3PFEA

Crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
471
structure length
471
Chain Sequence
GMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEHGYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEMSGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEESGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVHSGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYSEFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPPLVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDKPAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYVLYSFSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Crystal structure of a M20A metallo peptidase (dapE, lpg0809) from Legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Hydrolase
total genus 137
structure length 471
sequence length 471
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pfeA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pfeA01
3SJXA 1ELLP 2JBKA 3FVLA 2F8HA 4TNUA 2O53A 3FMCA 5K8MA 1TXRA 1DTDA 2GLJA 2PE3A 1QQ9A 4CPAA 4O23A 3PFOA 1VHEA 5LYIA 2CIJA 2AFUA 4NGSA 3PB4X 3H8FA 2JBJA 2PIZA 5LRKA 5D8NA 2PVVA 5I4MA 3JRUA 4R76A 2V8HA 3N5FA 5HVHA 1R3NA 3KHZA 5JGFA 2PJ0A 2PIYA 5HVGA 3ISXA 3SJGA 3S9LA 3SI0A 2V77A 1HDQA 3D68A 3PB9X 3CPXA 1FNOA 2PVWA 4P4BA 1F2PA 4P4JA 2PRQA 3FJUA 3VATA 2O4HA 5LRJA 2PJ2A 2GU2A 3TX8A 2PJ8A 4TWEA 2EK9A 4PXEA 2BO9A 1ZG9A 3KZWA 4K3NA 1YMEA 3NH5A 2EK8A 4OIWA 5F09A 2PJ1A 3PB7X 1Y7EA 4F9UA 1ARMA 3B3TA 1XMBA 3HUVA 2Q4ZA 5K8PA 4X8IA 4A39A 3HLPA 4OIDA 4P45A 3D7GA 1YW6A 3NH8A 3B35A 1CP6A 1BPMA 1LFWA 1TKJA 1ZG8A 4FUUA 3H8GA 1CPSA 4H2KA 4UF4A 3D7FA 1TKHA 4OC2A 3B3WA 3GB0A 4OC3A 1UWYA 2QJ8A 1EE3P 1JQGA 3CDXA 4MHNA 2CTCA 4MRIA 5CBMA 2C1CA 1BAVA 4P6YA 1VHOA 3SJFA 1BLLE 1AYEA 3QNVA 4OC4A 4UIBA 3KR4A 3PEIA 4PXCA 3WT4A 3WABA 1PCAA 1QMUA 4PQAA 3PBBA 3D7HA 2J9AA 2PCUA 5K8NA 4DJLA 3K2KA 6CPAA 2I3CA 2IJZA 2OOTA 4A37A 1AMPA 3DGVA 1ZG7A 5HXDA 1ARLA 2PJ4A 4NGRA 2IMOA 2PJCA 3D4UA 3IEHA 4MCQA 4PXDA 3IO1A 4A94A 3SJEA 4NGQA 2NYQA 3D67A 3VARA 2EWBA 2ZEDA 3RZAA 4RUHA 4IK2A 4NFRA 3KQXA 1Z5RA 4OKOA 1YW4A 1R43A 2HB6A 2PJ9A 2ZEFA 5ELYA 2Q43A 3FEDA 3KL9A 4ZY2A 5LYLA 4MXUA 1CP7A 4OC5A 1H8LA 1TKFA 3FH4A 3L2NA 2V8VA 4AXVA 3I1UA 4ZX8A 1F57A 1CBXA 1XBUA 3CT9A 2V8DA 4ONWA 2BCOA 1IGBA 3BHXA 4P4DA 4R8FA 1RTQA 4JZ0A 4PXBA 2JEWA 2PJ6A 2ZOFA 3V38A 5IB9A 2ZEEA 4NGNA 3KQZA 3PFEA 2AFOA 4LQGA 5LRGA 4R7MA 2AFSA 8CPAA 2AFMA 1VGYA 3IIBA 1Q7LA 4ZYQA 2XEJA 3CPAA 3PBEA 3IC1A 2XEGA 4Q7AA 1ZLHA 1LAPA 1GYTA 3IWWA 2OR4A 3VH9A 3NH4A 4NGPA 2XEIA 4UEFA 3S9MA 4FAIA 2PJ3A 4P4EA 3B3CA 2G9DA 4ZY1A 4DUKA 1F2OA 1Z8LA 2AFWA 3BXMA 3T8WA 2GREA 4MHPA 3S9NA 2C6GA 2Q51A 4KSIA 4YU9A 5THWA 1Y0RA 1LAMA 2C6CA 3LWUA 3SI1A 3V7ZA 5JM6A 2PJAA 1KWMA 3WC6A 3D7DA 4Z65A 5LYDA 3BI1A 1XJOA 3KASA 4B6ZA 4MHZA 2ANPA 3B2YA 2POKA 4UIAA 3K9TA 4FWUA 2RB7A 2CTBA 5LYFA 5K8OA 3B3SA 4IAVA 2GLFA 2XEFA 4EMEA 1LOKA 2ZOGA 1XRYA 1BPNA 3D66A 3GUXA 2WZNA 2ZEMA 4P4IA 4P10A 2ZEPA 4W9YA 5D29A 1YLOA 3IJ3A 2PJ5A 1LANA 3KGQA 3ISZA 1VIXA 2ZELA 4FBEA 2BOAA 3IFEA 3RBUA 1XFOA 1TF9A 5HVFA 1HEEA 4NGTA 3H8EA 3PRTA 1FT7A 3B3VA 3KR5A 3TC8A 4UEEA 1DE4C 2PJBA 2RFHA 3FECA 3PB6X 2V8GA 4UEZA 1CPXA 3B7IA 4EFDA 4NGMA 1TF8A 4MHYA 4EWTA 3RAMA 3WC7A 2F7VA 4P4FA 3SI2A 3WC5A 4ZY0A 1OBRA 2ZEGA 3GLJA 1PYTB 2IQ6A 7CPAA 3MRUA 3LMSA 4OC1A 4NJRA 4X2TA 3MN8A 1Z2LA 4P44A 4X3RA 1ELMP 5DS0A 2C6PA 2DEAA 1IY7A 4A38A 5JH9A 4PPZA 2HC9A 4DYOA 5J1QA 4F8ZA 3DLJA 2PJ7A 1ZLIA 1Y0YA 1YSJA 4OP4A 4OMEA 4BD9A 3FX6A 2VL1A 4MMOA 2FVGA 2ZENA 1CG2A 3FEEA 1LCPA 3PB8X 4ZX9A 3NA6A 2AFXA 2QVPA 4F9VA 2QYVA 1HDUA 2NSMA 3KHXA 4YWYA 4NJQA 2ABZA 5CPAA 1M4LA 4MCRA 2WYRA 4IHMA 4WJBA 2CF4A 3KI9A 4ZI6A 4WWVA 4GM5A 4MCPA 3FF3A 3NFZA 4JYWA 2ZEOA 2AFZA 4MCSA 4G1PA 1CX8A 4OC0A 3BI0A 1NSAA 4R6TA 2ZEHA
chains in the Genus database with same CATH superfamily
2HS4A 4FF2A 3SJXA 1ELLP 3DLBA 4XNHC 2FJXA 2F8HA 5KFEA 2GIQA 5E3CA 2VZZA 1W7WA 3H2LA 1KVKA 5DZ6A 2UUTA 4YY3J 3HSGA 4ZHRB 1H6KX 2HQYA 4GKKJ 2CIJA 1V6HA 3QGHA 1JLAB 1K1QA 1B0PA 3OTEA 1REVB 2ZVIA 3N5FA 4B11A 1SC3B 2KVIA 1KSPA 4IRDA 2LXFA 5HVGA 2A3JA 2F65A 3CEDA 2JDDA 2PFFB 2P6EA 2XCPA 3ZZRA 3POTA 4ZK7M 3DRRA 2P9GA 2ZVSA 4WFNQ 2HNZA 4P4JA 3Q8YA 3W61A 1M4GA 3L9ZA 5H1SV 5D78A 1S49A 2JDCA 4CLTA 1H3DA 2C2RA 3NH5A 1RAJA 4WK1A 2CPXA 2RHSB 2CJQA 1XMBA 3D54A 4RW9B 4ZN3A 4HHJA 5IS2A 1MG7A 4IDKA 3MEKA 1YW6A 5A6PA 4OIXA 4LR8A 3UDLA 4HI1A 2ZJRQ 3B35A 4N47A 2MGZB 3LWLA 2R8IA 1SJ1A 2M5YA 1Y00A 1Y5IB 1W25A 1WF2A 1RB0A 1OSCA 4MRIA 5ISVA 1VQPS 1QAYA 1M0SA 2RDDA 4OC4A 5J2QA 1PCAA 4K0KF 1W26A 4PQAA 2YNDA 1X4HA 2PRBA 1N8RT 1N5TA 3B82A 4ECQA 1QY7A 3DMJB 5GAHI 4O3QA 3LQVA 4DUZF 4LF5J 4DL5A 1TKTA 2HHXA 3DM2A 2LYVA 2XO6A 3BJYA 2MQQA 4TLRA 3TARA 3PW2A 4KOTA 4TU8A 1YGYA 4B02A 1RT1A 3OV7A 4FBUA 1HWKA 4DX7A 1LXJA 4LSNA 2LA6A 2FVRA 1YBAA 5HBMB 1M44A 4QWCA 4CAWA 1HPZA 3W1YC 4NE9C 2GIFA 1RLDA 2FLPA 1GMUA 2Q7SA 2ZEEA 2UVRA 2Y0MA 4ELTA 4J5OA 3P8BB 1XMTA 2LQ9A 1YJVA 3K5NA 3LP1A 2GJ2A 4Y2IA 3B4DA 2NSBA 4OYPA 4DEZA 2GIRA 2ZDOA 3SCLE 4UQTA 5HMWA 2AZ3A 2V2QA 3MFIA 3BKFA 3CJTA 1ZAXA 3KHRA 4ATNA 5IZHA 4EFAC 2UXDJ 1K8AT 1LAMA 3CDWA 1J5OB 1RHQB 4O44A 2E5LJ 1RYRA 2RQKA 5EUHA 4NLUA 4MFBB 3DOMA 2IPOB 2L3MA 3B2YA 1EP4B 1JLGB 2HV2A 4DR2F 2Y1RI 2ZH7A 1IKVB 1TP7A 4QR1A 5LYFA 2V9WA 3PR4A 2PC6A 4L73A 5B0AA 2R7VA 2EK6A 1IR2A 2CXAA 4B10A 3KDOA 1YLOA 1KTQA 3MEDA 1PUAA 2H4YB 2DHSA 4F50A 4TY8A 1VIXA 2ZELA 4CLFA 5F49A 3CDUA 1LW2A 4CLPA 1S10A 1TF9A 2D9OA 1HEEA 3LACA 4ZCLA 3BQ2A 3KK2B 4YR3A 1KDNA 1YJUA 2HBRB 1X4AA 3FRMA 2HHTA 3W63A 3NE8A 1BWEA 1JX4A 1T95A 4KT0C 3AA9A 2C2KB 1LWEA 2RD5C 2ZW5A 4ZBGA 5DM6Q 2Z3PA 5F3TA 4DN0A 3W9IA 2EFVA 1YLEA 1LW0B 4PG6A 3G4SS 3PM9A 5E2QA 1H2TZ 2IJNA 4CLKA 3M8SA 2J0SD 1A2ZA 4FD4A 2CJBA 3M30B 1AFIA 3KJVA 3HZEA 4DR5F 2BE9B 4OZJA 2HG4A 2KYXA 2DEAA 3Q24A 4Y49C 2HC9A 3ILJA 1TL1B 5ADZA 3MUTP 4F8ZA 2Z11A 2C2DA 2MPUA 4UQGA 2A10A 2B4PA 4DV5J 2JEGA 2DEJA 4Y65A 1HQEA 2CJXB 4CIOA 1KD1T 1G2EA 2VA3A 2C3YA 3PZJA 3R7NB 1VQYA 2XHCA 2PI5A 5KTDA 4N76A 4L72B 4MFPA 3RNZA 4HLBA 4FZVA 2DNLA 4YFJA 2M2BA 2Z2LA 2MLXA 2DR9A 3Q2SC 2YTCA 1FWPA 3FF3A 3OLAA 3NFZA 2ZEOA 4RLEA 3G8TA 3H5XA 4TYBA 2Y9HA 4LF8F 2MY8A 1RHUB 3BGUA 5CABA 3FVLA 2EKYA 2XY7A 4WU2A 5K14B 3WHIA 2DH9A 4CWBA 1U1LA 3D7SB 5K8MA 3WR7A 4WZMA 1ELOA 4X66F 4LF6J 3RRKA 1RA6A 1RWNB 1BGXT 2AJQA 2C3MA 5HQLA 2YH0A 2ZH8A 3H8FA 5CHCB 4DX8H 3M9MB 2JBJA 4FPRA 2IIHA 2CJ9A 1NK7A 1YBTA 5DDQC 4ECZA 2HNDB 2ZHAA 1Y0HA 5FLXU 4KOUA 5JGFA 4B3RJ 1TR0A 1RAEB 1I1DA 5CZVA 4A8YA 3AB2B 1OYDA 2HVHA 1NBEB 3DFEA 2NXJA 2XHWA 3AD8C 3DHWC 1AW0A 2C2ZB 2F8MA 3TX8A 4OJHA 5F46A 1S77D 3O2IA 4KR0B 3WZ0A 1XNQJ 2G1HA 4L8AA 2E1PA 4PUOA 2DNYA 3KZWA 3BGFA 3NS7B 2FIUA 2PJ1A 3HK2A 5H9EK 4UOFA 3FCVA 3TOQA 2AEFA 4J9OA 3U27A 2C2MB 4NZ0A 3MM9B 4JV5J 2HK3A 3KWMA 2CG8A 1NUEA 4TQRA 4M3SA 3KHHA 4JI6F 3OR1B 2DHGA 3VR1A 5IM0A 4MI4A 2L9NA 1F5BA 3F73A 2PIIA 2EVZA 4OC3A 1U1KA 2HIQA 3UR0A 2QSWA 3KK3A 2OJ3A 2Q0YA 1RWUA 1QE1A 1RKIA 2ZEJA 3LOUA 4QZVB 2VKZG 2H4WB 4P6YA 2OB0A 1YR0A 3C2PA 2ZBIA 1DTQA 4ZOSA 4DCPB 4M1KA 4WTOB 4UFVA 3TZYA 4IRKA 4BBHA 3THVA 1CPZA 2B4DA 1TMJA 3LW5C 3IXQA 5L8RC 4QIVA 4QC6A 4KSEB 1JJ2R 5DLFA 2MHNA 1T03B 3FDSA 4ZJOA 4L76A 3QT8A 3M2UB 1K9MT 1QSNA 3BYRA 4L6V3 2QFJA 1IKYB 3H2UB 2DXQA 3RGIA 1VBXA 1UWBB 2G2ZA 3TT2A 2ZNYA 4I2PA 1FWKA 2NCKL 5SUHA 3IMQJ 3CC7S 3SSQA 3TO6A 2AP6A 4K5SA 1I51B 1H73A 2NS1B 2UU9F 3R1KA 5J2MA 1PIEA 3VAKA 1TL7B 4ZX8A 4P9SA 3LO3A 2C27A 3NOCA 5ETLA 4CT8A 2V4QA 1BXNA 1G1XA 1TKDA 2V5HG 4UWJA 3MPDA 1Y11A 3PFEA 4TY9A 4MIAA 1PYTA 3ULHA 8RUCA 3DOKB 2LQ5A 4IQXA 3PBEA 1HR0J 2R8JA 4CYOA 3MMCA 1G6BA 2OR4A 2XNRA 3VH9A 1MJ9A 4CGLA 2UXCJ 1SQEA 1R8BA 3H59A 4F36A 5HJXA 4MK9A 2B6AA 1Z8LA 3UQSA 1VKCA 1ZM9A 4QWEA 3KLVA 2P8IA 2Q4VA 2Z0ZA 1Y0RA 2CQ3A 4FYVB 1VBZA 2AJ2A 1JMTA 3MAHA 3DR8A 3HT0A 2ANPA 3NMRA 4LQ6A 3AAWB 5DS7A 1DAXA 2BA9A 1S60A 4DBQA 1FRKA 3Q8PB 2AEMA 1CJUB 5DG7A 1HWUA 4R3KA 1X5TA 1XEBA 3CTRA 3BQ1A 3NLCA 5AJ3F 2LEPA 5JQ4A 1P27B 2H5EA 1ZYQA 3KOAA 4LVOP 2L9DA 1WEXA 3UI3A 4KSFA 2CZVC 2R7HA 3MM6B 4NGTA 1UEVA 1JIHA 3G8QA 1U02A 1VLYA 4QU6A 3JVNA 2V8GA 3VZIA 1Q82T 1U09A 3D0IE 1FY7A 4CLYA 1QTMA 1SC6A 5IT9U 2QMWA 4ZA1A 2DIVA 4OYIA 2F7VA 1EQ0A 3QJLA 3FZ2A 2QL7B 5GCNA 3M8QA 4DR3J 3IRXA 4RNNA 3K58A 1RZMA 2YNIB 4CNZA 2KB2A 1YBUA 2XGPA 3CCJS 1PC5A 1S48A 4G1IA 2BKPA 1ZOTA 3GFHA 2RDIA 1VQ9S 2CQ1A 4O4GA 2IHR1 1MN7A 2ZW7A 2W4PA 1NJYA 3WC2A 3GIUA 3H5YA 1S0OA 1WUUA 4IH6A 3LP2A 4OZ1A 5D0RA 2WOMA 2FJVA 1FDAA 1CC8A 5E3RA 4A8KA 1FJEB 2KRBA 2ROPA 1LKZA 2YKOA 5F41A 4KFBA 2KT2A 1X4GA 5D0EA 5DGAA 2UUWA 2JSXA 1WG5A 2VPXB 3CCVS 2WVEA 2GANA 1NPKA 1U47A 1EETA 1F6TA 3BBFA 1DTDA 4EEYA 4B9MA 1IBKJ 3TR5A 4AQYF 5KFGA 3UW1A 3SEOA 1HD1A 2C2EA 2ZM6J 4M5HA 2N3OA 2DH8A 3FBFA 3TWZA 3R5DA 4U7UK 3W8GA 1N71A 4CLWA 4LRAA 1V5VA 3R95A 1HWJA 1NXIA 2DGOA 4RW4A 1YI2S 5LMUF 2Y1JA 1NK4A 2CPIA 4LF9F 4LJMA 4ANDA 2D9PA 5C42A 4R57A 2V77A 1CJTA 2PQ8A 2IYGA 2DPJA 3EICA 4DV6F 5RUBA 4NA1A 3PRBA 3I82A 4CAEA 2G0IA 2N82B 4FDFA 4Z37A 3DC2A 3HMJG 2QC3A 2RS8A 2OP5A 2J6TA 3B3TA 4FNIA 3M9NB 1XWLA 1QM9A 4RI1A 4IFYB 3BKTA 3G6XA 3VHQA 4U96A 3X3UA 3IGRA 3HD2A 1X5OA 4DV7F 3KJQB 3CJKA 1KUVA 4NEXA 3K7RA 1KNZA 5I42A 2R8KA 1PAUB 2BANA 3DXSX 1NLKL 1RTDA 2MKYA 4M5DA 3SSRA 4CYNA 5GMEA 4XPKA 5KT7A 2JDJA 3JB9k 4KYZA 3RTVA 4JI1J 4QIWD 4U95A 5L46A 2FB0A 1TL3A 2FPHX 2JVOA 3QWPA 3QO9B 3SHPA 4C3LA 3PBBA 3D7HA 2KCWA 3AODA 3KG4A 3K2KA 1LRZA 2CQ0A 3GJSB 4A37A 2HW3A 2RILA 3P2HA 3R1HA 2KFNA 4DCOB 3T9NA 4F4ZA 1U6MA 3K0JA 3RYOA 1QVGR 4QPXA 3UCUP 2PEBA 1IBLJ 2DY1A 2FGCA 5I3UA 4QYZK 3KQXA 1R89A 3KKFA 2ADBA 3G9CA 1FNXH 2PJ9A 1UL3A 1WC3A 4TKTA 5LL6d 3DRRB 2HNZB 2Z3MA 3AXKA 3SFGA 1UA1A 4Y2CA 3CT9A 3K9UA 3IS9A 3DDDA 1NO8A 1HL6A 1LWFA 2W2QP 2JEWA 1PGZA 2DNHA 1R0BG 2NYIA 3QRRA 5LRGA 4P2XA 3CCRS 4IDKB 4P52A 1Y9WA 4C2MA 1ZLHA 5J2NA 1RDRA 4ZCMA 3M9OB 3D28A 4HPSA 4DG1A 3S9MA 3BH6B 4WYLA 3F44A 4EUVA 2FUG9 1RCXB 4P75A 4DUKA 1AZSA 2DJWA 4PYAA 1S7FA 1BLUA 3T8WA 4WE1A 4XPDB 2ZHBA 2UV8G 2MZ1A 1WOSA 3MMJA 4H4OA 2V50A 1QSLA 3S6KA 5J2QB 2YNHA 5CYQA 2VPZB 1UFHA 3QAEA 4ZP6A 5LYDA 2AJ0A 3OFHA 4C2YA 4MHZA 4CRYB 3OTDA 4FBTA 1ZM2A 3K9TA 1IKWA 5JVHQ 2BBEA 1WC5A 4DR7J 2LDIA 3BM7A 4I6AA 3MD3A 2G2YA 1TKTB 1P0HA 2KG0A 1S72S 2WZNA 3DM2B 4DPTA 1C4CA 1L3SA 3EX7B 1RI7A 2KG1A 1RCOB 3HCXA 1UAWA 3NRBA 3EZOA 3KGQA 1BOBA 4QUSA 2QFIA 1F2HA 1UA0A 3MXHP 4CI0B 2P5VA 2AYEA 3FBCA 2ZZTA 1T94A 3KHLA 1RT1B 4B3TF 2XLIA 3ENVA 2RFHA 4LSNB 4ILMA 1H98A 1UFKA 2IC3A 4J9NA 3UN2A 2Q44A 5ETKA 3D8PA 4I64A 5HATA 1HPZB 2GJIA 3OFGA 4LF2A 2BJ7A 2QLXA 1RYSA 3P49B 5ETNA 2HRTA 1FFWB 4IH5A 5A28A 5EDWA 3GFYA 3SZ2A 3TTHA 4NJRA 3I0RA 1LOUA 3LP1B 1I94F 5A8RA 1ELMP 1FX2A 5AXKA 2AMCB 1JXLA 3R6GB 4K2XA 5EWEA 5D0HA 3KLHB 4BMHA 4KSAA 3FEEA 3PB8X 1X4CA 1PSDA 1N32J 1Q95G 4BC9A 1ON0A 3Q8UA 4QOTA 3T1HF 2ABYA 3IN5A 2ABZA 4C8NA 2D3ZA 1WC0A 1RAFB 2C3UA 1SH2A 5A8WB 4O44B 3AQPA 3GYGA 4JI3F 2MJUA 4JYAF 5GADI 3PY8A 2AFZA 3NGRA 1MROA 3SI8A 2DEIA 3ZC4A 2OMLA 2O53A 2HFZA 2BQRA 1EHWA 2M3DA 3R96A 4P2MA 5CQGA 4FP9A 1RSCA 3PCOB 3MEDB 4RUBA 2QEXS 2YVSA 4YDXA 1WK4A 4TY8B 1T9WA 4H4MA 1LW2B 2F1FA 3DDNA 5FLXY 1UJ5A 4E98A 1VQ8S 1QDUB 2HHVA 3QJPA 3UPFA 2ZBCA 4LIWA 2W9CA 5KFQA 3OHAA 1B7YB 1VC6A 1U25A 2OLWA 1LWEB 1Y5NB 5AGEA 4K59A 3I55S 2F40A 4JBCA 2LECA 3S9LA 2FC9A 3CD0A 3HULA 2YKNA 2VV5A 2DXDA 3MCSA 4A8MP 3QT5A 4A8FA 3U1MA 2GFQA 3TE4A 3HPOA 2DR7A 3GMGA 3KJVB 2AZ1A 2W24A 2OZUA 4FXVA 1Y3JA 2BO9A 2RUSA 1SL2A 4E0AA 4TXSA 2BV3A 4DR4F 4OIWA 4JLYA 2YX7A 3PEJA 3JSMA 4JI7F 3US5A 1ARMA 1M1KT 2Q4ZA 1Q7YT 3HLPA 1S1TA 2J8MA 4OAEA 3N0VA 2V6AA 3NH8A 1HD0A 2RJZA 1DQAA 3LPYA 3MMBA 1HQEB 5LSLA 2VF3A 4ZVEA 1SJFA 5G4DA 3HDSA 3GILA 5F8MA 1L3VA 2J7KA 3S1TA 1Z8XA 4ES3A 3JSRA 4M5LA 1TKJA 5DQIA 3H8GA 3R5GA 2ZBPA 4NLYA 2WVFA 2YNFA 5KG0A 2MQ8A 3HM9A 4DUZJ 2V9KA 2M4MA 1AYEA 1DTTA 3CW2C 2C3OA 1FTRA 4WFBQ 3VGVA 4WU3A 4F4YA 6CPAA 4AD6A 4HL9A 1ZG7A 2ZDPA 5HXDA 1N52B 4CZCA 1CC7A 2JX2A 2E5IA 3IO1A 3SJEA 1HYSA 5KFMA 3J7Z5 2EWBA 2VIHA 2YX4A 4NLTA 1JLCA 4F2SA 2DH7A 2HKEA 4DR6F 2W7AA 3KL9A 4P73A 3BREA 2E9TA 3L2NA 2XSJB 2EG2A 4ZVFA 4PUOB 2K06A 3EM1A 2CWXA 5JVGQ 3MUVP 2E7XA 3FEXB 4AUKA 3CSKA 4USHA 4ZYQA 5KFUA 2L08A 2CPEA 2V2KA 2IVFB 4W90B 3W65A 1UVLA 2DYAA 2J8AA 3MUMP 2VH7A 4P4EA 3FMBA 1Z8WA 1VJQA 3W2WA 1M90T 3KK3B 4DR2J 4QIEA 1QE1B 1T9TA 3W5YA 3MPUB 2LP4A 1X9MA 3CJ3A 4O3RA 2WONA 1S6OA 1YWXA 3CZXA 4CP5A 4GO5X 1DTQB 1FDBA 3H4QA 1KHWA 1UCNA 2D41A 3DCAA 3O6QA 5IV4A 2B4DB 5LOQA 1VK8A 3QLHA 3HHLD 1IR1A 5EBVA 1ITPA 4ICLB 3GYXB 3V81B 2PDOA 1IYLA 4FF1A 1LOKA 2ZOGA 2YWKA 3UNYA 3FFIA 4ITSA 3KMQA 2K3KA 3VVUA 4LF7F 1Q5YA 1FRHA 2AD9A 2QN6B 3RBUA 2Q6CA 1S97A 4I2PB 2A4NA 3D3CJ 5IT9Y 2PJBA 3W2VA 3JTNA 5J2MB 3S6FA 2B9XA 3QSYB 1EKRA 4GKKF 1CJKA 3FYNA 4DR5J 1SKWA 2YXLA 2YBVA 5IOLA 4N41A 3VF0B 4J91A 3RB6A 1IM6A 2I0XA 4QYZJ 4Y00A 1YKWA 3RB3A 1PYTB 2XY6A 1U6FA 3QQCD 3LMSA 4XDDA 4F4XA 1ZETA 3A8EA 3CJ5A 3MMCB 5F8LA 4M94A 5A6WA 2CQ2A 2ZW6A 5JH9A 4Q36A 2NYHA 4F6AA 2OSRA 3PACA 3EGWB 3QIDA 4NSQA 4YQWA 1YSJA 1TQLA 1B70B 2RRAA 4K7QA 1UMJA 1NZAA 3TZZA 3QT7A 4IOAQ 2B6AB 1I6JA 3NA6A 3EJMA 3ZTQA 1Y9OA 1S99A 4YWYA 4NJQA 4LF8J 4ZPVR 5E3QA 1URRA 2HWTA 4M8LA 2FS5A 2OH2A 4WJBA 4FNHA 2VD3A 4FN5A 4MCPA 4GKJF 2J0XA 3B78A 4JYWA 2X51A 4X66J 1FFSB 1H0HB 3T90A 1X9SA 4G1PA 1Q2DA 1NMEB 1CX8A 1DRZA 3VTIA 2AT1B 3BDEA 1VLOA 4TQSA 4LRDA 2JBKA 2B4BA 5GAGU 3PVXA 1LNQA 1SQGA 3VGUA 1X4DA 1N56A 2GW8A 5E7OB 2HRYA 1P1TA 1S76D 1DARA 5KTQA 4IG3A 5GAEU 1URNA 2NQPA 1J2VA 1GTEA 2L9WA 5LRKA 2YWGA 5I4MA 1L3KA 2V8HA 3T3FA 5L1JA 2XYHB 2MMYA 3SJGA 1X60A 2RHQB 4DSLA 3DNCA 3M8QB 2RNEA 4K30A 4HNWB 4BS2A 3PXGa 1CLFA 2FVSA 1IWAA 1GNKA 4PXEA 2H3EB 1MWYA 4JI6J 1FDDA 5A76A 2IVMA 4Z2XA 4G3IA 4IR9A 5K20B 3PB7X 1ZTWA 2PEHA 1TK5A 5A27A 2H9ZA 2DGUA 5D0GA 4EVYA 5ETSA 4H54A 2AJFE 5CYJA 3F0AA 3PDNA 2P0WA 4O4GB 4DSJA 2P6TA 1H2VZ 1R0CB 3FQKA 4MYTA 3D1HA 3LP2B 2VI7A 1LFWA 3GWCA 5JUMA 4J9LA 2LQJA 1SJ3P 2GHPA 2B9WA 1YK9A 2IMWP 4P7TA 2C22A 4ID8A 1VBYA 4KFBB 3TAMA 2LU2A 5DETA 2DR6A 2LFVA 4LUAA 1VHOA 1VQOS 4C0HA 2QA1A 4CCHA 3CULA 7FD1A 5LXYA 3WT4A 4PXCA 2HEKA 3LALA 2VBZA 2BW2A 1EETB 3VWDA 3I4PA 5K8NA 4DF4A 1O51A 1WKLA 2DGTA 2BR0A 4NEZA 5A8KA 1CJVA 5M2PA 3D6FB 4MIWA 2HQ3A 3PW4A 2CUYA 2W7OA 1XK8A 1BY9A 1SV5A 4RNHA 2W4CA 2UU9J 4DXLA 1GMVA 4RW4B 1S1XA 1Z2ZA 3ZTSA 1FVSA 1G7CB 3D6HB 4F3OA 5C42B 5D4PA 3IAS9 1CJTB 1SIZA 1HW8A 4I2QA 5AXLA 4CM2A 3KLFA 2X1FA 5IFMA 1A7GE 3MDFA 3HVWA 1RHRB 4WXWA 1FKPA 2VODA 4YRHA 1GEHA 1XERA 4Q2MA 1YVOA 1WACA 1YRUA 3EO4A 4ONWA 3T1AA 3GG1A 3RRGA 2D3OR 4P4DA 3KYLA 2VFSA 2V67A 3KUGA 3PO4A 2OKQA 3R5AA 4OZ0A 4ZPWR 5F0WA 2OEJA 1LAPA 1GYTA 4I49A 3CJKB 2CRLA 1OPIA 4LBPA 2D69A 4HDGA 2BANB 5KT2A 3GE9A 2PJ3A 1S1WA 3K89A 2JEVA 4XO0A 1RTDB 2JEFA 3I5CA 2L48A 3S9NA 5AE3A 2WUUA 1RKJA 3IWEA 2NR0A 1OZPA 1L3UA 4JOUA 2C6CA 4DV4F 1ZO0A 4OMFG 5KAKA 5F9LA 1TL3B 4DV3F 3WC6A 3TEHB 2JLEA 3GV5B 5AJ3J 2NXUA 1RWKB 2HHWA 3WIUA 3GFXA 1NK6A 2I9SA 1CM0A 1TAUA 4H6ZA 4OI6A 4DL2A 1M5PC 4PWDA 2RDJA 3CIZA 4P10A 1SC1B 1R8CA 3NL0A 2AF6A 2BM0A 3BR8A 4NWBA 1XMOF 1JJHA 4IR1A 4R87A 5I3UB 2PMZD 4H4KA 4UZCA 3PJWA 3TFYA 3H8EA 4EO8A 2W8LA 4QR2A 4OX9F 4I6YA 1CVJA 1SI9A 1X8DA 4DUYF 3ZNUA 2XMMA 3ZZUA 1QSRA 4UOHA 2QTWA 1JLQA 2JJ4D 3C3LA 4YB1P 4XTTA 3IWGA 2QRRA 2J8NA 1K1SA 1LWFB 3GFZA 5C5JA 4ZVTB 2VG6A 2WZ1A 3M7VA 2R2UA 1TTHB 4L74A 1FT8A 2LMIA 3EXYA 1NDLA 4HNXB 3ZJ0A 4P44A 1U0SA 4FYXB 5J2NB 3B8HA 2NZCA 3TVYA 2E1AA 1Y0YA 4DG1B 3QT6A 4OMEA 3I9V9 1RBAA 3GV7B 2VJVA 3EPIA 4MMOA 2FVGA 1TK0A 5E5NA 1AZSB 3OFEA 2CNSA 3D6TB 4ED2A 4DDFA 4OHYA 4UT4A 3M2VB 1TU0B 4H4OB 4ZPAA 2UXBF 4ZI6A 2YNHB 1R6VA 1HNZF 1VOMA 2V4RA 1X12A 1S9FA 1S9EA 2Y1IA 4AQYJ 2Z3NA 2HWHA 2HHUA 1Z9UA 4QVTA 1D8YA 4I68A 5T7LB 2GLJA 1IU8A 2PE3A 5KFRA 2HBZB 4B5OA 5LMUJ 3PFOA 2PMWA 1FK9A 5CZXA 1Q78A 3DNSA 3HHLC 5LMNF 2KL8A 4WBFA 5FDLB 4DV6J 3DLHA 3FNCA 3M32A 2XWYA 1YJRA 1QLNA 3G96A 2IC3B 3KLIA 2IM1A 4PG8A 1VQ5S 3CJRA 1FI4A 2FVPA 1HHQA 3M6UA 1F9FA 1Y5LB 1J5EF 4AL5A 2ZXVA 2G0JA 3HF5A 4EZ9A 2WPXA 1FNOA 2PVWA 4HKFA 4NCGA 3FJUA 1N0VC 3EC4A 2D74B 1SL0A 3R2CJ 2GU2A 3E01A 7AT1B 2KZZA 1XE4A 3I0RB 4M95A 3IM9A 3TP2A 1JB0C 3H5ZA 1T9UA 4X4SA 2ASLA 3CJSA 4DV7J 2U2FA 3J7AN 3QSIA 4GO7X 9RUBA 2LEBA 2OTLS 4ES1A 4DHVA 2VJUA 1NKBA 3VAGA 1SQFA 2EEYA 4X62F 2CJAA 3RBEA 1E6YA 2BJ3A 2DNRA 4KPYA 2BSWA 2OGUA 3CCTA 1CPSA 2ZBRA 4M5NA 1EE3P 3OVAA 1JQGA 1M1GA 2UP1A 3N6LA 1MROB 2C1CA 4UTGA 3LGHA 1DURA 1U7LA 2IAJA 2CZ9A 4X4VA 4RWWA 1IJFB 3QNVA 3KR4A 1C1CA 4OI1A 9ATCB 4UWIA 2RH3A 3CJ0A 4M6IA 3NNAA 3SQOP 3C6TA 3GIRA 3Q8SB 2NZ4A 4ED8A 1V3ZA 4WK3A 2IJZA 1WI8A 4MY0A 4O4RA 2J76E 1I1GA 1T02A 2DNZA 4H4MB 5BJRA 4J9MA 2BUEA 2GJFA 4NGRA 1HA1A 3MEEA 2DVIA 3D4UA 4EYHB 4ZLNA 3EDRB 5A2QY 4OLOA 1B99A 3B8GA 1RTZA 2W9CB 1JLFA 2EBEA 2IVYA 1P9QC 2PSWA 1GFWB 4PG4A 4JI4J 3R27A 3E3XA 2YKNB 3CXPA 4PPDA 4JJXA 2G1DA 3MTJA 3EWGA 4K50A 4C0BA 3FRZA 1CP7A 1N4LA 5HP1A 3MZIA 3W9HA 2V8DA 4UCMA 4EYIB 1IGBA 2C2NA 2HVDA 4R8FA 2WVBA 2PJ6A 3JSMB 3OL9A 2BUNA 4WP9A 1S1TB 4FVMA 4U67Q 1Q7LB 2HAIA 3CPAA 2BEFA 1NMTA 3KMSA 3L09A 2XEGA 3MMBB 4A8OA 3NE7A 1NM2A 5H86A 3WX8A 2OTJS 1Q8KA 2MHEA 4KE5A 1RTJA 2R4FA 3BO3A 4FAIA 4NLXA 2XM3A 2B5GA 3EGVA 1NKEA 2IRYA 4KUAA 1CEZA 1OWXA 3LPEA 3VWEA 2GQ2A 2FVCA 5DZ7A 2J9DA 2F5GA 3H8YA 1DTTB 2W7PA 2DT9A 3JTOA 1KWMA 3ENWA 5KFKA 4Z65A 3LWMA 3RG6A 3KASA 1Q53A 4NYOA 1MMNA 2W8KA 1WSRA 5MLCV 2OMOA 4QR0A 1XRYA 2E7VA 3TAPA 4B3TJ 2UZAA 3MR2A 3KHGA 4LR9A 1HYSB 2FLOA 2XMAA 3IWXA 3EMTA 2AV5A 2YWFA 2GCFA 1JLCB 5I3PA 3B3VA 2DR8A 3QIPB 4CM0A 1NKCA 1FJCA 1T05A 3VGSA 4NI2A 4OYWA 3MPYA 4EWTA 3RAMA 1I94J 3TQEA 1H74A 4RS2A 2N7CA 2CPJA 4NCBA 4ELVA 3WC5A 1KN6A 4MJKA 1UVJA 2XGQA 3NNHA 2XWXA 4OC1A 4Y3CA 3ZZOA 2M8DB 4HR2A 4DCJB 3CUNA 2X3DA 4LIRA 3PYGA 2PI4A 3T1HJ 2FIAA 3GZ7A 3NGSA 3N01A 5J1QA 1TL4A 1VI7A 5KFNA 4C8YA 1ZLIA 4I0WA 4OZ2A 4BD9A 4CGNA 2F5IA 1SH3A 1LCPA 2ATCB 4JI3J 3W2WB 3TUPA 2QVPA 2MTLA 1SB6A 2FC8A 5CPAA 2ZD1A 1YJ7A 1B6BA 2LQBA 2WONB 1YDLA 3CJQA 3J7YI 2XI2A 4ZLLA 1O0PA 2RT3A 4J7CA 1PC4A 2CQCA 1K4JA 1Q2YA 3Q8QB 4Y34A 4GC7A 3SIPB 1D0EA 3QAYA 1RTHA 3QLHB 4D3HA 5KG3A 1ZM3A 3UDEA 1HBMA 1F2GA 4PK3A 1XN9A 3FFIB 3FMCA 1FEEA 1MWZA 1I12A 4P72A 2EG1A 3GJTB 5EX0A 2V8PA 1VHEA 1N34J 2CNLB 3LAMA 2PIZA 4D3GA 4M6HA 2AGOA 3W2VB 3M6VA 5HVHA 1HBOA 5CCMA 1C4AA 3DYAB 1NEEA 3RU0A 1L5UA 5FVJA 1CQMA 1XEZA 4K2JA 4DR4J 2M70A 1HDQA 4YB6A 1Q0NA 4U9ZA 1FCAA 4JI7J 2Q3PA 3ZTRA 1IIDA 1F2PA 5L38A 1IBLF 1VYAA 1MJAA 4CLUA 4CYQA 1D9FA 2FHJA 5G21A 3HFVA 3C46A 4NXMJ 5MAOA 5KFPA 5HANA 3O5TB 2IFXA 5AXNA 4DV2F 1NZ8A 2ATLA 2BYCA 3AD7C 1Y7EA 3HUVA 2VPWB 2EI5A 4Y0FA 5LJ3Y 4WTYA 1NK0A 2WB1D 3CCUS 4QW9A 1RT6B 1RABB 1T8EA 1PG5B 2HVZA 1CP6A 2VQFF 1MU2A 1DLOA 2HVIA 2OHDA 2ZFHA 4IFVA 4H2KA 2QA4G 2MKCA 3A3NB 5L1LA 2WBMA 2QJ8A 3ILLA 1NHKL 2RUGA 2MDAA 4UZBA 1RQ0A 3OL7A 5KT4A 4WCEQ 1VK3A 3KK1A 4O0NA 3WABA 1U26A 1ZM4A 1QMUA 1HWLA 1VC5A 3BGOP 1FX4A 4ED6A 3H2VE 3UR3C 1WDTA 5IT0A 4LFCF 1OJ4A 3WQPA 5D77A 1YG0A 1JJ4A 4OI0A 5KFYA 1MLAA 2QYGA 5HMYA 5DGBA 4IG3B 3A9LA 3A8IA 5C25A 1N36F 2BQUA 4DR6J 3M8RA 1Q2CA 5H9FJ 2Q79A 4NGQA 1UZHA 4MH8A 1TV6B 4C3KA 2J8RA 4AB7A 2B8QA 2E5JA 2HIYA 4NFRA 1TL5A 2B43A 4U9RA 4ALZA 2V0NA 1S1UA 2YKMA 1R43A 2HZVA 4A8QA 3D5MA 1F5CA 3QYYA 4DL7A 1WHYA 1VQMS 3OUYB 3BBBA 4OYZA 3M6WA 3QGIA 4NRUA 2B4VA 3FH4A 2OD6A 3ZFVA 1Z4UA 5GAHU 1CBXA 4O3OA 2N7YA 5BYSA 3QFHA 2ZUGA 1VFJA 1VC0A 1AROP 2B56A 3CCSS 2BJ1A 4B9UA 2ZOFA 4URSA 3I5BA 4NGNA 3BEGB 2GS8A 3EPGA 1N5QA 1VS3A 2KU7A 2AFMA 3ENAA 4USIA 4KGKA 2DGWA 3PZPA 2BE2B 3VAFA 5IXUA 2EFPA 3C66A 2R7XA 2XMKA 2UUBF 2A6MA 1DQ9A 1AB8A 3EXCX 2GQQA 1D8ZA 2GREA 3R8YA 5T14A 1RA7A 2BABA 3JS9A 3FSXA 3NY0A 3TAMB 4KSIA 4YU9A 3GR0A 2OI2A 3DN9A 3NXZA 4DX5A 4AG9A 4TYAA 2BX6A 2WRMA 4CGMA 5KG2A 4GVBA 4ZIWA 2F4VF 4YMEA 4B6ZA 1EARA 1KOOA 2I38A 4N8OA 4LF7J 2AW0A 4MHDA 5KTCA 1UTAA 1N33F 3HXMA 2CTBA 4C9DA 2HFSA 4CO2A 4C68A 2GLFA 4PWWA 1RT2A 3D66A 3OTCA 5A8KB 1CJVB 2H5IB 3FCWA 3H90A 4OI4A 2B7BB 4HTJA 1VQ6S 4R0EA 4FBEA 2BOAA 1S1XB 1V3RA 2A0FB 2YQ1A 1TK8A 1C0UA 2G3AA 1XBWA 4II9A 3ISNC 2JEJA 2XY5A 4MFKA 4TU9A 3KLFB 1KUXA 3A12A 1C2PA 4ZVOB 3LD2A 1FKPB 4EFDA 2CPDA 4PR6A 3P4UB 3T9ZA 3TYTA 2ASJA 2QT7A 4R8UA 2B8PA 5C24A 3FVYA 4NLRA 1XIXA 3SSSA 5ETMA 4ZY0A 2B5JA 1M5SA 5F8NA 1OBRA 3MM8A 3SXNA 2VB6A 3D2MA 1S9GB 4WF9Q 5KFSA 3OTOF 4ZN1A 3T5HA 4KOSA 4ECVA 3AXMA 4MT1A 2Z30B 3FBBA 4M5KA 2ZENA 1FE4A 1S1WB 4GKJJ 4WFAQ 4B9TA 2AFXA 3AY0A 2FCKA 2QMLA 2M88A 4LQ3A 3KHXA 4OYOA 3IG1B 1QSMA 2X1AA 1S6QA 4KGZB 3C6UA 3R9GA 3NBPB 5HI7A 2YKAA 4NX9A 4KOXA 3Q89A 4N56A 3T5LA 3J80U 2XSFA 2EPIA 1KVJA 2VHGA 3THTA 3CCWA 2GC8A 4ECSA 1U2RA 1HLWA 4WYWA 3G87A 3CC4S 3OLBA 1OQ6A 1SKSA 1UPMB 4LFBJ 2PN6A 4FKXA 1QQ9A 3C14A 1X4BA 2VKRA 3N28A 4RKUC 3E8OA 4RBUA 2AFUA 4NGSA 4JP8A 1ZA1B 3UD4P 1GQEA 2D4OA 4NXYA 1UVKA 1LQ9A 3N9UC 5L1KA 2ASDA 2KVQE 2ZH6A 2DITA 2PVVA 2AU0A 3JRUA 2KM8B 1YX0A 2XC9A 1T9YA 1JLQB 1UKUA 4Y2KA 5ETQA 3NGDA 3IBFB 1CULA 1Z8TA 2O66A 3G2XA 1S6UA 2VG6B 2R2TA 3QZ8A 4ZIVA 3QB8A 4B13A 5D3GB 3AHPA 2BE7D 4OHVA 2REEA 3T1YF 2F9DA 2GO9A 3TA2A 3K5OA 3PW5A 3O3LA 2IJRA 1F0XA 4DL6A 1UPPA 2DPIA 2MLYA 4QQBA 4IO1A 4ZVGA 4RX6A 5K8PA 2DRDA 4UUWA 1PAEX 2VBXA 3D1OA 4ECYA 1TVRA 1HW9A 2OEKA 2Z3LA 2UVVA 4NOHA 5LJ5Y 3H4DA 5KG1A 3EY5A 4YOEA 1FRIA 4CO3A 4JV0A 3L7PA 4RWXA 1FESA 2MYFA 1TKHA 1GAOA 3WDOA 3B3WA 2ZH9A 3FB3A 1UW9A 1S9EB 4ORFA 1HHTP 1BWVA 4WIQA 4IH7A 3NKYA 3SV4A 4QYRA 2WSCC 2I6WA 2GAGC 3U02A 4YHHF 1MNEA 2B4OA 2UUCF 1S57A 5E33A 4A31A 1B4SA 3JSYA 1FD2A 3DGVA 5E96A 4WKYA 1ARLA 1FK9B 3IP0A 4MCQA 2IA6A 2L41A 1SVDA 3M32B 4KV8A 2W2NP 5F8GA 3E2EA 3KLIB 1HQUA 1WF0A 1QUVA 5ELYA 4OYAA 2MQLA 3OTBA 5BYQA 3FNNA 3DI6A 4NCGB 2IYIA 1N0UA 2DKOB 1JWWA 3H20A 2MQOA 4L3NA 5HBMA 3E01B 1GX6A 3CB4A 4MFJA 2DBBA 3THPA 1VHSA 3N7ZA 2P6SA 2GZOA 2EBJA 2AFOA 4LQGA 1IUJA 1VQKS 3GIKA 2RF2A 2KJWA 4LT6A 1F9EB 1O5JA 1RAAB 2YY3A 4ZVPB 3N79A 4DV4J 4KVME 1E6YB 3NS6A 3GKRA 4DV3J 1RADB 4OJ1A 2G9DA 4ZY1A 2P2CB 1B0VA 4LREA 4KKOA 3CO9A 3TZWA 4B17A 3NCQA 3GSDA 3V6KA 4ED0A 1M5VC 1QJHA 2IAJB 2ZH3A 4Q43A 1C1CB 2DTJA 3D7DA 4A33A 4NXNJ 1HKAA 3C6TB 2NMTA 4YB7A 4I56A 1XMOJ 5HQMA 4NASA 3GCXP 1JNRB 1HMVA 5KFVA 4EMEA 3I5AA 2A6OA 5EHHA 4OX9J 3MEEB 2ZEMA 4DUYJ 1K44A 3KJNB 3RBDA 1JLFB 4PKDB 3Q86A 3K8VA 4M63A 1EX8A 2HNYA 3I0SA 3H5UA 1F1BB 3D2WA 3TVKA 3QGGA 3VAJA 3DRXA 2RRBA 2G0CA 3KLEB 3FECA 2J0QD 5JMNA 1JWQA 2ILZA 2CADA 4DFMA 5HP1B 2YPYA 2E5GA 1XNRF 2MY7A 5J1NA 2WSFC 4URGA 2EFGA 4DSIA 2NXNA 1B64A 3SI2A 4KC5A 1KOHA 5HMZA 1ZZFA 4DU8A 1Q4RA 2NLWA 2VG5A 4KH0B 3MN8A 1REGX 2GFFA 4GC6A 4USUA 2OPSA 2C6PA 2KTQA 1YGHA 3N5BA 2UXBJ 1HNZJ 2VXKA 2B5GB 4YS2A 2XS5A 1R8AA 3VAHA 1T3NA 1APSA 3GP9A 3HVTA 4LF4F 1RBOB 1PBAA 1IQZA 3BYPA 4USKA 1TFYA 3CDBA 4Q2LA 3DLKA 3S6EA 1BQXA 1VCTA 2GAHC 3AT1B 4C8KA 2JC1A 5LMNJ 4TNUA 1UZDA 3U7JA 3G3SA 3SDEA 4K4SA 3MWBA 5F8JA 3IM8A 3VWSA 2MZRA 2EWHA 1M5KC 1TKZA 1FKAF 3AD9C 2ZKTA 1NK8A 3U1NA 1J5EJ 4XNHB 3RYLA 3DLGA 2DXFA 1EZZB 3UN3A 1RT7B 3AJDA 2DNKA 5BYRA 3UVJA 1Q81T 3KHZA 1WTFA 5EN1A 2VZ9A 2E7WA 3MEGB 3MCOA 3DSBA 2PIYA 4NI2B 3ISXA 3GJQB 3RAQA 3SI0A 5E0OA 3W60A 5HL7Q 2LVWA 2MKIA 3U1LA 5HN0A 1S3ZA 2R7QA 1VRQC 4N5SA 5D6GA 3PKMA 3BZQA 1SL1A 2DGVA 1YQHA 2PJ2A 1M5HA 3G6VA 2PJ8A 3FXTA 4E2FB 2OPQA 2GHVC 2ARHA 2CVIA 3Q83A 1NJZA 2ROEA 3CJ2A 4W4MA 4ILLA 4X62J 1BHNA 4DX6A 2XS7A 3DOLB 3IR7B 1PILA 5HJYA 2HFNA 3CMES 2VG7A 3KTQA 3D7GA 2OFGX 1WTBA 2DXEA 3JYTA 4KOYA 3EXNA 3LH2S 4OJGA 2ZD1B 1BPMA 4NLDA 1UVNA 2W4DA 4UF4A 1CBKA 3GB0A 2VOPA 1UWYA 3LA0A 1X5SA 3V6DA 1LWCA 3GYAA 4EBEA 3RB0A 3IU2A 3EFAA 2XBPA 3A8KA 4PSXA 5L1IA 4C7QA 4A46A 1HBMB 4UFXA 2AX0A 2J9AA 2FHJD 2EXUA 2J6SA 2YNCC 2E29A 2NUHA 3R5CA 3D3BJ 1WELA 1AMPA 3QZ7A 1LXNA 4M5MA 1GK8A 4RUAA 2IL4A 2AJ6A 4RW6A 4A48A 3M2UA 2K7JA 2ROGA 2HVEA 1U24A 3D67A 4RUHA 1I21A 2DB1A 4CRJA 2FVQA 1Y7RA 2J9EA 3HX9A 2CWKA 2DNQA 4KLVA 3M05A 4AL6A 1S79A 4UUXA 3BSNA 4ZY2A 1FNMA 2RMLA 2Y0BB 2RC4A 4NZ6A 1OYEA 3FEYB 1B7FA 3KFWX 2MZTA 3UFCX 4F67A 2UV8A 3J7ZT 4HH1A 1VISA 3A13A 4RBTA 4KIAA 1GH8A 4A8XA 4U7CA 4FYYB 2PMHA 3BF4A 3TO9A 2GNKA 4DV0F 4HDHA 5IB9A 3SFUA 4CLZA 3H0PA 3M1VB 3H4BA 2X3GA 4PYDA 4I6WA 3RAXA 3DOKA 1OO0B 2CZ4A 2ZE2B 1B87A 4USJC 4Q0BA 1K47A 1KS2A 1NAQA 2XYPB 4QPTA 5D15A 3NH4A 1YJNS 1MU2B 1TUWA 3TJAA 2GVZB 4LF1A 1DLOB 4IFVB 3JTPA 3HHDA 1Z1ZA 4ZMMA 4AE5A 1R27B 2FY1A 4DMZA 4JV2A 4YB5A 5KFFA 2DR5A 5THWA 5C7PA 2BJ8A 1ZPWX 3V7ZA 2QL9B 5HAOA 3KK1B 4JWPA 1JLBA 1KP6A 3LTOA 3MF5A 4PWUA 3MFHA 2Q6BA 2B9EA 4ZP7A 1SXLA 2QE5A 3B3SA 4IAVA 4DFKA 4KGMA 1QD1A 3ETOA 5U47A 4RW8A 1QAIA 1L3TA 1RTIA 1M4IA 4KJIA 4KHPF 5D29A 2EKNA 1UFWA 1U0HA 4KGVB 4JD6A 4CO5A 5E3AA 4ZP9A 4RJVA 3I6PA 2CG4A 1KBRA 2YKMB 1S1UB 1I5OB 2Z2ZA 4R9MA 3CCQS 2B51A 1FT7A 2UUAF 3FCHA 2XEXA 4UEEA 1UJ4A 1EQMA 3CCLS 2V4JA 3P45B 2G9OA 4G65A 5ETPA 4CH7A 3P5TL 1Q8LA 2BM1A 3CMQA 2KXNB 3TOAA 3OPKA 2IQ6A 4CGOA 5DQGA 3FEZA 2YNIA 4PSWA 4NA3A 3H42A 3DKDA 2DCUB 1JNZB 2QL5B 1YZ7A 4IOCQ 1R8HA 1WOPA 1TIQA 3VQSA 1WWHA 3DDKA 5ETVA 4F3MA 2LDYA 5IC4B 1NSPA 3ZNJ1 2DCLA 3IRWP 3FSYA 2XZTB 4C2XA 2J9DE 2FE7A 1D1UA 3F41A 3NGTA 2HRUA 4DPYA 2YNEA 4Y49B 3J80Y 1KONA 5M2UA 1YQEA 2XS2A 1FEHA 2X1BA 2YQ0A 2BDPA 3PX0A 1RT3A 1U2CA 2CNMA 1OS5A 3ITHA 1NSAA 3BLNA 1U8SA 3Q2TC 3K8WA 3TZXA 2HHPA 2P6GA 2WVCA 3BPDA 3AJ2A 5KG6A 3UDVA 3ZZIA 3MM7A 2JFDA 3BN7A 4O23A 3R9FA 3UO0A 4PQUA 3DLEA 1O6XA 4YP3A 4ZP8A 3IU1A 4U9YA 4JI0F 2F9JA 4PAAA 1HNWF 3TANA 5AG5A 1SJQA 3NGKA 2XMUA 5GADU 3EVMA 3VAIA 5HMNA 1TELA 4LFAF 1XQIA 4C6AA 1NJIT 4DV2J 5KFIA 4NLWA 2WW4A 3POTB 1XR7A 3FBEA 4R8UB 1F9HA 2ADCA 3BKUA 1M4DA 2CQBA 2B5JB 2PRQA 3MM8B 2AKWB 2CQGA 2OD4A 2WSEC 2H5JB 2CQDA 1UWAA 5ETTA 4QJVA 4RL1A 4JI4F 3I9ZA 3V4IA 1HHSA 2M8HA 2XO7A 4I67A 3NWRA 2ZPAA 2VQFJ 3DXBA 3CPWR 3TJ8A 2HYIB 4F9UA 3F0NA 4ELUA 1FD8A 1F60B 4QWBA 1HI1A 3LGNA 1HI8A 1RGVA 5IV0A 4IFYA 2D3UA 5SZTA 2FSRA 4GS4A 4CGPA 1NE9A 4DPUA 3IAM9 3CIMA 3PX6A 2U1AA 2A1BA 3M4XA 2XCAA 5BR8F 1S6QB 1U1PA 4B14A 1FTCA 2IM2A 5DO2A 1IJEB 3R97A 5ETRA 3JQJA 8AT1B 1S59A 2FHKA 1CJWA 2RU3A 4LFCJ 5H9EJ 3SJFA 1CS4A 3CO0P 1A9NB 3PEIA 1S7LA 5KFWA 1RHKB 4FPIA 1WC1A 1N36J 3QO9A 5B08A 1E6VA 1P6TA 5IWAF 4DJLA 2VA2A 4N77A 1X10A 5CD4H 3W3SA 4KZTA 3TNVA 4ECTA 4DL0C 4LVNP 3C14B 4LRFA 5M2RA 4E2AA 2NXEA 5HROA 2Z8QA 2PJCA 1NH7A 1V9OA 1G4CA 2W2OP 4DI6A 4KUBA 2BRLA 1CULB 2ZHOA 1P1LA 2ZEFA 3CD5A 1KZFA 2J7UA 1EJ7L 3TW0A 1MW7A 1Y3KA 1FJGF 3H5SA 2GMJA 5HO4A 4C8LA 3KLGA 1DJ0A 2QO3A 4URQU 1HIYA 2HHHF 1J27A 4RU9A 5AT1B 1ICEB 3V38A 4OFZA 2M7SA 2UUBJ 2KDOA 2I8EA 4H6UA 3CMAS 1LK7A 1WNEA 3BB5A 1TVRB 2Z4PA 3IC1A 3RBXA 5B0CA 2B7CB 2VASA 3B54A 5K9FA 2A2CA 1OY6A 2Z58B 4DJBA 2QECA 3MR3A 2F4VJ 1VBKA 3MR7A 3CXSA 1DQ8A 2CA9A 4NZ7A 1N33J 4OV1A 2QLFB 4QU7A 2DPTA 3TUZC 2V34A 3CCZA 1DY3A 3SI1A 2VFUA 1NH8A 3A1YG 3IWNC 1BUXA 1XMQF 3TOBA 2ZKUA 3DOMB 4NLSA 1XR6A 4YEAA 2VFRA 2EVNA 3G8WA 1RUSA 2O1PA 2PE8A 3GIIA 3MMAA 3S6GA 4K4TA 5F9NA 1NSLA 4P4IA 1M1HA 1M1DA 4CS0B 1P8GA 4X4RA 5KT3A 4KV8B 2JFKA 2CFXA 3D2PA 4KHRA 2W1BA 4WFXA 2JVRA 1IN0A 1HQUB 3R5BA 3PRVA 2ZWOA 2X1GA 2MKJA 1RBLA 3ICLA 4ZPBA 3KR5A 1ZAVA 4ZLPA 4OI3A 3PB6X 2ASYA 3DI6B 5CCLA 2VQEF 4HTIA 1EKSA 4QWAA 4X4TA 1CPXA 2FYXA 3OTOJ 3FSIA 3ILIA 3K2YA 1N34F 2KZMA 4QBUA 2OEMA 1FKOA 1T11A 2VUGA 2W9BA 2MZQA 4A8SA 2LQ8A 4R5PA 4ZITA 3K5PA 3UWTA 3DLLQ 2RF2B 3W66A 1D3WA 2HQFA 4A38A 5EGYA 2PR8A 1NSKL 2PJ7A 4XAKA 1M5OC 4M85A 2VDIA 3KLHA 1V5IB 4YDDB 4NXMF 1H7WA 2OPRA 2QMUB 4KKOB 3N6MA 3IBWA 1S0MA 1C1BA 4DQQA 4DS5A 3RB4A 1ZAWA 2YQ3A 5A8WA 4WWVA 4Q38A 1U6ZA 1RAGB 3R2DJ 4PABA 2IDLA 2OUGA 4YUDA 1HMVB 2ZJPQ 1WJ9A 4Z7YA 3HHKA 2K7KA 4AFFA 3GV8B 3RR8A 4Q44A 1XJWB 4KVXA 4C11A 3HVRA 3P96A 4JI5F 1MN9A 1WHXA 2GO8A 2JEIA 2EBGA 5AE2A 3HT3A 1VQLS 5LYIA 5A0YA 4C4WA 2HNYB 3I0SB 4CRZB 3PB4X 5IB0A 4X64F 4MYUA 2GHWA 2CNTA 3J81j 4RU2A 5DQHA 3T1YJ 4WFZA 1Y4ZB 5ETOA 1U1OA 2EK1A 2DNMA 4L3KA 4RZRA 3PYDA 2RKIA 2RIJA 3O8WA 5HSPA 3CPXA 2W25A 1JLEA 4CH1A 3HHEA 2WHOA 4UW2A 2ZC4A 4X5KA 2OPPA 4ID5A 2HUZA 1WHVA 2VG5B 5J1PA 1ZH5A 4EU0A 3MHYA 3TUIC 2OPSB 1RAOA 1SH0A 1HNIA 2V94A 3TO7A 1X5PA 5CNPA 3FRYA 4A39A 2QA2A 3SBMA 2MKKA 2QMXA 3X1LB 5C2CA 4FS1A 5E41A 4JI2F 4MKYA 2W2PP 2DRBA 2RQ4A 2LCWA 3HVTB 5IM0B 3PNIA 3EDQB 4ZPDA 4KTQA 2O01C 3K17A 3ZZPA 4NF1A 1QSOA 2Q04A 4ANCA 4YHHJ 4OZ5A 1GHEA 3DLKB 4ZDNA 3CDXA 4TU7A 2UUCJ 1Z4RA 1VQNS 1RT4A 4DQRA 3VAMA 4F3QA 4YR2A 3MAQA 2Q66A 5G1ZA 3BPSP 1FO1A 3TAQA 4G1QA 3R5JB 2OFHX 3SDEB 1A0OB 3R1LA 3EGNA 1SUQA 4X4OA 4DLGA 1TKZB 5GMKa 4DPOA 1KC8T 3HD1A 3DLGB 3FJ2A 3OD2A 1DFDA 4PXDA 5DJBA 4IG0A 3UVJB 1VDHA 2HLUA 1Z5RA 2ACMA 1YW4A 2YKPA 4FKYA 3UN5A 2LA4A 5F0UA 2ODFA 2G2OA 4GVLA 1IQTA 1D09B 5CA5A 3TO8A 5LYLA 5KFCA 4B9VA 2XSJA 2K3IA 3ZZZA 3OJUA 2G13A 2OPQB 4KHMA 4BLGA 4A32A 2LXIA 4MY3A 4B9NA 4X84A 1IR0A 5BXIA 2VG7B 1UJ6A 4R7MA 1QSYA 8CPAA 3IIBA 5C82A 1MJBA 2XEJA 4XPDC 3IA0A 3JYTB 3PKYA 4A95A 3ENQA 3AOCA 1GXUA 4OYXA 2ZH5A 2BEIA 1Q5VA 1S12A 1S6PA 3GY9A 3B3CA 3KUHA 2R8VA 4X65F 3V6DB 1LWCB 3BJ7A 1ZPVA 2JLMA 4KLWA 1HI0P 4H89A 2HSEB 2R3VA 2AGPA 2MQMA 4QB9A 3GG0A 2ZITA 4CYUA 4PG7A 2WW8A 4ZGYB 4Q8FA 3UY5A 4K4UA 1NU4A 3MECA 4PRFA 2HMIA 4UIAA 2RB7A 3PIPQ 5K8OA 4CAVA 4YGOA 4ICLA 4A47A 3I32A 3V81A 2JHEA 4ZVQB 4C7IA 3GUXA 1WOOA 3BBCA 1YJ9S 3MI7X 2YGWA 4RW6B 4E8OA 1X7VA 1RWXB 2F3JA 2FZCB 4ZKAA 5F8IA 3T5KA 1LK5A 2LLZA 3R6LB 1ROFA 3CNQP 2Q4YA 1XNRJ 2I5JA 5G22A 3BV8A 5FD1A 2EC0A 2E9RX 2JL9A 2H48B 4BCAA 5IV3A 1U1QA 3Q8RB 3QRQA 1X0PA 4LFBF 4ONUA 1SPBP 4NEYA 4LX9A 3RR7A 1WKKA 4NGMA 2PFDA 5AG4A 4F0KA 4J9VA 1HWIA 3HSJA 4IO9Q 3HHLA 2HFOA 3NWGA 1BO4A 3W6XA 3IRXB 3CXQA 5AE1A 3E0KA 2ATRA 2AYGA 1T9XA 3BO2A 4Q0BB 4X4NA 1ULRA 2UVWA 3T6BA 4O3SA 3MM5A 4IQMA 4DQIA 5DS0A 3R9LA 1NB7A 2HLTA 4LF4J 2CJKA 2XMJA 2MLZA 3NCRA 3RUBL 1I3OB 1GTHA 4QIGA 3FX6A 4PG5A 1CG2A 4ZJQA 4M5JA 1VHFA 2G0BA 1ZZNA 3BJ8A 1JKHA 3WX4A 4K4XA 2DD8S 5DG8A 4IHMA 2WOMB 2CF4A 1T3OA 1KQFB 3KI9A 2E1MC 1JLBB 2OU2A 2HHSA 2PC1A 4GM5A 2AJ4A 5CYMA 4MK8A 3NNCA 3PG9A 3AOBA 1NPPA 2Z10A 4B3SF 1X0FA 3DRYA 3MCNA 3PHEA 3TRGA 3NGUA 4RW8B 4TNOA 2BOPA 1MMLA 1RTIB 1YIJS 2KJVA 2CPZA 5KT5A 3ZXWA 1U0HB 1H72C 2CXEA 3OR2A 5B7WA 2QYCA 1D9AA 1N88A 1U1RA 3G82A 1U8WA 1ZBTA 1OPZA 5KFOA 2BXJA 2V4JB 4MFLA 3T19A 2RRNA 3QRPA 5D8HB 3S8SA 3BGRA 2FHMA 1WWZA 1IKXA 4RNMA 3FC9A 4W98A 2Y8YA 2GIVA 2P6FA 2ZZNA 4P4BA 2CDQA 4ECRA 4MKBA 3KJFB 4YN3B 1PJ6A 1PO6A 4UA3A 1RHJB 4WP8A 2JLFA 2I2YA 3CF5Q 1R57A 2CIMA 3QMQA 4OJ3A 4C7HA 2VC1A 1WG4A 5GVQA 3BN4A 2ZW4A 3I31A 3JAMU 1U4BA 1IB1E 1N54B 3QWUA 4Y2MA 4P7VA 2OSQA 5KG7A 5I42B 1ZG8A 4ZVHA 4XDCA 5AXMA 3D7FA 4HACA 1K73T 4ECWA 4OC2A 2PDAA 8ATCB 1XF8A 1ZA2B 3LAKA 4M5DB 1RT3B 4OADA 4MJ8A 3ITHB 1RHMB 1FERA 4Y6IA 1SQHA 4UIBA 4LBIA 4WXOA 5JJBA 3T6JA 2OZHA 5IQ6A 4KGXB 1YTYA 2FD2A 4PZVA 1SC4B 4F4AA 1HBUA 3LODA 1U2FA 2NREA 4KH1B 3TCVA 3MM7B 1R31A 1WG1A 3EE3A 3MGJA 4CYPA 4PQUB 3DLEB 2MKHA 2XLKA 3GIJA 1W2BR 3K5MA 4U7UD 4NXNF 5CXTA 1KQSR 2ZEDA 5KG5A 2VONA 1RLCL 3KG1A 1QAJA 3DRPA 2HB6A 2Q43A 4DV0J 2HZAA 2FLLA 3MAAA 5KFAA 2VDHA 2NPFA 3HP6A 1H8LA 1RT5A 4B9LA 3QPIA 3OWCA 1RU2A 2EW9A 4JV1A 3IS9B 4C3MA 3V4IB 5EWFA 1A6LA 4PXBA 1F3VA 1FXDA 2JOQA 1RACB 5DWMA 1SJRA 3KQZA 3L4BC 2LEAA 3KNAA 3D3SA 2VOOA 2AFSA 2CNKB 3IBCB 1AUSL 4O0IA 4KY3A 2BRKA 3ET6A 3IR5B 3IWWA 1U1NA 6FDRA 4KS9A 2H65B 2ILYA 5HQ8A 1MMDA 3T5JA 2AWZA 4MK7A 1DHMA 1UEKA 1BQMA 3M8YA 4J9QA 1F2OA 2DRAA 2FJEB 4I7FA 4WE1B 3CXCR 2DO0A 1WEZA 1OQ3A 4V19X 3JQMA 4WFYA 1CS4B 2RAQA 4NYPA 2K1RA 5CYQB 3HFZB 4B9SA 4KORA 3GR1A 3S7RA 1KEKA 2DGQA 1V3SA 3NAHA 4B3MF 2QSFA 3BI1A 1E6VB 4KO0A 4LSLA 3DGPA 4KHPJ 5DRKA 3VVTA 1RWOB 1IKWB 3NG8A 3C16A 2OZGA 3HI9A 5LM7E 2XEFA 5BWAB 2MB0B 2KFZA 5L9NA 5HROB 1GT8A 2UUAJ 2KXFA 4OI2A 4R25A 3W64A 2DIUA 3EGZA 4HHUA 2HFVA 2JH3A 3IFEA 1Q79A 3B4MA 2HWIA 3PRTA 2B4UA 3I9SA 3C26A 3TC8A 2FQQB 2YNGA 5DWNA 4UBRA 2Z3OA 4WP3A 3Q22A 3KLGB 1NHUA 3PO5A 4MKAA 4I1TA 2M9KA 3BH7B 3WC7A 4E8UA 3HSDA 3VGTA 1XTZA 3PX4A 1UFLA 3T9YA 3W5XA 1WEYA 4QBJA 3I87A 2DNPA 3OVSA 4TLQA 2K8GA 1EIYB 1Y7PA 2GMLA 3MRUA 2DGXA 1GX5A 4DS4A 1H38A 3DRSA 2FL4A 5A8RB 4X3RA 3WIVA 1KLMA 4C98A 4OLPA 3PR5B 2XLJA 1UW4A 3DLJA 4AXIA 3P3DA 2XI3A 2RQMA 2Y8WA 3AJ1A 4OHZA 1HBNA 2FZGB 4ERDA 3W8PA 1X4EA 3C8YA 3TQ1A 3Q8VA 1QSSA 1HDUA 3M2VA 3WC0A 4DSEA 4OV6A 5J1EA 2KYZA 2VZYA 2HS3A 4ED5A 2DNOA 3TVZA 4IUFA 2V63A 4EBCA 3UCZP 3VZHA 4P2FA 4WPAA 3OVBA 2BKNA 2QLBB 1BMQB 2ZEHA 3MMAB 4LUBA 1S7NA 2BZ2A 4JI0J 5T7LA 1HNWJ 3W5ZA 2EUIA 1VHIA 3H25A 5B0BA 4CPAA 4LFAJ 5C2GA 3OHBA 4DV1F 3ZZTA 3NEKA 3LP0A 4P74A 1RWVB 3C15A 3J7YU 5FDLA 4EK2A 4DFJA 4MIBA 3NOGA 4EGLA 3BGLA 4A4JA 2PJ0A 1IVZA 2QLWA 1B0TA 4KOWA 5T41A 2XNQA 3PB9X 2MSSA 4F0MA 4ZPCA 1FKOB 2W9BB 1HNXF 3BO4A 4R5PB 4E0DA 4M5GA 3NP5A 4B08A 4A30A 1ZG9A 1P4NA 2EK8A 1OY9A 5F09A 5BR8J 3HSZA 2CNOB 1FRXA 2K5TA 1KVIA 4QIFA 3B6BA 1NRKA 2OPRB 1KUYA 1SIWB 2DNGA 4HVZA 2XZWA 2MKSA 4RNFA 4J37A 1C1BB 2DHXA 1BC6A 5DDOC 4HHHA 2DF5A 4QCLA 2RQCA 3F56A 3MURP 1RO5A 3A4TA 2REFA 2COLA 3SCKE 5IWAJ 2NXCA 2YNFB 4AL7A 1MWQA 3HZGA 3DDIA 2R2RA 1R7IA 3OBIA 3FQLA 4F4KA 3M8PA 1U49A 1EAYC 3FKBA 2QA4S 1RWMB 1S0NA 4LRCA 2FJAB 3JUWA 4C11B 2EO8A 4QW8A 1KFSA 3QJJA 2OOTA 4I69A 4OYMA 4X4PA 4PK2A 1PU9A 2FXFA 4UOCA 5A0YB 3RBZA 1VJWA 2IMOA 4B12A 3FZBA 4A94A 2E5HA 4OX6A 1FJGJ 2MEWA 3SXLA 2NYQA 3ZZ0A 3MOZA 4RW7A 1S7KA 4ZVRB 2QIRA 2HHHJ 2XQCA 4FD7A 4CDIA 2RKIB 4U6PA 2ERRA 3PP9A 4ENOA 2BKOA 2BVZA 1JLEB 2J8SA 2CQIA 4OC5A 2OPPB 2V8VA 4ID5B 1B3TA 3I1UA 3H40A 4B5PA 4ED3A 3FGVA 3JSBA 5LSRA 2HQCA 3CGIA 1S7IA 1IBMF 3C19A 2KT5A 3GTYX 4P71A 1RTQA 4JZ0A 1HNIB 2V69A 1EB0A 4UFWA 2AIRB 2J7WA 5KFJA 3G6ES 2R1IA 5G20A 4NPOA 5CAAA 4LBHA 1HARA 1VGYA 4C8OA 5FIIA 3M2RA 1Q7LA 4KB7A 2R7TA 3KDNA 2XTJP 1VQSA 4IKAA 1PBUA 4Q7AA 2HK2A 4CT9A 3MR5A 4F0XA 3HKZD 2X7IA 2DNNA 2BW7A 1JXVA 4DOZA 4K0KJ 3F8KA 1FHTA 4JUZA 1YHQS 1XMQJ 1XC9A 3DU5A 2ZC3A 1WDDA 1RT4B 2R7RA 2N3LA 1JJCB 2ZOMA 4DR1F 2DHHA 3HKWA 2HFUA 4G1QB 4JI8F 3EVWA 1NJWA 3GU0A 4DN9A 1IXKA 2YWWA 3CE8A 1SUQB 4CO4A 5KTAA 2D3O1 5D4OA 3T41A 1HNVA 1OSDA 4CTAA 3V6JA 2ZEPA 1S1VA 3MR6A 4IG0B 4HT5A 5I3QA 2Z2YB 2VQEJ 2PJ5A 3IJ3A 2O28A 3ISZA 4ECXA 3OSPA 1YREA 2WSAA 1XFOA 5A2QU 2YH1A 3SCJE 1R0AA 2VC0A 3DR6A 2WK4A 3ZTPA 3QIPA 1FRJA 2Z57B 4FS2A 1NNDA 2G3TA 3VV2B 4J3GA 4MBUA 2R9LA 1CJKB 2PD1A 4BHQA 1Z4EA 5LT5A 3RW7A 2WVDA 5HK4A 4IYQA 2V2ZA 1KFDA 4OHXA 4K5RA 4DLEA 1H2UX 4MTPA 4GXHA 1Q16B 2MQNA 1YJTA 3OFFA 4DWIA 1CQNA 1W2IA 3K57A 5B0DA 2YPZA 4ZCIA 2AX1A 5J2PA 1WKJA 3R9EA 3QBCA 4OX8A 2VL1A 1S6PB 3R3TA 1Y9KA 1FA0A 2DGSA 5J8FA 5ITHA 3TEGA 4DF8A 2QYVA 2NSMA 2FZKB 4A8WA 3D9BA 2GGPA 1PJ7A 4V1Ak 1M4LA 2ZH4A 2KRRA 4CYUB 3W62A 3TX0A 2FHOB 1KLNA 2SXLA 4DL4A 3LANA 1FRLA 1N6QA 3MGDA 5KFXA 3MECB 1T0TV 5DDPC 2AYBA 3PYFA 4R3LA 4JI5J 2HMIB 4MCSA 2FJWA 1BD6A 4OC0A 1QAXA 4X64J 4FYWB 3CC2S 3BR9A 2QZ8A 2VBQA 1TXRA 2KFYA 1N48A 2F63A 4CH0S 3GJRB 2E66A 2IRUA 1VRUA 2C2OB 4ZPTR 2I5JB 4J9UE 4C97A 4LQ9A 5IX3A 3UD3P 4HI2A 3BS9A 5D8NA 2W01A 5G0RA 1RK8A 2GX8A 3SQGA 1R3NA 2KXHA 2Y1LB 4C0OC 4YY3F 3CDAA 3PGPA 3DYAA 4F26A 2H54B 3HHLB 2HAFA 3AB4B 3V5RA 3J81U 3LUYA 2ZJQQ 1WC6A 1WHWA 3VATA 1PKUA 2J0WA 2BL1A 4FF3A 2VBYA 4ANEA 2RE1A 3W91A 3OL8A 4JI2J 4K4YA 3MM5B 1IWGA 3CWJA 4PV6A 5HLFA 4USMA 3M8ZA 3CD6S 3JAMY 4PEOA 2QIFA 2KI2A 2VFTA 1RT6A 3GYNA 5F47A 1JKHB 1VQ7S 4NL5A 4DPWA 2XG8A 2UVUA 1BQNA 4CO0A 3AH6A 2VPYB 1KQKA 1C0TA 1IOFA 5E3PA 5CYMB 1SKUB 2CTCA 1AA1B 4UY8T 2LU1A 1TKXA 1YVFA 3BQ0A 2A18A 1JXEA 2CJYB 1BLLE 2GV1A 2XMWA 1Y10A 3ELHA 1H7XA 2QJ3A 5KFDA 1O8BA 2PCUA 2KH9A 2AGQA 5KFBA 4ILRA 4C48A 4OZLA 2DK2A 1RWWB 1VRTA 3OR2B 2PJ4A 5LXRA 3QATA 4AXJA 4EZ6A 2B58A 3G82B 2P9EA 2FIWA 1SV5B 2VU5A 1J4JA 3RZAA 1TV6A 4IK2A 1TAQA 1KTVA 4F7VA 2GVDA 3JQKA 4LF5F 1N5YA 1WC4A 2CQPA 3BGRB 1IKXB 1HQ2A 1OMSA 2IA0A 3I56S 2HURA 2PGCA 2CAJA 3HJFA 1L0CA 4I2QB 1QTNB 3M6XA 3OUYA 2ALZA 2Q7BA 4B3OA 4XPEA 4NLQA 1TKFA 3QFWA 5DLGA 4RN7A 2JLGA 4FVCA 3OXLA 2HQGA 3FK4A 3BHXA 3E51A 4X2BA 3QNWB 3S01A 2VFVA 4C8ZA 6AT1B 2KHCA 5AG6A 2IRXA 4UCNA 1VIOA 3R7SB 4X65J 4C8MA 2OIHA 4IF5A 1YLXA 2RU9A 2BE2A 3PHTA 3I96A 5JXSA 4UEFA 3OJSA 3BSAA 5GMDA 4HACB 5B09A 2O67A 2MXYA 3ONQA 2HPUA 3S6HA 1R8PA 4X4UA 4MHPA 3FUYA 2Q51A 3NS5A 3SYZA 5JPHA 3UCGA 2M0GB 2B0GA 2KKHA 1CSJA 4X4QA 2PJAA 4BWMA 1HBUB 4J9PA 3H98A 2XZDB 2NSCA 2QLJB 2YWHA 2UXDF 2IDEA 4F02A 5C88A 1LEOA 3Q0AA 4PWDB 2E5LF 1FE0A 1KR4A 1X4FA 4DQPA 2CPFA 2X7BA 1DBDA 4LSZB 1LANA 4AVBA 4ES2A 4ZHRA 5HVFA 4DZDA 4MFQA 2JWNA 3DRPB 4G6VB 1OIAA 1JLAA 2G4BA 5IQQA 1XOVA 4ED4A 3TUJC 5J8CA 1REVA 3MAAB 3OXFA 4NRTA 3TA0A 1RT5B 5D4LA 3B7IA 4ZVUB 1TF8A 1GMWA 2XMTA 1YX2A 2B9YA 4I4BA 4FXDA 2OO4A 3GLJA 2R42A 1F5AA 2R2SA 1S7HA 3HLUA 1QSTA 5AG7A 7CPAA 1S9GA 1OY8A 4RBVA 2XB2D 3ET6B 2M52A 1S4EA 1IY7A 1X9WA 4DYOA 1NPRA 3DU6A 2DY9A 5B0GA 4OP4A 3AOAA 4RW9A 5GAGI 3EZUA 4OQJA 1BQMB 4ZX9A 4I7FB 2MGZA 2H1YA 1D9DA 2BJEA 1UETA 5KFHA 4B3SJ 3IG1A 3MOJB 2WPWA 5GAEI 3NBPA 3UNGC 2BACA 2K1RB 3PV8A 2N4DA 4IOBA 4NLGA 4LSLB 4KO0B 3DGPB 4DV5F 2HQDA 4AVAA 2WB4A 3VQTA 2GQCA 3D6MB 1RJJA 4BWJA 4CLLA 2I79A 2AJ1A 3C16B 1UVMA 1XR5A 2CNNB 3MTKA 1NK5A 2LXUA 2QX0A 4AG7A 3G86A 1GXLA 3EVOA 2FLNA 1RAHB 5IC6B 3DMJA 4PCQA 4O3NA 2HZCA 5HMXA 2DPSA 7FDRA 2ZUAA 3I4HX 4BBYA 2W2MP 3V6HA 3BDPA 5F8HA 1PYOB 3PIOQ 3PRDA 4NMLA 1ACMB 2YNGB 4DQSA 4R76A 3K59A 2YNCA 3MD1A 4LF6F 2NUUG 1FJ7A 3Q23A 1AXQA 4W92B 3MPVA 1AUGA 4LRBA 3BSOA 1FDNA 3G8SA 3D68A 3JXOA 1WSVA 2V2VA 3TI0A 4S0MA 4ED1A 5D3GA 5EX3A 5LRJA 3OXGA 4B3RF 5DM7Q 2EK9A 3ADAC 4K8RA 3DRSB 4K3NA 4FXWA 1GXTA 1ZS6A 4RO0A 1KLMB 2PA3A 2GMHA 2W9AA 3PJXA 1YJWS 4ZS6A 4X8IA 1MSWD 4OIDA 4P45A 1HBNB 4DPXA 4JB8B 1XNQF 3IGNA 1KKHA 2BJDA 1YVKA 2OELA 4U5YA 4OL8A 4A2ZA 6FD1A 5J1EB 1DZ5A 3G6YA 3EUNA 1LWXA 3NAIA 4JV5F 3KUEA 3D4JA 1VR6A 2YWEA 4YFUA 4MHNA 2Z3KA 2MQPA 5H9FK 2CPYA 2B3TB 2CY2A 4ZJLA 3K5LA 5EMIA 4V19J 1U1MA 2FJBB 2NPIA 4USTA 3R7BB 1J5OA 1BE4A 3P6YC 2I00A 1MK4A 1NJXA 2AYMA 1FXLA 2R7WA 4MFBA 3N4WA 3AFGA 4EI2A 2J9CA 1EP4A 1JLGA 4DL3A 2KO1A 2I3CA 1IKVA 3JTKA 4LF9J 3LP0B 1IM4A 4DUTA 4CAFA 3C15B 4KPCA 4LR7A 3KXDA 3IEHA 3CDEA 4WKRA 2BJ9A 2FY8A 4K4ZA 4ED7A 2WCXA 4IRCA 1RP5A 5KFTA 2ALYB 2OH1A 4DSKA 5I0CA 3KK2A 4NMXA 3FEDA 4KAIA 3QGPA 4NYZA 4MXUA 2E44A 2IBOA 3J7A1 1IOIA 2H5MA 1KRPA 4NA2A 2QGFB 1XBUA 1AUDA 1LW0A 2BCOA 1WI6A 2VQYA 1AT1B 3HJVA 4ZLJA 4R0JA 3LGMA 4RPFA 2EC2A 3M30A 1FXRA 2EFNA 4K4WA 4FYDA 3QAUA 4XIUA 4USWA 4JXRA 1TL1A 3CJ8A 4NGPA 4DFPA 4J9SA 1RTJB 4OZ3A 4B3MJ 4P2SA 1AFJA 2V68A 3FMWA 1HR0F 1NHVA 2C6GA 4QWDA 1TUGB 1TUVA 4WWSA 3LWUA 1NB2A 1IBCB 2Y0SD 3M8PB 5JM6A 1LFPA 2UXCF 4FF4A 2YKQA 2JRSA 1SKRA 4FWUA 4GRSA 4EO6A 3N6NA 4DNCA 3ISND 2JNJA 3OL6A 3UDCA 5K14A 1R6YA 2OAUA 3CCMS 3TA1A 2B3UA 2Z0GA 4W9YA 3M8WA 2MJNA 3IR6B 1NDKA 3SV3A 2E1CA 2WTFA 4RW7B 3VALA 2APOA 2B3VA 2FT0A 4YR0A 4HYKA 4MKVA 4IUSA 2AHOB 1YITS 1X31C 1S4FA 4OX7A 3KLEA 4EBDA 2HNDA 4F0HA 2H51B 2ZBQA 3SMZA 1T05B 3D0HE 4UEZA 4JXQA 4OHWA 4B5PB 4MHYA 3NMAA 3AQOA 3SXOA 2BQ3A 2CQHA 2HQIA 2R7UA 3V2UC 5K5MA 3I3GA 2ACYA 4NLVA 2ZEGA 2I1RA 2RS2A 4ER8A 1FF2A 3ZZYA 1IYKA 1SJ4P 2C28A 1LV5A 2A2DA 2IJFA 3OW2R 3M2RB 2PA8D 4ETXA 4X2TA 4F8RA 4KRWA 2C3PA 2HGLA 4KOVA 5IT4A 1YK3A 3LF0A 2CPHA 3P2FA 4PPZA 2XULA 4C2ZA 3EZ5A 4DR3F 3ZTOA 3MM9A 1Q8BA 1Q1KA 4UY85 1S5KA 5CH7B 4ECUA 2E1RA 1UEUA 2HGNA 1U48A 3OR1A 3W6SA 3BSCA 2HBQB 2O5DA 5CD4A 1RAIB 2D7SA 1Q86T 3KKWA 2K2PA 2WYRA 4F2RA 1P9YA 4OZNA 4HKQA 5HH1A 2IY5B 5L39A 2D1CA 1RXTA 4CQ1A 1RTHB 2XYGB 3ETMA 3O1LA 3PYEA 4H4KC 3KNGA 4XK8C 1RU1A 3A3PB 2PR1A 4R6TA 4DV1J 4XPLA 5F48A 1U6BA 5KOWA 3GONA 4CO1A 1HNVB 4F0YA 5DDRC 2CDRB 4MAKA 2DO4A 3RJMB 4CTAB 4K4VA 5L9XA 1S1VB 2BMBA 2KM8C 4Q5VA 3PEHA 2C1EB 3PW0A 5H84A 2EFQA 2VBWA 2R7SA 1RE1B 3NCPA 2HS0A 5KT6A 2ZH2A 1R0AB 4NCZA 2J5AA 2QG9B 4ZCKA 3L7UA 4HH0A 1T03A 1RT7A 2FTRA 2XMVA 4Y28C 2MZJA 4CNYA 1HNXJ 2CYYA 1UP1A 1HBOB 2Q1LA 1IKYA 4BINA 1JK9B 1N5VA 1PYSB 2KT3A 3MEGA 4KQZA 1IBKF 3PTWA 3J81Y 1UWBA 4AYBD 2HBYB 2ZM6F 4FD6A 1TMMA 4RUCA 2CVEA 2O4HA 2VICA 3GQCA 3IGVA 1TL7A 2AQ4A 1QVFR 1NK9A 4TWEA 2HHQA 3UE2A 3L3CA 2IBKA 1YMEA 5F3ZA 4TVAB 3DHXA 2Y3YA 3CJ4A 3DOLA 1V0CA 2IM3A 5J2PB 1NSQA 3OSNA 3V8IA 4NLOA 3FIXA 3W9JA 1RXOB 1FFGB 1YRXA 3O44A 3GSIA 3EYZA 4JYAJ 4HT7A 4CAXA 3MPWA 3GIMA 3ILOA 1RISA 5B0EA 5DG9A 2GGPB 5KG4A 2RVJA 4O3PA 5EC4A 4FUUA 1WF1A 3D1QA 1WORA 1FRMA 3WBZA 1N6QB 4U8YA 2N4CA 4AT1B 1F3FA 3OT9A 3RO0A 2KHDA 5CBMA 1K0TA 1BAVA 2CQ4A 2PT0A 4ZVSB 4DU7A 3UD5A 4UOGA 2HGMA 3A8JA 3G71S 1G3OA 2WBRA 2F8EX 2R8GA 2P9CA 1NCLA 3FBUA 4OYBA 4L75A 1T9VA 1VRUB 2ZNZA 3D0GE 5KOXA 4JI1F 5EWGA 3SCIE 5KFZA 4F4WA 1CJUA 5C25B 4Q45A 1PJ5A 2FGOA 5G0RB 3SQGB 2J6UA 4KBIA 3VARA 4Z7CA 4OKOA 3MM6A 4WZQA 5KFLA 1IBMJ 4KVOE 1IICA 1HFEL 2ZH1A 2WAQD 4CLSA 3PW7A 4FD5A 1K0VA 3HHNB 4AXVA 1F57A 1NDPA 5B0FA 2O3DA 2GA7A 1SCJB 4RNOA 2AE6A 5HLFB 4NCAA 1QUPA 5LSOA 3GCWP 1U45A 3M1VA 1TFWA 2ZE2A 2MSTA 4F25A 4N7TA 1FWLA 2R8HA 4M5IA 2GVZA 4DR1J 2XEIA 3W7BA 1BQNB 3AA8A 4HNYB 3MCMA 4JI8J 2FDNA 2Z56B 1C0TB 1T7PA 4U8VA 2AFWA 3BXMA 3CVKA 1NDCA 1WD6A 1SBRA 1TKXB 2JC0A 4WIIA 1ZTTA 3RRHA 2PSZA 4GVBB 4TN2A 2IM0A 1XJOA 3L95X 3F5BA 1TZ0A 2POKA 4UCPA 1VQ4S 4ETZA 1KQGB 4NLPA 1RWPB 2YX1A 4L89A 1VRTB 1YRTA 4GMKA 4M6GA 1RT2B 1N5SA 3PJ9A 1BPNA 2C42A 1Q8IA 1KHVA 4J90A 4RR5A 4J9RA 3IWLA 2RSQA 2ZZMA 2EFOA 2FJDB 4DR7F 2R7OA 2GVDB 1C0UB 3P5BP 3ZO7A 2KN4A 1N5YB 4Y2AA 3VCDA 4OLLA 1S0VA 1DE4C 3GPAA 4B3OB 3QAHA 2D4PA 4XPCA 3L7OA 2PO4A 3HO1A 3V4MA 2MZSA 5FJ4A 3CCES 2LKZA 5C24B 4P4FA 3KG0A 2F4FA 3TJ9A 4BDPA 2QV6A 3RW6A 2VEZA 3CD7A 4MFZA 1YZ6A 1Z2LA 4P6QA 4AVCA 3HVAA 3A3OB 2E9ZA 4LMZA 2DHAA 4DZ6A 2GE3A 4HEA9 4EMDA 4N8NA 1XIQA 1S5ZA 4F04B 4Q8EA 2CKWA 3HFKA 2R98A 4F9VA 5D4NA 2JZ5A 3C6UB 2Z2MA 4MCRA