3PFBA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ethylferulate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
b'NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
molecule tags Hydrolase
source organism Lactobacillus johnsonii
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
total genus 88
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pfbA00
1XRNA 4CCWA 2VTVA 2XT0A 4X71A 4OB8A 4PO3X 2WIJA 4H7JA 4X94A 3C45A 4X95A 4B83A 1R9NA 1ZGBA 3H04A 3TGLA 1UKAA 4O08A 4FLMA 1VXOA 1QIMA 3EIOA 4MQMA 3DJYA 2XQJA 2YYSA 1ZI8A 4ROTA 5HF8A 2QXUA 1SCKA 2FX5A 1VA4A 5AI5A 1U8EA 5AI4A 5FKJA 1EDEA 2QTBA 2VSQA 3R3XA 4RGYA 5HK8A 5JATA 3KD2A 4UPDA 1FFAA 2XQGA 1XZCA 1XZDA 3WL7A 2Z8XA 4UFNA 1IZ8A 3D59A 3NGMA 3G9UA 5AM2A 1H2XA 2J4CA 2NW6A 1CUSA 4H35A 5DTIA 1LPAB 4TGLA 2H1IA 2PU5A 3EQ8A 4UBIA 4ZREA 5LZ9A 3SWWA 4V2IA 1C7JA 4X91A 2XUPA 1ZJ5A 1QE3A 3FLBA 5E4JA 3RARA 2OCLA 3DCNA 1WPXA 3I2GA 1HQDA 1DQYA 2HU5A 1O6FA 4HXEB 3QPCA 2WQZA 4KAFA 1XRRA 2QXTA 4FNMA 3FVRA 4ZGBA 2XQKA 3A2LA 4BAUA 1EHYA 2HU8A 1FSSA 1N1MA 1T4MA 4J0GA 3DNMA 1UT6A 5AKEA 1CEXA 3H1AA 3IA2A 5F4ZA 3BIXA 4X6UA 3V1KA 1VZ2A 2JBWA 2XUOA 1ZGCA 1BS9A 4H7IA 1QIIA 5IKXA 2GBIA 4X93A 3H19A 2G63A 1CUWA 4G9GA 3I2KA 5ALWA 4BRZA 3RLIA 1N5MA 3F98A 3WK9A 4J0HA 1D07A 4X92A 4OYYA 2G5TA 2J3QA 5LZ4A 3WJ2A 3I28A 2BKLA 3DLTA 4KR0A 4HXFB 4OYLA 1CUFA 4CG2A 4H7DA 4WDQA 5HF6A 3FSGA 3ZI7A 2P8SA 4UHHA 3R3VA 4L0CA 2RIPA 1L7RA 1A88A 1QIFA 4U2DA 5AKIA 2QR5A 1GGVA 1ZICA 4H77A 3I2IA 4BCBA 2X76A 2JGEA 1AQLA 1VZ3A 2WHQA 4GXNA 1DX6A 2DHDA 2XMRA 3PUHA 4DIUA 3DL4A 2QMQA 4J0JA 1CVLA 5ALDA 1FFDA 3WJ1A 5CBKA 4AO6A 5AKJA 1W75A 1BN7A 1W6RA 3HSSA 1QJ4A 3QPDA 5T4FA 3VISA 1GXSA 5AHXA 3EQ9A 1H23A 1GQRA 3NUZA 4J0CA 1YA4A 4GECA 5AM1A 2VA9A 4C4YA 2WG0A 5C7YA 4CIAA 4GWLA 3BDIA 5JANA 1LGYA 1R50A 3ZLTA 5CT6A 5JASA 4HRXA 3H0CA 2B20A 2XQFA 1LPSA 2PVSA 5LZ7A 3WMRA 5EIEA 4EY4A 3D4LA 3STWA 4E46A 5AM3A 4I19A 5HFAA 3QH4A 3BE8A 5AM4A 2K2QB 1XRPA 1G42A 3V1LA 3S2ZA 5CT9A 1CR6A 4EZIA 5K3DA 5EIAA 2VT6A 4U2GA 5A62A 4Y2SA 2FJPA 4ARAA 4WCVA 1QFMA 2WG2A 5JIBA 2V96A 4BC0A 3NOXA 4L3WA 1ETHA 4GBGA 2XI4A 1XZIA 3DEAA 1WOMA 2QKYA 5AP9A 2WU4A 3KWJA 3VJKA 2WLSA 2V98A 4XVCA 5ALPA 5JADA 5K3BA 3G0DA 1XZMA 4CCYB 5K3FA 3FLAA 1QIDA 4W1RA 1JJIA 3BJRA 2QT9A 4X7BA 2H7XA 5AKHA 2PBLA 1SOMA 2JF0A 4UBLA 4MQLA 1K5PA 4KRXA 4WY5A 2HA5A 4B84A 3PFCA 1NU8A 1E3QA 3D2AA 1QONA 2OCKA 3UUEA 2O7VA 5KREA 1MN6A 2DHCA 3IVMA 3QZUA 5DJ5A 5AK6A 1J1IA 3KSRA 3I2HA 1QIGA 3GFFA 3LS2A 2IX9A 3W2TA 5LLSA 4E14A 5C8XA 1EVEA 3W04A 4QWWA 4UBNA 1EDDA 5ALNA 3G0GA 1Y7IA 2WFLA 3TJMA 4Q34A 3H17A 1OCEA 4G5XA 2XMDA 4M0MA 5H3HA 1MAAA 3GROA 5EFZA 1HLGA 2YXPX 3EBLA 4BVJA 3DOIA 1YS2X 3C6XA 1U2EA 2C0PA 4JYPA 5JAUA 5AH0A 2DQZA 3LIPA 1DT5A 3I6YA 3D0KA 2OQIA 1QO9A 5J3JA 4FMPA 1XZLA 3T4UA 1XLVA 3D5EA 1R9MA 3FYUC 5EHXA 2WHPB 1EK2A 1U4NA 2JGIA 5AI9A 1HPLA 4Y2VA 5DYYA 4K6GA 1VKHA 2GYUA 2PUJA 3ICVA 2ZSHA 3IULA 3WWOA 2OG1A 1ZD4A 4Y2TA 2PSFA 5BV7A 1JMYA 2PKYX 4ZV9A 1X2BA 5ALZA 4G1FA 1F6WA 2HA4A 3CN9A 1XZJA 1DT3A 5AO9A 4WFJA 2EDCA 4MYDA 1JT2A 3QITA 3M83A 2ZYHA 5IVIA 4BYMA 4C6HA 3DYVA 4BDSA 3BF8A 2OXEA 3KDAA 1YB7A 3G02A 1ODSA 4PNZA 3B12A 3I6ZA 1CUEA 4OSEA 1BEZA 3E1GA 1XQVA 3K2IA 1CUYA 1TCAA 2CMFA 1UK9A 3WL6A 4H7FA 5ALUA 4AQDA 4W1PA 5JAHA 5LZ2A 4QDUA 4DLNA 2XMCA 4FTWA 5HKAA 1CUZA 1EX9A 2DHEA 2UZ0A 4DNFA 1VOTA 1JFRA 2OLEA 4MWTA 2O7RA 2YASA 4ARBA 3ED1A 2AXEA 3BDVA 2QJRA 2ZJ6A 1CUVA 2X8BA 1GT6A 5A2GA 5AM5A 4A5SA 4I4CA 1TQHA 2OGTA 4X6XA 3JWEA 5CW2A 2XB6A 5AKXA 4DMKA 1PV1A 1JJBA 2HA7A 2C4HA 5JZSA 2PSJA 4K6KA 1AX9A 1XLWA 4UUQA 4ZWNA 2J3DA 3WLAA 4EBBA 4Z49A 3UMJA 1YCDA 4QEKA 2OCIA 1WPRA 3WIBA 5HQ3B 1Q0ZA 2C0QA 5JAOA 4X3CA 4OD0A 4QLOA 2HL6A 4HZGA 1G5FA 3TRDA 2HA3A 4B9AA 2HA0A 2XUJA 1CQWA 2RONA 4LIPD 2WFMA 3AIKA 1XZKA 3C5VA 3BJMA 4NMWA 3MUOA 5ALFA 5AIAA 1H22A 2PUHA 1BN6A 2JGFA 1DWPA 3R3ZA 3PDCA 2VATA 4J3JA 4AZ3A 3WK7A 4LKOA 3R3UA 4Y2XA 2DFPA 2HA2A 3G0IA 4HRYA 3ZPXA 1ZJ4A 4UHDA 4BC1A 4BRSA 4JYMA 1BEEA 4YPVA 4PQEA 5D6OA 3V1NA 3WL5A 1Y37A 1LLFA 3GA7A 4P92A 4DNPA 4FLEA 1ORWA 1K4YA 4K2AA 2AJ8A 4JNCA 2QJWA 4BB0A 3AJAA 1AURA 5JARA 1CRLA 3HYSA 4RPCA 5LZ5A 1XFDA 3K6KA 3B3QA 3STUA 2XUDA 2XE4A 4CG1A 3FYUA 1SC9A 3L1HA 1UK8A 4G9EA 1B6GA 3WWDA 3A70A 3O4JA 1G66A 1XZEA 2QVBA 4FWBA 2YH2A 3IUNA 2GYWA 3HZOA 1BCRA 5ALGA 1TKRA 2PSEA 4FFWA 5T4EA 1AKNA 3H18A 3H2GA 2FUKA 1EH5A 2WILA 3I1IA 1RWQA 3D7RA 3CCBA 1R1DA 4BAZA 5AI8A 1TCCA 2CJPA 3AFIA 5AOAA 4RNCA 5FRDA 1JJFA 4OUKX 1P0MA 2VF2A 3QBJA 5HF5A 2AJDA 1IUOA 3QPAA 3U0VA 2DCMA 3CXUA 3I2JA 1GKKA 3WZMA 2WIFA 1BCSA 1YS1X 2ONCA 4L9AA 5HK9A 5D3ZA 4Y2QA 2WFLB 3O4IA 4QWMA 4I3FA 4UHBA 1GPKA 3M82A 4W63A 3O4GA 5BOVA 3SC2A 4B82A 1CUBA 2WUGA 4DNOA 1KU0A 1J2EA 4DYHA 1QO7A 1ZD3A 4G4IA 2OGSA 2CUTA 4N8SA 2WTMA 4J03A 4G4GA 2GZSA 5CT5A 3GELA 5CXXA 4H18A 1WM1A 1CUGA 3STVA 4H7KA 5DNUA 4TVKA 5ISMA 5ALLA 3R40A 3C87A 1MNQA 2XUHA 3AILA 3WA7A 3R0VA 4MEBA 3C6ZA 1LBSA 2O2HA 2XQIA 4G8DA 3D3NA 4FFVA 5DNVA 5I7UA 3A2NA 4S0XA 4EB0A 1TIBA 3C70A 1QFSA 2WG1A 2XMQA 5JD5A 1EB9A 3G0BA 2PPLA 4KACA 2JGMA 4G8CA 4YX9A 4GEGA 5JYCA 4IQ4A 1SFRA 3WK4A 3ANSA 4P08A 4J0KA 1ZIXA 3FYTA 1N5RA 4KEAA 2WIDA 4HXGA 4Y2PA 2XUKA 4Y2UA 5CXUA 4KE9A 1CIJA 5FLKA 1PFQA 5BWBA 5AOBA 1MX5A 5CH8A 3MUNA 5ALQA 2HFJA 2I3ZA 1B41A 1XRQA 3ESBA 4G4JA 2WUFA 3W05A 5SYMA 2ROQA 5CTAA 4OB6A 1E8DA 4BDTA 1YR2A 3G0CA 4LHEA 3O9VA 5FUMA 3QMVA 4PSCA 3WZLA 2VJAA 1UFOA 1Q83A 2WIGA 1JMKC 3P2MA 1KEZA 1QIJA 4ETWA 2ECFA 2IIVA 2BGNA 2GZRA 5AIBA 4E11A 2CBGA 2HFKA 1E66A 3OG9A 4ZXFA 2OGZA 3JW8A 5HZGA 3QMMA 1CUHA 4NVRA 1JU3A 2ZJFA 4DGQA 4IH9A 3AUKA 3QMWA 4Q3KA 1E8MA 5AKZA 5K3AA 4U2BA 1LPPA 4E15A 3QM1A 4MEAA 5KWJA 4JUIA 4AN0A 4ZV7A 2PM8A 2CKMA 2BCEA 2JGKA 2ZSIA 1KU6A 3STXA 3ESAA 4AMYA 4H0CA 4BAGA 4ZRDA 2XUIA 1X2EA 2JGJA 1ZOIA 2RHWA 3DKKA 1EA5A 1F8UA 2CEKA 5AKKA 5ALXA 3WWEA 2BUCA 3HJUA 4BBZA 1USWA 2Y6UA 1C4XA 4Q1VA 1M33A 4QNNA 2Z8ZA 1ACJA 5SYNA 1DQZA 4UFOA 4UFPA 2GBGA 1F0NA 1IUPA 2WU3A 5AI6A 1WHSA 5AKLA 4UBKA 1VJ5A 2VAXA 1W76A 3WWCA 5AK3A 2C58A 2VQ6A 4OB7A 4C4XA 5AKGA 4RE6A 5DTJA 4OU5A 4AXBA 4CI9A 3WYDA 2WUEA 1UXOA 4YK7A 5BWCA 3BWXA 4OCZA 1NU6A 3AINA 1Q84A 4X90A 4B0PA 5A6VA 1T2NA 3OOSA 4FDMA 4HS9A 3OM8A 4LXIA 4DMCA 5FXMA 3DL7A 3I1YA 1CLEA 4UHCA 1QOZA 1XQWA 3I2FA 3FBWA 4Y2JA 1PJAA 3WQHA 3RM3A 4CCYA 2XMGA 3C6YA 1H2WA 4NZZA 1XZFA 4BTVA 3WK6A 3O9MA 3WL8A 4L72A 3FOBA 3PI6A 4LXGA 5HCUA 1XZAA 1DX4A 2RI6A 2I03A 2DR0A 5EI5A 5CH3A 3HLKA 2H9YA 2RHTA 4B81A 3FAKA 4MWSA 3BIWA 1FFCA 4JEIA 2XMSA 5JALA 1R4ZA 2AJCA 3SK0A 2X5XA 4M0FA 4WJLA 2GYVA 3C8HA 3KWFA 1UZAA 3WKCA 5ALHA 5ALMA 1LBTA 2Q0XA 2VJCA 1EB8A 3G9ZA 4BVLA 3H1BA 3WWPA 2GBFA 5ALVA 1WB6A 3EQ7A 2OAGA 1A8SA 1CUJA 1H2YA 3V1MA 2QUBA 4BCDA 1LPMA 4P9NA 1TCBA 2Y1KA 3WIOA 3LCRA 5DWDA 1BRTA 1Z68A 4C88A 2HA6A 5T4BA 1Q0RA 2B9VA 3VVLA 4UBJA 2VAVA 3IDAA 2H7CA 5JAPA 3QYJA 1UKCA 2I3DA 1XZGA 1XQYA 4MXDA 2BUAA 2XLBA 2WSLA 4EY6A 3PF8A 1JU4A 3FYUB 5EHNA 3R41A 4JH0A 3WK5A 3DKRA 5DLPA 1BE0A 4B85A 1EK1A 1SCQA 4BTLA 3BF7A 1VA5A 1CPYA 4Q3LA 1GQSA 4BVKA 1NX9A 3BL8A 3B5EA 2BAGA 1YASA 1DWOA 4GDMA 2B61A 5ALSA 1UWCA 5FPQA 4B9EA 1RYYA 3HI4A 3ZV7A 2ES4A 1ORVA 4GHWA 2Z3ZA 4F5ZA 5K5EA 3L1IA 1YB6A 3LIIA 1Y7HA 3M81A 1R3DA 5AK5A 2XUFA 2BUBA 1YA8A 2D5LA 1XROA 2BJHA 3H2JA 4KAJA 4C01A 2B4KA 1EDBA 3CCCA 3PUIA 1A8QA 2XMZA 3WI7A 1XLUA 3DDUA 2PL5A 3PE6A 3N0TA 5CURA 1AZWA 3HEAA 2OAEA 4J0IA 3FCYA 1QTIA 1QIHA 2PX6A 2WJ4A 2WKWA 4UHEA 2WM2A 3S8YA 4FOLA 4M0EA 4NS4A 4U2FA 1W52X 5ALOA 3ZWQA 5AK4A 1E8NA 4AB1A 3G7NA 2R11A 2WJ6A 3H2IA 1ZD2P 2CB9A 4QDTA 4FHZA 1CFJA 3V9AA 3PFBA 4F0JA 3OC0A 2VT7A 3C5WP 2HDWA 7YASA 5JD6A 1CUDA 3OPMA 1DINA 3A2MA 5T4HA 1G4HA 1DU4A 1K63A 2XUQA 5LIPA 4CIBA 2WTNA 2V9ZA 3A6ZA 4EUSA 2C5FA 3G9XA 5JD4A 4QDXA 5CMLA 2W6CX 4HVTA 1MU0A 4DSZA 3W06A 4DNQA 5EHQA 5C8ZA 1FFBA 1QLWA 4EY5A 1ZI9A 3WYNA 2QUAA 4B80A 5LYYA 2CZQA 5FP0A 5DYTA 4HAIA 1WCYA 1P0PA 1THGA 4WFKA 2XUAA 3IIIA 2HRQA 1CUCA 4QA9A 4N8EA 4OPMA 5A7FA 4IHAA 1CUAA 4WY8A 2AJBA 4DM7A 1LNSA 2W22A 4INZA 4Y9SA 2WUDA 1QIKA 5D3KA 5CT4A 3AZPA 2OQVA 3GZJA 3IB3A 1J07A 4PV7A 4EHBA 4GW3A 5FV4A 1YSCA 2I78A 4DMFA 3ICWA 2PU7A 3IUQA 1JI3A 4J7AA 1QZ3A 2JGLA 4YASA 4FNGA 2DSNA 1P0IA 1A8UA 2GBCA 2BGRA 4DSAA 2G4LA 3IBTA 4Q05A 2EEPA 4FKBA 4Y7DA 3RK4A 1XKTA 4X00A 5E2IA 3C8DA 2LIPA 3FSGD 1DTEA 4N5IX 4PSDA 1UKBA 4BCCA 4A16A 1XZBA 2Y2VA 3VJLA 3WKDA 2E3JA 4N5HX 1TAHA 1HBJA 1SCIA 4F60A 4KE7A 4LXHA 2WHPA 1YAHA 4BE4A 3OTQA 1ISPA 1TK3A 5FOQA 4KRYA 1LPBB 1X70A 2HADA 4AMZA 1CV2A 5AJHA 5ESRA 1ZD5A 5HKBA 5CRIA 1AMNA 1O6GA 4KAAA 2D0DA 4XX1A 3CN7A 4D9JA 4PF1A 5HFNA 2HU7A 4CG3A 3FNBA 4LYEA 3AZOA 2QM0A 4QDZA 3O0DA 3VXKA 2Y2UA 1WB4A 4XWGA 4X6YA 1R88A 1N8SA 3DOHA 4TPKA 4EA6A 3R3WA 3VDXA 2WIKA 5A71A 2WFZA 3WK8A 3O4HA 1IUNA 5C8VA 1C7IA 5C81A 5JZBA 2VJBA 2OCGA 3FCXA 3LLCA 3WKAA 3BXPA 3H2KA 4J0DA 2ACEA 3H2HA 4X85A 2OPHA 4QZVA 3WA6A 3HABA 4FBLA 1UOQA 5E4YA 3R3YA 5ALIA 1WHTA 1XRLA 2Z5GA 1HKHA 4RE5A 1QIEA 2AJLI 4Q3OA 2JIDA 1EINA 1JKMA 4W1QA 4AO7A 1UOPA 6YASA 4ITVA 2VEOA 3STTA 1L7QA 4KE6A 5JZ9A 2FJ0A 2V97A 1IZ7A 1EVQA 1AUOA 1IVYA 2ZJ7A 3AIOA 5I8PA 3OURA 3W9BA 1A7UA 4W1SA 4LYDA 3WKBA 1W1IA 1AGYA 3VJMA 2JEZA 1QTRA 1H2ZA 1VE6A 1GPLA 3RKSA 4BP9A 1ACLA 3M3DA 1F0PA 5AICA 1UK7A 2R8BA 5ALKA 1YAJA 3HXKA 3ZLVA 4DTCA 1L7AA 3V48A 3UUFA 2QZPA 1BROA 4AO8A 5HF9A 3O95A 5EHZA 1ODCA 1ODTC 3DQZA 4Q82A 3MGAA 3GUUA 1VXRA 4F21A 2C7BA 3FWHA 1MX9A 4P93A 2ACKA 2QRUA 3STYA 1LZLA 1FJ2A 1LZKA 2DQYA 4WFIA 2EDAA 3F9CA 4QDOA 1QGED 4OU4A 1THTA 3L1JA 1OILA 5AOCA 4BE9A 2Z3WA 5A7HA 3D2BA 2Y6VA 3Q8WA 4XIIA 3DD5A 1EXWA 2XUGA 5K3EA 4QLAA 1XZHA 4UHFA 3X3HA 1WB5A 2ZYSA 4AN1A 3IUMA 5IVKA 3AIMA 1E89A 3G9TA 3YASA 5CH5A 5E4TA 4IH1A 5FDFA 3IURA 4GLBA 2WJ3A 3VKFA 4BZZA 1CUIA 3HRHA 5K3CA 3AZQA 2O2IA 1RP1A 4MYSA 5LKRA 1DWQA 3SX4A 1MAHA 1VE7A 4MJ3A 4XJVA 5AKYA 3IUJA 2QOEA 1I6WA 4KJXA 1GPNA 3T52A 1VLQA 2H7YA 4BP8A 5ALTA 3JYHA 3E3AA 1J06A 1P0QA 4C89A 5DYWA 2J4FA 4U2CA 4EY8A 3F96A 5YASA 1MTZA 5K3FB 4HTAA 3DS8A 3DYIA 4KE8A 4W9RA 1U65A 1UOOA 2WHRA 2PSHA 5IH7A 1AC5A 4C4ZA 4Y2YA 4Y2RA 3VVMA 3FLEA 2PSDA 4GI1A 4IO0A 1MO2A 2ORYA 4B6GA 4U2EA 4WDRA 1MX1A 2ZYIA 3N2ZB 3C43A 5LP1A 2IITA 1ZIYA 3G8YA 1MJ5A 4QE3A 5KWIA 1K8QA 1XRMA 3GBSA 5DNWA 1IMJA 1CUUA 4PW0A 3U1TA 1MPXA 3ANTA 4IH4A 1MNAA 4B0OA 4UBMA 3MVEA 4KYVA 5HQ3A 3E4DA 3E0XA 5LKAA 1S8OA 1HDEA 1MT3A 5FPPA 1CQZA 5D7BA 1E5TA 4UBOA 3ESDA 3QVMA 5IVDA 4EY7A 4G8BA 4ZI5A 4BATA 1FFEA 1GKLA 5A7GA 2G5PA 3NWOA 2BFNA 5I9IA 3EF3A 2HM7A 3LP5A 5KBYA 5EIHA 2O2GA 5ALRA 2RAUA 1CUXA 3W9UA 1W4LA 5ALEA 4AZ0A 4CFSA 2XMBA 4A23A 3KOOA 4B7ZA 2HRRA 1LPOA 3ESCA 1LPNA 2QS9A 4N8DA 3HACA 4C87A 3I6MA 5ALYA 4X97A 5IVHA 3Q0TA 4K6HA 1K6EA 4H7HA 2C5GA 1OXMA 2HHAA 2XDWA 1BU8A 3F67A 1HL7A 5EGNA 3C6BA 4PSUA 3WKEA 1TRHA 4K5QA 4FLFA 4AX4A 4BZWA 2ZYRA 2ZVDA 2VJDA 1GZ7A 4H7EA 3ZLUA 3KXPA 5ALJA 5AI0A 3F97A 5CT8A 3PICA 1XKLA 3D2CA 2JEYA 3K9BA 3TEJA 5LZ8A 5AM0A 3FVTA 4FBMA 3HC7A 4DMHA 3ILSA 1ZI6A 3F8SA 2RGUA 1EI9A 1XQXA 2HIHA 1UK6A 2XLCA 3PF9A
chains in the Genus database with same CATH superfamily
1XRNA 4HZUB 2P3LA 2VCHA 2XT0A 1JQ5A 3K9CA 4NMMA 1DBIA 1IG0A 3NNSA 4CCWA 3KOWA 3QHQA 2RGWA 3CV3A 4N5MA 5IDYA 1IN5A 3OJ0A 3PNVA 2M98A 2GKOA 5ADUS 3AONB 1Z4IA 4FEAA 2C4VA 4L85A 3ZU5A 4WN9B 3SDSA 3E9DA 2AG6A 4JMPA 4KXYA 1O87A 1QHFA 2GCOA 3MOIA 4RIFA 4YGXB 2VXBA 2NVOA 3SCZA 4FVTA 4JUBA 4O4LA 3IV6A 3Q3HA 3L06A 1ZGBA 3TGLA 1YE8A 2CNWD 5TR9A 2JFVA 1NWCA 1T5HX 4FLMA 4TMWA 5CA0A 1JEOA 4J1NA 2YN4A 5DV9A 1DBQA 3KJIA 2P4EA 4XQ0A 3EIOA 5IYZB 2IYNA 4V0NA 4MQMA 4QOJA 1P8AA 3DE7X 3HU5A 3BWMA 3SAJA 1R6DA 5IJXA 4IIJA 3NB0A 4DARA 4F6RA 2HV8A 1CU1A 1UBSB 1GL6A 5BR7A 4XFJA 1A98A 3E0QA 4QDJA 2E4VA 1S2GA 1ESMA 2FX5A 4M0KA 5A0FA 2XE8A 1SUFA 5AI5A 5EMNA 1N1DA 2WHEA 1J97A 3D0QA 1XJQA 3AKEA 4DE5A 4FD3A 1ZHFA 3QVGB 1EDEA 2QTBA 2P62A 2AMFA 3OVMA 1NC1A 1KSGA 4AQ7A 5JQWA 1E3SA 2ZUTA 2B1RA 2HEGA 4QJBA 4UCXA 5JATA 2O59A 2G36A 2O3SA 1NR7A 2IYZA 2ZRFA 3H99A 1IBRA 1RWXA 3PE3A 3ZG6A 1IJKA 1K3FA 1MAVA 1JIVA 4ZYVA 3EPKA 5JMPA 2ZZKA 3PLNA 5HWSA 4RK7A 3V55A 1JB1A 1OGJA 2IUSA 3BD6A 2WWGA 2AR9A 2HI0A 3H05A 5DCWA 5EJ8A 3HCCA 3QFRA 4C08A 2GCIA 3NGMA 2GNAA 4AMVA 2FP4B 2AFVA 2N42A 3CURA 3MCUA 4S2EA 4F7DA 3EQ6A 4MKHA 3FRHA 1H2XA 1CULC 5DW0A 2PCLA 3WMEA 2G08A 3L7YA 4DUZB 3MGBA 5SZHB 2ZIUB 1H1DA 1EFTA 4NS1A 3MWKA 4G65A 4WQMA 4I66A 4TGLA 4BBPA 1QRDA 3KVRA 2H51A 2X5NA 3AY7A 3IPYA 3L9XA 3CT4A 3DCIA 4JOCA 4KMSA 4Z7OB 1FVOA 1RHRA 1UQTA 4A1OA 1N75A 1IG3A 2NZYA 2ZBVA 1T5DX 1UBTS 3ZD8A 5LZ9A 1A8IA 2AC2A 1S2MA 3R77A 4MP3A 1C9EA 1PW7A 2YDYA 3KTDA 2YBEA 5HUJA 4M0CA 4KQHA 3K9QO 3KEQA 3FLBA 4E2ZA 4ZAVA 2OCLA 1XJWA 3TQRA 4QYTA 2DTDA 2H2DA 2XE7A 3A4MA 2QGFA 2QIOA 3FR7A 3GD5A 4O4IB 1DQYA 4ZU3A 1L5KA 1CNMA 1N1GA 3OKCA 1PQ4A 5L6LB 1J8VA 1O6FA 4GKVA 4QRIA 3QPCA 1XN4A 2FX3A 1NXVA 3Q1LA 1W44A 5ITSA 4NESA 2VTKA 2Q1UA 4LTMA 2J9ZB 1P3JA 4DWVA 7MHTA 1XRRA 3GXBA 1MZVA 2IHUA 3DXYA 4P34A 4F12A 4FNMA 3QLVC 4TL9A 4MR9A 4MW4A 4BQPA 4N6NA 5EMKA 2XQKA 4C03A 5K0GA 1AXEA 3AJ8A 3U3XA 4CF5A 1LDNA 1HQCA 4AUNA 4M0PA 5T8KC 3HWWA 3ANMA 3EA4A 3BMQA 3IPRA 3BIOA 5F64A 1YDEA 3A2KA 3FW1A 4ZVPA 4UEOA 1X86B 4CQMB 5GIOE 5B1YA 1AQNA 5LQSA 3GLVA 3PGA1 1IMOA 1W9MA 3ENKA 4HDOB 4MV9A 2BISA 1D1SA 4RSMA 4UTPA 1YQUA 1W94A 5MF6A 3IA2A 1B3RA 3HCNA 1CYEA 1Z83A 5C9ZA 3QV2A 3ID6C 1OU0A 4ZDWA 2TECE 4R6XA 5JVDA 1RPTA 3CLUC 4UAVA 2QUHA 3FPKA 1HT0A 3NRBA 5JJBA 4LS3A 4XEUA 4EW2A 2XUOA 3RYCA 2O9JA 4GH5A 5EESA 1GQ2A 2JFBA 4OXQA 4DR2B 1EX1A 4YJ3A 1UMDB 4JLUA 5IKXA 1TK2A 2QM8A 3OPXA 4X93A 2WWFA 4YV7A 3R9KA 4JWKA 1ZS9A 3MRTA 4XPIB 1CUWA 5I7VA 3AEZA 1C8KA 1E2EA 3BPSA 4I7EA 1LQ2A 2AI2A 1UZMA 2OMKA 3F98A 5BUSA 3BCHA 4U7JA 1P44A 2DPLA 3UA3A 1TMOA 3WK9A 2X14A 3PNBA 4B4VA 1ONBA 3KQLA 1LA2A 1P2UA 2NADA 1IY9A 3CRQA 4QXQA 3NHLA 4HTFA 1LBIA 3U3MA 1XCGB 3MMXA 1EQAA 2HK8A 4TUYB 5JQGA 5KC9A 2J3QA 1KK3A 3FTEA 1MFPA 2RI1A 2YOFA 5ERXA 1AF4A 3QXJA 5LZ4A 2IS6A 2IZZA 3GR6A 1FTWA 4P4NA 3BJEA 5C46F 1ZSYA 3QXHA 2CSUA 3LNCA 5A3QA 3GLIB 3DLTA 1SXPA 4CG2A 2Q29A 3IHLA 4JP2A 4AIIA 4H7DA 3OTHA 2WR8A 4Q7JB 4NV0A 4C4SA 1GFSA 1X38A 2BFBB 3H2BA 3R3VA 4EMTA 4PG5A 3VUEA 4IDFA 4NOKA 1J7KA 1J90A 3BWDD 4L0CA 3GFRA 1W29A 1H0RA 2GAAA 2Q5HA 3KFXA 5T41A 4RTJA 4Y1FA 3WC4A 1A88A 4EKGA 4IIGA 4LDRA 3FZEA 1FUIA 2DCUA 1KPHA 4LSMA 3NXKA 1IPHA 3T9FA 3SYTA 1MBZA 3B1ZA 3OF3A 3QP9A 1JHAA 1G2OA 4BCBA 4OP3A 2WNSA 1C4KA 2HQ1A 2O05A 4IL5A 4X63A 3QVGA 2ZETA 2PMFA 5FOSA 4I55A 2XGOA 1MOQA 3TBFA 4XX0B 3RVOA 4L0QA 1M2WA 1M0TA 2Q62A 3H4VA 1M8GA 2XMRA 2ZSDA 4DIUA 3DL4A 4J0JA 1A4IA 1CVLA 2F8LA 2AQHA 1C3XA 2PMDA 3N39C 3P26A 3WJ1A 4C2TA 2XGJA 3K20A 5AKJA 4R8RA 3ZGZA 2HGSA 3M5PA 2OFWA 5DMXA 2QUJA 3C6KA 3IO5A 3Q11A 4HVAA 4S1WA 1QJ4A 3ZJ4A 5A9RA 2Z95A 4R1QA 4DILA 1KZ4A 2YS6A 4MMZB 1UZNA 4S0ZA 1CR4A 2J1LA 3WO0A 1S3IA 1T6ZA 4C4TA 1RZRA 1A1SA 4JCOA 1OAOC 2CUZA 2NXJA 2VNJA 1GQRA 1ADYA 1XEWX 3E3MA 3RFCA 4J0CA 1J1ZA 1OBHA 4GS5A 4M99A 1GZHB 2TMYA 1QH1A 4WN9A 1GZ6A 1WXHA 4GECA 4LUCA 5BO5A 4CR8A 2ZAYA 4I1UA 4ZIRA 1J5EB 5FFNA 2I6QA 2XRYA 3EW7A 1BKDR 4NFYA 2CHQA 3JQ6A 4IJ6A 3W5CA 2O0JA 4X6LA 5K4AA 3Q8LA 4GWLA 2V7TA 3PENA 1CK4A 2BGGA 4UDNA 4DAEA 3IE1A 4JJ4A 3T7RA 1GZ3A 2I4OA 3R5TA 3R74A 1Y48E 3ZLTA 4RD0A 1QKKA 4K7JA 5LQUA 3EPJA 5CT6A 1XDZA 1VBKA 4NONA 4WOJA 3QWAA 2JIPA 3Q3EA 2PCJA 4HRXA 1T1SA 2ZS8A 1EFAA 3TYXA 4C78A 1FFYA 3JSXA 3IHTA 1PVOA 1DC5A 1XCOA 4RZ2A 1K08A 1Z6QA 2WC1A 1G8FA 2GN9A 3RRJA 1KHTA 3HDGA 4XM2A 3WOHA 4A15A 1AA9A 1Q74A 3HKBA 5I4KA 1M74A 4UEQA 5I9LA 4R40A 2GVNA 1CIVA 1V7QA 3AKDA 4FI3C 4JDUA 3ZJ5A 8ATCA 4ECEA 5GOZA 3TAUA 5HFAA 3CMCO 2XTJA 3I3OA 1TTQB 4BO9A 3I4FA 3QH4A 3LA8A 2QNBA 2J5QA 2H1SA 2C7RA 2VDOB 2ZE8A 4JY7A 2PZ8A 1XNRB 4KUGA 2ANCA 5G40A 3IQGX 1TM3E 3CR3C 3A7EA 2B5VA 4IGEA 4F8JA 1AA6A 3SXUA 1F2UA 4M7PA 1DOZA 4LF5B 1T36B 1T3HA 5JE8A 5EIAA 2XODA 2JAXA 4EAAA 2DPGA 5JU6A 1H9BA 2WF9A 2ZB3A 3JX9A 1HE2A 4HQ0A 4GX5A 4WCVA 4ARAA 5GJVC 1E60A 2V96A 3F74A 1PCXA 3EMDA 4R8VA 4O8ZA 5H0IA 2R7NA 2FRVA 1JS1X 3KB2A 4QUJA 4FGWA 4RIGA 2NZJA 5JXHA 1N5LA 3EBPA 3H65A 4G24A 3AW9A 4GBGA 1UBCA 4II3A 4ONEA 1NN1A 4IDOA 1K3UB 2KW5A 3EF0A 5E8RA 3T5GA 3NORA 3CWZA 1NQXA 4Z3DA 4C6TA 2PGAA 1KZGB 1WOMA 5CYFA 3ZWPA 2YWEA 2ZROA 1A50B 1HUQA 4XB2A 2IH4A 1XVUA 1GV1A 1PYOA 2QT0A 1WUIS 2NZ2A 2QZSA 1L4FA 1U3CA 3PR1A 4HRVA 5PGMA 4XVCA 1J00A 1EXMA 2WAMA 1UPUA 4YH1A 1VHDA 2CFRA 2NTYC 2X0IA 3I09A 3M70A 4GEKA 4H16A 4Y30A 3NOVA 5H59A 4YRMA 2B25A 4CCYB 3P0HA 3FLAA 5K8JB 1FW8A 1C29B 2M6KA 4B3HA 4ML3A 4IAOA 4W1RA 3TINA 2CLHB 3BJRA 3AOGA 2H7XA 3MFQA 5AKHA 1Q7BA 3CF4G 3LBYA 3ZXUB 2W2PA 2CMKA 4BWYA 4ZK6A 5K0ZA 4BFLA 2PBLA 5K99A 2X6RA 4KNVA 4OHPA 1MABB 4KRXA 1ZVQA 4WY5A 3GMTA 1JYEA 3HA2A 3D2AA 3MELA 5AVQA 4FU0A 1CQPA 1WXDA 1BXRB 3P9XA 1XRSB 5TEWA 3UUEA 4PRLA 3VKVA 1D8TA 4G89A 3F4BA 2DHCA 3KUUA 3MM4A 4A2WA 5F73A 3K7EA 4M1ZA 4O0MA 3HA7A 2P30A 2G67A 3DZJA 3MZ0A 3JAMA 3O8RA 3JSAA 1SC1A 3ABOB 1GL3A 1NYTA 3TLZA 4KDCA 2BTEA 2AK2A 1OB5A 2PQ0A 2FZGA 1NT2A 2VK2A 3LS2A 3L6OO 2ISQA 4YJGB 2C4MA 4TSFD 2BIFA 1MD9A 3LUFA 5EERA 5M34A 1XOIA 1DPFA 3ABQB 3HJBA 3K1ZA 4RZSA 3IXQA 3WDLA 1UJNA 3QFHA 1MC5A 2AMVA 5KSYA 2FY8A 4E14A 1GGNA 1TA4A 2WUVA 3WLMA 2XIQA 3O1HB 4OHFA 3TLCA 3NG1A 4CMHA 2IQ5A 4EPVA 2PJRA 5E38A 1W5TA 1E3WB 1VCHA 2TMDA 3ETCA 5FOVA 4HQRA 4CN8A 5IT5A 3V80A 5EMJA 1U5BA 4OHKA 2I33A 3TZEA 1OH5A 2Q8NA 4TZTA 3E6AA 2GCEA 4CF7A 3LXRA 1BHQ1 1L7PA 3RHZA 1Y7IA 3F4LA 3EXG1 3TJMA 1QQBA 3WNCA 2LCFA 2J32A 4M0MA 3K32A 4WXPA 4UNQA 4L2IA 5FPHA 3JVDA 2C4TA 4PINA 5EFZA 5BQ5A 3R9IA 3GNLA 4QRHA 5MGBA 3BK7A 1K7EB 2B8EA 4JEMA 1Q5PA 5H70A 3RADC 1I51A 1T8TA 2ID9A 1GCIA 4ZT7A 4CCAA 5IC5A 3LCJA 2Y0BA 4MAAA 4J2TA 3WRVA 4BNUA 3FDJA 2WZQA 1MGOA 1X80B 2WD7A 3D4BA 1RYBA 4I9NA 4JJ7A 4B4UA 1E2BA 1UM9B 5DBIA 2J5BA 3HZZA 1D03A 2R2AA 3B3GA 3DDCA 3PHIA 1SPBS 4KQKA 3RB8A 5LXTB 3LIPA 3ZDBA 1ESNA 1WL8A 1YKSA 3D0KA 1QO9A 1I2MA 1YIOA 2BI7A 2NU9A 4F4DA 3UOWA 1CEQA 5M7EA 3T1HB 2QIPA 3V1UA 3A6GA 3T4UA 3QUBA 4CHTA 4EHAA 5F4BA 3CRW1 4PIVA 3KZXA 5TQ0A 3WGMA 4CDMA 5CEEA 1R9MA 1EFVA 4OQLA 5EHXA 2O7QA 2VP4A 4YCSA 5HHTA 4A0HA 1AN0A 2R97A 5DYYA 4K6GA 1HDGO 2OHGA 5JS6A 1SHTX 4I55F 3WG9A 2GYUA 1F14A 1XEXA 3K2EA 2ZSHA 4KXQA 2XBUA 4YN3A 3BCUA 2XOEA 1RWPA 1JQEA 4RIHA 2OG1A 3P2YA 2IA5A 1KAQA 2YJ4A 5FQOA 5ABPA 2XA9A 1ZD4A 3O03A 4URZR 1XT6A 3DNPA 1C8LA 3OJFA 2FFHA 4MYRA 2QP4A 3LC7O 2J0UA 1GNQA 1UBHS 1NYLA 3TSCA 1B16A 2QP9X 3ANXA 4BUZA 2QPAA 2C4NA 3GLFE 2PKYX 4FQ5A 2O2EA 3ICPA 1Y8CA 1NY5A 3N8KA 2ZB8A 3OKPA 4LSZA 1KY2A 1MF7A 3TSZA 4L8VA 4NL4H 3TFWA 1CJUC 4RVGA 3E22B 3NTXA 1DGQA 1XDUA 3CEPB 5EXPA 2ZPUA 4XYMA 3WSVA 1DAHA 2H8GA 3I3SR 2YY7A 2NYRA 1PNOA 1BO6A 1RJEA 3U4GA 4DC1A 3URKA 2I3AA 3EZ9A 3KKQA 3FBTA 2IV7A 3OOJA 4L8GA 4I4NA 3A6DA 3LFTA 2LPMA 4ZRMA 5IM4F 3PBKA 1B00A 2QQ5A 3KAQA 1FDWA 4QGHA 1MAUA 3ASZA 5B2FA 4WVLA 1Y3BE 2X5OA 5J1SB 1ODSA 3JYOA 2C7VA 1DJOA 1EBBA 1KMNA 1OC2A 3A27A 3SZGA 3O4RA 3WXBA 4HT3B 5C1PA 4W7SA 3RC8A 3IBGA 3D6JA 4HGZA 4Q9JA 5I7SA 3GLSA 3I8XA 1JECA 4EQZA 1CLUA 1PS8A 3SG0A 4I50B 2CMFA 4DQVA 4GI3A 1H2HA 2HJVA 4L5AA 3IVXA 4HUTA 2V7WA 3WAGA 1S0UA 1UK9A 4H7FA 3WL6A 3NHFA 2D4HA 2XCUA 3C85A 1HF3A 4JA0A 1YVPA 3RIEA 1Z0DA 3GVIA 4RFSB 1CDZA 4OV6B 1KO5A 5JAHA 4DLVA 1QGDA 4B3DA 2Q4TA 1P9NA 2W2LA 4DLNA 1WZNA 2QK4A 3EIFA 1FQJA 4H6XA 5L45A 2O14A 2HMUA 2JIMA 2XMPA 4FTWA 4D57A 2Z2KA 4C43A 1W48A 2WTEA 4DJJA 3IJPA 1RHUA 4JB3A 1OHHA 4F97A 2W37A 1C30B 4HWSA 4EJFA 1T1JA 2ZI4A 3E81A 3H5LA 4FONA 4OY3A 1UQUA 2A58A 4DNFA 1ZKMA 3EXEA 2PJUA 3G49A 5DNCA 1H3EA 1V2GA 1JDTA 3R5SA 3ZDYB 2WWYA 3VU8A 4ARBA 4CMBA 1WU8A 3LQKA 2OK7A 2HJGA 3N7TA 1NTOA 9LDTA 2RHMA 2QN1A 1PR4A 5FOWA 2FLWA 2W8ZA 4PX9A 3SQWA 4D9FA 3GRKA 3N6VA 2AQKA 2DBRA 1W85B 4JBWA 3WO1A 3E4CA 4RMHA 1AQYA 1INLA 2D5AA 2FZLA 2WVJA 2X8BA 3CGGA 4BIMA 4P33A 2E85A 2XRFA 3ZCTA 2C3PA 4AYWA 3DJFA 1C1XB 3BSFA 4REOA 4YCAA 4RWEA 1TQHA 2IU3A 2LNDA 4UM9D 2OGTA 3JWEA 2IS1A 3WLPA 4DIEA 5BSEA 2R68A 3GO4A 4EO9A 1RYDA 2ZB4A 3PD1A 3TLMA 3VR0A 4BRWA 2BHSA 3NHBA 3KV1A 3IQIX 3NIWA 4G0NA 1JDVA 4DMKA 2UXBB 1JJBA 2NOAA 2IU4A 3C8UA 3BMNA 2Z5LA 4UMVA 4Y6RA 1CF4A 2WJVA 1HYHA 3TW8A 2B4AA 3JQAA 2OZEA 1FVHA 2VUSA 4GSKA 1HE4A 2I8CA 4RJIA 2J3DA 4MA0A 1B15A 1OXXK 2AL7A 3H1PA 1J2UA 2QI9F 5LMNB 3H42B 4UOQA 4BJ3A 1M8FA 5BQ3A 4PAQA 2FU5C 4EPWA 5L4NA 1K7YA 1R0YA 1V9CA 3OLWA 1FDVA 3ETEA 4J0QA 3IPXA 4HGYA 2C9DA 5ESWA 1FTYA 1K06A 4XKJA 2ZR0A 2G1PA 2FF5A 2C0QA 1U0EA 4X3CA 2ZUDA 2FI1A 4E51A 1P2GA 4GXTA 8AT1A 4QLOA 1L5VA 5I7HA 1T9HA 4I9FA 5K8CA 2RJOA 4XSVA 2HL6A 2ZWIA 5DP2A 3TRDA 2HA3A 2PLWA 3VR1A 1K86A 4Y9UA 4UM7A 3OAAD 4DLAA 2XUJA 1L5QA 1CQWA 1XQ9A 1NF9A 2ZK7A 3FG9A 8OHMA 3PUZA 1E5DA 4LGMA 2R66A 3JQ8A 3TSYA 1XNGA 3V8MA 3BJMA 1FUUA 1E2FA 4DAOA 1GTMA 1YZGA 1L5NA 3AJRA 2E6KA 5JNRA 1P4SA 2PUHA 5F3RA 4PLZA 1BN6A 1ZEMA 3G23A 3R3HA 1E3DA 5DFAA 3QKSA 3TOXA 2VATA 1CP2A 4QBIA 4FIZA 5JZMA 3ZGLA 4LKOA 1EYZA 4Y2XA 1O6BA 3G0IA 3HVKA 1L8AA 4B6EA 1FS4A 3X2EA 5L95A 4JYZA 4V0MA 3QU9A 1F06A 1LFDB 1J70A 1X1CA 5JOQA 5KSZA 2H3EA 1WU7A 1XHFA 3B6IA 3QF7A 1N32B 5H4GA 1OFUA 2DSTA 2ZQZA 2PWAA 3NWPA 4CKYA 4HQ6A 2F8MA 2HIMA 4WZBB 3EIXA 4KWHA 4CM4A 4K3UA 5D6OA 4DQUA 4UU0A 4WBNB 4DPKA 4LNAA 2YJTD 1LLFA 2H17A 4O4IF 1STOA 3FHCB 4BWVA 1V0JA 5EP4A 4KLAA 1IOWA 3GARA 4KBFA 4PCAA 4BB0A 3TGPA 1SH7A 4MV4A 2FZEA 5JARA 1T91A 1XGKA 3DKPA 8MHTA 5D3MA 3HYSA 3S4YA 3EZ7A 3FPAA 4UD2A 3BGWA 2EBUA 4F06A 1YJ5A 1T24A 3MQFA 5UKDA 3HPRA 3V8EA 3K6KA 4D0SA 4AUMA 3D02A 3BQNB 3B3QA 3G7SA 5JG7A 3AR5A 3SF8B 1HK7A 1TE2A 3QLUA 5ICFA 4F86A 1G20B 3PNKA 4CN9A 5HYVA 4CG1A 2D13A 2W00A 3CRRA 2GN8A 1ZQ9A 2QAGC 4NFSA 1IIBA 4XAQA 4G5OA 1DQSA 1O7JA 2FP3A 1A7JA 1OREA 1PL0A 3L1HA 3M4ZA 2GEJA 4PRZA 1YCFA 4UHJA 1CRZA 4QYIB 3W4JA 3EGIA 3IUPA 1L0BA 2OY0A 1U9YA 3O4JA 1U31A 1VL0A 4QBFA 5JSFA 1G66A 2HWYA 1YGYA 1XZEA 2AF3C 2DWPA 2QVBA 3RODA 3ZW9A 3RUPA 3IUNA 3L1KA 3QKRB 5FYQA 5ENDA 1HYBA 1PS9A 1T8YA 1GWNA 3HZOA 4XR9A 3PHHA 2WJIA 2Z3VA 4OHRA 3RTEA 4BY9E 2HWUA 4NZOA 4EYSA 3G3EA 1DC7A 3JVUA 2PSEA 1V96A 3O1JC 4FCTA 2IY7A 4M9RA 5CX1A 4YCDA 1DPGA 2RCNA 1QOPB 2H7VA 2X0EA 4F9FA 1GRVA 1NI4B 3HEMA 1T5SA 2GARA 3RBVA 3IDQA 3H5NA 3HVIA 1TOAA 3H18A 1M0SA 4R1MA 3GCGA 5HCIA 2Y68A 4S1NA 1KEWA 1YIDA 3IV7A 2JLBA 4MH0R 5IWCA 2QLLA 2B92A 3I76A 4PICA 5ILOA 3RFFA 1ID8A 1LRKA 3QXSA 3P19A 3I1IA 1RWQA 4PYLA 2VJYA 2G71A 3CCBA 3UHOA 2QW1A 1LLQA 2WKSA 3CY6A 4JJZA 5F12A 5IS2A 3KLNA 1TCCA 2LCQA 3TCNA 2PHZA 3KU1A 1VLLA 1L4KA 2FOXA 3AFIA 1Q7EA 1YFZA 2BMVA 2DM6A 2CW5A 4JJIA 2ZUBA 4Y7CA 3WQRA 3DVAA 5DGTA 3A9UA 2ZZNA 4MUMA 5FRDA 1S1MA 2OZVA 4EQ6B 5LP6F 4LRWA 2W58A 4IFEA 4OUKX 1X7GA 2NZUG 3K1AB 4PTYA 1P0MA 4Q4LA 4ZAGA 1XEXB 3FMGA 5FIUA 1CNEA 1NTRA 1GLNA 4KHZA 3RSFA 3VAYA 2QY6A 3OZBA 1X1SA 3UM9A 1AB6A 1TF2A 1N77A 4DR4B 4KREA 2RAFA 3I2JA 4K88A 2W6JD 4OGWA 4EF5A 5KWVA 3LH5A 3OA2A 3KQHA 2ZTLA 2IF2A 4L9AA 2PL1A 4FE3A 5D3ZA 3L0SA 4EHLA 1DKQA 1FFHA 5I9SA 3ZS9A 1ND5A 1LWOA 1R4MA 3ADPA 2F2TA 5DGHA 4F8EA 2IYRA 3R9XB 1TI7A 2A9FA 3KP1A 3PPXA 2NWQA 4JJ8A 4UHBA 1Q7RA 3I5XA 1J8YF 1F4VA 3M82A 3HO8A 1RU3A 2KE5A 3I9FA 2IQIA 1IHUA 4O2AF 5L8VA 4CQLA 2YMLA 1A96A 4K9OA 4IXMA 3ZHTA 1CUBA 2PYIA 3K3PA 3L6UA 2DWUA 1QCZA 2JD1A 2PLNA 4ND3A 4A4DA 4MGKR 3V2UA 9ATCA 3IAS1 2Z6QA 3LMKA 5CX1B 1PKXA 4L02A 1XN1A 1KU0A 1C1YA 2J5KA 2KPOA 2VLBA 1BVRA 2O57A 3LO8A 1JFLA 1QO7A 1ZD3A 3AI3A 3G6KA 2E4WA 4KN5A 4LSWA 4LMPA 4UQOA 3ZS8A 4YXWA 4UATA 3CT6A 4MB0A 3U4IA 2A7QA 2YKGA 3PQEA 4J03A 1I0IA 5LB2A 5CT5A 2Y0PA 1PT6A 4DWOA 2VRCD 5JSZA 3L7OA 5CXXA 3SLKA 5CUQA 4MO9A 3BULA 4OHOA 5K0JA 2ET6A 4D3SA 1E79D 1SBYA 3ABZA 1ZUHA 3DQPA 1TQDA 4HJXA 4HLUC 3T1VA 4F56A 1CY6A 3AFHA 3P9RA 4B7CA 2OORC 3AKZA 1ML3A 2A30A 2FR8A 3UJCA 3K2BA 1JHRA 3OLZA 2OCXA 2Z8YA 4MR9B 4M89A 3RYHA 3JQQA 5F1PA 4Q7QA 2NO7A 1E3MA 1R8SA 2O3RA 3C87A 2ASEA 3GNQA 2W6ID 2XUHA 3AILA 4IGAA 3ZLBA 3ZKWB 3MWJA 1YL6A 3IQXA 4NNOA 5CM8B 1KSJA 3RVLA 5DKFA 3AHHA 3R0VA 4XCXA 3DZIA 2PRYA 4HGNA 3U17A 1Z8FA 1NLZA 2O2HA 1IBKB 2CSXA 1POWA 1CP3A 3L49A 1G5HA 1UXKA 3K6JA 4FYHA 4IWXA 1NE2A 2UYCA 2BBSA 1N57A 1UJBA 2HJ9A 1MRNA 4FFVA 2PY6A 1NRIA 5E6SB 1RWOA 2GKGA 4CEHB 2IYLD 3CNLA 4AF6A 5TT0A 1Q91A 4YJFA 1GZ4A 1VMKA 1YQDA 3KBOA 2ZITA 3IQZA 2XYRA 4WZBA 5CDTA 4MLZA 1E1RD 5DCYA 1ULSA 3CH7A 2GAOA 4IDQA 2EZUA 2W4MA 3RSCA 3DDHA 4ARUA 4YJ3B 2J3JA 1VJTA 2XMQA 2OCYC 3L9WA 2D7DA 1JTFA 4EYEA 1I2ZA 2VWQA 3DAFA 4KGZA 1NOKA 5JY1A 3E58A 2JGAA 2ATIA 1AG9A 2IJGX 3QE4A 3FUVA 2C9ZA 1XTKA 4M98A 2YZ2A 4MVJM 2OYSA 3R6WA 4IIJF 3UFBA 2XWPA 3AESB 1RZRD 1DKMA 3EASA 4G8CA 4JC8A 1D2RA 4QUHA 4TTTS 3TZQA 1MC1A 3BFVA 4UVHA 3WMWA 4BNHA 4IQ4A 1G5RA 5CLFA 4YCCA 3O74A 1IWOA 1JDNA 1Z8HA 2B3DA 3GHYA 3HYTA 4Q6WA 1NBEA 3RKUA 2OC9A 4X3PA 1SCUB 4TKLA 3SQLA 3WK4A 3TH5A 1IBMB 1YZYA 3UICA 2BFFA 5C8DA 2AEMA 5K7SA 4AI6A 3UW1A 2PMWB 4ZVLA 5K8IA 2Z4TA 4FFOA 5TVKA 4C4AA 1XD2A 3TIXB 1E99A 4I5GA 4QRDA 2JGDA 1E2QA 1FU8A 1NMXA 4LCEA 4LZNA 4PLTA 4JBXA 1M1NB 3QXXA 2DECA 4Y2UA 2VDJA 5CXUA 1XRJA 2J7PD 4IINA 4KE9A 5CPFA 1PFQA 3L7MA 4OM7A 5EJAA 5L7TA 2IW3A 2DFNA 2R00A 5I7FA 1A9RA 2CL6X 1B2RA 1LWNA 1FS6A 2K4MA 3MYRA 1BX1A 2YV3A 3NCTA 1GPH1 1A95A 4H7IA 5IKMA 3WQQA 5ELMA 1IWPB 2BSXA 4M9XA 3O0TA 4CYMA 1ADGA 1LLUA 4II7A 3GXOA 1VKRA 4QUBA 3V46A 4AP6A 4EEZA 3SKYA 2P2YA 3AJ9A 2HDHA 4N3NA 3UK2A 1A0OA 3K0AA 5SYMA 4IZIA 2A1TR 2P6RA 3BWYA 3WVNA 2YWXA 2GUWA 3RR2A 3Q9NA 5B36A 1YR2A 2QBYA 5IPFA 3KR2A 1C4WA 2E1PA 1PX2A 1ZDMA 3JTMA 3O9VA 5FUMA 1U2DC 4R6WA 4BNJA 3GJQA 3CISA 4M60A 5CFNA 1ILWA 4YC7A 1QAOA 4LISA 1N6RA 1JMKC 2V6BA 4H3KB 2P9GA 4C0WA 1D5CA 2C61A 4GR4A 3VOBA 5C5EA 1UBRS 2HMSA 1EQ2A 2MSEB 4AKIA 2IIQA 3L2OB 2W90A 5HDBB 1I9CA 2ECFA 4DLTA 4ETWA 2FPPA 4QYSA 2ZYTX 4R7ZA 1B42A 4W5HA 5AUNB 1JZTA 5BVHB 3SKVA 4P22A 5AIBA 2W0SA 1M2VB 1PFWA 1RRGA 1TZJA 2NNLD 1M6EX 3PJFA 5FLXA 2I65A 1PGPA 3E1KA 3OG9A 3W5DA 4QM6A 2C03A 1B7GO 2BW0A 4JS0A 5FBWB 1RQRA 2LE0A 2YC4C 4B6RA 5HZGA 5JTTA 2B1JA 3HV2A 3TE6A 3HCPA 3TPCA 5FA5A 2QEQA 5COQA 3G88A 2VSFA 5HJ2A 4BP1A 1QYCA 4S35A 3EIHA 2WDPA 4EX6A 1JSXA 1JU3A 3OZXA 2L2QA 5JAQA 1Y7LA 2H07A 4OP2A 1H9AA 1YUNA 3E2PA 2ZE7A 2YWFA 3QMWA 3QVOA 1M2JA 3A3KA 5AKZA 1XPOA 1PNQA 5HEKA 2FW0A 3HJCA 4GWKA 4FC7A 4QYMA 4N65A 4K9QA 3NBFA 2EKPA 3OZSA 3DTTA 3QM1A 5AW8A 2C4KA 3HXMA 1TT5B 1N2BA 2B82A 2PN1A 4G1EB 4I50F 1PJSA 5FTJA 3ZIDA 2BTOA 4AN0A 5HZMA 3DMRA 1SK9A 3BN3A 1E1CB 3FGZA 4ZV7A 4P38A 1C2TA 3B5JA 1ZL2A 2BCEA 4GDFA 1RFGE 4M1EA 3WJ7A 2EZ8A 2CLCX 2PQ6A 5EMLA 2ZSIA 1M2GA 1UMKA 1XMXA 3AVOA 1E6CA 2PZMA 4BLUA 3JAWA 1SBZA 4TN1A 2NT3A 2Y4NA 3SZ3A 3ZE2B 3ESAA 2EC5A 4PVCA 1VQ1A 4H0CA 4L9RA 4BAGA 1F0YA 4LHZA 1RACA 4OQMA 3TRFA 4QASA 1U0RA 1W59A 1X2EA 1HDRA 1JSCA 5SV2A 1UL1X 5BRAA 4D6XA 4XB1A 3C5CA 2LW7A 2JASA 4AS3A 3LDHA 3TTXA 5AFSA 1FFXA 1QYRA 4NCXA 4DV2B 1BE6A 3O9ZA 5ALXA 1U3WA 1Z0FA 5ARDA 1U1CA 1HORA 1VE9A 2IPAB 4MRNA 4ZOEA 5GJWC 4UEWA 5K6RA 2VTBA 5IXYA 4Q9IA 5HTOA 1BHSA 4YRFA 3EFOA 3BXXA 2X4DA 3CEAA 3V5NA 1X3LA 3KKOA 4IG4A 1C4XA 1VKNA 1ELOA 1M33A 2EBFX 4KPGA 2MYPA 4PG6A 4Q1VA 4B5LA 4E5KA 4MGZR 3VNSA 1Q7GA 1EKXA 3FNHA 1X7ZA 2YHIA 1KMHB 4GKKB 1M9NA 2QD3A 4UFOA 1A5ZA 5TS2A 3SIPA 3NT4A 4DV4B 1CF2O 1BWSA 4LN1A 4PANA 2BWJA 5AI6A 4ZU1X 5CG1A 3M6LA 1WIWA 2C54A 2NVWA 3CIFA 4HGQA 4MIKA 1RBQA 1VJ5A 2J3IA 4WMLA 2Y77A 1OX5A 3ND7A 1RTTA 1PQWA 2JLSA 1HDCA 1FMTA 1V4BA 2PZGA 3R3JA 2R6DA 2ZQ5A 5C80A 2GJ9A 3OZDA 5C1OA 1V48A 2VQ6A 4OB7A 2BSAA 4UZSA 4NDZA 4QD3A 1QMPA 4DXAA 4BJ1A 1G64A 2HDNB 1XKXA 3SVZA 1KYXA 5BXYA 4F5WA 1II8A 2O3UA 4A03A 3HJTA 1MJNA 1EFVB 3EDMA 5FJJA 6ADHA 1V8BA 4AXBA 2G1JA 3L8GA 3HRIA 4OU5A 4DCVA 1N2JA 2RHDA 4KN9S 4X1OA 1N5OX 5H9WA 5D86A 3SKXA 2ATVA 3QX7A 2WUEA 1AS0A 4LFCB 3PVZA 4LF4B 4ZGGA 1UXOA 1VHWA 2PT5A 2XX3A 2JGDB 3K16A 4YK7A 2AG1A 4RIEA 3ZXIA 4A8TA 2AR7A 4E07A 3T1TA 1OVGA 1KQOA 1RRMA 1VFPA 5TNXA 5KKNB 2JHFA 1ZVJA 1NU6A 2WKQA 3AU9A 4OCZA 1XD8A 4PPGA 3RS8A 2A1UB 1EESA 1XVLA 4B0PA 5KHAA 4RVFA 4HBZA 4ZI7B 2YIMA 3TPZA 3UV3A 3B6JA 5C51B 4V0LA 4RMJA 4PBRA 3OJEA 3TLKA 1PJCA 3LKVA 4IG9A 4BNDA 3AGQA 4F46A 1T4GA 4RTSA 1K8RA 1SUDA 1D2HA 1XQ6A 2PL9A 3DL7A 2I6SA 4MV5A 2P2NA 3I1YA 1CLEA 4KAXA 1OTHA 4UHCA 4BO2A 4G5FA 1E96A 3VR6H 4ZVMA 1PQYA 1P4JA 1Z47A 2CNWA 3ENNA 3HG7A 4P3OA 10MHA 1UKZA 2OB1A 4Q4AB 3PYLA 5DE3A 4EOGA 5HIKA 2Q3HA 3BWCA 5DH9A 5IJ0A 2HF8A 2QRVA 3EYWA 1U6KA 1KO1A 3CCFA 4Y2JA 4LY0A 3JYPA 2VPPA 3RF7A 4EB6B 2A86A 1N2XA 1HNXB 3GX1A 3RM3A 2VI5A 3E48A 2WTAA 2HCBA 3DEYX 4RAQA 3KYBA 4NZZA 1LBHA 1XZFA 1G3MA 3M1AA 3VH1A 2EG9A 4KXFB 2F1OA 4GXQA 4I1SA 4RDIA 4I1OA 1TRKA 1IQRA 1USGA 1VMEA 3QOFA 2BTQB 1NP7A 3GEEA 3ZXXA 3AM1A 2MSWA 4FSDA 1F2VA 1GEGA 4NATA 4FIDA 4FT2A 3LPLA 3I45A 4C5AA 1DUVG 4M8LA 3JWJA 3VPFA 1W0JD 3S5UA 5CXQA 4LXGA 5HCUA 4MYUA 5C3UA 3FJOA 2PRZA 2P9EA 4NV1A 3ZZMA 1DIOB 1XZAA 5ERGB 2FPGB 1DX4A 1A27A 4JHXA 2I03A 1EMDA 5G0TA 2FZKA 3FSJX 1F9EA 5A3RA 2H9YA 3GFQA 1WXEA 1YB2A 3OD5A 5DULA 2K87A 5IK2D 3BT7A 2XY4A 5KDLA 5CA1F 1WNTA 2CXQA 2GCNA 4FMDB 2XR1A 4UCFA 1M2KA 3FAKA 3GH1A 3RGWS 3U4CA 3VX3A 1FFCA 1YJQA 4PZPA 5DI3A 4B43A 5JALA 2XD9A 1N9GB 3PFKA 3H4TA 4PC3A 1DB3A 3R7SA 5BV0A 4TYYA 2X5XA 3LBFA 4R8LA 4ZEXA 3LOPA 5FNZA 3IEIA 3JATA 1Y1SA 1EK0A 1UZAA 2OGWA 5EXTA 3UKDA 4PYRA 2ETVA 1DFIA 3K5IA 4MR8A 4ZQGA 2PEZA 2VDVE 3F47A 3O75A 4DS3A 2ZRNA 3IUBA 3N2NA 3RUDA 5B6JA 2Q0XA 3QLUC 3NP9A 3P2JA 5KIAA 3ZE8A 2G09A 4CNQA 4DJDC 3KT6A 4X7MA 5EIBD 4AJNA 4JQOA 4IICA 5JBQA 3B1VA 3TD9A 4YR9A 4PZDA 4BVLA 2E89A 3P71T 3PUYA 2W7TA 2PJZA 4IKPA 1LJUA 2GZ3A 3FNGA 3H1BA 5CFMA 1T1GA 1SKMA 1ONNA 3VR3D 4DV6B 1I33A 2H4FA 2HSGA 3SNKA 3T7TA 1DC3A 5TMPA 3UBTA 3Q8MA 1DXHA 3KM0A 4B44A 3E22A 4ZAFA 1WD5A 2CL5A 3BMCA 4TL7A 1T2EA 3LUGA 1QCDA 3V1MA 2R1TA 1GQOA 2DPYA 3CF2A 3KYDB 3NVDA 4U9IS 1YZUA 5A04A 3PQ2A 4EG1A 2AYXA 2ZTMA 3R20A 2AOUB 3AUUA 4ICIA 5E4FA 3CW8X 5JQGB 3FF4A 1GGJA 1LPMA 1L8OA 4PNPA 2KJQA 1ORDA 1LI7A 4FCVA 4R1PA 3IT2A 4LK2A 4RJTA 1XCBA 2UYQA 3TTWA 4DUGA 3OZ7A 4QO8A 1YB1A 2OVBA 3FUXA 3U4DA 3LWZA 4HJRA 2QL7A 4YP0A 3ZCVA 5FAKA 4RL6A 1MJFA 1X87A 3GOHA 1A8HA 1Y80A 4MW6A 3AKYA 3KTAA 1ZO8A 1MEEA 4NWIA 1ZL0A 4LRUA 2VAVA 3ZQUA 1LNZA 4Q19A 3TLGA 1ZN8A 2C7PA 5JEDA 3UAOA 1KZ9A 4HH0A 1Q16A 2G25A 5JCOC 5FWXA 1Q15A 4RCZA 1XZGA 1XQYA 2HJSA 2QX6A 4MXDA 2Q6TA 3VO2A 2BUAA 2DLNA 1U28A 1CY4A 5BUQA 5G1NA 1PBNA 2P9CA 3MLBA 1L4NA 4MI1A 4PRYA 1NHGA 2HU2A 4BFCA 5KS2A 1GG8A 1Q2UA 3PFGA 4YRPA 1E5VA 2FW8A 4QHYA 4YRLA 2A5YB 3V2HA 3HUUA 1SAYA 5B4UA 2I29A 1VA5A 3IE2A 4AJ1A 1FY2A 1GITA 2UVPB 2DRIA 1GQSA 4Q3LA 1X1DA 3E18A 3RIHA 4DRZA 1HDZA 3W7BA 1I1OA 4AROA 1P3DA 2CC2A 3E3OA 1A2QA 1BXGB 1KZ7B 4D9HA 1E1DA 1JWAB 1R0CA 2ADMA 4IUCS 5FUYA 1NULA 1ST2A 2XF2A 5B2ZA 3B1FA 3UA4A 3IMFA 3CLRD 1NV9A 3LQ4A 3KJQA 3QKIA 5SY9A 2PAFA 2YFQA 1KOLA 3H1EA 2HUNA 4IGKA 4F2GA 3INYA 3C6QA 2A9QA 1IFXA 2VAMA 4RORA 5IF3A 4CM4B 1NW8A 2OENG 4M0UA 3ODPA 1O89A 2BFDB 4P80A 4QXMA 3RE1A 1P5HA 2WSSA 4PONA 3ZV7A 2MYNA 5EYPA 4GHWA 1PIWA 3RC3A 1BDIA 3C41J 1YHYA 5CM2Z 4O2RA 1NYRA 4PYIA 1CB7A 1Y9EA 3UGQA 4RTNA 2RFLA 2XHEA 3WFJA 1LS6A 3VR6D 4B48A 3OCXA 5AVWA 1YB6A 2O3QA 3D81A 3FLMA 2DKNA 4QPDA 1WMSA 4UULA 2M1ZA 2I6TA 4FDAA 4GMKA 4ZGWA 3AF1A 5JXWA 1TVMA 5HOQA 2E4YA 4K3VA 1MFZA 1ZH2A 4F7WA 4ZT5A 4GPZA 3PUVA 4WUTA 5CA1A 4MQEA 3MTEA 1LCIA 1TTPB 1SXJE 3ADKA 3G2MA 3I34X 4CQJA 2IE0A 4MHSA 1E9SA 4I1YA 3QVUA 1SKQA 3SLRA 1OW3B 4W5NA 3FDZA 1LEHA 1L1RA 1CQXA 1FTQA 1LTKA 2IOHA 4J0FA 3HKEA 1T1EA 2XMZA 3WI7A 3DDUA 4LFBB 1B73A 1YNSA 2BH9A 3PE6A 1OQAA 1UC4B 2HRBA 3SC6A 1HL3A 3SR3A 2E4UA 1G21B 5K4GA 5K0NA 3QUSA 6AT1A 1KQ3A 1V3QE 1Y9JA 3P0IA 2I0FA 5ILQA 3ZHRA 3T5TA 4FFBB 3B13B 1RM5A 2FSPA 1PE0A 1U8FO 3AR7A 3VR6A 5I3CA 3EVGA 2YHBA 2V3CC 1H8HD 1L4MA 1WF6A 1DQPA 1QIHA 3PHCA 1TZ2A 5KOYA 1Z38A 3HXLA 5IHPA 3H97A 5KYWB 3N7UA 1DLJA 3PD7A 2DFLA 3JQ9A 1I7QB 1W7AA 4U2FA 2G40A 3IB6A 3LLSA 4OQEA 1W52X 3PWSA 2V9PA 3EPRA 5AK4A 4ZD6A 4D99A 3NMUF 4LDJA 1SHKA 5L51A 1EJBA 2RGNA 4JT2A 1QQAA 3G7NA 3PWTA 3LF1A 2YJ3A 2VAWA 3UT5A 4JVSB 2J7KA 3HWX1 1ZD2P 3TFOA 2HWXA 4CQNA 1UAYA 3OIWA 1ZRHA 1RI5A 4FHZA 4ER6A 2P4HX 2GD0A 4CIYA 5HIMA 3T1NA 4LNUA 3QUAA 4IOLA 4L4UA 3V9AA 2JAQA 3PFBA 3C8ZA 1U9JA 2P2DA 4X1KB 1Q1AA 1Q57A 4F0JA 4RTOA 3DW3X 4MP6A 4P84A 2N9UA 3H9EO 3OWHA 4EPRA 3EPHA 2VT7A 4G0YA 4AFNA 7YASA 1EUCB 4PS1A 4QOIA 2OFFA 3A2MA 2REQB 5LQMA 2BE7A 1U1IA 1V7PC 2QPOA 2JA2A 4LHWA 8LDHA 1XL1A 3PWKA 2BM8A 4B6FA 4A8JA 1H2AS 3GRRA 1BGWA 2XZOA 3PZBA 1VP9A 1AXGA 3VDRA 4XGQA 1RABA 3DHYA 2V9ZA 3N87A 3WGVA 5KTPA 1GTZA 2OZKA 2J9RA 2IHBA 3NBKA 5KCMA 4EKEA 2XXAA 3I12A 2C5FA 3G9XA 4N5DA 1WXQA 5KNBH 5CMLA 2ZBEA 3RBZA 4WZAB 3GRAA 4ZO8A 3EBOA 1AKTA 2BD0A 4IYRA 1XK6A 3N2KA 3V00A 4BMYA 3KL4A 5EHQA 4NCJA 1LBQA 1BKSB 2YFHA 4EY5A 3V97A 5BWOA 4M2LA 5ADWA 2CZQA 2QZZA 4GMGA 4DBVO 4D6PA 2EW8A 5IYZF 1SHLA 4EB6A 1OT5A 2ZXEA 4F38A 2P9JA 3MRSA 5C32A 4FJ2A 3EK2A 4HFRA 3M7IA 4J0EA 3RT9A 3IDFA 4CMCA 1THGA 1N0VC 3KPYA 5FOUA 2Q3MA 1Y7TA 1WX1A 2AHOA 2MYTA 3KXLA 5DWQA 4XGRA 4ENUA 2VBGA 1NF2A 1P1IA 4OEHA 3RT1A 4OMUA 3DL0A 4N8EA 4BFUA 2DWOA 1G5PA 2Q5CA 4IHAA 1CUAA 3C74A 4RVUA 3W5HA 1J5PA 1KI9A 3QEAZ 1U7WA 3Q7EA 1IXKA 1GFIA 4WY8A 1PZHA 1ZCZA 2BBOA 3OH8A 4INZA 4WK6A 3UH0A 1LSUA 1C1HA 4JN6B 5D3KA 4B3XA 2F55A 4Q3BA 1AGPA 4N39A 2CZGA 3AZPA 3KFLA 5MFPA 2DVMA 1G5TA 4WIAA 4UKDA 2C2HA 3OFNA 1QBGA 2BZSA 3QTLA 3VC2A 4LJKA 3KT3A 5CJJA 2I78A 3PDWA 1FYWA 4DMFA 1YRQA 1UPFA 1QF7A 4KO8A 4AW9A 1A71A 4GZLA 1R3UA 3COJA 2VZEA 1A9OA 3JAKB 1I3LA 3NKLA 3AF6A 2I7CA 1QP8A 3A1VA 4C5CA 4EZEA 2AIRA 2WJHA 3JAKA 2O4CA 3KOUA 4QJ5A 4CT5A 2A78A 1DEHA 5DHTA 2ZBGA 1N2GA 1WRBA 5IAJA 1PJRA 2DSNA 4HD8A 4M1KA 2O19A 5AXBA 2BGRA 2XZTA 1E1RA 1TKCA 2OMEA 1MVOA 2W9XA 4MGHA 4WCFC 2V4UA 4F2HA 4C2UA 4DLZA 2DY1A 3S2YA 1U7ZA 4X00A 2HGZA 3H3XA 4IVRA 4ETNA 3V8QA 1YCHA 1FQKA 2GD2A 3F9RA 4IIXA 4LXXA 3E35A 4FWTA 3M4YA 2GO7A 3IYLW 2GSWA 4L4ZA 3FVQA 3X1KA 4BWGA 5LP6A 3W5JA 3PEFA 5A1TA 3HNPA 3HCRA 1XZBA 4M1YA 1XDBA 3K94A 3WKDA 4HSGA 1KC3A 4HLUA 4N5HX 5KJEA 3FTDA 3NHRA 2R60A 2O0LA 2YJZA 5DK6A 2DXIA 1T0UA 2CCKA 3W2GA 2IYOA 5EQTA 4WNIA 4Q9LA 4KE7A 1E5LA 2ZSEA 2H29A 4JUAA 3DC7A 2WNIA 5HKKA 4BE4A 3OTQA 1G17A 1TK3A 3BL5A 1TTHA 4N3CA 3LVBA 2YR0A 2RHGB 3DDNA 4LX0A 2ZI9A 4WLEA 1XA4A 2HLHA 2ZANA 3KOXA 3ETDA 4XD2A 5T7BA 1HH4A 3PGVA 5AJHA 3RSGA 2NUPA 1JSZA 3Q40A 1ZD5A 2DZDA 3AERB 2I2AA 4L7VA 3JWIA 2J9YB 4URHA 2C1EA 5CRIA 1JVBA 3P9IA 3VR5D 4YA6A 4QM7A 2HHHB 3UFXA 1E6UA 1YVDA 3A58B 5FI0B 1UBNA 1PR5A 4G09A 5J5VA 3MF4A 3UG7A 4KAAA 1P7VA 1Z6GA 4QLBA 2F1IA 1NQUA 4TS3A 3CN7A 4WKOA 4I99A 4DMUB 3OE5A 3WFZA 2VHTA 1OYWA 5IKOA 5BMVF 3NOOA 1XX6A 2R6R1 5FOXA 3OHMA 1NJ6A 1C0EA 4GPBA 3OM0A 2II6A 4N3AA 4JITA 1R0BA 2O6LA 4BNLA 1B8OA 2F43B 1LY1A 3A8TA 3CJQA 3FZNA 2VYCA 5BUZA 4EMUA 1V1JA 2R5NA 2VJMA 4S1OA 1M34E 2AXNA 1T0JB 3I9KA 4HB2A 3UWOA 1I6MA 4KWIA 1DRVA 3NM5A 5EJGA 3ME5A 1IK6A 3IALA 1ULUA 5DHAA 3H9GA 3ILYA 3DE6X 2P68A 4XUCA 3LJKA 4D6YA 2PXXA 1SHUX 3OU6A 1ZCBA 1N8SA 3I72A 3R5XA 4U63A 4TPKA 4UJ5A 3UTDA 3R3WA 5KKCA 3AYZB 4AY6A 3KB1A 4DKJA 4BHTA 2BMDA 4JI0B 1VG9B 2FWBA 4EGAA 1PNVA 3L5OA 3M1YA 1F7UA 1U3TA 3JPWA 4FHDA 1IXZA 2OV1A 1PJTA 2VJBA 2Z2IA 3IMGA 4Q6BA 3MB8A 2MSLA 3DM5A 1NMSA 3GJ8A 1GRNA 5KUTA 1OFGA 4HFJA 1Z25A 2HRDA 2P7IA 3F1KA 4JOSA 5JSKA 1Z0KA 3SX0A 3T0IA 3UWDA 4BL5A 5ES4B 4TZ6A 4HDSA 2A5DA 5FV7A 2R6GA 3QG1A 4J07A 2P3QA 4QJIA 4QZVA 1E4VA 4QYIA 3WA6A 1UOQA 3T5CA 4JGGA 3R3YA 1UUFA 1YR1A 4OP1A 1ZRMA 3T3IA 2HDOA 1J9ZA 1ZINA 1HKHA 3LHSA 4MW9A 5KB3A 3IAS6 3UKJA 4YAUA 4UM5A 1IN7A 1QIEA 2XCLA 3KJEA 4HDNA 4CKZA 2JIDA 1EINA 2DHQA 1L1EA 1RYFA 3PLAE 3R3SA 4AO7A 3BA1A 3H13A 1U8UA 4FHFA 2DUWA 1Y5NA 5IVPA 5IT0A 3RAJA 4MIOA 4ITVA 1MO3A 3DHVA 3WNBA 1CVIA 4MW0A 3STTA 4BO7A 2GTPA 2JI7A 4HS4A 4B2YA 4EA9A 5CA1B 2GJSA 4FX2A 4OREX 4DZTA 4IOKA 1YZQA 5JSHA 2HPVA 2XYPA 2YCLA 1E2PA 2VNAA 6LDHA 2FSGA 2QMOA 1AQUA 1EVYA 3L7DA 3P9PA 3WGTA 1KQPA 3E8MA 2GD6A 2A9KA 4PO9A 1TM4E 5GINE 3BG5A 3DZGA 4R7TA 5REQB 2N46A 4CEJB 3W5SA 1KI3A 1IZ7A 4WVFA 2UVQA 4FYJA 4PN7A 2PQMA 1N6HA 4PQRA 1IVYA 3GV0A 4RFSA 4TT3D 3W6PA 3A25A 2QLTA 4QPCA 3W2HA 2WAXA 3PC8C 4JGIA 4B35A 5HZHA 5ED4A 1ZJZA 2PANA 5JTUA 1QFZA 3DT6A 3LZCA 3OURA 4PPQA 2R7MA 4CFYA 1VSBA 4CIWA 5K2OA 3EVAA 1QMGA 4OMDA 2EXXA 3UW3A 4CLRA 4W1SA 4LYDA 5JEEA 3IQDB 4KG7A 3L7KA 1Z8DA 1HTWA 1NQVA 1W1IA 4A6PA 1QCYA 1YR3A 3K4HA 2QJFA 1FSPA 4O5OA 3AO0B 1QV6A 4C7KA 2GS9A 4R0NA 4ER7A 5ECWA 4IBOA 4R51A 3LUPA 2I2CA 3NI2A 1Z5WA 2PKWA 4ESEA 2ZJ1A 1VJRA 3JQGB 5HKKD 4URWR 1X8JA 3OE1A 1H2ZA 3L6RA 4F4CA 1KBZA 3RKSA 3EG5A 1IZ9A 1Y1PA 3IMKA 1ACLA 2BI8A 2C9YA 2IHZA 1BG6A 4RGQA 2XWSA 1REQB 1XEWY 3K09C 2P9FA 4YBRA 2QY9A 5CLHA 3VV3A 1OA0A 1WDKA 1LV7A 1KAEA 3R6GA 4ZCSA 2BJVA 1RQ7A 2OK8A 1Z0JA 2I66A 4OL0A 1E9BA 2NV6A 1E4YA 1D2GA 2ZI5A 4TQGA 4Z1OA 3PWZA 4TV9F 4E30A 1FP7A 3JQEA 2J33A 4E94A 1NC3A 1A4RA 2WWIA 3HXKA 3ED5A 3WGIA 1JEYA 4MQ6A 3CUEF 1IBLB 2XWJI 1F17A 5BMVA 3EHDA 2LKDA 3VTKA 2IDZA 3F2IA 5M5BA 1R10A 1K0FA 4PFJA 2PNFA 1MB3A 1NFFA 2NM0A 2QZPA 1LV8A 3SZMA 3T1YB 3QSGA 4MUNA 1SQ6A 2IKQA 2ONKA 3PXXA 3ZXSA 1RR6A 5LDGA 2J87A 1TC1A 1RNLA 5CB0A 3AG6A 4I2NA 2QD4A 3N5CA 1QLHA 3FHOA 4XCVA 3L41A 2O1WA 4XTCS 1ICEA 4CNBA 2NO1A 3T0FA 1W73A 1RW4A 1L7MA 3C3WA 3K9NA 1TF5A 3OX2A 3FZGA 1GL9B 4QPPA 4F5EA 4NTZA 2O20A 4TSRA 4F21A 3HDHA 4X41A 2Q49A 4KKVA 3LGAA 3CUYA 3ESXA 1ABFA 3OC6A 2NTVA 2IS4A 3N2LA 4C4RA 1JAXA 1LZLA 2ZI6A 5DM1A 2Y4OA 4K0KB 5D1HA 3B2NA 1LZKA 2ODTX 4DCPA 4US1R 4MV6A 2DQYA 1RYZA 1WE2A 2EDAA 2W8BB 4PR3A 1QP7A 3N7AA 1CE8B 2E4ZA 5G1PA 1VE1A 1QGED 5IBRA 2WF5A 3EG9B 3K1TA 3EXG2 1IXRC 2SKDA 2WHXA 1NPTO 1OILA 3T5DA 4BGDA 1Q50A 3UK1A 2REOA 5AOCA 4BO1A 2HQOA 3GJ5A 3G2JA 5H83A 1EFRD 2Z04A 1G3QA 2R96A 5A7HA 3G17A 3D2BA 4IS2A 3Q8WA 1N3YA 3IIKA 4BOYA 4A27A 4KH0A 4D3ZA 1X9IA 2O3JA 2YVKA 3FMVA 1H05A 4JSYA 4E5SA 1S6YA 4WAUA 3B6EA 3NOQA 4QLAA 1O57A 1XZHA 1NE7A 5IM5A 5JXGA 4YQYA 4FOTA 1N2IA 1WB5A 2QVLA 3MSXA 2ZTSA 4NG4A 3QW4B 5HBGA 2ZT6A 3OUTA 3IUMA 1G9XA 5FPSA 4AZ0B 4WSOA 4KYIB 5F2EA 3TTUA 3NYQA 4N0DA 1LDGA 4J7UA 3COPA 3AIMA 2VG8A 2ZATA 1XHLA 3HU1A 4ENSA 4BXOA 2WYVA 2WLTA 5JSYA 5E4TA 4TWBA 4MW2A 4MV8A 3HXTA 5LVAA 2ZP1A 3RG2A 3T4EA 3OCYA 5D6NA 2RK6A 2D7JA 4M7WA 1W4ZA 2JJ2A 1DFHA 3OZWA 3SJAA 1YULA 2WJ3A 2ZR9A 3GCZA 3JQFC 3OP4A 4R3WA 8GPBA 2ZTVA 1OFVA 4CUZA 2Y1XA 3UCXA 2WOOA 13PKA 1CUIA 3HRHA 3KS9A 4MUBA 5K3CA 1F3OA 3ZHVA 1ESDA 1EPUA 1ZAKA 2O2IA 2AS0A 3HS3A 1RP1A 3L5KA 5DU2A 4Z2YA 3ES9A 2UYHA 2NU8A 1G9SA 2V6FA 3WHLA 1KBQA 5AKYA 3NONA 3IUJA 5CM9C 1GNSA 1ZMOA 2QOEA 2JVIA 2G9RA 3PT5A 3V4FA 2WWTA 3HBAA 2Q9CA 2I91A 3T54A 2H2GA 5JPCA 3FFAA 3SVLA 1FZTA 3ELYA 3T1QA 2FDRA 4HL6A 4BP8A 4JJKA 4HFMA 1JEYB 2VP3A 3EAFA 3PC7A 4OMFG 1J06A 3ZI4A 1HEUA 1KXZA 2FK7A 4XQCA 5DYWA 2J4FA 5I7AA 3LO5A 4YIKA 3DZFA 3B38A 5HJEA 1GNVA 4M8SA 1G291 2GN4A 3NIFB 1P19A 3HVRA 3VVBA 2W43A 2X9QA 2BFMA 1GSIA 1ECLA 1IPFA 2BGLA 3ND9A 1J21A 4KB5A 4MUEA 4R01A 3ORHA 3UT0A 4J76A 2WHRA 4ILEA 2PSHA 4EMSA 3A37A 2O8DA 1AC5A 5T6MA 2EFGA 4DV0B 2GK7A 1J2JA 1WZCA 1YL7A 2OBBA 2Z4RA 3PTZA 2C88A 4M8NE 4BKOA 5U1PA 3KJXA 3S2FA 1V1MB 2GZHA 2NNWB 3RYIA 1Y4SA 2QW8A 1P73A 3GFVA 4ETMA 3VVMA 2PD3A 2R1TB 2E48A 1OLUB 4L8YA 1MO2A 2ORYA 1D0IA 2FW9A 4AJ9A 3ZLJA 2XNDD 2FN7A 2FRXA 2FEXA 2QLBA 4FGLA 4I46A 3BSWA 2P27A 3PYMA 2CDNA 5C52B 4E5MA 3BFXA 5BQXA 1QBKC 1QK3A 4FS3A 4RM3A 3RYFB 5CFZA 2PKRA 4HGOA 4IIUA 1OFTA 4ZT3A 3MWDB 3PNSA 1H8HA 3RBAA 5JNSA 1Z07A 3AEUA 4GOMD 3G2NA 3T9AA 3SBDA 1OIWA 2CMDA 5AOVA 2VHYA 1W4BA 4PLGA 2IFTA 1GTG1 3PGKA 5IZCC 1K89A 4EHJA 2KSQA 1N4DA 4GAEA 4YI3A 1W36D 1E0SA 2GZ1A 3KKEA 1X0XA 1AD2A 1Y3DE 5KWIA 3KUCA 1JB9A 4JLSA 3TZCA 1NX6A 1EFPA 2I2DA 3GBSA 4P4TA 4CL8A 3TX2A 2XB8A 4PW0A 1QX3A 1YZ3A 3DZHA 1BMDA 1O8BA 3FB1A 4OM8A 3U1TA 1LF0A 3ANTA 3ZGNA 3N76A 1WLSA 1T9GS 4YR7A 3E1SA 3CF4A 2G28A 2QRZA 3EXIB 3WLSA 3R9XA 2VFAA 4I6GA 5FWYA 1KSFX 4F96A 1YIAA 4ZODA 2GYYA 4F6LA 1IU9A 1II0A 3A1UA 3E5MA 4LXQA 3E9EA 5KDOA 5I7OA 4K2HA 4LE0A 2XAAA 3O3OB 5HM8A 1VPTA 1UANA 4PYMA 5I8WA 1JF8A 1S8OA 2JZCA 3DDWA 1YR9A 1N2CB 1WQ4A 3GGPA 1MT3A 1Z0SA 2IGTA 2XSZA 4D0GA 2R4QA 4QGFA 4OI0A 2OQ2A 3ESDA 3P9KA 3U3KA 3P5BA 4I3HA 1ENZA 5AQ1A 4PTLA 3WLEA 2XT6A 2KI5A 4RK5A 2FVYA 2B1GA 2PZLA 5K2MA 3GW8A 4ZI5A 1GKLA 2HJWA 3CEMA 3R23A 1ZD1A 1MXHA 3Q4GA 2BMAA 2Z58A 3DBVO 3NWOA 2PLAA 4CKWB 4EJ0A 1B1AA 1UPCA 2C84A 2GHQA 1R37A 3DHEA 3GJ4A 1R6UA 1JQKA 1K8YB 1M0WA 4I9HA 5KBYA 2ZWVA 5K0EA 3NV9A 2O2GA 2Q2VA 4JI8B 1H8EA 1P5ZB 2XGSA 2MWMA 2Y1LA 3HBMA 4DCGA 1JPJA 4NYJR 2IYQA 2RAUA 4YLYA 5THQA 4G37A 3W9UA 5LXTF 5ALEA 4AZ0A 4ZOLB 4NZNA 3T1OA 4K9PA 5EJMA 3OZFA 3W5VA 2FG7C 2XMBA 2ZJAA 4DANA 1QZTA 2CXNA 3R0QA 5JCJA 4ZDJA 5JBNA 1Y6GA 1Q0TA 2HRRA 1MCZA 4LZJA 1LPOA 2I6FA 3ESCA 1LPNA 2R4TA 2CYCA 1UEJA 5BW6B 2B2XA 2C4WA 2C96A 2JHCA 3HACA 3TR0A 1W4AA 3BXHA 3KB8A 2GNPA 4HQLA 1P1BA 3A9WA 4C30A 3FGPA 4Y0NA 5TB5A 1R6VA 2C5GA 1OXMA 2CXHA 2FUNB 5JSUA 1L4YA 4F3YA 2CXSA 4X1YA 2VSOA 2J4DA 2XDWA 3Q10A 3STHA 1QUEA 1NNLA 2N1BA 2IXAA 3QFSA 4JQCA 2FYTA 4R2WA 2FX2A 4M53A 1YBMA 5HRUA 4MDHA 4PSUA 4IOJA 5A5DA 3OF5A 1PWZA 3WKEA 4G1CA 5BT8A 2X0RA 4NZ9A 4CF6A 1FP4A 2O5RA 1E2JA 4FLFA 2O5VA 3PA8A 1BYIA 4PLVA