3PFEA

Crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
471
structure length
471
Chain Sequence
b'GMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEHGYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEMSGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEESGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVHSGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYSEFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPPLVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDKPAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYVLYSFSQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
molecule tags Hydrolase
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
publication title Crystal structure of a M20A metallo peptidase (dapE, lpg0809) from Legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 A resolution
rcsb
total genus 137
structure length 471
sequence length 471
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pfeA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pfeA01
3B2YA 1M4LA 3CT9A 4ZY2A 2V8VA 7CPAA 4MHNA 4DYOA 3NA6A 2ZEOA 3FEEA 1H8LA 5JH9A 4P4BA 1ELLP 2QJ8A 1DTDA 1VIXA 2O53A 4W9YA 3B3VA 3ISXA 3FX6A 4MCQA 3S9LA 4NGQA 5HVHA 3H8EA 5K8PA 2Q43A 1ARLA 3TC8A 2BCOA 5JGFA 4NJQA 2FVGA 1CP6A 1Y7EA 5HVGA 1LOKA 4MXUA 4PPZA 3PB9X 3D7FA 1ZG8A 3LMSA 3KR4A 4FBEA 2ZOGA 1XFOA 3PFEA 3V38A 2PJ7A 2PIZA 3IEHA 1IGBA 2XEIA 4MCPA 4YWYA 4O23A 3NFZA 4OC0A 5LYDA 3FMCA 1PCAA 3KL9A 2JBJA 1CP7A 4UEEA 2PJ9A 3RZAA 2PJ4A 4IHMA 1LAMA 2JEWA 3PEIA 2HC9A 4OC1A 5ELYA 1AYEA 3I1UA 4X8IA 3D68A 4NFRA 3FVLA 3WABA 4R76A 2RFHA 4NGMA 2CTBA 4P4IA 4FAIA 5CBMA 1F2PA 5THWA 4KSIA 3FF3A 4NGRA 4ZX8A 1HDUA 3IO1A 1EE3P 3T8WA 2PJ5A 3KI9A 1ZLIA 4NGPA 3L2NA 1CPXA 4A39A 4PQAA 1IY7A 4ZX9A 1GYTA 1XRYA 2VL1A 1CPSA 4PXBA 2ZEGA 6CPAA 4ZYQA 2V8GA 1LCPA 2BOAA 2ZEDA 3NH4A 3DGVA 2PCUA 3KZWA 3MN8A 1CG2A 2PJ3A 4UEZA 1ZLHA 4F8ZA 5K8MA 2V77A 3BHXA 2XEFA 4P4EA 2POKA 1ZG7A 3BI0A 1ZG9A 1LANA 1YMEA 1TKHA 2CF4A 2CIJA 4MHZA 1FNOA 4EFDA 2GREA 3QNVA 4A37A 4UF4A 2ZEMA 5LRGA 3SI1A 2BO9A 5F09A 1XJOA 3NH5A 3N5FA 1AMPA 2DEAA 1CBXA 2V8DA 4TNUA 2QVPA 2G9DA 3PB4X 1Q7LA 1F57A 5LRJA 5K8NA 5CPAA 8CPAA 4MHYA 2V8HA 1R43A 2EK8A 4R6TA 2IQ6A 5DS0A 4P4DA 3D7DA 4ZI6A 3MRUA 2Q4ZA 1HDQA 2QYVA 3D67A 4JZ0A 4OMEA 4CPAA 1TF8A 4K3NA 2O4HA 5LYFA 1PYTB 5K8OA 2GU2A 3RBUA 4B6ZA 3D7HA 1NSAA 2HB6A 3FEDA 1TKJA 3KQXA 1F2OA 2F7VA 3KHZA 4ZY1A 2C6PA 2PJ0A 1VGYA 3D66A 1QQ9A 3VATA 4FUUA 4BD9A 2ZENA 2AFUA 2GLFA 4OC5A 4IAVA 2AFWA 3FH4A 1Z5RA 2ZEHA 2NSMA 3PFOA 4EWTA 1LFWA 2EK9A 2AFZA 5HVFA 3CDXA 2OOTA 1RTQA 3VH9A 4F9VA 4DUKA 3SJGA 3PB7X 3IWWA 3BXMA 2Q51A 3HLPA 1R3NA 2ZEPA 3ISZA 3K2KA 2ZELA 3PRTA 5LYIA 5I4MA 1HEEA 1VHEA 4A38A 4OP4A 2PJCA 3B35A 3SJFA 2NYQA 5IB9A 1Y0YA 4F9UA 4P10A 3B3TA 2PJ1A 1ELMP 3KQZA 4PXCA 4OC3A 3FECA 3FJUA 3WC6A 3GLJA 4P4FA 3DLJA 4H2KA 4G1PA 3RAMA 3K9TA 4Q7AA 4OIDA 2RB7A 2C1CA 3B3CA 3HUVA 2EWBA 2J9AA 2PVWA 3IFEA 4WWVA 4P6YA 1YSJA 2PE3A 4EMEA 3V7ZA 1TKFA 2IMOA 3WC5A 3B3SA 5D29A 3PBEA 2GLJA 2OR4A 4ZY0A 4UIBA 2JBKA 3SI2A 1YW6A 3D4UA 3H8FA 4OC4A 5JM6A 5LYLA 3IC1A 1LAPA 1Z8LA 4AXVA 4OKOA 1TF9A 3KR5A 2F8HA 1ARMA 2PJ6A 4X3RA 4X2TA 4R7MA 4LQGA 2AFSA 3PB8X 3S9NA 1JQGA 2PJ2A 2WZNA 3BI1A 2XEGA 2C6GA 4ONWA 4NGSA 3IIBA 2PJAA 4FWUA 1BAVA 4UEFA 2PRQA 4Z65A 1VHOA 3KHXA 3KASA 4OC2A 2I3CA 3SJEA 1FT7A 2WYRA 3VARA 2PIYA 5J1QA 2PJ8A 1XMBA 4PXDA 4OIWA 4RUHA 4WJBA 4A94A 3H8GA 3SJXA 4MCSA 3GUXA 1BPNA 2PVVA 1BPMA 4DJLA 2ANPA 3WT4A 3NH8A 1BLLE 3KGQA 2CTCA 3TX8A 1TXRA 3JRUA 4P44A 4P4JA 1UWYA 2C6CA 4NJRA 1Z2LA 4MCRA 1Y0RA 1CX8A 1KWMA 3D7GA 4MHPA 1DE4C 1QMUA 1YLOA 3B7IA 2ZEFA 3B3WA 4MRIA 4UIAA 4IK2A 1OBRA 4GM5A 4TWEA 3IJ3A 4R8FA 3WC7A 2AFXA 2ZEEA 3SI0A 4NGNA 4JYWA 1XBUA 2PJBA 3LWUA 2AFOA 2IJZA 3PBBA 5HXDA 3GB0A 4P45A 5LRKA 4YU9A 2ABZA 5D8NA 2AFMA 3CPAA 3S9MA 4MMOA 2XEJA 2ZOFA 1YW4A 4PXEA 3CPXA 3PB6X 4NGTA
chains in the Genus database with same CATH superfamily
3QMQA 1XE4A 3CZXA 2RUSA 3KLEA 5L9NA 2V8VA 2ZEOA 3CD6S 1NPRA 1S5ZA 2CADA 2VBXA 5ETSA 3NNAA 3F0AA 3MAAA 1YRUA 4TNOA 1U26A 1SUQA 1FESA 3SDEB 1D9DA 2HQYA 2FT0A 4M3SA 1NKEA 1O6XA 2BABA 3PIPQ 3GSDA 3MEGB 4UUXA 2E1CA 3PFEA 2GJIA 4B13A 1R6VA 4KH1B 3RBEA 3MM9B 2IJFA 3G2XA 4NLDA 1PCAA 3GCWP 4GRSA 2EO8A 2R8IA 5IT4A 2ARHA 4UOCA 1YR0A 3IA0A 3FBCA 2GVDA 4WYWA 4RBTA 2HNDA 3M2RA 3TE4A 3UDLA 2RFHA 2MKHA 3DLKB 1RT3A 4ZLJA 1XTZA 1EE3P 2Q1LA 4UUWA 3GYNA 4C8KA 4A39A 4Z2XA 2LQ8A 3V4IA 4OMFG 1S7NA 1VBKA 3Q8VA 4Y2AA 2MPUA 4RL1A 4DG1A 4ZX9A 2MDAA 2F5GA 3R1HA 1XRYA 5LJ3Y 4O44A 3PHTA 2FHKA 4LREA 1Y5NB 3HVAA 1VQKS 4UCNA 2AJQA 2NREA 4H4KA 2CNNB 2EEYA 3HXMA 1RWNB 2ZBCA 1KNZA 2X7BA 4UW2A 3PNIA 2OEMA 1SC1B 2HFVA 3IN5A 5ETVA 3V8IA 2G3AA 2ZH3A 4DWIA 5LRGA 3D5MA 2JC1A 3NH5A 2GMLA 2HG4A 4RU9A 4A8WA 3CCWA 1WD6A 5DM7Q 3E2EA 1T9TA 2IM3A 1F57A 4F4ZA 1Q5VA 2EK8A 4J91A 2OPSB 2CPFA 2EBJA 1N54B 4F4YA 4A4JA 3D67A 2CPJA 2MQQA 1X8DA 2OO4A 1F9FA 5IT0A 4C8YA 3LTOA 3MM7B 4YB6A 4C11B 4LSZB 3U27A 4C97A 1QSLA 3R1LA 1NKBA 3VATA 2WUUA 4BD9A 2BRLA 2VFSA 4QW9A 5GAHU 3J81j 2GW8A 4I1TA 1U0HB 1RYSA 3W61A 2LQ5A 2W2NP 1UAWA 1NMEB 2Z57B 4DR2J 1H7XA 2GQ2A 3L7OA 3NCPA 4EUVA 4C68A 1KP6A 3TVZA 3DOMB 2LQ9A 1D8YA 5BYSA 1W2IA 4OAEA 2PI5A 2G2OA 1QSTA 2Z2MA 4U9RA 4PEOA 1XIQA 4CRZB 4P10A 4B5OA 1H2UX 4IOBA 2B5JA 3EMTA 5CYQA 2ZFHA 4MY0A 5AG4A 2W2MP 4K2XA 4YS2A 2JVOA 4WPAA 3QZ7A 3PX0A 3GYXB 4XTTA 3V6DB 3GIJA 3UI3A 3BJ7A 2BKOA 3MMCA 3D0IE 2ZPAA 2D41A 4FD4A 1UFHA 2EWBA 2JH3A 1VBXA 4PG8A 4CI0B 2HHSA 4IFVB 4NE9C 4URSA 2LEPA 2V94A 2IMOA 4C98A 4UCPA 4ERDA 1UA1A 2M4MA 4KTQA 1LQ9A 2BJ8A 1Z8LA 2UXDF 3OFEA 2UUCF 3U02A 1HYSA 3PB8X 5H9FJ 3CSKA 1JQGA 3BDPA 2HIYA 1VDHA 4GKJJ 4MFKA 5G20A 3J7YU 3FSXA 1VHOA 4MKBA 2XMJA 3G82B 3VARA 4R8UA 2YNFA 2NXUA 3CMQA 3BSOA 4V19X 4C48A 2HWTA 4RUHA 1N5YA 5IQQA 2DF5A 5J2QA 4CGOA 4WFZA 4C7HA 4ZJLA 1PGZA 2C2ZB 4M5IA 5GMEA 3BV8A 4MCSA 2JOQA 3GIUA 3UDEA 3MAQA 5KFDA 3NH8A 3GIIA 4J3GA 1ZTTA 3ENAA 4ZA1A 1R8BA 2JEVA 3W6XA 1SC4B 1YJWS 3I31A 2RDDA 2QZ8A 2IHR1 2XLJA 3LUYA 3QPIA 4OX6A 3LGNA 2FUG9 3C15B 2HBQB 4EEYA 2HZCA 3Q8UA 2X1GA 4LIWA 3HPOA 4NASA 2MKCA 3OR2B 3IJ3A 1S5KA 2IVMA 4IRKA 1IKWB 2ZHBA 3EXCX 1XBUA 2HAFA 2CYYA 4RLEA 4OX8A 3KTQA 2DEIA 5LRKA 2P2CB 3UFCX 1AUDA 3CPAA 2EG1A 2YQ3A 1JLEB 3HHKA 1YW4A 2QMUB 3T5JA 2HFUA 1I1DA 3AJDA 4LF5F 3FVYA 2PE8A 2HBZB 1UVLA 3CO0P 5KFMA 4HR2A 3TX0A 1C1CB 1NPPA 5IV0A 3F0NA 1Z4RA 5DWMA 5EBVA 2K2PA 3TOQA 2GA7A 1CQMA 2G0BA 3MURP 1CULA 3CJKA 3CXPA 4YR2A 4F0YA 4FBEA 2EI5A 2I0XA 3LWMA 2PIZA 3ZZUA 2LMIA 2YBVA 2VXKA 4XPDC 1J5EF 2AW0A 2AWZA 3W2WB 3WQPA 4E0AA 2KHCA 4OC1A 4LR9A 4NSQA 3GR1A 5KG5A 4X8IA 3FQLA 3I0SA 4JV5J 2CZ4A 2ZWPA 5CCMA 5M2PA 2CPEA 3T5LA 5B0EA 1FRLA 4P2SA 1T11A 1PBUA 3MECA 2DB1A 4UWJA 2G1DA 3OTOF 2HBYB 5F8NA 4DL2A 3PW0A 3MEEB 5I42A 1XEBA 3GTYX 2KYXA 2RU3A 4A33A 4AUKA 3UVJB 1WTFA 4IG3B 1VIOA 3HJFA 4PWDA 4DV3F 1Q53A 3L4BC 2WVFA 1UZHA 1OSDA 2VC0A 4ZPBA 2C2RA 3T5KA 1HBUB 1U8WA 4UEZA 1VRTA 2HHWA 1WHWA 1MW7A 2XG8A 2NMTA 3ICLA 2CPDA 4KGMA 2FC8A 3TAQA 2ACMA 4FVMA 1YJNS 1LANA 2CIJA 1EETA 4FVCA 1YI2S 5E7OB 1S10A 1GK8A 1R8CA 3NG8A 2FVCA 2XLIA 1QSOA 1QVFR 1ZZFA 3GKRA 2BKPA 5EHHA 4YMEA 3M6VA 4RKUC 1VLYA 2OEKA 2KRBA 1Y5LB 1QTNB 2QVPA 4AB7A 5K8NA 4LSLA 4DF4A 2XMKA 4PK2A 2YQ0A 3PYEA 4PPDA 3DHWC 4U8VA 5KFEA 3LP1A 3GIRA 4DR7F 1TV6A 1VRQC 1JLQB 1RABB 3WBZA 5DS7A 1IWAA 1HBNB 4P73A 2HKEA 5DQHA 2QMWA 4Q44A 1L3VA 2YX7A 3AA9A 2EG2A 3JQJA 1Q81T 3D54A 2PA8D 5LSOA 1OPZA 4C3MA 5I3QA 4C6AA 4YHHJ 3Q8SB 2XYPB 2PDAA 1T9UA 3IRXB 2OOTA 2IPOB 1HWJA 1SL0A 4OYAA 4IFYB 3A3NB 5C42B 2EFVA 3I56S 5B09A 1QAJA 2UUCJ 3FRMA 1REGX 1REVA 2ZBQA 4NEYA 3JAMY 2VPYB 3TO8A 1XMOJ 4OP4A 3TNVA 2DNZA 1SCJB 5IB9A 4B5PA 4WP3A 4M63A 1SKUB 1U09A 2BM1A 2C2KB 2DNMA 3Q83A 3HSGA 5MLCV 2CWKA 5J2MA 1RT1B 1S1WA 2OELA 4DFMA 6FD1A 5F41A 5I3UB 3ZJ0A 4NF1A 2DEJA 5F48A 5HN0A 3MCMA 3R7NB 2B4VA 4KPCA 4NOHA 1S1VA 1X4FA 2VQEJ 1MLAA 1UEUA 2E66A 3QJPA 1FWLA 1HWUA 2RQMA 5KFAA 2EW9A 4JD6A 4PG4A 2HQGA 3M8YA 3KMSA 5A28A 2HHHF 3SYZA 4JI5J 2HAIA 5KFKA 4C2XA 2QYCA 1P6TA 3V81B 1RAHB 4YFUA 2VZZA 1Y5IB 3MCOA 3KR5A 3AD8C 1KR4A 4JUZA 2CQIA 4MT1A 3A9LA 2YNHB 2JLMA 4UOHA 1YJ9S 3ZZOA 4X3RA 3O2IA 2W2PP 1NBEB 5EDWA 3V4IB 2BUEA 2GC8A 3G6VA 2E7XA 3EZUA 1KTVA 1DBDA 3AAWB 1FKAF 3T6JA 4UEFA 4JI2F 3VAKA 3Q22A 4Z65A 1V6HA 4PG5A 5KFVA 1Z2ZA 3VGUA 4J9LA 2XNRA 5J1QA 3NS5A 4TVAB 1S1UA 5KG0A 1TP7A 1CS4A 2HGMA 3DRSB 1KQFB 4P75A 1RWXB 2WW4A 4X4VA 3R9GA 3MCSA 4X66J 3PYFA 1QUPA 1BPNA 3T5HA 2FL4A 1NO8A 3M8PA 2ALYB 4NLVA 1BLLE 1FRJA 2CTCA 3QZ8A 1FI4A 3QT7A 5CD4A 4DEZA 3D7GA 2E9TA 4R5PB 3R5GA 5DGAA 3KWMA 5DG9A 1CJKB 5IXUA 1K47A 3K2YA 2VG6B 2YGWA 3J7YI 1CJUA 4QOTA 2AFXA 4DR4J 1AUGA 3WC7A 1XBWA 2QX0A 5ETMA 5GVQA 3CB4A 2HFSA 4ZJOA 3RAQA 3BO3A 2DNGA 4NLRA 4F3MA 5D8NA 3J7Z5 3S9MA 2IBOA 4LFAF 4C8LA 3GJSB 2XMVA 4X84A 1HD0A 1M4LA 3DOLB 2EBEA 3G87A 4ATNA 1NDPA 2GO8A 4NZ7A 3NA6A 3FEEA 1H8LA 2ZH2A 2R42A 2Z3PA 3K59A 4OZJA 4EK2A 1SB6A 4JI7F 1NMTA 1KHWA 4M5HA 3CCMS 2DHSA 2B4PA 4NGQA 2QIFA 3CJ2A 5G0RB 5C2GA 2F8MA 2B0GA 1WTBA 3IU2A 1RKIA 1LOKA 1OYDA 1V3RA 3KJNB 1XFOA 2AT1B 4XPLA 1ZS6A 1G3OA 2KT2A 3UDCA 2CNLB 5GMKa 2GX8A 3FMCA 4K59A 1GX6A 3H98A 3TOBA 2HFNA 1Q79A 4DUYF 2JZ5A 4OLLA 5J8CA 2FLLA 4W92B 1GAOA 1WC4A 3M8RA 3R5JB 1F3VA 2EXUA 4R76A 4NGMA 3NNHA 1YLEA 1QSNA 4ECWA 4ZVOB 1QE1B 4NGRA 3UR3C 4HHUA 3FNNA 3IO1A 4EYIB 2G4BA 2RE1A 4AQYF 3KI9A 1FCAA 1U1MA 4DU7A 3K7RA 1U48A 3KLIB 5AG7A 3TUPA 3R2DJ 2BOPA 1LWXA 2BUNA 1U2FA 2HQDA 3G96A 2AU0A 4NI2A 2H48B 3QJJA 1NJZA 5E3QA 2XYHB 3LP0A 4ETZA 4ZP9A 1RLCL 4P72A 2OU2A 4ZVPB 2VJVA 3PJXA 4IRDA 4OV1A 3QFWA 4M5LA 3TQEA 2XMUA 4CLUA 3BHXA 4HL9A 1W7WA 3BYPA 4Y00A 2HHPA 3C26A 5HROA 3I5AA 3B6BA 3LALA 2FY1A 3TVKA 2GZOA 3EPGA 1HBNA 3LH2S 4P52A 1SXLA 5GADI 3CCRS 3VAGA 4CAFA 4C4WA 1YGYA 1EAYC 3BH7B 2BO9A 3HVTB 1CJTA 5IT9Y 1GHEA 2MGZB 1TKTB 3DLHA 3FMWA 2M9KA 2LEAA 1UVNA 3M1VB 1BQMA 1R43A 2E9RX 4OYIA 4I7FA 4KHRA 5K8OA 4RU2A 3AB2B 1N32J 1REVB 4LBHA 3PZJA 3MM6B 1R57A 5LJ5Y 2MKJA 4DR5J 3TA2A 3FH4A 3RB3A 2Y1JA 2BX6A 1TVRA 3PW7A 2AFZA 1S72S 1H6KX 3GPAA 2VODA 4CAWA 1NDCA 4H6UA 1HBOB 2XZDB 2GMHA 3Q24A 2BQUA 2HEKA 4MYUA 1HHQA 2WRMA 3M8ZA 2K06A 1IOIA 4DV5J 2ZW7A 5HANA 2IRYA 2R7UA 1SH2A 1JWQA 4LBPA 1RAAB 1SJ4P 1JXEA 2Z11A 3W62A 1VC0A 4F9UA 3QSIA 1H74A 4L3KA 4UTGA 5AXKA 5IV4A 4DUZF 2R9LA 3SI8A 1RAGB 2RQCA 2CVIA 1U0SA 3BGLA 2FHOB 3SMZA 3THVA 3Q8QB 4AE5A 4TKTA 5HMWA 1TAUA 3DLJA 2ZVIA 2Y3YA 3RAMA 5AG6A 2J5AA 1RBOB 2IJNA 1ZO0A 1FFWB 1XNQF 3FRYA 1H0HB 4FZVA 1X7VA 4QWAA 3DLLQ 3EC4A 4OYWA 2KFYA 4OYZA 3LPEA 2R1IA 2EPIA 3WIUA 1TU0B 4QBUA 4N5SA 3FFIB 2H5JB 4DDFA 3V2UC 5IOLA 1UEKA 1KQGB 3KK1A 1ARMA 3I0RB 1M5HA 3F5BA 1UKUA 3MEEA 3VGTA 3QGGA 2K1RA 4X65J 4NA2A 4N47A 1IN0A 2ZH4A 5DG7A 3PY8A 4RW6A 1FRHA 4I6WA 1UL3A 1FXRA 5AG5A 2N3LA 2DK2A 1RTZA 2DHAA 1FT7A 1ZPVA 4DQIA 1NXIA 3FEXB 3JTKA 5HQLA 2ZWOA 1HYSB 3NBPB 1S9GA 1U2CA 5HK4A 4TXSA 3TQ1A 2FQQB 2HQCA 3KOAA 2LXFA 1S1TA 2PVVA 1EJ7L 4GVBB 5HROB 2DY1A 1SV5B 3WT4A 4F67A 3LGMA 2C6CA 3IM9A 4CLKA 1NB2A 1LWCB 2XQCA 1YLOA 3BLNA 5BJRA 4X64J 3QFHA 1WKKA 3MR3A 3FEZA 3O8WA 4IFVA 4G1QB 4G65A 3UN2A 3PDNA 3KNGA 1RA6A 4F50A 4ECYA 2CPZA 3KK2A 3EYZA 5FIIA 2UUAF 4GC7A 2LQBA 4OJHA 1DTQA 2UXBJ 1ZA2B 3AB4B 1RJJA 3MPYA 4OZ2A 3TFYA 2XMAA 4UFXA 4B3TJ 1XNQJ 2YKMA 2XS5A 2YNEA 2AEFA 1LOUA 3AQPA 3OLAA 2DXDA 3ZTPA 4ANDA 3MECB 2Q43A 1AT1B 1TVRB 1PU9A 5CQGA 3NS7B 1C4CA 4PPZA 4DUZJ 1HNWJ 3MMCB 2XNQA 4JOUA 2J7KA 2LEBA 1B7YB 3OBIA 1I94J 3IR6B 1SKSA 2FY8A 1KS2A 5K14A 4HKQA 3SXOA 1LW0B 1DFDA 4Z7CA 1IOFA 2HC9A 2R98A 4DV0F 1NJYA 3IBCB 1IB1E 2CQ4A 3HKZD 3HM9A 1IBLJ 3SSQA 1N48A 3GCXP 3DRXA 4ICLA 4RWXA 2R7WA 4P4IA 5CBMA 2OSQA 5KFQA 2ZXVA 5HL7Q 5THWA 2FHJA 2JEFA 3FF3A 4ZX8A 1SQHA 2ZM6J 5C25A 3SBMA 4I2QA 4DV7F 1S7LA 3GIKA 4PQAA 4RNFA 1HNXJ 1T7PA 4YUDA 5B0GA 2D4PA 5KT4A 2VI7A 4ES1A 1NH7A 3W60A 1CC8A 1DTQB 3BZQA 3ET6B 5EWGA 3E51A 1JB0C 3P45B 1CLFA 1ZAWA 1HIYA 3C19A 4X4UA 2YKMB 1BQNA 4HI1A 2PCUA 2HURA 2Q66A 2GHVC 1H38A 2DGOA 2V77A 3EDRB 2J7UA 3VZHA 1DTTA 3DRRB 2POKA 4WE1B 2IA6A 3QSYB 4I6AA 4R3LA 5ETOA 4KLWA 2BANA 1FVQA 1CM0A 2HQIA 3NNCA 4A37A 4DV5F 3MHYA 1NK8A 4IKAA 1Q0NA 1BQXA 3BQ0A 4DX6A 3SV3A 2NUHA 4TNUA 3W6SA 2MJUA 1Q7LA 4USJC 5LRJA 2YWHA 3OTBA 2GIQA 3V4MA 5HH1A 2ATCB 4JZ0A 4KY3A 1YJUA 1RWWB 1N33F 2Q3PA 1TK0A 1KD1T 3RBUA 4MYTA 3N5BA 1NUEA 2G0CA 3LPYA 1ZM3A 2HYIB 3ITHA 4RUCA 3J7ZT 1T05B 3G71S 3KQXA 1Q16B 2QE5A 3UCUP 3GQCA 4IO1A 2C6PA 3ZZZA 5B0DA 1VJQA 1Q2DA 3TA0A 3C2PA 1XMQJ 2RC4A 4UA3A 4EWTA 4PRFA 3FCWA 5CNPA 1FEEA 1T95A 4MAKA 4F9VA 4Q45A 3OTCA 4M95A 3DU5A 1WOSA 2MZJA 2PMZD 2ODFA 4B9MA 3MOJB 2PQ8A 1UJ6A 4K0KF 4EFAC 2W9AA 4DUYJ 3VWDA 2FZCB 2BE9B 1M5VC 4M85A 2G0IA 2E5LJ 3ZTSA 4A38A 2M0GB 3M2RB 3TP2A 3M9MB 2Q79A 3G6YA 3B82A 4U9YA 3QRPA 2WONB 2XBPA 5IWAF 2QYGA 1AFJA 5F8LA 2Q6CA 1FTRA 3ZZRA 1MROA 4GO7X 5IS2A 2D9PA 1D1UA 1FHTA 4CGNA 4IOCQ 4J9KA 2H1YA 2LU2A 2QECA 3KLFB 4GO5X 3EUNA 1WHVA 2AYMA 3I5BA 2AX1A 2ZH9A 3V5RA 2X7IA 2V4JB 2QJ3A 5DGBA 2FJEB 4H89A 4J9RA 4MFJA 2PN6A 2V2ZA 3P5TL 3ULHA 1V5VA 3TZWA 4O3RA 5LYLA 3IC1A 1R6YA 4QWDA 4KE5A 5KG2A 2UXCJ 2IM1A 4WXOA 4N8OA 3PRDA 3SHPA 2LKZA 3KHHA 4K4TA 3RB4A 4LT6A 2I5JB 1S9GB 2V2VA 1AB8A 1BHNA 2WK4A 1JNZB 1C1BB 1Y10A 2WZNA 3G8SA 3R9FA 3HHEA 1I12A 2Z2LA 2C2EA 3AD7C 4YR0A 2E5GA 2XHCA 1K0VA 1IQZA 4N77A 2OPQB 5LL6d 1TL5A 1VQMS 2B4OA 4FF3A 3TZZA 1IKXA 2Q0YA 4FDFA 1HD1A 5B08A 4KV8B 4YB5A 4CO0A 4BMHA 2R8JA 4KOYA 3MWBA 3MMAA 2HMIB 1X4AA 5A8WA 2BBEA 1TFYA 4N8NA 4CAXA 3SFGA 4A8FA 3TX8A 2REFA 5C25B 2VIHA 2FLPA 1Z2LA 3CGIA 1CX8A 3HHLA 1QMUA 1JKHB 1NNDA 4LBIA 3LO3A 4QR2A 3CULA 3OUYB 4WZQA 4KHPF 1S7IA 2GNKA 1SC6A 1FXLA 2OB0A 1CSJA 3T1HF 4FD6A 3HSZA 4CGLA 1SQEA 1X9SA 1RUSA 4TU7A 1MN7A 3DCAA 2HS0A 2ZOFA 4PG6A 3FIXA 5K5MA 3CPXA 3CW2C 4AD6A 3CC7S 4QIEA 3DRRA 1DTTB 3NY0A 3HFZB 1NZ8A 4NX9A 4ILLA 4BWMA 4A8KA 1R7IA 3SFUA 4ZVGA 1VQ5S 4KVME 2R7SA 2YWFA 2O53A 3FX6A 3L09A 2Y1IA 4F25A 5KT6A 3ILOA 1HQEB 4UWIA 1RSCA 3BDEA 4I68A 2IL4A 4TQRA 4NJQA 4DPOA 2CKWA 4ELUA 2OFHX 3C16B 2ZJRQ 4II9A 2CPXA 3IS9B 3GR0A 4MKAA 2PJ7A 3IEHA 4FKXA 2FZGB 4PCQA 1IM4A 1CJKA 2VBZA 3R5BA 1Q95G 5HP1B 5DM6Q 1HNZF 2FHJD 3W9HA 3DFEA 4JI3F 3D28A 1JX4A 3N4WA 4GKKJ 1S1TB 2LLZA 3HSJA 1DLOB 2RT3A 5KG4A 2ZNZA 4Y2CA 1FX4A 3I9ZA 2VQEF 4CLPA 4LFCF 3FJ2A 2BJEA 1OQ3A 2E1RA 3L2NA 5CABA 4JYAF 3EDQB 2X3GA 4CCHA 4LUAA 2D69A 2KFNA 1RT3B 6CPAA 2GCFA 1U24A 4E98A 3CDAA 4X4QA 2Z3KA 4LR7A 3WR7A 2REEA 2VFRA 2WVEA 4WFNQ 3MN8A 2VZ9A 1Q8BA 1N36J 4ECTA 1RWPB 3IWXA 4X66F 3GY9A 2DGTA 3AXKA 2J6UA 3BI0A 4WTOB 4IOAQ 1KSPA 2HVIA 1YMEA 4QZVB 1IICA 3DGPA 3T9YA 5H1SV 4UF4A 4X64F 2IFXA 1Y3KA 3D1OA 5RUBA 5JJBA 2DHGA 1OS5A 1PUAA 3AOAA 3LP2B 1LWFB 4OZ0A 4ED0A 3U1MA 1KEKA 3PW4A 4ZI6A 4WKRA 4CAVA 2VHGA 2YPZA 1T03A 2R7RA 3C46A 3UD3P 2BQ3A 3LAKA 1Q5YA 1RT6B 1LKZA 3MGDA 3CD7A 2Z2YB 2A4NA 2P0WA 3P6YC 4A48A 4HDGA 4OX7A 2PFDA 1S6QB 3T19A 2C3OA 4P2XA 3FBUA 4ZMMA 5G21A 1Z5RA 4O0IA 2HW3A 1YVOA 4Y49B 1TL7B 1B87A 5DWNA 3TUJC 1S6OA 4Y65A 4ZPTR 4ES3A 3TO6A 3IWWA 3KYLA 3Q8PB 2YKOA 1YZ6A 5E3AA 4PQUA 3T6BA 4FXVA 3OVSA 3E01B 4ZVTB 3KXDA 1HNWF 2B5GB 2DNHA 2OKQA 3DLEA 2QG9B 2R2SA 4DN0A 5F0WA 3SEOA 4UFVA 1NJIT 2N3OA 4EZ6A 5E3RA 3NCQA 1WOPA 2Y8YA 4Q2LA 3ZO7A 4HLBA 1Q78A 4DSIA 4P6YA 2WB1D 2HZAA 1NSQA 4N7TA 1RT1A 3HT3A 1DQ8A 4DR7J 5T7LB 5A2QY 5ETNA 2OR4A 3PW5A 3EY5A 2YKNB 4HVZA 5D0RA 1NK0A 1E6YA 2UVUA 4MK7A 4QC6A 3H40A 3MD3A 1OY9A 1TFWA 2P6FA 2ZBRA 4LMZA 4AVCA 4DX5A 3BJYA 3CCQS 2C6GA 1RAEB 2DO4A 3C6UB 4GC6A 4UBRA 2V0NA 3IIBA 4K4YA 1RLDA 5DLGA 3KK3B 2HRTA 2HHQA 3IS9A 2YKQA 1S6PA 1TTHB 4ELTA 2EVNA 4FNHA 4K4VA 3IGRA 4OC2A 3SJEA 3KJFB 2PIYA 2PJ8A 4ECSA 3OHAA 4WE1A 1RISA 2E7VA 3DOKB 4F2SA 1BPMA 3H90A 1WWZA 3NL0A 4C8ZA 1WSRA 2CRLA 4TQSA 4P44A 1YKWA 1HI0P 1FD2A 3G6XA 2J8NA 4OL8A 3L7PA 2BSWA 4OIXA 5DQIA 1JIHA 2XGQA 4DG1B 3ILJA 2E44A 5M2RA 1FA0A 2ZEEA 3PYDA 1TMMA 2VA2A 2ROGA 3CC2S 2P6GA 3W3SA 3GV7B 2DNNA 4PWDB 3KG0A 4B9UA 2H54B 4DYOA 5L9XA 3D3CJ 2GVZB 2CQ0A 3CJ4A 1N4LA 1PC4A 2DIVA 1PJ6A 3UDVA 5J2QB 1J5OB 4CH1A 4QU6A 2FCKA 1RBLA 1U1KA 5HO4A 1QJHA 1MJBA 1ZG8A 2B4DB 4DLGA 1U7LA 2KZZA 2R7HA 1CJUB 3D3BJ 5FDLA 1Y7PA 1X9WA 2AJFE 4OHYA 4OHWA 1CP7A 3WC0A 4UEEA 4LF7F 1T0TV 2RH3A 2PJ4A 2C28A 2O5DA 3MR6A 3HHLC 3T1YJ 1YIJS 3A3OB 4TYBA 1F1BB 2Y0SD 2ZNYA 3Q0AA 3I1UA 4LVNP 1TZ0A 2IRUA 2DGXA 2RIJA 2QTWA 4M5DB 3CIZA 1VHFA 2BJ1A 3R2CJ 2Z3LA 1IKYB 1NCLA 4LFAJ 3TAMA 1WNEA 4A8YA 5T14A 4RNMA 4QWCA 1AXQA 2MHEA 4GVLA 5FLXY 1ZLIA 3IG1A 5KFGA 3TW0A 2PDOA 2R7XA 4KR0B 3Q89A 9ATCB 3DMJB 1S76D 2A18A 5A8RB 2QLWA 3OXLA 3ZXWA 1I6JA 1LCPA 4JV1A 4CNZA 2ZEJA 4JI1J 2CJBA 3H5SA 5BR8F 4F8ZA 4ZOSA 1X0PA 4B3OB 1BWVA 4LX9A 2AZ3A 2AGQA 3EXYA 1Q8KA 4HDHA 3GJTB 5JUMA 3KLHB 1FFSB 5H86A 4C0BA 1IQTA 4PUOB 1T94A 3NP5A 4JI4J 2HNYA 5K20B 5I3UA 2W7PA 1WORA 4ORFA 4QUSA 2RU9A 2OIHA 2V8HA 2KJVA 3H5ZA 5DS0A 3S1TA 1T02A 1Q7YT 3QAUA 1MN9A 4ZCKA 1KDNA 1ZM2A 1HHSA 2PEHA 3SQGB 1L3UA 1S9EB 4LRDA 1G7CB 4KH0B 3I5CA 4BHQA 3DNCA 4HH0A 3FK4A 2QIRA 3FFIA 1VLOA 1QD1A 4ECZA 4QW8A 4O4GB 3POTB 3BN7A 1WK4A 4KORA 2PIIA 2NSMA 4YY3J 3NS6A 2FD2A 2B6AA 4WIIA 2B9WA 4P9SA 3DDNA 2CQGA 1LRZA 1HPZA 1WWHA 3SJGA 2IA0A 4DZDA 3BKTA 2CJXB 4HNYB 4MTPA 3FEYB 1W2BR 2ZKTA 5F0UA 3K2KA 2B3TB 1HQUB 2YNCC 5C24A 5LYIA 2HNYB 1R8HA 4HHHA 1FWPA 2IYGA 3PIOQ 4L6V3 4QQBA 1N88A 3P5BP 2IBKA 2KG0A 3CVKA 3ZZPA 3FJUA 2A10A 3GYAA 4LF2A 2IDEA 4EGLA 5KFIA 2OLWA 1N52B 4TY8B 2Y8WA 4I56A 4DV6J 1FDDA 2JWNA 2YNGB 2GQCA 3IWGA 5KFNA 4F36A 2K7KA 4QIGA 2UUWA 4XPKA 3BQ2A 1TKXA 1JXLA 1HI8A 1WEXA 5D29A 4GS4A 3TOAA 1YW6A 5H9FK 2WSEC 4NLGA 4NLPA 4X4PA 2G2ZA 3W64A 1KKHA 2FPHX 1M4DA 2FVSA 1RE1B 1YX0A 1KFDA 1WG5A 1T8EA 4J37A 2PMWA 2ZZTA 3ZZYA 2UUAJ 7AT1B 5IQ6A 3VAHA 3FMBA 1H98A 2C27A 4CM2A 2ZE2B 4KGXB 5F8IA 1BAVA 5KFBA 1HQUA 4CO2A 2W4PA 3KDOA 1RT2B 1X4DA 2I3CA 4EBDA 3PTWA 2Z3OA 5J1NA 2QEXS 3ZFVA 1TELA 3BYRA 1IVZA 3JVNA 2X1BA 3OR2A 1NPKA 2W1BA 4X4NA 2DPJA 1TK8A 4AG9A 4B3OA 4DSJA 4EBCA 4IQMA 2I9SA 4OYPA 3OL8A 2Q04A 3IAM9 1OPIA 3OL9A 3KG4A 1OMSA 2W01A 4MCRA 3B4DA 1WI8A 1MMDA 1EQ0A 3QQCD 3B3WA 3OVAA 4WXWA 1T9WA 1KRPA 2CNKB 3MM9A 4JP8A 2V69A 2DGVA 1ZTWA 1E6VA 3UPFA 3AA8A 1HR0J 1C2PA 3LWUA 3QGPA 1NDLA 3IBWA 1SC3B 3OQ2A 4XDCA 2GFFA 3HF5A 1WUUA 2VUGA 1HQ2A 2J0QD 5FJ4A 2XTJP 4DS5A 3R5AA 3R6GB 4LR8A 3CCVS 5KOXA 4NGTA 2E1MC 3RG6A 3BGFA 4N56A 1RB0A 2YWGA 1VQOS 4EZ9A 3O3LA 1XNRJ 4DFJA 2E7WA 2F9JA 3KJVA 1EZZB 4CH0S 4NYZA 2MQOA 2CY2A 3X3UA 2RUGA 4FPIA 3DM2B 3KUHA 1Y3JA 1UFLA 2MLZA 2BV3A 2HRUA 1VHSA 2RRAA 3BS9A 1YTYA 2H4WB 5JGFA 1B7FA 2RSQA 1YVFA 1B0TA 1AUSL 1NSLA 1TL3B 1K1QA 2I1RA 3W5XA 4ZPWR 1IGBA 2B56A 4F7VA 4MCPA 4QU7A 3KL9A 3QIPB 2XGPA 2R2UA 3BSAA 1LAMA 1GFWB 3QT5A 4IHMA 2HNZA 2XYGB 2B7CB 5D77A 1YQEA 2B58A 3OT9A 1QAIA 2MQLA 2VOPA 3S7RA 5EGYA 1F2HA 4RW4A 4NLSA 1IIDA 3T8WA 4YRHA 3FBFA 3ENQA 3CO9A 4O0NA 2AF6A 4CGMA 2J8AA 1JJ2R 1YRTA 2R2TA 4PXBA 3IU1A 3A3PB 2DPTA 4MKVA 4QJVA 2BMBA 1RO5A 4LF9J 1RTHA 3DGVA 1PKUA 3AFGA 2E5IA 1K44A 2XHWA 1MU2A 3L9ZA 1FJ7A 1JLBB 1FO1A 1RXOB 5AXNA 2N7CA 2HMIA 1JMTA 3ZNUA 2W7AA 3LQVA 5LMUF 2L41A 5C2CA 3AOCA 4PABA 2GIRA 3PV8A 4OYBA 3AY0A 2YH0A 2UVVA 3PJWA 4X5KA 3SV4A 1KUXA 1A7GE 2JDCA 4O44B 2F4FA 2R4FA 2SXLA 4K5SA 4B10A 2HVDA 2R8VA 3EVWA 1ZZNA 5K9FA 4LF6J 2L3MA 2DNPA 1UVIA 4K4SA 3TVYA 5CPAA 3GG1A 2CXAA 5LXRA 3KK2B 2PI4A 1HKAA 2G0JA 3VQTA 1PJ7A 4IUFA 3TUIC 1Y7RA 4CPAA 3VWEA 5KT5A 4GKKF 1F0XA 2OI2A 5E0OA 4MKYA 1GEHA 4FN5A 4JI3J 1S12A 4LJMA 3RW6A 2HB6A 4JI0J 4ILRA 2XSJB 4D3HA 2X51A 1Z8XA 5DDRC 2PJ0A 1VGYA 2XEXA 1D3WA 3G3SA 5D4OA 3OTOJ 1S7FA 2HGNA 2W9CA 3PFOA 4KSEB 1N5TA 3DXBA 2PA3A 2J9EA 2W8KA 1X4HA 3H2LA 1SJ1A 4AL6A 2DVIA 2GO9A 1IKVA 4RPFA 4DXLA 5IB0A 4DUKA 1TUWA 2R7OA 4FD5A 5KFLA 3W8GA 2Q6BA 5KT7A 2V50A 1EETB 4ANEA 4PYAA 2CDQA 2ZELA 5I4MA 1CJTB 5L1IA 1H72C 1M90T 1FK9B 2PFFB 3MUTP 2L9NA 3RNZA 1LW2B 4USUA 2GHWA 2KL8A 2LA4A 2NXEA 1VQ7S 2DXQA 1JK9B 4B5PB 2J6SA 1RTIB 1ELMP 3MEKA 1NK5A 3MM7A 3AQOA 2JL9A 1TKDA 4PQUB 1U6ZA 1CJVA 3BBBA 2DIUA 2Z0ZA 1MG7A 4K7QA 3BJ8A 5SZTA 1IUJA 4DPYA 4CS0B 2G13A 3B3CA 1UFKA 1N34F 1SIZA 2OMLA 4IDKA 4AYBD 1RT7B 3RBDA 2FE7A 1TKTA 3V7ZA 3LD2A 1RWUA 2Z58B 4M6HA 3HKWA 2ZH6A 2D3O1 1O0PA 3D4UA 5AE3A 1Q7LB 4DR2F 3MR7A 4AXVA 2IM2A 2IY5B 4QYZK 1WACA 3U7JA 2LA6A 2DHHA 5DDPC 1BO4A 1RAIB 3H0PA 1CS4B 3K5MA 3JYTB 4CAEA 3K5LA 2FTRA 2A1BA 2KVQE 3AXMA 3ELHA 4M8LA 1VQLS 4UZCA 2E1PA 2OFGX 1N0VC 3KHLA 4PKDB 2ZOMA 4F04B 4RZRA 2QA2A 3H5XA 1JLEA 4USTA 4JXRA 4WK1A 1EHWA 3H42A 1JLGA 4DJBA 1VK8A 4CO5A 3G86A 2OHDA 4DMZA 1WC5A 2ZW6A 4B3RJ 4F4AA 1F3FA 4A47A 3MF5A 1JLFA 1FWKA 2UXCF 2YTCA 2CXEA 4Q0BA 1M0SA 1KLNA 3GUXA 3KLIA 2H51B 3IMQJ 1S77D 2GVZA 2MGZA 4TY9A 4B9TA 3AJ1A 2FJBB 3GE9A 1Y0RA 5KFTA 4DV6F 3ZTRA 4DV1F 2KJWA 3J7A1 2ZEFA 4JI4F 1CQNA 3CDEA 4GM5A 1X5OA 3QYYA 1VC5A 3SI0A 4JYWA 2PJBA 3IWNC 3LWLA 4JI6J 4DSEA 3MEDA 2AFMA 1AFIA 2RJZA 3QGHA 4ED3A 3CJQA 1R8PA 1N34J 1S4FA 1U1PA 4R0EA 1RHKB 2MZTA 2ATLA 4B9NA 7CPAA 4MHNA 1B70B 4QR1A 4YB7A 3B8HA 5HATA 4RW7B 2O28A 2FSRA 3G82A 2DXFA 2FIUA 4FBUA 3OJSA 5EN1A 4TU9A 3KLEB 3FKBA 4WK3A 3TAMB 1UW4A 4MCQA 4J9PA 5HVHA 1IKYA 2G3TA 3HMJG 3IWLA 1ARLA 2BE2A 1FKPA 1TK5A 2B43A 3HSDA 4ZN3A 2NZ4A 1A0OB 1WC0A 3K5PA 3D1QA 1HQEA 5LYDA 4I49A 4PZVA 5KG6A 2E5JA 2PJ9A 4DX7A 3S6FA 4ED1A 1KUYA 4IQXA 4PWUA 4WWSA 2KB2A 3C16A 3S6KA 4C2YA 5L1LA 2OAUA 1S59A 3H7HB 1S60A 2GJFA 4E8OA 2RF2B 3U1NA 4HTJA 4C0OC 3SCKE 2Z3MA 2C1EB 3D8PA 3NOGA 3O5TB 3BM7A 4HACA 1XMOF 3TO7A 2E29A 2KT5A 1W25A 4CO1A 4RW9B 1YWXA 3GIMA 1Z8TA 4JV0A 1UEVA 2J8RA 3W65A 1G6BA 3G8WA 4A32A 2VL1A 2LCWA 4G1QA 5KFSA 1CULB 4NCGB 3HFVA 3HX9A 4QYRA 3NWRA 4RW7A 1CG2A 2C2DA 3M2UB 4ANCA 1IJEB 3F44A 8RUCA 4KSAA 5HLFA 2KVIA 1TKHA 2V34A 3NMRA 5I3PA 3J7AN 5IV3A 3TARA 4CO4A 2OPRB 4ZCMA 4MJKA 2VPZB 4O4GA 3PJ9A 1RHJB 4WIQA 4Q36A 3BF4A 5DRKA 2V8DA 5B0BA 3CJRA 2PRBA 3DHXA 8CPAA 3J80Y 3ONQA 3D7DA 2CVEA 2HHTA 2EFNA 2QYVA 4ECXA 2BDPA 2WBRA 4OHZA 5GAHI 4CLSA 1O5JA 2FLNA 3HD1A 2ZW5A 1S99A 3OR1A 4IO9Q 2D74B 1QQ9A 3NEKA 1J4JA 4IAVA 1LW2A 3A4TA 3RB6A 2V2QA 3JTPA 3LP0B 2DY9A 1S7HA 2I5JA 2EK9A 2ASYA 4IH7A 2VKZG 3ZTQA 2Q7SA 2AEJA 1SQGA 4TY8A 2QMXA 3PRVA 2DH9A 1NK7A 2Q51A 2F1FA 4IG0A 2CPIA 2XULA 3OXGA 3N9UC 4QBJA 3IXQA 4URQU 2BRKA 1LWEA 4FPRA 1J27A 4KRWA 4ZVQB 2UUTA 4BLGA 2PJCA 3B35A 1FTCA 3DC2A 5JPHA 2NYQA 4LQ9A 4A31A 1NM2A 2UVWA 4JV5F 4FBTA 1FJCA 1JLCA 4ZITA 3KG1A 4DL5A 1RYRA 1UCNA 5DJBA 1FRMA 4X4OA 3RJMB 2W7OA 2YNIA 3THPA 4M5DA 4A8QA 1GMVA 4DV0J 1RP5A 2GVDB 4NMLA 1HW9A 2VFUA 3GP9A 4CH7A 4IF5A 3R27A 1NE9A 2J9AA 5JVGQ 3BBCA 3DR8A 4DCJB 1UWBA 3C6TB 4DR3J 4DPWA 4RW8B 1OZPA 2UP1A 5J2PA 3VALA 4IRCA 4DR6J 3JSBA 2WAQD 3OLBA 4NXNJ 4CDIA 4C8OA 3FBBA 2V8PA 4J9SA 2DHXA 3N0VA 1UVMA 3N79A 3CPWR 3CJTA 4U5YA 2PJ2A 1H3DA 5K14B 4ONWA 2DYAA 4DNCA 3AT1B 4F4WA 4IR1A 5DETA 1UJ5A 4IR9A 3MPUB 5KFOA 4CO3A 5ETTA 4KOVA 1Y11A 1KN6A 1VQNS 1VQPS 2H4YB 3CCES 4ZPVR 3TYTA 4O3OA 2ZM6F 4OI6A 3JQKA 3CXSA 1RK8A 5IC6B 3JSMA 1YGHA 4P4JA 4CLTA 2VB6A 3C14A 2XO6A 4OYXA 1DARA 2A2CA 1J2VA 2DNOA 5J2NB 4I67A 1UPMB 2VICA 1RHUB 3PBBA 3CJ8A 2VPWB 2JLGA 3B78A 1FF2A 4YU9A 4B3SJ 4TYAA 2VASA 5ETKA 3HFKA 2M3DA 1S0OA 1Q8LA 1YRXA 2JX2A 2CJ9A 3P2FA 1FXDA 2CDRB 4Q5VA 2PD1A 3KLGA 2XS2A 4OZ3A 3LAMA 2JSXA 2VPXB 1ZBTA 4WZMA 1RWMB 4I4BA 4OFZA 4FF1A 4W9YA 2U1AA 3MMAB 4DR1F 5K8PA 1XWLA 1WDTA 4KYZA 1GNKA 1LNQA 3D2PA 1Y7EA 2QN6B 4MXUA 4PR6A 1J5OA 1U1NA 3LMSA 1GXTA 2ZOGA 2K8GA 3H5UA 3WIVA 3EM1A 5KFCA 5G22A 2ZBPA 3SXLA 3ZC4A 4ECQA 1B6BA 5LSLA 1N6QB 3KFWX 1TIQA 4JI8F 2IRXA 2CA9A 3NE8A 2YWEA 4MK9A 3EVOA 4IH5A 1CJVB 2OH2A 1P9YA 1SJ3P 3CD0A 3US5A 5A6WA 2F65A 3BSNA 2QA4S 2IVYA 3EX7B 2HS4A 2M8HA 1ZH5A 4LF1A 3H59A 3M8SA 2AGOA 3HT0A 3MPWA 2QMLA 2ERRA 4CTAA 4ZS6A 2EWHA 2BOAA 2DBBA 1PYOB 2U2FA 4A8OA 1DHMA 2L9WA 3UO0A 4X62J 3VV2B 5K8MA 3DSBA 3R97A 2G1HA 3DDKA 1YREA 3CE8A 4MFZA 4USWA 1FNOA 2M88A 3NBPA 1U6BA 2MEWA 2NXNA 3R96A 3BPDA 2MKYA 1S57A 4FKYA 2ZEMA 2FZKB 3HP6A 3CIMA 4JYAJ 3EXNA 5BWAB 2HGLA 1P1LA 4DHVA 1XJOA 3HDSA 4WYLA 1NAQA 3CCZA 1S3ZA 2R8GA 1SJQA 2CZ9A 5KFRA 5A8WB 1SVDA 3Q2SC 3VR1A 4ZKAA 1U02A 3WDOA 3QNWB 2VQFJ 2AJ1A 4A30A 4MIAA 1MMNA 2H5MA 1IM6A 1KUVA 1HL6A 4B6ZA 1KOHA 2O1PA 3M8WA 2IC3A 2HNDB 2ZHOA 3QJLA 1I1GA 3M30A 1XJWB 4RBVA 2FIWA 4CYNA 2VC1A 4C2MA 3NXZA 2HFZA 2AYBA 2RD5C 5L8RC 2N7YA 3CCLS 3ET6A 4Y34A 2HQFA 2I6WA 2YX1A 2FJXA 2VF3A 3JSRA 4DPXA 3GU0A 4UQTA 1F5BA 1RACB 2AMCB 3HLPA 2MKKA 1VJWA 3LW5C 1ON0A 3ISZA 5D0HA 3HHLD 2ZKUA 3PRTA 1U0HA 2C2NA 1HEEA 3N28A 3OVBA 3PEJA 2R3VA 3ILIA 1N56A 1JKHA 4A8MP 4RX6A 4NEXA 2W25A 1NK6A 1IR2A 3CDWA 1WEZA 1YQHA 3TA1A 1JLAA 3IRWP 5ADZA 1LK7A 2W8LA 2ZH8A 4O3PA 3KQZA 5KFUA 3WC6A 2MQNA 1JXVA 4YDXA 2EKNA 1HNXF 1Q2CA 3OTEA 4OIDA 3R6LB 2DPIA 4KLVA 4YGOA 1K0TA 4IFYA 4R0JA 2YVSA 1N33J 3GFYA 4OI2A 1WG4A 3W5YA 1L3KA 4AFFA 5IWAJ 3R5CA 4RUBA 2ZH5A 3TI0A 2J9DE 2FXFA 1MJAA 3SI2A 4KOTA 4YQWA 3KLVA 3GJRB 2WSCC 4ZIWA 2UVRA 4OC4A 4LSLB 3EGWB 4H6ZA 1UJ4A 5LM7E 3QIDA 1VBYA 1ZOTA 4GVBA 2QV6A 1VRUB 1M1KT 4E0DA 3DM2A 4ITSA 4DL3A 3M7VA 1ELOA 1SJRA 4ZVFA 2EK6A 2AFSA 2ZHAA 2EFOA 1TV6B 3NGTA 3FXTA 4JI2J 2GHPA 3HULA 4X4RA 2YXLA 3UNYA 2GGPA 2GFQA 1UETA 1HLWA 3KHXA 3MZIA 5AXLA 1S48A 4Q8FA 3IGVA 3KUEA 2W4DA 4L73A 1NRKA 2JLEA 1S9FA 4BDPA 1CPZA 3W2WA 4P2FA 4X4SA 4L72B 2MYFA 4EO8A 2XY6A 2ZVSA 2F4VF 2HHHJ 2UZAA 1FY7A 1DAXA 4CLYA 2YNFB 4ZN1A 5LXYA 5CH7B 2JVRA 1DE4C 2EFQA 2DD8S 5JVHQ 2UUBF 4DV4J 5IT9U 2ILZA 4IK2A 3CJ5A 4R8FA 2B3UA 5KFYA 1HNVA 2J9CA 1PYSB 3M6XA 1KTQA 4RW9A 4B9SA 5T41A 2G2YA 3MTKA 2QFIA 1RTJB 5L39A 4EU0A 2HRYA 2OZUA 3B2YA 4DR1J 5L1JA 4Q43A 4H4MB 2EC2A 1EP4A 1FDAA 3LANA 1FEHA 1A6LA 3D6TB 2CQCA 3M8PB 3FZ2A 2RVJA 1DTDA 5DQGA 1Z9UA 2PO4A 1ZPWX 4ENOA 2RHSB 2BACA 3OXFA 3P3DA 4R9MA 5HVGA 2O67A 3LODA 3LP1B 2GIFA 4N76A 4Z7YA 1XK8A 4K2JA 3TEHB 4FYXB 2B7BB 1AROP 3KK3A 3PRBA 2YH1A 2Y0BB 2H5IB 2B5JB 4ED2A 4B3TF 5ELYA 2AE6A 1NLKL 3PG9A 2CZVC 3M32A 3V6KA 3CXQA 1BQMB 4ZVEA 3H20A 4JWPA 5LOQA 5E5NA 1KVIA 4A2ZA 4WFAQ 3VF0B 3SXNA 1HDUA 1X9MA 2FVQA 2C3PA 4KIAA 3G9CA 2AHOB 1GYTA 2WB4A 3SSSA 2Y9HA 3D2MA 2ZEGA 1P27B 2QLFB 4K5RA 1C0TA 4DL6A 3H5YA 4URGA 3RYLA 3W2VA 4ZK7M 2HNZB 1T05A 4UZBA 2VA3A 4KOWA 2PR1A 1YK3A 1WOOA 5E2QA 2CJYB 2Q4YA 4R3KA 4OQJA 1SL1A 3A8KA 1HMVA 1QUVA 3A8IA 3CCJS 2GAHC 4EFDA 2VG7A 2NXCA 1VQ9S 4NRUA 2HIQA 4AL7A 1ULRA 3J81Y 1Y0HA 4RS2A 1E6VB 2ADCA 2DEAA 4OYMA 4DN9A 4HNXB 1CC7A 2GGPB 1HHTP 2VFVA 1QM9A 1NHVA 2YNGA 5CYMA 1VMBA 1KLMB 2XY5A 5AXMA 3DRPB 2B8PA 5D0EA 2WPXA 3EGNA 1NSAA 2K7JA 1F2OA 3QBCA 3J80U 1X5PA 3QO9B 1I94F 5KFWA 1RCOB 1FE4A 4J9MA 3NAIA 3E01A 3M4XA 2Z10A 2XLKA 2V4JA 2WHOA 5C82A 2GAGC 2CQ1A 2ZE2A 2Z0GA 5D0GA 4ES2A 2V6AA 4FF2A 3K5OA 1XQIA 3N01A 4RNHA 5HAOA 3M1VA 4ZLLA 1HBOA 4WFXA 3UD5A 3RTVA 2RILA 3T3FA 3MMJA 3DNSA 4M5GA 4KZTA 2OZHA 1X60A 1EB0A 4J9NA 2ASJA 1QTMA 2FIAA 2APOA 2FB0A 2UXBF 4Y6IA 5KTAA 1HBUA 2ZH7A 2RDJA 2DR8A 4LRAA 2JJ4D 2CQ3A 1U6FA 4ZLPA 2ZUGA 1TL1B 1FK9A 2KKHA 5EX3A 2KU7A 4WP8A 4YR3A 4UOGA 2C3MA 1G2EA 3K9TA 2ZD1B 1U1RA 1XN9A 4OYOA 2WSFC 2C1CA 2XM3A 3H4QA 2PVWA 4G3IA 3ILLA 3BO4A 5A0YB 2PE3A 3M8QB 4I2PA 2KI2A 1HW8A 2DJWA 5LSRA 2BJDA 3I4HX 3K57A 3T1HJ 3S01A 3QO9A 1BY9A 2HVZA 4RR5A 1SQFA 3FRZA 4ETXA 4MFPA 5JMNA 3TWZA 1EKSA 2MLXA 4U7UK 1TF9A 4MI4A 2ABYA 1ZETA 2FJAB 4CT8A 3EGVA 3CJ3A 3TZXA 4Y0FA 5ITHA 1HNIA 2J9DA 4J5OA 4U95A 3RU0A 3ZNJ1 2EUIA 4FWUA 5CAAA 2R2RA 3FUYA 2XZWA 2XMMA 3ZZIA 1OY6A 2ROPA 1IU8A 1TUGB 5AE2A 3OJUA 1K1SA 4MK8A 4DV3J 4K0KJ 2RS8A 3EWGA 1TR0A 3MM6A 3KLFA 2A0FB 4ED4A 4DLEA 2BXJA 3BSCA 3PXGa 1VBZA 3QAHA 1C1CA 1V9OA 4A8SA 2VKRA 1M1GA 4L74A 1KVKA 4NJRA 4HPSA 2P9GA 1S0MA 3OTDA 1P8GA 3BGOP 2MMYA 2VG7B 3B7IA 4RBUA 5J2MB 1QDUB 4MIBA 1J5EJ 4B3RF 3C15A 4JBCA 4UFWA 1GMWD 4P74A 2V9WA 5CCLA 4DZ6A 4EMDA 2AJ2A 4O3SA 4KGKA 3MR5A 1BD6A 2AJ0A 3D9BA 4B3MF 5L38A 2ZZMA 4DOZA 1C0UA 2FJVA 1O8BA 2CJAA 1BXNA 3ZZ0A 3CUNA 4J9UE 1Q4RA 2CQPA 5GCNA 1F2GA 2I38A 2ROEA 2WVDA 4OHVA 2QLXA 2BEIA 2HPUA 5KFFA 4B17A 1S9EA 3VGSA 4NLUA 3M32B 1CP6A 1F9EB 4XK8C 1YLXA 4X4TA 3KR4A 2QLBB 3V38A 4CZCA 1DURA 4NLXA 3HZGA 2XEIA 1EARA 5FVJA 2GJ2A 3NGUA 2JBJA 2WZ1A 1FJEB 2N4CA 2DXEA 3CC4S 1FNMA 1G4CA 2KM8C 3QB8A 1RADB 4NFRA 3CDUA 3FVLA 5H84A 3WABA 5J2NA 3CJSA 4MJ8A 1CBKA 1YK9A 1LWFA 4FAIA 4NI2B 2DTJA 1PYTA 2BEFA 2QC3A 2VBWA 1CPXA 1WDDA 5F49A 2CQBA 3B4MA 3Q86A 1HMVB 3EICA 1IY7A 3LP2A 4DU8A 3DXSX 3QGIA 1NEEA 2GIVA 3PP9A 3PZPA 1T9YA 4YN3B 3I82A 2CQDA 4HT7A 2AV5A 3SCJE 1RTDA 2YNCA 3RYOA 1S6PB 4DQPA 4JI6F 2AJ4A 5EUHA 1RT4A 3UWTA 1BWEA 1ZG7A 3DDDA 3M6WA 1Q86T 4NWBA 1S6UA 2DGQA 2K5TA 5H9EK 1KZFA 1KBRA 1BLUA 1VYAA 4LSNA 2ZD1A 4ED8A 2KFZA 2MZSA 3HHNB 3CJ0A 3S8SA 2W4CA 4AXIA 4J90A 4MFQA 4MHYA 2IQ6A 1RHMB 3AD9C 1M5SA 1GMWA 2VD3A 5BR8J 2HHXA 1MNEA 5HMZA 2JEIA 1WF0A 2HVHA 2GU2A 4RNOA 3MCNA 3KK1B 2R7QA 2DPSA 3M9NB 3M2UA 4S0MA 3KHZA 3CF5Q 4J9OA 4DV7J 5A8KB 4B14A 2ZENA 3PR5B 2GLFA 4OC5A 3JUWA 4U67Q 5C88A 1IBCB 4K4XA 5BYRA 5J1EA 1DQAA 2MY8A 3FSIA 4WTYA 1IBKJ 3W9IA 4PYDA 1Y00A 4OI0A 2MSSA 3T1YF 3QT8A 7FD1A 2UU9F 3F73A 4ED7A 3TEGA 3DN9A 1VHEA 3PM9A 4A8XA 1PG5B 4Y2MA 2OGUA 1JLFB 1Y0YA 3KJVB 4HKFA 3BEGB 4B3SF 3PX4A 5F3TA 1VHIA 4KFBA 1SH3A 2HWHA 2H65B 4H4KC 1RT6A 4C0HA 3VAFA 5E96A 1TKZB 2RNEA 3CNQP 4UT4A 4F4XA 3C6UA 3BBFA 4DSLA 4QWBA 2F9DA 1VQSA 5SUHA 4WWVA 4KUBA 5KFZA 4C2ZA 3D4JA 5E3PA 3NMAA 1IXKA 4TU8A 4BS2A 5MAOA 2OTLS 2NS1B 3WC5A 2MQPA 1D8ZA 1I21A 3EPIA 2D3OR 4ZY0A 4JXQA 1O51A 4I69A 1S1XA 4KUAA 4WFBQ 3T9ZA 1L0CA 2FJWA 1LXJA 2PR8A 5FD1A 2BW7A 1GTHA 5B7WA 3BN4A 1XNRF 2V2KA 4ZCLA 3FDSA 3W9JA 2PC1A 2F3JA 4XDDA 3BI1A 4CRYB 3RW7A 4JJXA 5B0CA 3TR5A 4RUAA 3BGUA 2VFTA 2PT0A 1ZYQA 3HI9A 1CVJA 1K4JA 4F0MA 4XO0A 4PUOA 2GMJA 1S0NA 2HSEB 5CD4H 1JLQA 2P5VA 1K8AT 1FDBA 2P6EA 4OIWA 4LF7J 1PILA 4C3LA 3OFGA 4QPXA 4LRCA 2CNTA 2ZC3A 2IAJA 3DRSA 2ZC4A 5HQ8A 3PO4A 4KHMA 2ALZA 4DR5F 4BC9A 4CNYA 2C2OB 2PC6A 2RF2A 4MRIA 3D7SB 2DITA 4CLZA 1V3ZA 2YKAA 2DO0A 3DU6A 1WHXA 3GMGA 4P45A 4M6IA 4CYPA 1NJWA 3WC2A 1RTHB 1JJHA 2HV2A 1KFSA 4MMOA 2W9BB 4CLFA 4PXEA 4LF9F 5DZ6A 1Y9KA 1DJ0A 3N6LA 5HMYA 2O01C 3MGJA 4WU2A 2P9EA 5ETPA 3VVUA 5FLXU 1X31C 3ZTOA 5I42B 4NZ6A 4XNHB 2NLWA 1FJGJ 3B3VA 1FFGB 1JJ4A 2XI3A 3DOMA 3K8WA 1NSPA 2MTLA 3FCHA 4GKJF 4H4MA 2DNLA 3NGSA 3D7FA 3UQSA 4RW4B 2DNYA 4WCEQ 2VBYA 5ISVA 1BGXT 1ZAVA 4K50A 3ITHB 2IM0A 4LF4F 5EWEA 1RHQB 2W9CB 2HHUA 4ECUA 1RTIA 3L3CA 2ZBIA 1VC6A 2M5YA 4NXMF 4K4ZA 1PC5A 3WZ0A 4KAIA 1FVSA 4A46A 2CNOB 1TKXB 4LF5J 4J9VA 1SUQB 1IKXB 3M2VA 1RWOB 2OPQA 4BCAA 1P9QC 1FE0A 2VG5A 3UY5A 2CAJA 1RTDB 2AYEA 1Q2YA 1RZMA 4AVAA 1TUVA 3OSNA 3KHRA 1RAOA 3BR9A 2PEBA 2IDLA 3RBXA 1FT8A 1MWYA 2Z8QA 2PJ3A 4CLLA 3H8YA 2YKPA 4USMA 2V4QA 1Z8WA 4DL0C 4P4EA 1HR0F 4KFBB 4HHJA 1ZG9A 2QGFB 2BL1A 2MB0B 1VKCA 4LIRA 1JLCB 1SL2A 2YWWA 3MDFA 4H4OA 4RWWA 3SI1A 4KGZB 3QWUA 2XSJA 1I51B 1HBMB 4QIVA 3N5FA 1AMPA 4AG7A 2ATRA 5C24B 1P4NA 2C2MB 5F8JA 2PMHA 2YNDA 1QSRA 1C4AA 4IH6A 3HHLB 4GMKA 1HDQA 4M6GA 4RN7A 5A27A 5LYFA 1LW0A 3M6UA 1NK4A 4CQ1A 5J1EB 4A95A 2H5EA 4DR4F 4ID5A 4EI2A 3D7HA 4DCOB 2HZVA 3UNGC 1TKJA 2F7VA 6FDRA 1FD8A 3FC9A 4FYVB 4AT1B 3PYGA 2MQ8A 5A76A 1W26A 4KKOB 2HFOA 2NCKL 5IM0A 1MSWD 3IGNA 2NSCA 1LFWA 2B4BA 1S1VB 5HVFA 3CDXA 1IYLA 4K30A 2EK1A 3Q8YA 1URRA 3VWSA 1C0TB 1YJRA 3BXMA 2OPRA 1UMJA 4R57A 2QLJB 1R0BG 2UXDJ 2HLTA 5B0AA 3MPDA 3Q8RB 5C7PA 2PSZA 3LA0A 4IUSA 4DV2J 4Q0BB 4KBIA 1OJ4A 2MKSA 4KVOE 4P6QA 2QA1A 1WJ9A 4DQSA 1D9AA 2O3DA 1RXTA 2MY7A 4ALZA 4OC3A 4Z37A 2DCUB 4ZVSB 4WU3A 1B0VA 3FCVA 3GLJA 5AGEA 5ETLA 4Y28C 5EX0A 1A2ZA 4B02A 5E33A 2YY3A 1UPPA 3IFEA 2UUBJ 1KONA 3WX8A 4O3NA 3BREA 3JXOA 2K3KA 4XPDB 4QR0A 1TKFA 1QSMA 5CYQB 5HSPA 5U47A 2C3UA 4ZJQA 1D09B 1QY7A 4OX9J 5B0FA 4QB9A 4HACB 4KO0A 5AJ3J 1KOOA 2XMWA 2CPYA 1SBRA 4CT9A 2B3VA 3MI7X 4YEAA 1WC1A 4MH8A 2XS7A 3D6HB 4LQGA 2DR5A 2R8HA 4LFCJ 3AODA 4ZP8A 4ZVHA 1N71A 2DNKA 3W63A 3MUMP 4JI1F 1RDRA 2KG1A 1R8AA 4OLOA 2YX4A 5GAEI 5F3ZA 2FS5A 2AQ4A 1T3NA 3LF0A 3M30B 2QT7A 1SV5A 5G0RA 4YFJA 2NYHA 4F3QA 4M5NA 4OZNA 3SJXA 4RNNA 4CIOA 2JFKA 3BGRB 3MOZA 5DZ7A 4U6PA 2QL9B 1F5AA 3JRUA 3RR8A 1P1TA 3AH6A 1VQYA 4NCGA 5JXSA 4DF8A 3CMES 2ASLA 4L8AA 1AZSA 3BKFA 3NGRA 3H25A 1X5SA 3GZ7A 5F9LA 1HBMA 2BE7D 2KXFA 3RR7A 2FVPA 5HXDA 3UE2A 4TN2A 4B9VA 2WBMA 2Z2ZA 1YX2A 1IKVB 1B4SA 3MAAB 5DO2A 3QWPA 1YJTA 2DCLA 4ID5B 3QAEA 4NA3A 2DNRA 3VVTA 2Z4PA 3TJ8A 1Q8IA 3OFFA 2F5IA 2QL5B 1R0CB 1FRXA 2BQRA 2CG4A 5E41A 2OTJS 3RB0A 3JAMU 2L08A 1Y9WA 2ZH1A 4XPEA 2XWYA 4M1KA 4FF4A 2BR0A 1RCXB 4O3QA 4DCPB 4AL5A 1FKPB 2KDOA 1M1DA 3OR1B 4B3MJ 2KH9A 4PWWA 1TL4A 4O23A 3NFZA 4OC0A 3CXCR 2MQMA 3DRPA 2D9OA 1XOVA 1Y4ZB 5FDLB 2AGPA 2B51A 2ZDOA 2JEWA 2C3YA 4EO6A 2I00A 2MHNA 3A8EA 3C66A 1OYEA 2RKIB 5H9EJ 1GQEA 1RAFB 5T7LA 2BANB 1SPBP 5CXTA 2EFGA 1F2PA 2XY7A 4OI1A 4WBFA 1UP1A 1M4IA 1XMQF 1AA1B 4DFKA 1NDKA 2AP6A 2WONA 4LSNB 5KT2A 1QAYA 1VR6A 3ETMA 3P8BB 2KHDA 4BBYA 1XF8A 1WC3A 2YQ1A 3I0RA 3BQ1A 2EKYA 1C0UB 5HQMA 2CQ2A 2QA4G 2W2OP 3NWGA 3EVMA 2HK2A 4ECRA 1GT8A 3P4UB 2HUZA 2CFXA 4DQRA 5J8FA 2ZEDA 3NH4A 2OPPA 3R7SB 4IYQA 4U8YA 4NLTA 5KTDA 3MXHP 1YBTA 2KTQA 2BE2B 3BKUA 3SCLE 4UY8T 3HVRA 2C42A 3TTHA 2GQQA 1UTAA 4JI0F 3RUBL 1CEZA 1RQ0A 1UWBB 3C6TA 1X4CA 1LK5A 5A8KA 3NRBA 5J2PB 1VK3A 4MY3A 2MXYA 2DISA 3R1KA 4U7CA 4LFBF 3JTOA 1B64A 1X4BA 2Q4ZA 4DFPA 2RAQA 4PAAA 4MIWA 4DPTA 3JSYA 2O4HA 2DH7A 5G4DA 3QT6A 2IAJB 1IJFB 2M52A 4USKA 4K8RA 3FEDA 5LMUJ 2Y1RI 1VQ4S 4ZY1A 4XAKA 1RT5B 1BC6A 4ID8A 1S49A 4YOEA 4I6YA 2D3ZA 3BGRA 3CMAS 1RGVA 4PV6A 1RT7A 1N36F 3M05A 3OFHA 1DQ9A 3OV7A 4NCZA 1H73A 4NXMJ 3PB7X 4OJ3A 1NU4A 2EVZA 1X4EA 4YB1P 2QO3A 4CLWA 2I79A 3D3SA 3IP0A 5D4PA 1H2TZ 2NXJA 2RRBA 4P71A 5IFMA 3SZ2A 1LV5A 3GJQB 1FRIA 2FGOA 3JYTA 2KCWA 3JSMB 3PGPA 5KFHA 2PJ1A 5M2UA 4F6AA 2OH1A 1VCTA 3I96A 1FJGF 3O6QA 4P4FA 1WEYA 2EFPA 1G1XA 5HMXA 4G1PA 3RRHA 4HTIA 4P2MA 1LFPA 3SDEA 4MFLA 4LUBA 1HPZB 5KFJA 4IG3A 3GFZA 4KC5A 3KLHA 4D3GA 4EMEA 1IR0A 3B54A 1WI6A 3R7BB 4TLRA 1OSCA 1HWLA 2GLJA 2MZRA 2MJNA 5HBMB 2EBGA 1F6TA 2LQJA 1IR1A 3HJVA 1YJ7A 2P8IA 3RAXA 1YG0A 3NE7A 3E0KA 3F41A 2AIRB 1RT4B 1YHQS 2F8HA 5LT5A 2PJ6A 4X2TA 3DLGB 2YPYA 3CJKB 4ZPDA 3S9NA 3I9V9 4CWBA 4L76A 2NUUG 3DOLA 3NKYA 2A6OA 4M5MA 2PJAA 4EVYA 2DT9A 1FERA 1P0HA 2UU9J 1GMUA 2W24A 4ZPAA 1KLMA 1VOMA 1ZA1B 4HEA9 5KG1A 4LF8J 1RBAA 3W8PA 3I32A 5CZXA 1TQLA 1AW0A 3KMQA 4DPUA 4XPCA 1VS3A 3K0JA 3BR8A 3KUGA 2VEZA 3C8YA 1U4BA 4IDKB 3FBEA 4DJLA 3KJQB 4NLQA 3IG1B 1TMJA 3AOBA 1TXRA 3CCSS 2P9CA 2V9KA 3S6GA 1DRZA 2ZDPA 4CYUA 1S1WB 2NPIA 5A8RA 4R25A 1OBRA 4FYDA 3GONA 5IZHA 1NHKL 1H7WA 2F40A 2AJ6A 4NGNA 1IBKF 2IMWP 2AFOA 1WELA 3TANA 2XCAA 2N4DA 4Y2KA 3DGPB 3TT2A 3JTNA 1XMTA 3M9OB 4ILMA 2HBRB 3VZIA 1E6YB 3CT9A 1RAJA 3W91A 4NLOA 3W2VB 4ZY2A 2BW2A 2LXUA 3I4PA 4ELVA 4OADA 2RS2A 1VFJA 4JB8B 1QSSA 4DX8H 1ELLP 4Y49C 1HNZJ 3TZYA 1S0VA 5KOWA 5F46A 3S9LA 2GE3A 4B08A 3EZ5A 3MEGA 3V81A 3ENVA 2FVGA 2JC0A 3EGZA 4FXWA 4OI4A 3G8QA 2L48A 3VAIA 1FKOA 4NLWA 4ZIVA 5HLFB 3RZAA 1Y9OA 4R87A 4KHPJ 3K58A 3K17A 3PEIA 2ZZNA 3NCRA 2FYXA 2DGWA 1AYEA 2HVEA 3SIPB 2BA9A 3D68A 2IIHA 1UA0A 5AE1A 4CYUB 3A13A 5CA5A 5A6PA 1XR5A 4X65F 1UFWA 3CCUS 4KB7A 3K89A 2JRSA 2B9XA 2J6TA 3HZEA 4C8MA 3O1LA 3MM8B 3OW2R 1KHVA 5KG3A 2WOMA 1N32F 3UN5A 5KAKA 1JWWA 2BJ9A 1GTEA 4HYKA 1U1QA 4P7TA 4DL4A 3EJMA 1V3SA 3KZWA 1PAEX 1ZLHA 3FQKA 2NYIA 3NAHA 4HT5A 1EX8A 4WF9Q 3IRXA 2XEFA 1X0FA 1M5KC 2IVFB 4DSKA 1VRUA 2DR9A 1YITS 4NYOA 3Q2TC 3R9EA 1IBMJ 1WKJA 3QNVA 5IX3A 1SKRA 3DLBA 1MWZA 3DLGA 4KT0C 3FGVA 4I2QB 4X2BA 2C22A 1LEOA 3KKWA 4QIWD 3VQSA 4WFYA 5E3CA 3PB4X 3QATA 4R5PA 4P4DA 3L7UA 5F47A 3N6MA 2R7TA 3FNCA 3FSYA 5LMNF 4K3NA 2N82B 4B9LA 4RI1A 4C11A 4Q8EA 1Z4EA 3D0HE 5A0YA 1N5VA 1XC9A 3LOUA 3EE3A 5CZVA 3TCVA 1OO0B 1JLBA 1N5YB 1I5OB 2J0WA 1FDNA 1R89A 1RI7A 3R8YA 1WG1A 4FUUA 2VU5A 4ZP7A 3DI6B 4AQYJ 4LRFA 2IJRA 4MFBA 5KTCA 2DRBA 3VAJA 4QIFA 1M1HA 2Z56B 4RW8A 1YBAA 1OIAA 5DLFA 3TO9A 1HI1A 3QLHB 1RTQA 4HH1A 2BKNA 4NL5A 2HQ3A 1F9HA 1PJ5A 1R3NA 3CWJA 3DYAB 1MMLA 1Z1ZA 3V6JA 4NA1A 3SJFA 4KO0B 3S6EA 1XR7A 3MD1A 4AVBA 4E8UA 2BM0A 1JNRB 4J7CA 1HA1A 4ZCIA 1BUXA 3I55S 3QIPA 4PXCA 3V6DA 2GS8A 2E5LF 3FZBA 2P6SA 4CGPA 3MFIA 1LXNA 2MSTA 1S79A 1S1UB 1RU2A 2Q4VA 2RB7A 3KDNA 1HNVB 1EQMA 1L3SA 1GXUA 4E2AA 2FGCA 2CQHA 4DI6A 4F2RA 1H2VZ 4NEZA 1LWCA 3B3SA 3ENWA 2J7WA 5D3GB 4G1IA 3HLUA 5ETQA 3CDBA 1UZDA 1EP4B 2BJ7A 4JI8J 2J0XA 3PEHA 2JFDA 2RRNA 4LVOP 1B99A 3A1YG 1NZAA 1RKJA 1YJVA 1MU2B 4FNIA 4BWJA 2LDIA 4E2FB 4DL7A 4ZVUB 2RMLA 4Y2IA 1IKWA 3J81U 1F5CA 2DRAA 3V6HA 1TL3A 3KASA 2HHVA 2RQ4A 2OPPB 3HVTA 2WW8A 3OD2A 2WYRA 4C8NA 2MZ1A 2MKIA 2E9ZA 3GV5B 3IM8A 3E3XA 3H8GA 1YDLA 2WVCA 3TJ9A 2P6TA 2WVBA 2QL7B 2OD4A 3VHQA 2ANPA 5BXIA 4W4MA 3KLGB 4CYOA 3ISNC 2V67A 4OI3A 2KO1A 4YP3A 4USVA 1NKCA 4H4OB 5CYMB 3QAYA 4FYYB 3F8KA 1CJWA 4ZHRA 1SIWB 3DKDA 1KC8T 5IC4B 3DR6A 2B4UA 4FS1A 1IWGA 4UOFA 2HLUA 2FHMA 3RRGA 3GB0A 3FYNA 2X3DA 3W7BA 2ABZA 2K3IA 1GXLA 1Z4UA 2KM8B 2D7SA 4LQ6A 1TKZA 2NR0A 1QE1A 2LDYA 2PGCA 4NCAA 1RU1A 4USIA 4NMXA 2HK3A 4OV6A 1KQKA 2XZTB 4KVXA 4O4RA 5F8HA 4P4BA 3NGDA 4F0XA 3UR0A 1GH8A 4G6VB 5KTQA 5JQ4A 1FKOB 3TRGA 3CTRA 3H8EA 1S7KA 3B8GA 3H2VE 3SSRA 3PO5A 4KGVB 1WKLA 3DI6A 4CTAB 3POTA 1S4EA 3PCOB 4N41A 1RT2A 4U7UD 4MBUA 3UCGA 3QLHA 1NSKL 3HVWA 4YWYA 4BC7A 3H4DA 1M44A 5A2QU 2V5HG 1MROB 2VONA 4V19J 3PHEA 3I0SB 2OJ3A 1S1XB 2AZ1A 2RQKA 3DDIA 2VV5A 2YKNA 1FNXH 3JS9A 2D4OA 8AT1B 1FX2A 3HK2A 1R31A 5GAGU 3T1AA 1JLGB 2FDNA 4FD7A 1ROFA 2XC9A 4F4KA 2LXIA 4CYQA 4PK3A 2PJ5A 4I0WA 2ZJQQ 4NGPA 2BVZA 2DNQA 4OHXA 3I6PA 3TJAA 3PACA 2VG6A 3PKYA 4BBHA 2CWXA 4NLYA 5EWFA 4F0HA 1HARA 4ICLB 4RW6B 4ZYQA 3T9NA 5CYJA 4L89A 4R8UB 2VH7A 3MM5A 3HCXA 3FB3A 3OHBA 1SJFA 4L3NA 2XO7A 2F4VJ 2XSFA 4QVTA 1DLOA 3UD4P 2A2DA 4DV4F 2J8SA 1Q82T 4RJVA 2GREA 2JEGA 1APSA 5D6GA 5F09A 4JV2A 4KS9A 3BO2A 4Q38A 5CHCB 4K4UA 3GILA 2QSWA 1ZM9A 2QFJA 4JLYA 1OQ6A 3AJ2A 5C5JA 3OPKA 4R6TA 4C3KA 5HJYA 2COLA 5D3GA 3PR4A 2JNJA 1U45A 2JHEA 1V5IB 5F8GA 1RA7A 2CPHA 4MFBB 3K5NA 1NJXA 2UV8G 4OZ1A 3MTJA 4DR6F 4ZDNA 5GAEU 2Z30B 2D3UA 3MR2A 3DYAA 5HMNA 2M8DB 2AFUA 3N7ZA 2K1RB 2W2QP 2AFWA 2ZEHA 3IBFB 4KOUA 2QSFA 4DR3F 2CUYA 1B0PA 2EC0A 4WKYA 1U2RA 3R95A 1AZSB 3VH9A 4ZHRB 2B6AB 2DR6A 1X10A 2J8MA 1BOBA 2BYCA 1U6MA 2CJQA 4KQZA 3MMBB 2V63A 3ETOA 2B8QA 1URNA 2GANA 4ZVRB 3RBZA 4ECVA 4NYPA 4HI2A 5L46A 3G8TA 2ILYA 1VRTB 5D15A 2VOOA 4CRJA 2VG5B 3OSPA 3BH6B 1UW9A 2JEJA 2OMOA 3TAPA 3EZOA 2YNHA 2LP4A 2I8EA 1XIXA 2H9ZA 3FECA 4ZP6A 1MWQA 2Y0MA 3BPSP 3HD2A 5IM0B 3UCZP 4F8RA 2LFVA 2H3EB 4H2KA 4F02A 5KFXA 1L3TA 6AT1B 3SQOP 2OUGA 3GV8B 3HUVA 3BB5A 3G6ES 1BMQB 2CG8A 1YSJA 2UV8A 1TL7A 3DOKA 4NRTA 5LMNJ 3H2UB 1UVJA 4KOSA 2ACYA 2NPFA 3PBEA 3F56A 3SCIE 2JBKA 3O44A 2CJKA 3H8FA 3OWCA 5JM6A 1LAPA 2F8EX 1HFEL 3A8JA 5GADU 9RUBA 2A6MA 2MZQA 3C3LA 1MK4A 3DLEB 2JLFA 4NPOA 1L5UA 4R7MA 3PX6A 1QAXA 2FVRA 1Q1KA 1OY8A 3AHPA 1HWIA 2NQPA 1EIYB 2ZITA 4AXJA 1KVJA 1PAUB 4UQGA 5L1KA 4PSWA 5HI7A 4OJGA 5KG7A 1N5QA 3HHDA 2DGUA 3D6FB 2OZGA 5EMIA 3IR5B 2VQFF 4WJBA 4A94A 3P96A 3D1HA 2FLOA 3X1LB 1N5SA 3GWCA 3EFAA 4V1Ak 3OL6A 4C9DA 3QRQA 5EC4A 2B4DA 3MFHA 1U47A 4USHA 1KWMA 1N6QA 2LU1A 5DG8A 1QVGR 3N6NA 4QWEA 3P49B 2ADBA 3W5ZA 3H4BA 2M7SA 1R0AB 2Z3NA 2JDJA 2KN4A 1ZM4A 4FYWB 1IYKA 3L95X 4C7QA 2LECA 1FRKA 1IBMF 1VI7A 3KNAA 1HWKA 2XWXA 1KQSR 1VQ8S 2XEJA 2RHQB 3D6MB 2KT3A 2YNIB 2PSWA 3VCDA 3GYGA 1T9VA 2GV1A 2FJDB 1N8RT 4W98A 2OP5A 2XMTA 4U96A 1ACMB 3CEDA 4ZLNA 4QCLA 4I7FB 4YDDB 5JH9A 4LF8F 4EBEA 2QJ8A 4M5KA 4OZLA 1VIXA 2WCXA 1U1OA 3ISXA 5AJ3F 3EO4A 2DR7A 2R7VA 3DMJA 2YWKA 3TC8A 7FDRA 3KKFA 3I3GA 4Y3CA 2BCOA 2XCPA 1X12A 1F60B 4X62F 1RWVB 3PB9X 3T90A 4PG7A 1U25A 2B9EA 4J9QA 2LVWA 1MJ9A 4YY3F 3THTA 2J76E 3I87A 2V4RA 4B12A 4FS2A 1K73T 1RHRB 3NLCA 4MHDA 4JI7J 5HJXA 2AD9A 5GMDA 1M4GA 2WTFA 4F3OA 4KOXA 3A12A 2OEJA 4DV1J 1WSVA 3QRRA 2CTBA 2QRRA 4KSIA 5D4NA 2ASDA 3MAHA 2NZCA 5I0CA 2VQYA 2BJ3A 3MM5B 1U1LA 3IR7B 3CCTA 3IAS9 3PKMA 3OUYA 3CD5A 1UVKA 4GXHA 1S97A 4ED6A 3P2HA 1R27B 1U49A 1CPSA 3M2VB 3PW2A 3DLKA 2Q7BA 3R5DA 5ETRA 4ZGYB 4XIUA 2V8GA 3GG0A 3GSIA 4M94A 3GFHA 2WPWA 3G4SS 3NOCA 1TAQA 1T9XA 2IYIA 2CF4A 4MHZA 2E5HA 3UW1A 4EYHB 1WF2A 5C42A 4ZBGA 2DH8A 4QPTA 1OWXA 4OX9F 2KRRA 1CBXA 4JI5F 1ITPA 4HNWB 1DZ5A 4UCMA 4RO0A 2M2BA 3UVJA 2G9DA 2Y1LB 2ZUAA 4P7VA 4C7IA 2FC9A 2AX0A 3GFXA 3WHIA 1B3TA 1WF1A 3C14B 4OZ5A 1SKWA 4ED5A 4LRBA 3MRUA 2X1AA 4BINA 2NSBA 1PIEA 5DDOC 4OMEA 3E8OA 2J0SD 5J1PA 1TF8A 2I2YA 1IBLF 1PYTB 1M5PC 1QLNA 4ONUA 2IC3B 2KZMA 1U8SA 5BYQA 1JJCB 2M70A 1BE4A 1SI9A 3D66A 3I9SA 2HS3A 2MLYA 1A9NB 4IG0B 1YZ7A 1C1BA 2OPSA 4LF4J 2HWIA 3VAMA 1M5OC 1NHUA 2XB2D 5F8MA 2VDIA 5D8HB 4B11A 4K4WA 4FP9A 4M5JA 2W9BA 4NZ0A 4DV2F 4KV8A 2DGSA 3TUZC 4NXNF 3UN3A 4L75A 2ZEPA 2WSAA 1NK9A 1D9FA 2L9DA 3R3TA 3RO0A 2X1FA 2CNMA 1RTJA 3RGIA 4PSXA 1N0UA 2RKIA 1HNIB 3SQGA 1QSYA 1WHYA 3B3TA 3R9LA 3T41A 3JQMA 5HP1A 1UWAA 4DS4A 3OL7A 2AEMA 4CM0A 5AT1B 2R8KA 1PSDA 4DBQA 3VTIA 1YBUA 3MEDB 1D0EA 2G9OA 5D4LA 4Q7AA 5F9NA 3ADAC 3ZZTA 1VISA 1NB7A 4ZPCA 2D1CA 4F26A 2LYVA 1ZAXA 2B5GA 4KJIA 2O66A 2Q44A 4H54A 3DRYA 1TL1A 4XNHC 3RRKA 4OJ1A 1X5TA 5DDQC 4I64A 2V68A 1T03B 4U9ZA 1GX5A 1X4GA 2AYGA 4DUTA 4UIBA 3NGKA 3LACA 4FXDA 2B9YA 2VJUA 2E1AA 2VZYA 4DQQA 4KSFA 4UY85 4OKOA 3MUVP 4QYZJ 3W66A 3M8QA 4I2PB 2VDHA 1I3OB 3Q23A 5HBMA 4KKOA 2XEGA 3MPVA 2BZ2A 4NGSA 4LF6F 2DRDA 1S6QA 2F63A 3ISND 3U1LA 1YVKA 2OD6A 2AKWB 3HO1A 3WX4A 1V0CA 2PRQA 1WC6A 3JB9k 3MMBA 1NH8A 1XEZA 1RWKB 4F0KA 1EKRA 5KFPA 2KXHA 1XMBA 4PXDA 4ER8A 1VQ6S 1RT5A 5G1ZA 4NCBA 5GAGI 1R0AA 1PBAA 3LGHA 2DKOB 3S6HA 1ICEB 3D2WA 5D78A 2KYZA 1LWEB 3KGQA 4LFBJ 4Q2MA 3W1YC 5KT3A 1XR6A 2CNSA 1UWYA 4W90B 4NXYA 1T3OA 1BQNB 3PVXA 4MHPA 2XI2A 1DY3A 4UIAA 4OLPA 3MM8A 4TWEA 2OSRA 2VBQA 2WOMB 3IWEA 3KHGA 2KXNB 1JLAB 1SH0A 4CP5A 2IJZA 2JDDA 2ZW4A 2A3JA 3VGVA 3D0GE 8ATCB