3PFBA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with ethylferulate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Inserted alpha/beta Subdomain Shapes the Catalytic Pocket of Lactobacillus johnsonii Cinnamoyl Esterase
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
molecule keywords Cinnamoyl esterase
total genus 88
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pfbA00
4M0MA 3U0VA 4IH9A 4JYPA 3M81A 4J3JA 3WKCA 4Y2JA 2XQJA 5CT8A 2I3ZA 4OB8A 5AIBA 1FFDA 1ZJ4A 2XDWA 4MWTA 3N0TA 2ZJ6A 2VQ6A 5ALSA 3BJMA 4OYYA 2Q0XA 2IITA 2HU5A 1ZI9A 3GZJA 2EEPA 3BJRA 2J4CA 4KE6A 3WJ1A 1FSSA 3IVMA 5ALEA 3FWHA 2WJ4A 5BV7A 4N8DA 3C6BA 1LBTA 3FOBA 1Q83A 5FPQA 1TQHA 1QIHA 2IIVA 5LIPA 5I8PA 5AM3A 2QUBA 1LZLA 1QGED 2XUHA 4RE6A 4Q3LA 4X97A 3V48A 4EBBA 3V1KA 4BP8A 4C89A 4B83A 1X2BA 5EHNA 2RGUA 1GZ7A 4KE7A 1IUNA 5AM1A 1XZKA 2ZVDA 4K5QA 5SYNA 3E4DA 4Y2XA 3H1BA 3NWOA 4DYHA 3OPMA 3EQ8A 5FKJA 4UHHA 1VXRA 1XLUA 1GQRA 4CI9A 2PKYX 5HF8A 3TRDA 2C4HA 1CUBA 1H2ZA 1SFRA 3LIIA 2JGFA 2QTBA 3LLCA 3TEJA 3HEAA 1H2XA 1H22A 4DLNA 1QIEA 3FYUC 4Y2TA 3OOSA 1A8SA 1DX4A 1EH5A 3V9AA 3O9VA 4PSUA 3CN7A 5JAPA 4H7JA 4IO0A 4Q3OA 4UPDA 1WCYA 3IUJA 5FLKA 1CUVA 1BCRA 1JFRA 2Y1KA 3G9ZA 4RGYA 1JMKC 3A2NA 1W75A 4Y2YA 5LKAA 1BEZA 4UHCA 5K3CA 1UOOA 3I2GA 4NS4A 3SK0A 2ZYIA 4L3WA 5SYMA 2WHRA 1UWCA 5JD4A 2I78A 3WMRA 5DYTA 3X3HA 3QZUA 2XI4A 4FBMA 3ANSA 4LXHA 3I6ZA 2HA5A 4OUKX 5ALJA 1AGYA 1LPNA 4MYDA 3I2HA 5BWBA 2XUOA 2GBGA 4AMZA 3C45A 5K5EA 1CPYA 2JEYA 1UOQA 5ALVA 5AOBA 5EIHA 1ORVA 5FOQA 5JAUA 1TAHA 2WTNA 2XUJA 2B20A 5ALZA 3V1MA 2AXEA 4E11A 4A5SA 2XUKA 3BE8A 3PICA 4MYSA 4BE4A 4AZ0A 5ALWA 4KAAA 4EY8A 2XUIA 3D7RA 1E66A 2FJ0A 5AM2A 2WIDA 3QVMA 4FOLA 1ZI8A 2JGIA 4B81A 5DNVA 3H2JA 1VA4A 1E8MA 4AN1A 3DLTA 2WUFA 1AKNA 3FCYA 5CH5A 4Q3KA 1U65A 3HABA 1TRHA 2ROQA 1W1IA 1IZ7A 2CBGA 1VOTA 1XZDA 1THGA 5I7UA 1QOZA 1XQWA 3STTA 1N1MA 2DQYA 4Y7DA 4CCYB 1T4MA 2C5GA 3GELA 1WHTA 2XUGA 1CVLA 3F8SA 3WYNA 2XB6A 2CUTA 2PL5A 1E8NA 2VAVA 4I19A 4GDMA 4P92A 5LYYA 4GEGA 4F5ZA 4RNCA 2Y2VA 3NGMA 1BEEA 4C6HA 1D07A 2XMZA 5LZ2A 2QRUA 2OGTA 2NW6A 3HXKA 5HQ3A 2ZSIA 4E15A 4FTWA 4WCVA 2PBLA 3KXPA 3KWJA 4WFKA 1H2YA 2JGMA 4GBGA 5LZ8A 3ESBA 5ALMA 1BN7A 2AJCA 2RHTA 5ISMA 5FDFA 2W6CX 4AO7A 4ROTA 5AIAA 1XZMA 3FNBA 5A2GA 5EFZA 3R3XA 1UK7A 1IMJA 2B9VA 5A7HA 5C7YA 5A7FA 4HZGA 3BL8A 1E8DA 5DYWA 3I2FA 3A2LA 4YASA 3AIKA 1YS2X 4KE8A 4Q1VA 2OQIA 1ZD4A 4MXDA 3W9BA 2DR0A 4FLEA 5IKXA 3FYTA 1AX9A 3WL7A 2XQGA 2JBWA 2XUPA 2OQVA 3H18A 4IH4A 4X6UA 3HACA 3NUZA 2QXTA 1XZEA 2HA0A 1ZOIA 3N2ZB 1FFEA 1GPKA 4DMKA 4EY5A 5ESRA 3C6ZA 2GZRA 3TGLA 1KEZA 3K9BA 4G4IA 1CUFA 5ALIA 4TVKA 4BAUA 3O95A 4C4ZA 4CCYA 3AZQA 2WG1A 2XQKA 1H23A 3AZPA 1ZD2P 3I2IA 4G5XA 3O0DA 3R40A 3H17A 4DNPA 1F6WA 4CG1A 1TKRA 2FJPA 5DJ5A 3HRHA 4C4YA 3PDCA 4IHAA 3KSRA 2C7BA 4G9EA 4Y2QA 5AKLA 2ORYA 1J1IA 1QJ4A 5CT4A 3OC0A 1ODTC 1CQWA 2WM2A 4QWWA 3P2MA 4N5IX 1EK2A 5T4FA 3W05A 1QONA 4AZ3A 4BRZA 1I6WA 5ALFA 1Z68A 4DM7A 5K3FA 4KAFA 4J0DA 2CKMA 1PFQA 3E1GA 3JYHA 1ZIXA 2AJDA 1EVQA 1GKKA 5HF5A 4G9GA 2C0PA 4UBIA 3FAKA 4G4JA 4QLOA 2XMDA 5D6OA 1LPBB 5HF6A 5AI0A 5A6VA 3DQZA 4H35A 2WIGA 5EHZA 4PF1A 2WU3A 4ZV7A 2QMQA 4BCCA 1LBSA 2HU7A 4BBZA 1XFDA 1HDEA 3W2TA 4QZVA 1XZJA 5C81A 4EA6A 1K4YA 2Z8ZA 5C8XA 4B85A 1ACLA 4DNOA 3QM1A 4MEBA 2UZ0A 5ALHA 4D9JA 3FVRA 5D7BA 2V97A 3ILSA 1JJFA 5JYCA 3PFCA 2XLBA 4AO8A 1VKHA 1LLFA 4H7KA 4K2AA 1XQXA 4DMHA 4BVKA 1AMNA 3L1JA 3WWOA 2ONCA 2QT9A 3ZLUA 1Y37A 3NOXA 3L1HA 4B0OA 3DJYA 1MNAA 4AXBA 2YASA 1IZ8A 5LZ5A 1XZFA 1MTZA 4AX4A 1S8OA 5C8ZA 2D0DA 2J4FA 1FFCA 1OXMA 1QIMA 2WFLA 1K6EA 1QIJA 1CRLA 1A8UA 4B80A 3ZI7A 1Q0RA 1WOMA 3FCXA 5HCUA 4P93A 5AOCA 3WK7A 4J03A 1UOPA 2J3DA 4W9RA 4ARAA 1G66A 1AUOA 3MVEA 1YB7A 5E4TA 3R3VA 1C4XA 5JALA 5DTIA 1X2EA 3S8YA 2WKWA 3IA2A 2XQIA 4FBLA 5JARA 5LP1A 3JW8A 5IVIA 1GPNA 5C8VA 1QE3A 3C8DA 4HXGA 5DYYA 5CBKA 4I4CA 3GFFA 2WQZA 4PSCA 1MAHA 1P0QA 1P0IA 2QR5A 3BIXA 5AKHA 1N5RA 5E2IA 2D5LA 2BJHA 2XMSA 4UFPA 1CR6A 4A16A 3T4UA 1HL7A 4KACA 1B6GA 5KWIA 1GT6A 1R88A 4X3CA 4CFSA 1VZ2A 2ZJFA 3IULA 1L7AA 3IB3A 2ZYSA 3BIWA 4BP9A 1CUEA 2WILA 1MN6A 2Y2UA 2Y6UA 1MX9A 5KBYA 4XWGA 1GXSA 1K63A 2GYVA 2WIJA 2PM8A 1CUDA 3RK4A 1R9MA 1GQSA 4N8SA 3B5EA 3PF8A 5AM0A 3C6YA 2G5TA 4JYMA 2CJPA 2PSHA 1YR2A 3I6MA 4BC0A 3D3NA 3DEAA 3AJAA 3VDXA 3WI7A 3WIOA 4X95A 1VXOA 3G0IA 4J0KA 2HRRA 3DCNA 1ZD3A 5AK4A 3MUNA 2PSFA 2V9ZA 1BN6A 1VZ3A 1M33A 5EIEA 2WUEA 4UBMA 3G0BA 5AI5A 4WJLA 3OTQA 2WHQA 1R4ZA 4NVRA 5AKKA 3STYA 1CUYA 2WJ6A 4BE9A 1UFOA 4BAZA 1TK3A 1XRPA 1SCKA 1UXOA 5BOVA 2FX5A 1CUUA 1CUGA 3GROA 4ZWNA 3RKSA 4Q34A 3C5WP 5YASA 4BVJA 4UBLA 3GUUA 1CFJA 2VAXA 3C43A 1DX6A 3D0KA 4V2IA 1CUIA 1A7UA 2OGZA 2QJRA 3M82A 2PU5A 5ALPA 2JEZA 1QIDA 3I2JA 3RLIA 1QIGA 4P9NA 4A23A 3FYUA 3H19A 1MT3A 1CEXA 4EB0A 3DL4A 4BZZA 2OAEA 2WFZA 4UBKA 3EQ7A 1WB4A 2VSQA 4OU4A 1SCIA 2H7CA 4KJXA 2PSDA 5AI4A 3RARA 4U2EA 5T4EA 3ICWA 4BDSA 4AB1A 3PF9A 1YASA 3ESDA 4QDXA 4GECA 3K2IA 5AJHA 4GWLA 1O6GA 5LZ9A 3DS8A 2XMRA 5AOAA 1VA5A 1MX1A 4BTVA 3HZOA 2C0QA 4X91A 3H2HA 4B7ZA 3D59A 4OD0A 3UUEA 4DTCA 4H7HA 3IBTA 3WWCA 1XKTA 4MQLA 5HKAA 2VJAA 4GHWA 4PSDA 2J3QA 4ARBA 4AQDA 3ICVA 3D2CA 5IVKA 1X70A 3R3UA 3DNMA 2WG2A 1YAJA 4H7EA 1HKHA 5CRIA 4Q05A 1XKLA 1QZ3A 3SC2A 1EXWA 2B61A 4IQ4A 1ACJA 2X76A 1LPMA 2Z3WA 3EQ9A 4FHZA 1G4HA 1R1DA 5FPPA 4YX9A 2DFPA 5JAHA 1DWOA 3R3WA 4EHBA 3QH4A 4X85A 4N5HX 1JJBA 5AKZA 1QFMA 5AO9A 1AZWA 6YASA 1DWQA 1ISPA 4U2GA 1LGYA 2CZQA 4OPMA 3PE6A 5A62A 1LPAB 3M83A 3Q8WA 3WK9A 2CB9A 1XZAA 3GBSA 1EA5A 3KWFA 3G7NA 3WKAA 4DNFA 5AI8A 1DINA 1ODSA 3WK4A 5ALXA 3BWXA 3D2AA 4BDTA 1EDBA 4XX1A 3WL8A 3C5VA 7YASA 5JD5A 5ALLA 1XZHA 2RI6A 1KU6A 2OG1A 3OM8A 4G4GA 1CUWA 3LS2A 1WPRA 4YPVA 4EZIA 2XQFA 4J0GA 4E14A 1K8QA 2X5XA 3WK6A 2PVSA 2OGSA 1DTEA 3O4HA 1BCSA 1U2EA 4W63A 2ZSHA 5A71A 4KAJA 5ALYA 4FKBA 2H7YA 4Q82A 3WKBA 1QO9A 1WB5A 4Y9SA 4HRXA 1R3DA 1W52X 5BWCA 4GLBA 2WLSA 1H2WA 5AKIA 4BRSA 5JZBA 2HRQA 4QEKA 5AK3A 2GBFA 5AKGA 1XLVA 2EDAA 3KD2A 1DT3A 2O7RA 2QOEA 5AKYA 1QLWA 2O7VA 1QIFA 5FRDA 1DQZA 2WJ3A 3CXUA 5CT5A 2ES4A 2G63A 1QTRA 4C01A 4MEAA 4H77A 2VATA 1EB8A 3A70A 3RM3A 5CURA 4BC1A 1BROA 3WA7A 1FJ2A 1QTIA 1ZD5A 5ALKA 2XLCA 5HZGA 1DWPA 3G02A 1CUJA 2GBCA 3FLAA 2IX9A 5JADA 3F96A 5IVHA 1C7IA 4FFVA 1J06A 3KOOA 3R3ZA 1NU8A 1W76A 1NX9A 1ZICA 2Z8XA 4OB7A 2WHPA 4U2FA 3QBJA 2W22A 3HI4A 3A2MA 1GPLA 1BRTA 2H9YA 2RAUA 3IIIA 5CH3A 1JMYA 4U2BA 3ESAA 1ODCA 3ESCA 3WZLA 4W1PA 4G8BA 1NU6A 4QDOA 1J2EA 2B4KA 4G8CA 4WFIA 4UHFA 5HKBA 3DYVA 3UMJA 1TCCA 4UUQA 1ZIYA 5ALOA 3DKKA 1XLWA 1RP1A 5CH8A 4NMWA 3AIMA 4CIBA 1N5MA 1XZLA 4C87A 3BXPA 4DSAA 5JAOA 4ZGBA 1E5TA 3PUIA 3QITA 1EVEA 1QO7A 3IURA 4FWBA 4PNZA 3JWEA 5IVDA 5JD6A 3H2GA 2R11A 1BE0A 3K6KA 5CT6A 4ZI5A 3HJUA 1WHSA 5JZ9A 4DMFA 2K2QB 1UK6A 5EHXA 1GGVA 2O2HA 4X00A 1IVYA 2BFNA 3FYUB 4MWSA 4OB6A 4CG2A 5CT9A 3YASA 1IUPA 4Y2PA 3DOHA 3V1NA 3R0VA 3SX4A 5EIAA 2BKLA 1P0PA 1ETHA 2GYWA 3WWDA 1LNSA 1EDEA 5AH0A 1JI3A 1CIJA 2Z3ZA 1CUCA 1QFSA 2HA4A 3FVTA 4UBJA 3TJMA 3G0GA 3CCCA 2PUHA 3ANTA 4KR0A 3C70A 1MU0A 2I3DA 5JIBA 4YK7A 1XQYA 1W6RA 4H18A 5AKXA 5JANA 2H1IA 3DD5A 4NZZA 2XMCA 3E0XA 4KE9A 1VE7A 2G4LA 3C6XA 5T4HA 1P0MA 5LZ4A 5A7GA 3D2BA 3O4GA 3I6YA 3G8YA 4TGLA 4F0JA 3ZV7A 5J3JA 1N8SA 3O4JA 1RWQA 3G9UA 1PV1A 3EBLA 2E3JA 4XIIA 5EGNA 1WPXA 1F0NA 2GZSA 1EK1A 2WTMA 3STXA 2WG0A 1E3QA 5E4YA 1YAHA 2OAGA 2VJBA 4OYLA 1DT5A 3IUNA 2C5FA 4M0FA 3QPDA 4FLFA 3AZOA 4ZRDA 1YA4A 1U8EA 3O4IA 4PQEA 5ALDA 1YB6A 4X7BA 2CEKA 1TCAA 1CUSA 1YCDA 1HLGA 4W1RA 5AKEA 4EY6A 4ETWA 5KWJA 4OCZA 1TIBA 1CUXA 4EY7A 3R3YA 1XQVA 3H0CA 3I1YA 1MAAA 4U2CA 4HTAA 4LYDA 4I3FA 1CLEA 2JIDA 5AM4A 1QIIA 4AO6A 3LP5A 2YYSA 4UBNA 3I1IA 4UHBA 4ZXFA 1QIKA 3VJLA 4H0CA 2GYUA 2OCLA 2ACEA 4JUIA 3AILA 3V1LA 3BDVA 3F97A 3VJMA 4QDZA 3PI6A 3WLAA 3WL6A 5CXUA 4DGQA 2AJ8A 2I03A 5I9IA 5HQ3B 5AP9A 2ECFA 2JF0A 2WIFA 5D3ZA 2XUDA 4K6KA 3WWPA 1L7QA 1ZI6A 3QMMA 5ALNA 4Z49A 2C58A 1UKAA 1Q0ZA 3WKEA 5CW2A 4B84A 2XMBA 4J0CA 4W1SA 5HFNA 1AQLA 1JU3A 5DTJA 1F8UA 5AI6A 5AICA 4LXGA 5FV4A 3IUMA 5K3BA 1JKMA 3G0DA 3S2ZA 3H2KA 4MQMA 3AINA 3FSGD 1C7JA 2GBIA 3F9CA 1JJIA 4JEIA 4X6YA 4F60A 4UFNA 4CG3A 5DLPA 4QLAA 1LPOA 3STUA 1XRMA 3B12A 4RE5A 4GW3A 3L1IA 4FNGA 4AN0A 2ACKA 4DIUA 3EF3A 4Y2SA 5AI9A 4LHEA 1J07A 1TCBA 2PX6A 3KDAA 4PO3X 3BF8A 4CCWA 4FDMA 4X90A 2AJBA 4BB0A 2BUBA 4G8DA 1OCEA 3VVMA 2JGEA 1LPPA 2QZPA 4ZREA 1VJ5A 4L72A 1XROA 5JASA 2EDCA 4HVTA 3D4LA 5EI5A 3FLBA 2Z5GA 2XMGA 5AK6A 4E46A 4J7AA 4B6GA 4DNQA 4HAIA 2ZJ7A 2HIHA 2OXEA 3VXKA 2WHPB 2VA9A 1CQZA 3VKFA 1Q84A 5DNUA 2DCMA 4UHDA 3WA6A 1G5FA 5DNWA 5AHXA 4L9AA 4QDUA 4XJVA 1SC9A 2O2IA 1MO2A 3I2KA 1JU4A 4M0EA 2HA7A 3DOIA 3VJKA 1FFAA 2DSNA 1E89A 4QA9A 4B9EA 2QM0A 5CXXA 3R41A 4P08A 5K3FB 3W9UA 2QS9A 3WK5A 2VJDA 2HDWA 1ORWA 2X8BA 3QMWA 1MX5A 2RIPA 3W04A 2JGJA 1JT2A 2LIPA 4WDQA 1CUHA 4S0XA 2BGNA 5K3AA 4TPKA 4B0PA 2ZYHA 4X71A 1GKLA 5K3EA 1EINA 5AKJA 3ZLTA 4JH0A 2HL6A 2P8SA 2OPHA 1MPXA 4WY8A 3PUHA 2WFLB 4QWMA 4RPCA 2BUAA 4AMYA 1XRQA 4X6XA 3AIOA 3H2IA 1UT6A 2QJWA 2V96A 3PFBA 3AFIA 2PUJA 4ITVA 1CV2A 3G0CA 3D5EA 2V98A 3MUOA 2DHEA 1MJ5A 5D3KA 4HS9A 3O9MA 5HK8A 4WFJA 4B9AA 3W06A 2OCKA 5FUMA 5JZSA 1F0PA 1XZBA 4KRYA 1VLQA 4BCDA 3A6ZA 2XE4A 4OU5A 2VT6A 2DHDA 4BCBA 5E4JA 4L0CA 1ZGBA 4J0JA 4QDTA 4KRXA 3QPCA 4PW0A 1XRRA 3F67A 2H7XA 4IH1A 1PJAA 1UKBA 2YXPX 3H1AA 1CUAA 1AC5A 1XRNA 3C8HA 5FXMA 4G1FA 1USWA 4DMCA 4UFOA 1XRLA 2XMQA 2DHCA 5HFAA 1THTA 3VVLA 4O08A 2BUCA 3HC7A 4X92A 2JGKA 2HA3A 5ALTA 2QUAA 3ZWQA 1VE6A 3ED1A 4J0HA 5CMLA 1Y7IA 4QE3A 1U4NA 1KU0A 1SOMA 5DWDA 2DQZA 4LXIA 4WY5A 3EIOA 3C87A 2PPLA 2WUGA 2XUAA 3ZPXA 4CIAA 3DDUA 4H7DA 3MGAA 1EDDA 3BDIA 4XVCA 5T4BA 3SWWA 1HBJA 1ZGCA 2G5PA 4C88A 2BGRA 1IUOA 2HA2A 2PU7A 4MJ3A 3Q0TA 4LKOA 2PSJA 4KYVA 3WL5A 1XZGA 3CCBA 2PSEA 4EY4A 4Y2VA 2HADA 4DSZA 2HFJA 4PV7A 2FUKA 5AM5A 2R8BA 4N8EA 1UZAA 5K3DA 5FP0A 4BVLA 2HA6A 3QYJA 5ALGA 5JATA 4X93A 4X94A 2OCGA 1YA8A 1B41A 3I28A 2QKYA 2JGLA 1MNQA 1O6FA 3B3QA 3G9XA 4Y2RA 2HHAA 2RHWA 3WZMA 3WYDA 2OCIA 4H7FA 2WUDA 1DU4A 1BS9A 1EHYA 4JNCA 4ZV9A 4GI1A 5ALRA 4INZA 2VJCA 3QPAA 1R50A 2HM7A 3WWEA 5HK9A 1SCQA 5CTAA 3WKDA 1K5PA 2OLEA 2QXUA 2QVBA 1W4LA 2VF2A 3DL7A 3WJ2A 1WB6A 2XT0A 2YH2A 4B82A 1RYYA 4UBOA 3IUQA 2HFKA 1LPSA 4U2DA 2AJLI 2WIKA 3M3DA 3QMVA 4FMPA 3BF7A 4W1QA 4HRYA 1UKCA 4Y2UA 3U1TA 5LLSA 4OSEA 3LCRA 5AK5A 5KREA 1T2NA 4H7IA 1EI9A 3E3AA 2VEOA 4FNMA 3FLEA 1OILA 3H04A 4FFWA 1AURA 2BAGA 3FBWA 1HPLA 4BAGA 2WFMA 3DKRA 1DQYA 1UK9A 3WK8A 4BYMA 1XZCA 2XUQA 1YSCA 2VTVA 1ZJ5A 4BATA 5ALUA 3F98A 2BCEA 2RONA 2VT7A 5IH7A 1L7RA 3HSSA 1EX9A 2WU4A 3STWA 4BTLA 4C4XA 4K6GA 1LZKA 1Y7HA 1R9NA 4K6HA 3UUFA 4KEAA 3OURA 4EUSA 3HYSA 1YS1X 2Y6VA 3LIPA 1FFBA 1UK8A 1WM1A 1XZIA 4FLMA 4WDRA 4LIPD 3IDAA 5ALQA 3GA7A 3G9TA 2WSLA 2HU8A 2CMFA 1A8QA 3FSGA 4UHEA 4HXFB 3DYIA 3CN9A 2ZYRA 4J0IA 1G42A 1HQDA 3OG9A 1A88A 5EHQA 3WIBA 3ZLVA 4GXNA 1BU8A 3WQHA 3AUKA 5H3HA 3VISA 4BZWA 3STVA 4F21A 1EB9A 5LKRA 2O2GA 1CUZA 5F4ZA 4QNNA 2XUFA 4LYEA 5HF9A 5LZ7A 4HXEB 3HLKA 3T52A
chains in the Genus database with same CATH superfamily
3DG9A 3F0TA 3TNYA 4Z5XA 1FTWA 1U7PA 1HE5A 1E1QD 4DUYB 4F45A 1HE3A 2V6GA 2UYYA 2WAYA 4Y2JA 2HPAA 4QU0A 3EZGA 4XUCA 2BRUA 5CT8A 5EOVA 3QIVA 1VJ1A 3RUCA 1NY6A 1RXCA 3L4BC 4LVCA 3QE2A 4E31A 5AOVA 2YV5A 5GJWC 1Z6TA 2IYTA 3LD9A 4MWTA 1DV1A 4TSKA 1C1XB 1PTJC 1T2UA 3AU8A 1VSBA 1D2HA 3D6HA 3WGJA 3K94A 4XDZA 2BEWB 2ZWIA 4MGYR 2GETA 3SC2B 2X77A 5IM4A 2FYTA 2E4WA 3ZE0B 4IHJF 4NYIQ 1TKCA 3BCRA 3GC6A 4FMBB 2D1QA 3CPSA 5H9VA 4J2TA 4YJHB 3VZSA 1L7OA 3ONFA 3ZHCA 3LA8A 4IIBA 5ILOA 4W4TA 3WC4A 1SZJG 3K5HA 1JUDA 1LK0A 1BDJA 2RFLA 2UVPA 3F6RA 3JQCA 3LM8A 1JHOA 1Z5PA 2NTYC 1P1BA 1V5FA 4EATA 3PPVA 1QU3A 2EG9A 2DPMA 3SE7A 1O94A 1X1BA 1N5DA 3K5WA 1N2ZA 4A6DA 2C00A 4AMGA 1WDLA 3WJ1A 3SGLA 3ZXYA 4A3SA 2O2SA 4D4JA 5IARA 2UAGA 3WAGA 1T91A 3FYCA 4GMGA 3Q8MA 3PC8C 4IV8A 3FW1A 3AVQA 4N8DA 4Q39A 3LCCA 2IXTA 4OOFA 3C1UA 4NE9A 4HDOB 3ZXUB 1Z4LA 2C07A 4OM7A 3CLUD 2B2XA 1JG1A 1II0A 1S2MA 3BGVA 2J3HA 3EEQA 3ESRA 4EMBA 2R7AA 3DTYA 4ARSA 3U4AA 1M2JA 5LIPA 1T15A 3V2GA 1BMTA 1NJ5A 3CVVA 3WGUA 1AT1A 5FAKA 1E7MA 2P6NA 2O3SA 2B1GA 1V2HE 2BGWA 3OX1A 5BPHA 2D1FA 1E7WA 4EF6A 4G1VA 3E22B 4IHQA 4BGIA 4CM8A 3V4SA 4B76A 4EBBA 2LUOA 1LRLA 3V1KA 2FW0A 2WYOA 3DL2A 3AI1A 4HDKB 2G1JA 4IS3A 4C89A 4EEKA 2JFVA 1SD2A 1QFYA 3GBPA 3EIWA 1CZOA 3L7YA 3HR4A 1Z4OA 4KO2S 3TGWA 8ADHA 2F6RA 5F1KA 4CZ2A 1VC2A 2XMPA 1F3OA 3LUHA 3R0JA 2RGDA 4CXMA 5KNDD 1NHWA 1XZKA 1TF5A 3PXUA 4HB2A 4KLRA 4MK4A 5SYNA 2F67A 3N05A 1X1DA 4FD2A 1RHRA 5CVEA 3UQYS 1SVKA 1GV1A 5DLQC 3TKYA 3NWOA 5AVWA 4Q66C 4IJ5A 2XNDD 3S2EA 5JYEA 3OPMA 4M49A 5FKJA 4D8UA 2FOXA 1VXRA 3LVQE 1GEGA 4CI9A 3PHGA 1Q22A 3KPVA 5B64A 1JBEA 1F2TA 1JDJA 1WXDA 1KBQA 2I99A 3MF4A 4IXWA 5LL6P 2AVDA 2PMDA 5HF8A 3E5MA 3AVUA 2CD9A 4LRWA 3WMWA 4EJSB 1I13A 1PJ2A 1WDTA 1KNQA 5J59A 5C31A 4HTFA 1OLXA 3LLCA 1KY5A 4O2AA 3HJFA 4AYWA 1AA6A 3KM0A 1E9FA 1E6WA 1KH2A 4CGZA 2I29A 3EEBA 3HEAA 1QTQA 5TVGA 1PFGA 4QQ8A 5BXQC 5C9ZA 2NVUB 5ICCA 2ATXA 4I66A 1QC5A 2MMGA 3FYUC 1WLYA 4RGVA 3V80A 3ZY4A 1JG6A 1YOBA 3ETEA 3H65A 4Y2TA 4MITA 3MCVA 4D0NA 1DX4A 1EAMA 1EH5A 1STOA 5IW8A 1KL7A 5E0OA 2C8JA 2XD4A 4UEKA 5DFAA 3T9FA 3ZY3A 3WLPA 2WWTA 1BU5A 2DP4E 2ZIGA 1KPHA 1QHGA 2ZS9A 4H7JA 3VQTA 3W5JA 4Q3OA 3PLNA 2H1HA 1EJ0A 1XCBA 3ANNA 4C6TA 4LSWA 3UT5B 1N9ZA 5LUBA 5LXTF 4TTSA 4TV8B 3TDNA 2YWEA 1WEKA 2JFZA 2ZAOA 3CE9A 4OHZA 1EA7A 4Z1OA 3MPUA 3WRXA 4HQ6A 4A1OA 3VZPA 1YV9A 4UHCA 5H3CA 3ZYZA 4JVLA 1OU0A 1ZGAA 2WSBA 1OX5A 2C9DA 1OAKA 2GCPA 3FJYA 2Q4TA 1VSUA 4M38A 4Q7KA 1J5EB 2V6JA 5EE9A 3N2NA 1RQPA 2QYTA 2B4YA 2EP8A 5KSWB 1P5RA 3OPYI 4L3WA 2FK8A 3HA2A 1R00A 4GPBA 5SYMA 2C4TA 2FVYA 1T8UA 2GSDA 1UWCA 3EIHA 2X1LA 5JOQA 5JD4A 1EJBA 4PPYA 4KXXA 4DJTA 5ES4B 1FFSA 1E63A 2VYND 3I3SR 4LI0A 1UPTA 3AJRA 3IGFA 1GU0A 3NTXA 3P2YA 2QSYA 5DYTA 3WMRA 3R6TA 4R9RA 1SR8A 1G1AA 3LP8A 4AVYA 2REQB 1IBKB 2XI4A 2XSZD 2I2WA 3AEQB 3LWZA 1P77A 1PV2A 3PC8A 4YBRA 2JH3A 4EHDA 4PQFA 1GZSA 3I6ZA 1F9EA 3KU4A 2HA5A 1D2MA 3IOMA 4HY3A 1B43A 4OUKX 4Z9XA 4UOEA 3LK6A 5DCWA 3RC8A 2OKCA 1AGYA 2VQDA 3BB1A 3MM4A 4J2OA 1ESCA 2H4JA 3I2HA 3C8MA 2YOHA 2H2HA 4MV0A 3AP3A 3P8ZA 5D2CA 4E5KA 1X13A 2YWCA 2J0SA 3SBXA 2GBGA 1OVGA 3FF1A 2C2GA 4ZOLF 5AQEA 5K5EA 4ZZ2A 1G2IA 2NUAA 1JAHA 1H5QA 2VP9A 2Y1GA 3KV1A 4F91B 4EEXA 1DUVG 3A1CA 5FOQA 5K7SA 2H4YA 1TTTA 4FU0A 5GM2A 2B20A 4EB3A 5JLAA 5BQ3A 3E9QA 1C4KA 4BEVA 2KQUA 4HAZA 2UZ4A 4WERA 5BWMA 4X54A 3HCFA 1G7RA 1GYRA 1SXJB 2JLCA 2V7WA 4Z3KA 1A4RA 3K32A 1AE1A 4UVEA 3MGBA 4BE4A 2CHEA 3E03A 1JIIA 2G25A 4AZ0A 1VLHA 2ZYUX 3P5BA 4I9NA 4TLAA 4WQMA 4WZBB 2B7CA 4KAAA 3WLNA 1SU4A 1XK7A 3DVRX 2PZBA 4KMOA 3M8KA 4X20B 1WUIS 2LWIA 2R5FA 1YXMA 2P90A 4HYTA 5LMNB 1RJGA 1HT1E 2XUIA 3HDHA 3USES 3VR5A 1XN4A 3WTBA 3BXXA 5AM2A 2WIDA 1MJNA 4Z99A 3R7WA 4MV6A 5EINA 5BW6B 3GEIA 2A92A 3MWDA 2R2AA 4FOLA 3U17A 4YQFA 1P2DA 3SYMA 4DQKA 3OFVA 1S6YA 3FZYA 3RVLA 4G1UC 4Y6RA 3WP1B 3TD2A 2CVOA 5DNVA 5I5EA 2IUUA 3NIWA 4RKFA 2P2YA 4LGVA 2ZJYA 3FMPB 2WUFA 2Y77A 4FR2A 4ZAYA 3W7AA 5AW8A 3HFSA 2I71A 1L5KA 3U3JA 3EBOA 3UJ6A 1FJGB 2G82A 2O57A 1SQ5A 1U65A 3CLHA 2HU2A 3KYIB 1CRQA 5T67A 2DM6A 4QUHA 2C1XA 3EUWA 4CKEA 1W1IA 5A4IS 2ZRDA 1FNSA 1QCDA 5DGDA 2CBGA 2JRCA 1EYZA 3VR4D 3WVNA 1PX2A 2Q9AA 4JVMA 1XZDA 4NCNA 2ONZA 3IUBA 1W6UA 1RAGA 4YB8A 4BRUA 1X8JA 4ARZA 3GG2A 1VDZA 3VTZA 3MAAC 1QOZA 4AMVA 3STTA 1J0EA 2GFQA 4E5MA 3MMSA 1Q3TA 2QIPA 3LC2O 4F2WA 1D5CA 3CBGA 4JUCA 5FFFA 1PFVA 2W6JD 1C2TA 3RTDA 5ENVA 4P86A 4EO9A 1AU9A 1T4MA 5JI2E 4XOUA 1I6MA 3EAQA 5JPDA 3H8VA 2HXGA 3OJEA 4UOQA 4F9EA 3TCNA 3UKOA 1L4NA 3GJYA 3E5NA 5DI3A 5EVJA 4TTRA 1E2UA 3RYTC 3PKJA 3OZAA 2H5LA 3PHCA 5M29A 3K0FA 4OGWA 2ZUSA 4ICIA 3IIMA 2V3CC 2IZZA 4DUZB 1DBIA 4IDOA 1JGTA 1EE1A 2X2FA 1RQRA 1PR3A 1IMOA 3HZHA 5T64A 2C8VA 1YHZA 2WD7A 4UCWA 3MTQA 4UM9D 3RS0A 1GRVA 2AK3A 5DEOA 1N3IA 5HQJA 3ETGA 3O3MB 2HQSA 2PZFA 1E1QA 1JR3A 3MJEA 3M5DA 2QTNA 2HB6A 5COBA 3M9LA 3Q3CA 1XF1A 1PR6A 2QVYX 4KIFA 3RUAA 5HQ3A 3VPBA 4NFYA 2R6HA 4Z4HA 4OK3A 4FTWA 4Q1DA 1N5JA 3VOBA 3ZVRA 2WZQA 5JY1A 2O4UX 4WCVA 5LLTA 5H83A 3TTXA 2IHZA 1ENYA 5L3QB 4B4KA 3EGOA 5CM8B 1XK6A 4JLDA 4YEDA 1YR6A 1Y98A 4GBGA 2DHQA 2ORVA 4L3VA 4ALNA 5KS2A 5JC8A 2C2HA 1NXQA 3L49A 4GG1A 1JDUA 1BN7A 5JSKA 4DAOA 4WNAB 2AJCA 5C1IA 2RHTA 1K4KA 3MRTA 4K40A 3I34X 2IW3A 1NSYA 5FOSA 1KEUA 1X7ZB 1NSFA 1U11A 1GNRA 4ROTA 3OF3A 3AHEA 3FPSA 3EPPA 5B53A 3U3XA 5JNLA 1NLYA 3A1EA 1GPDG 2RBEA 2AN9A 3INRA 2PPVA 2A0YA 1Z13A 4RGBA 1Q1NA 3RCBA 3TZKA 1EUCA 5A2GA 4LF9B 3KTAA 3GJZA 4GBED 3W2FA 4JV5B 3ZD6A 3S5UA 3P96A 3SYKA 2XOKD 4QJ3A 2BE9A 3HMKA 2WF8A 3IT2A 3GJ7A 1IMJA 3PGJA 3KQTA 4EYSA 1KS9A 3HRIA 5A7FA 2OFPA 4PZEA 1CS4C 2Q8NA 4GR4A 1VP9A 2GLTA 2JIZD 2JHGA 3ORQA 4HDSB 1NG1A 1ZR2A 1QZUA 1II8B 3FRHA 2CK3A 4U7HA 4DQ0A 4PWYA 4N4AA 1Z4QA 4PS1A 4LOAA 4A0FA 4XQ0A 1TJ5A 2Q4OA 3R09A 3B6KA 2XGGA 2AMYA 2QQEA 3MTBA 4JBYA 2RE8A 2OOSA 3E23A 1DO2A 2X8JA 3NVAA 3W6UA 4DXDA 2FOIA 3UW1A 4MXDA 4XJSA 3GPLA 2V0GA 1UJMA 4FFBB 2PQ0A 5DNDA 4L85A 4BQNA 2P79A 4R1NA 2IZ5A 4FLEA 4ZCLA 4HGYA 1Z8NA 2ZIFA 1YCFA 2YYZA 4DG9A 2VCHA 1DLJA 3C8ZA 1QTNA 4FSHA 5TARA 1AKYA 3UZUA 3QEBZ 4RK1A 2QVZX 2XQGA 4UEWA 2JBWA 4AKSA 1I1OA 1SVIA 1Y3FE 3N70A 1T8YA 2XV1A 4TROA 3FPCA 1PR0A 2PQ2A 3H18A 2JJQA 4FEYA 4IH4A 4X6UA 4ALJA 5F7XA 4FT2A 2ZCUA 4R9SA 3PQ5A 5EJ4A 3FTEA 3NUZA 1N2GA 3CYFA 2HA0A 1HFKA 2JL1A 4RACA 3RWOA 3ZNPA 3RFUA 4KQKA 1KJQA 4ZDKA 2W5UA 3PNMA 1YRQA 1JG3A 3R7AA 4MV5A 3KZ1E 1GPKA 3KT8A 3OP1A 5FTKA 3KRTA 3I6BA 3PUJA 5FBWB 5ESRA 1F20A 4EY5A 1OH5A 3C6ZA 4TWRA 2ZWAA 3C2QA 4GKBA 5HZHA 1RBQA 4HAXA 1KEZA 1U7WA 1XRSB 1K8YB 3CZMA 3HU1A 4GU5A 3RK0A 3BQNB 3P2IA 1LF5A 2P4SA 4B4WA 2OZVA 2Z6VA 4M21A 1WZIA 1DEKA 4Y6OA 5HUJA 5KC9A 1ZFNA 2H4ZA 4OUDA 4WVFA 1JXMA 3D6JA 3ZHUA 4PXSA 2EJVA 3VO8A 2BDTA 1CDOA 1XVIA 2PAFA 4XR4A 5LPNA 1RWOA 3NJRA 5ARDA 5JHGB 4QTTB 2C61A 3AZQA 4II7A 3CSDA 3JXEA 4QXQA 3F9IA 1H23A 1YKFA 3AZPA 3T4XA 5EIOA 5A3SA 3I2IA 4DC9A 4PGFA 3S1AA 2GKOA 4LBYA 4ER7A 1P5ZB 2G9ZA 5JJLA 2W2NA 2QN9A 5D1HA 1TKRA 2JA2A 1GAJA 4LRTB 4KIUA 3HRHA 2VP0A 1ILWA 4IHAA 4H3SA 4P3YA 3AR6A 2ZROA 4QUBA 2VCYA 3LBHA 1C3VA 1ZK4A 2ORYA 2GGSA 4AP9A 5LQRA 3EZLA 1IOVA 2OCYC 3HFRA 2ZAYA 1QS0A 5IWCA 3CUWA 4Y6QA 3GP8A 2WTXA 4E09A 4JI8B 2EXXA 4YO7A 1ODTC 5JISA 1F1JA 1CQWA 2BT4A 1N9KA 1XVAA 5FCDA 5G2OA 1MEOA 2YNMA 1WXFA 1RI4A 3ND6A 1L3CA 3GLHA 1WQ4A 3LL7A 3Q5DA 4YAGA 3MMZA 3THYB 3IEVA 1YB1A 4XXHA 4CR6A 1NZJA 3GFPA 3UA3A 5EWJA 1IY9A 2BEUA 3G6KA 1TKBA 5FOVA 4I8XA 1MVLA 2EVWX 1T3GA 4QRIA 1IM5A 1LY1A 4DM7A 4MMZB 1EX6A 1TKAA 4I4TA 4XPZA 3D6UA 4A03A 1JDZA 4AIIA 3LF2A 1H2RS 1Q20A 4QICA 1H93A 3AM5A 4J0DA 2L69A 4MNTA 4RGQA 4UVIA 3CLUC 4WZBA 3WNBA 1M3SA 2AX4A 4NXNB 1R16A 2ZR8A 4GZLA 4M7OA 1J0AA 1ZIXA 2AJDA 4PBRA 4ZEXA 1E77A 4WECA 3CVWA 3F3YA 3H05A 4MV4A 1XU7A 3ZHOA 4PYIA 5L95A 1SUIA 4MR8B 5HF5A 2GEBA 5B55A 1B16A 1RLOA 1HYQA 3LA6A 4G9GA 1GAWA 4K8RB 2PA0A 3OQ1A 3CVYA 1JFSA 1GYQA 1NVMB 2JKZA 4CKCB 2PKQP 1YQUA 2KB0A 3GG9A 3FAKA 4GPEA 1JH8A 4G0UA 4YH1A 5DHUA 4OLAA 4OOEA 2D3WA 5ITWA 3EAFA 1LPBB 3TL2A 2IF2A 3AR7A 1QOPB 4M86A 4ESEA 4M87A 2COUA 1AF4A 3C98A 1K7XB 2D2EA 1K9VF 3IR5A 3F4BA 1E0KA 2W93A 1PT7A 3KLBA 2ZJAA 1U7XA 3Q7RA 4IV5A 4QECA 5EHZA 1QX4A 1P72A 3NDBB 1WXEA 4PF1A 2WU3A 1NBOA 3KHTA 5HS6A 3BFVA 4O4JF 2KE5A 1WR8A 5LCXA 4Q9LA 3HVJA 2CXRA 5HKLA 3SHFA 2HU7A 1EVLA 3O47A 4BBZA 3NTUA 4KU4A 1HDEA 3VPDA 5JDIA 3AG6A 5EJGA 2YN0A 5IM4F 1U1CA 1XBTA 2JJ2D 3OPXA 4LZLA 3KJIA 2AXNA 1U2GC 3TUJC 5BUSA 4B85A 4YCDA 4F92B 5J2TB 1O0CA 1AV6A 4Q6BA 4ESVA 3PWSA 3I4LA 1AKUA 3UH0A 2WR8A 3UB3A 3O90A 4DKXA 3QM1A 3E6AA 3EXHC 1L2TA 4XX0A 1B7GO 4PWZA 2HWXA 4K3VA 5CX1A 3QVLA 2BR3A 3EZ6A 2V97A 3KYDB 3S4YA 4R1TA 3TXAA 3ILSA 4DYVA 4LFBB 2XLBA 3SXUB 4AO8A 4O2RA 4UTVA 1LLFA 4H7KA 2WAOA 1Q44A 1SUAA 3R7LA 5L51A 4B2YA 4K2AA 4NBNA 4TMVA 3CGGA 5CA1B 4RVSA 3JCZA 3RTCA 1IZ0A 4BFVA 4LYYA 2ID8A 5CNMA 4DCUA 1I6KA 3RFVA 3ZLUA 2I4IA 1Y37A 4NICA 4ACAA 3L1HA 2FWIA 3E27A 3P9YA 1VIYA 4KVGA 4YAJA 1UBKS 3DJYA 1VHQA 4UATA 2BHLA 3OUTA 2Z9DA 2ZRPA 3M89A 1YMVA 2PLAA 4R6WA 3KXKA 5HIJA 5CCXA 2QD2A 2COEA 3B1XA 3EQ2A 2C5EA 1V3VA 4FYJA 1QH1B 4ENPA 1SQGA 4R1OA 5LZ5A 5KOHB 1IRXA 1Z62A 4B7CA 4KK3A 4MCHA 4CIVA 2DCUA 1CDZA 3DZFA 4U9UA 1GUDA 1RM3A 2GD0A 4MCAA 4GMKA 1S0UA 1S8OA 1FLAA 4RD6A 2J4FA 4WZAA 1A97A 2B1IA 2QD3A 3DCIA 2Y92A 3ILXA 3RLFA 3HSKA 1A8UA 4DC1A 4B80A 5A4JA 3EDYA 5TPWA 2W8ZA 2GBLC 3DMRA 4ENTA 4MWDA 1JVNA 4PN7A 2J30A 1PEYA 4QTZA 2M2IA 4Z0NA 3OZBA 3FCXA 3BA1A 5H1YA 5E7MA 2VPYA 2IEZA 3KC2A 1KQGA 2ECQA 3FPLA 4C14A 3MG9A 4NAHA 1I51A 3PDJA 5I9TA 1A69A 2J3DA 4HEA1 3I9JA 4Y1RB 3SZOA 4ARAA 8AT1A 4QFCA 4ZVNA 1TUBB 3MVEA 4HYQA 1VBFA 5E4TA 2H5IA 2RHJA 1QR2A 1GN9A 1SXJE 1S1MA 5LNK6 3OCVA 3UJPA 1KETA 2R1VA 3M6XA 1ARZA 3PPXA 5DTIA 5B7GA 2WIAA 3OQIA 1L9XA 3OOWA 4JR2A 2BM1A 3RAGA 2DQSA 4ZO4A 1YTUA 4FBLA 2CLDX 5JARA 5IVIA 1Z38A 3IV7A 3K70C 3SSOA 3C0KA 3R7NA 1TAQA 1XG5A 2VPTA 1DI0A 1GTG1 3IPLA 1N57A 1B73A 3THYA 4LG1A 1K0UA 2CEAA 1WVIA 3FFXA 2RH8A 4X0EA 2HK7A 1MUUA 4HXGA 3RRFA 3RUFA 1H1LA 1A76A 1M2OB 2GEFA 3B7PA 4I4CA 2WQZA 4KQEA 1CNEA 1KMMA 3GFGA 1A9XB 4EGCB 2Q6VA 1E5XA 3M1IA 4GMFA 4BMYA 9ABPA 4QOFA 1U28A 1X3LA 5EIFA 3U39A 4L5IA 3A58B 4R7TA 2QVLA 8LDHA 4KO4S 3BDAA 4QG7A 3RYHA 4UFPA 2HJWA 2FPPB 3ME5A 3WDSA 4PHCA 4AUNA 4YMLA 4G3XA 2E5FA 2H16A 1DFGA 2CFOA 1YA6A 1M1UA 1HL7A 2EZ4A 1YR9A 3KKQA 5C7IO 3P9RA 3ZDDA 3G6WA 2BTQA 3IODA 1L4EA 2YQZA 1B6GA 3JR7A 1BGWA 4M9XA 1ZGHA 5JDCA 1VE1A 2WSSD 1XDBA 4CKCA 2PIAA 1MB9A 2G0AA 1Z75A 4OHCA 1E9EA 2E0IA 1YVEI 4F93B 4MMYB 1KJNA 4YV1A 3V8EA 4R9NA 3I0ZA 3NRBA 2IEIA 4KJZA 3L0PA 3W90A 1U2GA 2JLAA 4OUDB 1M34A 4CCSA 2AGVA 2ID7A 2GM5A 2GT1A 2OUIA 2QTCA 3BIWA 4DLYA 3OLVA 1C9YA 3ICOA 4FNAA 3MWKA 4CV0A 1DRUA 2WILA 4JOCA 1MABB 5EZSA 1RYMA 1XDWA 2O2XA 1XX6A 5KQRA 2PFGA 2Y6UA 3O8OB 5EE1A 4IIFA 1O5TA 3I5UA 2F17A 1GXSA 3PX7A 1MBZA 2Y0DA 5EWLB 2GYVA 1TVKA 1RE1A 2WIJA 4X1OA 3ZQKA 4P3OA 1CUDA 5CLHA 4K9KA 4NCIA 4J16C 5ESDA 3GRZA 1R9MA 3DBRA 2GAOA 1NW6A 4M6WA 3JATB 2QUHA 4RVOA 4QBHA 3RVJA 3G8AA 1Z63A 2QEQA 1Y82A 4J1SA 4N8SA 2ZBFA 4RHFA 5BYAA 5EJ6A 4ZCMA 3B5EA 4OGKA 4ARVA 1V9CA 1E9AA 1Y4DE 3H5AA 4QL3A 1C29B 1DRJA 5JWOA 2QG4A 2Q6TA 4PG5A 1R4AA 2BC9A 1BKSB 2P2NA 4Q4JA 1P33A 1BH2A 2G5TA 2XDQB 2ZJOA 3L8CA 3NM4A 3HLYA 5JNTA 1JA0A 5JMTA 3C5EA 3IE1A 1L6RA 1WQ3A 3PTLA 1NN3A 4GE0A 4MGIR 3PZRA 3RT7A 4C4SA 2YNMD 2XE7A 5FJJA 3DAYA 3VDXA 1C1DA 1KPIA 3OU2A 4Z6KA 1O9BA 2FEOA 4MR9B 1D7AA 1H2AS 1PKEA 2FWAA 2H51A 2KBFA 5BSTA 4QUJA 4RETA 3MC1A 4DAEA 3Q41A 3SFTA 1LJ8A 1KC3A 4LTNA 3JD0A 4C7MA 2HMVA 3DCNA 4QOEA 4H9GA 3VNQA 1MHTA 4OQFA 1ECJA 4YT2A 3UM9A 1MABA 4MX8A 1M33A 2QTMA 1NFRA 1SHZA 1E4OA 2B1QA 4LE1A 4HV4A 1QP0A 2ID9A 2O0HA 1N8KA 2E4YA 5EG5A 1X7GA 5D01A 5P21A 4Z54A 5KCZA 4G0QA 4UBMA 3K70B 3G0BA 1JXQA 2Y4OA 5DP1A 1JSRA 3UMBA 1YQGA 3CLKA 3OTQA 4YCMA 2Q8QA 3AEXA 2OY0A 1E0SA 1TECE 2C99A 1GPUA 2CGEA 4BP3A 4Y67A 3SHQA 2ZANA 4M9UA 4PZAA 4Z4QA 1FOEB 1C7FA 3ZJ4A 5KJ6A 3AHCA 1Z7WA 3FCUB 1TT7A 3OMWA 3RUDA 4BWFB 2HT1A 2BGTA 2DT5A 1SCKA 2ZRMA 3IDZA 5EIWA 1CQIA 3NDPA 3QVOA 4EPRA 1YS4A 2EW8A 1KFJB 1AY0A 1M2KA 4HCJA 1RM4A 1L4GA 3GJSA 2ZUTA 4FX5A 5H9WA 1SHTX 2BF7A 1CUUA 2Q3FA 4REQB 2P5SA 5L6MB 4WESB 3GROA 3QPUA 4OJYA 1YB2A 3C5WP 3MJDA 4EK9A 1GUYA 3CUUA 1TADA 2R1VB 3GDFA 3RVRA 3GI1A 3TLGB 1FSZA 1H4SA 1GGEA 2Z58A 2AV6A 4EITA 2VAXA 4KV9A 3VHXA 2YOFA 2QZ9A 2V5AA 1N8TA 1KERA 3AI2A 3ECAA 5H5JA 1GITA 5ARBA 1ZUNB 3ADCA 2JI8A 3FUXA 3RADC 3M1LA 1JR2A 4FYHA 4R8RA 4E0BA 4IGKA 3RSLA 4NHEA 1J6UA 4I4TB 1A7UA 2OGZA 2IHJA 2A9PA 4DGSA 1UAYA 3M82A 4FFNA 4GRDA 1GAXA 2FN9A 5ALPA 3L07A 4XPIB 4WSOA 2H1VA 4LOJA 1U90A 1Q1AA 1GT91 1NATA 1NPYA 3I2JA 4B73A 1QIGA 4WBXC 2R79A 3RD5A 2GCNA 1ODFA 2DGDA 2YJGA 3DC2A 1RKVA 1YQWA 5BR1A 4RDXA 1TF7A 4LY9A 2IP1A 3THXA 4DMRA 4CKXA 2ZE8A 5FBKA 1MT3A 1Z9BA 3I3OA 4XEUA 1VKJA 4Q1AA 4EB0A 2WFZA 3FZNA 4UBKA 1M6HA 2HJVA 4IVNA 3KZKA 3EQ7A 4F46A 1S2DA 2YXDA 4IOMA 2IYEA 2QG6A 1E9RA 1BIFA 3DKVA 3UXEA 2HR1A 4HH4A 4NABA 4YRBA 2Q5IA 3G1UA 5JY6A 1PJ4A 1IY8A 1HO3A 1OYYA 2I33A 4EABA 2XCRB 5AI4A 1U9IC 4XKJA 4NBRA 4F7WA 3RARA 2J6CA 1OXUA 3NBAA 3L9XA 3PBKA 2J3EA 5T4EA 4IKEA 5AVJA 4IG9A 4BDSA 4DMLA 5HKKD 1DEAA 3BE6A 1D6SA 4WZAB 2WMDA 1QU2A 2G8LA 4EA9A 5JS6A 3JWJA 4QDXA 4DLLA 1A4XA 3HFJA 3E2MA 1U7ZA 4YRDA 4KBGA 2GRAA 2CYCA 4JGIA 4NFLA 4KYTA 3AJ8A 3BB4A 1GNQA 2XMRA 3VH1A 4YUAA 4XPIA 3OIWA 4WNYA 2JAUA 1IK6A 1XP8A 3R5HA 1VA5A 4Q5IA 3BCHA 1MX1A 4IR7A 2GK6A 3ADPA 5KNCA 1IHOA 5ADVA 1W46A 4H17A 3HZOA 2WJHA 2CMGA 2I4OA 3OEWA 2UKDA 4K6FA 4QSHA 2EBFX 3EB9A 3A6DA 3WV5A 2OFOA 5F2NA 1XWFA 4LC0A 3QP9A 1G2QA 3BHMA 2ZYWX 4C7JA 2RC6A 3S70A 1AOXA 3VO1A 3ZVMA 3E9MA 3OM1A 1XKTA 3NANA 4BFTA 3PIRA 4FHCA 1NN1A 1KY3A 4IDCA 4PSDA 2Q46A 4QKQA 3H5LA 1OLOA 1M2FA 2V7PA 5AUOB 3LGSA 4C0BA 2IXGA 2I9KA 2RCNA 1IPFA 2ZT8A 2VH1A 1G5IA 1PEDA 3VR4H 3ZIAA 4A9AA 3OA0A 3VM6A 5EPUA 3DNMA 3F6SA 3W1EA 3AUUA 1SC6A 3N7AA 2I65A 5SY6A 5IYZB 1UCFA 4ZK6A 4LW8A 5IUJC 1P2VA 4ASUD 1L5ZA 2V03A 1YOVB 1YAJA 1NR1A 1HKHA 4H7EA 4OK6A 1AMOA 4RW0A 2DBYA 4WKGA 4P6VF 3SC2A 4W5RA 1AHIA 3ADDA 1PT9A 4FYVA 4QODA 3M6UA 4YHHB 2VP2A 4G01B 4MICA 4FHZA 1SRQA 1BE6A 1OA0A 1EFPB 1JV2B 2ZSKA 2YZ2A 4YX9A 2TECE 1WD7A 3CUTA 2QW8A 3L0ZA 1BGXT 4EENA 1VMDA 2VQFB 3WIUA 4NI5A 3GZTB 4EA8A 3D5QA 3QH4A 4X85A 1X8LA 3OPYB 1D0IA 3UK7A 1PP4A 4ZICA 1MX3A 1T4CB 1NF3A 2NUPA 1AZWA 1UIMA 4KPUA 3IP5A 6YASA 4S3MA 1F6BA 1PN3A 4U2GA 1P3Y1 3RYFA 3VR2A 1W1WA 4RZ3A 5D3MB 4GQIA 4U7PB 1B4DA 2P11A 2VJYA 2BZ0A 3OLWA 4NEGA 1XFAA 2CZQA 4Z0PA 3TLGA 1Z6PA 2YXEA 4GI3A 2BKAA 5A62A 2YJ6A 3DA8A 2FMUA 3IVAA 4TL6A 3AKYA 1KFKB 3B6EA 5JNSA 3DJFA 4Q48A 5BN4A 1XZAA 1YBHA 4XLLA 3V32A 2Q3HA 4LYFA 4NMLA 3E58A 3BB3A 3A3PA 4J90A 1UJ6A 1JKFA 3KR2A 4HH3C 4QYTA 4PCUA 4DCVA 3WHKA 1U9IA 2O0JA 3NHKA 2CXTA 3WKAA 2Q3JA 3X43A 1DINA 2OAQ1 1BWPA 1KTVA 4H3KB 4WV3A 9MHTA 3H9UA 2PMEA 3VKWA 3VYSB 3OJOA 3TI7A 3NMUF 3RUPA 3AFOA 5JWHA 3KDSE 4F5YA 1SEPA 3NKFA 3BWXA 4NSNA 3QG1A 1UJ4A 1JECA 2BHTA 1QGUB 3KB1A 5FPYA 4QRHA 1T0BA 4YJ3F 3SJAA 1GDHA 4R2HA 1H9CA 3C5VA 2Q8PA 4R1MA 4Q15A 2ZWOA 5ALLA 3IAXA 5F51A 1XZHA 3TPZA 2VJMA 1KU6A 3AY6A 5K45A 4MVJH 1W0JA 1KYWA 3ZZMA 1BSVA 1AK1A 4QG3A 1ODJA 3GCZA 3I5YA 1H2HA 2Y66A 3ABOB 4NJMB 2O8DA 4YQYA 2R7LA 4GXTA 4B2PA 1F14A 2AF3C 3M7IA 3DVQX 3OCCA 2HTFA 2XGMA 1LEHA 2RBKA 2RHOA 4G5HA 2FPMA 4EGQA 3VR3D 1HETA 3WB1A 3C85A 5IKPA 4BMSA 3MBKA 2C2XA 1M54A 1XALA 3NX4A 3KKPA 1K8QA 3QXHA 3HDTA 3FY4A 2X15A 4O1IA 1ZLYA 1T5LA 3OETA 2BFEA 3FNHA 3SX2A 5K0FA 3ZZ1A 3E7WA 3BL5A 2EKLA 3TZQA 4JR0A 5JH7A 2OGSA 5J23A 1Q92A 1DTEA 3GLUA 1NUHA 5HDBB 5K0NA 1HGXA 3O4HA 3HS3A 4CM8B 4F56A 2TMKA 2E5LB 5A71A 3DLIA 4KAJA 2E2WA 3NLLA 4LSZA 4RH1A 1JTEA 2H7YA 1Z35A 5TMEA 2X0EA 2GAAA 1DKQA 2FZLA 3LBNA 2R25B 5IDYA 3GGCA 3UFBA 3X1YA 3NIBA 3QPBA 1Z2OX 2XA2A 4QGFA 2HMTA 1WX1A 1W52X 1N8NA 3UMSA 4X7MA 3W5IA 3N59A 5IU6A 4V1CB 4R81A 1JYFA 5GGXA 4EG8A 1YRLA 2GN8A 4WCFC 3ZTTA 5JVDA 2OC4A 1TA4A 2OAP1 3GJ8A 3P9CA 4EDHA 1IHDA 2FW1A 3SXPA 2IZ1A 4QEKA 5T3YA 3KPYA 5KTPA 4XR9A 5AKGA 3WNVA 5BW4A 3A11A 2EDAA 2AMJA 2BKXA 4KSBA 3TQHA 1DIRA 4YV0A 2WZDA 4K9PA 5EMLA 4CU5A 1A5BB 4YRCA 5EFOA 2C2WA 3LUGA 2WP0A 1QIFA 5ECYA 4DBLC 5IANA 3AEUB 1MO6A 1XCMA 1DNPA 3UUGA 2B82A 1PFKA 3H4MA 2HJ9A 3EC1A 3AHIA 3K9NA 1ZMXA 2GZHA 3DTVD 4LNHA 3EJWA 2G63A 4Y6GB 1NX6A 5FB3A 3VV3A 4K6MA 2O1EA 3OQHA 3I5XA 1N6HA 3EPKA 4H77A 4JXZA 4QTXA 3QOWA 3NVMB 3F3KA 1DC7A 3TZBA 1DAHA 2O0LA 1KMIY 2E21A 3A70A 3E9YA 3FKQA 2AD1A 1SUPA 1U8AA 2PT7A 4OMDA 5CURA 4BC1A 4M9QA 1FL9A 2GZDA 3AXTA 2AT1A 3HHEA 1Z0KA 4P83A 5ALKA 3G8CA 5EUCA 3WGQA 1YU6A 4IIUA 3DBHA 2X0DA 3HM2A 1SUFA 1RKBA 4LGCA 2QL9A 2VDNB 3HB0A 2E4AA 4GGMX 1DKRA 2OHHA 1A4UA 1J22A 3EK2A 5FTNA 1KZHA 3G02A 4PXAA 4QU8A 4BFLA 4DT1A 1W5EA 4HAYA 4QASA 1G5RA 1WTCA 1E2DA 2ZQZA 4FIDA 3QF4A 3F96A 1K75A 4FKMA 4X1IA 1UANA 5I8WA 1E6UA 2AC2A 3MTDA 4FNOA 1JDSA 5CAEB 1ZISA 1HL3A 3AQ4A 1OTXA 4DS3A 3KKMA 1EQUA 4E2FA 5HX7A 2DLDA 721PA 3OJWA 1H1DA 2OZKA 1PD0A 5ERXA 1Y80A 3OMXA 1WBBA 4JI7B 4BO5A 3RVDA 3DAGA 3QLJA 1FP4A 3UT0A 2SHKA 4Q19A 3H5IA 5JCOC 3MWFA 4HNUA 3CRRA 3M4ZA 3T7EA 3K6JA 2ZTVA 3IALA 3LPMA 3PWZA 5JJCA 3OQPA 4OB7A 3H2YA 2HEGA 2WHPA 4JUAA 3ZQUA 4CDGA 5F7OA 3DH0A 3Q11A 1O97C 4BX8A 2X9QA 3HI4A 3K72B 1PV4A 3NTRA 3MSCA 4Y9DA 1VHTA 1CSEE 3D9QX 2IV2X 3A2MA 3IKJA 3FTPA 2QGNA 4R68A 1GPLA 1FDOA 2IVZA 1BRTA 1L4LA 3LPLA 3P0FA 1CQJA 4QVGA 2BM8A 2J7PD 5KJ1A 1CLUA 2QAGA 5KYGA 2FR8C 3W5UA 5TIIA 2VYVD 2P35A 2ZP1A 3I09A 4JQSA 5TJHA 3R23A 4MGHA 3I8OA 1TLFA 5JWRA 2LXNA 2RHGB 4R83A 1SEVA 1XMIA 1NU6A 1ZCZA 2X5NA 1ZK2A 2G3YA 2WJWA 1H3NA 2R4UA 4J4HA 4S1OA 3GFTA 2GA8A 1O1YA 1J2EA 4KX5A 2OTCA 4QDOA 2O5RA 4B71A 3BD7A 4UHFA 2GO1A 1WY5A 4Y8VA 4F06A 3WYBA 1XJCA 3QA9A 1A8IA 1PD1A 5K0TA 1PR5A 4AMUA 2G1PA 1CY1A 1XLWA 4F72A 1LVHA 3AR4A 2VK8A 2FDXA 4TLDA 5CH8A 1URPA 4K87A 5FUXA 2HV8A 2WM8A 5HNKA 2OBYA 1WF3A 3A06A 2VKQA 3AIMA 4PFJA 4ACBA 1DC8A 1PIWA 3OZTA 4CIBA 4JGGA 1N5MA 3EMBA 2PIDA 4G6ZA 4ID3A 5CNIA 5M3BA 3ZIUA 4C87A 4DSAA 4GNKA 2Z09A 3EVAA 4FMDF 3GRPA 3PUIA 4XFKA 5A6SB 1QO7A 4LC9A 1TK9A 3IURA 2JAQA 4MS1B 4YLEA 3PFHA 2HPZA 3JWEA 4MKGA 5IVDA 5JD6A 4DTIA 5AW6A 1JE1A 3EYWA 1U1DA 2EF1A 1C50A 1BE0A 1QKIA 1Y81A 2FZ5A 1UXIA 2R11A 5CT6A 1UBLS 2FZEA 3TIFA 5HIAA 4JWTA 1PS9A 5IC5A 3TL3A 4JLUA 5CFPA 1N2BA 4PICA 5DW0A 1KH3A 3EVZA 1Y1KE 4JYBA 3FUTA 3C7DB 2IH2A 3ZQ6A 2IGTA 4FEEA 2IA5A 5JVDB 1LLUA 4GYWA 4A2PA 1U2PA 4HGQA 4YQZA 4ZALA 3V2IA 2JFXA 3JSAA 3EH1A 2EJBA 4HDNA 1YHNA 2BFNA 3FYUB 4OB6A 2FRDC 4IINA 2AWNA 1PYGA 4E12A 4KNYA 5CT9A 3KVOA 4KV7A 4JELA 5JCJA 3E18A 4MAFA 5G53C 3YASA 3FPHA 4XQCA 3RSZA 4M8LA 3S8EA 1G5TA 4DE5A 1WKBA 1HSOA 3MTIA 4Y2PA 5CEFA 4GYJA 2A59A 1RPNA 4HWSA 5HRCA 3PQEA 3L6RA 5BUQA 4NZYA 1WXGA 3BMCB 1JH9A 3HVIA 2F9FA 3GLFE 1Z7BA 1HE4A 2Y3IA 3GUYA 4XLTA 1LW6E 1N2CA 4MLDA 3UATA 1E4EB 3FDXA 1L3IA 2GR9A 4F2DA 5AQ1A 5AH0A 2F00A 1CIJA 1CUCA 4D8YA 2QN8A 3V97A 4GKJB 3A1DA 4RIHA 3CW9A 4WGGA 5DXAA 2FFAA 3FYDA 5CK5A 1LLCA 4RXUA 4UBJA 1FUUA 1KK2A 5H80A 1K8XB 3WMFA 1V8ZA 3CCCA 4FI3C 1BXZA 3VNAA 2AFIA 3D8UA 4KR0A 3TLXA 2IYZA 2I3DA 2KI5A 3KTAB 1MKYA 4PINA 1T3SA 2POQX 4EG4A 1N7HA 3SHVA 4IFTA 1EP1B 2HBZA 3HYRA 1E60A 3BMQB 1H65A 1QK4A 3D4PA 5HCNA 2PGIA 3KALA 4Z4GA 3DFMA 1OC2A 2K87A 4QQRA 5IK2A 4CR8A 2QUKA 4J9UE 3LE8A 4J49A 3UAXA 1M67A 4ZQIA 3KXDA 1BFUA 4IDHA 4J7CA 4KBYA 2V9CA 4BNDA 3QE4A 1W0JD 4H1HA 2BTEA 3E0XA 3KE8A 4KDEA 2CYAA 1NW8A 1XRJA 3SNKA 2QM7A 4LMRA 3J7AC 3B9PA 3CRMA 1G20A 2J0UA 3QNUA 4MVJA 1R8XA 1QGZA 4KFRA 5J63A 4BJHB 2FGKA 2NLOA 1LDGA 2X0RA 4F12A 1UMDB 2OB1A 3I39X 3ZGXA 4P8RA 4XWYA 3T15A 2QX8A 2YWHA 4OX9Y 2P6MA 1N5KA 1BDMA 4DHEA 5EZQA 2VTEA 2HSDA 1QDLB 1YE5A 3G8YA 4X20A 3UHJA 3OA2A 4US1R 3DO8A 4B33A 1KZ6A 2QYSA 3K0EA 4I0WB 5LQNA 2TS1A 3HNPA 4EMUA 2O8FB 1F0YA 4TWBA 3NWPA 1SBTA 1NVDA 3P20A 1W36B 4FFMA 3EBLA 2H2DA 4PG8A 1Z83A 4PYJA 4O4IF 1TTPB 1JZQA 3IELA 2QN6A 1TA0A 1I4OA 4DA4A 1TCVA 2BGUA 4PLYA 3EW7A 4UTXA 1ODLA 5CLGA 3SM3A 3T7CA 3WXBA 1OIXA 2JD1A 3FTCA 3HGQA 1DXQA 2P5TB 1E3QA 4OMUA 5CYFA 1V7QA 4YP7A 3DMTC 5E4YA 4D9KA 4Q3CA 2XTNA 4NCAA 2IJGX 1TVEA 3RH0A 4A10A 1C1YA 1IIBA 4OAOA 2R7MA 1XU9A 1O97D 4INPA 4XI9A 1UT5A 4AYXA 1E2HA 4FT4A 3U80A 3SLKA 4G5SA 3FKJA 1COWD 4O25A 4M0FA 1JL3A 4BECA 3AZOA 2VZ9A 2YJ3A 1BZYA 1ECFA 3NH6A 1YA4A 3SR0A 4TOIA 4PQEA 2ZRHA 3COVA 4RPGA 2PXAA 5ALDA 4D6XA 3KZCA 2A9OA 1A8HA 4FDVA 3Q3EA 4OFZA 1QM5A 2IELA 2ZVJA 3ICEA 1QRSA 1GUBA 3BMXA 1TT5B 2FG5A 3NWBA 2HGZA 1LDNA 1P2GA 3AI7A 4Q7MB 4W1RA 1HLGA 5FI5A 1RYBA 1NNUA 4ETWA 3DTVA 3NNSA 3C1OA 4V02A 1EIZA 1RZVA 2R1TA 1R2QA 1YQDA 3NUQA 3ZWCA 4FM9A 1DOHA 5D6NA 1Q15A 3AUXA 4EY7A 3Q3VA 4IF4A 1JX6A 2PX2A 4ME6A 3QX9A 4KWHA 4RVGA 3U5ZB 3DEIA 4NXMB 3IPRA 4YQEA 4D80A 3WGTA 2H54A 1IEXA 3KAPA 2CXNA 3P32A 4LDZA 1JFFB 4GIBA 2I3BA 5LJIA 4E2WA 1CJSA 1ZN8A 1T3ZA 2GDJA 3GLGA 4WE3A 2XB9A 4NV0A 5BR8B 3GZ4A 5EZYA 4L57A 1XMOB 1FF9A 1LV7A 1TW2A 2HF7A 3OT1B 4Z1MD 4BO6A 3IHLA 4RSHA 1H1LB 2ZR7A 4O2AF 1IL0A 3QEJA 4UBNA 5EWMB 4W7HA 4ZXFA 1T6BY 5DBFA 1WPQA 3L8YA 2VJLA 3PRKE 4FE7A 3VJLA 1W8DA 2X23A 4H0CA 4HLCA 4OQEA 2AW3A 3TSZA 4YHBA 2BR5A 3GNQA 2WF5A 4QATA 1HNNA 2B1RA 2GYUA 1C9DB 2OCLA 2CL0X 4QYSA 4BNGA 4EYEA 3TSOA 3AILA 1LUAA 4GMHA 3I76A 4QYMA 2ZJ2A 2DKNA 4WN9A 1UFKA 4QDZA 4Q1CA 5DGIA 4LJKA 4RLHA 3T1HB 3WL6A 5JYDA 2WW8A 2HBQA 1LSJA 1TUEA 4MRMA 5A5VA 2AOUB 5DNEA 1N25A 2I1VB 2FLVA 2ACWA 2C2YA 2J31A 3LFTA 5A4MS 1MAVA 1RAFA 1Z0ZA 3P9QA 2G1UA 3AGPA 4DY4A 1GQFA 1U2SA 2JGAA 3B7GA 4BMOB 1NPTO 4N7JA 3OQOA 3E84A 2XWPA 5BYJA 5GQSA 4MKHA 4E5DA 1SU7A 1XVTA 3ENVA 4D4LA 2Z8YA 1G0NA 4MVJG 3A31A 1BHJA 5AK0A 2Q4BA 1VM6A 4GX1A 4HG2A 3MJCA 1HH4A 2XIJA 3AETA 1KIMA 1V16B 4MHTA 3ROGA 2FPXA 3LVRE 5BWLA 1NN0A 2P91A 3OEEA 4B84A 2BKUA 2UZ1B 4W1SA 2JJ2A 5E9AA 4DUPA 3VA7A 1N5LA 3W5SA 2UXBB 2PEYA 4GZ3A 4PGGA 4R7GA 1UPXA 3QA3E 3Q1KA 4Q9KA 4EHJA 4EPTA 3GEBA 3JQ6A 5DU2A 1PZXA 1AN0A 3AONB 2I8AA 1Y6RA 5DMXA 1D4ZA 3AERB 2PA3A 4YFVA 1Z5ZA 2G06A 3HYCA 3NIDB 3IUMA 3M5PA 1ZCFA 3P4YA 1F8XA 2ZTUA 5JCZA 2E5WA 5K3BA 4PQRA 3N8DA 2IGBA 4DRXB 2V3WA 4MQMA 1GNVA 1PJ8A 2BPOA 2VF4X 4FN4A 3GFOA 4TUYF 2IXAA 2J7PA 5CPFA 5JNVA 3L8GA 1U2DC 4PLVA 2GBIA 1PNRA 3ZDAA 4BX9A 3DM9B 5CVCA 2BJWA 3EIUA 1Q6ZA 3ZJTA 4B7AA 1PFWA 4R0VA 3SY8A 2I54A 3M9WA 1FQJA 2EFCB 2KMLA 1MEEA 3LHKA 3NHPA 4POOA 2NT4A 3SVTA 2HTEA 1A4IA 1TM4E 1BHSA 3DBVO 4LZAA 1G291 4MQ4A 1RKXA 4RJKA 4FWTA 1OROA 4X8OA 5JBNA 4BJ1A 1P1JA 4KXLA 1CS0A 4JJ8A 3Q72A 2ATCA 2UYOA 4XE5A 5DLPA 3EGEA 4ESHA 3HB4X 4YRJA 2LR0A 5NULA 3ICQB 2PMWB 4HEJA 5DOVA 4CT0A 3WSVA 3ZYCA 1VIMA 2RH9B 1L5LA 4AJOA 2E48A 3FHTA 1W0CA 4FNGA 3VO2A 4AN0A 1Q1BA 3CW2A 5CDUA 3OU6A 5AI9A 4LHEA 3AOEC 3AEUA 4KZKA 1V3UA 2P67A 3P9XA 3PHLA 2PX6A 4RQUA 3ROXA 4B6FA 4J76A 3GRVA 4PLHA 2G1AA 1PWZA 1CZUA 2I80A 2WNHA 2F9MA 5CB0A 4JD5A 2YDXA 1BKYA 4I1SA 4LS3A 3UPDA 1ZL0A 3VPSA 3IH5A 1IAVA 1ZG3A 3LCJA 1C1XA 3A32A 3MGKA 3LMKA 4MWEA 2IYSA 4Y3UA 5DXJA 3T61A 4I1YA 2NZVG 2CHVA 1EG2A 2XOXA 3DXXA 2VBFA 4G8DA 5D5QA 4G0VA 1YJ8A 1OCEA 1RKUA 2FUG6 4R51A 1ADFA 3K3PA 3P9KA 2N46A 4XUGB 1F5NA 4DR1B 4R2JA 3DDHA 1UF9A 1I4LD 3BTOA 4I3HA 1QPGA 3GOQA 3H5NA 1KI6A 2EDCA 2YUTA 4PM4A 1DO0A 2NU6B 4WOCA 3R9KA 1KSFX 2WU1A 3ABSB 4ZI7A 5K4HA 4XOIA 3NR2A 1GZHB 5C1DA 2DWQA 3CNBA 1N1EA 3KKLA 1ZUHA 1JP7A 2OR3A 1O96A 5EWMA 3OUZA 1KIAA 7ABPA 3L6BA 3JRWA 2OYRA 3EEIA 4B6GA 1A71A 2FW7A 1IFXA 3CT6A 2GPTA 4G07A 1SU6A 1ZNYA 1K9SA 3A4VA 2ARKA 1XPOA 1V1JA 3CXRA 1XD2B 4PFQA 1GL6A 3VXKA 3V4FA 2C3YA 3VYWA 3C3JA 2PZEA 3SOPA 4ZCRA 4ZCSA 3GV0A 5JH7F 3ITEA 1EVZA 1RU3A 1X86B 1ZESA 2WHPB 3HCDA 5DX0A 2BEUB 2C2ZA 3A3YA 4RVHA 2VA9A 3IAHA 4WTOA 3VU8A 5KMGA 1RXEA 4CDRA 3N6XA 5DNUA 4MVJI 2H0QA 2ZIWB 3S6JA 4NARA 1NP6A 3RODA 4BNIA 1QQ5A 5C1OA 2C92A 4FI3F 2P1ZA 4L5AA 4DQLA 1V6AA 5BQXA 2YX1A 1KJWA 2N47A 5D1NA 1M6EX 2XVZA 1N0UA 3RVOA 1XCJA 4I2NA 1PL6A 1ZCAA 1EK0A 3LHDA 4KQMA 1EM8B 2C31A 5CA0A 4D5EA 1TJNA 3QE3A 1C4WA 1JU4A 1V5EA 4YYZA 1NASA 4M0EA 5EQJB 5DI3B 3K15A 1FFAA 2CXXA 3EZ9A 4JLOA 3V9PA 3QXGA 4QA9A 4B9EA 2QM0A 1S2NA 2PKQO 4MO2A 3RIXA 3UYLA 5K3FB 2UVDA 1ZVJA 2IK8A 2K4MA 3MFQA 1OWOA 3Q40A 3LJKA 1G4AE 2X22A 2Z1DA 4MVJD 2AF4C 4W9MC 1LX6A 1ZSVA 3PLAE 2WKRA 2VJDA 4RBNA 4HEQA 4LZPA 3ZUGA 1V16A 1I4TD 2FQ1A 1X87A 1MX5A 1EUQA 2OHXA 3TOXA 1BXRA 3K0AB 4UMVA 4ZU1X 4LX8A 1YZYA 4LWPA 1DKNA 2WTAA 5ITZA 1IY2A 4OGFA 1JAXA 3ON5A 5ECGC 1LF0A 4IEIA 1TT5A 4S0XA 3H2ZA 1O89A 3AIIA 3TSWA 1S4QA 1EE2A 2OD7A 1HLPA 1B8UA 4LNAA 2YWRA 3PNBA 4FUQA 1A5TA 3DEZA 3P0EA 5AVQA 4JX9A 2H65A 3W8FA 4B0PA 2BD0A 3NGLA 4D46A 1HFEL 5K3EA 5KQSA 1H2BA 3M49A 4AQ7A 4ZT7A 1P2TA 4CL2A 2UZ3A 5BQPA 4QTYA 1CJBA 3GFVA 1U7TA 1E2LA 2NU6A 2OPHA 3S7ZA 4S05A 4E6EA 2GZMA 2V65A 1GNLA 3ESZA 1FTGA 4WY8A 3AUTA 2PYDA 5C52B 3AKZA 1GL7A 1IZ9A 4C3ZA 2WP8J 5ER9A 4C7KA 2WRZA 3HFGA 4QWMA 3GEGA 3O8DA 4C5AA 4GVXA 4A91A 2AXPA 1Z88A 3TTWA 2W7TA 4ISBA 2YJ4A 3AIOA 3GJRA 1UDCA 2QZJA 4I1VA 3NBXX 5EYPB 3RSCA 2XNDA 5JZVA 2OVFA 3U4QA 3D0RA 3RABA 2A33A 4CKBA 3AHJA 2EFGA 5K9ZA 3BH0A 4J8PA 4XD7D 3Q6IA 1QV7A 3CKKA 4PXYA 3NHYA 2HK8A 1I36A 5KYWB 1USVA 2P69A 2GCGA 1P91A 2FSFA 2I1LA 1PWXA 3FSRA 4PLWA 4U00A 3RJ5A 2O0KA 4F5EA 2DEUA 4E4TA 3GA0A 5IUNC 2KLBA 4KXQA 4ER0A 1JR3E 3MUOA 1C8VB 3T38A 1G8HA 4GOKA 4IQGA 2Z9BA 4BMNA 2D74A 3OO0A 3MIIA 2EWVA 3H5VA 1HA3A 3EZYA 1QK5A 1JSXA 3S44A 2EP7A 1B1AA 1D4FA 2OHFA 3KELA 4RFLA 5FV7A 3V6MA 5EJ7A 1U0OC 3O9MA 4NZPA 3DE1X 4M0CA 2R8RA 4ENVA 3BWDD 4MWOA 2ZETA 1TMKA 2ZS7A 2OCKA 2IRWA 2KYRA 1XCPA 3ZHSA 1F0PA 3V00A 4BNYA 3KQNA 4ILKA 3TZHA 1IEQA 1SC4A 4B8WA 3ZGNA 3JAWA 4JY7A 2AC7A 2PQMA 5HOEA 1JEOA 1SG0A 1XC7A 4YRQA 1NVFA 4BCBA 2NQTA 5G0WA 4IO1A 4CM5A 1GO2A 1RS0A 5G02A 2D13A 3UMYA 2CLCX 4KVAA 3OIGA 2IYAA 2YOGA 3QPCA 2C2BA 1OZAA 4LBVA 4D25A 3ZEIA 4R84A 1NULA 2QPLA 4PW0A 5K0LA 1DAFA 2XYQA 3VNVA 5CA1A 5HVNA 4MW0A 2VIIA 5HJ5A 1YUBA 3GCXA 1E2JA 2QU7A 3IUPA 2N1MA 4BJ3A 1GGMA 1EGAA 5FXMA 1PQYA 2V1UA 2FA9A 1USWA 5E8JA 4FCTA 2ZTHA 2GXAA 3ISTA 2XMQA 3GARA 2J5XA 5HFAA 3KBBA 2REBA 4E5NA 2DPHA 3ZW8A 4WIAA 5E9JA 2VLBA 4XB2A 4ZQHA 4BKMA 4X92A 4AWAA 2HA3A 1LXCA 2E18A 3AUYA 2OO5A 3GQVA 4KHZA 3ZWQA 1VE6A 2V7BA 1LS6A 3ER9A 1Y5IA 1YZLA 5IVPA 2HXYA 4CEHB 4EEZA 1Y7IA 1HMYA 2BFOA 1NUUA 4P3PA 1IJFA 3DZKA 2CFTA 1GV0A 1MQ8B 2ANBA 5DWDA 3QYPA 2E4VA 3JQGA 4ZQGA 3ZWNA 2ZJ5A 3CIFA 3NS7A 4LXIA 3ZXIA 4NDAA 1Z5NA 3ORHA 1CR2A 3ACCA 2NSDA 2Q29A 3ZPXA 3K9QO 3JYQA 1HOTA 4BU0A 4ZIRB 4NCKA 3LP6A 4DWJA 1RWPA 2CJFA 2V74B 4FYYA 5TQ0A 2PNJA 1EFPA 3PCXA 4KDCA 1SCJA 3EIQA 1DDGA 2MSNA 1DPFA 2BW0A 1MCZA 2JB9A 3QOYA 1C41A 2R66A 3LY5A 5T4BA 1ZM7A 1QUEA 4ND8B 3SLRA 1NMEA 2Q2VA 1GQQA 3PTZA 4JROA 3SE0A 5J4YA 4ZHQF 3VTKA 1PG5A 1IUOA 4LJSA 4TT3D 3G3EA 3I42A 1QGAA 4LWZA 2PU7A 2IPAB 3HU3A 4ARZB 2QTVB 3WL5A 1MZVA 2JFGA 3BWCA 1C80A 4FDUA 2PSEA 4EY4A 1HZZC 1ST3A 2C4WA 3CB2A 1ADBA 5B37A 3X2FA 1XMSA 2SKCA 4CHGA 4FDAA 3HWX1 2XVAA 2FUKA 1PK8A 1SURA 3NI2A 4G86A 1PYOA 1XCGB 1ZVKA 4IIHA 5DM70 4P22A 2ADMA 1PNTA 2FQQA 1RJ9A 2FSPA 3I9V6 1BFDA 3O83A 4KGVA 4XIFA 1XN1A 3PEFA 4ZAWA 4N8EA 3ENQA 1EFHA 1YVUA 3N2KA 5FP0A 5KKNB 4RKWA 2J67A 1JKJB 4E4YA 4ENSA 2PGLA 1GCIA 1R37A 1E6EA 2OCGA 3GMDA 3L7MA 5TGDA 3FOFC 2CV0A 1NVEA 2NUBA 2WD7B 3VH4A 4IIDA 2FEKA 4KH0A 3SC3A 5IDWA 1DCTA 3ZHZA 3AL0C 3FKSD 2QE7D 1MNQA 2A86A 3BRSA 1CDDA 3DV2A 2Z3VA 3B3QA 3ESYA 4EG6A 4Y2RA 4U0JA 1RJFA 5FO0A 5HEKA 3M33A 3DBOB 3BMNB 3LC0A 4JJGA 4RXMA 4YP1A 2H18A 2DH5A 4ASUA 3K8ZA 4L3OA 2ANCA 1Y6QA 4AJKA 1EHYA 1HDIA 2BMFA 4ZV9A 2DJIA 4MSUA 4WPGA 2VBIA 2C1EA 4NRDA 3JQQA 3RRBA 1BX1A 2M6KA 1Q0LA 2F9LA 4INZA 4Q4HB 4EQ6B 5L7WA 4LJ7A 4K9RA 2Q0QA 1WHSB 4TKMA 2HM7A 4MW7A 5JU6A 3WWEA 1H05A 4BP1A 1JZTA 5KC8A 4ZODA 1TEVA 1DJPA 2QP9X 4G24A 3ZU6A 4D42A 2VAWA 2QVBA 1R6AA 3S1LA 3QUTA 1W4LA 1XL0A 3DL7A 1JXAA 1T4GA 3Q7IA 1BQ4A 1Y48E 1WB6A 2XT0A 4TZ6A 3GJXC 3N2EA 2YMQA 3OM0A 3RRYA 2CJXA 3IAEA 4IUYA 9GPBA 3T5BA 3MBIA 4LQCA 1HYEA 1VYHA 4HSEA 4HP8A 3UJ3X 4C4TA 1AHNA 2JGDA 3GLQA 5FNVB 3WRYC 4AX8A 2H9AA 3MLBA 3LXUX 5IHXA 4ITUA 1V4NA 2JLXA 1OT5A 3CVJA 2HAEA 1M1YB 1RZ3A 3NB0A 1CDEA 3HN2A 5L4LA 1I2AA 2UVQA 2W2PA 3GAFA 2WJYA 4U2DA 3T95A 3UAVA 3CKLA 1IN8A 2JIZA 4RTJA 1WAMA 2YHBA 2IXFA 1FXWA 4AC9A 1XQ6A 3OEYA 1EJ2A 2WIKA 3M3DA 1VE9A 4KKXB 2A0WA 3TRFA 2IS6A 1VPDA 4FMPA 5CFQA 2NV2B 5CG2A 3VYRB 8GPBA 1P4HA 4W1QA 4UZSA 4LMAA 4MEJA 5EN4A 1ZHOA 4C08A 1I7PA 3NHLA 1E0JA 3AKCA 1AKMA 4M83A 1CNFA 5EXPA 1HE1C 4CEJB 3W7BA 4OSEA 3LCRA 5AK5A 1KZ9A 1P7PA 2A9KA 3JD3A 3R44A 4J9VA 4MWGA 5KREA 1T2NA 3OE1A 3SEZA 1SQSA 1R27A 3IQZA 3CLVA 1JHAA 1GVHA 1U2ZA 2CW5A 3W8NA 3B3GA 2P75A 2M9MA 2YCBA 2G9RA 5C1BA 1O0BA 2OBNA 3FBWA 1PU2A 2XOKA 3QU5A 4OEHA 3PGLA 4E3ZA 3T5CA 2AZ4A 3IVXA 2PN1A 4G41A 1QKJA 4MQFA 1NRWA 1QJCA 4EO4A 1OZGA 2W6NA 3HYNA 5BMVA 1KYQA 3W8EA 2BBTA 1J5XA 3N0XA 3SKVA 1CW2B 2CK3D 1RJDA 1R4NB 1WKVA 2HF9A 2QMEA 4G4SO 4HC4A 4ZO8A 3RC3A 1Z4JA 3SJUA 2KX7A 4Q4DA 3T5MA 2C9OA 3UN1A 2J5RA 4X62B 2JHCA 4MQEB 1M74A 1WABA 3HXQA 3HH8A 2WWYA 1E1LA 4EGFA 3RREA 1EX9A 5EESA 5CEEA 5EKUA 3P0RA 3OZ7A 3F7NA 3SIWA 4NJEA 3W04A 2A4KA 5THKA 4EJSA 4MA4A 3VJRA 1V5IA 1GAEO 2OFFA 1TB4A 1OFTA 4K6GA 1LZKA 2REXB 4K6HA 3FPBA 3VPGA 2NZXA 2I34A 4JBHA 2EBWA 1M6VB 1ZJWA 1R5NA 4A8TA 2H08A 2OSBA 4ZJUA 1FFBA 1UK8A 4DADA 1D2AA 4ZANA 1WOYA 4KFTA 4QM7A 1XZIA 6ADHA 3AYZB 3S28A 2NU9A 1T5IA 1FLNA 3MRVA 4CIYA 1YRYE 5KSZA 1XTRA 2HEIA 4E03A 4LDNA 5LQKA 2JBAB 2YWBA 3OWXA 1EEXB 2QT0A 4M1YA 1D6NA 4QC2A 5ICSA 5LOVF 4HX2A 1FDIA 2FKAA 2IBSA 2OBBA 3K30A 4ONEA 3ETNA 3P9NA 1ZA1A 2ZBUA 4L50A 1KKLA 2UXCB 3DYIA 3QWFA 3VNRA 1QB8A 1PRYA 2ZI3A 3BMNA 3L7IA 1QG6A 5KJEA 1MRNA 4BFCA 1U7OA 2JLWA 2P1RA 1UP6A 5KTTA 2MR5A 4WN3A 3FAZA 3LFHA 4DA8A 4EHAA 1X74A 1ZO8A 1SG6A 1ZCBA 2V6MA 3K2EA 3PLRA 4U3JB 5DEIA 3BWMA 1GPBA 3TVYA 5T57A 3S81A 4LTMA 3LX8A 3W5CA 2BYTA 1II8A 1QFXA 4JI3B 4TYWA 2HZ7A 1JQDA 3WIBA 5KMGB 3IDQA 1CJMA 1ADJA 3WQHA 1K6XA 5HR5A 3SD7A 1H0KA 1UM9A 2BF4A 1W35A 3LTEA 4IGAA 4IGEA 4KL8S 4DLRA 3OM9A 1QCCA 4GX2A 3W78A 3VISA 1NVKA 2WZBA 3H1FA 1VL8A 1YR8A 1QPBA 1EB9A