3PF9A

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
molecule keywords Cinnamoyl esterase
total genus 88
structure length 251
sequence length 251
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pf9A00
1IZ7A 1HLGA 5CT8A 2I3ZA 3DS8A 2WIFA 5JIBA 3R3UA 3WKDA 1CUBA 4WY8A 1EB9A 1CUIA 3NWOA 2WIKA 1LPAB 4BVJA 1R9MA 2OCGA 3OURA 1G42A 4H7HA 1TIBA 4UBIA 1UOOA 2QZPA 3P2MA 3WWOA 2HDWA 4X93A 2D5LA 2GZRA 3QMVA 4G9GA 3L1HA 2XUAA 2XMQA 2QS9A 4HRYA 5DLPA 3BDVA 2Y2UA 4PO3X 4Q05A 2XMBA 5FPQA 3DD5A 4L0CA 4EY6A 1W4LA 4FHZA 4M0EA 3DJYA 2Y2VA 3R3VA 1XZLA 4H7FA 4ETWA 2OAEA 4J0HA 5C7YA 1R88A 5AKYA 4HAIA 4M0FA 3WI7A 4DNFA 1CUWA 4K6KA 4FFWA 4W1SA 1ORVA 5H3HA 4PSDA 5CT9A 1O6FA 3D4LA 3VJMA 2R11A 4K2AA 5HCUA 2FUKA 3G0DA 2GBFA 2OCLA 2GBIA 4LYEA 3ZV7A 4M0MA 1QIDA 5C8ZA 4TPKA 2OG1A 4UBNA 3WJ1A 4H7KA 5ALQA 3MGAA 2VEOA 3H2GA 4RNCA 3QBJA 5SYMA 3R3XA 1ZICA 4CI9A 2HA2A 2XUJA 1F0PA 2YYSA 5JASA 5ISMA 3PUHA 3QZUA 1E89A 1ZD2P 1LPOA 3BL8A 4QA9A 4D9JA 2ZSHA 4DMHA 1HKHA 2WFMA 4BC1A 2O2GA 1SCKA 1LBTA 4U2EA 3VVLA 5BWBA 1XKTA 1ODSA 1UOQA 4H7IA 4HVTA 2H9YA 1I6WA 3W9BA 2V98A 3I2FA 5LYYA 4WDQA 3SX4A 3WWEA 3NUZA 2XMDA 3W05A 2WHQA 1CPYA 1VOTA 4H77A 1T4MA 1G66A 2ZJFA 5ALZA 1NU8A 3FWHA 1MX1A 5JD6A 1WCYA 1VXOA 2OLEA 4X6XA 4X92A 4Y2QA 4QEKA 1XQWA 2QMQA 3HJUA 3CCBA 3VJLA 1IZ8A 2PSJA 4X6YA 4B9AA 2WG2A 4IH1A 1EK2A 3AIMA 1Y37A 1QJ4A 3HEAA 4BZWA 5CTAA 4GBGA 3G8YA 4KEAA 4X6UA 4GWLA 1ODTC 3WKBA 4A16A 4H0CA 4BTVA 2BUBA 2VTVA 3KD2A 1M33A 2WHPA 2AJBA 1TK3A 4PF1A 1B6GA 2HU7A 2PBLA 4X71A 4I4CA 3A2MA 5C8XA 4KE9A 5AICA 5DJ5A 1QGED 3PDCA 5AKIA 3X3HA 3DOHA 4G4IA 3I6ZA 2XI4A 2JGLA 2E3JA 1QIGA 1T2NA 4EHBA 2WHRA 1JU3A 2J3DA 1J06A 1ZD4A 4AO7A 2BCEA 3FSGA 3PFBA 3WWCA 4RGYA 1GPNA 1E8DA 2AXEA 4PNZA 5FV4A 2O2IA 3T4UA 2HA6A 5CMLA 3AZPA 1K6EA 4OB8A 3EQ9A 2XUIA 2PL5A 4B7ZA 3E1GA 3VJKA 2UZ0A 2HRRA 4S0XA 3LIPA 5AHXA 1TKRA 2B61A 2QXTA 4BBZA 4GHWA 4DSZA 4ZV9A 2EDCA 1DWOA 4ZI5A 2OPHA 2PSEA 4KYVA 4ZRDA 4EZIA 4UFOA 1AX9A 3VXKA 1XQYA 4UHHA 4G4GA 2J4CA 4G8BA 2WKWA 2VATA 1VA4A 3S2ZA 2QOEA 1FSSA 4B85A 2EEPA 1HPLA 4LXIA 3S8YA 1C4XA 4FBMA 1WHTA 1H2ZA 3RM3A 1OILA 1NU6A 3IBTA 3QVMA 3RLIA 4DNOA 5AIAA 1JJIA 3AZQA 1QOZA 1DWPA 1GZ7A 2WIGA 4W1QA 4AX4A 5EHNA 4XVCA 1MO2A 1AURA 5CH8A 3M3DA 2PX6A 1J2EA 2XUKA 4EY5A 4C4ZA 4G8DA 4UBOA 5AKGA 1EDEA 5KBYA 4F0JA 4GECA 5C8VA 1LZLA 2HM7A 1LZKA 3QITA 2V9ZA 2AJLI 5DYWA 1AUOA 2H7CA 1JMKC 2WUEA 4UUQA 1BE0A 5ALUA 1BN6A 3OM8A 3IUQA 5IH7A 2YH2A 3GUUA 4UHFA 3JWEA 5I7UA 4GXNA 7YASA 1JMYA 5AKLA 3N2ZB 3D7RA 4BAGA 4FTWA 3PUIA 4H7DA 1XZAA 3IUJA 3VISA 3NOXA 1SCQA 5CURA 4XWGA 4LXGA 2LIPA 5DTIA 1YSCA 3K2IA 1AQLA 2VJCA 4BE4A 2B20A 1R3DA 2VF2A 1E5TA 4BRSA 4G9EA 1PFQA 5HF8A 2PU5A 4Y2SA 2O7RA 3U0VA 2DSNA 4WCVA 1CUXA 1LLFA 3C6XA 2ZYIA 4ZV7A 3FYUC 4BC0A 4IHAA 4ZGBA 2GBCA 2HL6A 3WL7A 3F98A 1AKNA 5FXMA 1N1MA 1ISPA 4MEBA 5CT6A 5AKEA 2XMZA 4KE7A 4BP9A 4UBLA 4FMPA 4H18A 5J3JA 2HHAA 4I19A 2XLCA 4Q34A 5E2IA 2WFLA 1S8OA 4AXBA 4AQDA 5FKJA 4KAFA 3EQ7A 3HRHA 1GPLA 2HA3A 1EDDA 3AINA 4QLOA 4F21A 1TCCA 2HA4A 1XROA 4MJ3A 5AI5A 2IX9A 2FJPA 2QM0A 4BRZA 2WFZA 3WKAA 3F67A 1QONA 3C87A 5JZ9A 3H2KA 4JYMA 5HQ3A 5JZBA 4AN0A 5LZ5A 3IB3A 1L7AA 2RAUA 2W22A 3DOIA 5JADA 2C0PA 3WA6A 4ROTA 5AK3A 5HZGA 5IVDA 1W75A 5I8PA 4BVKA 3BXPA 2CKMA 1CV2A 4G1FA 4KRYA 4Q1VA 1TCBA 1MTZA 2AJCA 3BIXA 4WFJA 1CR6A 2BAGA 4DIUA 3RK4A 1CUVA 2ACEA 4Y2TA 6YASA 1A8SA 1XLVA 4L72A 5HKBA 4AMZA 5CBKA 3C43A 5AM1A 5ALSA 4XIIA 4IQ4A 1ZGCA 3WWDA 3C6BA 5LZ8A 2WU4A 4N8DA 1GQSA 5EFZA 1CUCA 4V2IA 5ALGA 4PSCA 2WFLB 5K5EA 4GW3A 2HA7A 4Y2PA 3O95A 1B41A 3G0CA 3WL8A 1BN7A 4FBLA 2RI6A 1QIHA 5HF5A 1U65A 4LXHA 2XUFA 1XRNA 4H7JA 1XRLA 2XUOA 3BWXA 3OPMA 1LPNA 2BKLA 3C8DA 2ECFA 3ESBA 2V96A 2C58A 2X8BA 1WB4A 5K3FA 4RE6A 4YASA 3WYNA 3QPDA 1J07A 1CEXA 3WJ2A 2XUHA 3G0IA 2V97A 2RHTA 1CUAA 5CW2A 4IO0A 2RHWA 2QJRA 5DTJA 3UUFA 1ZD3A 1IVYA 3KDAA 1GT6A 1EVQA 2ZYRA 3V1KA 1LPBB 1BROA 2DFPA 3ZLTA 5ALKA 3BF7A 3HYSA 4J0GA 3ED1A 1EDBA 1XZFA 3H2JA 2WM2A 2Z3WA 5F4ZA 2CEKA 2JIDA 2HRQA 4L3WA 2BUAA 4HRXA 4UPDA 5AM0A 2WTNA 1AMNA 1UKBA 4B83A 1R9NA 3AFIA 3B5EA 4EB0A 3WQHA 1UKCA 4KRXA 4BATA 4BCCA 1CUFA 3G0BA 4KR0A 4MEAA 2QRUA 2HU5A 5K3DA 1YA4A 3RARA 4GLBA 4Y2UA 5LKRA 4J7AA 3O4JA 1Q84A 4MQMA 1IUOA 4YPVA 1XZDA 1H22A 2X76A 4KE8A 4DGQA 3C6ZA 4LKOA 1W1IA 5AKXA 4B9EA 1CVLA 5K3AA 1BCSA 2C5GA 1SC9A 3FVRA 5T4EA 4N8EA 3FCYA 5A71A 5CT4A 1GKKA 4ZXFA 4BCDA 4KE6A 5A7HA 1EH5A 4GDMA 1IMJA 4UBKA 4WJLA 3E4DA 3L1JA 5KWJA 3DL4A 5ALJA 2WJ3A 3QPAA 4UHCA 1Z68A 2XUGA 1JFRA 5IKXA 1XQXA 1H2YA 1KU6A 1UK6A 2XUPA 4B81A 1CUZA 3QYJA 4NMWA 1N8SA 1HQDA 3ICVA 3ZLVA 3GFFA 1QFMA 3PFCA 1CUYA 1G4HA 1YCDA 4UBJA 4P08A 3QPCA 3TEJA 3U1TA 1UOPA 2BUCA 4I3FA 5EIHA 1E66A 4Y2RA 1K8QA 5T4BA 2B9VA 2HADA 2OCKA 3EBLA 3F97A 2PSFA 5LP1A 4K5QA 4BTLA 1PJAA 4ITVA 3FOBA 2YXPX 1USWA 5AI9A 3G9TA 5AOBA 4CIBA 4G8CA 5AKKA 2ZYHA 1C7IA 1XZBA 1YAHA 4MWTA 4P93A 4J0JA 4QLAA 3WKCA 2CUTA 1LPMA 5LZ9A 4DSAA 2CB9A 1UT6A 1YR2A 3WK6A 1VA5A 3C8HA 4HXFB 3KWFA 2X5XA 4Q3LA 1R1DA 4E11A 5JATA 1OXMA 2O2HA 4FLFA 1CIJA 2ZJ7A 3FVTA 1L7QA 2XMGA 3CXUA 2J3QA 4EUSA 3I2HA 1ACLA 1YASA 1EA5A 4UHDA 3I2GA 4O08A 4U2BA 3FAKA 3LIIA 5ALWA 2OGZA 4BAUA 1HBJA 4LYDA 3STVA 2PPLA 4XJVA 5ALFA 3WK9A 3BJRA 4OUKX 1VLQA 2C0QA 2G5TA 1BRTA 1VE7A 2I78A 1VJ5A 1XZKA 1QO7A 2DHDA 3C70A 1P0MA 1X2BA 5EGNA 2WU3A 5EI5A 1DT3A 1EK1A 1UZAA 5KREA 4RPCA 5BV7A 2RIPA 5CH5A 4Y7DA 4FKBA 3ESAA 1R4ZA 3DDUA 1WB6A 4JYPA 1XZGA 4KAJA 4CIAA 3ESDA 2CJPA 5AJHA 1XZMA 1FJ2A 1FFAA 2XMCA 2ACKA 3I1YA 5JZSA 1UKAA 4DTCA 3T52A 5K3FB 3H17A 2Z8ZA 1TRHA 5LKAA 3DLTA 5D6OA 3OG9A 1XQVA 2XMRA 5EHXA 5ALYA 2JBWA 3NGMA 4MXDA 2G4LA 1SCIA 4FNMA 1QLWA 3I2KA 4H7EA 1H2XA 2XDWA 2QT9A 5CT5A 5HFNA 4EY8A 4B0OA 3F96A 3ESCA 1CFJA 4X85A 4NS4A 2VAVA 5DYYA 2JEZA 1UK7A 1K5PA 4TVKA 1ZIYA 3WK5A 3D59A 1MX5A 3GA7A 1QO9A 3BE8A 1ZD5A 1CUUA 1EHYA 3AIOA 3KWJA 4OD0A 4X91A 1TQHA 3A6ZA 4RE5A 1HDEA 1CUGA 1XLUA 1EXWA 2AJ8A 1DWQA 3O4IA 5ALEA 3HI4A 4OSEA 1F0NA 5HF6A 5ALXA 3V1MA 5CXUA 2WQZA 1CUEA 1L7RA 4B0PA 4K6HA 1MAHA 1ZIXA 4J3JA 4CG3A 3AILA 3FCXA 2VJBA 3ZWQA 1EINA 1QIFA 2JF0A 5K3EA 3ILSA 5AI4A 2GBGA 3M81A 4W1PA 5AI0A 1XZEA 2QUAA 1MJ5A 3V1NA 3BJMA 4INZA 5AKJA 2Y6UA 1DQYA 4EY4A 4LHEA 4E15A 3E3AA 1ZI6A 2XLBA 2WJ4A 4HXGA 1YS2X 1JKMA 2QR5A 1BCRA 2CMFA 3OTQA 4FWBA 3FYTA 3R3ZA 1Q0RA 4WFIA 1EB8A 3F9CA 4OPMA 4Y2JA 1ZGBA 2DHCA 3B3QA 3IUMA 2BFNA 3EQ8A 3WK8A 3DYIA 1DX6A 2FX5A 2DHEA 1Q83A 4W9RA 1G5FA 1W52X 4OU4A 2JGIA 3H1AA 1A7UA 2XB6A 2FJ0A 2ZYSA 5DWDA 4FOLA 1ETHA 1WB5A 4OYLA 2QTBA 1MT3A 4C6HA 1JT2A 4OU5A 5ESRA 5YASA 3UUEA 4Y2XA 4DNPA 5ALTA 2C4HA 4L9AA 4OB6A 3STYA 1OCEA 4B80A 3ZLUA 1N5MA 1P0PA 5AK4A 5ALMA 5K3CA 4J03A 4CCYB 2VT7A 4QE3A 1DT5A 2YASA 3UMJA 5ALLA 4W1RA 3TGLA 4WY5A 2XQGA 2D0DA 3TRDA 1CLEA 5AO9A 2I3DA 5IVKA 1CUDA 4GEGA 2C7BA 4U2DA 4ZREA 4U2CA 4QDOA 3FYUA 1BEEA 1A88A 2Q0XA 5IVIA 1YS1X 4KJXA 4A5SA 3MUOA 4Q82A 2PSHA 4HXEB 3G9XA 2WUDA 5JAOA 4J0DA 3H19A 3R0VA 4BDTA 4OCZA 4IH4A 1W6RA 5CRIA 5EHZA 4UFNA 5JYCA 3FNBA 1QZ3A 3OOSA 5ALDA 5LIPA 2PU7A 4C87A 3W2TA 3WZLA 2GYUA 2Z3ZA 2Y1KA 4PW0A 2JGJA 5CH3A 2PSDA 3Q8WA 1X70A 4B82A 1JJFA 1UFOA 3FSGD 3WWPA 2DQZA 1YA8A 4E14A 4X90A 1Q0ZA 3V1LA 3W04A 5AIBA 2WSLA 4NZZA 4Z49A 1CUSA 1QTRA 1J1IA 2VAXA 3G9ZA 1NX9A 1XLWA 3WL5A 1BS9A 3L1IA 2O7VA 1DINA 3QMWA 3SC2A 1FFDA 3VKFA 4QDUA 3WK4A 4MQLA 4CG1A 3HSSA 5KWIA 2ZSIA 5AI8A 2ROQA 3I2JA 5AP9A 1XKLA 3V48A 3D3NA 5FRDA 5JAPA 3SK0A 1LBSA 1MX9A 4QDTA 3WKEA 1WM1A 2JGFA 1EX9A 2C5FA 4DM7A 4C01A 2ORYA 2GYVA 1QIEA 1HL7A 2HA5A 1RYYA 4EBBA 4TGLA 3BDIA 3FLAA 1LPSA 3K9BA 2W6CX 3IURA 3FLEA 5AK6A 2PKYX 4KACA 4P92A 4X95A 4U2FA 3AJAA 4G4JA 5AK5A 4GI1A 4C89A 1WPXA 3PICA 4QWMA 1RWQA 5ALRA 1ORWA 2VSQA 1E8MA 4Q3KA 4FNGA 2BJHA 4BVLA 5LZ2A 5BOVA 2DR0A 2WLSA 3N0TA 3WA7A 1ACJA 2IIVA 3CCCA 3MVEA 2JGKA 3M83A 3PI6A 4WFKA 1QIKA 5BWCA 3D2BA 1XZIA 5SYNA 3HLKA 1XZCA 2OQVA 3MUNA 2IITA 3AZOA 2OGSA 5HF9A 4ARAA 5AM4A 4BP8A 2CBGA 4CFSA 5AOAA 1VE6A 5EHQA 1TAHA 2JEYA 4F5ZA 2OGTA 3HABA 4J0CA 1UK9A 3A2LA 1XRRA 1ZI9A 3H18A 5A6VA 4XX1A 2RGUA 4DMFA 3WIBA 2OAGA 2Z5GA 3WIOA 2XT0A 1U8EA 3E0XA 3G0GA 3ANSA 1UXOA 3DQZA 3C6YA 5CXXA 4KAAA 1F8UA 3H0CA 4JNCA 1VZ3A 2OCIA 3HZOA 3R40A 4DMKA 3WMRA 5JAUA 1U4NA 3GELA 2RONA 5AKZA 1MNQA 2WG1A 1GKLA 3H1BA 4QZVA 5D7BA 1BEZA 2VQ6A 4CCYA 1P0QA 2Z8XA 5LLSA 5E4JA 4UHEA 1K63A 5D3ZA 2OXEA 3LLCA 2BGRA 2PUJA 1KEZA 1D07A 5FOQA 4AZ0A 3GROA 1YB6A 1UK8A 1CUHA 5ALHA 5FLKA 4OB7A 2XE4A 1AC5A 2QKYA 1CUJA 3DL7A 1E3QA 3CN9A 1QIJA 5JD5A 1F6WA 3R3YA 3LCRA 2ES4A 3WZMA 4A23A 3O9MA 1DTEA 1R50A 3O4HA 3D2AA 5DYTA 3BF8A 2VJAA 3ANTA 4C4XA 1X2EA 3A2NA 4YX9A 2HFKA 3W9UA 4QDXA 2H1IA 1KU0A 1MPXA 1DQZA 3C5WP 2AJDA 4DNQA 4C88A 3BIWA 4JEIA 5DNWA 5JARA 1GXSA 4EA6A 1GGVA 2PUHA 3AUKA 2QVBA 3KSRA 2PVSA 3EIOA 4OYYA 3IA2A 4HTAA 2H7YA 2ZJ6A 5DNUA 5JAHA 1DX4A 4QDZA 4Y2YA 4CG2A 5FDFA 4PQEA 5ALNA 4BCBA 1XZHA 2VA9A 4BAZA 1THTA 3JYHA 4AO6A 3C5VA 3WLAA 2XQJA 1SFRA 4LIPD 4Y9SA 1U2EA 3DCNA 4PV7A 3O9VA 4F60A 1WHSA 4X97A 3YASA 5HQ3B 3G7NA 2XQFA 2WILA 1IUPA 5ALIA 3HACA 3PF9A 3LS2A 3H2HA 3DEAA 3EF3A 5HFAA 4B84A 1Y7HA 4BB0A 2P8SA 3I1IA 1MAAA 4N5IX 4BE9A 3GBSA 4J0IA 3IVMA 3H2IA 4ARBA 3OC0A 5FPPA 1CQWA 4QWWA 3WYDA 3IDAA 1H23A 3D2CA 2R8BA 5C81A 3ZPXA 1AZWA 3M82A 3R3WA 2H7XA 3JW8A 3KOOA 5T4HA 3STXA 3CN7A 3LP5A 3QM1A 4X3CA 5HKAA 4MWSA 5FP0A 2XQIA 2CZQA 3STUA 1E8NA 3RKSA 1UWCA 4FLMA 2Y6VA 3PF8A 2WIJA 5HK8A 1JJBA 3V9AA 5ALPA 4AO8A 1XRPA 1THGA 4X7BA 2I03A 1QTIA 3SWWA 5LZ4A 5DNVA 3DYVA 2EDAA 2XQKA 3ICWA 3F8SA 1PV1A 4NVRA 5D3KA 5AOCA 3VVMA 4DLNA 1VXRA 4ZWNA 3KXPA 2JGEA 4FFVA 3D0KA 2QUBA 1ZJ5A 2HU8A 3G9UA 1ZJ4A 4UFPA 1H2WA 1LGYA 2DQYA 1ZI8A 5A2GA 2B4KA 3HC7A 4MYDA 5A7GA 4P9NA 4CCWA 3DNMA 3FLBA 5ALVA 3A70A 1MN6A 3IUNA 3TJMA 2G5PA 1C7JA 3B12A 3D5EA 2J4FA 4JH0A 5E4TA 3VDXA 3GZJA 3C45A 4IH9A 4HS9A 1EVEA 3K6KA 3AIKA 2ONCA 3DKRA 3O4GA 4DMCA 4FDMA 2G63A 2XMSA 1YB7A 2HA0A 1JI3A 1MU0A 3QH4A 4UHBA 3I2IA 2GZSA 4QNNA 1FFEA 2DCMA 2ZVDA 5EIEA 1VZ2A 3ZI7A 1TCAA 1A8UA 2K2QB 3DKKA 4W63A 1YAJA 5LZ7A 5AKHA 1ZOIA 1GPKA 1SOMA 5HK9A 4HZGA 4PSUA 1LNSA 3FBWA 1IUNA 1LPPA 3QMMA 5AM2A 2HFJA 3WL6A 3HXKA 2NW6A 4AB1A 2WUGA 5A62A 3O0DA 4YK7A 3I6YA 1GQRA 2GYWA 5EIAA 3STTA 4DYHA 4Y2VA 1ODCA 4BDSA 2QXUA 5JANA 4B6GA 3W06A 5FUMA 1EI9A 5T4FA 2WJ6A 2XUQA 5K3BA 5I9IA 3IULA 4Q3OA 4FLEA 4C4YA 4X00A 3R41A 1FFCA 3G02A 3STWA 4JUIA 4BZZA 1FFBA 2OQIA 5JALA 1RP1A 2JGMA 1BU8A 1W76A 3Q0TA 4UBMA 1O6GA 4AMYA 1CQZA 1QIIA 4AN1A 1AGYA 4K6GA 4WDRA 3I28A 2WTMA 3FYUB 1QFSA 4E46A 1VKHA 5JD4A 4H35A 1JU4A 2WUFA 3IIIA 5AM3A 4J0KA 1P0IA 4X94A 2QJWA 2VT6A 4N8SA 1QE3A 5E4YA 2WHPB 5ALOA 1K4YA 2BGNA 1XZJA 2XUDA 1XFDA 1XRMA 2VJDA 5A7FA 2PM8A 4BYMA 4AZ3A 1WPRA 1QIMA 2WG0A 2WIDA 5AI6A 3I6MA 4MYSA 1WOMA 3PE6A 1XRQA 4G5XA 5AM5A 2HIHA 1Y7IA 1N5RA 5AH0A 4U2GA 5IVHA 4EY7A 1DU4A 1CRLA 3WK7A 4N5HX 1MNAA 1A8QA 3H04A
chains in the Genus database with same CATH superfamily
5TJ9A 2B36A 1FVHA 1HLGA 5CT8A 4LI0A 3HJCA 4AY5A 2UVDA 4BX0A 4AUKA 1VBMA 5ADHA 1TQ8A 1EWTA 1E2HA 4DCOA 4NEHB 3FJ1A 1EWQA 1CB0A 1JX6A 5JIBA 2YHUA 3R3UA 3WKDA 4B4KA 1J33A 1SBIA 4WY8A 4RD6A 1FVOA 4D3YA 1CUIA 2DH5A 4PN7A 5CA1A 2D2EA 4MKXA 3NWOA 4RTLA 3IBCA 2WKPA 3RG2A 2WIKA 4JKOA 1Z4MA 4QFBA 3LMKA 4GX0A 5JNWA 1LPAB 1KHTA 3AM5A 1XEWY 4G36A 4JODA 3OURA 4NV3A 4RGQA 5KWSA 2M1ZA 5C52B 1EU1A 4DGSA 3HYCA 4CKWB 3Q8XB 4MHOA 3EVBA 4H7HA 2AN5A 4MYCA 4Q5IA 5CVTA 4NTZA 4UBIA 1UOOA 2PMBA 3CLHA 4H1UA 4KBGA 4BVHA 1V39A 5JCPA 2HDWA 4PBTA 5GM2A 4GR5A 4PXSA 3H5OA 5BP7A 3SOZA 2D5LA 3ZOKA 1X9GA 2FSVA 4HGNA 4UZFA 1YF3A 3QMVA 4G81A 1OXUA 5JCOA 3VPHA 1T4CA 4OMDA 4JJ6A 2DETA 3GGSA 2NV2B 2QAJA 5DK6A 4PLTA 4EKGA 4PPNA 4KOAA 5JDIC 2WB2A 1TKBA 2A14A 2P2CA 2QZJA 3E35A 1WL8A 4ZVKA 3HJHA 1RQ7A 4JK3A 2UUAB 9ATCA 1RQNA 4P1ZA 1MV5A 1BQ4A 1L9XA 1T9CA 2A9VA 4DLRA 3BDVA 2HK8A 4DCJA 2ZBFA 1E58A 2GGSA 3HDYA 3PFHA 3OM0A 5EYPB 2QX7A 2XMBA 2QXYA 2O8DB 4R5HA 3RLFA 13PKA 3DD5A 3DE3X 3W5IA 2AR9A 2I65A 5LP6B 2YZNA 4JT4A 4B2PA 1XRJA 3R77A 1W4LA 5BVGB 1U0NA 1DUSA 3IKVA 2G9RA 2Q3HA 1AT1A 1QH1A 3LUHA 4M0EA 4CVNA 1OJ7A 1V8OA 2ZR0A 2HT1A 2XE6A 3D3JA 3TMYA 4TRRA 3R3VA 4R2HA 2QJFA 4BV9A 2L2QA 5A3QA 4H7FA 2OAEA 2CVPA 5JQGA 5C7YA 3GLTA 3QSGA 5JCJA 1R88A 2R96A 1LJUA 2OD2A 4WVLA 4YXFA 5HUQA 5DTMA 2NP7A 4ZO9A 3U17A 5DV9A 3WP0A 2Y4OA 4MUGA 3H99A 5LJIA 5MFZA 3ZY5A 5DXFA 5FBRB 1TTTA 4PYMA 4Z51A 3REGA 1H2FA 4DA6A 3B53X 3C3DA 3P9XA 3KG2A 2N42A 5EZ5A 4B6RA 5EJ5A 1Y5NA 4X3OA 4XYGA 2NIPA 3SHVA 4E5MA 4EHJA 3KJXA 1GFZA 2HQRA 2CFIA 3OJEA 2OV3A 4E7PA 4K6KA 2R5FA 4W1SA 4J6EA 1IC6A 2Z2XA 3MCUA 5DNDA 1QVZA 2Z09A 3QHQA 4OQEA 3PNVA 2ZRPA 5JS1A 1USGA 2BZ0A 2JLUA 5HCUA 2XGJA 1W2WB 2HCBA 2GBFA 1XQ1A 4EMBA 4NXMB 3DO8A 1FA9A 2I4IA 3I09A 2ZUFA 4M0MA 4O2AA 1IG3A 2ECKA 2JAXA 3GFPA 3K1TA 4O3FA 2B0JA 2EX0A 5M5BA 1P3Y1 1YWGO 1BU5A 1SB8A 3DEKA 2V3WA 4MWZA 1Z38A 4B3SB 1YJBA 3AVXA 5LXTF 3DDHA 2Q1YA 4PY2A 4WOKA 1JEJA 5BQPA 1A8PA 1KH1A 1M3SA 2AKAB 2P11A 2VF7A 1V2HE 1PR6A 2WAMA 1FBTA 3MGAA 4H7KA 4NCNA 4TYMA 1B93A 2CXXA 2VEOA 3IXQA 4WJZA 3RYFA 4LJ8A 3BC1A 1ODLA 1XVTA 2IP2A 2AUMA 1ZICA 3N53A 1P73A 2HA2A 3HUTA 4KQ6A 4V24A 4LA4A 3EFBA 4LY9A 4TKZA 3CLUD 3LUCA 1L7VC 1JFTA 2V7QA 4MINA 3UKOA 3UFBA 2A7QA 5JASA 3ER9A 4GZLA 2HDOA 4I4TA 3QZUA 3MNFA 1SBZA 1YHNA 1XDBA 2C5LA 2GK3A 4G26A 4UVEA 4D3DA 3VR5H 3GH1A 4YJGB 3WRVA 1C7QA 1C7ZA 1VHQA 2MJLA 4D5GA 3FFWA 1C80A 4Q4AB 3T5AA 3KETA 4Z4CA 2KI5A 3RWMB 2RH4A 3GJ0A 3TVTA 1XWWA 4JYBA 4MW2A 5DEOA 1AHPA 3DAHA 1BWRA 1E9AA 1LBTA 1SBYA 3LRTA 4IX9A 3U3KA 1XP5A 2OGUA 4CPDA 1C3EA 3L6DA 3W78A 1ODSA 2O48X 3NBZC 4R7TA 3UW1A 4EUKA 4CM4B 2ZYWX 2OO5C 1U1DA 3WJAA 4I50B 2Y9PB 3IXLA 1HLPA 1O77A 3M4YA 1UOQA 3DCJA 2J0SA 3ER6A 4O4IB 4XUCA 5KTTA 1NZFA 1FP1D 1T8WA 3CNEA 4OKSA 2VLBA 5HZHA 2V98A 3I2FA 5LYYA 1X0XA 3NUZA 4FUTA 1L6RA 3LX8A 3PDUA 3LUAA 2WHQA 3W05A 1UBOS 5AUOB 1CPYA 1N92A 1J20A 1VOTA 3DZCA 1RVV1 4RIGA 4N6NA 4H77A 4YWHA 2RGWA 1W88B 1G66A 2ZJFA 3LNCA 3V4OA 1EESA 4N65A 1QG0A 1JXMA 3IQGX 2Y71A 3COJA 1R6VA 2EBFX 3LUJA 3BSYA 3TB4A 1PT6A 3W1EA 1GU0A 1OVGA 3A7DA 1A2OA 4LOIA 2H31A 3QWAA 1OAOC 3K4QA 4WZAA 2ODTX 3FCSB 1MX1A 3AUJB 3FWHA 3O5AA 5E0OA 3T7TA 1VJTA 3IOBA 1RM5A 1JDNA 3MBOA 1JBKA 4QO7A 4O25A 4AMUA 2VNKA 3LFTA 3T0IA 2WWXA 3T3EA 4D82A 3CCBA 4O29A 3NBFA 2SECE 3HA7A 2GKSA 1FDOA 3Q3VA 2G4CA 1D04A 4XX0B 2HC9A 2B5OA 2DT8A 3E2IA 3PWKA 1P2BA 3VGPA 1SAYA 2V6GA 3PFGA 1IOZA 4KI7A 4B33A 3BGIA 4OXRA 5ECYA 2PEZA 4JOCA 1KMQA 4HDSB 4X6YA 4IH1A 4B9AA 2BI7A 3RYCB 5D5PA 1HE1C 3MWLA 3MWJA 2VJNA 4BZWA 3AOEC 4LF4B 1A9XA 2Q4EA 2FJUA 1QYRA 3WKBA 1QC5B 4DIFA 1NVTA 2OBFA 1HSZA 2VTVA 3QKUA 3R7LA 1I32A 1JZQA 5A9SB 4E08A 1M33A 1MXHA 2Z8YA 1VSTA 1Y48E 2X3FA 4KKVA 4C7OB 2NM0A 4OAPA 5ELXA 4AX8A 1QUEA 1RWOA 3HYNA 2PH1A 2WHPA 1K3TA 1V5FA 4PS0A 4RVDA 4BFTA 5IJ0B 4C0SA 2ZPTX 2J87A 3ID6C 3EODA 1GZDA 1FSPA 2R8OA 2XADA 5JBQA 5C8YF 3D6HA 2DMRA 3BE4A 4LMAA 4LWOA 2WABA 5E8JA 4GZ3A 1PD1A 3RT1A 5IT4A 1GNTA 1V7ZA 3NI2A 2Y76A 2I4MA 2YL2A 4KDCA 1SVNA 5IBRA 3O2NA 5C8XA 2X9LA 5HBGA 2IS1A 4X6LA 3FGPA 3NP7A 2WR8A 3UGKA 1QK3A 3E8SA 1D7OA 1KQOA 2CCKA 3IPRA 1HUQA 4JI1B 5K8IA 1E7SA 3ET4A 3DF7A 3ZKWA 4D9MA 2XCSB 1N25A 3EFHA 3PDCA 3WTCA 4YP9A 4BO1A 1S5PA 1P4JA 1GITA 2FGJA 2PRJA 2RKBA 2GAFA 1H65A 3PQ8A 4G4IA 4PG5A 4ZGGA 5HM6A 4MYRA 1C5KA 3I6ZA 5LPNA 2VH1A 2XI4A 3B1VA 1SXJE 3FCAA 1IWOA 4LMBA 4ECAA 1S1CA 3AVVA 2PGXA 1QIGA 1RHRA 3MS2A 2GN4A 4Q48A 4RL4A 4V39A 1H5QA 1UAYA 1A69A 1JU3A 1Z6XA 4QJIA 2J3DA 1AQ6A 3COWA 4CF7A 1QHIA 3FB1A 2AXEA 4PTYA 2GXUA 3USCS 4AYWA 4MHTA 1DPFA 1A50B 4MR7B 2K4MA 3SNHA 1JPNA 3IPCA 3EIWA 1ZCZA 1DUIA 4WASA 4UUPA 2QU8A 2VS1A 3TOVA 3EC2A 3VNBA 4YLEA 1L7MA 3V2UA 1SO8A 2FZEA 4YGYA 1A2KC 2UXDB 2WVJA 3GLFA 2VRCD 5JQGF 3MIZA 5JPIA 1MC5A 3E1GA 3RS2A 3KUDA 1EIWA 4XXHA 2FWIA 3NEJA 4GGMX 3GP8A 3DV2A 5CNKA 2HRRA 3L7MA 2ZUEA 3LIPA 5BRNA 3OIWA 1C7RA 1JDVA 3W8EA 4YLGA 2B61A 1S2NA 4B7CA 1W4BA 2YVKA 4LJRA 1LFDB 1GGKA 1V1RB 4GHWA 1X92A 4IIVA 2HK6A 4KQCA 2L17A 2EDCA 2JHGA 1HURA 4CHTA 5B30A 3RV3A 4W5HA 1PAUA 3NO4A 4UEWA 4YMSA 3VVCA 1NUAA 2RGCA 4O1IA 4J75A 2IHTA 1KGDA 1BKYA 4Q7KA 3G2LA 3GLHE 3PD7A 1Q3KA 1WMAA 3WO1A 4LQ4A 1GL9B 5IPFA 2AZMA 3S1LA 1ZJWA 2OTCA 3ZE2B 6NULA 3OY7A 2I2XB 1ESMA 4RVOA 2XWJI 1I4WA 4P3OA 4KPUB 4RD3A 3FPKA 4JMLA 3UGTA 3DB1A 4G4SP 1R15A 1ST3A 5LP6C 1FSSA 5TEWA 1I7LA 4D44A 3C3KA 5BSUA 2EEPA 2H4ZA 1PJBA 4G0XA 1C4XA 1H1DA 2BEVB 3GX1A 4IOJA 1L5VA 3S8YA 1TJNA 2ZS8A 1VL8A 3MD9A 3RM3A 5I5EA 3H9CA 3OZSA 3FBTA 2OOKA 4KN6A 4UQPA 3VOSA 1HR0B 3RLIA 5ERXA 3E61A 4GOOD 2NU8A 3ITEA 4F85A 1KDPA 3H5LA 2IELA 1II9A 3B85A 3IT0A 4EFNA 4XVCA 4P81A 2PUDA 1NW7A 3QG5A 1WOYA 3VH4A 2ZE6A 2B3TA 5IRCD 3QVJA 3K4HA 3S6JA 2XUKA 3IOEA 4WLEA 3BXOA 4E2XA 4HYEA 3E15A 1VMAA 4G8DA 1U7ZA 4UBOA 3PQ5A 4F1JA 4MQBA 2IU4A 1Z16A 2J3MA 1TAUA 1EDEA 1RBZA 4V0OA 4YVFA 1H3FA 3PHLA 3V8QA 5KU7A 5KBYA 1X74A 3PA8A 4NBSA 4M1MA 3M70A 2QNBA 2QV7A 2QD1A 2JH8A 3EXFB 1TJ4A 4PRZA 4PXYA 2GN8A 5JWHA 1FDIA 3WR5A 1VIMA 3GRFA 4BUCA 1QQ6A 1NUPA 3IQWA 4IJQA 4DMMA 4F56A 1VL6A 5C8YB 3LQ4A 4S04A 1HRKA 2GEDA 3AF0A 2I1QA 1Y4AE 3D7NA 1KNXA 1N77A 3UHJA 3M34A 1DG3A 1EUZA 3G2OA 3ZCUA 1PNRA 4RZHA 5M29A 1NYRA 4BNDA 1KSFX 4TWAA 1A04A 2EZ9A 4AECA 3L06A 3T38A 3LQFA 4YO7A 3KK0A 3KP1A 2EU8A 1F12A 5EY5B 4OHRA 3WLHA 4DIDA 5BSGA 4U6SA 2ZYVX 2VDWA 3HUFA 2J32A 1HEUA 4M54A 1UPTA 4ZCLA 3DXYA 4Y98A 1HRDA 3JD1A 1JAHA 1ZUWA 3H65A 3S1AA 3KZNA 3GUUA 3HO6A 3QQ5A 2D5IA 1UANA 4I1IA 1PNOA 4UHFA 2VHUA 1M1YA 1B7GO 1G5IA 4OBWA 2HEIA 4FSXA 3W9YA 4ESHA 1JHUA 4EUHA 4RTQA 4QT4A 1SIUA 4ZGWA 1JMYA 1E9EA 4EGJA 1UPUA 3ZVKA 5CAEA 5ED4A 4O1HA 4BAGA 4WMLA 2Z4TA 2AX4A 3ZDDA 2JLBA 1FTSA 1G55A 2FW7A 3P0IA 4C5CA 5KTOA 3LW8A 3PUIA 2BKAA 3CNLA 2RK3A 1QDEA 3HY6A 3N0XA 3O8QA 1XZAA 2H0RA 3BQ9A 4LSMA 4JLOA 2Z56A 3JZMA 3CYFA 3JPYA 1Z7GA 4LDJA 4MV6A 3MRXA 2DT5A 3UJAA 1L5FA 1EXNA 4MRMB 3X1ZA 3Q0IA 4BEWA 1SU6A 4A2QA 5FYQA 5JY6A 3QUAA 1F4VA 1LBHA 1RKUA 2HF7A 4ONEA 2FP4A 5JVDF 3GFTA 1JSZA 2AFHB 2MSDB 3N2KA 3S2SA 5K7SA 2FQXA 5BO5A 3WBFA 4BE4A 3CMMA 1R3DA 2VF2A 1E5TA 1C9EA 1LSJA 1XTTA 4WLNA 5DW0A 4ZAWA 1UDBA 3L6OO 2CNDA 1PFQA 2F59A 2NSHA 3OEYA 4Q4HA 5LFAA 3EC1A 1YZGA 2IK8A 1G0NA 3AJEA 1U8XX 1UZNA 1MGPA 4HAZA 1CUXA 4PAQA 3U0VA 1LLFA 3C6XA 4O4JF 4ZV7A 4V1CB 4JX9A 4RPKA 1U0TA 4IHAA 2C92A 2QTZA 3HA5A 4RIFA 5E6RB 4ZGBA 5FAKA 1VKZA 4Y6LA 3GRAA 3RRBA 3CU5A 4ZMSA 3RUFA 3VX4A 4C0AC 1TPZA 4QTYA 1NI3A 1UQTA 3LZDA 3U13A 4DWJA 1LF5A 3FVWA 2Q5CA 1N1MA 1R6UA 5IKEA 1JQDA 2PH7A 1W0JA 3F46A 1JZSA 3ZWOA 5I4BA 5F2EA 4ZCIA 1N0WA 1NOIA 3KWMA 1QVAA 3NRBA 4I19A 5COBA 1GG2A 4I50A 4Q34A 2VWHA 5E2IA 2WFLA 1S8OA 1S96A 4IMIB 1SEPA 2J0UB 4N12A 4TLDA 3WMXA 2O8VA 4V02A 4AQDA 2PMCA 4HPJB 4L75A 4ZDWA 1DBSA 1MX3A 4PRLA 2GHRA 1RTKA 1TLFA 2GUWA 3RG8A 3G6WA 4B2YA 5ANRB 4MPDA 3ABSB 3L5OA 5DSXA 1EDDA 1RHQA 3QXJA 1U5AA 4EDFA 4F21A 1DARA 4YLYA 1GPDG 3VYWA 2ZI6A 5AI5A 5EVJA 1XROA 1TI7A 2UZ3A 2ANBA 1GLGA 2QM0A 4M0KA 1JJAA 4BRZA 5EJ8A 1NBEA 5J1TB 3M6MD 2QRVA 4BBAA 2Q49A 3ADKA 5FPKA 3V00A 3HCEA 4MLPA 2R6CA 3VDNB 1I01A 3FETA 1GQYA 2I66A 2J6CA 4CLRB 1JNYA 1T2FA 2RG7A 3RRNA 4M87A 4OBBA 4ZI3A 2NTJA 1I51A 2VDQB 4B7UA 3DPIA 1W44A 4P5DA 3EGXB 1M6HA 4IHKA 3WAGA 5JZBA 3W7BA 4AN0A 2PYIA 3MILA 4N18A 1WIWA 4Q9LA 4HSGA 1EFLA 4Y9UA 4CDRA 1OH5A 4ZEMA 3IB3A 4EEZA 2W22A 3DOIA 3RSGA 4NP6A 1E2NA 2KYRA 2O1XA 4L8LA 4LC0A 4ROTA 1C9YA 3DBRB 1MA0A 2AKEA 4EHHA 4AU1A 1I2AA 1SM4A 4G84A 3KSDO 5HIKA 2XIJA 4OHKA 1RI1A 5E1BA 3DVSX 1CV2A 3CBGA 3DBLB 2BH9A 1OFUA 1U98A 4Q1VA 4D97A 3BIXA 4RJIA 1QX3A 3U1VA 1ZK0A 2CYCA 2J85A 3K9LA 1H1LB 1HZZC 4KGZA 3UB3A 4AKSA 3IPYA 1U11A 1CR6A 5TQ0A 3S2EA 4ZOLA 3RK4A 1VECA 1VIYA 3UOWA 4DEXA 2TRSB 3GFQA 3C3PA 3PTAA 5IX8A 2ZSJA 3P2JA 1ADFA 2RHDA 3B48A 6YASA 3VRHA 4N5DA 3Q8MA 4L72A 3CKLA 3UM9A 3CSUA 4LE0A 5CBKA 4LHYA 4TM7A 4X20A 2XKAA 1K4MA 5ALSA 5AM1A 3RHFA 4BRSA 4MQEB 4E12A 4JI7B 4XWAA 2HNAA 1S3GA 1WZ2A 2WMOB 4CV1A 5A6SA 1PFVA 4ALMA 5AW4A 2HOQA 1U0OC 2VPPA 4YJFB 5G0WA 2AN9A 1U6JA 2JLRA 3NAGA 5C0OE 5LZ8A 5KU1A 2GN2A 3ZE7A 2FR0A 1II8A 2GN1A 3UJ3X 5EFZA 1EMDA 1ENZA 2OZKA 2QE7D 3RVSA 2GAJA 2OCBA 3GA0A 4I3GA 2V7BA 5K5EA 4QSMA 5JMPA 1Y7PA 4KWTA 1FK8A 2Z0MA 5J5VA 2ZIAA 1F6DA 3MLEA 1VE5A 4JL5A 2C2MA 1N2HA 4BLPA 4NU6A 3ZZTA 2CLMB 4MV0A 3A25A 2EGUA 3AB3A 1K98A 3QVOA 4WNAA 5BXYA 4UUAA 2BGUA 1G3RA 2QRMA 3QBVA 2GUGA 1ETUA 4TLCA 3ZHUA 2QTCA 2JGAA 3H8WA 1SVIA 6CHYA 1U65A 1ZN7A 4J8PA 2WNHA 2FEKA 1XRNA 4Q4CA 1N7IA 1W88A 4U1RA 2YRWA 3KVNA 1EJ6A 4BMZA 3PHGA 4BVEA 1M2EA 4CGYA 2QPLA 5IAAA 2CJWB 4I7EA 3B38A 2FLKA 2F62A 5KOYA 3ESBA 2NG1A 3TKYA 2IDKA 4ZEOA 4U3JB 4LXXA 1QRRA 2ZTHA 4UCFA 4AG3A 2VTDA 3FE2A 2EFGA 3CA8A 3A6LA 1ZCAA 4YASA 2BMFA 2FK7A 2YWCA 2WM3A 4HDKA 2R5NA 3NPMA 1CY8A 4RPLA 4W8HA 2OLJA 2AXNA 1Z5NA 3JRWA 2A8YA 3MXOA 1X42A 4HUJA 1I36A 3QPDA 2GKOA 3GQVA 4YGXB 3VH3A 5JS8A 1ISIA 2ADFA 3MRVA 2PJUA 3F9RA 3VR5A 2JEOA 3I83A 3E5HA 1T2EA 2ATCA 1MV8A 3NM6B 3WSVA 4AULA 3PNKA 4IIHA 2VWGA 3AG5A 3NNSA 4EPXA 5CW2A 3EF1A 5KTNA 5HTOA 2FG6C 4RQUA 4IO0A 2RHWA 4QECA 4D80A 3AF2A 3BB3A 2QWXA 4AKIA 1XD9A 4GMXA 1KK3A 4OGWA 2FUG1 1ZD3A 2A0WA 1XTBA 3L7JA 3ZQJA 2P77A 4O59O 3I6QA 1CY0A 2HK9A 2ZYRA 2B8EA 2WYIA 3KOZA 3O8QB 4M0LA 3IGFA 4W5TA 1NL3A 1GVNB 1PL0A 2FOXA 3EA4A 3RUDA 1Y4UA 1BROA 3G23A 4EA8A 3NT4A 2BPOA 3BXXA 2EX1A 3DGEC 1GUYA 4RQBA 4U7PB 3R6GA 2UYCA 3R9WA 4MGZR 1FYXA 4FC6A 1EX1A 5A9TA 4TV9F 4HY3A 1IN5A 3ED1A 4EUNA 2M1XA 2VUUA 1RW4A 2AI3A 3VAAA 1Z0AA 5FBHA 5BT9A 1XZFA 2HHJA 2ZWVA 2K6GA 4HQNA 4LNHA 4RVSA 4D8XA 5BWOA 1VYUA 1ECBA 5BVHB 2QLLA 4RFVA 3V1LA 4JMPA 3OEWA 2BUAA 3PGJA 4ZANA 5FUBA 4ZJYA 4UNSA 2A3NA 2JASA 4WUTA 3NRJA 1TE2A 3ZBUA 1FNBA 1XU7A 2WTNA 4UAUA 4IDOA 3L9XA 4DMRA 2A5FA 4Y9TA 1OH7A 1LRJA 1OQAA 4UXIA 1UJ6A 2Z9DA 2Z1NA 3PEFA 3S8MA 4DUYB 1H4QA 1C4OA 3B5EA 1SHUX 1DCMA 4BQQA 1S4QA 4CLEA 4EB0A 4WK6A 2QBYA 4ZAGA 2GVDC 1D5WA 3GLGA 1E3TA 3WQHA 4LRQA 1P5ZB 4BATA 4F3KA 1HDIA 2NZ8A 3HYLA 3QTTA 3G0BA 3VR6A 1G38A 4MW0A 1RQ2A 3UMCA 4XR9A 3THYA 1VLLA 2HU5A 3BIOA 4IYRA 4BBJA 1CDOA 3RJZA 4E94A 3D4NA 1C1HA 2GJ4A 5IM5A 1N8KA 1O5OA 2GI4A 3TKLA 1DG1G 1V5WA 1W19A 3NR2A 4Z1MA 3URMA 1CQJB 4S3MA 1A72A 3I9LA 3ZXYA 2QN1A 4E5NA 2HSDA 4JR1A 4U5QA 4IVPA 4IDPA 1H22A 3ASYA 3ENVA 3D6FA 3H97A 4LKOA 1K2VN 4YIKA 1M10A 4CN8A 2BFAA 4AXXA 3FSEA 4B9EA 5JWRA 2BTQB 4Z9BA 5AVJA 5CA0B 4BMSA 2J5RA 3FVRA 5I3CA 1RYMA 2WJHA 2PMDA 2DJIA 2D4HA 3FCYA 4BCDA 4KE6A 1V71A 2YN0A 1EBFA 1N2IA 3MTQA 3VYTB 4C1BA 5ITZA 3U09A 1PE0A 3VKHA 3LC7O 4H4DA 3L1JA 1WUTA 3T7DA 3IEKA 2WUWE 3D8RA 1K0UA 1R5BA 3DL4A 4JLKA 5D86A 2IU3A 4UJ3A 3R7AA 2H2IA 1E9RA 1AD2A 1SC3A 2R6FA 4WD3A 5U4QA 5I48A 1DGQA 3R5XA 4FP9A 4HH3C 2CXRA 3B1JA 3CW8X 1AJEA 3PT5A 2C8JA 3QU4A 1CUZA 4DLUA 1JAZA 4H31A 3DQQA 3DT8A 3K6SB 1N1GA 1SIBE 5CG1A 3ROEA 1R0LA 2PS0A 2XYQA 1G21A 4OJKA 2Q3DA 1XCJA 4DHWA 5A4DA 3QU9A 4WOPA 4HWRA 2BCJQ 3JASB 1W6UA 1U3TA 3ICVA 4MI9A 3GWGA 4TOIA 4D4GA 3CB2A 2ZUTA 5AVYA 4MB6A 2DLDA 3UC5A 1CJCA 1YCDA 4HTFA 1I94B 1BHJA 1T3TA 3MTGA 1FQWA 3QKTA 4RHUA 3U1TA 4UNRA 4Y7CA 4RKWA 1NJ5A 3QHAA 3CRNA 2DUJA 1GFSA 1I6MA 1PKEA 1U94A 4FUQA 4JLDA 5IAGA 2B83A 1R6AA 3G2IA 4QYIA 4ZQBA 1GPAA 1KEEB 1NMXA 1VGQA 4GOXA 4IFBA 1E66A 3TDNA 4LSGA 4PEVA 3AH8A 5T4BA 1IN7A 1FYFA 1KEUA 3E05A 4KUHA 2P3QA 3CX7A 4S24A 3NC1C 2HO5A 4L8VA 1C3OA 2ZCJA 4F4CA 4Q7LA 1NWHA 4BTLA 1MOZA 1IVSA 3M6WA 3OT4A 3P0FA 4ITVA 3AKZA 4JL6A 4MOWA 4NBUA 4ECEA 1ZSVA 1ZUHA 2XSZD 3G9TA 1RM0A 4RA6B 1ECCA 1YRYE 2QGZA 1UBKS 4F2DA 4FM9A 2D2XA 1XZBA 2ZYHA 2Z83A 3D6UA 1EQUA 3LO5A 1ZOOA 2Y27A 1H0KA 2IGTA 2X7JA 4P93A 4EVQA 5G1OA 4B7AA 4D9GA 2IYVA 3CLTD 3F0TA 4ZMRA 4CCSA 2CUTA 1LPMA 3E9NA 4K7JA 4KFTA 4MR9B 4YRTA 4CUJA 4DSAA 2WPDD 3ZOZA 5TQ0B 4GI3A 1G20E 4MAFA 2VRWA 1LDEA 4FEEA 1YUMA 2RGNC 4IJ6A 2R8EA 4B3FX 3KWFA 4FINA 2I9PA 4F4FA 5LMUB 2X5XA 2XDYA 4JI5B 1OXMA 2G70A 4ZI7F 2CBXA 2DFLA 2O2HA 1CIJA 2FPPA 3AU8A 3I0MA 4FLFA 3TQHA 1G5QA 3R8XA 2ZR8A 2IH2A 5BNIA 3V46A 2J3QA 1U3VA 5LNK6 2GAIA 4KQGA 1OIVA 2XBMA 4P58A 4XB6B 5G40A 3R4CA 3RUCA 3EW7A 1MG5A 3KFXA 2FSUA 2C07A 3Q3GE 5F33A 2LTAA 2AX3A 1EFKA 2BGLA 4FD3A 1JWBB 2NT3A 4O08A 3URKA 4AF6A 1PD0A 1NQOA 2Q6TA 3DCYA 3FAKA 3BFKA 4OHCA 4YACA 5EKSA 5BYKA 5J4YA 2DWUA 2R8RA 3FMFA 2O3TA 2A9QA 4ZOAA 3UAVA 1WBJB 4BAUA 5FWYA 5B7GA 1DRJA 1IFXA 3L46A 3RIHA 1LLCA 1PUXA 2FUG6 2WWRA 1E1QA 1GEEA 4DLZA 3BH0A 2A5JA 3EHDA 3CEJA 4AJ2A 1Z4NA 3OQBA 3WHKA 2J08A 5A05A 4PFQA 4GMHA 5J58A 2ZRIA 3BTVA 2BW0A 1S4MA 3B52X 4FPXA 3QGMA 4CF3A 3PDWA 3OKAA 1R6BX 1XZKA 3O38A 5F1OA 1A9RA 3HPRA 2EG5A 3LCMA 3C70A 3NOOA 3F7TA 1XGKA 4UMEA 2WU3A 1EK1A 3OQIB 1UZAA 3ZR4B 1ISSA 1V3TA 2PV0A 1IBKB 2AG0A 2IPNA 3IKJA 4DG9A 1AQYA 3GMTA 4ZYYA 5CH5A 1KORA 5CDTA 3HJGA 3F6EX 1JIVA 3QENA 2HGSA 2Y0BA 4FKBA 4PGMA 1T6BY 1ZR2A 2ZT7A 1G6KA 3NMUF 4TZ6A 4NECA 3BZBA 4FZ5A 2CNLA 2WWGA 4YECA 3VZBA 1YBAA 2ZTUA 2RGDA 2GEKA 2LNDA 4TT8A 1P81A 1NSFA 4JGBA 4JGIA 1WSWA 1V9LA 1CS4C 3NCTA 3FPFA 4B31A 3WGMA 2CJPA 2HUPA 2E18A 1WCIB 3EZLA 3H6KA 4HRAA 5AJHA 1ZD8A 3A6KA 1JBEA 1XU9A 1Y1TA 3AI7A 3T3IA 4BVAA 5J63A 1SGWA 3NKVA 3EXG1 4RLFA 2E6KA 1N9GA 1B8PA 5JZSA 1LTQA 4CR7A 1JQKA 5KC9A 4EDHA 1E5DA 4DTCA 2W6ID 3IALA 1RM3A 5K3FB 4UATA 4IV8A 3R7WB 4BHTA 3HU2A 3HV0A 4CMKA 3AHEA 3OCZA 4LVOA 5H82A 4TSFD 1X80A 3OCYA 4RYLA 1SRRA 3TIFA 4C4PA 3WNQA 4CZ2A 2QVZX 3C8MA 3GFSA 2J4DA 3OG9A 2YXNA 1Q1ZA 2JBWA 1Z5WA 3ZY3A 4B3IA 5KCMA 4AY3A 5HR5A 4DLWA 2FR1A 1GGJA 3B70A 4FNMA 1QLWA 5EJ4A 5A4FS 1D6JA 4KX5A 1XZ8A 1H5UA 2IJGX 4HEA6 4H4EA 4LCEA 1JFFB 4MVJG 4C7MA 4YP6A 5EUQB 3WE7A 1DHTA 2JBAA 5EZYB 4O3MA 3UG6A 1CFJA 4X85A 4YR9A 2BSXA 1G17A 4HK4A 1J25A 4RY0A 4TWZA 1OLSA 3ABIA 1SOUA 3BUSA 3MUFA 4Q1AA 1NI4B 2IGBA 4X24A 3T7RA 1UK7A 2A0KA 2FW0A 3CVUA 3C39A 5E7IA 1PLJA 3HFGA 5KS2A 3VAZA 2I6GA 2RGXA 1NKSA 1P62B 2MSNA 3WK5A 4B3CA 2Q4DA 1ESDA 2BMJA 3D59A 3FMVA 5FX2A 5DM70 1SXQA 2IYZA 1RMTA 5BYBA 1P7CA 3SKVA 4GLLA 3ZHQA 4BJHB 1A8IA 3KQWA 3JYOA 1F6BA 1UP4A 3CH4B 2QLFA 4LN1A 1KC1A 4GNKA 3AIOA 2WYUA 1L8QA 1YZQA 1L5OA 1H66A 2C1ZA 2IYXA 2O50A 4HB4A 4IOKA 2OT3B 3A6ZA 3TRJA 1WNFA 1Y3BE 2JHFA 4MV7A 1T1GA 3OU7A 4KPEC 2ZT5A 1YZYA 4E13A 4W9NC 4PTLA 4Z86A 1UBCA 3P45A 4D81A 5HRUA 5KINB 4JI2B 4YTEA 2PHZA 4AF7A 1YDEA 2B8WA 2E48A 3OWOA 4RCZA 4CEIA 1E6KA 2CB0A 2B98A 2VDLB 3DT9A 1PCXA 4JLMA 4JLNA 2ZBPA 3LOQA 2TMGA 2ZB4A 1H8EA 2M98A 3EGXA 1RLOA 3M5DA 4RS4A 4EMSA 2D54A 4YJFA 1HDXA 3CUTA 2WQZA 3LSYA 3PRHA 4WZ6A 4F6CA 4ANFA 1SU8A 1ZH4A 4LJSA 1OFVA 4L08A 4R8VA 4N3BA 2C94A 5FBLB 3T9DA 1NGSA 4R2XA 5D1NA 2REBA 4DPMA 4OXNA 5BW5A 2TMYA 2W2QA 4M8SA 2P9EA 3KVOA 3CEMA 4POOA 4UQLA 4MTCA 1QPGA 3AYXB 4CGZA 4FQ8A 1CJKC 3WMGA 2PSSA 1QIFA 1V37A 3Q11A 4OGKA 1XYVA 4F91B 4K81B 2PJDA 3RTGA 1J2RA 1GAWA 2VG8A 1T9HA 3M81A 5ER6A 4FIZA 1I7PA 1K86A 2G67A 1AN0A 4OI1A 4DHEA 1ZONA 3C3WA 4YDSA 1IHUA 4BLWA 1IXRC 3JAKB 4MS3A 2EKQA 5FOUA 1DKPA 1XV5A 2FPPB 1SKUA 5AI0A 1XZEA 4M22A 5L6LB 5KOJA 3EH2A 3KPJA 1TECE 4X8HA 1S8AA 3I34X 3BJMA 1IPEA 1CD5A 3V1NA 3IP3A 3IKLA 5AKJA 1TC2A 5IDYA 3UVEA 1P8AA 4LHEA 4E15A 1G5RA 1K08A 3BULA 3IOYA 1GADO 3L79A 2BR5A 2J9RA 4YRSA 2RGRA 2OB2A 1GO2A 5EPOA 2CLKB 2MWMA 2WJGA 3TRHA 1ZC3A 2YVUA 1Q19A 1T24A 2Z95A 3VNAA 2BZ1A 1SKAA 3C24A 3L6CA 1TZCA 1BCRA 3QVTA 3B1FA 4G3XA 1O96A 2NAFA 3OLVA 2QQGA 3AR7A 4A6DA 1A2BA 1G4UR 3EUAA 1XMJA 3JQ9A 2DFNA 2JFBA 3FWPA 3MB8A 3OJOA 1PR2A 5ICSA 4F4DA 3A3YA 4M6WB 1A4UA 5BQFA 1C3OB 1LV7A 4WNAB 3VNRA 5FJJA 2AYXA 1NVVR 1FJGB 2IHZA 1Q0SA 5KJEA 1HZZA 1YDGA 1U2PA 2JLYA 4XQ0A 4GYJA 3SC3A 1V0JA 2R6AA 4B6JA 4LY3A 3FPHA 1KO5A 4P4GA 3NUQA 4LJ5A 4FX2A 4LXYA 4MA5A 4OA5A 3AHGA 4IVRA 1Y98A 3M6FA 1G3UA 4I6EA 5BSMA 4IJWA 3A9UA 2I7CA 1PGQA 3C2QA 1IY9A 1NVFA 3DP9A 3IMKA 1JPVA 4YCLA 2PL3A 3LECA 1DTWA 2TMDA 4FYPA 5GQSA 1UXGA 4F06A 5HCNA 3BIJA 1B1AA 4U63A 5DASA 1G5FA 2ARKA 1R8XA 3K72B 3CKMA 3SX2A 4KO2S 3WLOA 3ZZUA 4OAOA 2H1LA 2WTXA 4IDEA 3TSCA 4C0BA 3EVAA 3IS3A 2QPOA 2IQ5A 3FIUA 4CTOA 5KJCA 2A4MA 1P9WA 2LXNA 3K6SA 3DFIA 3CONA 2LW7A 5CFOA 1FBNA 4TKMA 1DIHA 1EM8B 5L6MB 4Y67A 3CH5A 5SZIA 1POXA 1X7YB 4WLUA 2ENWA 3JZDA 4XGRA 3X2SA 4DF3A 2XB6A 5EIBC 1JWAB 4IILA 4ENQA 3DEZA 4YAFA 3VYSB 4EIWA 1XELA 1BXZA 1X6VA 1GZ3A 2D7CA 1NMEA 1EFVB 3KLMX 2FN9A 3UAGA 4AY2A 4XPZA 2QSUA 1W29A 1ELOA 2Y8EA 1BXRB 1L8OA 2GPYA 4HX9A 3RHSA 4C6HA 4M7OA 4I9GA 4OU5A 3QLUC 3D1JA 4PX2A 1EBBA 4MRMA 1O9BA 5GADl 4XOIA 3QVVA 2B1QA 3ESZA 2R8ZA 2E82A 4IZIA 2J48A 1F4PA 4JP2A 1E3WB 1RLUA 4ZVRA 5EMNA 1THMA 4D6XA 1RBMA 2VK8A 2C4HA 2X19A 3GT4A 2VHVA 4L1KA 4RZIA 4TWIA 5AJXA 5ADWA 3K9FC 2CXSA 2WE8A 4B80A 2GNPA 2VF5X 3ZLUA 5AK4A 4FOSA 2IIBA 4XVQA 1R7RA 1VCOA 2NUAA 2H18A 3P5SA 1E0JA 5ALMA 1OIWA 4UNPA 3V6MA 4RU1A 1T0BA 3I45A 1ULSA 1H8ED 5FQNA 4CCYB 4BV2A 1K7SN 3KJIA 2XBUA 3SXJA 4QE3A 5F98A 3JATB 1H2AS 3UMJA 3OQ6A 4ZYXA 1BE8A 1E3WA 1YVUA 1J21A 4W1RA 4IMPA 3AGQA 2YBEA 1Q1BA 3VPGA 5F12A 2BDUA 3IV9A 4LDPA 4ESOA 1YACA 2WAXA 2D0DA 3TRDA 2C8LA 4W9MC 3R2JA 1QCCA 1GLVA 3WS7A 4N9QA 2HJGA 1NI5A 2RCNA 4BX9A 3L84A 1RPAA 2BBTA 4Z7JA 1N6NA 4EPWA 1TU4A 2I22A 4OFWA 3ORSA 4DA8A 3NHPA 3F8TA 1P5FA 2ZS9A 4F5DA 4U2DA 4A0SA 1GG9A 2CNWD 4M0DA 4AQ7A 4ZREA 1M8KA 1RLJA 5JI3E 2GN9A 4LJYA 1M8PA 2PRZA 1GP2A 3EA0A 5DNCA 1QK5A 2Q7XA 2ZIZA 3G49A 4MIYA 3G59A 1DKRA 2QQEA 4C3ZA 1F2UA 1YS1X 3OIDA 4MV4A 3BG5A 5CGZA 3ZLBA 2PSHA 4R2WA 1TX4B 2AEFA 3FWZA 1Z5PA 2Q8PA 3SIWA 1DRUA 3Q5GA 3HYRA 1E6EA 5H3CA 4DDWA 3G9XA 2NO4A 3T0FA 2BE9A 1UZLA 5JAOA 3QPVA 4LEIA 1OU0A 3B2NA 4BDTA 1K7EB 5CB4B 4RM2A 1MBZA 1GR1A 4IIFA 3ROXA 2XTAA 4GMKA 3VHRA 4QUJA 2ZQ5A 2PUEA 1HDRA 2IHUA 1XALA 2XTJA 3I39X 3ESRA 3OZGA 1W6RA 5EWLA 5EHZA 2C9OA 5JUWA 1GL7A 2AB0A 1I9GA 2MDTA 2XJ4A 2Z5LA 2ZRFA 3A04A 3JVUA 3PX3A 1ORDA 1E9BA 1ZGAA 5BSFA 1JHRA 2GHQA 5I3ZA 2YWEA 3C15C 5G0VA 1P39A 2Z4SA 2O57A 3KKEA 1FY2A 3OP1A 3T9BA 3IH5A 3OZAA 2G9ZA 4QICA 5K2OA 1XNQB 3AR9A 4DQLA 1ODJA 3HGQA 4MYTA 3VOTA 5B37A 1G3IA 1U9IC 3WLMA 1SY7A 4IBOA 6PFKA 5E9QA 2DCUA 4E21A 3S70A 2GFQA 2XKJE 5T67A 3PVSA 1E1DA 3HCWA 3UG7A 1UJMA 3PIRA 3WZLA 2Y1KA 2C9ZA 1YDHA 2Q4TA 4PW0A 1Y0BA 3I3OA 2W2VA 3KWLA 2ORWA 4WCFC 3Q8WA 2AG1A 1GUFA 2EARA 3CC8A 2E9SA 3E8XA 4TL6A 3JVDA 3H1PA 1OXBB 2R6JA 3I2YX 3Q8LA 1YA8A 3RYIB 2WMNB 1K3UB 1OI2A 1RXYA 3GLHB 4M9XA 2W48A 5DLEA 3ZKAA 1M8JA 4E14A 4EKEA 1CRQA 4BWVA 4RACA 1G8JA 1JAIA 3CNQS 1ECJA 4GWKA 1IJEA 2PYZA 4YAGA 4NENA 5BV1A 1IYZA 4MAAA 4E6EA 2D1RA 4F84A 1F8YA 5IYZA 4WBNF 2FR8C 5DB4A 1CUSA 2GJAA 3V2IA 2P9JA 1KETA 1AV6A 1RRVA 4FU0A 4AKEA 5CFQA 2JFQA 2R0QC 3U80A 1UH5A 1SUAA 3AF5A 4YEDA 5ITSA 4KN8A 4A3SA 5BQ5A 3NTXA 2F17A 3MJVA 5BSVA 3WL5A 1S3SA 1DEOA 2QGNA 2VJMA 3TR5A 4HAVA 2CHEA 3N0WA 1GVHA 3IKMB 4ZALA 1BS9A 1RXSA 2J3HA 1R4NA 3L6BA 4CL3A 2VDRB 1RXWA 1GRCA 1R10A 4R9SA 4L6AA 4O0LA 5LD2B 3SU8A 4J9VA 4RDCA 3TVDA 2DE0X 1I2CA 1TQDA 4D6PA 1FFDA 4JX8A 3MC1A 4NJEA 2I7DA 4IV0A 5KVVA 2QT0A 3BMNB 3K8ZA 2IHNA 2YIMA 3EWSA 3MTEA 4XA8A 2IY8A 4C06A 5KWIA 4R9UC 2WU8A 1KDTA 3ZX5A 4RF5A 1X77A 1E6CA 2CE2X 1ZS9A 3GJSA 4TMFA 5AI8A 4AP9A 2JAOA 3I9MA 4RW0A 5CB8A 5FEUA 1A1VA 1S8FA 3I2JA 5T6BA 2PVPA 3OIYA 2YS6A 3V48A 4KOEC 2CMGA 5FRDA 3H2BA 5P8WA 2EYUA 5JAPA 4DV2B 5KNDD 1QHHA 4Q15A 1SXJA 5TGDA 2VBIA 4YP7A 4DLPA 1G2PA 1S2DA 4G23A 1UKEA 2VCHA 4V0MA 2YN2A 3LX5A 1X7XB 3NH9A 4QDTA 4G1EB 3R8FA 1AK9A 3ILHA 5FB3A 3WKEA 4BJ5A 1HOTA 4WBNA 4CEJA 4YDHB 3W3AD 4NWIA 3U3JA 4F8EA 2G80A 2ZE7A 3Q41A 3G17A 4NPHA 2R62A 2VQFB 2AOUA 3T3PB 2O8DA 1Z2DA 1UXIA 1AF4A 3Q7SA 1N5OX 1CNEA 2D1TA 2G40A 2JGFA 1N6PA 3OOYA 2ETXA 1WY5A 2X14A 3PCXA 4L5BA 4O2BF 5G3YA 3V8PA 2ZSAA 4BFVA 5JT1A 4JLVA 5CX1A 3T41A 3GLQA 3SDZA 3C5HA 3HCFA 4C01A 1DEHA 2YNMA 2LCQA 2YKGA 4AWAA 1QIEA 1NBWB 1UM9B 4AYXA 3WBKA 1JQAA 1RYYA 1U04A 5ES4B 4EBBA 5IN4A 4WBXC 5HW0A 3R5KA 4MR9A 4JUBA 1MEOA 2ZXEA 2CL5A 1DBIA 1J70A 4R8KA 2C78A 1RKBA 5B55A 3HHEA 2W6CX 2AK2A 4K8OA 3U5TA 4Q1EA 3QFSA 4UDNA 4TQ9A 5AK6A 3JAMA 2HIMA 2VYVD 4MIOA 2G3YA 3TX2A 4UM9B 3N0RA 1A96A 3L05A 2Q3JA 3IUSA 1TM4E 4OHXA 5KX5A 4P92A 3QI7A 5T41A 4IVNA 5L4LA 3B6KA 3JY6A 4EFDA 2Q62A 2WYWA 2X15A 4KO1S 4KCGA 4WADA 1KSGA 4EVRA 3JAWB 1KIMA 1QZZA 1V2GA 3QY9A 5AK5A 3GVPA 4DOMA 2OHXA 1I1NA 3F6SA 3O8NA 4OP2A 3QNWA 4TVBA 4PG6A 2IZ7A 2AC7A 3U3RA 1RWQA 2IZ0A 3TN7A 3SY8A 4B71A 1PWYE 1Y4DE 1EK0A 3RU3A 4JELA 3BFVA 4ZRMA 1E8MA 1XSEA 2PJRA 3ROFA 2E5WA 4IGKA 2E4YA 1X1CA 2OZLA 2BJHA 4P53A 4D41A 2VYVA 1BW9A 1V95A 3AV3A 4BVLA 4PZDA 4LF5B 1HFWA 2A9KA 2J0UA 3IP5A 1KYWA 5BR8B 3DD1A 4MUNA 2HLDA 4W4TA 3JYLA 5IJ9B 2AIRA 2QYSA 1W87A 4KQ1A 4WKCA 4EG1A 4DV4B 4JNKA 2PIAA 5TY0A 3E53A 1ACJA 2IIVA 4L2IB 1P9LA 3UT5B 1VYHA 5BURA 5JCXA 2JGKA 4R1TA 2Z9CA 3S0JA 4LBYA 1KZYC 1JAXA 1AKTA 1NULA 1OU4A 3JQRA 3IIEA 3LY5A 3PI6A 1T4DA 1XZIA 1OE0A 1ZUNB 2P6UA 3B82A 3NETA 1IATA 2OQVA 4CF5A 2FCAA 3H6HA 3U4MA 4RHCA 2H2HA 3N5CA 2RHRA 3ZTWA 1UM9A 1ZY2A 2IXFA 3GUHA 3L1VA 4CM3A 4DQDA 2R7LA 1WW8A 1MUUA 2QI9F 4UFNA 1A27A 3FMOB 4JI6B 3TLYA 3Q15C 1YQGA 3A58B 3PIDA 2OMKA 3DA8A 4X66B 5A4IS 4N1AA 3JCZA 2Z1MA 1WE2A 3L5KA 3TK1A 3TQTA 1QV9A 1VE6A 3F2VA 2PXHA 1NXTA 4HN9A 3E7PA 3Q6NA 1QLJA 1VGRA 1ZHOA 2YVAA 1P75A 3EE6A 4I14A 1XJ5A 3WLNA 1HDZA 1JF8A 2JEYA 3FUCA 4W5JA 4F5ZA 4Z4QA 2P4UA 4IQ8A 3A2LA 3TCXB 2F7SA 3DVRX 1Y8QA 3NEAA 4URHA 4R2JA 3JATA 1FMFA 4HNRA 4E33A 1IK6A 3RGWS 1FNNA 2O5CA 3AKDA 2R47A 5LVAA 3DOCA 2AOTA 2OAGA 4Y6OA 1VLHA 3PQ3A 4PGHA 2XT0A 5DE3A 1SK9A 1O9GA 2QN3A 3G0GA 2OBMA 3S68A 1J8FA 1IEQA 4KH1A 2ZS7A 4FI3C 5CXXA 2GPBA 1F8UA 1UMCA 1SA0B 1Z0FA 2QRPA 4X54A 4R8LA 2A2ZA 2IH4A 2OCIA 1NUHA 2HMAA 4YMLA 3WMRA 4JHXA 1QE0A 5JAUA 4OLBA 4N01A 4F9TA 3GELA 3KOMA 4L27A 3KKPA 4CL2A 3H6GA 1PGPA 4CEIB 1TIKA 1TM5E 3K7EA 1DXQA 3R20A 4OYHA 2FPKA 2ZIFA 2IOYA 4MO2A 2G17A 5ECGC 3C5EA 4FGWA 2BWJA 2OD9A 4QEDA 4UCWA 4YREA 2GMWA 4CMEC 5B4TA 2IBTA 4TXHA 1BDBA 1W96A 1MVNA 3DEIA 3O8CA 3L4BC 4QHTA 5LM3A 3QP9A 4URYR 3HH8A 3CISA 4P2GA 2VQ6A 3WLIA 2PT5A 4CKCA 4HLUC 3W3AH 2Z8XA 3AFGA 3PHHA 4E09A 1YQUA 2JKVA 5HIJA 4QPJC 5SZHB 2H08A 3BSFA 4F45A 5E4JA 4CXMA 4UHEA 4DQKA 4PZEA 1OB5A 4H2DA 3QVWA 4YQEA 4ARZB 2AN4A 4OXYA 5B7PA 3DO6A 4UVGA 1JKJB 2YV3A 2BGRA 4KW7A 3J81A 2Q1XA 5FUYA 4AWBA 1J8DA 4FHGA 3AUUA 5AQEA 1WR8A 3GGCA 3GJXC 1P2DA 1DWUA 1DUVG 3HDQA 4QPZA 4ZCSA 4M46A 3UO8B 4BLSA 1I4LD 4CODB 5HHTA 1ICEA 2H07A 1UK8A 4MWOA 1CUHA 4YRFA 4YUZA 3E5RA 4OJNA 4FFNA 2DBYA 2Z30A 2OHOA 4N4AA 3T9FA 3A4VA 2DPYA 3GCGA 4GC5A 1F38A 4BFSA 5LQNA 2CDRA 1JVBA 4JQYA 2ATVA 5HKKD 1F60A 2QTVB 3GRZA 3DZKA 5ILGA 4A82A 1PJSA 3WICA 4I2VA 4HNAB 1AC5A 4DANA 2W7TA 1QPBA 2J07A 1YZTA 3FKJA 4JR0A 4KFRA 3T1TA 5I9BA 3TW8B 3ZXUB 3BERA 5TRTA 1ZO8A 1U8TA 2KW5A 2ONZA 1XPJA 5J2UB 1X9IA 5G0UA 1T29A 1QIJA 1TM1E 2CSUA 5BWNA 5JD5A 5I8WA 2K7ZA 3CBQA 3LXRA 4IM7A 4BBPA 1JZTA 2YY6A 3FJOA 3PNBA 3O9MA 4FXOA 2CV1A 1DTEA 1R50A 2EW1A 4M1KA 4KQWA 4TV8F 2PRIA 1CDEA 2RHHA 4KZPA 3W6UA 1PK9A 5I5GA 2H54A 4NCIA 4HEJA 2RCYA 4KQMA 2AYZA 4S05A 4TRNA 4HJRA 3RJMA 3WISA 4PVDA 5FTMA 4Y0AA 3A2NA 3F1LA 3SC4A 4YX9A 2NO1A 4UARA 1KYVA 1PJ3A 4DC1A 2FRDC 4YN3A 4BB9A 3O84A 5C34B 4DARA 5HPYB 2FSFA 5F7JA 4JS0A 3FNGA 3KCQA 1JLRA 1ZVMA 2H9AA 1MPXA 2CD7A 4U0KA 4RK1A 5JZMA 2ZU6A 3LK6A 1OROA 1SVLA 4O8ZA 1QYDA 1VKJA 4BMDA 3K20A 4M2LA 2AJDA 2HZ7A 3HRIA 4MI3A 5AJYA 1QF9A 4G24A 4RLHA 3SSAA 2HB6A 3V32A 1Y8ZA 3DV0A 3ZNOA 4M53A 3L8YA 2IYUA 3OLXA 4R71A 2Z04A 1DJQA 3PQ2A 5DNWA 3EZ9A 3E18A 1JXQA 3COZA 1GXSA 4EA6A 2Q5FA 2VPWA 3FRHA 1U2RA 4US0R 3GIDA 1KDZA 2QVBA 2IPAB 2VUSA 3F5SA 1TUGA 4BMOB 4MPRA 1BSVA 3R9XB 2NT4A 1QQ5A 2GSWA 4J90A 3NYWA 2GJ8A 4YJHA 1RFLA 3EEIA 4MQEA 5KAPA 3BB1A 5DNUA 1L4EA 1V41E 4URUR 2PMFA 5CLLA 1DX4A 1L1RA 5M3BA 1XHEA 4UTZA 4J0FA 4MVJI 4YY3B 4Y2YA 2GF0A 5IJZA 4CG2A 4RZUA 4PQEA 4TUYA 4X1OA 5FDFA 5ALNA 2GK4A 4N39A 4B75A 3F7NA 2JLVA 2FMTA 3FNRA 1K8YB 4N54A 4C08A 1THTA 3QE4A 4AO6A 3C5VA 1FDUA 1HWYA 3PPVA 4M38A 1RD4A 2IIPA 3C7AA 5JH7A 2AXQA 4A27A 2NN3C 4AW9A 1V3UA 4CIVA 3MHTA 2DXIA 1JHZA 1N6HA 2R7MA 4RTNA 4YMTA 3DCNA 3LPAA 5IJWA 3JQCA 4OK6A 2EJCA 3CVJA 4G5GA 4AIIA 4AY6A 2XVAA 5HFJA 2OAQ1 2ZYTX 3K8OE 4IOMA 4L8GA 2XQFA 4QGGA 2GEFA 1ZNZA 5DBOA 4IIJF 2WILA 5E8RA 4AJLA 4W5QA 1CW2B 5E95A 3PSHA 1IQ0A 1GTJ1 2QUHA 4MUYA 4ITRC 3S5UA 2ZJ2A 2W58A 4MAMA 1T4CB 4L50A 3AM4A 1QYWA 3F1KA 1QANA 2J33A 2Z1DA 3ANLA 5HFAA 2JIBA 3N7UA 1JFLA 2DUNA 2EJWA 2P8SA 4B48A 1GA6A 1O87A 2CL6X 1DC3A 3A1DA 1A9XB 3IVCA 4UMDA 3GRRA 3WY9A 4EENA 1GZ5A 2HSZA 1MAAA 4WIAA 2DF8A 2X5KO 4PR3A 6REQB 2F1KA 1ISHA 1SUCA 4N5IX 2WEKA 3IQHX 3JD3A 2FQYA 3MOIA 3OC6A 3PHIA 4QAJA 5HJ2A 4C78A 3MD0A 3WOHA 3UOAB 1M0EA 1HT0A 3UMRA 4N0DA 2BTEA 1CQWA 2NZJA 3DFZA 3NBXX 1L5HB 2XNCA 4F2HA 1VHJA 3IDAA 3LG2A 1LUAA 4IUBS 2PX3A 1NVWQ 2FN4A 3UJPA 5I9LA 3R7DA 1R8JA 1U3DA 2JIMA 2FDRA 1VG8A 1BWSA 2H7XA 4FMBB 3B2QA 4E4TA 4EHDA 2ZI5A 2QG4A 4FN4A 4MKHA 1V5IA 4QXAA 4A6PA 1CYDA 1P9RA 2QTLA 2WIBA 3LP5A 3Q7QA 1IXSB 3GJZA 4GLJA 4HDMB 1OASA 4ZVPA 2GDZA 2R2GA 4HCJA 4ENTA 4RVNA 1LW7A 2CJFA 3A1WA 3N8IA 3C1OA 2ZU0C 4B3HA 2YYZA 4BO8A 5HKAA 4EPRA 3L1UA 3W5UA 1CF2O 221PA 4OATA 1N0UA 1BS1A 2C2ZA 4CLOB 3GVHA 5THQA 4P98A 2XQIA 2IWRA 2XY4A 3BXZA 5CEEA 1ITZA 1UWCA 3RVLA 2H57A 4WEQA 5HK8A 1G8KA 2H63A 2JIPA 3PNLA 1JJBA 4C6SA 1K89A 3IJPA 3T5TA 3CGWA 2F9FA 3V1TC 3TH5A 4CQMD 1REQA 2G9QA 4MVJE 3F78A 1THGA 4HB0A 1JA1A 3RSLA 2XZLA 3W8RA 3OJCA 5JXWA 1KMMA 3RKUA 2VF8A 3ZCSA 2X4IA 2QW0X 3FNEA 3PIIA 4JQSA 2X0RA 4O2BA 4RH1A 5KOJB 1RKVA 3PNQA 4EVIA 1IG0A 1IOVA 2EDAA 2XQKA 3K16A 3U7EB 1PV1A 4A8HA 1BHQ1 4B5LA 4KPYA 4UXHA 1PWZA 3TW8A 4AZ3B 2P9TA 3GLFB 1JJVA 2H29A 2QTFA 1TJPB 3VR2A 3A3PA 4QNRA 3RT9A 2VHYA 3ETJA 1PDOA 3SBDA 3U4HA 3MOSA 3KJNA 4NG5A 4BPBA 3FRJA 3FYDA 3COVA 3KQNA 3KVYA 4YBRA 3S28A 1UJ5A 2HU8A 1JILA 3B7PA 3G5UA 4C2BA 4DPLA 3UGQA 5G1NA 1O94C 1U2QA 1Z3CA 2C4WA 1ZN9A 2CVHA 5BSKA 5E3HA 1ZXXA 3D3WB 4F5WA 3CS3A 2B4KA 4Q9NA 3RRYA 3NTRA 2WYHA 3N76A 3DAFA 3UANA 4AZVA 5B6PA 4N0EA 5CHYA 5AESA 3L77A 5CLQA 4CCWA 4Q4DA 1O95C 1W2GA 2F4NA 1MN6A 1T6XA 2D1QA 2C3PA 2O0JA 1OWOA 1TFRA 2H4WA 3KEMA 3NDIA 1C7JA 1SVSA 2G1UA 3D5EA 1QO0D 4OO3A 2J4FA 2ZYDA 4Y30A 3ADDA 4ZODA 3KT3A 2JCBA 3QVLA 3UMSA 3VNQA 4KMRA 3LD9A 4LF9B 3GZJA 3JQFA 4C9BA 5BW4A 1Z0KA 4JLSA 3EGDA 2FEPA 5HJEA 4ATNA 1P4RA 4V38A 4LC1A 4RJ2A 4IAOA 2GCOB 4H0NA 3K6KA 3WXBA 3TXXA 2EGGA 3AIKA 1YDFA 5KCZA 4DMCA 1TEHA 1Z6QA 1QGUB 2LCFA 2PJZA 2I80A 1WZCA 1X15A 1GRRA 2XMSA 1KI7A 1YB7A 5HNKA 2EWVA 2X6RA 3LPDA 3LYHA 4I9NA 2TECE 1LB1B 5ECWA 5EIOA 3VH2A 4DY6A 1I7DA 3PX7A 1JEOA 3QOFA 4LS3A 1E5LA 3NVMB 1NE7A 3QH4A 4X7RA 2G7MC 4S0ZA 1X7ZB 4FYWA 1J9GA 1U2TA 3ZJVA 3DZHA 2F1JA 4P33A 2OL4A 1PQYA 2ZVDA 5DYGA 4O8CA 4NKRA 3TPZA 2IBMA 4BO0A 1YTUA 3N58A 3K5PA 3F9IA 4JITA 5GOZA 1RPJA 4HJXA 1FP2A 1PJ4A 1NP7A 2JBAB 1NKTA 3H4VA 1NQXA 1CBUA 2PQMA 4B3GA 4TSFA 2H6EA 3L0PA 2YOGA 4LRTB 4DTIA 2WWWA 2EX4A 3CKYA 1AGRA 2D6FA 4ZOLF 3C98A 4RDXA 2NVBA 2XF2A 4NARA 1FDRA 2YNMD 4CHGA 3HY3A 4EAQA 2V7EA 2B37A 2VK4A 3E7XA 5EIBD 4GRIA 4HDCA 1IY8A 4DLTA 4ENUA 5CBPB 1I4EB 4M89A 4M8IA 4AI6A 4NOKA 4ADSG 1SOMA 4MKGA 3UF0A 4EHFA 5HK9A 1JQBA 1ULAA 2UYGA 2WLTA 4KQ9A 4PCUA 4EG4A 4XB2A 1XXHB 3RUAA 1LI7A 3W9SA 2PBRA 1KO8A 2ZJBA 1WVIA 1A0OA 3L9WA 2C9CA 4HATA 4NHOA 5AM2A 1V9CA 2UUOA 2HTFA 4CLXA 1NXVA 1H3NA 3IUBA 4EEXA 3DHWC 3WL6A 3HXKA 4D9HA 2NW6A 1HQYE 4MVWA 4QBIA 4CG0A 4X0EA 1LD3A 1B74A 3I6YA 3SS8A 4XPIA 3STTA 6ABPA 1JXAA 3G5MA 4RK6A 4BDSA 3IUEA 4GIBA 4YQZA 1WCWA 3T1QA 1JI0A 4MPPA 3ZV6A 4CV2A 1DO2A 2YZKA 3SYTA 4K28A 4XB1A 2FPGA 2D0PB 2R6HA 2EXXA 1KJ8A 4G89A 3ZHVA 4Q4HB 2OC9A 4IHJB 4ID9A 5JDCC 5T4FA 3ILYA 2PZKA 4BGUA 1AY0A 2A9PA 3IILA 3S1SA 2AMJA 4FHCA 3OETA 2HXYA 2F1HA 3LC1O 3OHMA 4D6YA 3RVNA 3ICEA 3FFTA 3HE3A 4RPIA 1TKAA 2VRCA 2ZB8A 4DIOA 3R41A 3RV4A 1MDBA 2XIQA 4KDFA 4URFA 4P22A 4C0XA 1XTRA 5A02A 1SUEA 4JUIA 1Z15A 4QJBA 1CRZA 1N3YA 1TAGA 3B7GA 3AP2A 3SSOA 1MJFA 1FFBA 2OBLA 1N2CA 3E1KA 5CXSA 3DE7X 3QXXA 3AEQA 5JALA 3IR6A 1CZOA 3KPYA 3H5RA 2E21A 2ZE8A 1RU3A 3EDCA 2F8MA 1US8A 2UYYA 1H4SA 1SPBS 3OE7D 5BUQA 1W76A 2PKQO 1K6JA 2QL5A 2WM8A 1HDCA 2K87A 1ULTA 3AERB 3K0EA 2EFDB 1E2DA 1CIVA 1HQCA 2QNRA 2QX8A 2W8BA 2WV9A 3D8NA 1IMOA 1SCAA 3OVMA 4MO9A 1GCGA 4NU5A 5CDUA 3THWB 3RS8A 3O4FA 3O92A 3RRXA 3WIDA 5HDBB 3QSYA 1ZINA 1ENOA 3FYSA 5DTQA 2CK3A 3VM6A 5JAMA 4QDKA 1PRYA 1XCPA 1GL3A 3X2EA 1AGYA 1ZL0A 3H7IA 4WDRA 1ID1A 2AUTA 1WUKS 2ETVA 2GFHA 4AZ0B 1X86B 2QY9A 3QXCA 4CV0A 1J9EA 5H8WA 4Z4IA 1EX7A 3KKMA 1P1FA 1O03A 3AQIA 3FG9A 2C2BA 4KXYA 3O91A 4XI9A 4EFLA 2CHQA 1KI2A 3COSA 5CUQA 1JU4A 5TT0A 2Q3LA 2SKDA 1NE2A 3ND9A 3ON5A 3OJFA 3JD2A 1YI0A 2I29A 4FOOA 2FVYA 2ZOSA 4REOA 1AH2A 2HCTA 1BOFA 2HREA 1W36B 1N6KA 1SELA 1QTQA 3QTBA 3FR7A 1UWVA 3INGA 4CM8A 2MYNA 4V03A 1N2EA 3DKPA 1N9KA 1AKQA 2VT6A 1Q0PA 1FMLA 2MINB 4NFLA 4RKFA 5LR6A 1VJCA 2WSSD 1W85A 1F06A 1J9ZA 3DUFA 4XVHA 5B7QA 5EESA 5CVJA 3OY2A 1AB6A 3DP7A 3FFAA 4J76A 1UBRS 1WZNA 3P9SA 5FD8A 2PUGA 4GOND 1U0RA 5ALOA 1T0UA 1Q77A 1RQGA 1XZJA 5J2UF 2VSOA 2XXJA 4GWGA 2YIDA 3J80A 1VIVA 1DBRA 2ACVA 2Q3EA 5CPBA 5J4HA 2W2MA 4DCVA 2CNOA 3IP6A 5G1PA 1J39A 4WKGA 4MRNA 5F7ZA 4D8TA 4P3NA 4TSRA