3PFEA

Crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
471
structure length
471
Chain Sequence
GMFKPQGLYDYICQQWQEEILPSLCDYIKIPNKSPHFDAKWEEHGYMEQAVNHIANWCKSHAPKGMTLEIVRLKNRTPLLFMEIPGQIDDTVLLYGHLDKQPEMSGWSDDLHPWKPVLKNGLLYGRGGADDGYSAYASLTAIRALEQQGLPYPRCILIIEACEESGSYDLPFYIELLKERIGKPSLVICLDSGAGNYEQLWMTTSLRGNLVGKLTVELINEGVHSGSASGIVADSFRVARQLISRIEDENTGEIKLPQLYCDIPDERIKQAKQCAEILGEQVYSEFPWIDSAKPVIQDKQQLILNRTWRPALTVTGADGFPAIADAGNVMRPVTSLKLSMRLPPLVDPEAASVAMEKALTQNPPYNAKVDFKIQNGGSKGWNAPLLSDWLAKAASEASMTYYDKPAAYMGEGGTIPFMSMLGEQFPKAQFMITGVLGPHSNAHGPNEFLHLDMVKKLTSCVSYVLYSFSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a M20A metallo peptidase (dapE, lpg0809) from Legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
total genus 137
structure length 471
sequence length 471
ec nomenclature
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pfeA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pfeA01
1GYTA 3NH8A 5JH9A 4EWTA 1ZG8A 3B3SA 4MXUA 1DTDA 2BCOA 4YWYA 2CF4A 3PRTA 3PB4X 2ZEGA 4MHNA 4P45A 1CX8A 4ZX9A 4LQGA 2ZOFA 2ANPA 4MHYA 2OOTA 4IK2A 2ZEHA 3D68A 1BAVA 4ONWA 1CPSA 3RZAA 1PYTB 1YMEA 4P10A 1QQ9A 4OC4A 2ZEMA 3LMSA 1ZG7A 2POKA 3SI1A 4A37A 1F2PA 2PRQA 3B3TA 1TKHA 2ZEDA 1F57A 4EFDA 1Z5RA 1FNOA 1UWYA 4PPZA 2PJ0A 4ZY1A 3HLPA 5CPAA 4WJBA 2DEAA 3I1UA 3SI0A 1CPXA 5THWA 3BXMA 1TF8A 3KASA 1QMUA 3GUXA 3S9MA 2V8GA 3VARA 4UIBA 5LRKA 1Z8LA 2JBKA 4OKOA 3IWWA 4F9VA 1NSAA 2NSMA 4PXEA 5F09A 3B3WA 2Q51A 5HVHA 2QYVA 3WC6A 4G1PA 3BI0A 4BD9A 4EMEA 2AFXA 1H8LA 3KHZA 3GB0A 3PB7X 4OC0A 2AFUA 3NFZA 3TC8A 4PQAA 3FMCA 3L2NA 2Q4ZA 3WT4A 3B35A 2FVGA 1XJOA 3FF3A 4P4DA 2PIZA 4UF4A 4W9YA 5JGFA 3PFOA 2ZEEA 3CT9A 2PVVA 4NGPA 8CPAA 4NJRA 4NGQA 3D7DA 5J1QA 3RBUA 3DLJA 4P6YA 2PJ8A 2G9DA 7CPAA 3BHXA 3CDXA 2JBJA 3KQXA 3PB8X 4DUKA 3D4UA 3SJFA 2V77A 3IC1A 3K9TA 3H8FA 4X2TA 3KI9A 5HXDA 1ARLA 2AFOA 5LYIA 3H8EA 3PBEA 2IJZA 1R3NA 4OP4A 5LRJA 2ZENA 4FAIA 4CPAA 3B2YA 4R8FA 5IB9A 2OR4A 3KGQA 1YSJA 2PJCA 3JRUA 4OC3A 2C1CA 1BPNA 1Q7LA 3KQZA 3ISZA 5JM6A 3D7GA 4GM5A 5LYLA 2F8HA 4OMEA 3T8WA 4MCQA 4A38A 4NJQA 1Y0YA 3B7IA 4ZYQA 1CP7A 2BO9A 1TKJA 3CPXA 5LYFA 1LOKA 1HDQA 3B3CA 5K8OA 3IIBA 3IO1A 1VHOA 3TX8A 4ZY2A 1LANA 3HUVA 4UEZA 4B6ZA 3NA6A 3GLJA 3KR5A 1Y0RA 2BOAA 3PFEA 3LWUA 1VHEA 2PJ9A 2NYQA 3IJ3A 2GLFA 3WC7A 1HDUA 2PJAA 4FWUA 4R6TA 4DYOA 4MCPA 1VGYA 2HB6A 1YLOA 3V38A 3VATA 2IQ6A 2O53A 2CTBA 1TF9A 3PB9X 2ZELA 3MRUA 1TXRA 4A39A 2AFZA 2VL1A 1KWMA 3S9LA 4JZ0A 3D66A 2PVWA 4FBEA 2CIJA 4P44A 4TWEA 2PJ1A 3WABA 2GREA 4P4BA 1XMBA 1VIXA 2PIYA 3H8GA 3SJGA 1XBUA 1Y7EA 3MN8A 2WYRA 1TKFA 4A94A 2AFWA 2GU2A 4MCSA 1XFOA 3FH4A 1LFWA 1CBXA 1LCPA 5K8MA 3V7ZA 1BLLE 2IMOA 3D67A 5CBMA 4NGTA 3D7FA 1LAMA 1IY7A 1ELLP 4MRIA 3DGVA 2V8HA 4PXBA 5ELYA 3NH4A 2F7VA 1EE3P 3PBBA 5LRGA 2V8VA 1FT7A 3FVLA 2XEGA 4R76A 3N5FA 4Z65A 4OC1A 1CP6A 2O4HA 2C6GA 3BI1A 4ZX8A 5D29A 2XEJA 2PE3A 3PEIA 2EWBA 1HEEA 4UEEA 4NFRA 4P4IA 2PJ2A 4X8IA 4P4EA 3PB6X 3FEEA 4PXCA 3SJXA 4PXDA 4NGNA 4ZY0A 3FJUA 2GLJA 2V8DA 2C6PA 3FEDA 3KR4A 2J9AA 1R43A 5K8PA 4YU9A 3KZWA 4OC2A 3IFEA 5HVGA 1ZLIA 2XEFA 5HVFA 1ELMP 3IEHA 4OIDA 4DJLA 4Q7AA 4WWVA 3NH5A 2XEIA 2PJBA 4NGRA 4NGSA 4ZI6A 1CG2A 5I4MA 2PJ6A 3RAMA 2AFSA 2PJ3A 3SJEA 2EK8A 1DE4C 3K2KA 1BPMA 2AFMA 1IGBA 5D8NA 1OBRA 4IHMA 2EK9A 4OIWA 4UEFA 2HC9A 3KL9A 5DS0A 2JEWA 2PJ5A 1AYEA 4IAVA 4TNUA 3S9NA 4MHPA 4MCRA 4O23A 1ZLHA 2WZNA 3FECA 3D7HA 1PCAA 4MMOA 4F8ZA 3KHXA 2ZEPA 1YW6A 2I3CA 4FUUA 3B3VA 2QVPA 2PJ7A 4F9UA 4AXVA 1RTQA 2ABZA 4KSIA 1Z2LA 1JQGA 1LAPA 2C6CA 5K8NA 4MHZA 3FX6A 4RUHA 5LYDA 1F2OA 1ARMA 1AMPA 4X3RA 4P4FA 1YW4A 4NGMA 2ZEFA 2CTCA 4OC5A 2RFHA 3QNVA 4R7MA 3SI2A 4P4JA 2Q43A 2ZEOA 2QJ8A 4UIAA 1XRYA 4H2KA 2PCUA 3VH9A 3CPAA 2PJ4A 3WC5A 1M4LA 4JYWA 1ZG9A 4K3NA 2ZOGA 2RB7A 6CPAA 3ISXA
chains in the Genus database with same CATH superfamily
4EK2A 4DV4J 3VF0B 1IN0A 3KHLA 2BCOA 1CX8A 2VUGA 2J9DA 2HQ3A 4ZX9A 2ZOFA 4UUXA 2FSRA 3ZZUA 1PILA 4UBRA 1A6LA 1X9SA 2IJNA 4HI2A 3ZZIA 2BM1A 2BE7D 1WG4A 1A0OB 4ILRA 2DRDA 1TKHA 2R7HA 1XF8A 4DL6A 3L7PA 5HBMB 4DV7J 1CPXA 3IMQJ 2R3VA 1M1KT 3MR6A 4KJIA 2ASYA 3GV5B 4F4XA 3M32B 1NKEA 1TFWA 5E5NA 3SQGB 3DRRA 4CYOA 1KUXA 4I6YA 2GQCA 4DF8A 1R7IA 3LODA 2NSMA 4J9VA 4WIQA 2GW8A 3EWGA 5ETLA 1RADB 1IYKA 3CDWA 5HVHA 2DR9A 2MTLA 3MI7X 5AXNA 2BE9B 1E6VA 1KBRA 4RBVA 4JV5F 1X5TA 3I0RA 3LF0A 2ZE2B 3CJQA 3EE3A 4FKYA 5F8NA 1LOUA 2UUAF 1X5OA 3M1VB 4HYKA 5T7LB 1RSCA 2VA2A 4JI5J 1D9DA 4JI6F 4NGQA 4ZP9A 1ZO0A 1GEHA 3HHLC 3RBUA 3B8GA 3EICA 1GX6A 3MR5A 2PMHA 4DU8A 4QIGA 2J6SA 3NWRA 1TVRA 4H4KC 1RXTA 2APOA 2LKZA 1CQMA 4CWBA 2HHXA 1SQEA 4MFPA 3KXDA 3OFFA 2PR8A 2WSCC 1BQNB 3QRPA 5J1NA 4ECTA 4CPAA 4F7VA 4K30A 2DPIA 1YSJA 3W8GA 3R2DJ 3G3SA 4NLDA 5C7PA 2IY5B 1KD1T 1N88A 2K3IA 3MEGB 4AYBD 2DRBA 2OEMA 2GFFA 5D6GA 3A8EA 3HT0A 3CC2S 1HDQA 5KTCA 3ZZ0A 4DR2J 1RT3A 1N4LA 1LW0B 5H9EK 1IKXB 4ZY2A 2HNDB 2Z2YB 3NE8A 2AJ0A 3NY0A 3ZZOA 1Y0RA 3FXTA 2DGTA 2KXHA 5LSLA 5G1ZA 2VQFF 2I5JB 1UA1A 1FCAA 3KDOA 4FWUA 2ZH6A 3A8KA 1RT6A 2HB6A 4WFAQ 3VAFA 5ETSA 2R7QA 4GVLA 1Q78A 3GSIA 3NGSA 2WB1D 3QLHA 2CPXA 2LP4A 4JP8A 5E3RA 3FMWA 4JZ0A 5J2PB 1NKBA 2EPIA 3H4QA 3AH6A 3DNCA 4NZ7A 3I56S 4UY85 2JX2A 4FYDA 2VDIA 3NNAA 2QJ3A 5L38A 4ED1A 1TKTB 3FJ2A 5IOLA 3KFWX 3MM6A 3DNSA 2Z8QA 3MAHA 3MCOA 2ZUAA 4ZVUB 3SCKE 3CDBA 1Y3KA 5F47A 1YHQS 2BACA 1CBKA 2QL9B 2NXEA 1R6YA 4FVMA 1U0HB 3I82A 2ZDPA 3NE7A 2HV2A 3CWJA 2EG2A 1DHMA 3I0SA 3H4DA 2R42A 3UE2A 2WBRA 2X1FA 2ZM6J 1IWGA 1QAXA 4JUZA 4Q36A 1TMJA 3D1QA 2W01A 4C3KA 3THTA 3GFZA 2RRBA 2PE3A 3R9EA 5DM6Q 4ED3A 2XO7A 4OFZA 4CTAA 2RDJA 1ZBTA 4YFJA 4K2JA 3PHTA 3MGDA 2I38A 4B3RF 3UPFA 2KT5A 2OH2A 4KC5A 2Z3PA 4PXDA 2CKWA 5IZHA 3C2PA 2IRXA 5IB0A 5CHCB 3KMSA 4O3SA 2FS5A 1SCJB 3RRGA 3KLVA 1JLAB 2DT9A 3BV8A 2JEJA 4NGRA 5I4MA 2DGXA 1VQ6S 4ZVGA 3K2KA 1J4JA 3EVMA 4AE5A 5C82A 1S6QB 1Y9KA 4OIWA 1KOOA 2K1RB 3BM7A 4IRCA 2YWWA 2CDQA 2DO0A 4L6V3 4IUFA 2GNKA 3NGTA 3VQSA 3GR0A 2PJ7A 4RZRA 2KZZA 4AXVA 1IKWA 4AL7A 5K8NA 3KUEA 5D0GA 2QIFA 3BB5A 5HJYA 3I31A 4QYZK 2CQ3A 2VA3A 1XERA 4YEAA 4K4WA 4I4BA 4X66F 2MQ8A 1YX0A 5AG4A 3CJ4A 2VG5A 4HH1A 1TZ0A 4PZVA 2XY7A 2QJ8A 4EO8A 1S9EA 4JI3F 4BBYA 2UXDJ 2F5GA 1HLWA 5E3PA 1NSLA 1K9MT 1C0TB 3TOBA 1NH7A 5KFSA 4FD5A 2M52A 4LRBA 2XZDB 1KQSR 4MT1A 2WAQD 3PB4X 2E1AA 3OL6A 5B0GA 2FD2A 4U9YA 2J6UA 1S0OA 4RS2A 2LEPA 2B3TB 1VR6A 5I0CA 2W2QP 3EXNA 2CJQA 1F2HA 2L3MA 3U1NA 3LMSA 3FRYA 4B3MJ 3JTKA 3K8WA 4O4GA 2GVDA 4NYOA 4CS0B 4KVME 1Z8XA 3UR0A 2COLA 2DCUB 1Y10A 2HHPA 4NA2A 5AG5A 3C14A 2AJ2A 3QFHA 3HFZB 2QGFB 3FEZA 2CZ9A 1HBUA 4DPOA 4C8YA 2BV3A 2PDOA 3BBCA 4ES1A 4CIOA 2DTJA 1TL3B 4YQWA 1RLCL 1SIWB 1YK9A 2RQ4A 3KG4A 3CSKA 4FD6A 1EETA 3GMGA 4C7QA 1H8LA 1HHQA 2ZOMA 3DRPA 1QAIA 5HL7Q 3OVSA 3S01A 1C0UA 2GIQA 3WT4A 1XN9A 2MZQA 3FBEA 3SYZA 2FVGA 3BSNA 1ZTWA 3FF3A 2E5IA 2HQDA 2RQMA 5IQQA 4UF4A 3RB3A 1RBLA 2OO4A 4BINA 4USKA 3EJMA 5L9XA 2DNZA 4FF1A 1B99A 5KFKA 1HWLA 3GPAA 1X4DA 2DPJA 4FPRA 4QW8A 4B02A 1IU8A 4DUKA 3MOZA 4LF8J 3UDCA 2XCAA 4DU7A 4RNFA 2X51A 3IG1A 1R3NA 3GFHA 2GIFA 5AE1A 4M6GA 4GO7X 2Y8WA 2JEIA 5HN0A 3T90A 2QLJB 3CD6S 4FDFA 4GO5X 4WPAA 1URRA 3T1YF 1XBWA 1DTQA 1CJVA 4OHYA 3MEDA 3M2UA 2VBYA 2HWHA 1GT8A 3IU1A 3FBUA 1U1MA 2FB0A 4QBUA 4NCGB 3TARA 4CYPA 4MCQA 4IRDA 2MY8A 3QATA 4IOCQ 4L75A 4NCAA 1J2VA 1RGVA 3A3NB 3NCRA 4OLPA 4ZLJA 1JWWA 3ET6A 5C24B 2P9EA 2MB0B 2DF5A 3JSRA 2XY6A 3QIPA 3R9FA 4PSWA 1P0HA 3R1HA 1OWXA 3FB3A 4X4RA 4QWDA 2JLFA 3FFIA 1EKSA 2I6WA 4DX5A 1Y3JA 3G82B 3T41A 4X4SA 2RUSA 4USVA 2CVEA 3AAWB 1OSCA 4ECXA 3BPSP 3W2WB 5IX3A 5ISVA 5A2QY 5CABA 1KWMA 2MLYA 4PEOA 1ZZNA 1JLBB 3PW7A 1EAYC 2DXDA 3KJVB 3CTRA 3C46A 2IHR1 4ZHRA 2R8VA 1S79A 3DI6B 5KG5A 1VK3A 2Y3YA 3NNHA 3SQOP 1B3TA 1EB0A 1TKFA 2KXNB 1WDDA 3O2IA 1XFOA 4RW7B 2QL7B 5FD1A 3EDRB 3H90A 2VXKA 3PJXA 4XPDB 2C3YA 2RRNA 5KFLA 2OP5A 4NGTA 1DARA 1AA1B 4Q0BA 1ZPWX 1UKUA 1NPKA 5BR8F 1U25A 4LUBA 3DGVA 3TZZA 2E5LF 3JXOA 2FLLA 3GG0A 1XMTA 2PR1A 3BQ2A 2JFDA 2P8IA 5CD4H 3QT6A 4Y2CA 3P2FA 4DL7A 1CP6A 3W2VA 1FRKA 2KM8C 3BGRA 3PX6A 4MH8A 1U2RA 2H51B 1HQUA 4RJVA 1JLQA 1C1CA 1QSLA 3PB6X 5B0AA 4MFZA 1LXNA 3E01B 5H9FK 1J5EJ 1Q2DA 2UV8G 2ZH5A 1RTJA 3SJXA 4NGNA 4Q0BB 2MHEA 4MYUA 4ELTA 2HS4A 3SCLE 3BGLA 2IIHA 4HNYB 1WKKA 4UTGA 4OIDA 2L41A 2F4VJ 4ID8A 5L1KA 1H3DA 3SDEB 2XCPA 4MBUA 3UN5A 5FLXU 2GS8A 3OFEA 4CZCA 3HKZD 2E5HA 3LA0A 3J81U 3KNGA 2HRYA 4M1KA 3PXGa 3DOLA 2MDAA 1DQ9A 2ALZA 1S9FA 5DS7A 2PJ5A 2J7UA 2VG6B 3W2WA 1ACMB 4M5KA 1HQ2A 4NLWA 1KN6A 4MHPA 2BQ3A 4G3IA 3MEDB 1DTQB 3QZ8A 1P9QC 4CGMA 4CRYB 3DRSA 2W4DA 3I9SA 3LAKA 4AXIA 4KYZA 4DLEA 4ZVTB 2BJ8A 1U4BA 2YX4A 2ZW5A 1RQ0A 4M6HA 1WEXA 3DLGB 3GYAA 2W2OP 2D9OA 2EBJA 3QIPB 4WZMA 2HS0A 3O6QA 4HR2A 2YKNA 1FD2A 2ZBIA 3GWCA 1F2OA 3ET6B 2B4OA 4MK8A 2CZ4A 4IG0B 4R7MA 3T6BA 1LWCA 4DV0F 4LF9F 3GIUA 1X0PA 2P6TA 4ANDA 4R3LA 5BWAB 2A2CA 4JYAJ 2XYPB 3W3SA 3EZ5A 1OJ4A 1GYTA 2R2UA 2P6SA 2MHNA 3IWLA 3NS6A 2HZAA 4ORFA 2YVSA 3GIIA 2R8KA 2MLZA 2FJBB 1HMVA 5F46A 4IH5A 1VLYA 3POTB 4A37A 2DD8S 2KG1A 3Q2TC 1UWYA 2PN6A 5DLGA 3ZXWA 3HLPA 1XEZA 2QA1A 2J0WA 1QSMA 1EP4B 1JX4A 2WSAA 4CM0A 2LQJA 3BXMA 5DWNA 3S9MA 2XYHB 8RUCA 4KOWA 2CWKA 5KG2A 2F63A 2DPSA 4NXMF 3QT7A 1N32F 5G21A 3CCWA 4DR6J 1LV5A 1T03B 1MU2A 4E8UA 2KFZA 4MKBA 2HFNA 3LQVA 4ZP6A 5HANA 3CJKB 2BSWA 3G8QA 5JXSA 1N36F 3W64A 5CD4A 5DGAA 2XNQA 2CQGA 3K5NA 1BQMA 1RYRA 4P7VA 4CLKA 1S9GA 4CP5A 5J2MB 3ENWA 5DDOC 5JGFA 1GXTA 1TKDA 1S9EB 4KHPF 2ZUGA 5KFBA 2Q79A 3OR1A 2D74B 1KFDA 3KYLA 3P3DA 2MKJA 3BHXA 3CDXA 4I2PB 4P7TA 4EUVA 4A8QA 2C28A 2NCKL 3IM8A 3JSBA 1NLKL 5CXTA 1Q7LB 5A8WB 1QSTA 1GMUA 4J9PA 1NK9A 2PJCA 1H7WA 3QGHA 3R97A 2C1CA 1XWLA 1OS5A 2H5IB 1S7FA 5IFMA 3GFXA 4H4OB 3CD7A 2RIJA 5JM6A 4GM5A 1S6QA 4ONUA 3B7IA 3SXLA 3O1LA 1IBLF 1R0CB 2YH1A 2VG5B 5K8OA 3J7ZT 3IO1A 3B82A 4UEZA 3QO9B 2XULA 3KLFA 2M0GB 4PCQA 1N33J 3BKFA 2ZBRA 2CIMA 1W25A 4NA3A 1FDDA 3O44A 3MPYA 5AT1B 1U6ZA 3OD2A 4DV2J 4I6AA 4WFYA 3HXMA 5T14A 3FVYA 4OV6A 4LX9A 4ZN3A 2RT3A 2O53A 3GKRA 4DL0C 3ULHA 1SJRA 3OVBA 4KS9A 2K1RA 2DXFA 3D66A 3MPUB 4I64A 4P44A 2OB0A 4B13A 2VFRA 1N5YA 2FVPA 3I5BA 2EFQA 2ARHA 4PKDB 1XMQJ 3CCES 2V4RA 2AFWA 3V4IA 2YQ3A 3MMCB 4KRWA 1JLAA 1HNXF 2FJDB 2ZW7A 5JUMA 1PC4A 1B64A 7FDRA 4NCZA 1A7GE 2DGQA 1ZAXA 5KTAA 2QE5A 3NGRA 5K8MA 2CADA 3VGSA 2IMOA 2GJ2A 2XZWA 1S12A 2G1HA 5KTDA 1QM9A 1VBKA 4MRIA 4J90A 3NH4A 1Z1ZA 3D8PA 1PAEX 2UUCJ 5F0WA 3MMJA 2DCLA 2X7BA 2XEGA 2OD6A 2QRRA 2B6AA 2A4NA 4HI1A 3OL7A 3QLHB 4HTJA 3VZHA 1UEVA 2VFSA 3D4JA 3ENVA 3K58A 2AU0A 4X8IA 4A32A 1SKWA 1UVJA 3MR2A 3CXCR 2HQFA 5F8IA 3Q23A 1RT7A 3KR4A 3Q83A 4H4MB 1UTAA 2UUWA 2BW2A 3KZWA 5GADU 5B08A 2E29A 2CQDA 2FHKA 4ENOA 4U6PA 1HR0J 1WF0A 2HNDA 3R1LA 1TKTA 2UXCF 4HTIA 4YB1P 4N8NA 1KVIA 3B54A 1T05A 2PJ3A 5CYJA 3R5JB 1CLFA 3QAYA 4XNHC 2K7KA 3H25A 2AFMA 2C42A 4QW9A 4WF9Q 3CJ2A 2HC9A 3KL9A 2AHOB 4CGNA 3HK2A 4KH0B 4DPTA 4KHMA 5BXIA 4H4KA 5CNPA 1RWUA 1RT6B 3FGVA 4KGXB 4NE9C 2HQGA 3NRBA 2FIWA 1N71A 1FDBA 3ITHB 1PKUA 1Q79A 2Y8YA 5KG3A 4QWCA 3DFEA 2RVJA 3BPDA 3B4DA 4IQMA 5KG7A 4X3RA 5G22A 1C1BB 3TOAA 4IUSA 2PDAA 4R9MA 2CTCA 4A8MP 1K1SA 4F3OA 2QG9B 2B9YA 4KPYA 3OFGA 1IR0A 2RD5C 2PI5A 1VJWA 4DFJA 4PR6A 2BE2B 2GO8A 2CXAA 1S97A 3B3SA 4MXUA 1E6VB 5HSPA 1RWMB 4F02A 2BUNA 3NGDA 1NK0A 1PJ5A 3MZIA 1RUSA 4YDDB 2FQQB 3SQGA 4Z2XA 2POKA 4Z37A 1EZZB 4IDKA 2R8HA 1XMQF 3MMCA 2J0QD 3SXNA 2X1BA 4HHJA 5HBMA 1XMOJ 2GFQA 1F5CA 2E1MC 3UD5A 3BEGB 1Q8IA 5ETOA 4Y0FA 3BO4A 3H40A 4H54A 4PV6A 3WZ0A 3BQ1A 1QMUA 2DR7A 5LRKA 1VRUA 4OKOA 2HFUA 1MSWD 1U1QA 1TL4A 4DCJB 1C2PA 1NH8A 5F09A 5DGBA 2UUBF 3ADAC 2WSFC 4FNHA 3IWNC 1NB7A 2MQOA 1HHTP 3KHZA 3GB0A 3TC8A 5ETMA 1RA6A 3V6DA 3BN4A 4K4TA 4NMXA 2IFXA 4X4OA 3LOUA 4OYXA 2QC3A 3KLFB 3U7JA 2AYEA 2V68A 2YNCC 4LR9A 3JSYA 2MZ1A 4A8XA 3W1YC 3G6YA 4NGPA 1D8YA 2B8PA 1M5HA 3DLJA 1RBAA 1NE9A 3Q8UA 2OEKA 3NL0A 4IFVB 3HFKA 2IBKA 4L76A 5I42B 3DOKA 4X2TA 3OTOJ 4IRKA 2VICA 3PBEA 5FJ4A 3PP9A 4UFWA 5IT9U 2IRYA 2ZZNA 1HBNB 5LRJA 2ZENA 2OR4A 4ED8A 5KFYA 3PDNA 1YBAA 2K7JA 1WC1A 4V1Ak 4YUDA 4ED7A 2NREA 4DS5A 4CH1A 1YLXA 3HHLA 1DAXA 3ZTPA 3CJRA 3DLKB 1BY9A 4EBEA 4WTOB 2V8PA 5CYMB 4CNYA 3Q8RB 1V3SA 5F9LA 2ROPA 5GAEU 3CCUS 2FCKA 3CPXA 4TQRA 2LA6A 4Q8FA 2A2DA 2QLXA 1AUDA 1X8DA 3S6GA 2XY5A 1HPZB 3MMAA 4OX9F 4RBUA 3EZOA 4N5SA 1BQMB 2FZKB 2RS8A 2VC0A 4TQSA 5B0DA 1T94A 1X31C 4ED6A 4UA3A 2PJ9A 1VLOA 2NYQA 2D4PA 2O3DA 3CJKA 2WBMA 3H4BA 4QU6A 1HDUA 2KO1A 2UUTA 5J2QB 3LTOA 5G0RA 4MKVA 3VATA 1TQLA 1UFKA 1UAWA 2Z30B 3OJUA 3T3FA 2V69A 5ETKA 2X3GA 3PX0A 4JI5F 2AFZA 2HZCA 3TO9A 2NR0A 1Q82T 3T1HJ 3PEHA 2V9WA 3I32A 4QIFA 3M8YA 2FHMA 2AJ1A 3KK1A 4X64F 2PIYA 1HNVA 1Q8BA 5D0RA 2GV1A 1X4GA 4FXDA 4C0HA 4WKYA 2LU1A 2MPUA 2RQCA 2FC9A 4USIA 4K5SA 1HMVB 4E0AA 3HDSA 2LFVA 3HI9A 2HNYB 5KFVA 4JI8J 1REVB 4AVBA 4F36A 2AYGA 4BHQA 2ZFHA 3CD0A 1YJUA 1M5OC 1S1WB 3L4BC 1JJCB 3PEIA 1YJWS 1H2TZ 2H3EB 1FJGF 4JOUA 3V2UC 2HBQB 5D0HA 2BZ2A 3IRXA 1U45A 3B6BA 1XNQJ 1AXQA 2XMUA 2CFXA 3MXHP 2YKNB 3UNGC 1L3VA 4TY8A 2GIRA 2XEFA 2CPZA 2ZJQQ 1VQ5S 3IEHA 4ZCKA 4JI6J 2XLJA 5AG7A 3PG9A 3SJEA 1KC8T 1EKRA 2D3ZA 2PA8D 4PUOA 2YX7A 4DWIA 4M5IA 4EZ6A 1ICEB 3Q8VA 1Q1KA 3T1YJ 4LF7F 2ROGA 4G1QA 3FECA 1ROFA 4XAKA 4KGKA 3CD5A 5KT7A 1KUVA 5H9FJ 4QC6A 3MEEA 4F9UA 1WELA 4KSIA 2VPXB 1YZ7A 1L3TA 4X4TA 3IXQA 2AEMA 2VODA 4MHZA 3H5ZA 3TVZA 1TAQA 2OEJA 3A8JA 2ZJRQ 4QR1A 4OX9J 2DGUA 2XSFA 2UUAJ 4M63A 4DXLA 3VWDA 3BGRB 3P8BB 2AE6A 3D2PA 2PJ4A 4LT6A 4B3RJ 4KZTA 3D6MB 2HK2A 6CPAA 5KG4A 4GS4A 3R96A 2FVQA 1FXLA 3C6UB 1ZG8A 1N0UA 5ITHA 4U8VA 4ZVFA 2DR5A 3E8OA 3I4HX 3ZZTA 4R25A 4K59A 1XOVA 1AUSL 2J8SA 4P10A 1QQ9A 1VOMA 4DR3F 1S0MA 1S7KA 3R9LA 3Q24A 2H4WB 3TJAA 4EFDA 1M4IA 3DDDA 2GGPB 4ZY1A 4J9NA 1S0VA 5CPAA 4J9SA 2HUZA 1UEUA 3I1UA 4S0MA 3WHIA 3KJVA 1TF8A 3A4TA 2MKIA 1QLNA 2V8GA 4C8ZA 2IM0A 4TKTA 1I3OB 1Q4RA 5B09A 4DZ6A 1BWVA 1FT8A 1FDAA 2XI2A 4AQYF 3IWEA 2BRLA 3J7YU 1N52B 5GMEA 4RW9B 2NYHA 1T02A 3GZ7A 1U24A 5KT3A 1LFPA 1M5VC 4UZCA 1KNZA 1MNEA 3UN2A 3OV7A 3HVRA 1R57A 4LJMA 4UOHA 2G0IA 1OPZA 2J7WA 1Q2CA 4C8LA 1VDHA 4PG4A 3THVA 4J37A 2HGNA 4KOSA 2YKMA 4B3TF 4L73A 2EXUA 4B14A 3PRDA 3BS9A 3M6VA 1P1TA 3VAHA 4Q2MA 3GONA 3R8YA 3PB8X 4DZDA 4KOYA 3HVTA 2V77A 2BJ3A 2F3JA 4C9DA 4PWUA 3IA0A 2DO4A 2G2YA 2DGSA 1RP5A 2JC1A 3EY5A 3EZUA 2ALYB 3IBWA 3HP6A 2W9CB 2Y1RI 3C66A 3B2YA 1G2EA 4WU3A 3T5JA 3AODA 4UWJA 2XQCA 1L5UA 4FBTA 4BC7A 3KKFA 2IVFB 1APSA 1NXIA 2WRMA 5HK4A 2UV8A 3T5LA 2Z0GA 3T9YA 1S4EA 3BR9A 4I56A 3MM8B 4IFVA 1K1QA 2AX1A 1RHJB 3IBCB 2D4OA 1VHOA 2CPDA 1WTBA 1I5OB 3RR8A 2HRTA 2LDYA 2C2MB 1HQEA 2NXJA 2HWIA 1VHEA 1FWKA 2CG4A 3DRPB 4Q44A 3A13A 5EDWA 2UVWA 1J5OB 3V6DB 2VIHA 3KLHA 1EETB 2DR6A 1RT5A 1FHTA 3DHWC 2CXEA 3D54A 2CJYB 6AT1B 4DG1B 2OPQA 4B5PB 1MMLA 1B7FA 1TXRA 4A39A 2A3JA 3LP2B 2I00A 5GCNA 1FESA 2HS3A 5HAOA 3TI0A 1Q86T 1YIJS 4F0MA 2C3PA 2XI3A 1AZSA 5F49A 2A10A 2PSWA 2BVZA 4ER8A 2ASDA 1H6KX 2WYRA 1UVMA 2GVDB 2J8AA 1RT4B 3IWXA 4YR2A 3GE9A 2G13A 1WNEA 2HMIB 3DLEA 3CCZA 1GTEA 5K14A 1R8HA 4ZKAA 2M8DB 1DQ8A 5D77A 2B7CB 4DV3F 1FEEA 3DCAA 2O4HA 5B0EA 4ANCA 3CB4A 4LFAJ 1BUXA 4HNWB 4OYOA 1QVFR 2GO9A 4DQRA 3W9JA 2V4JA 3FEEA 1U2CA 1URNA 2HLUA 3M7VA 2YKQA 5E3QA 1UWBA 4XK8C 4UOGA 3FJUA 3MMBA 2C6PA 2BM0A 1R43A 1PBUA 1C1BA 2E9ZA 1KTQA 2YWFA 4RW4B 4DQSA 1OQ3A 2CQPA 1SIZA 1IKWB 4DJLA 4Q7AA 4WWVA 4F04B 3NH5A 4FYVB 5BYRA 3K17A 3FRZA 3JTNA 4KVXA 2M88A 2VBQA 1CG2A 1VMBA 4NASA 2JJ4D 5IWAJ 4O44B 4J9UE 2WB4A 4OX8A 4XPLA 4QOTA 2BQRA 4GKJF 3QT5A 1NMEB 4RW6A 2G1DA 5E3CA 3SV4A 2P6GA 4MAKA 4NLRA 1KTVA 2B7BB 1SC4B 3VALA 2LQ9A 4ELVA 4JI4F 1T05B 1FRXA 3FK4A 4ZLLA 3QSYB 3QAHA 2HLTA 4NRUA 1JKHA 3KLIB 3RYOA 4DV6J 4P9SA 2FLNA 1FWPA 2XYGB 5F8GA 4ZLPA 1RDRA 1N33F 4GVBB 4K4SA 2ZH1A 3RGIA 1UW9A 2ZWOA 1OMSA 4OZ2A 2NXUA 1N48A 2C2KB 1FKPB 3FCWA 2EFNA 2N4CA 3TO6A 2ZEJA 2P5VA 3HF5A 4MJKA 4I7FA 1IKVB 3S7RA 3N01A 1F9FA 3GTYX 5AE2A 3I0SB 2DNGA 3CXQA 2ANPA 4MHYA 3T19A 1JNRB 1S72S 1HHSA 1Z8WA 1UPMB 3GILA 2ZH7A 2R7VA 5KFQA 1S7HA 1SI9A 1F3FA 2QFIA 4LRAA 1JXEA 3LP1B 4OZLA 1NKCA 4H89A 1Y9OA 4IYQA 2LCWA 2RILA 2AGQA 2XS7A 2R2RA 4F4YA 2ADCA 1DBDA 1S1TB 1HI0P 3MTJA 2BQUA 1KHVA 5CH7B 1HBMB 1X4BA 3D6FB 3D1OA 1JJ4A 3GY9A 4F2RA 2Q51A 3ZNUA 1VFJA 4LFAF 2EFGA 4G1PA 3TEGA 3MD1A 4YR0A 2FL4A 1CC8A 4WU2A 4LF9J 4O3RA 2R4FA 4RW4A 6FDRA 3C6TB 4KLWA 3AHPA 4F4AA 1JKHB 1IKXA 1DZ5A 3QO9A 1RT3B 4RUBA 1N5TA 2ZEEA 5EWGA 1CJTB 3SFUA 3CT9A 4X5KA 1XEBA 2LMIA 1SBRA 2E9TA 4RKUC 2HHQA 2J9CA 3MUMP 5JVGQ 3SJFA 2XMKA 3S8SA 1V0CA 3MEGA 3CMQA 3H8FA 3E51A 4Y34A 4XPEA 4C2ZA 2WVEA 3VGVA 1F3VA 4K4VA 2XWXA 5A8WA 3EC4A 1B7YB 5K14B 1Q7LA 3DLEB 4UZBA 5CCMA 1TVRB 2PQ8A 2HMIA 3CO9A 3DDNA 2E9RX 1UVNA 3HLUA 2JEGA 2E5LJ 4UCMA 3VWEA 2BA9A 3LGNA 1HWUA 4K4YA 1U1PA 2GA7A 2VPYB 3EGNA 3OFHA 2GHVC 2ASLA 2OIHA 2BO9A 2Q4YA 4CGLA 2HYIB 2PFFB 2I1RA 3OR1B 1ZYQA 3IIBA 4AB7A 4KOXA 3PKMA 5J2MA 1SV5B 2J7KA 1S9GB 4U9RA 4CLZA 2XMVA 2BOAA 3U27A 2ZE2A 3I0RB 3S6EA 3JVNA 4OI6A 2PJAA 4R6TA 2PSZA 1MWQA 2DVIA 4MCPA 3D5MA 4ZBGA 4DX7A 2XO6A 3FYNA 1T03A 2A6MA 2IQ6A 1LWXA 4KT0C 4D3GA 4JI7J 4OHXA 3D2MA 1NDKA 4KHPJ 4U7UK 3TTHA 4URSA 2HHHF 4ZA1A 3HHNB 1HQEB 4JI1F 1Y5LB 4K4ZA 3NNCA 2G2OA 3GCXP 2AKWB 3H7HB 3MN8A 3ZFVA 2X1AA 1CQNA 3KLEA 4QCLA 1LFWA 1TUGB 2AV5A 1U6MA 3SV3A 4E98A 3CXSA 2J0SD 1EHWA 5F3ZA 3GYXB 1I1GA 2PFDA 1LAMA 2CZVC 1QAJA 4HHUA 4PXBA 1AFJA 2YQ1A 2V8VA 2ZH2A 3UCUP 4Z7CA 2UUBJ 4X65J 3OSPA 1SC3B 2W9CA 1F0XA 4USJC 2HQYA 2ILZA 2QN6B 5DZ6A 2V67A 3BI1A 1F9EB 4C8NA 2DITA 3J81j 3RW7A 1TL1B 5F48A 2ZITA 3MM5A 2W4PA 2U2FA 1H38A 4EU0A 2PJ2A 4HPSA 4P4EA 3MR7A 1SKSA 1Q8KA 3J7AN 5EWFA 2PA3A 2Z10A 3MM8A 4F4WA 3WDOA 5EN1A 3BJYA 3TFYA 1YJTA 5KFXA 5K8PA 4YU9A 2K5TA 1S76D 3R95A 1AROP 4WWSA 4A8FA 4FXWA 4BC9A 3V5RA 2W8KA 4RNHA 3HJVA 2YPYA 4Y2IA 5KFUA 3J81Y 2N82B 4M5MA 4C2YA 1ZM9A 3CF5Q 4RU9A 3AOCA 4RW9A 4CAEA 2F8EX 1RACB 3MAAB 4OADA 1KFSA 4X4PA 1VKCA 4KOTA 3QAEA 3PZJA 4O23A 2WZNA 5HI7A 2RKIA 3KK3A 4NLGA 2XMJA 4KFBA 2VQYA 4FUUA 2GGPA 3DXBA 1NK4A 1TV6A 2WW4A 3PKYA 4RW8A 2AGOA 2GHPA 1N0VC 1VBXA 1YQEA 4YB5A 2WSEC 4ZVPB 1U26A 3MM9A 3WX8A 1CJUB 2W25A 3E3XA 4WFNQ 2QSWA 1RWOB 3SFGA 3E01A 2ZEOA 5L9NA 2IBOA 1HQUB 2D9PA 2AD9A 4H2KA 4DFKA 3WC5A 1S5KA 4AG9A 4OYMA 4LRDA 3C6UA 4JYWA 1S1XA 3M9OB 2BL1A 2RB7A 5KG6A 3QJLA 4BDPA 2EC2A 2FY8A 4LF1A 4YWYA 1NJYA 5ETVA 4R3KA 4YGOA 3HMJG 1XE4A 5J2NB 1S7IA 2KJWA 4IK2A 1FJCA 4X64J 4KR0B 4DX6A 2UXCJ 2F8MA 3ILLA 4JI1J 2KVIA 4OC4A 5GAHU 1XR7A 3V6HA 3PR4A 2Q7BA 3M6XA 4KGVB 4FKXA 5IT4A 2DEIA 5GVQA 5LT5A 2B8QA 3I55S 1M4GA 2BOPA 4CH0S 5IXUA 2JH3A 3CJSA 3W60A 1XJWB 3CVKA 3DI6A 2DYAA 2B56A 3G8SA 1X12A 2DHXA 1VHSA 1Y5IB 4K7QA 2WPXA 4NLOA 2LECA 3G8WA 1N34J 4NCBA 5E3AA 3N6LA 4HT5A 4A8OA 1OYDA 5KTQA 4B5OA 2AT1B 3IP0A 3B3WA 1KQGB 2LDIA 2FXFA 2KHCA 1YBUA 4ZDNA 2DXQA 1ZH5A 1QSRA 3TZXA 2AFXA 4P2FA 5D3GB 3OLBA 2JVOA 2YTCA 2PMWA 3R5BA 1AB8A 2DHHA 3ENAA 4MFBA 1XNQF 3C16B 4KBIA 4PPDA 2W8LA 4P4DA 3HHEA 1RXOB 1V5IB 4A31A 3RRHA 2VZ9A 5HMXA 4R57A 3IRXB 3R5CA 4C11A 4QIWD 2M2BA 3AOAA 1IM4A 7CPAA 3CCTA 3EVOA 4G1QB 1ZM4A 3MPDA 4ICLB 5A8KB 1VBYA 1ARLA 1U2FA 3W91A 3H8EA 2FLOA 4DR4F 4OP4A 3P96A 1IOIA 3AA9A 1CJVB 1U02A 3ZJ0A 4DQIA 3BF4A 1O5JA 4CO2A 4R8FA 1RHQB 3GYNA 3L7UA 1B6BA 3KGQA 1YITS 2QIRA 1XQIA 2KH9A 4HKFA 3MGJA 4JV2A 4WZQA 3IG1B 4M85A 1MJBA 5F9NA 2HBYB 3VZIA 4KORA 3M05A 2I9SA 2C3OA 1P8GA 4LF4J 2F8HA 2FZCB 4B9NA 4X4NA 1F5BA 2KVQE 1UP1A 1OYEA 3B3CA 4JXQA 4DPUA 3G6XA 1SC6A 3TX8A 2BJEA 1SQFA 1SH2A 3KK1B 2NXCA 2HKEA 4OL8A 4UCPA 3KR5A 2YKPA 5A0YB 1PSDA 2ZNZA 4NXNF 2V5HG 4YN3B 2VJVA 2HPUA 1CC7A 1U09A 2ZW4A 4A4JA 1YRXA 1VGYA 4F0HA 5G0RB 1SH0A 1Z4RA 4R87A 1W7WA 2HNYA 3KHRA 3AXMA 2GCFA 5KFHA 1KKHA 5HROA 4CYNA 2BJ1A 2EBGA 1I94F 1IM6A 3FSIA 3OL8A 2HFZA 3CCSS 2W7OA 3DLLQ 1PAUB 4IOBA 4WYLA 1UA0A 2Y1IA 4HNXB 2JDCA 4ID5A 3FBFA 1EX8A 3H8GA 2XMWA 3SJGA 2PGCA 3FZBA 3PIOQ 1IUJA 3DM2B 3G4SS 1VHIA 3BYRA 2MKCA 3FH4A 2OTJS 2RH3A 4OHVA 3G87A 4I67A 3RAQA 3NAHA 4DPWA 1N5VA 2FJWA 3MAAA 3TWZA 1UVIA 4KV8B 5EGYA 4LBPA 2A18A 4DCOB 2EFVA 5KFNA 1AFIA 1DY3A 2DNOA 4A48A 2XLIA 4HEA9 1EE3P 2MJNA 5K20B 1T95A 2JLMA 2DGOA 4FBUA 4XIUA 4R76A 3N5FA 4I69A 2ZC4A 3F41A 2I8EA 2XBPA 3TZYA 3DOKB 4J9RA 1NO8A 2GQ2A 1HEEA 1HPZA 3MMAB 1U49A 1HNZF 1X4EA 2GMHA 3QGPA 1RHKB 3JQKA 2ZBCA 1WUUA 4OJ1A 3W63A 4GKKJ 2W9BA 2J9AA 1R8PA 2DIVA 4EFAC 3RB4A 1P9YA 3DLKA 3CDUA 4Q2LA 1NZAA 3PCOB 2NXNA 1IB1E 1HBOA 4KAIA 4F50A 1RAFB 3ZTOA 1ZOTA 3LUYA 2VKRA 4OHWA 4CAVA 5D15A 4K4XA 1D9AA 5EWEA 1RE1B 2CPFA 1B0VA 1MWYA 1PYTA 1JNZB 4C7HA 2D1CA 4ECRA 3D7HA 3D6HB 3HULA 3MHYA 3PEJA 1BLUA 4IG3A 1RAOA 4MY3A 1YW6A 1S57A 2OSQA 2DGWA 5LMNF 4PWDB 3PGPA 4OAEA 1V9OA 2C6CA 2Z0ZA 4IDKB 3DGPA 3FC9A 3AOBA 2Y9HA 5KFRA 2N3OA 5IQ6A 4I68A 1GXUA 3SI2A 5AXMA 5C88A 4F4KA 5B0FA 5I3PA 1K0TA 2YNHA 1G7CB 2J9EA 4JV0A 2DR8A 4N56A 4NLUA 2BE2A 4K0KJ 2RU9A 1GFWB 1XTZA 1SV5A 2EBEA 1FFGB 1VQKS 3EFAA 1P27B 3PRTA 2R8JA 3SSQA 2O5DA 4FYWB 4K4UA 1ITPA 2OOTA 3CPWR 3PJWA 1LWEB 1U0HA 2O67A 3PX4A 2H1YA 4YFUA 4A8KA 4B9TA 1T0TV 5LXYA 2CDRB 1KLMA 3NWGA 3NOGA 3CUNA 5LJ3Y 2E7WA 3D2WA 3IWGA 4Q38A 4MIAA 1LK7A 4YRHA 2DEJA 2PJ0A 1SJ4P 3R7SB 4ZJOA 1VQYA 3JYTB 1KS2A 2MQMA 2OZUA 2OZGA 2AP6A 2QLWA 4WJBA 2Y0BB 2PT0A 2RS2A 4WXOA 5J2PA 3EYZA 3TEHB 4DL5A 4MYTA 1G1XA 3TP2A 2ZBQA 3C3LA 5GAGU 2ZHAA 1CJTA 4X66J 3R6LB 2YPZA 3OBIA 4ZMMA 2KN4A 3HSGA 3C6TA 1WOPA 2Q4ZA 2O1PA 2I5JA 2QZ8A 1CVJA 1J5EF 3A3PB 3TQ1A 4NYPA 3FEYB 1GQEA 4ZIVA 1Q81T 3IS9A 4W9YA 2ACYA 4HDHA 1Z9UA 3VGTA 1XK8A 4USHA 4NJRA 1KEKA 1VQOS 3N4WA 3X1LB 4FP9A 1HBMA 4ECUA 4XPCA 3GQCA 5F41A 2ASJA 5DM7Q 2YWHA 4RUAA 2V63A 4KUBA 1VHFA 2Z3MA 2MGZA 3R5AA 3D0GE 4LF5J 4B17A 3W9IA 3S1TA 2L9NA 2ZW6A 3CMAS 1L0CA 3UD3P 1JLFA 3OXGA 3RB0A 2GMLA 4H6ZA 2B9EA 4QWEA 2VKZG 5ETQA 1NUEA 1MMNA 4H4MA 4NJQA 4DV6F 2L9DA 4NOHA 3BZQA 2ZM6F 1PJ6A 3LGHA 1CP7A 4QJVA 4EEYA 1F60B 2C3UA 2ZKTA 1GMVA 1WKJA 3HVAA 4ZITA 3CJ3A 3V6KA 4AQYJ 1LANA 5D4NA 1N5YB 4I7FB 3VAIA 3ISND 2H65B 1FJGJ 3DLBA 1N54B 4M5HA 2PEHA 3DDIA 4F0YA 4DHVA 2NMTA 3BBFA 5C2CA 4DYOA 4QQBA 3RBXA 1PIEA 5KT2A 3VCDA 1F5AA 2CTBA 4FF3A 1XNRF 2EKYA 1IXKA 1B0TA 4YDXA 2DKOB 4O3QA 1B87A 4KKOB 3H2UB 4RR5A 2AEJA 2GREA 1WI8A 4P4BA 4LF8F 4C8MA 3K59A 1NRKA 2WK4A 4DR3J 5L46A 4RNNA 2B3UA 2LVWA 3R2CJ 2YNEA 4JI2J 1ULRA 4RW6B 3KLGB 4LIRA 2MZRA 1WF2A 4F4ZA 1IR1A 3UY5A 2BKOA 1OSDA 3S6HA 1JK9B 2L08A 2DY1A 5ELYA 3S6KA 3NXZA 2BKPA 1WC3A 4NWBA 4DS4A 3J7YI 1X60A 4TVAB 1CSJA 3KG0A 4KSEB 2IM2A 3MMBB 1NBEB 1VQ9S 3MFHA 2UU9J 2UXDF 3KOAA 1SVDA 4DR7F 4EYHB 2V34A 4CLLA 2I79A 3LP0A 3BGFA 1HNWF 4PG5A 4OHZA 3NG8A 3B4MA 4PWWA 3D1HA 1JXLA 4A8YA 1IICA 2RUGA 2H4YB 2HIYA 1NDLA 3MOJB 4H4OA 1SL1A 5LSOA 2A6OA 1WC6A 3UDEA 5IC4B 4HACA 2AX0A 1Y00A 4U7CA 1SL0A 4R8UA 2KL8A 3PW4A 3OUYB 5C5JA 4UEFA 4QWBA 3H2LA 2HHSA 1RT4A 3BSAA 4I2PA 1KLNA 2VBZA 2UVVA 3RYLA 3MTKA 3WBZA 1EP4A 3M9MB 1VRQC 3M8ZA 3MECA 4DV5J 1HNIB 1UVLA 2IL4A 4X84A 2Y1JA 1Z8TA 3FX6A 4WYWA 3UN3A 3KJFB 2Q6CA 3F56A 3JTPA 4XDCA 4P71A 2LYVA 4HLBA 5H84A 4DCPB 2N7YA 3H8YA 1HIYA 2VU5A 4PAAA 3QNVA 1JLEA 4NA1A 4W4MA 4AL6A 2VONA 1XRYA 2MQLA 1KUYA 3UW1A 1FTCA 5DETA 3AB4B 5JVHQ 3T1AA 1ZG9A 1YBTA 4WTYA 5J8FA 4B3TJ 1GHEA 3HT3A 3ISXA 3M30A 2EW9A 2Y1LB 1RAEB 3ZNJ1 3W65A 2BXJA 5CAAA 2MZSA 4WK1A 4KGMA 4IG0A 2R7WA 2FVSA 4WIIA 3RZAA 1Q16B 4HDGA 2KYXA 3OL9A 1YMEA 4DX8H 3PIPQ 3AD7C 4KO0B 1X4FA 5KT5A 1IBMJ 1L3UA 1D3WA 3V81A 4L3NA 2P6FA 3MEKA 4OJHA 2DNPA 1HARA 2XMMA 3VTIA 2V2VA 3P5BP 3N5BA 5L39A 2M3DA 4OZNA 3GV8B 2EVZA 3TA0A 3IM9A 3KASA 1KONA 2YNIB 3CDAA 1Y7RA 2B0GA 2BMBA 3DOLB 1Z8LA 1TMMA 1VIOA 2CWXA 3H42A 3PV8A 2QMUB 4CO4A 2QV6A 3ISNC 2YKMB 2Y0MA 3DOMA 1BXNA 3UO0A 2GE3A 3SDEA 2GHWA 4TLRA 3V6JA 1E6YB 1UJ4A 1AW0A 3ICLA 3PRBA 3CIZA 2ZD1A 1W2BR 3M8SA 3QGGA 3GU0A 4UY8T 1RO5A 2VV5A 1GK8A 2G9OA 1VC0A 1HNWJ 1L3SA 2WHOA 3HSZA 1SQGA 1BC6A 1S3ZA 4B12A 2RSQA 3EM1A 1JLQB 4ETXA 3DR8A 4UFXA 2CNKB 1SUQB 2CQHA 1R6VA 2KM8B 3BO2A 1FY7A 2VQEJ 2AFOA 4OX7A 3W2VB 1MLAA 5JJBA 2CQ2A 2EG1A 3KTQA 1XR6A 2G3TA 2JWNA 5LOQA 4YB6A 1VC6A 1LW2A 4FAIA 1NMTA 4WFBQ 1JXVA 1F2GA 1QDUB 1QVGR 1PUAA 3JRUA 2K3KA 4RLEA 3R7BB 2V6AA 3ISZA 5E7OB 1RAHB 5HLFA 4LVOP 3D0HE 3H20A 4RWWA 2JOQA 1F9HA 3PJ9A 5ETPA 4DV3J 4DV5F 4CRJA 1JIHA 2F5IA 1IJEB 3FRMA 2YNDA 1IBCB 2AYBA 1HL6A 1VJQA 5D0EA 2CRLA 3PFEA 3G86A 2UZAA 1JLBA 2OTLS 2QO3A 1RAAB 2B5JA 1ZTTA 3ZZZA 2CNOB 1N36J 3QAUA 4BWJA 5EC4A 2EK1A 3DHXA 2HGLA 4U5YA 1DURA 2VEZA 3N28A 2F4VF 1HKAA 1N56A 3HSJA 3I5AA 2V4QA 2ERRA 4KVOE 2AJ6A 2CQBA 4GXHA 3WIVA 3ZTQA 5FLXY 2C2ZB 4RW7A 1UZDA 4J9MA 2XHCA 3MEEB 4ZGYB 4N77A 5AJ3F 3Q86A 4IH7A 4QIEA 4ZVRB 2MSSA 1U6BA 2GIVA 2GU2A 3VAKA 2MZJA 1SL2A 1TL7B 2Q3PA 3IGRA 3L7OA 4ANEA 2R8IA 3C26A 4D3HA 5D8HB 3G8TA 1K8AT 5A76A 1Y7PA 2W7PA 2FGOA 3N79A 3C15A 3PW5A 1RTDB 1BE4A 1RT1B 4OZ0A 4DV0J 5KFIA 3ZZYA 1JWQA 3V4MA 4LQ6A 1NK7A 1MW7A 3DOMB 3JAMY 2XLKA 2H54B 3P5TL 2XNRA 4KLVA 4ZS6A 2HURA 4ZY0A 4EZ9A 2KI2A 4ZPTR 2V8DA 2AF6A 2DNNA 4AUKA 4R0EA 1H74A 4NCGA 3G6VA 1S1WA 1TUWA 1YJ7A 2W9AA 4USUA 3DYAA 1YX2A 3NBPB 1C0UB 5LSRA 4KSAA 1RCXB 4XNHB 1YKWA 1RAGB 4O3PA 2PJBA 3PRVA 2HHHJ 4JB8B 4ZI6A 3RAMA 1HYSA 2AFSA 1WSVA 2HIQA 3HKWA 5D8NA 3TE4A 4CQ1A 4OLOA 1TL3A 2CPHA 4Y65A 4ZPWR 3V81B 1WWZA 3SSRA 4M8LA 4Z7YA 4ECQA 1HBUB 1UEKA 2DBBA 1BMQB 1UJ6A 2J8RA 3MR3A 3EGVA 1M5PC 3HM9A 1TKXB 4LF4F 5RUBA 5KFFA 1FJ7A 1HNVB 2BJ7A 1RTQA 3N6NA 4ECVA 1RWVB 4LUAA 3QWUA 1JQGA 5DLFA 4Y6IA 4ZPDA 4J3GA 4KY3A 4ATNA 3VHQA 5EBVA 1H98A 1RTHB 3UWTA 4NXYA 4YY3J 2QTWA 4QB9A 4Y2MA 2J5AA 2ZBPA 1LQ9A 2HW3A 1VQLS 1KOHA 1JLEB 4LF6J 1VQ4S 4X4VA 4AXJA 2O01C 2RRAA 3H5UA 4MFLA 4EWTA 4BMHA 2UP1A 2KHDA 2CF4A 4MHNA 1DFDA 3T1HF 3C14B 1I94J 2OFHX 4CI0B 4FYYB 4DSJA 3PW2A 4O4GB 3ETMA 3OPKA 4ZK7M 4DSIA 1ZG7A 3U02A 3GV7B 1HFEL 5F8JA 5GADI 3DSBA 3NP5A 1NAQA 2EWHA 2GVZB 2NZ4A 2KCWA 4LBIA 2Z4PA 3GSDA 3VAJA 2HRUA 1VYAA 1LK5A 4DUYJ 5EX0A 1WF1A 2HFOA 2MKHA 2BKNA 3AQOA 4NI2A 3UDVA 1FNMA 5EHHA 2VZZA 3VARA 2FHJD 1SJQA 3IWWA 3GIJA 1R8AA 2V9KA 3BREA 2K06A 1T11A 1M4DA 5DRKA 2BW7A 1M44A 1ZZFA 2ZKUA 2QYVA 3WC6A 3BQ0A 3BO3A 1X9MA 3PB7X 3CXPA 2O28A 2PIIA 5M2UA 4PQAA 3FSYA 3JB9k 2V2QA 4URGA 1KR4A 1R89A 2FJEB 5LM7E 3I5CA 2ZNYA 3NOCA 5I3UB 3SI8A 2MY7A 5L1IA 1RBOB 2PJ8A 1U1RA 1KQKA 1NHVA 2G2ZA 3D4UA 3CJ5A 1J27A 3FUYA 3A9LA 5KFEA 3I4PA 3AD9C 4FXVA 2DH7A 1LNQA 3CW2C 4P2MA 4YP3A 3DN9A 1HI1A 2SXLA 5F0UA 4MKAA 3KQZA 5HP1B 3D3SA 2G0BA 4CYQA 2WVCA 4MFKA 2D3OR 1NHUA 4Y2KA 3MM6B 1FKOA 2QMXA 1RLDA 4ZYQA 3RO0A 3RUBL 2X3DA 1UPPA 4A8WA 2OPRB 1LOKA 5HO4A 3N0VA 1WG1A 1NK5A 3HUVA 4YY3F 3NA6A 1RKIA 3K57A 3FNCA 2DNQA 3LWUA 4C2MA 4PRFA 1DJ0A 2CPYA 4TU8A 2NSBA 1I6JA 1IKYB 2RNEA 4MHDA 4K0KF 1MWZA 2J6TA 5CYQB 1TAUA 2ZELA 1GMWD 3MURP 2ATLA 2BDPA 1TKZB 4QU7A 5U47A 2NZCA 3S9LA 1ELOA 2U1AA 3R7NB 3UQSA 3KHHA 1JLFB 1KP6A 3UDLA 1YJ9S 3RAXA 4TYBA 4IO9Q 1KHWA 2IJRA 3DMJA 1F1BB 5IV3A 3TUIC 3P6YC 5CZVA 1QTMA 2R7RA 1YRTA 2JNJA 3J80Y 4DI6A 3SZ2A 1F6TA 3KDNA 2VBXA 4F6AA 4J9OA 2ADBA 3D7FA 1IY7A 1FRJA 3OVAA 1JLCA 2C3MA 1FX4A 3I9ZA 4Y3CA 2HHTA 3LPYA 1FT7A 2Z2MA 3L95X 3A8IA 3W61A 4UUWA 5M2PA 2YX1A 4OC1A 2JHEA 4LQ9A 2C6GA 3JUWA 5I3QA 4GMKA 3BSOA 4I6WA 4ZX8A 2ACMA 3KNAA 2XEJA 4KOVA 1FWLA 4F0KA 4WP3A 3SMZA 2UXBF 1RT7B 5SZTA 1T8EA 3A1YG 5HQ8A 2VQFJ 4K50A 3QSIA 5CZXA 2J8NA 5CCLA 4CLFA 5FIIA 1IKYA 3T9NA 1Q5YA 2B4PA 2B5GA 4OC2A 3M1VA 1ZAWA 4FF2A 2DK2A 3Q0AA 1FTRA 4FVCA 2FHOB 5J1EB 3CIMA 3DXSX 3OJSA 1RZMA 1BQNA 2YKOA 4TY9A 3K2YA 2Q6BA 3OXFA 3K5LA 5AG6A 3HX9A 1P6TA 1TKZA 3NKYA 4CO1A 4ZVHA 1HWIA 1SQHA 3T5HA 3CJ0A 4IAVA 4R5PB 5BYSA 1LXJA 3V4IB 4U9ZA 2XZTB 4W92B 4DV1F 2YKAA 3OTDA 2I2YA 3R1KA 1FE0A 2ABZA 2R98A 1Z2LA 4HL9A 2AQ4A 4JI8F 2JLGA 3TJ8A 1N34F 1X10A 3NMAA 1ZAVA 3LW5C 5LYDA 3WIUA 3K5MA 1Z4EA 1C4CA 1YW4A 5KFAA 3MAQA 4RWXA 4O0NA 2WPWA 2FE7A 4UOFA 2FVRA 2Q43A 4R0JA 2GAGC 4N8OA 4QWAA 2MQQA 3H5SA 1HNZJ 2OLWA 4F67A 3H98A 4J5OA 1VQ7S 2IVMA 2ZJPQ 5HP1A 2IAJB 1UWAA 5FDLB 4CLWA 4CO5A 4UT4A 1RWXB 4DDFA 4M5GA 3KG1A 3MPWA 3JS9A 1U8WA 2NSCA 3M9NB 4ECYA 3PNIA 4F25A 4IG3B 2FPHX 1YGHA 4ZP8A 2ABYA 1FFWB 4DR5F 2Z11A 3CCRS 1PYTB 1N5QA 2B9WA 1FA0A 2VHGA 1EQ0A 3RTVA 4QYRA 1F57A 4WCEQ 3BJ7A 2R8GA 1XC9A 3AQPA 3PYEA 3GIMA 1X4HA 4NEXA 1NNDA 1U1KA 2KDOA 2Z56B 2EFOA 1HBOB 2IYGA 2KJVA 2IDEA 3SI0A 1NSPA 1YWXA 2BANA 3IR5B 3LD2A 2IA0A 2KB2A 3ETOA 2JDJA 3IR6B 5DQHA 2LLZA 5KFGA 1FERA 4LIWA 4C8OA 3DRYA 4ZPBA 2ILYA 1YTYA 2W9BB 3UVJA 1R31A 4B3OA 4H6UA 1S1UB 3PVXA 1I21A 2CYYA 5HJXA 4MFQA 4NZ6A 4NXNJ 3BI0A 1CJWA 5KOWA 3QGIA 4DR7J 1P1LA 2EO8A 4A46A 1YVOA 1D1UA 3L2NA 4IFYB 1RWNB 3DC2A 2WCXA 4L3KA 3CE8A 2VG7B 2FC8A 2QSFA 3W6XA 1MU2B 5F3TA 2MSTA 3BDPA 4A30A 8CPAA 3D28A 4ERDA 3KK2B 4J9KA 2DH9A 4RX6A 4C3LA 5IM0B 1WACA 4C48A 4IO1A 3KI9A 5LYIA 1FE4A 5CQGA 1DLOA 2L9WA 4KIAA 1FVQA 1KVJA 2M4MA 5A6WA 1TKXA 1V3RA 3TZWA 1N6QA 2CPJA 4ILMA 1GMWA 3VAMA 3US5A 1EIYB 4JI4J 2C2NA 5JMNA 4A47A 1RA7A 2B9XA 4LR7A 4OI4A 1U1LA 3G71S 4WE1B 2CVIA 1VCTA 2PRBA 3MUVP 2QX0A 2FIUA 2PC1A 1GXLA 2NUUG 3R5DA 1RTHA 3HHKA 4QBJA 3RBZA 1S6UA 2R7UA 4A2ZA 2NS1B 2XSJA 4PQUA 4G6VB 2GLFA 2D69A 4FPIA 2OUGA 4FNIA 4IR9A 1Q5VA 1LWCB 3V38A 1MROB 1WHVA 4LFBF 1BHNA 4B3SJ 5KFMA 1O6XA 2RF2A 2HNZB 3TRGA 4DNCA 1RT1A 3OTCA 2W2NP 1T9YA 3DLGA 2FJAB 2XEXA 2BYCA 1IBMF 3CJTA 4DPYA 3U1LA 3DRSB 1CS4A 3BN7A 3OSNA 3OR2B 3NBPA 4WXWA 2EK6A 1RK8A 3T9ZA 2DNYA 4EVYA 4ICLA 4LF5F 3EO4A 2AJ4A 3LO3A 4EMDA 1BWEA 5HH1A 5DDPC 1TL7A 4PK2A 1RHUB 1MK4A 2IM3A 5DDQC 5DDRC 4M3SA 2OPSB 1VC5A 3PBBA 4RNOA 2KTQA 4WBFA 4RPFA 4JI0F 4YHHJ 4Z65A 1RT2B 4WP9A 3C16A 1RTDA 4KB7A 3SHPA 1WORA 5D29A 3RRKA 1HD1A 3IN5A 1RTIA 1RTJB 2ZZTA 2HWTA 3RR7A 2M70A 4QR0A 3L3CA 3ZO7A 2WZ1A 4CLPA 4CLUA 3KMQA 1I1DA 4OZ5A 3M6WA 1QSOA 3MDFA 4IOAQ 1ZLIA 2B4UA 1I51B 1FI4A 4YB7A 3GJTB 3QIDA 2R7TA 2R2TA 1QE1A 5C25B 4XDDA 2XEIA 4ZP7A 1A9NB 2PJ6A 4KQZA 2BJDA 3TUJC 2C1EB 1CJKB 4Y49C 1BPMA 2IMWP 4K8RA 1PU9A 3ZTRA 3ILOA 2EK9A 5ADZA 2VBWA 4OYWA 1YVFA 5HLFB 1YVKA 1MG7A 4TNUA 2QLFB 3EMTA 3TOQA 1T9XA 1CJKA 4F8ZA 3DU6A 2CAJA 2I3CA 3B3VA 5C25A 1QE1B 2V2ZA 2OFGX 2EUIA 3TA1A 4ZHRB 2CUYA 1M5KC 1JJ2R 2V0NA 2JDDA 1H0HB 1SUQA 4DSFA 2ZEFA 3PZPA 3G82A 4BWMA 2V2KA 4DOZA 4MJ8A 4K3NA 4CAFA 1RHRB 1UJ5A 1DTTB 1KRPA 4A95A 5C24A 2W7AA 1IQZA 2ZEGA 2B4VA 2E5JA 4P45A 3PHEA 3ZZRA 3KK3B 3M4XA 2ZEHA 2FYXA 4ECSA 4XPKA 2BEFA 3WQPA 4DBQA 2FT0A 4FN5A 5DG9A 2MMYA 4RUCA 3K9UA 2QA2A 2W2PP 1RYSA 1WHWA 2K8GA 2MYFA 2ZEMA 3SI1A 2YNIA 4Y49B 2OI2A 1KDNA 1FK9A 3UCZP 1R8BA 3EGZA 4B9VA 3EDQB 2H5EA 4MFJA 4JI2F 4PG7A 3GJRB 4NEZA 1VBZA 4WKRA 5THWA 2OELA 4UWIA 1UCNA 2REEA 2ZH4A 4RNMA 5T41A 3ENQA 4UIBA 5KAKA 4CCHA 4NLXA 4WP8A 2VOPA 2AWZA 1M5SA 2ROEA 1TK0A 2KT3A 4B11A 3TO7A 5H86A 3LWLA 4BD9A 4JV1A 2HQIA 4OC0A 3NFZA 1TL1A 2PC6A 1ZA2B 5KFCA 1ZM3A 1YR0A 3I9V9 1XJOA 2A1BA 4DFPA 3M2VB 2WW8A 3TR5A 4ZN1A 4EBDA 2KXFA 3M8QA 4L8AA 3CCVS 1S7LA 2G9DA 2JEVA 4X62F 4WE1A 3HHLD 1FDNA 3EPGA 4M5DB 4DSLA 3UR3C 1T9TA 3M2RA 4LREA 1FF2A 3D7SB 3K9TA 2OD4A 5HXDA 1WJ9A 1HNIA 4OJGA 1TU0B 1UL3A 4LBHA 3RW6A 2VB6A 1IBKF 3TAMB 4HT7A 4ZCIA 4C6AA 5IB9A 4PG6A 3L9ZA 4NZ0A 4OI3A 1BOBA 1Q95G 1QJHA 3R6GB 4QVTA 4OZ1A 3FNNA 2ZWPA 5IM0A 5F8MA 3LPEA 1N5SA 3QB8A 4OZ3A 4DLGA 1NPPA 4CGOA 4DQPA 3I87A 2BR0A 2NPFA 1FRMA 3TO8A 4P2SA 2H5MA 3UD4P 1FVSA 1X4CA 4HACB 1WC5A 3W62A 2OHDA 3KWMA 1S0NA 5GAHI 3FKBA 1K4JA 1U6FA 2BRKA 2RC4A 2V50A 1T7PA 1U8SA 2F9DA 3AJ1A 1C0TA 3IJ3A 3WC7A 2E1PA 4ZVOB 4JI3J 4RO0A 1ON0A 4DPXA 1HWKA 3LP0B 3IAM9 5IV0A 1W2IA 1TF9A 3PB9X 4KE5A 3NGKA 4F8RA 1Q0NA 4TWEA 3QRRA 3WABA 3OUYA 3IAS9 3W6SA 3IBFB 4TXSA 3S6FA 1PC5A 1RU1A 2AGPA 2ATCB 4UFVA 3I96A 1FRLA 1YDLA 4B3MF 3FSXA 2WVFA 4L89A 1LCPA 3X3UA 2OH1A 1SB6A 2E7XA 3ONQA 1Z2ZA 4DUYF 2VFVA 1S60A 4OYBA 1NM2A 3W5ZA 2OPPB 4CYUB 4B9LA 3HSDA 2CNMA 3DR6A 1ELLP 2IM1A 2F7VA 1NDPA 2E66A 2PD1A 1FD8A 2IAJA 5FDLA 4ECZA 2AJFE 1VQ8S 3IR7B 1LWFA 4KKOA 3OXLA 2YNFB 2YNGA 4FS2A 2ZH8A 2FY1A 3HO1A 5C2GA 4WFXA 3AB2B 2C22A 1OIAA 2V94A 3C19A 3BGOP 2YNCA 2CQCA 4P4IA 3V8IA 4C68A 4M5JA 1G3OA 4MKYA 1OY6A 3T6JA 1YREA 4CTAB 3CNQP 3RBDA 2W1BA 3GYGA 1DQAA 4JI7F 5HVGA 3J7A1 1FFSB 3M8PB 1SC1B 4L72B 3T5KA 5J1PA 4OI0A 1JLGA 3BKUA 2AJQA 1HA1A 1JMTA 4AD6A 2BEIA 4K2XA 1FJEB 4CRZB 1WTFA 4UOCA 2CQ4A 4HVZA 2Z2LA 4XTTA 2FLPA 2LQ8A 3LP1A 1WC4A 3EUNA 5EX3A 1CM0A 2JRSA 1P4NA 5MAOA 2XGQA 1PG5B 2HEKA 5AE3A 1PCAA 2YY3A 1Q7YT 1GAOA 2QFJA 4AT1B 3UFCX 5HMWA 4O3OA 2CQIA 4DSEA 3GJSB 5IT0A 1LAPA 2QA4G 2RQKA 1NK6A 3P45B 2B5GB 3PACA 1WC0A 3H0PA 1N32J 2AMCB 3W66A 3P4UB 4UQGA 1ARMA 4RI1A 1FXDA 2G4BA 4E2AA 1O8BA 4E8OA 4PYAA 1WSRA 4GC6A 1QD1A 3GIRA 4OI2A 4P4JA 1YI2S 3O5TB 3Q8SB 4TNOA 4NYZA 4ZVQB 3VGUA 4GVBA 3TAQA 2E44A 1OZPA 2MXYA 3CPAA 5H9EJ 7FD1A 2M5YA 2PEBA 1TIQA 4IH6A 2DHSA 2YNFA 3Q8YA 2N3LA 3NH8A 3K5PA 1MN7A 1LW0A 1RCOB 3RB6A 2YWGA 2MGZB 5LMUJ 4B10A 2JC0A 5HQMA 1JLCB 2G3AA 2QL5B 1H7XA 1VRTA 1VK8A 2Z3LA 3NS5A 2KRBA 3JQJA 3VQTA 1FKAF 4Y00A 3DLHA 4AVAA 4FS1A 1T9UA 1SJ3P 4JXRA 1OQ6A 4YR3A 3OQ2A 4ECWA 1Z5RA 1TK5A 3PM9A 4WFZA 2OJ3A 3EXYA 4XO0A 3JYTA 5ETNA 1WHYA 5IC6B 1B70B 4CAXA 2ZZMA 5HMNA 4B08A 3PTWA 1IVZA 4B9MA 2DEAA 5H1SV 4TU7A 4YS2A 3GFYA 4QYZJ 3GUXA 1RKJA 4FZVA 2AYMA 4F9VA 1SPBP 4LFCF 4PXEA 2C2RA 5EMIA 5CYQA 1UWBB 2VPWB 2EC0A 4M5NA 5F8HA 2V4JB 2IRUA 1U48A 3D0IE 4BLGA 5T7LA 1Y11A 1M1DA 3FMCA 3VR1A 4DV2F 1UETA 3JTOA 2B58A 1M90T 3R3TA 4AG7A 2OZHA 3PY8A 3Q89A 1RWPB 2OPRA 4C97A 2H48B 3IGNA 4GC7A 2CPIA 1FKOB 1HI8A 1TELA 1I12A 2WUUA 2JBJA 3DRRB 1KLMB 3HCXA 4CH7A 3M32A 5EUHA 4ZJQA 2W2MP 1NPRA 1HNXJ 4PWDA 5ETRA 4P74A 2VC1A 2C2EA 2OAUA 1S99A 3AY0A 4PSXA 3AFGA 1S6OA 3NCPA 2RU3A 1AZSB 2OMOA 3OT9A 2DNHA 2Q04A 3PO4A 1D9FA 5LYLA 2YNHB 4OMEA 3M2RB 4Q43A 1O51A 2HHUA 4M5DA 1MMDA 1YQHA 2HQCA 4DG1A 2KU7A 5I3UA 3M8QB 4QIVA 4MTPA 4P6QA 4DL2A 2DHAA 4CAWA 4L74A 3N7ZA 4B6ZA 3GLJA 5C42B 3AJDA 2WONB 2VPZB 1R0AB 2HVHA 4OQJA 1YG0A 2BABA 1TR0A 3DGPB 2MKKA 2CA9A 5GMKa 2H5JB 5HATA 1KZFA 2EEYA 1PYSB 3TVKA 2WVDA 2GMJA 4DV4F 1SKRA 2XHWA 2Q4VA 4X4UA 2IPOB 4DL4A 2PVWA 4FD7A 1Q53A 1V6HA 4LRFA 3CCMS 2F4FA 3QQCD 1NEEA 2R1IA 5JQ4A 1XBUA 5L1JA 2IC3A 1Y7EA 3MWBA 2GVZA 3CEDA 4TLQA 3OTOF 4A94A 2I0XA 4NF1A 3LWMA 2B51A 4KTQA 5GAEI 4KV8A 2P6EA 1QSYA 5KOXA 5HMZA 4E0DA 3BBBA 1GTHA 4P2XA 1O0PA 3HFVA 3GG1A 3THPA 4C0OC 1HD0A 2OSRA 4I0WA 2V8HA 2GJIA 2GX8A 2AZ3A 1IWAA 2K2PA 3FVLA 2R9LA 1ZETA 1YZ6A 1R0BG 5GAGI 1FX2A 4Y28C 3NS7B 1Y0HA 3QNWB 2YH0A 3PR5B 1CULA 4LF6F 5IV4A 4NFRA 3FZ2A 1BO4A 5E2QA 3FQLA 2KT2A 2YXLA 2DB1A 3TUPA 3PW0A 5D4PA 4NX9A 2LU2A 4KPCA 3TANA 2CNSA 4AFFA 2DNRA 8AT1B 5HVFA 4MY0A 1KQFB 5G20A 2G0CA 3DM2A 3N9UC 4QPXA 2BBEA 4DR1F 2YWKA 3ZTSA 2EK8A 3HD2A 1S4FA 4MI4A 4ID5B 1IGBA 1HW9A 1BGXT 2CJXB 3KJNB 4HH0A 3LH2S 5GMDA 3Q8PB 4OJ3A 4IQXA 3RU0A 3M6UA 3N6MA 2IVYA 4F26A 1G4CA 4O3NA 2RHQB 1RJJA 3QFWA 1Q2YA 4I2QA 3H5XA 1T9VA 5AXLA 4DSKA 2B4DA 1S6PB 1GX5A 2HAIA 3QJPA 3DYAB 2DHGA 5DWMA 2Z3KA 1S49A 4B9SA 4DR2F 4Y2AA 1IJFB 3ILIA 4BCAA 4F3MA 1VQMS 2CPEA 2RJZA 2VDHA 3RNZA 2CNNB 1AT1B 3JSMA 3OW2R 4OC5A 1S1VB 2Z57B 4C11B 1RWWB 4M95A 5A8RA 5KFTA 2UXBJ 3LANA 2C2DA 2LXUA 4EO6A 3BJ8A 4LSLB 4CDIA 1T9WA 2ZOGA 3FMBA 3FCHA 3C15B 2VI7A 3RJMB 4LSNA 4U96A 1NJIT 3VVUA 3JAMU 3DKDA 4NLYA 5IT9Y 4LVNP 1YGYA 2WOMA 5KFOA 4ONWA 4JD6A 5D4OA 1NJWA 1M1HA 1WK4A 2LXIA 4I1TA 2HHVA 4DR4J 4ILLA 4DL3A 3UNYA 2HFSA 1F2PA 5E96A 3LACA 3B3TA 2HVDA 3DU5A 3CCJS 2XG8A 2MQPA 2ZEDA 5L8RC 2WOMB 5B7WA 2B4DB 4LF7J 4M94A 4RU2A 1K73T 4NL5A 5F8LA 3NAIA 1TP7A 1UMJA 4J91A 3FBBA 4MFBB 4LSNB 4ZVSB 4J9QA 2NUHA 4DV1J 1ZPVA 3W7BA 1EARA 2HVIA 4TY8B 3A3OB 5LMNJ 1WOSA 4JI0J 1MJ9A 3B78A 1XR5A 2HNZA 1NSAA 2DPTA 2RF2B 1GNKA 2VJUA 2HVEA 1AUGA 2M7SA 2KFYA 4G1IA 2MKYA 4ZPVR 3SBMA 5J2NA 1NJZA 2UU9F 2NYIA 4A33A 4ITSA 4KHRA 1XIQA 3UI3A 4PQUB 4V19X 2VOOA 4UCNA 1S1XB 3GIKA 2HG4A 2Z3OA 4PG8A 1H72C 3QMQA 1S6PA 4I2QB 1VQPS 4AVCA 1IYLA 1CEZA 1UZHA 1REVA 4P6YA 1CJUA 2YBVA 3KQXA 2CJBA 5K9FA 4E2FB 3QT8A 4DR1J 2KFNA 4DR5J 3PO5A 4CT8A 1ZS6A 2D7SA 4MIBA 2MEWA 5KFPA 1LW2B 3MCMA 4RBTA 4OC3A 1QSNA 2Q66A 1TTHB 2XMTA 1RHMB 5AXKA 2AEFA 3KHGA 4Q5VA 2MLXA 3D7GA 8ATCB 4ZIWA 2JSXA 4NLTA 4A38A 3O8WA 1CPZA 3D9BA 3TT2A 4ES3A 1TKJA 5LYFA 4LR8A 2QECA 2FTRA 1CULB 2ZD1B 1WWHA 1PYOB 2BUEA 1E6YA 4RW8B 3MCSA 3HZGA 1TL5A 4TYAA 5A27A 1D8ZA 3U1MA 4KFBB 3MM7A 5AGEA 1S1UA 1TFYA 3MM5B 3MRUA 1HW8A 2M9KA 5CYMA 4MK9A 3BYPA 2CG8A 1SJ1A 1UVKA 1R0AA 2PJ1A 2WONA 2XM3A 2KG0A 2H9ZA 3NEKA 2OMLA 4ELUA 2RAQA 3DDKA 3CC4S 1NDCA 4O0IA 1U1OA 4ZCLA 2UVUA 4EBCA 4DJBA 4MCSA 4NEYA 2X1GA 1C4AA 3PYFA 2IJFA 3W5YA 2QA4S 1UFWA 5I42A 3F5BA 3MCNA 1QSSA 4HHHA 4U7UD 1SJFA 4G65A 4U67Q 3RG6A 4ES2A 3QRQA 3CZXA 4CLSA 1B4SA 4DUTA 4HKQA 3TCVA 2EVNA 2Q1LA 3I6PA 4N7TA 3MUTP 3GP9A 1QAYA 3CC7S 2FIAA 3QWPA 9ATCB 3JQMA 5C42A 3SEOA 3EVWA 4UEEA 2ZHOA 2REFA 2GQQA 1FRIA 4CO0A 4PXCA 3RBEA 1S48A 5KFJA 2QEXS 2GLJA 2UVRA 3TX0A 3CDEA 2VH7A 1VRUB 1ELMP 1QUVA 3KLEB 4LFBJ 4B3SF 4KSFA 3MECB 3OHBA 4FYXB 4F0XA 4C0BA 5DQIA 4W98A 2NQPA 1JJHA 3K7RA 3K0JA 2DNLA 1D0EA 3AD8C 2L48A 4ETZA 1OBRA 1S10A 5DG8A 4R5PA 1NB2A 3D3CJ 3MFIA 3K89A 2JEWA 4N76A 5ETTA 5SUHA 3S9NA 4NLSA 4LF2A 1H2VZ 4R8UB 4XPDC 2ZEPA 3J7Z5 2CNTA 2QVPA 4CLYA 3Q8QB 3H2VE 4ED5A 5J1EA 1LKZA 3EXCX 4OIXA 4CGPA 3KKWA 3W8PA 3EX7B 3BDEA 2QT7A 3R5GA 3KUHA 4QUSA 2GZOA 4NLVA 3CJ8A 2E1RA 7AT1B 2HGMA 3EPIA 1Z4UA 3FCVA 1VRTB 1IQTA 4BS2A 1BD6A 1U47A 2J8MA 4A8SA 3VH9A 3K8VA 4ZOSA 5J8CA 2LA4A 2P9GA 1X9WA 3ITHA 5JH9A 3J80U 4W90B 2OGUA 4Q8EA 4LQGA 2E7VA 4C8KA 1BQXA 4CNZA 4C7IA 3D68A 3WC0A 4OYAA 3PYGA 1IOFA 3TNVA 2HZVA 1CPSA 1NHKL 2RDDA 5AJ3J 2HHWA 3KLGA 2A0FB 1KSPA 4CM2A 2WTFA 2CJAA 4ED4A 2PRQA 1WI6A 3G96A 1WDTA 3BH6B 1K47A 2FDNA 1S1TA 3C8YA 2ZXVA 1FNOA 1OY8A 2YWEA 1OY9A 3F0NA 5KFZA 3DMJB 5BR8J 3E0KA 5KT4A 4OMFG 4QR2A 3TUZC 5D4LA 3ZZPA 4N47A 2ZHBA 2GAHC 2NPIA 3IRWP 5B0BA 1T3NA 2PI4A 2JBKA 3Q22A 5E41A 4DFMA 1RABB 2LQ5A 3TW0A 2ODFA 1TUVA 1WHXA 4EI2A 4FF4A 3P49B 5D78A 2FUG9 1JLGB 2AFUA 3M8PA 2E5GA 4KH1B 3B35A 2AZ1A 4B9UA 2PIZA 4I49A 2B6AB 3TYTA 1XNRJ 2QLBB 3P2HA 1WEYA 1S59A 2PVVA 3QYYA 1YJRA 1R27B 5J1QA 2VASA 3DRXA 2GC8A 1W26A 4DQQA 2Y0SD 4TN2A 4DN0A 4WK3A 3AT1B 4J7CA 3IC1A 1X0FA 3G9CA 3MF5A 1MJAA 3KLIA 2FJVA 2B4BA 1LRZA 3CCLS 4OI1A 1S5ZA 2CY2A 2EI5A 4UW2A 1IKVA 4CYUA 4DMZA 2XB2D 2P9CA 1IR2A 2QYGA 1SH3A 3T8WA 1FKPA 2KZMA 2XTJP 4YHHF 2D3O1 4NLPA 1PBAA 2MZTA 1XIXA 2B43A 3IS9B 1QY7A 5E33A 2KRRA 4DR6F 2YNGB 3OHAA 4AL5A 1RAJA 1LWFB 4II9A 3VWSA 2Z3NA 1FRHA 2XC9A 2DNKA 3BSCA 1H2UX 1EQMA 2ZH3A 2O66A 1WD6A 3K5OA 1V3ZA 4KGZB 2OPPA 2VFUA 3ILJA 5LMUF 2HBRB 2VL1A 2FVCA 2KKHA 2CIJA 1QTNB 5JPHA 4NI2B 3SXOA 3F8KA 1XMBA 2XS2A 4O44A 3IU2A 1RISA 2GJFA 3IGVA 1NK8A 4N41A 1FXRA 1U0SA 2GANA 2MKSA 3R27A 2XMAA 2FZGB 2F9JA 3V7ZA 1BLLE 3D67A 5CBMA 3B8HA 4NPOA 4IKAA 1M0SA 2EKNA 2E1CA 1LWEA 2VZYA 3CULA 3BH7B 2DXEA 1UW4A 2VFTA 2R7XA 2Q7SA 4OYIA 4P75A 5LRGA 1A2ZA 4F2SA 2ZVIA 1MN9A 5CA5A 5E0OA 4MIWA 2BX6A 4OV1A 3ELHA 2XS5A 3LP2A 2EWBA 2HSEB 3FIXA 4DEZA 2F65A 1UFHA 3SSSA 4OYZA 1RT5B 2KYZA 2YGWA 3FEDA 3KLHB 1J5OA 3D6TB 2QYCA 4V19J 3M2VA 1NU4A 3IFEA 1VI7A 2ZPAA 1D09B 1EJ7L 1H73A 2Z58B 2ZDOA 3PYDA 4MK7A 3TA2A 5KFDA 4X62J 4NGSA 2R2SA 1YJVA 4ALZA 3TAMA 2ZC3A 2PO4A 1DE4C 1VQNS 2P2CB 4C4WA 4QZVB 2XGPA 2RE1A 5A2QU 2DISA 5DS0A 2X7IA 3POTA 4ZCMA 4DF4A 2JLEA 2OPQB 4MCRA 4B5PA 1ZLHA 4U8YA 3D3BJ 1Q8LA 3O3LA 1HYSB 3GCWP 1FO1A 4C2XA 5DG7A 4CT9A 2LEAA 3M8RA 1FK9B 3W9HA 2FHJA 4M5LA 2UUCF 3I3GA 4Q45A 1AMPA 4YMEA 2VD3A 3WC2A 1X7VA 2RFHA 4OYPA 2FJXA 3MM7B 3MPVA 2PCUA 1YLEA 1NZ8A 2C27A 1RWKB 2ZH9A 3BR8A 2CJKA 2CQ0A 5MLCV 3NMRA 1DTDA 5LJ5Y 5KG0A 1RI7A 3CO0P 3E2EA 3TJ9A 5A6PA 1BAVA 2VQEF 3HVWA 1VISA 1V5VA 2VG6A 3QBCA 1IBKJ 3BKTA 2N4DA 3HVTB 1VS3A 3QPIA 1HWJA 3F0AA 4DN9A 4USTA 1RU2A 4PPZA 2LQBA 4TU9A 2MJUA 2AIRB 4ED0A 2J76E 1Y4ZB 4NLQA 3OTBA 1WEZA 3M8WA 1Y9WA 3OTEA 2F40A 3FBCA 5KFWA 5G4DA 2B3VA 1JB0C 2R7SA 1DTTA 2D41A 2YQ0A 5HROB 4O4RA 2AW0A 1NSKL 4NRTA 2CQ1A 2ZVSA 2Q44A 3FEXB 2DNMA 2Q0YA 1C1CB 3NCQA 4M6IA 4YOEA 4EMEA 2CJ9A 3HJFA 1UFLA 4LQ3A 3CCQS 1ZA1B 3TAPA 5LXRA 2B5JB 5A0YA 3Q2SC 3H59A 4J9LA 4NSQA 2ATRA 1KVKA 2W24A 3PFOA 2DRAA 3H5YA 1YK3A 3HHDA 3VV2B 1GH8A 3VAGA 3D7DA 1X4AA 1S7NA 1IIDA 4DUZF 3NLCA 3OWCA 3R9GA 2JFKA 3FDSA 2MQNA 2F1FA 1K44A 4C98A 4CO3A 4RL1A 5IWAF 1K0VA 2IJZA 2HVZA 3F44A 1RT2A 4PYDA 2QMLA 1TK8A 2DY9A 4GKJJ 3BLNA 2OPSA 2PE8A 1NJXA 2M8HA 5BJRA 1BPNA 5A8KA 1XMOF 4P72A 1T3OA 4PABA 3SIPB 2IDLA 2PMZD 4JLYA 4X4QA 3EGWB 1Y0YA 4X65F 3OR2A 3LALA 1CS4B 2W4CA 3GR1A 2RMLA 5LL6d 4KOUA 1X5SA 3FFIB 4USWA 1RTIB 3ZC4A 4LFCJ 2OKQA 4ZLNA 5A28A 2Z2ZA 3HZEA 5HMYA 4OX6A 1X5PA 4LSLA 5D3GA 3QZ7A 5DZ7A 5A8RB 5M2RA 1N8RT 1S1VA 2J0XA 4ZPAA 1YLOA 3CGIA 3JSMB 3TQEA 4JYAF 4EYIB 2IA6A 1M1GA 1HR0F 4P52A 5K5MA 1G6BA 4FBEA 1QUPA 4PUOB 4NMLA 2EFPA 3SCIE 3M2UB 1VIXA 4IF5A 1RAIB 5DJBA 1YRUA 4CLTA 5DO2A 5KT6A 1NCLA 4PK3A 2HBZB 4X2BA 1RB0A 2HAFA 2IYIA 4USMA 1CBXA 1SKUB 1SXLA 4JBCA 3NGUA 3W5XA 4KO0A 2CNLB 1WG5A 1WOOA 2JVRA 3F73A 2RDIA 4DV7F 1PO6A 3VVTA 1NSQA 3SCJE 2G0JA 1MROA 4LSZB 4RN7A 3QJJA 1N6QB 2VF3A 3FQKA 1PGZA 2RHSB 3BGUA 1FEHA 3HD1A 4ED2A 1S77D 4JJXA 2XSJB 3AA8A 4IR1A 2NLWA 3M30B 3KJQB 3MD3A 4NXMJ 4EGLA 1OPIA 4JV5J 4F3QA 1LEOA 1R8CA 3AJ2A 2N7CA 3G2XA 1REGX 3KK2A 4FD4A 1WKLA 1DRZA 2C2OB 5FVJA 3MM9B 4U95A 3TVYA 2HK3A 1FNXH 2R7OA 4LMZA 3LGMA 1ZM2A 2HFVA 4URQU 2DIUA 4C3MA 1TV6B 4IFYA 4P73A 4KUAA 1B0PA 3OLAA 5L1LA 4UQTA 2LXFA 3G6ES 4DUZJ 3WR7A 2RKIB 3WX4A 3LAMA 3CMES 4BBHA 2FGCA 1DLOB 2QMWA 1U1NA 4IHMA 2BJ9A 2DJWA 6FD1A 5DQGA 2P0WA 3AXKA 5BYQA 1YJNS 1AYEA 4K5RA 2D3UA 4MMOA 3KHXA 4ZJLA 2IC3B 1HBNA 2JEFA 5J2QA 1PJ7A 2JL9A 2VG7A 4JWPA 5HQLA 4GRSA 2J9DE 5KG1A 1IBLJ 1OO0B 4RUHA 2DH8A 3KUGA 1L3KA 4OLLA 2WVBA 5IS2A 1U7LA 4OZJA 4P4FA 4NGMA 5B0CA 3A12A 2DGVA 4QPTA 3HPOA 2OU2A 4ZVEA 4B3OB 2LEBA 4UIAA 3L09A