3PFBA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ethylferulate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
total genus 88
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pfbA00
1R88A 3EBLA 4CI9A 2BUCA 4OB8A 4L0CA 4EA6A 2FJPA 3M3DA 3V1MA 5CXXA 4H7KA 1C4XA 3IUNA 3W04A 3WIOA 4L72A 5ALWA 3JW8A 3LLCA 5CRIA 1E8NA 3STWA 3HI4A 4BCDA 1DWPA 3H2IA 5HKAA 3WWOA 5EGNA 3R0VA 4NS4A 1WHTA 1F0NA 3O9MA 1ZD5A 3OG9A 2PSJA 3STYA 1H2WA 2BCEA 3D2BA 5ALXA 5E2IA 1BN7A 1IUOA 1QIFA 1O6FA 2FX5A 4CG1A 5DYWA 1IUNA 2H1IA 1XRRA 4KJXA 3GELA 4IHAA 3WKAA 1DTEA 4B83A 2V96A 1G42A 1GKKA 2XUAA 3I2GA 4QLOA 3R3UA 4QNNA 3QITA 2XDWA 4AQDA 4CCYB 1ZI8A 5EI5A 2GZRA 5AKYA 4CCWA 4B6GA 1UOPA 5FKJA 3G9UA 2CUTA 2QTBA 2CEKA 4HZGA 2WM2A 3G0IA 2B20A 3EF3A 1QFMA 3IDAA 3TRDA 2XUJA 2ZSIA 1E89A 2IITA 1DINA 1BU8A 3W9BA 5BOVA 4NVRA 1VE6A 5AOBA 2RIPA 4I4CA 1QE3A 1AGYA 4ZV7A 2VJDA 4UHHA 1W75A 4C01A 5FV4A 1RYYA 3DYIA 1CUZA 2ZJ7A 4UHCA 1CUYA 4EUSA 1WOMA 5JZ9A 3HLKA 1Y7HA 2XMDA 1LZLA 4UHFA 1ZOIA 3DKRA 5A7FA 3H1BA 2I3ZA 4FKBA 2QXTA 5A2GA 3AUKA 3BJMA 4M0FA 1K5PA 3R3WA 5F4ZA 1VA4A 3AZPA 4UHDA 1QOZA 1VXRA 5IVDA 1E8MA 1BN6A 3LIPA 2VSQA 1QLWA 2OAEA 4B82A 2G4LA 1T4MA 4BCBA 1XQWA 2C0QA 2JIDA 5YASA 4KRYA 3OC0A 4DTCA 3H2KA 4JH0A 1ZJ5A 3DQZA 1XZLA 4AZ3A 4C4ZA 4G5XA 2WFLB 1AX9A 2Y1KA 1XZGA 4PW0A 3G0DA 4ETWA 4F60A 3P2MA 2OLEA 1Q83A 1KU6A 3QM1A 3WL8A 3IIIA 2I03A 3F67A 5C8ZA 4IH9A 2O2GA 4B81A 5AI0A 1ODSA 5JATA 4X97A 1CV2A 2WJ3A 2DSNA 5BV7A 2HRRA 2WIFA 5I9IA 1X2BA 4GECA 1CFJA 3N0TA 4BAZA 4LYDA 3R3ZA 2V97A 5SYNA 2VAXA 5AP9A 1HQDA 3DS8A 2XQFA 3I1YA 1IZ8A 4W1SA 1QIDA 4F0JA 2XI4A 3C6BA 5CT6A 3O95A 3DLTA 2WHRA 5DWDA 3K6KA 2E3JA 3WKDA 3WK5A 2WQZA 1AKNA 1BS9A 4Q05A 2HA6A 3I2FA 2HDWA 1Z68A 2PX6A 3L1HA 5LLSA 3CXUA 2G5TA 2OCIA 1MX1A 4Q3KA 1SCKA 2YXPX 4UFPA 3H18A 3ESDA 3LS2A 4CCYA 3EQ9A 1XRMA 2H7XA 3C43A 4UBLA 1QIMA 5AIBA 5JD5A 3R40A 4QDXA 3SX4A 4U2DA 4KR0A 1WB4A 1Y37A 4BVJA 1MTZA 4GLBA 1UK6A 4INZA 4KE6A 2CMFA 2OAGA 1SCIA 3BDIA 3DJYA 3ZPXA 2OQVA 1GPLA 2DR0A 3OPMA 3O4IA 3WK9A 2QUAA 3G7NA 3Q0TA 4KAJA 1JT2A 1N5MA 5AKEA 4E46A 4P92A 2YASA 5CXUA 4XIIA 4XX1A 2WUFA 5SYMA 5AOAA 4BP8A 1JU3A 1THTA 3WJ1A 5ALNA 4RNCA 5K3FA 2XLBA 4GI1A 4TPKA 4B7ZA 4BB0A 4HXFB 3JWEA 1LPNA 1W52X 3STTA 2JF0A 1XZDA 2WILA 3H2GA 3CCCA 2B61A 1DX6A 4KACA 3BL8A 1E3QA 4QWMA 4MYSA 5AOCA 5ALUA 1CPYA 3VISA 3E4DA 1HBJA 3BDVA 1TIBA 1CUBA 4QEKA 1EI9A 1M33A 3CN9A 1XRLA 1IVYA 3AINA 4FMPA 3WWPA 5ALIA 1XZFA 5E4TA 5JAPA 3H2HA 2QJRA 2WU4A 4K6GA 1AURA 4EBBA 2XUKA 1XRQA 4FLMA 1GXSA 4BVLA 5ALPA 4G9EA 3HACA 3HABA 2WFLA 3QBJA 3WKEA 3HJUA 2WUGA 1QGED 4FLEA 4UFNA 5AI5A 2ZJ6A 3A2LA 3G9TA 2QR5A 3WK4A 5AO9A 2BFNA 1XKLA 4U2BA 4EY8A 3QVMA 3R3VA 5ALJA 4U2CA 5HQ3B 4ZGBA 2ZYRA 4Y2JA 1FFAA 2WUDA 4X7BA 2ORYA 1SCQA 1P0MA 3D2CA 4EY7A 1MO2A 1XKTA 3V1LA 3EIOA 1MX9A 5AM5A 3QPCA 1ACLA 1VZ2A 1QIGA 4DGQA 5BWCA 4Q34A 3L1IA 5AKIA 4MJ3A 1QIEA 4HTAA 2HA2A 4X00A 1N8SA 2GBIA 4AO6A 1WHSA 3FSGD 4IH4A 1YCDA 3WL6A 5ALGA 5JAOA 2XUHA 3ZLUA 5C7YA 1DT5A 3ZLVA 4U2EA 2HA7A 2ZVDA 3KWFA 1J07A 2WFZA 4Y2PA 3G02A 4GW3A 1I6WA 3AIOA 1CUJA 2QOEA 5JAUA 4KAAA 4B84A 2XQGA 1DWQA 4DSZA 4QA9A 4E11A 1YS1X 4NZZA 1J2EA 1GGVA 3D59A 3QPDA 4HRXA 4BVKA 3ZV7A 3STUA 3UUEA 1VKHA 2WG1A 4ROTA 1ORWA 4B9EA 3AJAA 1RWQA 2QRUA 4V2IA 3WZMA 5D6OA 1ACJA 4LIPD 4DMFA 1XLUA 3FCYA 1TKRA 5DTJA 4L9AA 1G66A 3I2KA 2G5PA 1UKCA 2K2QB 1W6RA 1MU0A 5IKXA 1EDDA 4N8DA 4IH1A 2WU3A 2H9YA 3RLIA 1TCCA 3C5VA 5HKBA 3WMRA 1EB8A 4PNZA 4C88A 1K4YA 2GBFA 4EY6A 4B0PA 4FDMA 5ALEA 1ZJ4A 4WJLA 1OCEA 1EDBA 3DYVA 4J0HA 2OCLA 1SFRA 5HCUA 2C5GA 4X93A 5AKHA 3M81A 4QDZA 2VATA 1R4ZA 2JEZA 3G0BA 1ODTC 4BBZA 1ODCA 4DYHA 1TRHA 1BEEA 4HXEB 3I2IA 5K3CA 3U1TA 1FFCA 2XUQA 3G9XA 4H7FA 4Z49A 1UT6A 1CUSA 2G63A 5FOQA 4K6HA 1J06A 4UBJA 3DOHA 1BROA 3D0KA 5EHZA 5AM0A 1J1IA 4H7JA 1C7JA 1LGYA 5AM1A 2JGLA 2BJHA 2YYSA 1WPRA 4W1QA 4OB7A 5AI4A 3U0VA 4Y2XA 3T52A 1WPXA 2XQIA 3ANTA 1ZI9A 4A16A 2WIKA 5HQ3A 4UBNA 5AH0A 5I8PA 3PI6A 4E15A 2CBGA 1AUOA 1MAAA 4DLNA 2VEOA 2DCMA 5K3BA 5AKKA 4IO0A 3DOIA 4H7DA 4MQMA 5AM2A 1ZGBA 1BE0A 2ZYSA 1DX4A 1A8QA 1IUPA 1VOTA 1XZEA 3HC7A 3CCBA 4M0MA 2PUHA 5DTIA 5JAHA 1W1IA 1WB6A 5CBKA 4HRYA 1YAHA 3IUMA 1P0QA 2WIJA 3PFCA 1CUAA 4Y2VA 4ZI5A 2PL5A 4DNPA 4Y2TA 3GBSA 3WL5A 1RP1A 4FWBA 4Q3LA 3WA6A 3PUHA 2C4HA 5IVIA 1FSSA 1ZGCA 4KE9A 1YA4A 5D3ZA 1QZ3A 1CUEA 3V9AA 5A6VA 3VDXA 1W4LA 1ETHA 5K3FB 1TCBA 4N8SA 4CG3A 1PFQA 5JANA 4DNOA 2HIHA 2HHAA 1ZIYA 3C5WP 3ANSA 1JI3A 1VJ5A 3HYSA 2Z8XA 5JYCA 5CW2A 1JJFA 1AC5A 1IMJA 4Y2SA 1MPXA 2PSDA 3H04A 3VVMA 5C8XA 5ALKA 2RI6A 5CT4A 2X76A 4M0EA 4W9RA 1W76A 2LIPA 2V9ZA 1FJ2A 4G1FA 1XFDA 4ITVA 4X85A 2XMQA 3LIIA 1HLGA 2HA4A 5DNWA 2JGKA 4BDSA 3C45A 1H2ZA 4DNFA 1VE7A 1E66A 2HL6A 5ALDA 3A70A 4FTWA 3C6ZA 2C7BA 1EA5A 4WFIA 5I7UA 2NW6A 4AB1A 4S0XA 5EIHA 3KD2A 3PFBA 3ESAA 5LKRA 2D5LA 3F96A 3QMMA 3C87A 3NUZA 4H77A 1QO9A 5LZ8A 5EHQA 5HK9A 4W1PA 1USWA 3BF8A 1ZIXA 1VLQA 4P9NA 4LXIA 1Q0ZA 1BCSA 4XJVA 2VJAA 4J0GA 3ILSA 4F21A 3D4LA 5HZGA 4BAGA 3IBTA 1E8DA 4Y2YA 1LLFA 1QONA 1L7RA 1XZBA 4X90A 4QDOA 4BDTA 1YSCA 1G4HA 2HA5A 4XWGA 4QE3A 2GBCA 4G8DA 2YH2A 3FLBA 3FCXA 2CB9A 1EVQA 3O0DA 1CUGA 2Y2UA 4FLFA 1N1MA 1LZKA 4JYMA 1U8EA 3B12A 4UBOA 3O4HA 2QS9A 5CMLA 2WTNA 3F8SA 2XUIA 1XZIA 2CKMA 5AKGA 1KEZA 3VXKA 2RHWA 5AM3A 3CN7A 1GQSA 1LNSA 4KAFA 2UZ0A 4W63A 3H1AA 3FLEA 3HEAA 2WLSA 4J7AA 3G0CA 2WG2A 4LYEA 1PJAA 5CT5A 4WFJA 1LPBB 4HS9A 3MUOA 1U4NA 4C87A 3DKKA 4GDMA 2PSEA 1GPKA 2HA0A 2C58A 5AK4A 1QIKA 1XQVA 4KE8A 3KOOA 3DDUA 3HXKA 2WIDA 3FWHA 4LKOA 2BGNA 1CR6A 3NOXA 5T4HA 2XUDA 2WSLA 3FAKA 3B3QA 7YASA 4MXDA 1XZMA 4X6UA 2O2HA 1AMNA 1XQXA 1G5FA 2PU5A 2XMGA 4B9AA 2XMZA 5DYTA 5IH7A 3AFIA 2RONA 4DMHA 4J0KA 5J3JA 2AXEA 2AJLI 2J4FA 2RGUA 3LCRA 1R9MA 4G8BA 3C8HA 2HRQA 3BIWA 3QZUA 5ALTA 2RHTA 3AIKA 1U65A 5FDFA 2JGFA 1LPMA 5CTAA 2VT7A 4MQLA 3W9UA 5EFZA 1MN6A 4ZXFA 4F5ZA 1HDEA 5KWIA 4IQ4A 3PDCA 2XUOA 1CUXA 3D2AA 1P0PA 4D9JA 3I2HA 3ZWQA 1UOQA 3SK0A 2XB6A 5H3HA 4BE9A 4FNMA 1XQYA 1ZICA 1TK3A 1D07A 1YB7A 3C6XA 3DD5A 4H7EA 1KU0A 4BTLA 5CH3A 3AIMA 2HFJA 2QZPA 1GPNA 1TAHA 3FYUB 3FNBA 3FLAA 1DQYA 4X6YA 1CUFA 3IVMA 2PBLA 4QDUA 1LPSA 4I19A 4DMKA 4EB0A 3RKSA 4JYPA 4DNQA 4Y9SA 3ZLTA 1E5TA 2QUBA 1IZ7A 1EX9A 3AZOA 4JNCA 3WYNA 1TQHA 3WKCA 3TEJA 5AK3A 1SC9A 3IUQA 4KYVA 3V48A 5IVHA 1XRNA 4UPDA 5AJHA 3EQ8A 1R50A 4J0IA 4X6XA 1A8UA 5JARA 2ROQA 4PQEA 5HFNA 2Q0XA 4X95A 1H2YA 2DQYA 5CH8A 3W06A 1QTIA 1MX5A 2C0PA 1FFBA 3QYJA 3WWEA 2XLCA 2XT0A 1XZJA 3ICWA 1WM1A 3IULA 4OPMA 5FPQA 5ISMA 5KWJA 3NWOA 4K2AA 5JD6A 2QKYA 1EINA 4B0OA 4OCZA 4Y2QA 5HF9A 3I1IA 1UOOA 3M83A 1R9NA 3LP5A 2ZYHA 3G8YA 3R3YA 3WK7A 1UWCA 5AKXA 3BIXA 3IA2A 3E3AA 2QT9A 4GBGA 2GYVA 2P8SA 5LZ7A 1CQZA 2OG1A 1K63A 4A23A 5AKZA 2VJCA 4BZWA 1QIIA 3X3HA 4H35A 3FSGA 1EK2A 1EHYA 5KBYA 2GZSA 2QVBA 1QFSA 5ALYA 1F6WA 2H7YA 5LYYA 3HRHA 2QM0A 4N5HX 2RAUA 4KRXA 5EHNA 2GBGA 2O7RA 1H22A 4FOLA 5AKLA 4GWLA 3FYTA 2PUJA 3A2MA 3R41A 4L3WA 4AXBA 4CIAA 5AK5A 4Q1VA 3UMJA 4YASA 1GZ7A 2OQIA 5T4EA 5KREA 3GA7A 3IUJA 1CLEA 4Q82A 4CG2A 3E0XA 1S8OA 2WHPB 1EDEA 2J3QA 1HPLA 5CT9A 5EIEA 3W05A 3UUFA 3FYUC 3IURA 5AK6A 1CUVA 3FOBA 4O08A 4H7IA 4FBMA 4UBMA 2CJPA 2AJ8A 2OCKA 2IX9A 2O7VA 4P93A 1R3DA 1QTRA 1FFEA 2PSFA 5JADA 4QWWA 1ZD2P 2AJCA 5C8VA 3ICVA 4FFWA 3VJMA 3WK8A 2XUFA 5DNVA 3BF7A 1X2EA 2JBWA 1CEXA 1ZI6A 5AHXA 4WDQA 3OURA 3NGMA 4HAIA 4C6HA 4X91A 1XZCA 2ACKA 3FYUA 3WKBA 1CUHA 3QPAA 1UK9A 1MJ5A 1FFDA 2ZYIA 5EHXA 1BRTA 1GT6A 3R3XA 1WB5A 4Y7DA 3D5EA 2QXUA 4K6KA 2H7CA 2OPHA 5HF6A 5ALSA 5AICA 1F8UA 5FUMA 5JASA 3SWWA 1MNAA 1CUUA 3O4JA 1SOMA 2VTVA 3QMWA 1LPPA 2HU8A 2AJDA 2ECFA 3WZLA 1UKBA 4G4JA 5A7HA 3WJ2A 4I3FA 2BUAA 4G4IA 3HSSA 4Y2RA 4U2FA 2O2IA 3I6ZA 2IIVA 3KSRA 3AZQA 5D3KA 3GFFA 1CUDA 4H7HA 4TVKA 5JALA 3GZJA 5AI8A 1YR2A 1AZWA 3F9CA 5BWBA 3V1KA 3FVTA 4EHBA 2WKWA 1Q84A 1YB6A 4ARAA 1VXOA 4OB6A 5JIBA 1JFRA 3WK6A 5JZBA 5AM4A 3DNMA 2PU7A 4N5IX 1YASA 3H19A 4NMWA 5LZ5A 4X94A 2Y6VA 4J0JA 1UFOA 4JEIA 2VQ6A 1O6GA 1N5RA 5C81A 3N2ZB 1AQLA 3FBWA 2QJWA 1HKHA 4BC1A 4LHEA 5HF8A 1DU4A 5LKAA 3S2ZA 1A8SA 4UBIA 2QMQA 5ALQA 3VJLA 2FUKA 3M82A 4OYYA 4PSCA 5IVKA 3H17A 1UZAA 1DT3A 2GYWA 4RPCA 3S8YA 1EK1A 5AKJA 2AJBA 4DMCA 2V98A 1R1DA 3QH4A 2XUGA 4RGYA 3RM3A 2WTMA 1XZKA 4QDTA 4AN1A 1YAJA 4RE6A 1P0IA 1L7QA 4AO7A 2Y6UA 5E4YA 1QJ4A 2XMSA 5A62A 1QO7A 4B85A 4DIUA 5K5EA 3V1NA 2VT6A 4PO3X 2XQJA 2Z8ZA 2Z5GA 2OGTA 3YASA 4J3JA 5AI9A 3I6YA 5K3DA 5ALHA 2HADA 4QZVA 2B9VA 5CURA 3I28A 3K2IA 5LZ9A 3W2TA 1MNQA 2XQKA 4RE5A 3O4GA 5ALZA 4B80A 2W6CX 3H0CA 1XLWA 2J3DA 2WHPA 4ZV9A 4UHEA 3DL4A 5DYYA 3O9VA 4UFOA 1OXMA 4PF1A 4PSUA 2XMRA 5ESRA 4BCCA 2OGSA 2HFKA 3ESBA 2DHEA 1GKLA 4A5SA 1JU4A 2PM8A 1EB9A 3BWXA 4WY5A 4K5QA 4P08A 3KDAA 4MYDA 4X71A 4BZZA 4UHBA 1T2NA 1A88A 3RARA 4BRZA 3DCNA 3EQ7A 5FP0A 2JEYA 5LP1A 1B41A 3AILA 4ARBA 1VA5A 5K3AA 1BEZA 5FLKA 4AZ0A 2ES4A 2DFPA 1LBSA 1ZD3A 2X5XA 4DM7A 5LZ4A 2CZQA 1EVEA 2DQZA 1CQWA 3I2JA 1H2XA 1JJIA 3RK4A 1OILA 3E1GA 3PUIA 4EZIA 6YASA 2WJ4A 3F98A 5DNUA 4AMZA 2WFMA 4AX4A 5LIPA 3OM8A 4AN0A 4G9GA 2HU7A 4TGLA 4E14A 4PSDA 4YK7A 5JZSA 1WCYA 3Q8WA 2HA3A 3WWCA 4JUIA 1CUCA 1DWOA 1XROA 3D3NA 5FRDA 1U2EA 2ONCA 1ZD4A 2C5FA 3K9BA 3T4UA 4J03A 4BTVA 1EH5A 5E4JA 3TJMA 2JGIA 4ZWNA 1TCAA 2XMCA 5LZ2A 1Y7IA 5T4FA 2VJBA 3HZOA 4GXNA 4CFSA 2ZSHA 4C4YA 1L7AA 5A7GA 1GQRA 2HM7A 2R11A 3TGLA 4MEBA 3WWDA 1EXWA 4AO8A 5FPPA 1B6GA 3GUUA 1NU6A 2XE4A 4X3CA 3H2JA 2DHDA 3DEAA 3VVLA 3PF9A 4OU5A 2BUBA 4WY8A 3OTQA 2WUEA 1LBTA 5ALFA 1BCRA 1JJBA 2WHQA 3B5EA 2JGMA 2BKLA 1UXOA 3SC2A 4EY5A 5JD4A 4H18A 5AI6A 4BRSA 2JGEA 5T4BA 3PICA 4QLAA 3WL7A 1UK7A 5FXMA 4AMYA 5HFAA 2OCGA 2XMBA 4H0CA 3WYDA 2D0DA 1MAHA 1X70A 2W22A 4YX9A 1CUIA 4OSEA 3GROA 4WDRA 1K8QA 3ED1A 3BE8A 3FVRA 4C89A 3VKFA 4MEAA 4BAUA 5ALRA 5K3EA 1CVLA 3C6YA 4BC0A 2XUPA 1NU8A 2Z3ZA 2ACEA 5HK8A 1YS2X 2PPLA 2VA9A 3WA7A 1K6EA 3JYHA 1F0PA 3WIBA 4ZRDA 1CUWA 2WG0A 1PV1A 4Q3OA 5CT8A 3WQHA 4FNGA 3BXPA 1A7UA 4GHWA 4KE7A 1CRLA 3A2NA 3G9ZA 3MUNA 2Z3WA 1H23A 4BATA 2B4KA 2J4CA 5A71A 2BAGA 3I6MA 2R8BA 3G0GA 4LXHA 1NX9A 3STVA 3VJKA 4EY4A 4GEGA 5ALVA 4UBKA 2WJ6A 2WIGA 4MWSA 2GYUA 3STXA 3QMVA 3C70A 5ALLA 4ZREA 4YPVA 1MT3A 3IB3A 4UUQA 5D7BA 1UKAA 2Y2VA 1ORVA 4W1RA 5ALMA 1HL7A 2X8BA 4FFVA 4WFKA 4KEAA 1VZ3A 4CIBA 2I3DA 1XZAA 3PF8A 2EEPA 3DL7A 2I78A 5DLPA 2EDCA 1LPOA 1JMKC 1UK8A 3ESCA 2EDAA 3MVEA 4G8CA 1QIHA 3D7RA 3PE6A 1YA8A 3A6ZA 1JKMA 4BE4A 3WI7A 4G4GA 2HU5A 5HF5A 1Q0RA 5DJ5A 1THGA 2VF2A 2OGZA 1CIJA 1XZHA 4BP9A 3OOSA 3KXPA 1DQZA 4BYMA 1C7IA 3ZI7A 1LPAB 4J0DA 2FJ0A 3WLAA 2DHCA 4DSAA 4OYLA 4C4XA 2PVSA 3KWJA 4XVCA 2OXEA 1ISPA 4HVTA 4HXGA 5ALOA 4N8EA 5EIAA 4FBLA 4OUKX 4OD0A 4U2GA 1XRPA 2VAVA 3F97A 5CH5A 3C8DA 1XLVA 2PKYX 2ZJFA 3MGAA 1JMYA 2JGJA 4X92A 2PSHA 4WCVA 4FHZA 4MWTA 4OU4A 4J0CA 2BGRA 3BJRA 5AIAA 1QIJA 4Y2UA 4LXGA 4PV7A 3L1JA
chains in the Genus database with same CATH superfamily
5IJZA 1MC5A 3EBLA 2B4AA 3O4FA 4UDOA 1F0YA 1XP8A 4TLCA 1K08A 1G9SA 1X1RA 1HSOA 3VHQA 3JR3A 2BUCA 3MRTA 4JAVC 3SFZA 2J0VA 3DDOA 2A14A 2FJPA 3ZNQA 4B7XA 4DY4A 2TMKA 3IUYA 2PS0A 3M3DA 4LWZA 3NIWA 1J20A 1P6QA 3JRXA 3OF5A 4M46A 5JS2A 2O5CA 3ZH9B 3VNVA 2G70A 4CUZA 2R7AA 4F7WA 3DMHA 4CLHA 5K01A 1DPFA 3EGDB 2RGAA 1N2SA 3R7WA 1PNQA 2GD1O 3IL2A 1T6YA 2ZUVA 4J16C 2XNKA 1ND6A 4BU1A 3HZZA 3WO1A 1IG3A 4BCDA 4LRUA 2OAP1 4I4NA 2B1IA 1FBTA 4Q1AA 1WO8A 3EISA 5HKAA 1EXVA 2MINB 2HX1A 4KMOA 3B1KA 4GMGA 2P69A 5I4CA 1FDWA 4NS4A 4P6VF 4AY5A 3A3YA 3O9MA 1UZLA 1DG3A 1BMFA 2REBA 3STYA 1H2WA 2BCEA 3D2BA 1K88A 4CKCA 5IP5A 1QIFA 3DMNA 3FR7A 4EJ0A 1O6FA 4CG1A 4MKZA 1PKEA 2C61A 1ZUHA 2W2QA 1PEYA 2J7PA 3ED5A 2H1IA 1TM7E 4HTFB 1XRRA 3E23A 4TKVB 3ZZ1A 4C0LA 4KJXA 4NZNA 2OO5A 3GELA 1ZK1A 4IIJA 4E5YA 3AXSA 3HZRA 3UJBA 4Z51A 4D4GA 1E7WA 3BE4A 1Z83A 4B7CA 3ZJ5A 1ZESA 5EP4A 2FTKE 4ZEOA 1S3IA 1JQEA 4RK6A 3I0NA 2RJOA 2FOLA 4P58A 1MJGM 1NBEA 1QP4A 3LUBA 4BQQA 3HWX1 1KSFX 2O8CA 1AUVA 2PWAA 1P29A 5H3CA 4OG2A 4MKFA 3T7IA 3LFUA 4JI4B 4DAEA 3T5BA 2DX7A 4KIJA 4CPDA 1WSBA 1Q17A 3QITA 1FYXA 4QARA 2XDWA 2YHUA 5TPWB 4AQDA 1EE9A 2X1MA 3AO0B 4JLPA 2GZRA 4QVGA 5EI5A 1TT5A 3ZW9A 1UWKA 5HM6A 5F78A 2DC1A 1SCNE 4QM7A 1I6LA 1WF3A 1Z06A 1T3SA 2YQZA 3DDHA 3EVNA 1H4SA 1AB6A 1Z07A 2A0FA 3BWVA 2CDCA 3F1KA 3FN4A 3QOWA 4RVHA 4BGDA 5LQNA 5JBIA 2X9QA 5CM2Z 4EEXA 1QH0A 4JJ4A 4GZMA 3B1ZA 4IFIA 4V0QA 3VR6H 3ZV5A 4POOA 3FUTA 3BRWA 3W8NA 2F00A 3BMCA 2D4HA 4BN5A 4TQUS 1G8GA 3PPWA 4WGFA 3TRDA 1E89A 2IITA 1DINA 3SNKA 3ZWPA 4BMCA 4DUYB 4R2JA 3C7CB 3GJ5A 3OKCA 5DT2A 3RNLA 3W9BA 4LF7B 2O3UA 4OTZA 2PS1A 2OHIA 3CLHA 5BOVA 2P1ZA 2FPGA 1F20A 1VE6A 3NAQA 2QNIA 1E2NA 1CJMA 1L8AA 4Q7MB 2EFDB 4CKWB 4JU9A 2A5FA 1TMYA 2NSDA 1AKQA 2LCIA 3DTVA 4KUGA 1N5DA 2OM6A 3UY4A 3THRA 3HXOA 3OD5A 2QHXA 1GU1A 5LNK6 1V4VA 4NULA 1BXRA 2XE6A 4W5OA 3W7VA 3IKTA 1L4YA 3C1UA 2XBMA 3VZRA 1V5EA 1XCOA 1SAYA 2Q46A 1UWLA 3DE4X 5ADWA 4B40A 2IXTA 1E59A 2G06A 2B2XA 1VKJA 2D0PB 4LQCA 2UYYA 5DM4A 4L75A 2DFVA 4Y1FA 2GPBA 3KQOA 5TQ2A 1JG4A 1KKLA 4DRZA 1ZN7A 4S05A 4R0NA 1D1TA 4ZVUA 1FUYB 2AR7A 3EVGA 5C4IA 2EOAA 4BIIA 2BI7A 2PT9A 2VXCA 1FNSA 2JFZA 1NP3A 3FNRA 2JI7A 3K6RA 3NR2A 5A9TA 5A7FA 4MV5A 3H1BA 3K2QA 1A2BA 2I3ZA 3ZE0B 3UWSA 1RQ7A 4U7DA 1EWRA 2XGSA 3SZRA 3FPBA 5A2GA 1D2GA 1DTSA 3BJMA 3A1SA 2X3YA 1E5VA 3E3MA 3LY9A 4OGFA 1EZZA 1HR0B 3W8FA 2PUGA 1U2DA 2ZPUA 1PJ4A 2VYCA 5KWVA 5KS2A 3T3NA 1A4UA 3TRFA 2Q3EA 4Z1MD 2O3TA 1ZJWA 3BQNB 3DNFA 3NYIA 3NAMA 3AZPA 5CIQA 3LM8A 4TTAA 4UHDA 4H27A 3AL0C 4ZKEA 5CB0A 4JUBA 1VIYA 2IE0A 2DT8A 1VXRA 4TS3A 4JIMA 3RGWS 1BJRE 4FYMA 3O7WA 5IN4A 3MRXA 1U2GC 2DQSA 2X4IA 2GKOA 2RGWA 3DVSX 4MR9B 3DAGA 1DJLA 3X1JA 2HBRA 4UE3S 4W8OA 4PO1A 5EKXA 2DB3A 1BXKA 4XJXA 2GBPA 5HUQA 4CTKA 1E20A 1Z6ZA 3A28A 4UVEA 4YRKA 5FV7A 4Z9YA 4IBOA 4OUDB 3I83A 5GP1A 4F4FA 1T4MA 1XOIA 1JZQA 1XQWA 3BCSA 4HQOA 4WOCA 1HV8A 2UVPA 2EP7A 3OT1A 4B79A 3EMKA 5GWXA 4QSHA 3WJAA 4HDOB 2R5NA 3T1YB 2ZRDA 3QFFA 4JJKA 4KQ6A 1HNWB 2DHRA 4G41A 1FIUA 1I8TA 1KOFA 1IZ9A 1W87A 3PFNA 4X60A 3TINA 3GLFA 2D2FA 1KDYA 2PGNA 3G23A 4TROA 2SECE 3ETGA 1ZJ5A 1MA3A 3H3XA 1DFGA 4Y9RA 4G5XA 4TTVA 1VE1A 5EXSA 4NICA 4LXYA 1NMXA 1ZPDA 1AX9A 4MR7B 4BPBA 1CT9A 3G0DA 5C7OO 3W4JA 5CFLA 4FJ1A 3DE0X 4P3XA 3JYOA 2XNDA 1NRIA 5C35A 3CJRA 1SBHA 1RBZA 3MB8A 3RQSA 2XD4A 3DM9B 5G2OA 3G2HA 3LCJA 2EATA 3W2FA 2H08A 3CNOA 1Q1EA 4EUKA 5LDHA 3MW8A 1IK4A 2B6HA 4MKGA 3WL8A 4HS4A 4WADA 4HGQA 3SIRA 2HPHA 3VGPA 2F9LA 5AJVB 2IUSA 4BWGA 3F67A 3FTPA 1Q16A 2IZOA 2K4MA 3DH0A 3HDJA 5FPTA 4YT8A 1PG5A 5C8ZA 4HMQA 3GGOA 1QP0A 4MB6A 1PGOA 1ODSA 3H7AA 2OBLA 5DMHA 2H51A 4QAQA 5EMMA 5C5CA 5JATA 2IS2A 3O93A 1SCJA 3DOEA 4H6VA 4J3NA 4EVIA 3S68A 3VHXA 2P75A 2WJ3A 2H17A 1J39A 1F2DA 5IUKC 4MGHA 1NI4A 2CT8A 3P9NA 5JH7A 1UEJA 2WICA 3LWDA 1WUIS 3T0FA 3G9QA 2E55A 3K0AB 4HDQB 5I9IA 4YO7A 4GECA 4F86A 3LY7A 4ND2A 3WISA 3GDOA 3LWNA 3N0TA 2JJ1D 3MT8A 4ZVOA 4EUNA 3OHSX 1XNHA 2V97A 3MLBA 3SE7A 1QYDA 3SKYA 4B1FA 2PLFA 2C1EA 3HB7A 3LUJA 1IQ0A 2OCXA 3IKLA 3RBXA 4IIYA 3OLWA 1FDRA 3DS8A 1EFRA 2XQFA 5JMOA 3I1YA 5EQTA 5DNEA 1YCHA 3ZWOA 4LZNA 3E18A 1ZW6A 2ASEA 5GV7A 2ZJ5A 1VP9A 3N6RA 3E9EA 2Y0PA 5CGZA 4R9UC 3MJVA 3T5TA 3VOSA 4U9HS 1OR8A 2QE7D 3EH1A 2AE1A 4XWAA 1G5RA 2AUNA 4QT0A 1VHLA 5CT6A 2J3KA 4PX2A 2JVIA 3RFFA 3A6LA 3NKLA 1QRTA 4MRNA 4IGFA 2OD2A 3L6BA 1AKYA 1GZSA 3B85A 3E05A 1RJDA 4PANA 4ZC8A 1C81A 5CYGA 3TPFA 3K1AB 1BO6A 5FOVA 2WQZA 5BV2P 3OX4A 2AHRA 1XBTA 4Q05A 5DK4A 2BTOA 2HA6A 1Q1AA 3T3HA 2RJ3A 1KH1A 3I2FA 4TV8B 3KOMA 5CD9A 4AAYA 4MVJG 1D4OA 4U6QA 2DTDA 2OUKA 4OHWA 2PX6A 3L1HA 1RXCA 4CFYA 2P77A 1YZGA 4A1OA 2F1JA 5LLSA 4AP9A 5B6JA 5K3OA 1RWNA 3T3OA 3ZU5A 2IY9A 1PLJA 1SULA 2GM5A 1KH3A 2IC5A 2Q27A 3LKVA 4G56A 1OYVA 4PZ9A 5TV2A 1ZIPA 3MWDB 4AYXA 2ZIUB 1XHLA 4MNTA 3QEBZ 3Q0EA 1L0BA 4MVJP 5AVTA 1K66A 1CY6A 1L8LA 1MX1A 2R8EA 2VXBA 3LVQE 1L3IA 4FBGA 4QUJA 4RQAA 3VQTA 4HV4A 1SCKA 2YXPX 2CDNA 4JJ6A 2D1QA 3K4QA 3I9OA 4JLVA 4BBPA 4CCYA 4QRIA 3EQ9A 2CMGA 1HYQA 2HDOA 3AEZA 4C3VA 4S24A 3BK1A 2V7EA 3WBBA 1T25A 1B0UA 3SX0A 4D9KA 4UBLA 1TFRA 1QIMA 3KKPA 5AIBA 5KMGB 3D7LA 3R40A 3OLQA 4QDXA 1QRRA 4U2DA 5K0GA 1KL7A 1R4AA 4N5MA 2OBYA 4KR0A 4R9SA 4Q3AA 3TCKA 4C22A 2Z3VA 4JLWA 3G2NA 3WDMA 5PGMA 3D6MA 1WB4A 1Q0TA 5FHQA 3NEPX 2MHCA 1Y37A 2BP7B 3U7EB 4BVBA 5LXTA 1ZXBA 4LCEA 5GPBA 1JE0A 3RUFA 5JYDA 3T7JA 2JC3A 4EG1A 5BVHB 1KAGA 1UK6A 2HV9A 4H59A 4I7EA 4INZA 1XC7A 2CMFA 2C03A 3KDPA 3T35A 3BDIA 3KQNA 5BN4A 5M34A 3KAJA 3L05A 1EFPB 2ZYUX 5F7ZA 1KJNA 3HB5X 2OQVA 1I3CA 2DR0A 2KW5A 3AMVA 1ZAKA 3WIUA 1C9DB 1JILA 1R8YA 3KJNA 4QASA 3WK9A 4CM7A 4PZUA 2W8ZA 4ABTA 2QUAA 2QN6A 2QTRA 1IQPA 1B93A 2W6PA 3L7KA 2G67A 4I6JA 4NPHA 4BS9A 4B6PA 1X1BA 3CPSA 4PCVA 4DLBA 2Y99A 4P92A 4DJAA 4K9MA 1IZYA 1V48A 5DHAA 5CK4A 3A26A 4XIIA 3KIPA 5EXDA 2PUAA 4D25A 2PXAA 2YJNA 5SYMA 5EUMA 2IOQA 4QEDA 2B8JA 2PX0A 4Q19A 3TZ6A 4BP8A 3RI3A 3SIPA 3DEHA 5CXSA 3R7BA 2DLDA 4ND5A 3T95A 3JAKB 5C5DA 5F9FA 1KE2A 4URVR 4EG6A 4MAAA 2GM4A 4TPKA 5IC5A 4B7ZA 4IW3B 4IXWA 4BNDB 4HXFB 1O6CA 4JC4A 2WD8A 2G04A 5CVEA 4ZI7F 1W52X 1IHPA 3GJXC 4H17A 1NQWA 3UUWA 2WILA 3HFRA 2NP7A 1R16A 1G6OA 3A4TA 4QTTB 2WTBA 4MICA 2M32A 1I7NA 2OPBA 5CNKA 4FFMA 3D0QA 2C2YA 3IAM6 3IP5A 2QQGA 4BQIA 1FB5A 2GPSA 3EXEB 3R5FA 3UOGA 2Y92A 3BL8A 3F49S 3LLUA 2CMDA 5AOCA 3OVMA 1CPYA 2VZ0A 5L9AA 3QYAA 3NHPA 3BDVA 1J7KA 3PD0A 3JYQA 4X66B 2BY4A 3PWSA 4U7WA 2G28A 4GZ5A 1HF3A 1V4NA 3EW7A 1SCDA 3CF4A 4U5QA 1CUBA 1WUTA 4YRRA 5D3MB 4JVLA 4BMOB 3PKIA 3KUUA 4GOMD 1KMIY 1XRLA 1ZN2A 2E6UX 5IJ9B 4W7HA 4DV4B 1M0TA 1YL6A 2I4NA 7REQA 3KETA 3AINA 3JQPA 4HPJB 2FDXA 3BS4A 4JBIA 4QRDA 3WWPA 1M7BA 3PQ2A 4JJIA 5ALIA 5E4TA 4J4HA 3WB1A 1L8OA 2AZDA 2GPJA 2WU4A 1PVVA 3PJEA 4K6GA 3TDNA 1AURA 1EXNA 1FSGA 3CLKA 4ZOLA 3AHGA 3OO0A 3GUCA 2IV7A 3L6UA 4ARIA 1OIXA 2KBEA 3KZCA 3QPUA 5M3BA 3UHPA 1QYRA 2F3SA 2IEIA 3KEOA 4L8LA 4MDHA 2Q4BA 4R16A 3CNEA 4TTJA 4KTTE 1QGUB 1SR8A 5DB4A 3L6DA 3U2QA 2WFLA 3URMA 4BQFA 3AR7A 2REXB 3DAHA 4LGYA 1FTYA 2H2DA 1X8LA 3RGGA 2X22A 2J09A 4MGEA 2CDAA 5B4UA 1WLYA 4YQZA 3TTVA 3ZHYA 1AMUA 3GEPA 3A2LA 4TS9A 2PDAA 2FG6C 4CGYA 3DEIA 2GOYA 1NRXA 5AO9A 4KFCA 1WXGA 2JB9A 4DPLA 3CW9A 2NYRA 3QVMA 4FS3A 2VDNB 3EA0A 4EYEA 2IT1A 2O23A 1D6SA 2Q6OA 2I3BA 4G24A 1HDOA 1EZ4A 2IF2A 4U2CA 4DCSA 3KJIA 1FVOA 3GPDG 1M34A 3PE4A 5T41A 2ZYRA 2FPUA 4L50A 5FAXA 5BN1A 2DMRA 4BNFA 3IC5A 3ESYA 2VCYA 2FPLA 3QIAA 4D3YA 1QTQA 1FFAA 1WDLA 4TQGA 3L8MA 1COWD 2W8BA 1SCQA 3HCDA 3OA2A 3MILA 4V1CB 3PLAE 4ND3A 1YQ9A 3H1PA 4AJKA 2J46A 1UL1X 1XKTA 3BE5A 4A3SA 5A9RA 2IRWA 3EVDA 3ON5A 4E31A 4B3IA 1UJMA 2LPMA 4TRMA 4NV1A 4ER3A 4ZEXA 1HYHA 3TJRA 5I7EA 4QTYA 1B3BA 3K6SB 5AVVA 4I55B 4XCXA 2VF7A 4CEJB 5BWCA 3L1IA 3TUZC 3ME5A 1NF9A 1QIEA 2NTEA 3QXSA 4FSDA 5KU7A 4X00A 5L4SA 1GV0A 1U8UA 1FYFA 4CRWB 4N54A 1IM2A 4ZD6A 4EMTA 2HIAA 3U3ZA 5IDXA 4US2R 5DYGA 4J07A 3RHSA 3L0PA 2NU8B 2QAGA 1FCJA 4II7A 1XN1A 3DCYA 3NLLA 1FC0A 4IIDA 4L16A 4LVOA 3KPWA 5BRNA 2C0CA 3WL6A 1Z74A 3RSGA 5I48A 3OP1A 3RIEA 1GVNB 1CY8A 721PA 4DTIA 2HLDA 2QIPA 1MC8A 3VR0A 3IDFA 1Z8NA 3ZLVA 4NFHA 4C30A 1UM8A 2RHCA 5ICMA 3MOGA 1VL8A 3VR4H 1LJ8A 2ZVDA 1MVLA 4TL8A 1S3FA 3TMAA 3G02A 1NF2A 2BR4A 4NH0A 3A3OA 3ZGOA 2Z8YM 1EAMA 1OYOA 4FZRA 3MN1A 3ZXXA 2R6CA 1NNI1 1RJ9A 3F5DA 3I58A 2DFKB 3U0BA 5FPSA 5ARDA 3KXIA 1I6WA 3M0EA 4LYJA 4GPIB 2HCRA 3R6TA 2ZR9A 5TQ0A 2BSQA 2ACVA 2QVGA 1SQ5A 4PZ0A 4I1OA 4F5DA 1COWA 4LNUB 2AMVA 3NKVA 4U0JA 1K7FB 1DWQA 1SA0B 1VRVA 4MO2A 4I1VA 3K15A 1HEYA 4QA9A 4DQDA 3H87A 3OJLA 4AN4A 2FRDC 5DM70 1I7DA 1Y3HA 4NARA 1YS1X 3KVRA 3MJEA 3Q4GA 5LP6A 2JCBA 4QJIA 1GPWB 1E1NA 4OF4A 5HTKA 3DO5A 3UT5B 5B55A 4NE9A 3PC2A 1RXUA 2BKXA 3QSGA 4FI3C 3NANA 2G9ZA 4BVKA 1CEQA 3UIEA 4CV1A 4BKMA 4CKZA 4EGQA 1E94E 4D82A 3FPKA 1XL0A 5G4KA 1G4UR 2II6A 4HFNA 3R9KA 4NJEB 2LDXA 1R0BA 2RGYA 4ZCPA 3NHZA 4QYTA 1P1CA 3CG4A 2X6QA 4B9EA 3AJAA 3WGUA 2BBTA 5H59A 3F5MA 2D3TA 4L5JA 5FBWB 2P30A 4DXAA 1L5LA 5KNCA 1C1XB 1ZISA 3VAYA 4CUKA 1KP2A 1LLUA 1LX6A 4GR9A 2NO9A 2FI1A 1IEXA 4OGKA 4IDNA 3IP9A 2DP4E 3TSOA 5DTJA 5E6RA 3VDQA 4U5XA 4FCVA 3SI7A 4ENVA 2ASVA 2F55A 2YOFA 3PENA 4WNIA 2X8LA 1UKCA 1BMTA 4AG6A 3EWIA 4BV2A 1W6RA 1KMHB 1WNFA 2IP4A 3DWFA 4MUJA 5DBFA 4IXDA 4OKSA 4XD7A 3S8EA 1YVUA 4IH1A 3VKWA 3AGQA 4IKEA 1TCCA 5IFLA 4HLCA 1ACMA 3KALA 3SEQA 1Q14A 1EFHA 4AU1A 4ZMBA 5HKBA 3RUPA 3FYCA 3R0QA 3KT8A 1YKSA 2DBZA 3SD7A 3VR6A 4PNZA 4GGPA 4U9UA 1X94A 1MHPA 4C88A 4E30A 1UXIA 5FI1B 3VO9A 2OYCA 5BN3A 1KI7A 3WLKX 1YKGA 3EXIA 4YUXA 3MMSA 1F4VA 3MAJA 3LC2O 1G1AA 4FYWA 1CETA 3CISA 1UUFA 4XR4A 4B0PA 4C21A 3IPXA 4FDMA 1UPTA 5KSYA 1HFKA 1X7YA 4BKRA 1SM4A 4KXLA 4URWR 1OCEA 4U4AA 5E9WA 2V7PA 4G0NA 3ZY6A 4DBLE 3AERA 5CFZA 3DYVA 4QYWA 1DMSA 4E2WA 3F9IA 1SFRA 5J4LA 3OFKA 3SKVA 3TIFA 4LV8B 1UEXC 4RKWA 1XRSB 2H4JA 3JZIA 2J3IA 1T15A 3P0HA 1HDXA 4G65A 1UBNA 1VFNA 5J2TF 1A9XB 1FRQA 1C7FA 2GMWA 3G0BA 3SXUA 2XVAA 1EK0A 1ZCFA 2V6MA 4ERNA 4XIFA 5IG2A 4IOMA 1WKBA 1ODCA 2CYAA 3LPNA 2G08A 1BEEA 1CEEA 4ZGGA 5HW0A 4BMYA 1FFCA 2VJPA 2JVKA 1LSSA 4P8RA 4BLTA 1UINA 4GX0A 1Z22A 1E3IA 1NXWA 5CK5A 1R5NA 4QG3A 4TS4A 2PNFA 1ONPA 5JTUA 2RDMA 4IGEA 2EXXA 1T10A 4JGIA 2CYBA 3EZ9A 5JFGA 2GVNA 3TPCA 4YAUA 1YFJA 1O94C 5I45A 2QAIA 4EO4A 1O4VA 2AG5A 2G63A 3QUSA 1CJBA 3UYKA 2PWPA 3GCGA 5AKKA 4C7KA 3TRKA 3V7UA 4KQEA 5DP1A 3RRNA 3C3XA 4HNQA 2VUUA 3W2IA 3EB9A 4C03A 2A59A 1OVGA 2HSGA 1XR3A 1J06A 3MRVA 1O97C 5LFAA 4MW4A 1BROA 3D0KA 3UOAB 1HRDA 3SXJA 5GZ3A 4J1QA 4F5EA 1J1IA 4CLRA 1ISIA 1C7JA 1XA3A 1ZRNA 2GXUA 3EOBI 1LGYA 1YQTA 3G1WA 4H7JA 2WU8A 4D74A 4YYEA 4OXQA 4DCVA 3QUAA 4KQ9A 5GONB 2CL5A 4MRSA 3W9YA 4BO0A 3PU6A 1RI5A 3F90A 4UCQA 4WKOA 1C9JA 2QPAA 4W4TA 4W1QA 3GRYA 5E9QA 2OCAA 3GI1A 1QZTA 3DEYX 3BL5A 5AI4A 5KDDA 1K4MA 1W46A 2REQB 2VR1A 1JDVA 2A0WA 1DMRA 4TL6A 1PW7A 1STOA 2L0XA 3M5CA 4ML3A 5FBRB 2FV8A 1XAIA 3T52A 3TXAA 4AL4A 5K0ZA 1TUGA 2VJNA 4Q9HA 3TOXA 3P0IA 4K6OA 4POAA 3ANTA 2W4QA 3W6PA 2ZPAA 1WCV1 3C8MA 1RHQA 3DB2A 4P4UA 2B5WA 1P60A 3DMPA 1VJCA 3M8KA 2D62A 2VTKA 3GLIB 2ZJ1A 5K0BA 2EJWA 4IM7A 1WEKA 5A1TA 1RKXA 3K9FC 3DBHA 1E2DA 4FMBB 4O2BF 5FUBA 4O4HB 2A5LA 1DUIA 3ZQKA 3KVYA 2J41A 4H1VA 5A02A 2J0SA 5ITVA 4WW0A 4EI8A 1PTJC 4F9EA 1EBBA 4RBNA 1V43A 3IO5A 3BHMA 3U6BA 2HK9A 4HB3A 4AUNA 4DLNA 2AI2A 3OZAA 2WQ7A 4AT1A 3E3NA 1UZUA 3II6X 2QTVB 4WY2A 4JVNA 4DDMA 1XEWX 3RIHA 3WGVA 3AB3A 1OWOA 2ZBPA 4IO0A 5F2NA 3FUWA 3IPAA 1T0PA 3DOIA 3QXXA 1HUQA 1X38A 4H7DA 4MKHA 5J63A 2ABWA 5B2EA 3OQNA 1JFTA 3DPUA 4PBRA 1JIQA 1ZGBA 4EKDA 3AM3A 1RI3A 4XUEA 4LTDA 1JFLA 2VUSA 3QLVC 5HOQA 5JSQA 4O29A 3QLEA 1IUPA 2FUG6 3CCBA 4DIOA 2B4YA 1KK3A 1KDZA 5A4MS 2ATVA 4FE7A 4YH1A 3TNJA 3E7XA 1EYZA 1W1IA 3CUUA 2B94A 2O0KA 4A4DA 4DUPA 1OV4A 2CUKA 3UHFA 3R5KA 3EPHA 2ZUBA 5F1KA 1XTTA 3K1YA 4MDFA 1NVXQ 1YAHA 3AUTA 1EQ2A 1P0QA 1GY8A 2IHKA 3MTDA 5MGBA 3ZD7A 1RFGE 4R2MA 5B1SA 2FMIA 1GRNA 2YFKA 4Y2VA 4CR6A 1R6UA 3LX4A 1Z6PA 1NVVQ 1MG5A 2PD4A 2ODPA 5JMTA 4CKEA 1TUBA 1VL6A 2VHVA 2I67A 2P3SA 2QROA 2UZ1B 2YCLA 1CLUA 3E7WA 3O90A 4FWBA 4OXIA 5BWOA 5F2EA 1CJSA 3A11A 3OX1A 3PUHA 2VWQA 2C4HA 5IVIA 2VNHA 4Y6QA 1OXSC 3B8EA 1I4DD 3QBDA 3TIIA 2FR1A 4O4LA 4FYHA 3FTFA 2C5BA 4JI0B 3FMOB 3GRPA 3GLUA 1IL0A 1KJWA 1YA4A 1QZ3A 1SHJA 3TB6A 3F47A 2NACA 5FPYA 3PUVA 3P9KA 5EE1A 1ZCZA 1OLXA 2ZCUA 1BVRA 1NAHA 1M2JA 1RYBA 4H60A 4CG3A 3A8TA 4WBNB 4XWWA 3ZVKA 3GZ4A 3DFMA 3EASA 2JH8A 3LFHA 3ANMA 4M1MA 2L19A 2BF4A 2GHTA 3I6IA 3FSJX 4XB6B 4RZXA 3TBHA 4LQ4A 3FTCA 2HIHA 1CR1A 3C5WP 4YFVA 1FTSA 4UJ5A 2ZEJA 4P98A 5I8ZA 3MCTA 3NTVA 3HYSA 1VJ5A 2DTXA 3CUYA 3WRYC 4JC5A 1NXPA 3JALA 3RS7A 3AVXA 3VYTB 1CJTC 5CW2A 2FMTA 1JJFA 1SXJB 3SLRA 1T5LA 1CRWG 1MPXA 2OO7A 2SCUB 3EXFA 4M8NE 1FRZA 2H85A 4B4UA 1ITZA 1WULS 3VVMA 5I7OA 2VP9A 1GHTA 1WKCA 4WOKA 2N3ZA 4HAWA 2KLBA 3QWBA 1GTJ1 1FTWA 4HZUA 4S1VA 5CT4A 1QDUA 3RBVA 3UMFA 4BN0A 2A1UB 4W9RA 2ORIA 3AUSA 3ENVA 3DW1X 1ESNA 5EJIA 3ORFA 1PIWA 1ZH4A 2VLIA 2QV0A 3ZWWA 1E2FA 4GVPA 1XJ0A 1P2BA 2VDPB 2XMQA 1N2ZA 3LIIA 3VR5A 2BHRA 1ZSVA 4ESOA 5DNWA 4E7PA 4DXDA 1B1CA 3JY6A 3KP1A 1BOFA 1U5CA 2JLSA 4ICIA 3N0WA 4PPYA 1M72A 2B0JA 1E66A 1SB9A 4AUKA 1L9XA 2HL6A 4L27A 3L8ZA 3O8BA 5H83A 1NL3A 1G21B 1U0OC 2A35A 2OVFA 3A70A 3OIWA 5EHIA 1ISMA 5TGTA 3WGMA 4L3OA 1NY5A 4CNBA 1U0BB 3NMUF 4TMZA 3RVSA 4EJSA 4QM6A 2QW8A 4MQFA 4WFIA 1U94A 3D54D 3B6MA 3KSDO 1X7XB 3LZCA 1RI4A 2AG8A 3ONNA 1E7MA 1HT3A 1EGAA 1LSOA 3D8RA 1FFXA 4LZLA 4OHPA 4S0XA 4U02A 4Z7JA 3CLSC 5AVSA 1YS9A 3R9XB 1OW3B 3SCZA 2AQKA 3ETJA 3C85A 3VA7A 3PHBE 5ELMA 1NQOA 2QY6A 4A0HA 1FFHA 3HBJA 4IQGA 1GFWA 4J1NA 3B89A 5AOVA 2AN4A 2PQMA 3ZCVA 3W5VA 4R98A 3CFYA 3B1XA 3LECA 5DI3B 4W1PA 3ET4A 5IW8A 2YJGA 3D4IA 2QK4A 3L79A 4PXYA 3ELWA 1VLQA 1O0BA 4DA9A 4AXXA 2QVCA 1V3VA 3PGXA 4OHXA 2F9FA 4ALMA 3GZNB 3JARA 4TLAA 3TNLA 3TW8A 3HGTA 3SR4A 4RHFA 4XDYA 5DK6A 5FWXB 3ZV6A 3H9BA 1H6DA 4RTLA 4F21A 3DOFA 2SKDA 2QVLA 4IZOA 3TTSA 4LG1A 1J8YF 3QVVA 1F9EA 2QX9A 4Q4JA 1MB2A 3VPCA 3U5TA 5DSTA 1EP3B 4CJXA 1HE1C 2FRXA 2H2WA 4I1YA 4Y2YA 2Z58A 4E5PA 4F8JA 1D2RA 4BDTA 2PBZA 1F2VA 1GTMA 5ECWA 1B2RA 5TQJA 1LUAA 2AYZA 1NJ1A 4KI7A 1N6KA 3PDJA 2F62A 3P4UA 3SIXA 5JAMA 5LMCA 1OV6A 3WB2A 4CM5A 4QQKA 2X7JA 1T1IA 3TOCA 4P5PA 3OJWA 3PRJA 1PWEA 1DRVA 3ADDA 1VL2A 1YRWA 3FCXA 2IP2A 4GICA 1PT7A 4PLZA 5KQPA 7ABPA 2QQEA 1C3VA 3TSAA 2P65A 3CPHA 3A25A 2PRZA 4CTJA 1ISGA 4F1WA 2P62A 3PLNA 4FOOA 4KPUB 2A9PA 4HRVA 4UQPA 1N1MA 2MSLA 1GQOA 1LZKA 4FFBB 5DDIP 4E5KA 1AOXA 1ONSA 1WV0A 3L0ZA 1XDWA 3P9IA 1G8HA 1GZ5A 1IMOA 2Q1YA 3CA8A 1ZUWA 4F3KA 3GP5A 2O6HA 1BXZA 2QN8A 1I51A 3NCTA 2E82A 3E5NA 2WTNA 1ORRA 5BYJA 5EWMB 4MV8A 5JS6A 1VL1A 1VPLA 2FGKA 3JVEA 4JA2A 4I9GA 2Q5QA 1NG9A 1XZIA 1FVHA 1PNVA 3C8ZA 4Q1CA 4QGAA 4UVIA 3PHGA 3IEKA 5EP1A 2EW2A 5E8JA 5G4LA 4Z4IA 1E2BA 1PG0A 2GJ8A 1V1JA 3BILA 1YB1A 2RHWA 5JDCA 3VSCA 2XW6A 3X1DA 4XVUA 2YV2A 1LU9A 2X3UA 4XXHA 5KSPA 1LRLA 2XDQB 4REQA 1GQSA 4EMUA 2H18A 5EJMA 4YR9A 3ZGZA 1TD9A 2X8JB 3OO1A 1MIOA 2XEXA 4C4RA 4W63A 2UZ0A 5M5BA 1KO8A 4L6IA 3TD6A 4R0MA 4OHMA 3FLEA 3K4HA 1T5OA 3UPDA 3V42A 2DFTA 4D0SA 5JOQA 5AUOB 2LCFA 4H16A 4UTRA 3UK2A 1EVIA 1BDIA 1UFVA 3G0CA 1PJAA 5BWNA 3PEVA 1EM8B 5CT5A 5FL3A 3G89A 1ZOOA 4YMVA 3ZHQA 3KHUA 3VRHA 4ON9A 1CCWA 1E9DA 2AZTA 2J5QA 4HS9A 4N03A 3MUOA 4WFJA 5KJEA 4ZEVA 2GCOA 1U2ZA 4EHDA 5JZMA 4PLCA 4DA7A 3HPQA 3RYHA 4JJAA 4DUGA 4GSYA 3DKPA 3QVGB 3VR4D 4EF4A 1JRLA 1AY0A 4GDMA 1WR8A 3QG1A 3SYLA 1GPKA 1Z18A 5E8RA 5EJ7A 2HCFA 3V32A 2ZRHA 1WW2A 2AXQA 2C58A 3M6IA 3W2EA 5BW5A 4N6NA 5JQGB 2FEMA 2B4RO 1LS6A 4LOJA 1DIHA 3GFTA 4JI5B 4GR4A 1J97A 1P7YA 2I34A 4D0LB 1TLLA 1TZCA 2RHLA 2HSWA 3PFIA 5T4HA 5LDDC 1RACA 4DR6B 2MYTA 3AF6A 2WSLA 3HKBA 3TXXA 1ZKMA 4ZYTA 4ZCLA 4G8JA 1NLMA 5ADHA 3T3IA 2BFFA 1C4KA 1S4QA 3EEIA 3I45A 4QYSA 4X6UA 2XOEA 3KLNA 4BV8A 1TJ5A 5DWVA 2WD9A 1WBDA 1Q21A 4R81A 1JG3A 3O0TA 4HK4A 3I9V1 5E6RB 4RK0A 4YP7A 5AXAA 1AO0A 2NZYA 3QK7A 1ZITA 4KL8S 2ZT6A 3TVDA 5LN1A 4P38A 4DPKA 1FXUA 4NOJA 4WUTA 1H9BA 3HB9A 4JXKA 2DVMA 3PHJA 5U1PA 3UCXA 3NBXX 1V71A 3DM5A 4XJSA 1M0SA 3WYCA 5DGIA 3P19A 2HW8A 3FOFC 1H3FA 1QPGA 4B34A 4CMEC 3OF2A 1JHDA 4DWWA 6ADHA 2W2PA 3BGVA 4M8IA 5IH7A 5K6AA 1RYNA 1G60A 1E2IA 3U7GA 1NFQA 5KB3A 1JF8A 3G85A 5CDFE 5J3JA 2AJLI 3K9HA 4IRUB 4NKRA 4Q93A 5JSZA 4NIMA 2Y1FA 3KB2A 4CT5A 2O8DA 1B8PA 1UP4A 2AK3A 2DFNA 2HRQA 3PXUA 2QTCA 5E7MA 5E9JA 1NX6A 2RH5A 2YDXA 1M2WA 5EJGA 5I9LA 1HORA 2QY9A 5DGTA 3WYEA 2FGJA 2RHTA 4TMKA 1U65A 4N3AA 2K87A 1SWWA 3HJAA 1NVKA 5L3VA 1D2EA 1XMSA 3AONB 1RZRD 1A0OA 4MA5A 5KHLB 3BDAA 4JDPA 3NNDA 1LSUA 4MQLA 1Y5MA 4CTMA 2P41A 4AS2A 1Y4SA 1H5UA 1M5TA 3EJ6A 5FR2A 3WIEA 2HJVA 5GVSA 3PE3A 3P0RA 4C14A 1IATA 2WFAA 4QFDA 1A27A 4DIKA 1X3LA 3AJDA 1HDEA 3EMBA 2XWPA 3B2QA 2GYYA 3I05A 3JZMA 4ZC1A 4X1IB 4E6EA 1Z47A 3C6MA 1MDFA 3RUCA 3I2HA 3TBKA 2NU6A 3ZWQA 3H4IA 2Q4OA 1L1RA 4V0NA 2A3NA 4W5RA 1VSQA 4X7MA 2QUHA 3EZ6A 5EUQB 1H2HA 2KHZA 4YWHA 4FS8A 2XB6A 1C9EA 3M7IA 3U3KA 5F7XA 3FPHA 1G3MA 1JAIA 4QUDA 4RL6A 3CF4G 5A0VA 4MITA 3WL3A 4KAXA 5EMLA 3P0FA 4D3XA 1TK3A 4H7EA 1XKQA 2CLMB 4H1TA 4XVQA 1T1GA 3BGWA 2FETA 3SEAA 3LWZA 3ZV3A 5C8YB 2H0QA 1Y80A 5CH3A 3AIMA 3JU3A 3X1ZA 2VJKA 5JJCA 1D3AA 1YRLA 4PZCA 3I8OA 1V3QE 4CQLB 3GL9A 4GM1A 1Q0PA 4PE5B 3WLHA 4F9TA 2DPLA 2ACWA 2XCTB 3A6JA 3TUJC 4M1QA 5E7JA 2PKRA 1YB5A 5E9AA 4F72A 3EXHB 4ZO8A 1GU0A 4R41A 1UBSB 1RI1A 1GZ4A 4RGBA 2R6AA 4DM3A 1XEXB 3DV2A 3LO5A 4OQMA 4DIMA 4D9FA 2J59A 3ILYA 1FFSA 2UKDA 4LJ7A 2Q49A 1FS6A 4WCFB 1G8SA 2ERXA 4I19A 3VVBA 4B2YA 4YIHA 1D8TA 5I51A 2Y68A 3G5UA 1IZ0A 1DJNA 2FFQA 4R1NA 1JFFA 1CKEA 2BGUA 2YHIB 3AHIA 4V0SA 5CLHA 5B12A 3ZHUA 3LX6A 4Q66C 4BB6A 1D4FA 2BN4A 3EGOA 4WGGA 2H2FA 4P7FA 4F06A 4WXYB 4DNQA 4FHGA 5C7LO 4TYNA 4TKUB 4Y9SA 2ID8A 5DHTA 3VR2A 4MS1A 2QUBA 5GQSA 1WDTA 2Z4SA 3AZOA 1GCOA 3DB1A 4HUQA 4IUYA 4JQYA 4JNCA 1TQHA 1GSOA 1YT5A 5CIWA 3WKCA 2W37A 3OZGA 2WKQA 4MHOA 3HZHA 1LA2A 4MUMA 2L42A 4XYMA 1PR2A 1XDUA 1PSDA 2IUTA 2XHEA 3LU1A 1YKFA 2A1TR 3V48A 3S1SA 3AY3A 4JD5A 4LEIA 5F5LA 3H0EA 1X9HA 5IVHA 3M6UA 4AJLA 4RVNA 1R27A 2UYGA 4RHTA 5IM4F 2IK8A 1Q15A 2YDYA 4HDRB 3ENKA 2V74B 1L5SA 5JWRA 3IDSA 1A8UA 4RDCA 4Z3OA 2XBUA 3LLVA 3AKYA 4Q7LA 4DR3B 2C2BA 3NI2A 5F33A 3FPAA 3F74A 4UHKA 5EESA 1OB5A 1G20A 2G5GX 3GT4A 3GC6A 1H2YA 2DQYA 4II3A 4EHFA 3W06A 1NVWQ 1XTZA 1VDZA 4HGYA 4HC4A 5K4GA 1N5LA 1A1SA 3AW8A 1II8A 1RAEA 2ZI9A 2NADA 2NZUG 4O2RA 2PPVA 4Y0NA 2XLCA 3ICWA 4IF4A 2W6ID 1EQAA 1HZZC 1E6MA 1Z12A 3LBFA 4JENA 1UFKA 4N7RA 5D5HA 3UXHA 2YKGA 1AF7A 3MFYA 2OGWA 1J25A 1WQ4A 3AOEC 4KNYA 5THXA 5KWJA 2PZAA 1IPFA 4HQFA 2AFHE 4RA6B 3FFBA 1GD1O 2ODNA 2J9RA 4TRNA 1TO1E 4RTKA 1ZVMA 1U8FO 1AG9A 1VPVA 1X92A 3MGGA 1M83A 2XWSA 3UT0A 3PVZA 3NTXA 5LYJF 4I4IA 5HF9A 4YUYA 2E21A 3I1IA 3QP9A 2R65A 5JWOA 2KLHA 3ZCQA 2F3UA 3MSXA 5JI3E 3LDFA 2GXAA 4YMUA 4AFNA 2G8NA 4YREA 4ETIA 4CL2A 5KTTA 1XMOB 1N3BA 2ZYHA 1A5BB 4G4SP 4KCGA 2WV9A 4L51A 4KNWA 5EUBA 3N86A 1YE5A 1LW6E 4OMDA 4RSRA 4FEGA 4ZAWA 5BT8A 2R2AA 2VO1A 3GDWA 4P53A 1XWWA 2OV1A 3AJRA 1E9AA 3IA2A 4C0QC 4RZUA 1MDBA 4NE7A 5KTMA 4MQBA 4GBGA 1TAGA 2GYVA 3NXSA 5T6BA 4Z54A 3RC8A 4AKGA 3OOEA 4GRDA 3TTYA 4NXMB 1WSDA 5KX5A 1KJZA 1B3RA 3COYA 4WVFA 5IEJA 1YQUA 3Q3VA 4URHA 1QHHA 2NUPA 4X84A 1FMCA 1WD5A 1ZUNA 2QD2A 2GCGA 3B5IA 4H35A 5DTMA 3FSGA 4M8KA 5B64A 1JHYA 2XVZA 2E9SA 1HOXA 2GQ0A 3EGXB 1C1HA 2Y4NA 1L9KA 3QPBA 1HEIA 1E7SA 1TVEA 3Q87B 2LIVA 4WCDA 2V3CC 1SBIA 4KQWA 1TKBA 3SBEA 1RIIA 3GH3A 1E3WB 3H1FA 3LXRA 2Q6LA 1J8FA 2H7YA 1M1YE 2I1LA 4G5HA 3TNFA 3E53A 2VZ8A 4F85A 3R4CA 1Y63A 4HATA 2RI1A 4JJ8A 3OZCA 5MN6A 2I3AA 2GEBA 1FNNA 3E8SA 3M5PA 1KHTA 4NAHA 4KRXA 5EHNA 3HYCA 3KWLA 3H4VA 4H3HB 2UUBB 1HOTA 3G49A 1UC9A 1Y7LA 4IOJA 5D5PA 4Z9BA 4RGVA 2ZYDA 3P2IA 1H22A 5JEDA 2AFIA 1R8JA 2IDZA 2Q2VA 1SK9A 1O87A 2O6LA 4EAQA 1RLTA 3RFVA 4YJ2A 2BMJA 4QQNA 3BMNA 2V6FA 4CIAA 1M0WA 2H9IA 1YRAA 3MAAC 4Q1VA 3WNBA 3W78A 5IUNC 2ZZNA 2JBAA 3WHIA 2YRFA 4K87A 5KREA 1E1CB 5T4EA 2CXNA 2RARA 3HUFA 3GV0A 3WLEA 3DLBA 3GA7A 1MC4A 2DUUA 3IUJA 3BMQA 2ZJ2A 4H3VA 4QHTA 1Y9EA 1CLEA 1AN0A 3U80A 3GJ6A 1FLDA 4CG2A 4QJ3A 1QV6A 3P7MA 1M1NA 3KXDA 1R00A 1P17A 2RIRA 5EPUA 3N5KA 1JXQA 4DLVA 4BV3A 5JT1A 1EDEA 2J3QA 2H5IA 4TWRA 3REQA 2O59A 1XA0A 3BD8A 4DZZA 5DKFA 3W05A 1T29A 3ASYA 2YX1A 4YHBA 1KC3A 1NUQA 4CQMB 1X86B 3HU2A 3R0JA 4JP5A 3ZXYA 5FNVF 3K92A 2P3OA 3FOBA 1K98A 4KBYA 3FVWA 4NEHB 1MJHA 4H7IA 1ZH8A 2Y0CA 1JYSA 1OFTA 1US8B 1OTHA 2HY7A 3GLGB 3TKLA 2ZUEA 2FSSA 1K1EA 4WCFC 4HUJA 1IU9A 3RRMA 2VRCA 1WPQA 1MQAA 3GJSA 3Q85A 5LXTF 3O8RA 3WADA 2O7VA 4N7MA 1U98A 1QTRA 2YIJA 4FVTA 1ENYA 4CMBA 4JLUA 2PHZA 2WHYA 4RABA 4F4CA 2E0IA 1OFIA 1Z4JA 4P34A 1H2BA 3WNCA 3E2MA 1D0IA 3QXJA 1JXMA 5C8VA 4FFWA 3PC8C 4B71A 1J9ZA 1JHAA 3QBEA 5ANRB 1P4JA 4BU0A 4EFNA 5C52B 1TPZA 2R6JA 4EMBA 2ARKA 4IV8A 5KWSA 4B3RB 2XXBA 2QA5A 2WVAA 5G3YA 2I33A 4PRZA 1T24A 2HWUA 4LRQA 1G98A 1UJNA 2WUWE 1ULTA 2BCGY 1NVAA 2LP4Y 3KYDA 1B42A 1QQTA 4G1UC 5AHXA 1APBA 3EY4A 1RE1A 4YJHB 4NY1A 1CS0B 3NIGB 3TRIA 1MGPA 5G0SA 3S2IA 1PJSA 1HSZA 3PPVA 2O8BA 4E5UA 1E1KA 1MRSA 3BSWA 4GP7A 1EX1A 3BCHA 5HRUA 5EGSA 2FRVA 3CJTA 3MRSA 3QPAA 3V4VB 1UK9A 3LGAA 1M74A 1OZFA 3V8QA 2O4CA 3HR7A 2EWWA 1NRWA 2MT9A 2ZYIA 3HQ4O 5E3IA 2Q6VA 3KZ1E 1PZFA 4I1IA 4TX1A 1NBIA 4I50F 1GT6A 5KYXB 1ESZA 1I3NA 2OO3A 2ZSDA 3RAFC 3MGBA 1CDOA 1UJ6A 3DJFA 3P94A 4GQBA 1K7YA 1XQ6A 3U4CA 2PR2A 4ZICA 3PNPA 1XXHE 4N7BA 3MGKA 4NZYA 2ZBEA 4PNHA 1DS6A 5HG0A 5FI3A 2EL7A 3QKRB 3LX8A 2OPHA 3VYSB 4BFLA 3I39X 5AICA 5FUMA 4UUNA 1ABEA 3A6HA 2XEDA 1DI0A 1CUUA 5BWLA 2Q5EA 3KPJA 4S1NA 4UKDA 3FWNA 3QKWA 2VTVA 3QELB 4MWEA 2DAPA 3ZGXA 4JJFA 2N1MA 5EJ8A 1P44A 1WCWA 3P26A 4XGKA 4DLLA 3K5WA 5LPNA 2QVXX 1AQJA 2IL1A 3OQPA 2P3LA 2RAVA 4G4JA 4I9UA 3TQOA 1RRFA 4QXQA 1L8XA 1DELA 4G4IA 1Q7BA 4M9ZA 4ZI3A 1FX1A 3K0HA 4TTQA 3OE7D 1GFZA 4P80A 4Y2RA 2LE0A 2O2IA 4WKCA 2JZCA 3I6ZA 2IIVA 3P97A 4HAOA 4KMRA 4NOKA 4OBBA 4YRCA 4DN6A 1SBYA 5J2TB 3IEMA 3DQPA 3DHVA 2MOKA 4OK5A 2GFQA 4J16A 1ZHOA 3GFFA 1N7JA 4IDHA 2JIQA 4HLUC 4IDPA 5DV9A 2B8EA 3CWZA 2VTEA 4PIVA 3GZJA 2VPIA 4LFAB 1DBRA 4MQ4A 1YR2A 4I4TB 5T3UA 1DL5A 2GZMA 3F9CA 3V1KA 1MXHA 3I30X 2X7HA 3FVTA 4LJLA 4FFDA 3AF0A 3VV2A 1B8NA 4MA0A 4ANFA 2BZGA 3QY9A 4D8WA 4ESHA 1NJ5A 1Q84A 3K0CA 1B00A 1YB6A 3RDPA 1VXOA 4DQXA 2E87A 2VH2A 4BO4A 3TZEA 3BAZA 1Z0IA 5DHRA 5FI0B 5JZBA 1ATZA 1PR9A 5AM4A 3DNMA 2X40A 2PV0A 4ADSG 4N5IX 2A33A 3KTDA 4WA8A 3H19A 2HR1A 2FSPA 2BLLA 3JQDA 4JC8A 1MOPA 2Y6VA 1IY0A 3LUGA 1KE1A 5KJFA 1G7CA 3PT5A 4TYYA 3CX3A 4ZPJA 3I12A 4X1YB 3TVTA 5KTNA 3D3QA 1O6GA 1TF5A 1N5RA 4EKIA 1L4BA 3LYAA 3N58A 1AQLA 3RKUA 2QJWA 2E37A 3I0MA 2VWGA 1KMMA 4P7JA 1NJSA 3ZIAD 2K2WA 3PVCA 5HF8A 4NH4A 3HXTA 3T7SA 5GTDA 2HNBA 1J2RA 1G0NA 1A8SA 1P7WA 2ZSFA 4UBIA 4OI1A 4TT3A 3DUFA 5DTEA 2W6NA 5ALQA 1GRQA 1IB6A 2ZLBA 3OLVA 4BFYA 4Z99A 1PZGA 2G36A 3P45A 4PIPA 2J9ZB 4RPCA 3S8YA 2PY6A 5FFMA 2WY2D 3KRTA 5JNRA 2AJBA 2F67A 1A9SA 1FP7A 3Q8XB 1R37A 2GD2A 3TI7A 3VC7A 2G71A 2IOHA 2AD1A 5JJ5A 3BWCA 3EPJA 3QH4A 2I29A 2D6FA 1QP8A 3W2GA 5CB8A 2F90A 1RRGA 1PT5A 4G07A 1P31A 3ZGYA 3P9PA 3LT5A 4F6CA 5LLDA 1XZKA 5EEHA 1KI2A 4EHAA 5JC8A 3ZKWB 4O2BB 4JVOA 4PYRA 4AN1A 1T36B 1YAJA 3TCNA 1P0IA 2VWHA 2A0UA 1CQJA 2RJNA 1NONA 2PLAA 5E4YA 3HH8A 3ETDA 1ADYA 1OB2A 4BO3A 1KYXA 3EGWA 1P61B 3UH0A 4BNLA 1I4WA 1XTIA 1GG8A 3FWKA 3OQBA 3I73A 4B3XA 1PTKA 5C5EA 1ELOA 3OQOA 4CM3A 1DBPA 4DIUA 1T4DA 2D8AA 4BX2A 3SZLA 1IDOA 2HJGA 3MT7A 1FA9A 4KVGA 2WE7A 4PO3X 2Z5GA 4PPNA 3KKLA 2ESRA 1PJ8A 2NAPA 3I6YA 4LZAA 4M38A 4CV0A 5K3DA 2HADA 1YUMA 2UDPA 1ZS9A 1C14A 1D7OA 2QRPA 2OCPA 5CURA 1JSCA 4EPWA 5A9SA 3H9JA 3I28A 2X8WA 4YMWA 1Z16A 3PBKA 1YZTA 3T7EA 4DT1A 2XQKA 2R68A 1GIAA 3CURA 3MJHA 1Y9ZA 3IIEA 3OLYA 1XLWA 3CR8A 4M88A 4CDMA 3BH0A 3GD7A 3L0CA 4M21A 3N75A 4PC3A 4MLCA 1NASA 2P1RA 5KOYA 1NTRA 4UUMA 5J2UF 2XODA 1XNGA 3IA7A 2A9OA 3ZDZB 4B8WA 3CEMA 2GN8A 3L77A 1TMOA 3GARA 4O59O 3HDHA 3NGXA 4UFOA 5CNMA 5DCWA 3UFXA 4FYIA 3JQGB 3PQ7A 1W88A 4HN4B 4IMJB 2D0IA 2IZZA 3ENNA 3QFSA 4LI0A 4C3ZA 1JLLA 1DQPA 3HRKA 4PGAA 3ROMA 4JP3A 4IINA 1U3GA 1CP3A 1OQAA 4ZYWA 1KK1A 2R6DA 3W1VA 4D9EA 3MJ4A 3W5CA 2BYTA 5D86A 1Y1SA 1ZNWA 2DETA 1YDHA 3IKJA 4LFCB 1YQGA 5JLAA 4DMUB 3UFBA 3GCWA 4GX1A 1KORA 2EFEB 2ISSD 1U2GA 2PM8A 3I42A 4FHCA 5L7YA 1XDGA 1DC5A 4DLAA 1JFVA 3H6HA 3KVVA 3PRKE 1ISRA 1FK8A 2B1QA 5K4AA 4WY5A 1MO3A 4EQ6B 2JDIA 4PHHA 4P08A 5IJWA 4CLOB 3KDAA 3MUFA 1T91A 4NZPA 1I5EA 5A4KA 2RMKA 2FSIA 1FJXA 5HQTA 4GFDA 4TMFA 2WDPA 3AVYA 3CUKA 1RBMA 4LNAA 2C9ZA 4W9MC 4IKPA 3HNPA 2DCUA 5D3QA 3S81A 1D5CA 1JJ7A 2H4HA 2QG9A 1VCOA 4ZO6A 1AHPA 5DZSA 4GMKA 2WMNB 1N3YA 1T2NA 1G5QA 1V8DA 2GAOA 4BNNA 1U6KA 2QG4A 4WK4B 3IPCA 1LF0A 4AJOA 3QWHA 3SEFA 1UPCA 4C78A 4CQJA 4LWOA 4DRXA 1E1YA 1O9HA 4BRZA 1TO2E 3A7EA 4TV9A 3DCNA 5FP0A 1QQ5A 1ZXXA 3N0XA 4D9GA 1Z2DA 3AP2A 1BXGB 3K05A 4PLFA 4DG5A 4ZARA 3ZCTA 3QX8A 2FEOA 2X41A 1GYPA 4MV9A 1NRJB 1GGFA 1VA5A 2GA9A 1M7HA 3H65A 4PWZA 4W82A 1I13A 2EGHA 1U9ZA 3VPGA 4C29A 3MK31 1NYQA 3PFFA 2MINA 3AJEA 1DBVO 3PXAA 1TTTA 4AZ0A 1XVVA 4LXQA 4MUBA 2NVUB 1I0IA 2ES4A 2DFPA 2DR3A 4WUVA 2XHZA 2H1SA 3D31A 2BMVA 1ZBQA 4YRQA 1S7CA 1GFSA 3O8OB 3ZDDA 4QKQA 3G5MA 4JX8A 3UG7A 3VU8A 3PDUA 2PS9A 3FUUA 3NHBA 2CD9A 4FYYA 2ETVA 4MINA 3ZVRA 3D3WA 3MHTA 1MB9A 1N5KA 2SICE 3PUKA 2BE9A 3QEOA 4TKVA 2IU6A 1EVEA 3RW9A 2FKAA 4YMSA 1E3JA 2HHJA 1H2XA 1JJIA 1KBOA 1VGRA 2O1SA 2RK4A 1IQRA 3G6WA 3NV9A 4IQ8A 5P21A 1AUQA 3ROZA 3WDSA 4A26A 3TMYA 2L18A 4XKJA 2XCIA 1GGNA 2ZJ0A 3PUIA 4Z0HO 1G8PA 1SVUA 1Z5UA 1D6NA 3AR2A 3GWZA 2HT6A 3C6QA 3GPIA 3SICE 6YASA 2VQEB 2WJ4A 5DM1A 3A6GA 2VJOA 4WXRA 4X20A 3F98A 5FB3A 2YWXA 2J33A 3MIIA 3T7DA 2MR6A 2D8MA 3VU0A 1JBQA 4AMZA 5JH7F 1RCFA 2JASA 4OXKA 4B09A 2PE5A 1Z2EA 3GGPA 3QQ5A 3AM1A 1T1JA 3MJTA 1WS6A 4D99A 5TPWA 1D2NA 2AOUB 4QPNA 3FE2A 1KJJA 3OM8A 1NQ5A 2QLFA 1JBEA 1T9AA 1VKZA 3O03A 3WOHA 3MWEA 1GAQA 4TVOA 4OLJA 2M1ZA 2YJTD 2Q9CA 4BWFB 3WBKA 1Z15A 3RTGA 3JR7A 4PSDA 1C30B 3DHWC 5F3RA 2FZWA 3BCRA 4OAOA 2ZP1A 4GEKA 4TRJA 2ZM5A 2JD0A 2EYQA 2MIIA 4ZO7A 1T1RA 5K0JA 4NENB 1A72A 2XDYA 4MUXA 4CM8B 5CB4B 3CZ9A 3Q8KA 3L07A 3EUWA 2GZHA 1QZZA 3RODA 1YS6A 3OAAD 1OZHA 3RG2A 3DBRA 2O7QA 5DIZA 3LHFA 3WWCA 3TI9A 1CUCA 4QRHA 3DAPA 2XYGA 2AQ8A 1H6CA 5FRDA 4D8VA 1CQIB 4QPZA 4AMGA 3PUWA 1ABFA 1XCGB 1ZD4A 3SDZA 2YN2A 4JLOA 3W0LB 1XZQA 4F93B 1EWQA 2BTEA 2AX4A 1XQ1A 2ZSBA 3CVYA 2XNHA 2Z08A 3P8ZA 3R6LA 4EPRA 2DLCX 2DUMA 4HAUA 5LC1A 4J03A 3ACDA 3PR2B 2C5EA 2QG6A 4JNKA 2KMLA 1Y3BE 3BOSA 4MV3A 3TO5A 4QGHA 3PNOA 2A0YA 3B5JA 2XT9A 1N75A 1OH6A 1OWMA 4JL5A 3ZOKA 3CC8A 3UMYA 1I80A 1QRSA 5FF9A 4ZWNA 3QFRA 2CHUA 3MYRA 4ALLA 5LZ2A 3TLBA 4CU5A 1AM4D 3ZNNA 3LL7A 1P2UA 1ZIOA 3DP7A 1DAHA 3I6BA 4GXNA 5DIFA 4CEIA 4OYRA 1WOYA 1GA6A 2WU1A 4ZEWA 3LQ1A 3H16A 5CA0A 3ROEA 5I9SA 1GLNA 2Q9AA 4K3UA 3HL0A 2IWHA 2Q9BA 3DWGA 4MMXB 3DKVA 4X7PA 3TTTA 2UVQA 3ZHBA 5ITZB 2G40A 5CHYA 2FPIB 2H0RA 2DECA 3A27A 2OBNA 3UJPA 4B3DA 5KYUB 4S04A 1WXDA 4AO8A 4DA6A 1FY2A 1RWMA 2RHHA 4YXWD 4QBFA 1ZQ1A 2WC1A 4NP6A 3C15C 2WU0A 4TTTS 1SU6A 2XE4A 4ENQA 2ONZA 2XXAA 4EP1A 1CR0A 2C2OA 1R6VA 2PGIA 3Q10A 1N0WA 4HAVA 1G8YA 4M1TA 5A3VA 4DWOA 2X4GA 3QEJA 1A77A 1QE5A 3GFRA 4YCLA 4WY8A 1JEAA 1TAQA 4ZRMA 2ZRLA 4Y0VA 3IP7A 2R1ZA 5EKSA 1KI6A 5JO0A 1BCRA 1CF9A 1JP7A 2FEWB 1A7AA 3KUCA 3ODGA 4FGLA 4N1AA 1N25A 3H42B 3L4EA 1U80A 4O4LF 5SICE 2O06A 3AUXA 2HDHA 4LHZA 1EUYA 5KDLA 2YY5A 4V39A 4H18A 3ZCPA 2I6FA 3PUJA 1EBUA 3RUDA 3OCCA 1XF9A 4LWPA 2Y1GA 1Y6FA 2CXPA 4GPZA 4DGSA 1IHXA 5KJ6A 2ZIXA 5FXMA 4AMYA 1Z28A 5HFAA 4H0CA 2XMBA 2D5CA 5F7OA 2P2CA 7GPBA 1X70A 4X0EA 4YX9A 1HT2E 4OK6A 4OSEA 1RM4A 2QI9C 1Z13A 1PV2A 3GVHA 4HQ6A 8ADHA 1JKJA 2H1OA 1ZUIA 1P2DA 4GX2A 4NHOA 3TTUA 4CKCB 1N4AA 3NU1A 3VKFA 3AQ4A 4MEAA 2JI4A 4BAUA 4YMTA 3ONVA 2C4UA 2HCTA 4PS0A 3ZZMA 4N82A 1KRXA 1KZGB 3ULKA 4HKTA 1BS1A 3PGKA 2V7BA 2DLNA 2ORVA 3M3PA 4IIJB 5AD1A 4BNIA 4RTQA 1NU8A 2AYYA 3GMDA 4J1TC 4Y2GA 3RAEC 2C54A 2C3PA 3MCWA 2ACEA 4L9RA 4TWZA 2H4YA 5HK8A 2PPLA 4HOYA 1OLOA 5GZ1A 2YVAA 4OQXA 4DRYA 2BELA 1XMVA 3M1IA 1U2RA 2PR7A 2VHUA 4ZRDA 1X1CA 1SKQA 4CW7A 2JJ8A 2C5SA 4YJ3B 3WXBA 1N7IA 2LR0A 2J5BA 1WY7A 2O8CB 2OHHA 2JJ2D 4RGQA 4ENPA 3KJEA 1NZDA 1SCUA 4Q21A 4JN6B 1ZEMA 4Q3OA 1XSEA 2EG5A 1RAFA 2AW5A 2QPTA 3KXKA 4EF5A 2O19A 3GUZA 1TT5B 2ZVJA 3DE1X 1BHJA 4UM5A 5BT9A 2IS6A 4GHWA 4KE7A 4U7TB 1CRLA 2AG6A 4Q01A 5B1IA 1KMNA 1E77A 3LGSA 1R3UA 3WQSB 2MDTA 3JYNA 2XECA 2Z3WA 1YC2A 3VH2A 2YZKA 2GEUA 2YNMD 2G1PA 1Q19A 2J4CA 4JLSA 4DQKA 3X0DA 5DBIA 1IWBB 3OFND 5EN4A 3BMCB 4U63A 3G5AA 2EP5A 3RU7A 1UAGA 4LXHA 1FLAA 3HO1A 2PZ8A 3O1IC 4LYAA 3STVA 1NMQA 1UBJS 2D1YA 4ZCQA 2IS4A 5AK0A 3DFZA 4ER7A 5JPCA 4F2WA 2HLNA 2A8YA 2FPGB 1V26A 4Q4DA 3TOZA 4D57A 2V7UA 3DE2X 1XE3A 3E9NA 1UBCA 3VPAA 1YNSA 5IUJC 3A1UA 1Z2OX 2RGNC 5DE3A 3HM2A 3OTIA 2CNWA 1Y3CE 3UKDA 1GL9B 5KYGA 1LTKA 3DTVB 4MWSA 3TLXA 3OQ6A 3Q9SA 2J6BA 4L8FA 3V5NA 4KJZA 3D5QA 4NCAA 5HE9A 3H84A 1BXRB 3NKFA 1ZM7A 5F52A 1QHEA 1WPGA 4LDQA 2RK6A 3RS2A 4DV0B 1DX9A 1O95D 3FWPA 3OIUA 5AW3A 3ZDBA 3SYTA 5I7FA 1G6Q1 4A0SA 1T9HA 4ZREA 2O2SA 3K9QO 3KE8A 5DX0A 4YPVA 4G84A 3IB3A 3T5GA 4UUQA 4EZEA 5D7BA 4X64B 5AJUA 1Z7EA 1E9SA 2ZI6A 1PD1A 2QMYA 4QPCA 3M6XA 4FUQA 5TQ2B 1EUQA 4W1RA 4Q4LA 3N2LA 5ALMA 1CY0A 1EWVA 1PJLA 3H5TA 3L4SO 2X0JA 1U3FA 5DPMA 2GHRA 3F71A 3HTXA 4TSRA 2XQVA 3OE5A 5L6MB 3GOQA 2PFGA 3G2PA 1H05A 3SF0A 3TL2A 2UV8A 4ENTA 1ECCA 4XCVA 3PF8A 4C3OB 4MRPA 3I5MA 3RROA 1T5HX 2EEPA 3DL7A 2I78A 3GG2A 3VZQA 4L8VA 5CFPA 1F4PA 4DPMA 1J0EA 2EDCA 1LPOA 1PS9A 5JVDF 2C04A 2WAXA 3B3FA 4G8CA 4CR8A 2GTHA 3DMGA 4BVGA 1QIHA 1R5OA 2FFJA 1F5SA 1KI8A 3D7RA 3PR3A 2IYTA 5HHTA 4OJKA 1BA2A 2BF7A 1RJEA 3DXXA 2UYQA 5ED4A 3DQQA 2YWJA 4ZQHA 5TIIA 1OPXA 3ZJTA 1NHGA 1FU8A 2JGRA 3T8YA 1AZTA 4Q7EA 2HU5A 2XKBA 5FEUA 3ANXA 5HF5A 2IYYA 5JAIA 3ZQ6A 2JFOA 3DYBA 4PONA 1THGA 2Z0MA 2CK3D 2OGZA 2VF2A 1J8MF 3PXCX 4LZZA 1XZHA 2CLEB 2R96A 1A97A 1ML4A 4W7IA 2P40A 1Z3IX 4YALA 2QD5A 3KXPA 2J4DA