 3CC8A 4D82A 4E12A 5KU1A 5SZHB 3NDBB 1P2SA 2X23A 1XZQA 2Y92A 4OHMA 3BH7A 4LN1A 3GCDA 1ETUA 2YWJA 3QEMB 5GGXA 1TE2A 3S2UA 1R0XA 3F3MA 1CSEE 4M21A 1HDYA 5LMCA 2K6GA 1M9NA 1SVMA 2XI4A 2WVGA 1PJTA 3T5BA 3LC2O 3WE7A 2WVJA 3L0SA 4TSFA 3OECA 4LY3A 5IG2A 4L15A 2WYUA 2WSLA 2GARA 1UBOS 3WXBA 3BD7A 3DLIA 2D3WA 5F3DA 4BRUA 2OG2A 1T6ZA 1UBSB 1OXMA 2V7WA 3HP7A 4OHRA 3WY9A 1V39A 3K9HA 5C8YB 5EMJA 1N1DA 1XDSA 4LRXA 5DKFA 5T4FA 1XKQA 1NUPA 1B43A 1JG2A 1U0RA 4U1RA 3UIEA 2DBVO 5IAJA 2DH6A 1EAMA 3EGVA 3UWPA 5LOVA 2AFRA 4M0MA 3LVBA 2RC5A 1FDUA 5F4ZA 2X15A 4LIPD 4L73A 1Y9ZA 3N07A 1D03A 5CCXA 4P82A 4GYWA 4FJ2A 5B7GA 3CVVA 3ZGOA 1NNI1 4AY5A 4BQNA 4M60A 4RJKA 1UMBA 2E87A 2RAPA 4R5HA 3V1UA 1WMEA 2VJLA 2GEUA 3MTQA 3RNOA 1JT2A 3KD2A 4GXQA 5KPDA 5DP1A 3EA5A 3SVZA 2W8ZA 1JECA 1PJCA 2FN4A 2PXHA 4RD3A 3X43A 4BTEA 1ODIA 2CHEA 5IT5A 5IZCA 3ENWA 5JATA 1OCEA 1QWSA 1XMQB 3IAEA 4L4SA 4QOHA 1LJLA 4G24A 2HF2A 3QA9A 4MVYA 1XJQA 1U3VA 2XNJA 4JP8A 1K8YB 4NV3A 5FKJA 4JAVC 4BNZA 4PR3A 3KHKA 4ANFA 3BMOB 5CPFA 1H2YA 4RDXA 2A9VA 1G7RA 5F3RA 3I39X 4YRDA 2PWAA 3L4BA 2XYRA 3LGXA 3NT2A 2QTZA 1LPOA 2BONA 4MYDA 1F9AA 2YIDA 3THWA 1E8NA 3K94A 4HQRA 3LUKA 2FX2A 3N0WA 4OQLA 2VSNA 1JJIA 3NHMA 4PEVA 2B1JA 2YV3A 3SEQA 1PRYA 5CA1A 4EL0A 4KR2A 2VO1A 3UUGA 3CHYA 1PJ4A 4YPVA 4MDHA 3KXDA 1Z63A 4IVQA 5J4YA 4I14A 3OLCX 1DCFA 3IVGA 3DNFA 3A1EA 4YRFA 2YR0A 1NOIA 1R8XA 2ZVQX 4LHXA 2A9PA 2E55A 4LXGA 1OX6A 1FS5A 3WYNA 1GL6A 1NXXA 1HPLA 1F0NA 1J8MF 1WZCA 4A8JC 4MUKA 3BB1A 1HDCA 4RV5A 1SVOA 4MQEA 1P72A 4DCPA 3ZZ1A 2LUOA 4JC5A 3FUTA 3G2JA 4F6CA 2WZQA 2R79A 4K03A 2C0QA 4BVFA 3KQYA 1SHUX 4GGPA 2Z5GA 5M7EA 1DRJA 2YY7A 2O2YA 4BLPA 3DQQA 1BQEA 2O8CA 3QEKA 3ESBA 1MABA 1UZNA 4F4DA 5DHAA 3FW1A 2QW8A 1FNNA 3VVBA 5SYMA 3CX7A 1Q0HA 1VECA 2YV4A 3ZHRA 3AEYA 1F2DA 2P9TA 4YPFA 4BB9A 4M9RA 2A5FA 3M1IA 4YJ2B 3F8WA 1Z4IA 3AHCA 3DPSA 3NDPA 5ALRA 1PX0A 5ER6A 4KN6A 1TJPB 4YRTA 3JPYA 5AFSA 4LWZA 4D96A 2Q07A 4TRJA 4OK5A 3S70A 4AIRA 3F7TA 2BFWA 4UVDA 5C5DA 3MGAA 3QHAA 3M0EA 4MXDA 4C7OB 5ARBA 2BJVA 3ZKWA 1JN0A 1B4DA 1XU4A 3R5HA 4R81A 3PHBE 5BWMA 1CUFA 5KPJA 4DR7B 4BDSA 4C2UA 2I65A 1SC3A 4LE1A 3P96A 4LDZA 2JI6A 1X8JA 2PSHA 3LK6A 3PFCA 1BHQ1 2ONKA 3GXOA 5F52A 1U4SA 4RA6A 4QGBA 4JBIA 3ORYA 1U8EA 2WG2A 1D04A 4O29A 5HYVA 4BVGA 1FDWA 3MTJA 3KTAB 2AKAB 4JYPA 4KPGA 2MMGA 1O95C 1RI3A 1TQ8A 1QIMA 1UAGA 3HH8A 3BTSA 3WFJA 3QE9Y 1S2DA 2OA0A 1JR3D 1Q77A 3FH0A 3GJQA 1CY2A 2RGAA 1VGQA 1I32A 3VNQA 3HL4A 3MJVA 4P5DA 1WWKA 4CMEC 1H9CA 1A96A 1X8XA 3RC2A 3TAHA 1D0VA 2B0CA 3MWDA 1V6CA 4LK3A 5EVCA 1Y6QA 4GNRA 3TNJA 1NTOA 1WCV1 3EZ9A 3IODA 3UYKA 1LBSA 4V0LA 1TT5A 5FLEX 2HWKA 3A0RB 4O2BA 3PRJA 4UFOA 1IDOA 2VPQA 2YQ5A 4PE5B 4TMKA 3T0FA 1J06A 1E79D 4XYLA 4BNJA 4OBWA 4HAXA 4XX0B 3SX0A 3GLGE 1C1YA 5ICSA 4FX2A 3G2OA 1RWPA 3UCEA 2G6BA 3U7HB 4B4KA 3M6AA 2I4NA 1GZSA 1U3WA 4KFUA 2EKLA 2XMRA 4UMVA 2Z5LA 5EIXA 1DZIA 4QOIA 1CY4A 1AUXA 1RAFA 1YQWA 1PEKE 3GRKA 2BCGY 4LXYA 4MUNA 1Y1QA 1S01A 3CURA 1B8VA 3PXDA 5JNLA 3PVSA 4TQUS 2OHHA 4PLTA 4CBVA 4OI0A 3LPDA 3T61A 4AKEA 4DJDC 3H11B 2BFAA 4DGQA 5BW5A 3GLGA 1P6QA 2R84A 1U3UA 3M89A 4K81B 3K1AA 2REQB 2O8DB 3F6YA 1CUWA 2LIVA 1PGJA 3ER9A 2CLSA 1UKAA 3GH1A 1DJQA 1MB2A 2OZKA 2XMGA 4CNQA 5HUJA 3W77A 4ZYXA 3IPXA 3PHGA 3ENZA 5MDHA 3NEPX 4GQBA 2ETVA 2YJ6A 3PGVA 3DAHA 4Z2AA 4KYIB 1LXCA 1U2ZA 1IRIA 1LWOA 4KCGA 3U4QA 1PKXA 3LY7A 3NBAA 3OG9A 4LJLA 3FDXA 4NABA 1XLVA 1PK8A 1BMQA 3R40A 1SVUA 1A69A 3PNQA 3JZIA 4ALJA 1H8HA 3JQFA 2R5FA 4HI0E 2XA2A 3F7OA 1EE2A 3PQFA 1XL0A 4RJ2A 4BLRA 4E6EA 2CT8A 1YJ5A 2R62A 2ZETA 3CN9A 3NZEA 1DTWB 4RK7A 1MAUA 2MT9A 3IOBA 3R4CA 1XMPA 1SBQA 1VLLA 1DUIA 1ZGAA 2I8AA 3A1DA 2C58A 3FFXA 3NHPA 5L7YA 3RKUA 3RS4A 3W8RA 2BGGA 4YRKA 4EVQA 4P32A 4R0MA 3WQSB 2Z2KA 3G0BA 1U5CA 1U28C 4RHUA 3Q2OA 4OMDA 3HCDA 2HDWA 3FCYA 4HC4A 4V0NA 1RABA 3IT2A 4L2IB 5A7GA 1SXIA 3LCMA 1I4OA 1V11B 3K92A 1ABFA 2B1IA 4PC7A 1PHPA 2EWWA 1TF2A 2NZUG 1RKVA 3L6OO 1FP4B 2VP3A 4OK6A 3ZQ6A 3I9KA 4TYWA 2ZTMA 3QPUA 5BORA 2ZU6A 5EZYF 3HMKA 4DUPA 1RYYA 3AVUA 4YMUA 4RTPA 2FFJA 3CPEA 3DVAA 5K3FA 1SXHA 2ZJ5A 2ONZA 3DPIA 3WI7A 2MHCA 3OHPA 2PKWA 2NYUA 2F7SA 4M22A 2A9QA 4Z4EA 1UZUA 4JP2A 4FLMA 1K0FA 1KVQA 2A0YA 2VDRB 1XTPA 1UMCA 1ZJZA 1CQIA 3DV0B 4LRUA 4LHSA 1DQYA 2WV7A 3LA6A 4YAUA 3EGDA 5A0TA 2A5JA 2A9KA 2AR7A 2AWOA 2CVPA 3E3LA 3Q7RA 3V1TC 3RYHA 2GNPA 3E7XA 4QYMA 3RVOA 1IZ0A 1FU8A 1GXSA 4GOND 3PC6A 4HQNA 4HXYA 4IM7A 4LE2A 3RVMA 4DC9A 1N2ZA 4DA8A 4YPOA 4Z8XA 1Q22A 1O57A 4O4HF 1GAQA 3R5JA 5DYIA 3M4JA 1CZLA 3HA2A 3VZQA 3QZUA 4PVCA 4ES6A 1A82A 1IQPA 3ZCXA 3GPLA 2RHDA 3KJZA 2WWXA 1G8PA 4HGYA 3RHZA 4EZIA 1R8JA 4MX8A 1VG9B 1RZRA 1GV0A 1OLUA 5EZ5A 3ZHBA 5L3QA 4BLWA 4G0UA 1DMRA 5IX8A 1ZGHA 4M49A 1VYUA 1PLLA 2CJWA 2CXHA 3NHUA 1ZNXA 3AVYA 1C1XA 1BXRB 5NLLA 1MF7A 2C4VA 4Y1GA 4EOGA 3BMQA 4BPRA 1Q7TA 5A4JA 3UN1A 3KTOA 2VHUA 3MCVA 4W9RA 4KPFC 3DR5A 2WAYA 1MR3F 1YR3A 3RQSA 5CDYA 3PFBA 1EJBA 1SM4A 4HXEB 3L8ZA 2OG1A 3VO2A 3ILHA 2VRNA 5KHAA 1YDMA 3OZEA 2H7CA 2JI9A 4B40A 2NZJA 4EKYA 2XXAB 4KQIA 4PXAA 4TVSA 3ZD8A 3OE4A 1W8IA 1G3UA 3EZYA 3E15A 4EARA 3FDZB 1ZYUA 4G0MA 2O6HA 4F4HA 2UUCB 2AFIE 4PYLA 3G49A 1TMGE 4URYR 3I23A 3SJ7A 3OMWA 1Q7EA 4QOEA 2VOEA 1TTTA 2NTYC 2C07A 4H7DA 1VMDA 5IYZB 1WVGA 4LXQA 2EFGA 1XALA 5AIAA 3ZCVA 2QUAA 4O2BF 1KBQA 1YJQA 1O96B 2AGVA 2YXEA 2O7SA 3MOGA 1WO8A 2FH5B 1SY7A 4LGVA 4PFSA 1E6LA 3L5OA 4R1TA 5FTKA 4BWFB 3BMNB 1E4YA 2H63A 1DJMA 2II6A 1E9AA 2JGLA 3G88A 4FC6A 4L4YA 5GP1A 3T99A 1Z06A 4U2KA 2AFIA 1GNSA 3F2VA 3AJAA 3ZNQA 4PZ0A 4MUAA 2GOYA 2WSIA 3SBOA 3W5IA 2PUAA 1G7TA 3R77A 2DR0A 4D26A 4XIGS 2BOVA 1GU0A 1ZVKA 2ZYAA 4MR8A 4NTZA 4RF4A 3QVKA 4XGKA 4CXMA 1OC2A 1QHHB 3R3YA 4CDMA 4U2CA 2QR5A 1GQYA 4Y1RB 3HBAA 5C46F 1N77A 3U3XA 1A9RA 2ZTLA 3HUEA 4DBVO 1I4LD 2RK6A 4BNUA 3A4MA 1ZA1A 1X8LA 2BZ0A 2HF8A 2Q3JA 2ZBDA 3KHSA 5PNTA 3UJPA 1DRVA 1OFGA 1X86B 2V1XA 3D3KA 1J07A 4FGSA 4N3NA 1FFEA 1J33A 1W6UA 2EBUA 2DPXA 3WX0A 3K7EA 5A3QA 2H0AA 4AKIA 2IU0A 2Q41A 2ZWMA 1SR8A 3A6KA 4HMPA 1AO0A 3EBPA 4QM7A 4C30A 4CEHB 3CLUC 1QH9A 3DAOA 3URMA 4TTSA 5CXSA 4B7XA 4G8BA 2P1DA 4JUCA 1GZ7A 1JVSA 1OGYA 1SCJA 2IHVA 4B2PA 1VB3A 4HDQB 4CT4B 2FY8A 3NORA 1M2FA 3WIOA 2E4WA 4UMFA 1SCUB 1E3SA 2O3TA 5EFZA 1FRQA 3Q8LA 1N2BA 3A31A 2QD1A 4ER5A 5LJIA 2RH5A 2WF7A 3G8BA 4KX3A 5AM1A 1Z6YA 5B53A 2GEKA 1EQAA 3JZMA 5F12A 4ZYZA 2R1VB 2WM9B 5CAEB 1NOJA 1Y5NA 2ET6A 1KDOA 5EUBA 2EQ5A 3PXCX 5A71A 2PJUA 1L2TA 3CR3C 1CZUA 1E1CB 3WYCA 3VH4A 2BAGA 1OA0A 2I6GA 2V9PA 4UUBA 4UXJA 1AUPA 3UH1A 3NM5A 1UC5B 3EIWA 4G1CA 1E1RD 2IV7A 3TBFA 1TYAE 2GA8A 4DWVA 1N5OX 2ZAYA 2P35A 3CYFA 4TM7A 4EUHA 1YS9A 1L5OA 2Q3MA 2G04A 3EFOA 1GV1A 1W4CA 2EZ9A 3B7WA 4K9MA 1P1JA 4HLDA 3FMOB 1TM3E 4KOEC 2J4FA 1YA8A 3EULA 1BDMA 1Q21A 1RQ2A 3TJZA 2XKJE 1R4MA 1N1MA 3OX1A 4E2FA 3SNHA 1LPPA 3T5AA 5C1IA 4BNKA 1R0KA 4IJQA 1CDDA 1DMSA 2QX4A 4M0DA 1XEWX 2IT1A 4UQPA 5I7EA 3F47A 4PG6A 3S55A 5I8WA 4PSUA 4X7BA 1P2GA 3MGKA 3HPQA 3MSCA 2Z98A 3P45A 4GO1A 2VEOA 4QG7A 5EKDA 4I5IA 4ZN6A 4AURA 1M75A 3PL1A 4AZSA 3BQMB 2Q29A 5CIWA 1OPRA 2IVFA 2VAVA 3ONEA 2M6KA 5LOVB 3GFRA 5KIAA 5K0SA 4F85A 4V1CI 3VI3B 3OTOB 4J76A 2ZRNA 2GFHA 2HJ9A 3GZTB 4G37A 4WGGA 1Z13A 3CS3A 4C7XA 3UAGA 1NRWA 3NVAA 1NRJB 3OQ6A 4DIBA 1Z33A 3LPCA 2Q49A 4HWOA 4I9NA 5CLGA 4BQIA 4I8DA 1UMBB 2FQXA 4CZ2A 1GZ4A 1I10A 3TOCA 4IILA 2VR1A 1XZIA 2NTNA 2YV2A 5F98A 3W1VA 1HETA 3GJ3A 3HUUA 3MT0A 1B2LA 3SE0A 2IXDA 3GG2A 1A8SA 4GE3A 1YO6A 2RGNA 3BXHA 2H1CA 3C6KA 3HGTA 4LC0A 4LMAA 3PPWA 3QY0A 4GMDA 4ZOAA 5ECWA 3UWMA 4I1RA 5I9IA 1XVTA 1HNNA 4WNYA 5EJ2A 2UZIR 2LBPA 1PSZA 4S05A 1J7JA 3H9BA 4ENUA 2RGUA 3BZBA 1I7PA 3H2YA 4XQEA 4WEQA 3UC5A 3W3AD 5JAIA 2CJPA 2V9CA 1W5EA 1GITA 5AOVA 4TVOA 2BCJQ 5FNVA 3SZGA 2O0JA 4ZVKA 3THWB 2HQOA 3NT5A 4X93A 1SPXA 3H8SA 3QE2A 5CT8A 3T9EA 3M9WA 2V4UA 3THRA 3O93A 5T6MA 3EPLA 1Z5VA 1RC8A 2NSHA 4YMGA 1ESDA 4OHOA 1S02A 4UCQA 4O4LA 3D54D 2CD7A 1IJKA 2VZ0A 5LU8A 2OXCA 2VA9A 3C6MA 3B38A 1J00A 4ZZ2A 1S3SA 2XQGA 5EZYB 3HWSA 1X7GA 2SKCA 4GSYA 4L5JA 4M1YA 4M9CA 5AKGA 3FPEA 4IXDA 2ATCA 3K72B 1D6JA 2J3JA 1TQ2A 1QQ6A 3FRIA 4NWIA 2IKQA 5HCIA 4OTZA 4MQEB 4O0LA 1ENYA 4FHZA 2RI6A 2XVMA 2PUTA 1B15A 2FUCA 2YVAA 1ADGA 1ECFA 5M29A 1L5LA 3CSSA 4N8DA 4LI0A 1XTQA 3RHFA 4B48A 4COKA 4EO4A 5JCZA 4UNRA 5DM70 4QNMA 3UKOA 4FT4A 4DV2B 2O8CB 1L7RA 4DPKA 2D0IA 3AR5A 4LZWA 3WLFA 4D9GA 4D74A 1MABB 3HDHA 3LCCA 2OAEA 1LK5A 2EF1A 4G36A 1EKXA 1NNUA 1UK8A 1JHXA 3QOXA 4LOHA 3C39A 3LBNA 1JIJA 1L8QA 2XGOA 1QF9A 4MH0R 5G1NA 3BGOS 3FFTA 2P2CA 4X7MA 2VDPB 4LKOA 3W9BA 4YXWA 2PRZA 1H05A 2OHVA 2AUTA 2I62A 1SG9A 2R85A 2GKGA 1BCSA 2YOHA 3H5TA 2BV3A 1LDGA 4KJXA 5LDGA 4OYRA 4YUYA 1P2UA 3D43A 1G8KA 2AW5A 3TZHA 3IO5A 2YS6A 1MC8A 4AJPA 1N6OA 4X60A 1CUEA 4FKMA 4CQJA 2YC4C 1TVKA 4B75A 1QE0A 4K7JA 1W46A 5HVNA 1G6Q1 3ZKWB 3KSDO 3OPVA 1YU9A 1E63A 4RZ2A 5K3SA 5CP8A 2ZI6A 3TM4A 1G2PA 3DEZA 5JV5A 1KTIA 2ARKA 2A92A 2G06A 3SYLA 1FU7A 4EY5A 4RA6B 5DLEA 4HLUC 1PNTA 1ZITA 2P0YA 1M2JA 4PN7A 1W36D 4NFYA 1OV4A 4QEZA 3KUCA 3OZUA 1UWKA 4UQLA 5CHEA 5BOSA 3L8CA 4OQQA 4Q3DA 1C3VA 3I4FA 1G8YA 2ZU0C 3KOUA 5HW0A 1T1SA 3PIRA 3ZEIA 5L7WA 3FR7A 3K09A 9LDBA 3ELWA 1W49A 4Y2JA 1HURA 1NJ1A 2MSLA 3WGYA 5DXAA 1TT5B 8ATCA 4O2BB 1DLJA 2FG6C 3NHBA 1TRKA 1KSGA 2ESRA 2W2VA 5KOIA 2P9GA 5H81A 4IOMA 3EOBI 3QPVA 4QL3A 4TT8A 3UA4A 3GMTA 1ZR2A 2IDJA 4MVJE 3GPDG 5DRTA 2Q3FA 1MA3A 3E18A 3I9FA 2PE5A 2BGKA 3SS9X 3CNBA 2W4QA 3UJ8A 1DOAA 2VQSA 1YQEA 3BSFA 3H7IA 1HE1C 4CV1A 2DKOA 4OKSA 4OXNA 4FFMA 1X94A 5AW7A 4Z3KA 1JQAA 5BNTA 3I5YA 1I2ZA 1LLCA 1U8TA 1UBRS 1XLTA 1NJGA 1Z0ZA 2CMFA 2V7BA 3DEHA 3H9JA 3OU6A 3R6TA 3CUTA 4IUYA 2WMYA 4MVJA 5E2BA 3EODA 2RHCA 1TTHA 3UJ3X 1AS2A 3K1AB 5KTMA 4H15A 4DRXA 4WV3A 1VJGA 3OPYA 4FU0A 4XPZA 2WIKA 1U90A 5KSYA 4UXIA 2WD8A 2AZTA 2BDTA 1EEXB 1TCBA 3Q0TA 1NN1A 1GTMA 3N58A 5AWFC 4D44A 1AJEA 1MZVA 2WJJA 2XKAA 3U4QB 1V1JA 1DCMA 1W2WB 2QP3A 4AUMA 4HMQA 3RYCA 1G8HA 3UQYS 4LOIA 3IFSA 2ATVA 5K7SA 1CQJA 3FY4A 4EB3A 2GN1A 3TLAA 3GEIA 1XQVA 2WICA 1FMJA 2F8MA 1AXGA 3NBQA 4IXNA 2WTXA 3SEAA 4M1KA 3SQMA 1NBME 1QMGA 3L7NA 3CGWA 4EUEA 5J2TA 4BC1A 3G0GA 2FGJA 2J3DA 4IWXA 2D54A 2VCEA 2ZSIA 1S2NA 2R8BA 4KQ2A 2OCIA 5FNVF 3TBKA 4XGQA 4Q9IA 4AF8A 4BO6A 2R3SA 3U4IA 1ZH2A 2C97A 4K6OA 1W1IA 1Z29A 2RGBA 3I34X 4BYMA 4UUQA 3BULA 3UB3A 2OFFA 3S7TA 4Y6OA 2D0OB 3D9QX 4MPPA 3TKLA 3EJ6A 1NBMA 2OUIA 3FKSD 5K09A 2YW2A 1GDDA 5SZJA 4JELA 3GPBA 3RCBA 1V35A 1VKRA 3ZXXA 5TMDA 5HM8A 1EGHA 3D6UA 2B4YA 1VA5A 2H5EA 1EP9A 3ONWA 3T7CA 4DMGA 3DVAB 2ORVA 2JI4A 1FYFA 1TD1A 3AUSA 3TW4A 1PW5A 3FYCA 3V7NA 4DLAA 2VSOA 1D0SA 2JJ1A 4A91A 4NS1A 2ZUTA 3A9SA 1Q20A 1E6CA 4KRXA 4M88A 4WT7A 4G1VA 4OQFA 2QZSA 2Y77A 3EW7A 3RSZA 1D1TA 1OWMA 3L0ZA 1UAAA 5B7PA 1CQIB 4JVSB 4WBXC 1CZRA 4Z4GA 2XVAA 4FVTA 3HZOA 3HWX1 2RD2A 2QSJA 1QH8B 3JD0A 3RYHB 3HFGA 3EGWA 1LPAB 4QOFA 4YJDA 1GXSB 4B44A 1LA2A 2FW7A 3QEBZ 1DEAA 2R2AA 3QLVA 4HTFA 3G0HA 3OA2A 1FBNA 2CYAA 3FTCA 2A14A 4MRMA 4PYNA 1AQIA 3ANLA 5ALQA 3SBEA 3IQWA 1U9YA 1Y4DE 1SG6A 1KORA 4DCOA 5BR4A 3KKNA 2J5KA 3DWIA 4AG3A 3T9DA 3R3JA 5WRFA 5JH7A 5FR1A 1YS6A 3N2KA 1AV7A 3U48A 3I9V1 1JSZA 1JX6A 1OLUB 2WSBA 3KWFA 1DX9A 2ZRBA 1PT8A 3H1PA 2BFFB 1I0LA 2CJWB 1XLUA 3O90A 1C1XB 3JW8A 1C30A 1UDXA 3RIYA 3AFIA 3V2GA 2B92A 1P2BA 2Z2IA 4AW9A 3RVQA 5JC1A 1A5TA 1HQDA 2Q45A 2WJIA 3QMMA 1ZCBA 4YAJA 1EE9A 2GEJA 2PMBA 3BE8A 3GMSA 1URPA 1ZIXA 4G8CA 5AM0A 2SNIE 4CG0A 4QUBA 1XTUA 3PX2A 3WLHA 4UUPA 4CU5A 1MNQA 1WPXA 3C87A 3Q8WA 3ZR4B 3OIYA 5JPDA 2VC2B 1V16B 2AIRA 2DT5A 5L3ZA 3L7LA 5GZ6A 5REQA 3OCZA 1AQUA 3GJ8A 3B1KA 4GPTA 5BY2A 2PUEA 1PGNA 1MP0A 1POXA 3N8DA 1XLWA 3CBQA 1GAJA 1YHZA 3PE6A 2Q2WA 1DC8A 3I05A 2E49A 3IJEB 3L8FA 4NENB 1RZUA 3DBHA 2XMBA 4XQGA 1V2GA 2HLDD 2CKDA 2GILA 3PXXA 4X97A 1R5OA 4R83A 5LP1A 2F9FA 5BVHB 4EHJA 1O0SA 1TEHA 1TDJA 3C8HA 3LKVA 4L8YA 2DTEA 3UUEA 3C3DA 1Y8ZA 1OH5A 4QO7A 1SHJA 4MKHA 3L79A 4F5EA 3WR5A 2X0RA 3A2MA 3E7PA 1G3IA 2AFIB 2HI0A 4FLEA 4JBYA 1FUKA 1EP2B 1OA1A 1G3QA 5M04A 2NO4A 4FFSA 4R69A 5I4CA 1A8UA 2F9MA 1HOTA 4MR8B 4RSMA 3K35A 4PYOA 4D9CA 4YACA 2HMSA 1VIYA 4RKQA 2XZTA 3QVUA 2XXBA 3V6MA 3SMQA 2PKQO 1EYZA 5FR2A 2OD2A 1XTZA 1NFQA 1XXHE 2GBLA 4MVJF 1XD9A 1JIUA 4X0EA 3NTLA 3VZSA 5JNUA 4D80A 2D6FA 4EG0A 3KZXA 4IEEA 1ACMA 2KLBA 3HG7A 2W98A 3K0AA 4JJKA 1WKCA 3USZA 4PLYA 2BH2A 3SN6A 3E48A 3OJCA 5FO0A 4GE0A 5EHNA 4QOSA 4C89A 3E23A 3OTIA 2ZYWX 5FJJA 3VV3A 3FHJA 5J5AA 4GZLA 1DBWA 4ETIA 1WHSA 1YNSA 4S35A 4QD3A 4AXBA 3AHDA 1H6DA 1NXOA 2X5NA 2VRCA 1U8ZA 4MOWA 2HGZA 13PKA 3MJSA 3WOHA 1KJZA 4CR8A 4D5GA 2ZYSA 1LDBA 3NU1A 3VYRB 6ABPA 2AF3C 2JJQA 5KWEA 3IXLA 1MN6A 3HBNA 4P84A 2PH5A 4HDKB 4IXTA 4L4ZA 5J2TF 4NLLA 2PNJA 3V8QA 4YCLA 2F55A 1KWKA 1A5SB 1JEOA 3MN1A 5K45A 5FPYA 4XB6B 3VYVA 4BMDA 1S6YA 5C53B 4PWYA 2CKMA 3AOGA 4JBGA 2P2LA 1H23A 5C7YA 1U2GC 3KCQA 3ZU5A 1JQBA 2C8LA 2JF0A 4RKEA 3H0KA 1GEGA 3WFIA 1G3MA 4MMYB 1WS6A 4O3FA 2PKEA 3GAMA 1JEDA 3QPCA 4HWGA 1XWFA 4ARUA 5JZOA 2EERA 5PGMA 1JAHA 2ZAMA 4JT8A 2JIQA 3NLLA 1SXJB 4NU8X 4ZODA 2BM8A 4ZQCB 4BAZA 2QRPA 3LUHA 4S3MA 5B7NA 4BNMA 4B4VA 2XITA 2XECA 1JV2B 2ECPA 2Q1UA 1OZGA 2W0SA 1JH9A 2O7RA 4G63A 3VKVA 4XTRA 2Z2JA 2WKWA 2PSJA 2W2OA 4L4XA 4C4PA 1FX0A 4IY1A 3A58B 3PHLA 4AJHA 1ZY2A 4BNDA 2D5CA 3HPRA 3I6QA 1VKHA 3OY7A 4BEWA 2PUGA 1F12A 2RBGA 4YRMA 1NULA 1RKXA 2I7XA 2R7MA 2ZOSA 4MA4A 4DQUA 4ECAA 2VTEA 2POQX 1NMZA 2JDID 2V7VA 3MHPA 3PUJA 5D2CA 1DPFA 2I4RA 1O8CA 3PEUA 1YF3A 1I7LA 4JT2A 1D7AA 1N5IA 2ZE7A 4FCTA 3PG5A 5AJHA 4BO0A 3HLYA 1E0JA 2WHQA 4OLBA 2E7ZA 2R68A 3ZOKA 2FG5A 1TAUA 3GARA 3AUYA 3NNDA 2GD0A 1HTWA 1DADA 5FPSA 3GJ4A 5FWYA 2P4HX 2Y1FA 3FDFA 1PJLA 1SHLA 4L9AA 5JFOA 4JUIA 1NPYA 4ILKA 2VH2A 5EKXA 4DTIA 1YBHA 3UZUA 2VCHA 1K5HA 3THSA 2ZIVB 4MB2A 1OFUX 1KYVA 2CNNA 4QXMA 2OXFA 2CLEB 2ZI3A 4DAOA 2FEPA 1RAHA 1DBSA 2CHVA 6NULA 2W2PA 2WZCA 4DEXA 2R5WA 3K6SA 3LT2A 1EX6A 3BGSA 5E1MA 2BWJA 4EJFA 3U13A 5D00A 4N6OA 3KWLA 3SMVA 2ZSHA 2ZSJA 2XAUA 3A1SA 2PX2A 1YVRA 4L22A 2JHFA 3CRMA 3ESDA 3VJRA 3ODPA 1A76A 1YJCA 1ZCJA 4ZEXA 5FNVB 4C2TA 5GOZA 4TKMA 3W1EA 1CEQA 1S2LA 4LHZA 1WDKA 3HU5A 3KU1A 1FLDA 1N57A 1Z5PA 4HDSA 1QZTA 4DMMA 1ES9A 1JHMA 3F9IA 3JTEA 2O2IA 4YUAA 3MMSA 2A1TR 3Q3IA 1AC5A 3JR7A 4IIJA 4MGEA 2X1HA 1SHKA 2Y9MB 3ASYA 3CLTD 3QNMA 3GIDA 1P3Y1 3HKBA 3FPHA 1ZHOA 2NG1A 2QTMA 5BOVA 1OI3A 3LHFA 4UCFA 1OREA 2O2SA 3PR2B 1QS0B 4MSUA 1EUDA 2NZYA 4K9KA 3TYXA 3VJLA 2EBWA 4M3NA 2OQVA 3RTGA 2P62A 2RGYA 5D3MB 2RJ3A 2EGUA 5LLTA 1W6RA 3HZRA 3ZXYA 2GR9A 3RU9A 2YVKA 3CW8X 3NHYA 3QQ5A 1PX2A 2PANA 4U7WA 4GGOA 4GM4A 4M8LA 2C96A 3JXEA 2G9VA 5DGXA 4BNWA 2XWQA 2X5JO 3AUKA 4QBIA 2P91A 4MUJA 2B5WA 5FUXA 4KRGA 1T3LA 1FY2A 3HYTA 4YCMA 3IDSA 1PYDA 1DP4A 2ZT7A 3FLMA 3KT6A 4WL0A 4ZAGA 3IPYA 1NV9A 1YB1A 3R7SA 1U80A 3FI0A 1P77A 1T4BA 1WCWA 3CY6A 4TUYA 2FVYA 2BZSA 4C0AC 3ISJA 3Q6MA 4ZEOA 4BC0A 3N7AA 4M9ZA 6YASA 1BCSB 2HN9A 3GFTA 2D13A 2PZJA 1C3OA 1OMOA 3R6DA 1JR3E 1T0HB 1YQDA 2NXNA 3PGA1 4E08A 1MO6A 3LSTA 4YDSA 3H87A 5LA6A 2JIMA 4QIHA 3OQBA 4TRNA 1TVKB 4HPWA 4EJSA 2PR2A 2VHYA 1UJBA 3I4LA 5EKUA 2VF2A 3MGBA 1WJGA 4WJKB 4MW5A 1TIPA 5I47A 1C7IA 4EQZA 4D9EA 3DO8A 5FFFA 3FB4A 2LR0A 2DFPA 1H4VB 1JR3A 2Q7XA 3O8CA 4AI6A 2RHBA 3P32A 3TQHA 4ZI7F 3I4CA 4Z4QA 1MAHA 2BMWA 4OGWA 5BOSB 3U6KA 2C59A 1A5BB 1DWPA 1Q19A 2VJOA 3DMYA 5JEEA 4DCGA 5ANRB 3I04M 5EMLA 1KVSA 2HWYA 3UBMA 2VQFB 2CJXA 1JR6A 4JLBA 4AJNA 2XRZA 4MI9A 2HK8A 4UUAA 4R51A 4WLNA 4DWOA 3SU8A 4ENRA 1K3FA 3C5EA 1CRQA 4TQGA 4KO1S 1E79A 2CHGA 2FW0A 1KVRA 2GX6A 1J8VA 1V9CA 3WTBA 2IHTA 3ZK8A 3PR3A 2RKWA 3LAWA 4EFMA 2VJPA 1TVMA 1W5SA 2JFNA 2JHGA 4RPKA 2BMJA 2HY7A 2QQEA 3AR9A 2X0EA 4DNXA 1XAIA 3DEAA 4JJ8A 4CLDA 1PAUA 3BA6A 1EUYA 2TMGA 2Z3WA 4PRZA 2D4HA 2RHGB 4FUTA 1V6SA 2HU8A 2QIOA 1LEHA 1QH1A 2JLCA 4QHTA 2DECA 2NQ2C 5F5NA 4NOJA 4A2CA 2KYRA 5IUNC 4C88A 3F98A 3HNPA 5CYFA 2FPLA 2Q9BA 1JG4A 2OAP1 4MZXA 3UB4A 1OILA 3LU1A 3V8PA 3DFMA 3K0FB 4P81A 2HA7A 4KEAA 3V32A 2DZDA 3G82C 4TV9F 1EA7A 1HEIA 1ONSA 4MVJM 4EHIA 3EPKA 3OFJA 4PC1A 3UF0A 3CMCO 1RQGA 4DRXB 3H2KA 2PQ6A 3OPYB 4P7GA 4PYQA 4QXQA 4DHWA 2XB4A 3VZCA 1BKYA 3FUWA 4J4TA 1E64A 1N5KA 5COBA 4GWKA 2UAGA 4DLSA 1FNSA 1NQTA 4HDOB 1IM2A 2OFWA 3GFBA 3VR1A 4BFVA 3A6LA 1N6PA 2X4LA 3KT3A 4DQVA 3ZU3A 2ZJBA 4LKRA 5FPHA 4YO7A 5A7HA 3KFVA 4QFDA 2BBTA 1RWOA 3RYCB 2FW8A 5BNZA 1CQJB 2X1LA 1C9MA 1R37A 1RWMA 1KKMA 3GJRA 4XASA 3PJGA 3G5AA 3A36A 5HJ2A 4CTJA 4P4LA 1FLNA 1G6HA 3AI3A 5EXDA 2Z9CA 4OMFG 4TWZA 3B12A 4E2YA 5J2TB 4F21A 1Z25A 4Q21A 5TV2A 3HCBA 4JL8A 3G7NA 2DU8A 2PUBA 4RESA 4PAQA 1EP3B 1EBBA 4LA4A 5EIFA 3AVTA 1JFTA 1V9LA 1ZU5A 1LK7A 3EGXA 1ACLA 3RTCA 2ST1A 5IAOA 1CFZA 3UYLA 4ZMSA 3V1MA 1B0UA 2BP7A 4IIJF 4FYYA 1E5DA 4ZCIA 2QORA 3NXKA 1UZAA 2RHLA 3LQYA 3EISA 4TSRA 3VAYA 5HKAA 3FUVA 4TYQA 2C2BA 2FEKA 1X1RA 4FBLA 1CTQA 4DZZA 3EZXA 3KLNA 5ALDA 4YCBA 3SC6A 4M6WA 2ZJYA 4B3HA 4N0DA 4MV9A 1GSHA 2VL7A 1MXFA 2GEVA 3BHNA 3KX2A 1DBQA 4KXFB 5FPKA 4IDNA 2CXQA 4LZZA 8GPBA 2OGTA 3BBLA 2VP4A 3WGOA 4OFBA 3AG5A 2OD9A 3OKCA 1YRBA 1MO2A 2GASA 1T3GA 3P4UA 3RFFA 1Z0KA 1PP4A 1WY7A 2FZ4A 4QU0A 1M2VA 3FWHA 1MIHA 4ICIA 5G2OA 1N0UA 3FJ1A 1UWCA 3ZHTA 1YE3A 1Q0RA 3BGDA 2Q99A 1QOPB 3ZVRA 3AW9A 1XHFA 3BWMA 3QVGB 4PFKA 4RH0A 1RTTA 2FN9A 4GBED 4QFMA 4W7SA 1QFYA 4MRMB 2EU8A 4OBBA 4P7BA 4TUYF 4EB8A 2XYVA 2X8WA 4NBLA 1YQUA 1KNQA 4ZJPA 3O31A 1BHSA 1NSYA 2MU1A 1P0QA 4QAJA 2O4UX 2UUOA 3INNA 1K27A 2J3HA 3IUEA 4W9MC 1KI6A 4PFJA 2VZ9A 2QBYA 1A8HA 4LF8B 1JR2A 3T9BA 1JQDA 1EVEA 4INPA 1C30B 1QHGA 2R11A 3ZI7A 1P6UA 3LDAA 5KU7A 4BNGA 3MERA 3BJRA 3HXMA 2XTAA 4DR6B 2BR5A 3UHFA 1Z7EA 3H4VA 3PQ8A 1ZUHA 4DIDA 2FEOA 3EVTA 2VJAA 3HKDA 1KR2A 4U6SA 3MPOA 4X1KA 4MKFA 2V4MA 5REQB 2OYSA 3RT1A 3BEOA 1TKCA 1UFQA 2FPRA 4YA6A 2I1QA 4CFSA 2GVDC 6PFKA 2G6TA 5BQOA 2FCAA 1CERA 2WWIA 1HYQA 2H7YA 2Y05A 3DBHB 1CFJA 1ZX1A 2ECKA 2QTBA 3DZFA 4GRAA 2Y8EA 3IVCA 1VE7A 2AHRA 3C14C 2W6MA 4Y1FA 4BJ3A 5BPHA 4H31A 4C4ZA 5HF6A 5LZ9A 4PGAA 2QXTA 2B3DA 5BV0A 1M6WA 3SS8A 3CR8A 3G2LA 2JGMA 4PIMA 4I1YA 5FRDA 2CUNA 1L7BA 1RRVA 3RVLA 1Y98A 3O03A 4HP8A 3GN1A 2G1PA 2R4TA 2HK7A 1WY5A 3ILXA 3AC0A 4Y2GA 1BA3A 4MLDA 4G3XA 1CXZA 4GG1A 3AUAA 5TY0A 2XOKD 3R9XA 4UBKA 1FJ2A 1HQYE 4KG7A 4WOBA 1ZINA 4GECA 5CTJA 3REOA 3U0VA 1Y3AA 1QWOA 3PQ2A 1N0VC 4LJAA 1NW7A 4KVGA 5EE0A 4CM4B 1ZRHA 1GZUA 3WXMA 2WKRA 4N4AA 3KYDA 1NW5A 1WD5A 4BKPA 4DVJA 1RMQA 4HBZA 1L4HA 4LF5B 4XVHA 3T9AA 2IF0A 3NEJA 3CF2A 3GG9A 3DCNA 5AJXA 1EWVA 2IPAB 2QW1A 3FE2A 3JPWA 1TUIA 1C8LA 1XMXA 4N48A 1NUTA 2V97A 5HF9A 1WHSB 3MBOA 5DTEA 2Z6UA 4I55A 3RJ5A 3NHLA 3OPNA 4REOA 4NJOA 4PYMA 3DVQX 4NEGA 2QV0A 4BE7B 2YWRA 3H8JA 4MVJH 2VTDA 4J7XA 3LDUA 3MRSA 4JC0A 1CVRA 2JW5A 4R2HA 2OSVA 4R8KA 1WLSA 2PN1A 4MDYA 4PBRA 4WY5A 2WIBA 1T15A 5ALYA 1N3LA 3BJIC 3W4JA 2BHSA 1E1RA 3DAFA 3DOHA 2FOXA 1TPYA 4ZI7B 1UJ5A 1VXOA 3OQVA 3AF0A 4D57A 3PCTA 3CRZA 4G4SO 4IDQA 2HMAA 4BUCA 1K6MA 2GN8A 1TQDA 2ZRKA 3EIQA 3JRXA 1RQLA 1E4EA 4RGBA 3B36A 3UV7A 1V9SA 2DHRA 2IE0A 3AM3A 4DNFA 3PLAE 1EFRA 2ACEA 2PGJA 3OFVA 1TM4E 1CWUA 5C4IA 1W5AA 3H9GA 3DHVA 3LCUA 5EWMA 5KSWB 2WW8A 4Z3OA 1IWOA 1PR4A 1QXSA 1YR7A 4K9PA 4PAWA 4BFLA 1KBZA 2IOFK 2V96A 1I6MA 1WB4A 2C9DA 3OJLA 4L57A 4RC9A 3VPFA 3C3BA 5HZMA 3U56A 4TXHA 1J2EA 1MHTA 3CZPA 1GDTA 4FE3A 2C5LA 3RI3A 2LWIA 4BNDB 3WJAA 4XCQA 5EQTA 3HSKA 3QPWA 3T0GA 4V0QA 1WSBA 2NO5A 3BF8A 3TW8A 2GA9A 3T34A 1AVTA 2A0FA 1L5RA 4Z54A 1Z74A 2CVFA 5IYZA 2XT6A 1MOQA 2ISCA 3G9ZA 3AUFA 4Q0MA 5CDUA 2HEGA 3QBEA 1BTOA 2WMNB 4PCLA 5MN4A 1DIRA 4KN8A 3DDCA 3AFOA