3PFEA

Crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
471
structure length
471
Chain Sequence
GMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEHGYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEMSGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEESGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVHSGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYSEFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPPLVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDKPAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYVLYSFSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Crystal structure of a M20A metallo peptidase (dapE, lpg0809) from Legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Hydrolase
total genus 137
structure length 471
sequence length 471
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pfeA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pfeA01
4OP4A 2DEAA 2OOTA 2RFHA 3CPAA 4KSIA 5JH9A 3BI0A 4NFRA 4PXDA 2CTCA 4MCSA 1CBXA 2QYVA 4YWYA 3WC6A 3B3TA 4X2TA 3BHXA 7CPAA 4P4EA 2F7VA 3BI1A 3NH8A 2JBJA 4OMEA 4ZYQA 2EWBA 2PJCA 2QVPA 3V38A 5K8PA 2HC9A 3RZAA 4P6YA 2QJ8A 2O4HA 3K2KA 2C6PA 3D67A 3LMSA 4PPZA 2G9DA 4NGTA 3CT9A 3RBUA 2F8HA 4OC5A 3HUVA 2POKA 2IJZA 1ZG7A 3KZWA 2PIYA 3FVLA 2AFXA 5JGFA 2C1CA 4OKOA 3L2NA 3FX6A 4A94A 4G1PA 2PJ7A 3JRUA 2GREA 2Q4ZA 1TKHA 1YLOA 5LRGA 4NGSA 5LYLA 1LCPA 1XBUA 4R76A 2V8VA 2AFOA 4UEFA 2PJ0A 2PRQA 2AFSA 1Z5RA 2Q43A 1YW6A 4DJLA 4MMOA 5DS0A 2OR4A 1IY7A 3T8WA 3FH4A 4UEEA 2PCUA 4F9VA 3D4UA 3S9NA 3S9LA 5LYFA 3SI2A 2PIZA 1CX8A 4WWVA 4WJBA 4FBEA 4P4JA 4A38A 3FEEA 2J9AA 4NGQA 3SJGA 4F9UA 4JZ0A 4P4BA 2XEIA 1GYTA 4NGPA 3N5FA 4ZI6A 4ZY2A 4B6ZA 4DYOA 2PJ9A 1RTQA 1HEEA 1ARMA 1LOKA 1VHOA 1ARLA 1BLLE 3QNVA 5HVGA 1Y0YA 1YMEA 3SJXA 3KR5A 2AFUA 4R8FA 3NH4A 5LYIA 1HDUA 4FWUA 2V77A 4OIDA 1F2OA 5JM6A 3PRTA 2HB6A 3S9MA 1VHEA 1LFWA 2XEJA 3NFZA 2BCOA 3KGQA 4P10A 3GUXA 4P4IA 3DGVA 5HVHA 1XFOA 1VIXA 2PE3A 3IFEA 3IJ3A 1CP6A 1YW4A 4LQGA 4PXEA 4PXCA 1PYTB 4TNUA 2AFMA 3PB4X 1QMUA 3FJUA 5HVFA 1FT7A 4OC0A 2AFWA 4UF4A 1QQ9A 4OIWA 1AYEA 3WC7A 3D7GA 2ZEGA 3FMCA 1TKFA 3FF3A 3FECA 5LRJA 3IIBA 3B3CA 3NH5A 2ZEEA 3LWUA 2XEGA 3IO1A 2ZELA 4P45A 4FAIA 5J1QA 4NGNA 4EWTA 3K9TA 4BD9A 2EK8A 1R3NA 1XMBA 3H8EA 3KQXA 1CPXA 2ZOGA 1TF9A 3CDXA 1F2PA 4DUKA 2IMOA 2PVWA 4MHZA 3V7ZA 4MCRA 4JYWA 4EFDA 4MXUA 2C6CA 2PJ6A 4W9YA 2NYQA 3WC5A 3SJEA 1ELLP 1CP7A 1DTDA 5ELYA 1CPSA 3IEHA 5IB9A 4X8IA 3SJFA 2RB7A 4MCQA 1EE3P 2JEWA 4K3NA 1BPNA 1CG2A 1FNOA 3GLJA 2V8GA 3PFEA 1KWMA 4FUUA 4P4FA 3KI9A 2ZENA 1H8LA 3BXMA 4IK2A 1R43A 2I3CA 2C6GA 3GB0A 2PJAA 4CPAA 3VATA 3KHXA 2FVGA 4OC3A 2CTBA 1TKJA 1XRYA 4F8ZA 4P44A 1Y7EA 4GM5A 3MRUA 4MHYA 2NSMA 1VGYA 3CPXA 4UIAA 1DE4C 1TF8A 1AMPA 2WZNA 2PJ1A 1YSJA 3B7IA 3D66A 5CBMA 3RAMA 3SI1A 1TXRA 2ZEMA 1OBRA 4OC4A 4UEZA 1LANA 3H8FA 2ZOFA 4TWEA 3PFOA 1XJOA 4ONWA 1LAPA 2AFZA 2GLFA 4ZX8A 8CPAA 4NJRA 4A39A 2CF4A 2WYRA 5I4MA 3PB7X 2IQ6A 3NA6A 1NSAA 1PCAA 1IGBA 4ZY0A 1Y0RA 4EMEA 4R6TA 2ZEFA 4P4DA 2BOAA 4NGMA 4ZX9A 4ZY1A 3TC8A 5THWA 4PXBA 4A37A 3WABA 3VH9A 1ELMP 4MHPA 4OC1A 5K8MA 4OC2A 3D7DA 3ISZA 1ZG8A 4RUHA 1ZLIA 1M4LA 3IWWA 5D29A 1ZG9A 2PJBA 2PJ2A 2ZEDA 4Q7AA 2ABZA 3PBEA 1UWYA 3B3SA 3SI0A 4NJQA 3WT4A 2EK9A 2ZEPA 5CPAA 4IAVA 2PJ4A 3KR4A 3KASA 4UIBA 3KHZA 3D7FA 2GU2A 4NGRA 3FEDA 3HLPA 4AXVA 1Z2LA 5F09A 1LAMA 3ISXA 3VARA 2ANPA 2PJ8A 3D68A 5LYDA 2ZEOA 4MCPA 3PB9X 2ZEHA 2PJ3A 1Q7LA 3PB6X 4X3RA 3H8GA 5LRKA 4IHMA 4MHNA 2CIJA 4O23A 3KQZA 1HDQA 5D8NA 3I1UA 6CPAA 5HXDA 3PB8X 1JQGA 4Z65A 3KL9A 2GLJA 4H2KA 4MRIA 3B35A 2V8DA 2PJ5A 5K8OA 1BPMA 2BO9A 2XEFA 3PBBA 4R7MA 4PQAA 2JBKA 5K8NA 1F57A 3TX8A 2V8HA 4YU9A 1Z8LA 3B3WA 3MN8A 3B3VA 2Q51A 1ZLHA 1BAVA 2PVVA 3PEIA 3IC1A 2VL1A 3B2YA 3D7HA 2O53A 3DLJA
chains in the Genus database with same CATH superfamily
4F6AA 1TL1B 5SZTA 1UJ6A 3BI0A 1TKTA 4NFRA 3IGNA 5J1EB 3UCUP 2JJ4D 1QVFR 2B43A 4FD7A 5IT9Y 5KG4A 2VPWB 2GV1A 2VDHA 1MMLA 1HBOB 4KFBB 1VQ4S 1MJ9A 1ZZFA 2JBJA 3TZYA 2F8MA 4NEXA 4ZS6A 2IVMA 2OIHA 2ZXVA 2W4CA 1IBMF 1U2CA 1DRZA 3D67A 1KVIA 3R2DJ 3AXMA 2G9DA 3R5AA 4ZP6A 2DISA 3L09A 1RT1B 3NWGA 3I0RA 1V3RA 3JAMY 5FD1A 2J8RA 4H4MB 2VFSA 4DUTA 4DR4J 3IG1A 3VAJA 3MTKA 3MZIA 5JGFA 2MLYA 4F0YA 2XMMA 4J9NA 1HKAA 2ZWPA 2BUNA 3NY0A 1TQLA 3BV8A 2ASLA 3F44A 4LRAA 3W1YC 1QJHA 3UQSA 1RT3A 1NK5A 5H1SV 5DS7A 3BH7B 2PI5A 2GAGC 1S1VB 2JSXA 2HS3A 1JLAA 3MCNA 1MWZA 4GS4A 1OJ4A 4ZJLA 1I1GA 1TAUA 5DRKA 2FIAA 1BC6A 3K57A 3MMCA 4KR0B 1Q5VA 3KLVA 2FE7A 2R7SA 3N5FA 3OVSA 2ZZTA 2LU2A 2ZW7A 4NA3A 2R8JA 3ZZ0A 4K30A 4DSJA 3C6UA 3H20A 1N33J 2M5YA 3UY5A 1LOKA 5AG4A 2YWGA 3NNAA 2DCUB 2FPHX 2C2EA 4OV1A 5DLFA 2Z56B 1VRTB 2LP4A 1Y0YA 1YJWS 2QMXA 4ZLLA 4R8FA 4Y3CA 4CYOA 1UP1A 2QYGA 2HB6A 2B5JA 2F9DA 4JJXA 3RW7A 3N0VA 4B5PB 1IIDA 2EBJA 3J7A1 3DYAB 5EMIA 3FK4A 3THVA 4II9A 4M5DA 1E6YB 3M1VA 1Y4ZB 4K0KJ 3KHLA 1J5OB 2OSRA 5CYQB 3GV5B 4NLYA 2AEJA 1X9WA 2OZGA 4DV0F 1X9SA 2AE6A 3OJUA 2HBRB 3W6SA 1L3SA 2ZH9A 3VQSA 3HVRA 3ZZPA 5CQGA 2WZ1A 2AV5A 2CJBA 3IA0A 5HROB 3GU0A 1X4FA 3K9TA 2AWZA 2D9OA 4M3SA 1CPXA 2UUCF 5CXTA 4O4GB 3MURP 3BDPA 2R7WA 2Z0GA 4JYWA 2PFFB 1PIEA 4HT7A 1K1SA 1RAHB 3SJEA 2CJAA 4ONUA 5HP1A 2XTJP 2FVRA 2C3UA 5CZXA 2JEWA 2IBKA 4RNHA 2RILA 3QRQA 1UPPA 4CI0B 3BSCA 1FI4A 2OSQA 4I56A 1XRYA 3OXFA 2GMJA 4QWDA 3AA9A 1FF2A 2DR5A 4OZ2A 1HWKA 1NHKL 2V4JB 2W7PA 2W1BA 5KG6A 1F6TA 3FFIA 1MN7A 1H72C 3FEZA 4OZ3A 4AG9A 2DHAA 2B4DB 2RVJA 4X66J 4FXWA 2VFRA 5D3GA 3I9SA 5A0YB 5L1LA 2K06A 2MQPA 4RN7A 4OFZA 1C1CA 3B8GA 2HQFA 4URQU 1U2FA 2HIQA 4LRCA 3QPIA 1HR0J 4XDDA 3TR5A 1E6VB 3DC2A 2VONA 2QX0A 3CO0P 4DR7F 3OV7A 4XO0A 3DU5A 2VODA 3D8PA 1QUPA 3JYTB 4XTTA 5K14B 4ECXA 4KVOE 5H86A 5KG1A 2DHGA 1Q8LA 1DQAA 2J8AA 2K7JA 1TL4A 2E9RX 3SI0A 2Y0MA 4NJQA 3P2FA 4CZCA 3ILLA 3MPWA 3KR4A 3GTYX 2FLLA 2B8PA 3TAPA 3N7ZA 2L41A 3GYXB 3PW7A 2D9PA 1Y00A 2YQ3A 5KTQA 5L46A 2CQ0A 2UV8G 2PJ3A 2VG7B 1HIYA 3ENVA 1VHSA 5HXDA 2FT0A 5CYMB 2CQDA 2RUSA 4B17A 5KT3A 2BO9A 1CJTB 1JWWA 3B54A 1KLNA 3C15B 4GVLA 5GAHI 1S9GB 2YNCA 2VL1A 4J9QA 4F04B 6FD1A 2E9TA 1RAIB 2HQYA 3HM9A 2RFHA 4KSIA 4F4XA 1LWEA 4R3LA 3SCLE 5I42A 2VH7A 1VQ9S 1N5YA 2ZH7A 1ULRA 2W9BA 3PYGA 5K5MA 5KFYA 3TQ1A 1FKAF 3NKYA 4X4UA 1IWGA 5J8FA 2N4CA 2KT5A 1PJ7A 4NI2A 4RUAA 3VGSA 2J0SD 3G96A 3EMTA 3OR2A 2G3AA 4DFJA 2HBQB 2QSFA 3V38A 5K8PA 2AHOB 2UUBJ 3OQ2A 2BM1A 1N5QA 1VJWA 4EU0A 2WSCC 2QJ8A 4U8VA 5CNPA 3NAHA 5E3RA 2LVWA 1JIHA 4DDFA 1YRUA 1OYDA 1X4EA 3W2VB 1ZG7A 3FZ2A 4TN2A 4C6AA 2PIYA 3BBCA 2RHSB 4PG4A 3HSDA 2VJUA 3FX6A 1RT6A 2R7VA 1TUVA 3U7JA 4IOAQ 2KFNA 1SJFA 3JRUA 2HHTA 1MWYA 4OV6A 3MFIA 1U47A 3FB3A 1PJ6A 2JVRA 2AIRB 1S1WA 1KS2A 2DVIA 1VBKA 2BW2A 4KS9A 2MZ1A 1GQEA 2Q43A 3K8WA 2VZ9A 1HNZF 4H4KA 1YQEA 2K1RB 2QGFB 3MFHA 3T5KA 2BOPA 5KFOA 2DNOA 5HMWA 4B9SA 5DG7A 3MM5A 2X51A 4FYDA 2PIZA 5F48A 2MYFA 1S76D 3BR9A 3G87A 4H89A 3M8SA 4Q36A 3OL7A 2VA2A 4NGPA 2MKCA 1TKDA 4WU2A 2I2YA 1EJ7L 3IR7B 9ATCB 5H84A 4DZ6A 1ARMA 3NNHA 4NCGB 4P75A 1RCXB 4GVBA 2H51B 3PEJA 1WC4A 1NB7A 2GE3A 5H9EK 3ELHA 3K5PA 3KLHA 4KGVB 2MSSA 5KFBA 1Y11A 3FRZA 3FBBA 3OTOF 1GFWB 2DR8A 3IR6B 2D3UA 4U8YA 2Z3PA 4DR5J 2Y8WA 4ECQA 4B9MA 2FGCA 3G8QA 4B3TF 1RADB 1YTYA 5L9XA 4CO2A 2DPTA 2M3DA 4QPTA 4I4BA 2E44A 4HVZA 1Q95G 5D0EA 4G3IA 2RSQA 4CLPA 3TA2A 4QIGA 4B08A 2R7UA 4J5OA 3KWMA 4ILRA 3OFFA 2HNYA 1TFYA 3NH5A 1SKRA 2XLIA 1HW9A 2JDCA 1N8RT 1YJ7A 3J7Z5 1OY6A 4JI5F 4AL6A 3T1AA 3NGDA 3KNAA 3FZBA 4LSLA 1X5OA 4W9YA 1XNQF 3VAKA 3HD1A 1FDDA 1TP7A 2H3EB 3LD2A 3M2UB 1Q2CA 5FLXU 3SJFA 1Y0HA 2RB7A 4K3NA 1S4EA 1K9MT 3MI7X 4E0DA 2V8GA 3PFEA 3Q22A 3JSRA 3B78A 3W3SA 1R43A 2KU7A 3EE3A 3Q23A 2VC1A 2PJAA 1CM0A 1IBKF 1TKJA 4LIRA 5KFQA 4MJ8A 4MHYA 3V6HA 4HTIA 1KEKA 5GAHU 2VICA 3MMCB 4F2RA 5HI7A 1TF8A 2VQFF 5F0WA 3UR0A 3ISNC 3LWLA 3JUWA 3D6TB 2FHMA 4S0MA 2K8GA 2BRLA 3C6UB 5D0HA 3EGNA 2IRYA 2H4WB 1UMJA 3IBCB 2OZHA 2H5MA 2CRLA 5KG0A 2HHXA 1R0BG 4TWEA 3KKWA 4DUZF 4ZX8A 4IQXA 2BSWA 2MHEA 5E7OB 3IRXA 1YK3A 1VIOA 4CT8A 3EM1A 3EPGA 5E41A 4JI3F 1QAXA 3HP6A 2V2KA 2N3OA 2CPIA 5IT0A 2BL1A 2BJDA 1TVRA 4EFAC 4A32A 2JRSA 2YNGA 4P4DA 4M5DB 2LFVA 2CQ1A 2XNRA 3TA0A 4GXHA 4A37A 4W90B 1SQGA 1VBZA 2DH8A 4QWEA 4F7VA 1HNWF 1U6ZA 1RHRB 3EVWA 4KVXA 2F65A 1NPKA 4DFKA 4Q7AA 2EW9A 4IH6A 5DO2A 5ETKA 5AXLA 2OH1A 1UWYA 2B6AA 2NR0A 1IOIA 1YJRA 4J9PA 5AE3A 3KLFB 4K5RA 1N5TA 4KGMA 4OX8A 4ED7A 2ZITA 1IKWA 5DG9A 2DPIA 1NKBA 4OYBA 2Z0ZA 1RYRA 1REVA 1M5SA 4MCPA 2IJNA 1KD1T 4X3RA 8RUCA 4IG0A 3HDSA 3UCGA 6CPAA 1JQGA 2KXHA 3NS7B 5LXRA 5HP1B 1HNIA 4U7UK 4K4YA 5I3UB 2V94A 4PQAA 3BR8A 1TKZA 3F5BA 5B0GA 1NCLA 2M70A 2OU2A 3J7YI 3OHBA 2X1AA 2C2OB 2HNDB 3ETOA 3KK2A 2UVUA 1DURA 3LF0A 1TV6A 1REGX 2XB2D 3DOMA 5IM0A 2HFOA 1F0XA 1YITS 1I1DA 1NDCA 3LALA 2Y0BB 4CTAA 1SCJB 3DRXA 5D3GB 1OS5A 2DR6A 1FRMA 4P72A 4URGA 1LQ9A 5DM6Q 1FCAA 4GKKJ 3T9YA 3N6MA 4YDDB 1NZ8A 4PPZA 3CXSA 4PQUA 2RRNA 1KOHA 5ETQA 5B08A 3TOQA 2MZTA 2XY6A 2P2CB 1JK9B 1TR0A 2Q6CA 3TUPA 2IAJB 3R9LA 4NZ0A 4JYAF 3DLGA 4OI1A 4NGSA 3QYYA 2R7QA 1RXTA 3KG0A 4ETXA 3N6NA 2XHCA 1RABB 2VV5A 1WG4A 4MKBA 1Q0NA 1IY7A 1QAJA 1S0OA 2PCUA 4XPLA 4F9VA 4F3MA 2O28A 2QIRA 5F8NA 2LMIA 3BO4A 4K4SA 1VR6A 3SI2A 4NXNJ 2PMWA 3EGZA 1DLOB 1HQEB 2Z3LA 4NGQA 4K4ZA 3M8PA 4JZ0A 2XLJA 1WWZA 4DG1A 4NXMJ 1Z2ZA 1S9EA 3V2UC 1HMVA 3I6PA 4JI6F 2BJ9A 4ZPAA 4NYZA 4FXVA 4BS2A 2CQIA 2R8VA 3UDEA 2XLKA 4DV4J 2G0CA 4ZPTR 1HD1A 3JTPA 1NDKA 1LWEB 5I42B 2C42A 5DZ7A 1OY9A 1VHEA 4FPRA 3QZ8A 1KFDA 2W9BB 3KGQA 4IFVA 3NOCA 4M95A 2VG6A 4CO3A 3SQOP 5C2GA 1B7YB 3A13A 4DJBA 4CS0B 1H2UX 3MECA 1RT7B 1MK4A 2LECA 1L3KA 4NI2B 1WHWA 1MN9A 3OR2B 3MR5A 5A6WA 1KFSA 3BKTA 4C8MA 4LFCF 4AQYF 3H98A 3PW2A 1S5KA 3MD1A 4UUXA 1YVOA 2A6MA 3FVYA 1RAEB 4YGOA 1SC6A 2PA8D 1S4FA 2DK2A 3BGLA 2DGTA 1KUVA 2P6SA 3FMWA 3EO4A 1I94J 4DL0C 4A8QA 4K59A 4B13A 1ACMB 4MHZA 3AQOA 2J0WA 4MCRA 1YRXA 1RKIA 2PJ6A 4B10A 5HH1A 2OMLA 4DSLA 1S1WB 2NYQA 4C8OA 1IICA 5E2QA 1OY8A 1Y3JA 1X0PA 4F25A 2XZTB 3PO4A 2Z58B 1KWMA 4FUUA 3KI9A 1H8LA 3HT3A 3PKMA 1ZA2B 2E5LJ 3MWBA 2C3PA 3O2IA 1SQHA 2IA6A 4P44A 3MPYA 4MFBA 4C11A 2R9LA 1VGYA 2JZ5A 2DBBA 5A8KA 3J7YU 4ZDNA 3N9UC 5CBMA 4Q8FA 5LOQA 2BYCA 5KFFA 3Q83A 1T05B 4I49A 4CP5A 4ZIVA 5HO4A 4OC4A 1RSCA 1WWHA 3R1KA 2ZOFA 2ZH5A 5DDRC 4AVAA 1UEVA 4GVBB 2L3MA 1VS3A 3H8YA 4HI2A 4ZK7M 3MAAB 3KLHB 2YKPA 5IT9U 1U25A 5I4MA 4WFYA 4ED1A 1J2VA 2BABA 2CPFA 3NL0A 3A8JA 3OTCA 3DLLQ 1Q8BA 4EMEA 3V4MA 4IRCA 3FIXA 1HPZB 4JBCA 5ETSA 4DR3F 1R8PA 3W60A 1ZETA 4PXBA 1U02A 4ECTA 1LWCB 3N79A 5CH7B 4YP3A 4DZDA 1M4DA 3KDNA 4CAFA 3CJKA 2DITA 3JAMU 1QY7A 1EARA 4X4TA 1WEYA 1NK9A 4C2ZA 1FEHA 2IHR1 4R5PB 1SUQA 3W5ZA 2GHPA 3GIKA 4UOGA 5KFRA 1VLOA 3RBZA 5KG7A 2YWWA 3FEDA 2CJQA 2VPXB 2UXBJ 5KOWA 2D4OA 2YWEA 1DQ8A 1NJIT 1TUGB 2QECA 4ED6A 5HL7Q 4LSLB 1F2GA 1VRUA 2HURA 4RNMA 4WTYA 5E3PA 4IG3A 5LRKA 3MEGA 1UZHA 3JSBA 3QJPA 1RUSA 4O23A 1OWXA 4F02A 4OX9F 1B4SA 3J7AN 3RB0A 3PCOB 1T03B 2ADBA 2XEFA 5C42A 3CXCR 4RW7A 3TVYA 4LQ3A 5K8NA 1S49A 2W9AA 4NYPA 3NMRA 3B3VA 2XQCA 3BPDA 1KDNA 1JLGA 4ZITA 2WTFA 2J8MA 2HWIA 3GSDA 3VALA 3VVUA 3A8KA 3PACA 4PSXA 3RBEA 3CDAA 1GHEA 3GIMA 1NE9A 1NXIA 5AE2A 4Q38A 4PG6A 3OLAA 3BYRA 2FC8A 2EWBA 2EC2A 2YX1A 3PW4A 2GGPB 3IRXB 3SFGA 4LF9J 2BE7D 4GMKA 2MQLA 4EI2A 4LQ6A 2C6PA 4LF7J 2XSJA 2YNGB 3RBUA 4DS4A 3K7RA 1HWJA 2VC0A 2Q6BA 2W8KA 5MLCV 1P27B 4K2XA 1A0OB 2LQBA 4DSEA 4KPYA 1P4NA 3M30B 3CC4S 1QAIA 1TL5A 2RQKA 3CC7S 2IPOB 4MYUA 3FXTA 3G3SA 4NLQA 5F8IA 1KONA 3BM7A 1YLOA 4YFUA 3R8YA 4CRYB 2B6AB 1UVKA 1LCPA 3L95X 3R6GB 4OL8A 2XMUA 4NCBA 4EYIB 4CGOA 2FTRA 3I32A 5EBVA 3KJQB 1C0TA 4ED5A 1VQYA 2ZD1A 3S9NA 5G4DA 3EZUA 4UY85 1REVB 1WF1A 1N56A 3BGRB 2MLXA 1HWUA 3VAFA 4H6UA 4WJBA 1A7GE 4IG0B 4ANDA 4CLFA 4GO7X 2B7BB 1M5KC 1H38A 1KBRA 3OT9A 1G3OA 1TKZB 3LOUA 4LREA 4CNZA 1ZPVA 2NYIA 5IT4A 1CQMA 2J6UA 4KV8A 3T41A 1Q1KA 3UN2A 1SPBP 1C4AA 4RW8B 3MUTP 3KK2B 3HO1A 3GIUA 3QFWA 1JLBB 3CCLS 3PRTA 1UW9A 1TV6B 1RWNB 2GQQA 3NP5A 5IQ6A 1SC4B 2NCKL 1X4DA 1IKYB 1VIXA 2IA0A 3SV4A 1LXJA 1S6PA 1CP6A 2AJFE 3TA1A 4KIAA 2KL8A 3SMZA 4M5JA 2PEHA 2E5IA 2YKMA 4ZVHA 2DO4A 3TUIC 1HHQA 2YKAA 1K4JA 1HHSA 3CCZA 2CA9A 3HMJG 1QSNA 4PQUB 2J0QD 4F50A 5C88A 4PKDB 2HLUA 2MY8A 2Y9HA 3HVAA 3H90A 4NRUA 1VDHA 5LMUF 1FRJA 1P9QC 4I6WA 4LF4J 2CFXA 4MKVA 4FS2A 1RISA 1RGVA 2RH3A 3LPYA 1X5PA 2HHWA 4YR3A 4XDCA 4I67A 4RJVA 4JI2J 1RWVB 1G1XA 3BBBA 2LU1A 3QJLA 1QUVA 3JXOA 2CTBA 4F8ZA 1NJYA 4RNNA 3OPKA 3HD2A 2V63A 3AB2B 2J9EA 3JSMA 3M8PB 1NK7A 3VF0B 2GNKA 3VGUA 2ILZA 4DV5F 1B99A 5ETNA 3DMJB 1WC6A 1N36F 1S9EB 5M2PA 5E3QA 3F41A 3R95A 2XO6A 2QO3A 4NZ7A 2DNMA 2KB2A 3QO9A 3HHLA 2PC6A 1WKKA 3SBMA 4DQRA 1EQ0A 1NDPA 2WVBA 1XN9A 4X4QA 1YBUA 3HFZB 4YRHA 1F5AA 2CPZA 4OJ3A 5LSRA 3AH6A 4FD6A 1NK8A 3NA6A 4LT6A 1A2ZA 2DXFA 4R0EA 4TY8A 1EQMA 4ECWA 1KQKA 3FUYA 1JLEA 5J1PA 2YNHA 5G0RA 4DV2J 3H7HB 3HHDA 2G0IA 4TU7A 5LMNF 3TAMA 1KQGB 4B9UA 1X4GA 3PIPQ 3D2WA 4P73A 5B0DA 1BWEA 4DV3J 1PAUB 3LGNA 3RYLA 1VQLS 4ZKAA 4JB8B 1VQNS 4QU7A 2HVHA 2V69A 4CH1A 1X9MA 2EXUA 3IWXA 5KFZA 2BM0A 4IAVA 1WF0A 1JKHA 2PFDA 3C66A 5KT5A 3KG1A 1VC0A 2XMJA 3UNYA 4YHHJ 3CUNA 2W2OP 1B0TA 2W9CB 3TAQA 2ZEHA 4FD5A 3K5OA 3DDNA 1RHJB 4A8WA 2HAFA 1GT8A 1M4IA 2VG5A 2JFDA 1Q7LB 4NLUA 2WCXA 1BQNA 3BGUA 3CD7A 4C97A 3M4XA 3W5XA 3EGWB 4C11B 3O1LA 2OOTA 4WIIA 4KAIA 5JH9A 5CD4A 2HRUA 2GHVC 1UCNA 3ISND 5A8KB 2IM3A 3FQKA 4C2YA 2GANA 1WC5A 3X3UA 2W4PA 3JQJA 3S6GA 4DU7A 2GJIA 2EBEA 1RTIA 3S6HA 1SH3A 2DT9A 2WAQD 4OLPA 3CD5A 2NXUA 3EDRB 4A8FA 1QD1A 1OQ3A 1T9WA 2E7XA 1D3WA 2W01A 1FJGJ 5DDQC 2BA9A 3UR3C 3TE4A 4CAXA 3RO0A 2L08A 2CJ9A 3K2KA 1CSJA 1ZAVA 5HAOA 2JVOA 3OTEA 3L9ZA 2A2CA 4QJVA 4MK8A 3LACA 1KLMA 1MW7A 1RT5B 1WSVA 2FQQB 4ILLA 2QZ8A 2AFXA 1FRHA 3EWGA 1G4CA 3QRPA 1HBMB 1GAOA 3RB6A 4G1PA 3CJKB 1TKHA 5B0FA 3V4IA 2V2QA 3MMAB 2QA4S 5LYLA 2NLWA 3JQKA 2HS0A 3UD4P 3ILOA 1SUQB 5DETA 3DN9A 5IV3A 3T1HJ 2HGMA 2XGPA 3RBXA 4QWAA 3VWDA 2CQHA 1M90T 2FHJA 1IYKA 2DNZA 5IFMA 2Z3OA 5KTCA 5LYFA 2Y1IA 4TQSA 1VRUB 4N56A 4IG3B 3QAYA 2F5GA 3OR1A 2G3TA 3PJWA 3S6FA 4PWDA 2W2QP 4X65F 2JEJA 4CLTA 4RW7B 4HYKA 3MM8B 2B5GA 3D4JA 4XNHB 4B5OA 2DY1A 2RT3A 1BLLE 2FJAB 4DOZA 2AYMA 3P5TL 5BR8F 3OTOJ 1JLGB 5EHHA 4HLBA 8AT1B 5FJ4A 5KFSA 5KFWA 5L8RC 2NSCA 3MR3A 1T9VA 2WB4A 3P6YC 2YH1A 4WK1A 1NAQA 4XIUA 4F26A 3GV7B 4QB9A 3RRKA 2ASDA 4YN3B 2AZ1A 3SEOA 4JI7J 1FFGB 4FPIA 1WF2A 1M1HA 3A9LA 4DWIA 3ZZOA 5B0BA 1G7CB 3WR7A 5HVFA 4GO5X 4NLOA 4OZ1A 3D7GA 4A46A 3L7UA 3T5JA 2XSJB 3CJSA 3WHIA 3GZ7A 2I0XA 4DPXA 1N34F 1CEZA 2MZQA 4EBEA 5J2NA 4CAVA 3LAMA 1XMBA 1FNMA 5KFXA 2XCPA 3R9EA 2JC0A 4C9DA 2M0GB 1SI9A 4RX6A 2QIFA 3G86A 3K89A 4J9LA 4QWBA 1IXKA 1UWBA 1T9YA 4NA1A 2CNSA 3EGVA 3WC5A 4C8LA 4CAEA 1ELLP 3CD6S 1CPSA 2B7CB 4J3GA 3CJ2A 3O5TB 4O3SA 5KAKA 1X60A 2VASA 2OTLS 3PR5B 1IJEB 1JWQA 4P4FA 4C98A 1C0TB 1R8AA 1F1BB 3MM6A 1KSPA 3MM9B 3KHXA 1WUUA 3LUYA 1TAQA 2ZKTA 4LF1A 3QRRA 4LF8F 1Q2YA 4X4VA 1D9DA 4F0KA 1RE1B 2CJYB 4UOFA 2ZBQA 3RAMA 3UVJB 4J9MA 4DUZJ 3PP9A 4DSKA 5D0RA 1YJTA 4USUA 4QR0A 2C2KB 3M32A 4YQWA 1EIYB 4KV8B 2WYRA 3IBWA 2R8HA 1AFJA 3MAHA 1TL7B 3UWTA 2H5IB 4WIQA 2A6OA 4HACA 5A76A 2CAJA 4KSAA 2GIFA 2B9XA 2N7CA 2XNQA 2FHOB 2LLZA 4F0XA 1RLDA 4IFYB 4FVCA 1FVQA 3FBEA 1S99A 5AJ3J 3MHYA 3QBCA 2DNPA 1HBNB 4PK2A 1J4JA 4JXQA 3BGFA 3M9OB 4CM2A 4MH8A 3W6XA 3MAQA 2LEPA 2LQJA 3RW6A 3E51A 4DX6A 4H4OB 3IAS9 3DR6A 2UXCF 1R8CA 3FQLA 4AXVA 4MAKA 5F09A 3EC4A 4N5SA 3DLKA 2COLA 3PB9X 1NDLA 3AAWB 2P0WA 3GE9A 3H8GA 3KQZA 5D8NA 2DKOB 4RBUA 3TI0A 2R42A 1ZO0A 4TU8A 1DZ5A 5K8OA 2KT2A 1I12A 4I64A 2NXJA 1UKUA 1RP5A 4R7MA 2F8EX 3GYAA 1V3SA 1HBUA 3SCIE 1EAYC 5DQGA 1FHTA 4ECYA 1L0CA 4OI4A 1VQOS 1HI0P 2LDIA 3D7HA 4FNHA 2XYGB 4PYAA 1PILA 4G1IA 4BLGA 3CPAA 4RL1A 3JSMB 4DR1F 4B3MJ 4FF1A 1SL1A 4R8UA 4EO6A 1WHYA 3Q8VA 4Z7YA 5AXKA 5D4PA 3AD8C 3V6DB 2CQGA 2GMHA 2XBPA 4U67Q 2R8GA 5I3PA 4DSFA 2AZ3A 1VQ8S 4JI1J 4XPEA 3SXOA 2HQIA 4X84A 4LF2A 2E7WA 4TY8B 1RA7A 1P1LA 2IL4A 2O01C 3GJRB 1CQNA 2YNHB 2F4VJ 2HRTA 4A8KA 4HNXB 2LEBA 2IJZA 1WC3A 1HYSA 3TAMB 4JI8J 2R7XA 4CRJA 3GSIA 2NMTA 1S7FA 3VCDA 4OKOA 2MY7A 2KM8C 3LP0B 4A94A 1X31C 5L1JA 3MMBA 3JQMA 3PX6A 2P9CA 2ACYA 4L6V3 4EEYA 3J81j 4KSFA 4RNFA 2R2RA 4Q44A 3CSKA 2H54B 3NMAA 3PM9A 1JKHB 4RPFA 3HSZA 1AUSL 2MKKA 4F36A 3QQCD 4DJLA 3OD2A 4ZLNA 3G6VA 3OTDA 4WFBQ 3OHAA 2D4PA 2OEJA 5LL6d 2OPSA 4Y2KA 1NJXA 1AB8A 3MCOA 2LQ5A 3RU0A 3ZZTA 3BQ0A 3DM2B 4A38A 3FEEA 4XPDC 2Q4VA 3SJGA 3KJFB 1GYTA 4RW6B 3RAQA 5T14A 3DRPA 4LUBA 1GMWA 5C5JA 3H4BA 2VBXA 4QIWD 3M8QA 3OUYB 2FIUA 1RYSA 2HHQA 2QV6A 4FD4A 2B4BA 2ZH4A 5JM6A 2ACMA 2B9EA 2C28A 1HNXJ 4FF2A 1LFWA 3N01A 1NSPA 2BANB 3GJSB 5KFCA 1Q53A 2PIIA 3PEHA 1Z9UA 1TIQA 2J8SA 3ZTPA 5AXNA 2XULA 4TNUA 4C8KA 2HQGA 2PN6A 3CXPA 1FJEB 3PW5A 4NCZA 2CZ4A 1ZM2A 4KT0C 1EB0A 5K9FA 1S6QA 5H9EJ 3OBIA 5I0CA 3DHWC 2ZHAA 1W7WA 3HVTA 1YLEA 2Q0YA 2ZOMA 3FMCA 3M2RA 2Z3NA 1M1GA 3IMQJ 1D8YA 1P6TA 1XNRF 2GO9A 5GMKa 5LRJA 1NBEB 3LWUA 5E0OA 2LQ9A 4NMXA 1IR1A 2KN4A 2FJXA 4CAWA 4TY9A 2IIHA 2IRUA 2EG2A 1BQMB 3KQXA 5KG3A 1J5EJ 4ZVFA 1XQIA 3JTOA 4A8YA 4LFAF 2RNEA 4FN5A 4KVME 1SKWA 1FE4A 1YVFA 1FXLA 1VRQC 5D0GA 3BS9A 5J1NA 5FLXY 1H98A 4MI4A 1FWKA 4OX6A 1BPNA 3NGSA 3R2CJ 2ZVSA 4DUYF 2FSRA 4DN0A 2QE5A 3L7OA 1RHMB 3J7ZT 4WFZA 4X64F 2YX7A 1UETA 2CZVC 4QBUA 2ZNYA 1Y7EA 2OZUA 2U2FA 3FGVA 3R96A 2CPXA 4RZRA 4DR6J 4YMEA 2DB1A 2X7BA 3B82A 1S9FA 4J9KA 5KFIA 3CEDA 2EO8A 2EVZA 5LJ3Y 5C82A 1R8HA 3D1HA 3RB3A 3RUBL 1OBRA 5HANA 2ODFA 1YDLA 3GFHA 2DPSA 1MSWD 2NXEA 2AMCB 2AFZA 3CCQS 1BY9A 2UVVA 4GRSA 1RB0A 3GFZA 5FDLA 3BB5A 3SI8A 3OFHA 4PG5A 1L3VA 2K2PA 1UW4A 4DR3J 4FYVB 4I6AA 4R25A 4CLYA 2H9ZA 2LA6A 3CVKA 4CO1A 2C22A 1LWFA 4KORA 1RT2B 1HD0A 4RI1A 4K4VA 2G13A 3EZOA 1LW2B 2MGZA 2EC0A 4JV5F 4OC1A 2UP1A 3O6QA 3S1TA 3T1YF 2NUHA 3EVOA 2D1CA 2ZKUA 1X4AA 2AYGA 4JI4F 4IKAA 1PSDA 2NXNA 1EETA 1KOOA 1HW8A 3AFGA 3GIRA 4GKJJ 3FSXA 2ZEPA 1V3ZA 4C48A 2OPQB 5J2NB 3D7FA 4P71A 1WDDA 4ZP8A 4B9TA 1Z2LA 4DEZA 2FZCB 1LAMA 4TQRA 4ZVQB 1YBAA 3FBCA 2Y8YA 5LYDA 2ZBIA 3EFAA 1YKWA 4Z7CA 1UWBB 1O51A 2Q44A 4CRZB 1KZFA 3PG9A 3CE8A 4H2KA 3BQ2A 2KT3A 4X62J 1T9TA 2P6EA 3A3PB 5DGBA 2BEIA 3QAUA 1U0SA 4NEYA 4YY3F 4AYBD 2DRDA 3MM6B 3C3LA 3MPDA 2D69A 4TKTA 2W2MP 2FLPA 3NRBA 5H9FJ 5A2QY 3ADAC 2OP5A 2X3GA 4ILMA 3KKFA 4JP8A 3HZGA 3HKZD 2HFVA 4MIWA 3M9MB 1LXNA 2LDYA 2ZVIA 5K20B 3T6BA 1GXLA 1IKXB 2QRRA 4DL2A 2B3VA 1U8SA 2QA1A 3BKUA 1LK7A 3MOJB 2XHWA 2R7OA 4X4SA 3SSQA 2YNDA 4Q2MA 2YGWA 4OYWA 4HACB 1OSCA 4B3SJ 3O8WA 3POTA 3LANA 4A8XA 2FHKA 4YS2A 4UCPA 4ZPWR 1HI8A 3M05A 2L48A 3TW0A 4CLSA 3CCVS 3NGKA 4NRTA 2CXAA 2BEFA 2UU9J 3KYLA 5J2QA 2LXFA 2PJ7A 2GREA 4G6VB 3I87A 1FWPA 2EFOA 1EP4A 2ZPAA 3D3BJ 1K0TA 5CCLA 1X5SA 4CWBA 2XYPB 3I9ZA 1TZ0A 5DS0A 2OR4A 5IXUA 2CQBA 2MZSA 3TO7A 2P9GA 3G6XA 3T6JA 1R6VA 4IO1A 1KRPA 3DLKB 3WDOA 2J76E 4OZ0A 2J8NA 3H5XA 5GCNA 1KP6A 2F4FA 2FD2A 3CXQA 1WD6A 2RHQB 4Y65A 2KI2A 1UAWA 4CYPA 5CHCB 2G1HA 2GVDA 4USIA 1L3UA 5J8CA 1HBUB 5HBMB 2VQEJ 3NS5A 5DG8A 3M2VB 2KO1A 1U0HA 4Y49B 2ARHA 3QATA 2VPZB 4IUSA 3E2EA 2DCLA 1JJHA 2QLBB 3V81A 4O44A 3DRSB 3CW2C 1UA1A 5ETMA 3F0NA 2HHSA 4KUBA 4QIEA 4Y2AA 3ZTOA 4BC7A 4LF5J 4M5HA 1KN6A 1UWAA 3ZTRA 1S1TA 2BV3A 2AFMA 2IC3A 1OSDA 2ZC3A 3Q8PB 2D3ZA 3UPFA 2OUGA 4ECSA 4QIVA 2JLEA 4O3OA 1XC9A 1HHTP 4ID8A 3MCSA 3MR6A 2ZEGA 4B9VA 1U48A 4ERDA 4YDXA 2BE2B 3IS9A 4DX5A 4DR4F 4EWTA 2A3JA 1R3NA 5F8GA 1Q7YT 1RT4A 2MPUA 1TL3B 1NKCA 3MMBB 2IMOA 1HWIA 2ZW4A 4WP8A 4MXUA 1UZDA 3UCZP 4KB7A 2RQMA 2EUIA 2IBOA 3KXDA 7FD1A 5JMNA 3ZNUA 4XNHC 2YNEA 4HDGA 1JXVA 2VQYA 3CCWA 2KRBA 1GX5A 3THPA 4RUCA 3KK1A 1VYAA 4DV5J 2Z8QA 3R3TA 5AT1B 2WONB 4CYNA 1FFWB 1N33F 1YSJA 2E5GA 3QT7A 3Q2TC 4L3NA 4RU9A 2MJNA 1TXRA 4IR9A 3M8QB 1I3OB 4K4WA 1OPZA 3ENQA 1IR0A 4USVA 4DPWA 3BQ1A 1XJOA 4M5GA 4ONWA 3TWZA 4AFFA 1NNDA 3SXNA 4WFAQ 3W2WB 1ZH5A 3DNCA 4AUKA 2MQMA 3C14B 3NXZA 3ICLA 4UCNA 3AD7C 3PDNA 4XPKA 1FDBA 5IC4B 1CJUA 2HFNA 2DNQA 3VHQA 3QGGA 2QA2A 4DR2J 4UOCA 4CO4A 1H3DA 5HMNA 3L7PA 1ELMP 2ROPA 3FSYA 2E7VA 1YJNS 1YVKA 5K8MA 1OO0B 2A1BA 2BDPA 3D0GE 1S6QB 1TKXB 2HNZA 4ER8A 5JVHQ 5A6PA 2DNNA 4RUHA 2X1FA 1QM9A 4DV6J 4M5IA 4ZLJA 1ZG9A 3HVTB 1RTDA 4UUWA 3BBFA 3W9JA 2ZHBA 3G6YA 2C1EB 2EK9A 1ITPA 1XERA 2VZYA 2IYIA 5DLGA 2BJ7A 4FS1A 4NGRA 1T3NA 1Q8KA 3C6TA 4LR8A 3ISXA 2Z2YB 2PJ8A 1Q82T 2IVYA 3GJTB 4R87A 5T41A 1H7WA 1KVJA 4IHMA 3DCAA 2AP6A 2A0FB 1X0FA 2Z4PA 2Z2LA 5KFUA 4HT5A 4RBTA 4ID5A 1PU9A 4KHPJ 3ENAA 4K50A 1DFDA 5B0CA 4B3OA 1JNZB 4KGKA 1O5JA 3MN8A 3QFHA 4QQBA 4LIWA 2M4MA 1PGZA 3KFWX 4OP4A 4IH5A 2VOOA 4QU6A 3UFCX 4MCSA 1RDRA 3SXLA 1ROFA 3MDFA 4DQQA 4CT9A 1WG1A 2F7VA 2X1BA 1QSOA 3TT2A 5KTDA 3NH8A 3DRRB 4WFXA 2AQ4A 3AXKA 4X66F 2F5IA 3I31A 3EPIA 1PYTA 1FRIA 2O66A 2DGVA 2DRAA 5D4LA 1WOSA 2QJ3A 5FDLB 3EY5A 3PO5A 3E3XA 2B4UA 1Q8IA 1SV5A 4DPYA 2K5TA 3Q86A 1FX4A 2B51A 2ZW6A 4RO0A 4M5MA 3V8IA 2H1YA 4PUOA 1LWFB 4NLRA 3JB9k 2YKQA 2MGZB 5B0AA 3PJXA 1F9EB 2WSEC 2PR8A 2EK1A 1KHVA 1Q81T 2ILYA 2C1CA 3AT1B 1LW0B 1WI8A 3WX4A 1F9HA 1M44A 2R7HA 1EETB 3V6JA 2PO4A 2VBZA 5C2CA 1FJCA 1S7LA 2V8VA 1IKVB 4OHYA 3PHEA 2W2PP 1P1TA 1RTHA 2XWYA 1U1MA 1Z5RA 1B6BA 2GCFA 3QIPA 1YW6A 2HRYA 3IRWP 2YKNA 2JDJA 2GIVA 3RR7A 2RIJA 1YHQS 3FH4A 2M8HA 2M7SA 1NHUA 2DGOA 1C0UA 3BEGB 3CB4A 3IU1A 4ZBGA 4C0HA 3CMQA 4OI2A 2ALZA 1RJJA 1NMTA 4ZY2A 4LBHA 2ATRA 1JLFB 5BR8J 4ZPBA 2GVZB 1XWLA 1U45A 2VUGA 1S7NA 4AVBA 2Y1RI 4HEA9 4QYZK 1KHWA 4Y28C 1PBUA 2C2ZB 4UY8T 4CH7A 2HS4A 2RF2B 3F8KA 2CY2A 1FXRA 2G2OA 2E1CA 3OWCA 2IJRA 3I3GA 2KYXA 4MHDA 4CH0S 4KSEB 3I0SA 4I2QB 3K17A 4GC6A 3Q8QB 4DV1J 3HX9A 3QGIA 1QMUA 2UUBF 4PZVA 3CDBA 4OC0A 4HNYB 2BQRA 2AJ1A 2HHVA 1TKFA 2CQCA 2J0XA 2GFQA 1S5ZA 3P49B 1CPZA 3KUHA 5DJBA 2UUAF 4BBYA 4J91A 4BBHA 2EK8A 1HI1A 1B7FA 3FEYB 2ZOGA 2N82B 1KUXA 1Q2DA 1DTTA 4UT4A 1PC4A 4ECRA 4RUBA 5E96A 3V7ZA 4ZA1A 1ZYQA 1EP4B 2OO4A 2HHUA 1M1KT 2QLFB 3EXCX 4K4TA 3DOLA 4F0HA 2J5AA 4J9SA 2JFKA 5EWGA 3AODA 4FKYA 4JI0J 3PXGa 1VISA 3JVNA 5KT6A 4RW9B 1N48A 4OZJA 3LAKA 4ENOA 3G9CA 3VAMA 5BYSA 1MLAA 2XCAA 1Y9WA 4AXJA 4ED3A 4ES3A 2JH3A 2N4DA 3GR1A 2R98A 4DL4A 1RI7A 2R8IA 1HL6A 3WC0A 2GC8A 4LQ9A 4QVTA 2DNHA 3PJ9A 1PYSB 1F9FA 1T02A 4Y2MA 3RNZA 3KLEA 5D77A 4DCJB 4F3OA 2C3YA 4NJRA 4DLEA 3TYTA 4KKOB 2YNFB 3EJMA 3V81B 1R89A 1IGBA 4NL5A 1S7HA 2EPIA 4U9RA 1Y0RA 1C1BA 2B56A 3LA0A 1LRZA 3BH6B 5GAEI 4DNCA 4ZX9A 4KE5A 2DHHA 1S1TB 3D54A 4MHPA 1ZS6A 2IC3B 1FT8A 1QE1B 4M5NA 4W4MA 4KUAA 5ITHA 3LODA 1XOVA 2GS8A 4Q43A 3Q8UA 1ZLIA 2HBZB 5KFLA 4OHXA 2ZEDA 4Q0BA 4U96A 4EUVA 2FDNA 3BZQA 2HMIA 2JL9A 3GWCA 2OELA 4WKRA 4ZVUB 3QIDA 5JJBA 2B9WA 3ZC4A 2EI5A 1NM2A 3VARA 4I0WA 1VOMA 1WORA 3VV2B 4QR2A 2HVEA 3NAIA 2BW7A 1MNEA 2O5DA 3KK3B 1Y9OA 4MIBA 5CABA 1YGYA 2XGQA 3B35A 1IM4A 3BF4A 4CYUB 4LF6J 4MK7A 1FRLA 4WE1B 5KFVA 3J81Y 1TL1A 2LYVA 2OD6A 2R3VA 1U1OA 4HKFA 4X2BA 3WIUA 3MEDA 1Z4EA 2AJ0A 3CJ0A 2RJZA 1UFWA 5GAGU 4WFNQ 1VC5A 1TTHB 1S1UB 4WCEQ 4K7QA 4KFBA 3C16B 4X5KA 2JLFA 2FC9A 1VLYA 3N5BA 4LX9A 4NZ6A 2J6SA 1TKTB 3CTRA 4A31A 2WB1D 1TK0A 1RT1A 1T3OA 4DLGA 2N3LA 3FJ2A 4RNOA 2WHOA 3QMQA 3TVKA 2NPFA 2RU9A 1D09B 1V0CA 4LVOP 1ZAWA 3D6FB 3W65A 4KPCA 3FSIA 3TUZC 3A8IA 3NCPA 3A4TA 3LGHA 3CJTA 3FVLA 1QSYA 3I0RB 1UJ4A 1YK9A 3TZWA 4OQJA 2VFUA 3FYNA 1BE4A 3S7RA 1IQTA 4A8SA 2P9EA 2PDOA 3IG1B 1S1VA 4USMA 3P96A 5F47A 3D1OA 2XM3A 4EZ9A 1NH8A 1CS4A 5J2MA 3GFYA 2XMAA 4R3KA 5D4NA 2JWNA 2E1MC 4P7VA 4MMOA 1LK5A 1YIJS 2GMLA 2FS5A 4WYWA 1K47A 3H4QA 1RT3B 2VD3A 3Q8SB 4MBUA 2LEAA 1FRKA 4WWVA 3Q24A 5B09A 2PEBA 5F41A 3HHNB 4PYDA 2HFUA 2E5JA 1JLAB 2BRKA 2UUTA 1DTQA 4O0NA 1IM6A 2MB0B 3IGVA 3PY8A 2H5JB 1U24A 2VBQA 1FFSB 3PX0A 3HXMA 2J6TA 4QYRA 2H4YB 5HVGA 5F9LA 3IGRA 1R0CB 1YMEA 3DYAA 1ZA1B 2Z57B 1HDUA 2V77A 1E6YA 3RB4A 1F2OA 4E98A 2DF5A 3JTKA 2WK4A 4V19X 3B4DA 3VZIA 2XEJA 1J5OA 5CYQA 2UXDJ 4P4IA 1V6HA 3DGVA 2O67A 3HJFA 4MYTA 3A12A 2LKZA 2M52A 2B5JB 4PXCA 1PYTB 3I82A 1EKRA 3B6BA 1QVGR 1ELOA 5GAEU 5IWAJ 4MY3A 2ZEJA 3M6UA 4GKKF 2NQPA 3M1VB 1AYEA 5HROA 3VR1A 4XAKA 4N41A 4RU2A 3D3CJ 3AOAA 2ZEEA 3AOCA 5HJXA 4P74A 1N5SA 4FDFA 4LFAJ 3DI6A 2W7AA 2XI3A 1YZ7A 2HK3A 1TF9A 4KLWA 3CDXA 1XMOJ 1XMQF 2AJ6A 2XMKA 3MEKA 2I00A 2QA4G 1O0PA 3T19A 1B70B 5ELYA 1WTFA 3WC2A 2B4OA 4TLRA 3HSJA 2ZH6A 4JV1A 1FNOA 5H9FK 1RXOB 1RAAB 3MOZA 4KH0B 3Q89A 1C0UB 4NXNF 4PG8A 3D1QA 7FDRA 2MMYA 4M63A 3U27A 2V4JA 2KZMA 3TEGA 4LR9A 4Y49C 2XY7A 3CPXA 1Q86T 4NXMF 2QTWA 4ALZA 3MMJA 1AMPA 3TRGA 4USHA 2RDIA 4PK3A 3WX8A 4MY0A 3DXBA 3CCES 4KQZA 2DD8S 3OTBA 1H6KX 4AXIA 5A0YA 2CQ3A 2RE1A 4DV4F 5A2QU 2CXEA 2EFVA 2B3UA 4NE9C 1LEOA 3D0IE 3BYPA 5E3CA 3FFIB 5G21A 1HNVA 4YR0A 3PV8A 2ZBRA 3SCJE 2FUG9 4TXSA 4USTA 4IF5A 2AYEA 1TFWA 4M6GA 4ZCIA 4R6TA 5IS2A 3NG8A 4ZLPA 3I0SB 2YPZA 3UN5A 2WOMA 4AL7A 1A6LA 2QL7B 4C3MA 4B3RJ 5IX3A 2C2RA 2BR0A 1C1CB 2R4FA 2GA7A 2EBGA 2YWKA 4K4UA 4QC6A 1AFIA 4UBRA 4I2PA 4OYZA 3H5SA 4P7TA 4EZ6A 2DEJA 3HSGA 4HHUA 1YWXA 1W25A 1JMTA 4PWUA 4KJIA 4WXOA 3M8WA 4NWBA 2L9DA 3V6KA 2D74B 6FDRA 2FZGB 1WG5A 1I94F 5HSPA 4KLVA 1FXDA 3HLPA 3TOBA 1L3TA 2OMOA 4C7QA 1U4BA 4KO0A 4M1KA 4ZPDA 2EVNA 3K0JA 2BBEA 1SXLA 2AYBA 3DOLB 2VB6A 4QPXA 1G2EA 2E1AA 3K58A 2VA3A 3GMGA 4YY3J 2PJ5A 1FK9A 4ECZA 3D0HE 2CPDA 2M2BA 2JEGA 3I96A 2HAIA 2E5LF 1D0EA 1K73T 4C3KA 2PVVA 2ZM6J 3PEIA 2XMVA 3IC1A 3J80U 1LNQA 1N32J 2QN6B 2QL5B 2ATCB 4DX7A 2CTCA 4MFPA 3W91A 4U7CA 2OFHX 2YPYA 4YWYA 2JDDA 4ICLA 4YB6A 2CNLB 4IO9Q 4P52A 4F4ZA 4UWIA 2HHPA 1WOOA 3OJSA 3KLEB 4OIXA 1LWXA 1H74A 1N5YB 2C3OA 4QCLA 4NPOA 2PR1A 2OLWA 2QVPA 3FCVA 4WKYA 2BVZA 4F3QA 2R2TA 3PR4A 1F3VA 2CQ2A 4EMDA 1WELA 4ED0A 1N0VC 1C1BB 3MPVA 4DPUA 4DV7J 3MXHP 4NYOA 5KT4A 4NASA 1RBAA 1NU4A 3R9GA 3HI9A 3UDLA 3NGUA 3MR7A 5GADI 2OD4A 2BACA 2AX0A 3R6LB 3MGJA 1WNEA 1UFKA 2ZUAA 1B0PA 4K4XA 2WRMA 2XY5A 1X4CA 4NLWA 4NLPA 2K1RA 2Y1JA 5LRGA 2DIUA 3M6XA 2HMIB 3K5MA 3KMQA 1RT6B 2AFOA 3QSYB 4DL7A 2UXBF 4ED4A 2ZH3A 4YR2A 3D4UA 5G22A 3HULA 4J37A 5EC4A 4WWSA 4P4JA 2J9AA 4QWCA 3I4PA 4OADA 2O1PA 5D15A 4ZI6A 3MM5B 2CNMA 1VK8A 3MEDB 1VQKS 2N7YA 1YRTA 3QAEA 2VI7A 2KH9A 1FKPA 5AGEA 1D9AA 3A1YG 2XWXA 4OIDA 1SIWB 3BO2A 2BJEA 3AJ1A 1XIQA 2DHSA 4ED2A 4LSZB 3FBFA 2HEKA 5EGYA 1IVZA 1Z1ZA 2W2NP 5L9NA 4B9LA 1AA1B 2PGCA 2V6AA 5HATA 4A4JA 4F4KA 2MKSA 2X7IA 4LF9F 2RS2A 4AB7A 5BWAB 1FT7A 1FX2A 1X12A 2UZAA 4UF4A 2AFWA 3QLHA 4LF7F 4B02A 4DX8H 2MTLA 4MT1A 4ETZA 2MLZA 4X4RA 3RRGA 3ZZRA 4TNOA 2Z3KA 3LTOA 1R27B 4P6QA 2IVFB 4NGNA 1K8AT 1R8BA 2OI2A 3DKDA 5DQHA 2Z11A 4EBCA 3JTNA 3M2UA 2REFA 2HNYB 4DUKA 5KOXA 1N88A 2G4BA 4QZVB 2YXLA 2C6CA 1FO1A 4B11A 2XZDB 1VBYA 2FVCA 2XS5A 3NNCA 4AL5A 5G20A 1CS4B 5J2MB 2GQCA 5F8LA 1P9YA 2J7KA 3GLJA 3BPSP 4P2MA 4DI6A 5A8WA 3SYZA 4JLYA 2ZENA 3UDCA 3PW0A 1FERA 5KG5A 3KNGA 1MU2A 2OJ3A 4OC3A 4C8NA 1VJQA 2F1FA 4Y6IA 4LBPA 2HHHJ 2ZDPA 3D5MA 2APOA 1SQEA 3NBPA 2HZCA 4N8OA 1DTQB 2D41A 3HZEA 3HHLD 4QBJA 3P45B 4CQ1A 1LANA 1IWAA 1YG0A 1FRXA 4QW9A 5FVJA 3R7SB 1N6QA 3AA8A 3SFUA 2B9YA 4WYLA 1NUEA 1D8ZA 1IBMJ 2ZEFA 3LP2A 1PG5B 3AHPA 1B87A 1SH0A 2G0JA 4C0BA 1IJFB 3TANA 5D78A 1NO8A 1WKJA 2GIQA 1T0TV 5E33A 1TVRB 4OHVA 1I51B 2V68A 3U1LA 4YB1P 3PNIA 5GADU 2JX2A 4FP9A 1FD8A 5KFPA 3KLFA 2HYIB 4X4PA 3CCJS 2QFIA 3B3SA 4L76A 5EX3A 1WSRA 2Q79A 5CPAA 4Y2CA 2PJ4A 4UIBA 3DI6B 3IP0A 5KFTA 4KYZA 1LFPA 3CCTA 4LF4F 1YJUA 1JJ4A 5I3UA 3DDIA 3SZ2A 4Q2LA 3HT0A 3HK2A 3PB6X 1IKWB 2C3MA 1IBCB 2PMZD 1NK0A 4FYYB 4M8LA 2WVEA 4DN9A 4BWJA 4JI2F 2HNDA 3R7BB 3TQEA 1F57A 1TU0B 4YU9A 3B3WA 5LSOA 2E29A 3B2YA 1AROP 1HNIB 3E8OA 1RA6A 3HFKA 4CLWA 4DQIA 4A30A 5KFDA 4C4WA 4NEZA 2IRXA 3CCMS 2DO0A 1AUDA 4X4OA 4HI1A 1KNZA 1VBXA 3F56A 3KUGA 2FGOA 3MPUB 4J9OA 1IOFA 1PBAA 2KJWA 4DHVA 5A8RA 4ZYQA 4I68A 3DOMB 5A28A 2B3TB 4J9UE 5IM0B 1HNVB 4M6HA 2ZH1A 4PV6A 4UA3A 4FBTA 1SJQA 4CTAB 2LCWA 4DV0J 4UW2A 1XR7A 4H6ZA 2M8DB 3CJRA 1MJAA 4DV2F 2IAJA 1H2TZ 2WOMB 3HUVA 4CLZA 5IC6B 4OYPA 5D4OA 2RDDA 4UCMA 1FA0A 4J90A 1Y5IB 3LH2S 2Q3PA 4DV3F 4LR7A 3SV3A 3LW5C 4I2PB 2Y1LB 2FXFA 2C2NA 4IUFA 3H4DA 2BJ3A 2CG4A 2NZ4A 2UUCJ 3VAIA 2KVIA 5DM7Q 4RWWA 1BHNA 4A33A 4NX9A 4J9VA 3R5GA 4AE5A 2B58A 1XE4A 1KC8T 3LO3A 2AFSA 3DLGB 2FHJD 5LSLA 1VI7A 1HQEA 1DLOA 1CJWA 4YHHF 2DNKA 4KO0B 1X8DA 3KMSA 2YWHA 2P6TA 1FD2A 1CJVA 3PYDA 1CX8A 2BKPA 1RU1A 4N77A 4C2MA 1RAOA 4IRKA 2GHWA 5ETVA 4CGMA 1FK9B 1GX6A 4WU3A 4BC9A 4ANCA 4ZVRB 3PIOQ 2PT0A 4EO8A 5HMXA 4DG1B 2FVPA 2K7KA 1HMVB 1BXNA 5HK4A 1ZTWA 4TLQA 1RT7A 4K8RA 4ICLB 1HWLA 5KFNA 1SIZA 3IJ3A 1ZZNA 1RAGB 1U1PA 1FJGF 4KRWA 1RZMA 2Q7SA 5ETTA 3W63A 1X4HA 3NGRA 4KGZB 4DR7J 4IFVB 2AT1B 2G0BA 2GFFA 2VG6B 3EYZA 2AEMA 4OIWA 2EG1A 3FCWA 2BE9B 3MECB 2V8PA 4CO5A 2UUAJ 3CJQA 3U1NA 3ILJA 4U9YA 1WEZA 2I79A 1U1QA 3BLNA 2QEXS 5IV0A 3IIBA 2MJUA 4V1Ak 3KTQA 5HMYA 2CWXA 2CKWA 3IXQA 2F40A 3RR8A 2CPYA 1RWKB 2SXLA 1MMDA 1XK8A 3GPAA 1HQ2A 2FL4A 3HHKA 4M94A 2HZAA 1X5TA 2LQ8A 3IEHA 3T1HF 2I8EA 3CCSS 4X8IA 1JXEA 2QL9B 2HFSA 1NK4A 4OYOA 3B4MA 3BXMA 2ZJPQ 3CC2S 3TP2A 2RS8A 2AD9A 2J7UA 1XR5A 1QDUB 1T05A 2NSMA 1FVSA 4CLKA 4UIAA 4G65A 2BJ8A 3J81U 2K3KA 3BN4A 4NLSA 2CJKA 3R27A 3MEEA 4MFBB 4A48A 3MAAA 4PABA 2WVCA 4O3NA 5HQLA 5F3TA 1P8GA 2YH0A 2V5HG 4IOCQ 1T95A 2AKWB 2GLFA 2MKIA 2CF4A 1FKPB 1HPZA 2RUGA 2MXYA 2FIWA 2ZJRQ 4WTOB 4Q8EA 1ZM3A 5JUMA 2IQ6A 1BO4A 1LWCA 4OZNA 4ZY0A 4JI7F 1S7KA 3W9IA 1FTCA 2BOAA 2DJWA 4OYMA 5IQQA 4KHRA 3MUVP 3OVAA 3CF5Q 3FC9A 5THWA 2AF6A 4OYAA 1RHKB 3WABA 3VH9A 2BUEA 4QUSA 3K5NA 4OC2A 2IM2A 1CBKA 3A8EA 4HPSA 2GQ2A 4R5PA 3GFXA 1ZG8A 1HQUA 3H2LA 3EX7B 3QLHB 5AG6A 1M4LA 4NF1A 1ZM9A 3HJVA 3PX4A 2C2MB 3SQGA 3FMBA 5F8JA 2B8QA 3DLHA 3T9ZA 1WEXA 4EGLA 1K44A 2YY3A 4ZHRA 3OXGA 1HNZJ 1T03A 1S12A 4ZPCA 3GG1A 1M5OC 4TU9A 2ZEOA 3FBUA 2EKNA 2ZE2A 2Z2ZA 2DGUA 1BMQB 1PJ5A 2J9DA 4TYBA 2Z2MA 4OJHA 2JLGA 3ZNJ1 2HW3A 4Z65A 4NA2A 2AGOA 2ROGA 1BPMA 2MHNA 2KXFA 2CWKA 3NCRA 3MEGB 5A8WB 2ZDOA 2Q51A 1SKUB 1MU2B 1X10A 3NGTA 4PWWA 2C27A 5C42B 5B0EA 2ASJA 4MIAA 3GV8B 3NBPB 1GH8A 4HHHA 1RK8A 3NS6A 4DSIA 1VKCA 2YKOA 2GGPA 3VGTA 5HLFA 3O3LA 7CPAA 4P4EA 2HVIA 1UVMA 2OFGX 1HARA 2BKNA 2QLXA 3RRHA 4JUZA 4PG7A 1FEEA 4B3TJ 4LFBF 2DNRA 1YZ6A 1N6QB 1AW0A 1RQ0A 4DFPA 1R7IA 1U8WA 5ETPA 1GTHA 1OYEA 3M30A 3LP2B 3DLBA 4NGTA 1UVNA 3N6LA 1U1LA 2POKA 1RAJA 5DWMA 5AJ3F 2ZJQQ 3I5AA 4L72B 6AT1B 1R57A 3GONA 1OPIA 2I6WA 4JI5J 3T3FA 4H54A 4ORFA 5D8HB 2KYZA 2RAQA 3EVMA 5EWEA 2FCKA 1BLUA 1MG7A 2DNGA 3ZZUA 1XNQJ 5ETOA 2XS7A 3BGRA 2G2ZA 2W24A 1WC1A 2CQ4A 4PEOA 4U7UD 2VDIA 2BZ2A 4MKAA 3T8WA 4DQSA 2OKQA 4ZP9A 2A4NA 4KY3A 1RWOB 5HQ8A 1DAXA 2R7TA 3W66A 3RG6A 3KOAA 2JNJA 4FF3A 1UPMB 2KVQE 3G2XA 1IBKJ 3T90A 1EZZB 4F9UA 3PTWA 1GMWD 2ZD1B 2YNCC 1XTZA 4O3RA 4YUDA 2JEFA 3S8SA 2VQFJ 2ZNZA 1CJKA 1Q79A 4RW8A 5LT5A 1RAFB 1RTQA 1FDAA 1JLBA 2IM1A 1W2IA 1VHOA 4UFWA 2ZH2A 2HVDA 3QNVA 2V2VA 5KT2A 4B3MF 2AFUA 1L5UA 1IKYA 2D7SA 5LYIA 4KGXB 5ISVA 4WK3A 2QT7A 3H2UB 3KHGA 2AGQA 3MGDA 3GUXA 4JI3J 4C7HA 3DLEA 1MROA 2DGSA 5A8RB 4NLGA 1YW4A 4LQGA 1UEUA 1RTJA 4JI1F 1ZTTA 4CLUA 4QYZJ 4E8OA 4URSA 3ZFVA 2IY5B 4MFJA 3WC7A 1S6PB 5HJYA 1HNWJ 3CCRS 4RW4A 3QNWB 3QWUA 4Q5VA 3NCQA 3D9BA 2F4VF 4DL3A 2KZZA 4DF8A 3AJ2A 2MQQA 2YKMB 3G8WA 1VQSA 3ZJ0A 1O8BA 2XEGA 4JI8F 1YI2S 3H42A 1XMQJ 3TO6A 5KTAA 1HA1A 3SCKE 2NS1B 1D1UA 3PRVA 2ADCA 4WZMA 1BQXA 1H0HB 5CYJA 3OSNA 2OEKA 3BSOA 4H4KC 5L1KA 2DPJA 1QSMA 2ZW5A 1CP7A 4UZCA 4B14A 3GCXP 3ULHA 1QSLA 2RD5C 1U6MA 2I5JA 4N76A 1N0UA 3I9V9 1EE3P 4C3LA 5AG5A 4P2SA 3M6VA 3RTVA 3K8VA 1DARA 4OZ5A 1SJ4P 1XIXA 1S77D 4ED8A 2OHDA 5JQ4A 5C24A 2ZZMA 3DMJA 2MZJA 3VATA 1CJVB 4ZIWA 3US5A 1YQHA 2RU3A 4CIOA 4GM5A 5G1ZA 5D6GA 3TX0A 4ELTA 4D3HA 2I1RA 3C19A 4JWPA 3DRYA 3TZZA 2C2DA 2DIVA 3VTIA 2QMLA 4OI6A 2EFQA 4KC5A 4HR2A 4CDIA 4HNWB 4OLOA 4V19J 4DU8A 2PMHA 4ANEA 3H8FA 2MQOA 3AD9C 4KH1B 3ZZIA 1NRKA 4DCPB 1HNXF 4WXWA 4Z37A 2RRBA 3CDUA 5MAOA 5L1IA 1NSAA 4PCQA 3QO9B 3HHLB 1NSQA 1UVIA 4ZN1A 4I6YA 4C7IA 1WHVA 3TO8A 1M0SA 2LXUA 4FBUA 4XPCA 3TC8A 2UUWA 3IWNC 4OI0A 1Y7RA 2ZHOA 3D7DA 3W5YA 1I21A 2RRAA 1FY7A 1JLEB 5G0RB 1K0VA 3IWWA 1U1KA 3ETMA 1W26A 4LVNP 2PE8A 1S10A 5ETLA 4JYAJ 2VOPA 3BSNA 2W9CA 2KHDA 1J5EF 4IOBA 4DXLA 2OEMA 3IU2A 3DDKA 2YNIA 3SSSA 2RC4A 1Q7LA 1EKSA 4MHNA 1RBLA 1S59A 5U47A 1NSKL 2GLJA 1NJWA 1W2BR 4A8OA 3RGIA 1J27A 1CVJA 2JBKA 1ON0A 1M4GA 2QLJB 3FKBA 4JI6J 4OLLA 2RMLA 2FJBB 1U26A 4DR6F 2DYAA 2GAHC 3DSBA 4O3QA 2VG5B 4LMZA 3CWJA 1Z8TA 1WC0A 2DEAA 5RUBA 4EVYA 1CBXA 3MUMP 3M9NB 4ITSA 1BQNB 2REEA 3B3TA 3VQTA 3MEEB 3DFEA 5C25A 2MQ8A 3BI1A 3PHTA 4ELUA 4ZVOB 1RO5A 3HKWA 1DBDA 1CULA 4NXYA 1VFJA 4DFMA 1B0VA 1SC1B 1NLKL 5E5NA 1JXLA 1YX2A 1RTIB 2DXDA 1S7IA 3FNCA 2DXQA 4MK9A 2DTJA 1SL0A 4LFCJ 1RT5A 3QJJA 1Z8XA 4A8MP 1YR0A 4AQYJ 3VGVA 4I69A 2I38A 1RBOB 4Q45A 1HBMA 3SDEA 1SJ1A 3DDDA 4E0AA 4QW8A 3ZTSA 1PYOB 3KZWA 3TUJC 1AUGA 3MMAA 4ZJQA 4KOSA 3N28A 4NLVA 3PYFA 2XS2A 1HQUB 4KBIA 1KLMB 2BQUA 1V9OA 2YVSA 2JOQA 3HFVA 3SQGB 2B4VA 4GKJF 2KFZA 1KR4A 2KM8B 2FLNA 1V5VA 1XBUA 3U1MA 4R9MA 4UEFA 4IH7A 2G1DA 4ZGYB 3V4IB 3VWSA 1M1DA 1IBLF 2DEIA 4ZHRB 4UEEA 3PRBA 1G6BA 1QTNB 1KQFB 2ZE2B 3MM8A 2CNNB 2WBRA 3CGIA 3GP9A 4X62F 2EKYA 1TELA 3IWEA 4AG7A 4P4BA 1GMUA 2P6GA 1WI6A 2E9ZA 1UJ5A 4DYOA 2PJ9A 3ET6A 4AT1B 3EZ5A 5EX0A 4XPDB 1HEEA 4C2XA 2IYGA 1Y7PA 3OR1B 3IAM9 5EDWA 4PWDB 4U5YA 1S0VA 2B5GB 4U9ZA 3M6WA 3OSPA 4FWUA 3VZHA 1EX8A 3CJ5A 3BREA 3AJDA 4F4YA 4OHWA 2QSWA 3I56S 2BCOA 5HLFB 3QSIA 4L3KA 3D28A 5HVHA 3L3CA 4LUAA 1XFOA 3IFEA 4DF4A 1IYLA 1F5CA 2FYXA 5JVGQ 5LXYA 3BSAA 1GEHA 4B9NA 1F3FA 3RBDA 2HGLA 4FZVA 3TO9A 4ZP7A 1BOBA 4YB7A 1F60B 2WSAA 1Z4UA 2PD1A 1NH7A 2VKRA 2M88A 4BDPA 4B3SF 1RWMB 4M5KA 4KOUA 2JLMA 3CD0A 4L8AA 4RBVA 3IR5B 2ZELA 2HQCA 2J7WA 3AY0A 3GQCA 2UU9F 1UL3A 3GJQB 1CC7A 3BN7A 2HWTA 1U6BA 1ICEB 2KDOA 2OTJS 5DQIA 2DRBA 3OL9A 4Y00A 2BXJA 2V2ZA 5IB9A 2FZKB 4OX9J 3MM9A 1NEEA 4E8UA 2GJ2A 2HPUA 3FCHA 1JLCA 3ONQA 3DGPA 5CZVA 3KJNB 4YOEA 5CAAA 3HCXA 2WSFC 1R31A 3RJMB 3AB4B 2C6GA 4CPAA 2M9KA 4PR6A 3LGMA 3UVJA 4HH0A 4FVMA 2Q7BA 1DY3A 3I55S 1JJ2R 4OZLA 3I5CA 2F63A 1Z4RA 3ITHA 2GZOA 5T7LA 1MJBA 1VHIA 2VQEF 1CJKB 2ZWOA 3KLGA 5JPHA 4G1QA 2NUUG 1U49A 4ZPVR 2KFYA 1TL7A 3LP1A 4KOYA 2CQPA 1RU2A 4LJMA 3RAXA 1IQZA 2CNOB 4A39A 4USWA 2QG9B 1N54B 1NPPA 2FY1A 3WQPA 2RKIA 3ILIA 4IFYA 2CVIA 3D2PA 3M32B 3DLEB 2KKHA 4LF5F 1MROB 4ZY1A 1WK4A 4USKA 1RTJB 1HBNA 3CDWA 1N52B 4MFQA 4CGNA 4ZVPB 4I1TA 1UVJA 3R1LA 4J7CA 4NSQA 3TJ8A 3G8SA 4H4OA 3P3DA 1LOUA 3NOGA 4RR5A 4RW4B 3CZXA 4WP3A 2PJBA 4DMZA 3VWEA 4DCOB 3OVBA 2DGXA 3WT4A 2PDAA 3B8HA 1TMJA 2P8IA 3CPWR 4YFJA 3Q8RB 2CPHA 2BQ3A 4PPDA 5KFMA 3K59A 2FB0A 1DHMA 2ANPA 3KLIA 3D68A 3HLUA 1URRA 1TK5A 1CLFA 1HDQA 1Y9KA 3I1UA 2OPPA 1D9FA 3BDEA 3LPEA 3BJ7A 3PZJA 2VXKA 2I5JB 2V8DA 2JEIA 4C0OC 3QT5A 1NMEB 1F5BA 4BINA 3J80Y 1U2RA 3QZ7A 2HK2A 5C24B 1ZLHA 4LRFA 1LKZA 3T9NA 4O4RA 3V6DA 2Q66A 2GX8A 3A3NB 3HVWA 1ZPWX 3PYEA 1S3ZA 4HDHA 4PXDA 3AOBA 2QYVA 3C26A 1XBWA 4F2SA 4P2FA 2OB0A 3MCMA 4X2TA 1T7PA 3ZZYA 2AEFA 3H59A 3W9HA 3CMAS 4LSNA 3K2YA 2L9WA 4HHJA 3QWPA 4E2FB 4R8UB 4ECVA 2CVEA 2FJDB 1Q4RA 1ZOTA 3QGPA 2PJCA 1VK3A 5KT7A 4MFKA 3UD5A 2CJXB 3VAGA 2B4PA 3DHXA 3RZAA 1GXUA 4JV0A 2ASYA 2XO7A 3MR2A 4DR2F 5SUHA 3R9FA 4USJC 3CT9A 2F8HA 4FYXB 3LP0A 4K2JA 2WVFA 3IWLA 3JS9A 4B12A 1YLXA 1I5OB 2IDLA 3WBZA 4ZVTB 1OMSA 1S57A 4MFLA 4CO0A 5F0UA 3IN5A 4NLDA 4DV6F 3GKRA 4IDKA 5LMUJ 3L2NA 5LJ5Y 3E01A 1HYSB 1IN0A 1RKJA 2Q4ZA 4MFZA 1AT1B 2XI2A 2L9NA 3PRDA 1YGHA 2VFTA 4OI3A 4CGPA 2K3IA 5BYRA 2FY8A 1RWXB 5DWNA 3NE7A 4XK8C 1GXTA 2CADA 4HTJA 3DM2A 1KUYA 1U1RA 4RW6A 3OL6A 2Z3MA 2YNIB 3TARA 3G4SS 3NWRA 1PKUA 2AJQA 1JJCB 1HFEL 3IM9A 3MTJA 1SB6A 3OUYA 2NPIA 2XEIA 3TJ9A 1ZBTA 2MKHA 1U09A 1FKOA 4KHPF 4B6ZA 3I4HX 2OPSB 1NJZA 4DL6A 1N36J 4DPOA 3R5CA 2BANA 1Z8WA 3DRPB 3SJXA 3KR5A 1P0HA 3DOKA 2HLTA 3P2HA 4K5SA 1H7XA 3NLCA 1SJ3P 1B64A 5HN0A 4J9RA 2KTQA 1NK6A 3R5JB 1S0MA 5F46A 5C25B 3P8BB 1QSTA 4PXEA 2EWHA 1CULB 1RCOB 4U95A 1GNKA 1Y10A 1MMNA 1FDNA 5ADZA 4M6IA 5LMNJ 5I3QA 4K0KF 2JC1A 4R57A 5DDPC 4NMLA 2CIMA 2XYHB 4ZJOA 3GIJA 1OQ6A 1BQMA 3FF3A 3FECA 2EEYA 5C7PA 4WF9Q 2NREA 3GYGA 2IJFA 3SDEB 4C68A 3H5UA 2V50A 3P4UB 4MKYA 4PAAA 3PZPA 3IO1A 1WTBA 4FAIA 5J1QA 2HSEB 1VQ7S 4CYQA 2KRRA 3M2RB 1WJ9A 1IU8A 3QGHA 2CPJA 2ZFHA 4TVAB 1S72S 1X4BA 1VC6A 1XR6A 3GR0A 4EFDA 4YEAA 1HLWA 4KHMA 4P9SA 2DR7A 1NHVA 2CNTA 2VKZG 4F67A 3OFEA 1PUAA 2EK6A 5FIIA 3W64A 2HZVA 1XEZA 1AZSA 2NXCA 4WP9A 3UDVA 4IK2A 2AJ2A 2MEWA 2CPEA 4Z2XA 4KOTA 2A2DA 2IDEA 1VQ6S 5B7WA 2QFJA 1WOPA 3OL8A 3FNNA 1S1XA 2HQ3A 1DE4C 2XSFA 1Q5YA 3EXNA 3N4WA 1NSLA 2AW0A 3B7IA 3D66A 4UWJA 3HHEA 3ET6B 4RKUC 1V5IB 1APSA 3P5BP 3H5YA 4ZN3A 4ZVEA 1U6FA 3MM7A 2XZWA 1T9XA 5L38A 1Y3KA 3QT8A 2VBWA 8CPAA 4WBFA 2V34A 3H40A 3TVZA 3G82A 1RHQB 3R5BA 1RT2A 3BKFA 3W62A 3QB8A 1LW2A 3A3OB 3OXLA 1FTRA 3Q8YA 1AXQA 2KJVA 3ENWA 4PRFA 4DV1F 2LXIA 3ZXWA 3W8PA 4A2ZA 5KG2A 2W7OA 2R2UA 4IR1A 2HQDA 1YJ9S 2UVWA 1TUWA 2MSTA 1HR0F 4MJKA 2DGWA 1R0AA 5EN1A 5DGAA 1SBRA 1H73A 2MDAA 2MQNA 2OPQA 5KFEA 2PI4A 2PJ2A 3BGOP 2KCWA 4MTPA 5F49A 4OJ1A 3H0PA 4GC7A 2GU2A 2PA3A 1S48A 4I7FA 3THTA 4F4AA 4DPTA 2QMWA 2QYCA 4DS5A 3KHRA 4EBDA 3SIPB 2CIJA 3BJ8A 3PB8X 2VU5A 3OFGA 1YJVA 4JI0F 4D3GA 3Q2SC 2EFNA 1JLCB 2OH2A 3DGPB 4X65J 3TX8A 2V8HA 1Z8LA 4IQMA 4L75A 3PGPA 3W8GA 3CMES 4BCAA 5JXSA 2CG8A 5GAGI 2FVQA 3L4BC 4QOTA 3FEXB 3WC6A 1IKXA 2IM0A 3ITHB 3HHLC 2V4RA 3BHXA 5T7LB 5J2PA 3KLGB 3IBFB 4LFBJ 4EYHB 5GVQA 3UN3A 4G1QB 4DQPA 3LP1B 4OMEA 3CJ4A 1R6YA 3FDSA 1MWQA 2ALYB 1KTVA 1FE0A 2HC9A 1C2PA 1I6JA 5BJRA 2WPWA 2A18A 2RKIB 1UEKA 1SL2A 3GYNA 4IRDA 1RACB 4W98A 2PRBA 5KFGA 4OX7A 4JD6A 1TK8A 1RTZA 1FJ7A 2DHXA 4O0IA 2D3O1 1N34J 2KXNB 4RS2A 2HWHA 1RWPB 4WPAA 1VCTA 4Y0FA 2ZUGA 3POTB 1DJ0A 2E66A 2V9WA 2CUYA 4KTQA 3WZ0A 2FVSA 3CO9A 2QLWA 4BMHA 2B0GA 4U6PA 4DL5A 4W92B 5J2QB 2ROEA 1A9NB 3W7BA 1JX4A 3CIMA 1S0NA 1SC3B 4DBQA 2AX1A 1PO6A 1SVDA 5BXIA 3KUEA 3IM8A 5IZHA 1IR2A 3KLIB 1XMTA 3DR8A 4CLLA 4FBEA 1Q16B 5HBMA 1URNA 2OPPB 3DXSX 4LF6F 4OAEA 1Y5NB 4LF8J 3M2VA 3S6KA 1ZAXA 4LRDA 1UTAA 4R0JA 3GY9A 5KFAA 3UO0A 2YBVA 1ARLA 1T9UA 3DRSA 4YB5A 2QC3A 2F9JA 2EFPA 2QMUB 4F0MA 2KHCA 2NSBA 3NH4A 3UD3P 1UA0A 2GVDB 2V0NA 3W61A 2R7RA 3M8RA 1GTEA 2NYHA 3NFZA 1SQFA 3PKYA 2UV8A 3F0AA 1U0HB 2VFVA 1NPRA 3NEKA 3TEHB 4LSNB 3PVXA 3U02A 2YWFA 2EFGA 4O44B 1RWUA 1BWVA 4DR5F 5IOLA 3FJUA 5CD4H 3DNSA 3BJYA 2BE2A 3LQVA 3H5ZA 3HF5A 1NKEA 4A47A 2R2SA 2DGQA 4FYWB 2WBMA 4LRBA 3S01A 3LWMA 2PC1A 4FXDA 2IFXA 1O6XA 3EDQB 3I5BA 1TL3A 1JLQA 2O3DA 3B3CA 5GMDA 3KJVA 1N71A 5M2RA 2DNLA 2OPRA 2MKYA 4OHZA 5DZ6A 3H8EA 4EK2A 4KZTA 4IDKB 2UXCJ 2WUUA 4FKXA 3E01B 3K9UA 1FESA 3IS9B 5F3ZA 3C2PA 4NCAA 4L73A 2R1IA 3SSRA 2AGPA 3UE2A 2Q04A 4NLTA 1BUXA 1RT4B 2CNKB 3TTHA 4OMFG 2HFZA 2KG0A 2WONA 2CZ9A 4PSWA 1C4CA 4ZVGA 3H25A 3GB0A 5AG7A 1N5VA 4L74A 4CNYA 3CCUS 1DQ9A 2Q4YA 2E1RA 5J1EA 3H2VE 9RUBA 2WZNA 1WHXA 4DR1J 1FKOB 1WKLA 3KK1B 2AJ4A 5F8MA 3SI1A 3W2WA 2ZEMA 4IYQA 1HBOA 1CC8A 4UEZA 3C14A 1NB2A 2HGNA 1YREA 3TOAA 3ZO7A 4CGLA 3DOKB 3RYOA 5L39A 3IWGA 3C8YA 4ZMMA 3WIVA 4JXRA 2UXDF 2DR9A 5KFJA 1TKXA 2Q1LA 2VZZA 1N4LA 2W25A 1NZAA 1U1NA 5IWAF 4H4MA 2YX4A 1SJRA 1F2HA 1CJUB 3ISZA 4TYAA 1S97A 3D7SB 5D29A 3TZXA 5A27A 3MD3A 2ABZA 1X7VA 3PBEA 1GK8A 1T94A 2XC9A 2CDRB 2E5HA 2HNZB 3M8ZA 3EUNA 2RDJA 1KKHA 1UFLA 1RTDB 4L89A 1XMOF 2ZH8A 2ZC4A 4WZQA 1KTQA 2JEVA 1QSSA 5EWFA 4A95A 2V4QA 1OZPA 2P5VA 2U1AA 1M5PC 1FNXH 4KOXA 4ECUA 3R5DA 2DH7A 2HG4A 3UW1A 2Z30B 3C6TB 2JHEA 4MRIA 4NOHA 1M5HA 3VVTA 3PBBA 3AQPA 3R1HA 5M2UA 4UQTA 2XG8A 1AZSB 2H48B 1BAVA 3CJ3A 1SH2A 2W8LA 1VRTA 3DLJA 4ID5B 1JNRB 3UNGC 2VIHA 3DRRA 2GO8A 1S1XB 4B3OB 1BGXT 4KOWA 4ZCLA 4HL9A 2WVDA 4B5PA 3D3SA 1YX0A 2D3OR 1S6UA 3MM7B 2CDQA 4F8RA 2V67A 1RWWB 1U7LA 3G82B 4ZCKA 4P6YA 1T11A 3F73A 2PSWA 4OYXA 3Q0AA 1VQ5S 2HV2A 2A10A 2O4HA 3LMSA 3CIZA 1YBTA 2R8KA 4B3RF 4OC5A 1LW0A 1M5VC 3X1LB 3KHHA 4ELVA 1XNRJ 3TCVA 1XJWB 1SV5B 2WW8A 1R0AB 2BX6A 3GCWP 4PUOB 4O4GA 1IKVA 2ZBCA 5KFHA 2XEXA 1H2VZ 2IMWP 5EUHA 3QAHA 1IBLJ 4R76A 2J9DE 2PJ0A 2MKJA 2PRQA 4RLEA 4I7FB 3ZTQA 1TMMA 4DUYJ 3O44A 5IB0A 3S9LA 2VF3A 2YQ1A 5F8HA 1RTHB 4X64J 2LA4A 1JLFA 4N8NA 2BJ1A 4UZBA 3QIPB 2GVZA 3T5LA 2HIYA 2YKNB 4N47A 2X1GA 5GMEA 1RHUB 5AXMA 4M85A 5BYQA 3EXYA 2OAUA 2GW8A 2RQ4A 2VPYB 2VJVA 3CULA 2RF2A 5DDOC 2ZM6F 4JV2A 4ZVSB 2B4DA 3D6MB 1N32F 1JB0C 3UI3A 1IUJA 2FJWA 3ZZZA 4I2QA 4X4NA 1XEBA 1VQPS 3S9MA 8ATCB 3TFYA 4P10A 3DU6A 4C8ZA 5J2PB 4BHQA 2ERRA 3JSYA 2F3JA 2PE3A 1E6VA 2KG1A 4OYIA 4ES2A 4N7TA 3GIIA 3PB4X 4JOUA 3GILA 3VAHA 3JYTA 3G6ES 2Y3YA 5K14A 4M5LA 4JV5J 1QQ9A 2BMBA 5F9NA 3OW2R 2XMWA 3SHPA 4DV7F 3T1YJ 1UFHA 2W4DA 2CYYA 2DY9A 1SKSA 3KDOA 1PC5A 4O3PA 1EHWA 4JI4J 1LV5A 4Y34A 2V9KA 4RWXA 4LBIA 2WPXA 2H5EA 2WW4A 4P45A 5KFKA 4C8YA 1Q78A 4BD9A 4UFVA 2NZCA 2HVZA 2AU0A 1Y5LB 1F2PA 3FRYA 2FJVA 5CA5A 1BD6A 1K1QA 2PVWA 1KVKA 1OIAA 4CCHA 3MF5A 2VHGA 5IV4A 2Z10A 2P6FA 2VG7A 2BKOA 2FLOA 1XF8A 2PQ8A 1DTDA 4NLXA 4RW9A 2YTCA 2G2YA 5CYMA 1DTTB 4UTGA 1T8EA 4MCQA 2GIRA 1CJTA 3S6EA 1CG2A 3TJAA 2ZBPA 4ZCMA 3C15A 4AD6A 2I9SA 3QT6A 1S9GA 2I3CA 3D2MA 2FVGA 3K5LA 2DXEA 3OLBA 3MRUA 1GMVA 3NE8A 1RLCL 3R7NB 2PJ1A 3D6HB 4OJGA 2UVRA 1QAYA 4FF4A 4KKOA 1ZM4A 2YNFA 3G8TA 1IB1E 3PFOA 3TNVA 1QTMA 1LAPA 5CCMA 4BWMA 1PAEX 2MZRA 4KOVA 4ES1A 3PB7X 1KQSR 2XMTA 4QIFA 2ZZNA 7AT1B 1PCAA 2YQ0A 1QE1A 4ATNA 2X3DA 4F4WA 4NGMA 2ABYA 3M7VA 4FNIA 5HQMA 4CM0A 3W2VA 2OGUA 3EICA 2VBYA 3BO3A 1VMBA 3G71S 3C46A 3GG0A 5ETRA 2HUZA 1S60A 2HKEA 3CJ8A 1S6OA 3E0KA 1VQMS 4Y2IA 1JLQB 4AVCA 2Y0SD 2DNYA 5AE1A 2RQCA 5LM7E 4E2AA 3KJVB 3KASA 2OPRB 4QR1A 3KHZA 4P2XA 1B3TA 3T5HA 5HMZA 1FWLA 1S79A 3R97A 3KK3A 4Q0BB 1QLNA 4HH1A 2E1PA 5E3AA 4CYUA 4UOHA 1QSRA 4WE1A 3HPOA 3V5RA 1WDTA 3CNQP 1VHFA 3KL9A 2PSZA 4UQGA 2VEZA 2GJFA 2DH9A 2FJEB 3FRMA 2HBYB 4HKQA 3KG4A