3PFFA

Truncated human atp-citrate lyase with adp and tartrate bound
Total Genus 254
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
254
sequence length
811
structure length
735
Chain Sequence
b'SAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALGHRPIPGKSTTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCATMQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-citrate synthase
publication title ADP-Mg2+ bound to the ATP-grasp domain of ATP-citrate lyase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 254
structure length 735
sequence length 811
ec nomenclature ec 2.3.3.8: ATP citrate synthase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
A PF16114 Citrate_bind ATP citrate lyase citrate-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.110 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3pffA01
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3pffA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 3pffA04
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pffA03
2CDAA 1JU9A 3WJAA 3M6IA 4LRTB 1YXMA 1I01A 4E2ZA 3OJ0A 5C5IA 4RO0A 1P1IA 3G79A 4NBVA 1PU2A 1GUZA 4OSOA 1UZLA 3EW7A 3LT0A 3MCVA 4OMUA 1NWCA 3QVWA 4JJFA 4PVCA 1VKNA 5U9CA 1R12A 4BQPA 1BRMA 3NDIA 2AXQA 4LSMA 5TNXA 4A27A 1PGOA 5COAA 1Z45A 1R16A 3FPCA 1QLJA 1LDNA 2Y0EA 3JQ8A 3MJ4A 4L74A 3CXRA 4PLZA 5JXWA 1ENOA 1H2HA 2WE7A 2BHLA 2FOIA 1ML3A 3S2EA 1RM0A 2LDXA 4FCCA 4XQGA 1PL7A 1C1XA 4WCFB 3SLGA 1YB1A 5KOIA 2O2SA 3TZKA 3I3OA 4UVIA 4DBVO 1N5DA 1TVEA 2BH9A 2Y0CA 3O9ZA 4CM6A 4CMEC 3JQ8B 3QY9A 4WOKA 3UW3A 1ZH8A 2Z1MA 1DC5A 3JQCA 4D3FA 3H2ZA 4N5NA 2QW8A 1H2BA 1U4SA 4R01A 9LDBA 4OKNA 5CDSA 2Y66A 1C1XB 3WMXA 4ESOA 4TMFA 4FSHA 3F6YA 1EQ2A 1I33A 5A9TA 2J5KA 1UDCA 3VDRA 3WNVA 3EUWA 4KWHA 1EUCA 1KEUA 3ADOA 3DFZA 5BSFA 3ORFA 2HMWA 3FI9A 5J23A 1DIAA 2GLXA 2PZLA 1P33A 4KP7A 4AJOA 2AG8A 3H2SA 2WYUA 4XDYA 4YRDA 3JQEA 3WWZA 1NQAO 4W99A 4C7JA 1SC6A 3DZGA 4J7CA 1LLDA 4BNKA 4QO8A 4GH5A 4PZEA 5LC1A 2W98A 3E48A 5K6AC 1PS0A 3TFOA 4AJ4A 3NGLA 2VYVD 1PJSA 4M87A 2Q2VA 1T2EA 2HK7A 1DFHA 1E5QA 3T7CA 1YOVB 3HE3A 3HN7A 2IRWA 1ZUD1 2C2XA 1DXYA 4DQXA 1IPEA 1RPNA 4BV9A 2O3RA 1NASA 4BHTA 1EMDA 1KEPA 1NR7A 4AJNA 1HDRA 1Q7GA 3AM4A 3GHYA 4AL4A 4WLOA 1B15A 5ENDA 2VQ3A 4E6PA 5JDCA 1W6UA 4R3WA 4J9VA 4U5QA 1HDOA 3DC2A 1SOWA 4KOAA 4A0SA 4GMFA 1EVZA 1VL8A 3EMKA 1EE9A 1ZXBA 3QVXA 1C14A 3I23A 3QVOA 4HNHA 4OOEA 2NNLD 4GKVA 4JX8A 1FK8A 4EYEA 4YB8A 2VCYA 5TGDA 1ZK2A 4MVJA 1NAHA 2OGUA 3IDSA 3GA0A 4G5HA 2D5AA 2AQIA 3PXXA 3Q3CA 3BTVA 2GDZA 5IXSA 3G17A 2PZMA 3V5NA 4BO9A 3AY3A 2VTEA 4NDNE 4R1UA 1PTJA 2WEKA 5H82A 4AFNA 4ZJUA 3EVNA 1YDEA 5A1TA 2CSUA 4U8GA 5EJ2A 5THQA 1MGOA 4M54A 1LBEA 2B35A 5A3VA 2EJWA 5A5EA 3ROPA 4Y8VA 2E4AA 2WYWA 3CH6A 4XRRA 1N1EA 1ZK3A 2ZB7A 5JNLA 1ENZA 4RORA 1X0XA 3TQHA 4ZRMA 3LC1O 2DU8A 3UUWA 1PSDA 2HRZA 2X9VA 3OIGA 3X2FA 1E3IA 4CUZA 4EEZA 5JCXA 3ZWNA 1P1FA 2GN8A 3WYEA 5COBA 3RKUA 1B8PA 1JKIA 2HSDA 1HZJA 1I2ZA 3KUXA 4FS3A 4Z9YA 2V65A 1UP7A 3FTNA 1E7RA 3O03A 1DO8A 5KJCA 4DC0A 2C54A 3HDQA 3JD1A 3P2YA 4NR0A 4YR9A 4RPJA 2GZ3A 2G17A 3WTCA 1M66A 5I7FA 1HLDA 2V6MA 3L6OO 4UEKA 2JAPA 2DBZA 5FYDA 1ZIDA 3PK0A 2Q1TA 3WYCA 5B4VA 1KS9A 4IMPA 4CLEA 5T8KC 3B1KA 2VN8A 4K26A 3B6ZA 1MX3A 3IQDB 2F00A 3EC7A 3RIHA 4OSPA 1Y8RA 2O3JA 4I08A 1E3SA 1PIWA 4PFJA 2Q3EA 1GV1A 3NV9A 5A9SA 3LYLA 4WCDA 5I9LA 3OIDA 4HY3A 4ND1A 4UUMA 4EJMA 3BAZA 1ADFA 4A2CA 4QECA 3P2OA 3VPSA 1GZ6A 1WNTA 3B70A 4CLOA 3F5QA 2JD2A 2NU9A 3QA9A 4EUEA 1LDMA 1MXHA 2B5VA 4QTZA 5G4LA 2Q50A 3GNSA 4QFDA 2OP1A 1UXKA 4WLEA 3ZV4A 2WE8A 2OFPA 4J43A 3E03A 3KO8A 3RC1A 1E1MA 5L53A 2Q4EA 2QZ9A 4WPGA 2VNSA 2EIHA 2B4QA 2PH5A 1GUFA 1DC6A 2BF7A 4CLOB 2JKVA 1GYPA 1WDKA 3ETGA 4Z9XA 2FSVA 5A05A 4E30A 4GWKA 2AMFA 5ICSA 1Z6ZA 1PEDA 3PRJA 5L7TA 1JWAB 3VTZA 4IIUA 3LT1A 4BL5A 3D5QA 1CWUA 3RUAA 1IZ0A 2CUKA 3KLPX 4CM7A 2VYNA 1E92A 2NTNA 1ZFNA 1KETA 3KYCA 1KERA 4XD2A 1V3UA 1LXCA 2VRBA 2HK9A 4KUEA 1LRJA 5THKA 1B8VA 4CV3A 1JTVA 4U6QA 2Y1CA 2WM3A 4DIOA 4QXMA 2ZYAA 5T5QA 4JBGA 4CM3A 4IDFA 4WLVA 4L4SA 4YDRA 5KVSA 3G0OA 3I4CA 3ZU3A 1UAYA 3ASVA 3KYCB 4CV1A 2CDCA 1X14A 1E3JA 3E1KA 3GLQA 3LU1A 2ZB4A 1HF3A 2HKIA 1PX0A 3HB5X 3IJRA 4ND5A 5F5LA 5G0WA 3MJEA 1AUPA 3OIFA 3E6AA 2GN4A 2JFFA 3ZWXA 3M2TA 1X7DA 1RYEA 4XCVA 1ZO8A 5BQFA 2X0IA 1HE3A 3MTJA 3RASA 3SC6A 2I3AA 3PWKA 5IFLA 4WE3A 2CVQA 4J1SA 1E7MA 2QYSA 4IINA 4JROA 1Y6JA 4RJTA 4YQYA 4RVSA 3UICA 1U7TA 3ADPA 5B12A 2X9NA 2ZCUA 4YJHB 1OAAA 1CYDA 1XKQA 2HU2A 2X7HA 5BNTA 4BNLA 2YHUA 5IDXA 4LSWA 3CEAA 2PLAA 3ZWAA 2D2IA 4JJGA 1G6KA 2HQ1A 4I9NA 2PWZA 1YH3A 1P1JA 4MKXA 1LJ8A 1LU9A 5I9NA 2NVBA 3RUIA 1LDGA 2QX7A 3ANNA 3GNTA 3H8VA 3ENNA 4Q39A 3ON5A 1P45A 2UYYA 4DMMA 3H4VA 4IGFA 2YYYA 2ZB3A 3AUAA 1ISHA 3EHEA 1D1SA 5AXDA 3PGJA 5BSEA 1VRWA 2Y1FA 3HSKA 3LLSA 5DZSA 3QV1A 2PNFA 3TRIA 2OUIA 4N54A 4E4YA 3WGYA 5B4UA 3MJTA 2PD4A 4NU5A 4AG3A 3PWZA 2ET6A 5H83A 3IJPA 2YV2A 4NHEA 1ORRA 1UXIA 2PY6A 2EWMA 1JKFA 3C85A 5FI5A 3QRWA 4E31A 4D41A 3ZW8A 2VHZA 4LK3A 2W4QA 4XDZA 1SCUA 3RROA 5JDIC 3I9KA 3BHMA 5FWNA 3ZWPA 1DFIA 4A26A 2FPIB 1NPYA 3W4IA 4R54A 1IPFA 3DEYX 3ETEA 4E5NA 2GGSA 3AUSA 3JQAA 2P2SA 4H16A 4S3MA 2LDBA 5DULA 1SOVA 3D1LA 3EYWA 3AUTA 4BGEA 5HRUA 2PR2A 1CJCA 3OJFA 3DWFA 2JCYA 1WDLA 1EFLA 5TQVA 3WQQA 4IMRA 4MP3A 3ZWBA 1SCUB 1SZJG 3OECA 4BIIA 1X1TA 5EERA 3UAGA 4LISA 4WCFC 2WMDA 2O3QA 1U1IA 4AJJA 2DT5A 5TT1A 1PJ4A 3DMTA 3KYDB 3JQAB 3OH8A 1M6WA 3L9XA 3VVCA 1CETA 1QORA 3BMCA 2J5QA 1B0AA 3OBBA 3HN2A 4P22A 3TSCA 3QP9A 4NK4A 3WLEA 2VUTA 4ALNA 1K6IA 5B1YA 1A9YA 5KTKA 4NPCA 5A04A 1VI2A 1F14A 4DL9A 2VT3A 1V35A 4FGSA 5G2OA 1A7AA 1BDMA 1YQXA 2Q2WA 1T1SA 3CPSA 3UOGA 1U8XX 5KVCA 4YRBA 3RWBA 3BMCB 2VZ0A 5JMPA 4C7KA 4YJFA 1R0SA 1LQUA 4RZIA 2TMGA 1HYEA 1Y5MA 2VZ8A 5IDWA 1YDWA 2IXBA 3WGZA 2WSBA 2EHDA 4AJIA 1PR3A 5IF3A 2GUGA 4KWIA 4OL9A 3VH2A 4J49A 1DRWA 3I5MA 5DDIP 3D5TA 1PL8A 4AJLA 3ABIA 1EE2A 1HDGO 5EL0A 1CERA 4PLTA 1KVSA 3VAZA 3ZWVA 1E6UA 3VH4A 1RM5A 3MZ0A 4YJFB 1NWHA 4YPOA 2E49A 2NU7B 2XOXA 3F1LA 2NLOA 4TRJA 1FF9A 3JQ9A 3HHPA 4DYDA 3ZHZA 4LCJA 2C0CA 3FHLA 1H6DA 2HCTA 4NFYA 3W4JA 3ZNNA 4YXFA 2IEDA 1MG5A 4IDCA 4NBWA 3GQVA 4IQGA 2C82A 4MOWA 4R3NA 1JLLA 4FC7A 4S1VA 4CM4B 1K5HA 1NYTA 4EGFA 2DPGA 1AE1A 4NFSA 5IG2A 1CQJA 1NQOA 2UVDA 1EQUA 3RCBA 4Y98A 4BGVA 1I8TA 2CD9A 4NH4A 4CQMA 3ZCXA 1DIBA 2RH8A 3DBLA 1HL3A 2H63A 4LMPA 1BGVA 2E48A 2V6FA 4IJVA 3JYLA 4IJWA 4J1QA 1U3WA 2B83A 4E5KA 4TVOA 2ZYGA 2H9IA 5COQA 1JLLB 3DDNA 2OMEA 4WECA 4CMKA 2YFQA 2AQHA 4OXNA 2JFGA 5JDCC 5CHEA 4BMNA 1T24A 4K28A 3GAFA 2IZ0A 1JDJA 2Q4BA 4PLWA 4CQMB 3ZWYA 2HJRA 5KJ1A 2VRCA 3DBHB 5DCYA 2QRLA 4RQTA 1UP4A 3HADA 4YAJA 1CDOA 3RU9A 1PZGA 3KB6A 3PDUA 4TSKA 2J5RA 5DBFA 2YZ7A 1WPQA 2Z95A 4E2YA 3IUSA 3EDMA 1PQPA 4FBGA 2GNAA 4DPLA 1GL3A 2HMVA 4GI2A 4MO2A 4YAEA 1G0NA 3LSYA 3IL2A 1XQ1A 4D42A 3SC4A 1JN0A 3UCEA 2UDPA 2GASA 1NPDA 3AU9A 4NMHA 2SCUB 1IUKA 1NFRA 3AFMA 1I3LA 4CMGA 5JC1A 1GUYA 5JBIA 2JHFA 3U4DA 4AICA 3GUCA 9LDTA 2Q49A 2DPHA 2G76A 1O89A 5JE8A 1PJQA 2P9EA 4WKGA 3SVTA 2DM6A 3U4IA 2C29D 4ZGWA 1I24A 4N5LA 3RC7A 3S1LA 1VSVA 2PA3A 4TZKA 1I10A 3I9OA 3WX0A 4BO0A 2W2KA 3U0BA 3VOSA 1BMDA 2O48X 1H93A 3E9MA 5DOZA 1E7YA 3NJ8A 1IYZA 3PWSA 4B7UA 2V7PA 3TZ6A 3JTMA 4PG4A 5B37A 4JLWA 3W8DA 3R3JA 1VL6A 1D7OA 2Q99A 1E1LA 3VC7A 3PHJA 3U09A 3BXXA 4P8RA 2G0TA 1LI4A 4O63O 4RLHA 4NBTA 5DOVA 1NVGA 3MJVA 3OJLA 1FDVA 1YB5A 1X1EA 2OHXA 5F1PA 4EDFA 3WGIA 4D3DA 1ONPA 2CNBA 4RVUA 2ZTLA 3AUUA 1LTHR 4UREA 3ANLA 4LCEA 5CEEA 2HUNA 2P5YA 2P91A 5JC8A 4N18A 3UH1A 3VPGA 4U6SA 4CMBA 4DRYA 2AG5A 4Q9NA 1B14A 3NJ4A 2PD6A 4RGBA 4A73A 1TT7A 2J3IA 1IOLA 1H9AA 3C7DB 2YDYA 3ICCA 1ZMTA 3NT2A 1FMCA 2DAPA 5IN4A 4MVJD 2WYVA 4MKRA 2BKAA 2JD0A 1MLDA 5F3RA 3W8FA 3KEOA 5HWSA 2BI8A 5TLSA 3B1JA 4DPKA 1PWZA 3A9WA 3QWHA 5JAZA 4BO7A 1ISGA 3K9QO 2BFPA 4NK5A 1ZW1A 3I9NA 4JN6B 3HDHA 4KDFA 4OAQA 1BG6A 2FY8A 4HX5A 1O9BA 3ETDA 1W73A 8ADHA 4JP3A 3MWEB 3JQDA 1N9GA 2QRJA 3RUEA 2PGJA 3ZNPA 3BA1A 3L4BA 1U3VA 1PZEA 5CAEB 1DLJA 2OXIA 1T26A 2NM0A 4A5OA 1PJ3A 1C1DA 1CQIB 4OQZA 1LUAA 4RVDA 4CMHA 5C37A 4L4RA 4Q3DA 2GERA 5HM8A 3TWOA 3KLMX 4NNJA 1ZNQO 2H5LA 1XR3A 3PEFA 1HXHA 2BI7A 4CLXA 1RM4A 2ZYDA 3FBTA 4Y6SA 5FFFA 4B7CA 3VPHA 5FEUA 4BB6A 4UULA 4HFRA 1K3TA 1YKFA 1GPDG 1Q0HA 1RYDA 3O38A 3WLFA 1L7DA 3QQPA 3F5SA 3TN7A 5JYDA 4E13A 1HSOA 3K8ZA 5CDYA 1R15A 4GMGA 4BV8A 5A3JA 4K1LA 1I3NA 4R68A 3I6IA 1ZEJA 1QYVA 3NDJA 2VT2A 1NFFA 3QWIA 3DAPA 2DUUA 4W7HA 1I2BA 5EMHA 1MP0A 1UDAA 4M89A 5CDUA 1WVGA 4ILKA 4MVJF 4RVGA 3WQSB 5L7WA 3VZSA 4PZCA 2X0RA 3FNFA 1JQBA 1PJ2A 4DIBA 3AY7A 1DHRA 5A9RA 3RJ5A 1J6UA 3BTUA 3R1IA 5K9ZA 4D0RA 3U4HA 2NU6A 1WMAA 3D4OA 3T4EA 3Q9UA 4IS3A 2EG9A 4H15A 4CR6A 5T57A 4K6FA 4IXTA 5KKCA 4II2A 3IAHA 4OIMA 3UKOA 1GEGA 5JPIA 2QYTA 1HKUA 3IP3A 2YUTA 3FRJA 1DB3A 1KVTA 3LVFO 1KVRA 3GN2A 3NEPX 4FJ2A 4PRKA 4YAIA 2NU6B 3QVSA 4R5MA 1EUCB 2A94A 3OICA 3DTYA 5HS4A 2FPPA 2FPGA 1C0PA 1N92A 4ZQEA 2O4CA 3PHIA 5ILOA 3DHEA 3BHIA 3LF1A 1ONOA 4I5FA 4BGIA 2DC1A 2EKLA 4R1NA 1P1HA 4FJ0A 1K0UA 3TL3A 4DXHA 3WFJA 3RD5A 3WBBA 3DFUA 3HB4X 2A35A 2BELA 4WLFA 4AJEA 4Z0PA 6LDHA 3GVHA 2D59A 1UP6A 5LDHA 3IUPA 2O7SA 1YJ8A 4ALLA 4GLOA 4FR5A 3FNHA 4YCAA 5AXCA 3H9QA 3AI2A 5AXBA 1EDOA 2HMUA 1ZXLA 1ENPA 3C7CB 4DLAA 1AGNA 1WWKA 2PZJA 2AEMA 4JK3A 2IODA 4E5MA 4GSKA 2B69A 3OJEA 1BVUA 2ZJ1A 4HWKA 3AWDA 2JCXA 1W0CA 1PQUA 3V1UA 3WDSA 4XJTA 3L6EA 4U0JA 4BNVA 4GX0A 3PZRA 1BDBA 3AK4A 2EGHA 2P68A 3VPFA 1PS8A 3AOEA 3EVTA 3ANMA 2EGGA 3JQBA 4BKQA 1UR5A 3DMTC 5G0SA 4CM9A 1XIVA 2EP7A 3TOXA 5TF4A 4E3ZA 3N58A 3GK3A 4F6LA 1B7GO 3HWRA 1BWSA 5L4NA 4MVJG 4QX6A 3GZNA 5A06A 4J7XA 3ZWOA 1ISFA 4TWRA 4BB5A 4KUGA 1LNQA 2X1HA 1EDZA 3Q11A 3F1KA 4R41A 3UHAA 4J6FA 3ZW9A 4EEXA 5JY1A 1HSZA 1TEHA 3ZU2A 2DFVA 2NVUA 3DO5A 3MJCA 2FMUA 1QR6A 1DIRA 1E3WA 4L75A 4XQ9A 3RFXA 3BYZA 1IHYA 1VSUA 3GZNB 5ILGA 1IY8A 1QP8A 1B16A 1T2AA 4IDDA 3X2EA 1JA9A 3JQFC 5IZCA 2C2YA 2VZ9A 4FOSA 1O95A 1V8BA 4GBJA 2Q46A 5JSFA 5TJHA 4PLHA 1Y9AA 3JYNA 1XU7A 2NTJA 4CUKA 4WJZA 3JD2A 1ISIA 4FN4A 2C59A 1I30A 3GPDG 2C7GA 3AI1A 3MJSA 5G4KA 3JQ9C 4YAKA 4GWGA 4DUPA 4YT8A 2HJSA 2ZKLA 4OJNA 3ZWWA 5U1PA 3W8EA 4TRRA 1F06A 4FFPA 4JJIA 3E5MA 4F45A 5B4TA 5AOVA 3TDKA 4CL3A 1J4AA 4B8ZA 3H9UA 3JQAD 1UXGA 3MEQA 2VHYA 3DHYA 4IBOA 3DBRA 2RCYA 5I8WA 4L73A 3PP8A 4UUPA 1Y8RB 1R0KA 5G4KB 5GY7A 3OQ6A 5CEFA 1LQTA 3LT2A 4BNZA 3ROKA 1PJBA 3FPLA 4WASA 5A9SB 2JJYA 4ONEA 4Q3CA 2W8ZA 4PIVA 5GMOA 3GFBA 1GFSA 3VZQA 1NPTO 2O2YA 4NU6A 4IQ8A 4OOFA 2NU9B 1U3TA 4QEDA 3H5RA 1BVRA 3WOHA 3GVXA 2DFDA 3Q2KA 3K2BA 4FD3A 1E7SA 3WGHA 7MDHA 1UXHA 4U7WA 3ZHBA 1OI7A 3KOUA 2BFOA 3QIVA 2CDBA 1EEHA 4R5HA 5F21A 1Z73A 2G1UA 5A5FA 5TC4A 3OJOA 3ZV3A 5BNIA 4ZICA 1ZBQA 3ZGYA 1YQDA 3V2UA 2E6UX 2O23A 3DAFA 4BNFA 5KJ6A 1V0JA 3ITKA 5DCUA 1L7EA 1DIGA 2JL1A 3NT5A 4OQYA 4YRAA 4CMCA 4EI2A 5JFOA 4H3VA 4F3YA 1D4FA 1R4MA 2DTDA 1IULA 2RBEA 3NX4A 4W9NA 3JV7A 2VYVA 3NUGA 4DMLA 1GYQA 4MPDA 1EUZA 1RKXA 4B3JA 3SEFA 5DBIA 3WR5A 4XGIA 5G0TA 5IXYA 2OORA 2OBNA 3D3WA 4NG5A 3PQEA 5F1KA 4A7PA 4WGGA 1E7QA 1R4MB 4HBGA 3TZCA 3BTOA 4URFA 4DPMA 1PZFA 1ENYA 5L7YA 4IDEA 3AFNA 3GT0A 5LDGA 1IL0A 2GSDA 3JQ6A 1ZCJA 2CFCA 5KCZA 2PTGA 4J1NA 2Q2QA 4Q3BA 4CM1A 1WDMA 1SO8A 5CG1A 2NU8A 3QE3A 1U8FO 1GCUA 3H6KA 3NKLA 4CQMD 1T2FA 1G0OA 4O1MA 1P31A 4CMEA 4WEOA 4ZD6A 3FWZA 3H65A 1WLYA 3I1JA 1E1KA 1Y1PA 3GG9A 3H5AA 3PPIA 5EQDA 3LLVA 1WW8A 4MIYA 3G1UA 2EXXA 3RJ9A 4YYZA 1GV0A 1GU7A 3CTMA 2IE0A 3DTTA 1S7CA 3UVEA 3DB2A 3LC2O 5A02A 3BIOA 1DRVA 4D45A 1HRDA 2P4HX 3R6DA 4U0KA 3RKRA 2B37A 2A9FA 2HLPA 2FHSA 3GRKA 3GMSA 1PGQA 3I9MA 4XYEA 4G2NA 1EVJA 4BKUA 3F4BA 1B3RA 2AW5A 3ZU4A 1DIHA 1LDBA 2NVWA 2WTBA 4JIGA 4IDAA 4BO8A 4LRSB 3OQ1A 1P3DA 3WICA 4EW6A 1UXJA 1H0KA 4G65A 4CMIA 1B2LA 3FNGA 2FZEA 1YRLA 4D7AA 3GAZA 2DTEA 3LDHA 3AU8A 4ND3A 3FD8A 4WLNA 4CLRA 1KEVA 1TLTA 2NV6A 1F8GA 2J3KA 3V8BA 4NI5A 4TRNA 2NTVA 3H9GA 3TNLA 5F5NA 1P0CA 3PJEA 1T4BA 4CMIB 4R16A 1V9LA 1XDWA 5C7OO 1QKIA 1GEEA 3PDJA 1GR0A 4CLHA 3W1VA 1GAEO 2HMTA 2TMDA 1WXDA 4PVDA 4HP8A 3RUHA 4MDHA 5T6BA 3BZUA 3WGTA 4RL6A 2GZ2A 4HV4A 2YV1A 5ITWA 1Q7BA 4UAGA 3RUCA 3PHLA 4CV0A 1DC3A 4FFOA 4TVBA 1B3BA 2O4UX 3GGOA 3S2FA 4HFNA 1DJQA 5JCJA 4DREA 3RI3A 3GDFA 3LZ6A 1TA4A 4L8VA 2FR0A 1BSVA 3SX2A 4BKRA 5C7IO 4D0SA 2I67A 4RDHA 1CIVA 3C7AA 1YL5A 3E8XA 4AJKA 3D4PA 2DKNA 1R37A 1BXZA 4OM8A 4WNCA 3JD4A 3FF4A 2AHRA 3FN4A 2NWQA 3PLNA 4YT2A 1N8KA 1ZZEA 4MINA 4TQGA 3IMFA 2D4AA 1GQYA 4CQLA 4BNWA 4KUHA 1NQTA 2WJPA 2PKQP 3IIEA 3QW2A 5GZ6A 1P77A 3U3XA 1GCOA 4XR4A 1GDHA 4FB5A 1PS9A 3C3XA 4FFMA 1A7KA 4IDGA 4TZTA 3GDGA 1LA2A 2Y99A 1X7HA 2J6IA 3PQDA 4J0FA 2VOJA 3WB9A 4I9HA 4R69A 1QG6A 1DAPA 1N7HA 4CQLB 4UUOA 4GPD1 4PG7A 5JYEA 3F4LA 3Q9NA 1XYGA 4TKMA 2O3SA 4WLUA 3Q6IA 4YBZA 4ZA2A 3G3EA 1ISMA 2YJZA 2CF5A 4EITA 2GD1O 2H1SA 4RF5A 1ADGA 3DXFA 5IN5A 4I8XA 3WS7A 1BXKA 1EVIA 3JD3A 4WEQA 2X4GA 4R1TA 3NYWA 4BGUA 4E2WA 1DAOA 3JCZA 1PJLA 5DP2A 2WDZA 2QZZA 4FDAA 2G5CA 3GPIA 4YTEA 5FF9A 2W2LA 4BNTA 4P38A 4FOOA 1BW9A 4GGOA 1I36A 2P9GA 4YAGA 1MB4A 1YONA 5EN4A 5CFZA 1QV6A 4D3SA 3I9JA 4YACA 1X0VA 4BUCA 3ZWMA 1HE2A 4OXYA 5T8KA 4QQRA 1ZMOA 4MVJH 1QYDA 4RVFA 5L4SA 3U49A 4XEHA 3NTRA 3VHRA 1LC3A 2POQX 1PGNA 2FRDA 2VHVA 3CZRA 3GF4A 4PLPA 2NACA 1ADBA 3DOCA 5BT9A 3JSAA 5JLAA 2WD7A 5IZ4A 1BW9B 1O0SA 1SEPA 4IJKA 3PZBA 1MC4A 1CQJB 4EJ0A 3V2HA 3S8MA 4UEOA 4FFRA 1WAMA 4BKOA 3OA2A 3DMYA 3DBLB 1VJTA 4CMJA 5DNAA 1FJHA 2OOSA 1HEUA 4WNIA 1NVTA 1Q1NA 3COSA 3NT4A 4PGFA 3S55A 1WZIA 4KQWA 1U5AA 4CPDA 1H9BA 4Y9DA 5IDYA 4XZ3A 1HZZA 1W8DA 2FN7A 3KV3O 5KNLA 1EK5A 1C0KA 1DSSG 2OO5A 3WWYA 4DC1A 1HE4A 3OEWA 2X0NA 3INRA 4OXKA 1JAXA 4W6ZA 5JW6A 4NJMA 1MFZA 4R1SA 4R51A 3M1LA 4CM5A 2EW2A 2ZQYA 3AOEC 3JYPA 4ITUA 2O3UA 3ITDA 4RPGA 3T7EA 2AEJA 4IIVA 1PJTA 3JQBC 1NQ5A 2JCVA 3ROQA 4ZHSA 1H6AA 4M1QA 2FZWA 3HZZA 3NRCA 4YEDA 2Y1DA 3WG9A 2ILTA 4ZVVA 4XYMA 3AW9A 2RHCA 4HFJA 4I9UA 4NJMB 3ZHYA 3ZNOA 1XEAA 1CRWG 1DJNA 3KVOA 7ADHA 4UUNA 3WXBA 2CVOA 4BNGA 1D8AA 1A72A 3Q0EA 2DVMA 3VH3A 4I5DA 4XQEA 1KY5A 1U7HA 1DC4A 2X86A 5DBGA 1GTMA 4DLLA 2ZK7A 4ALJA 1TT5A 3PLRA 3GMDA 2PH3A 3RFTA 3GN1A 4DWVA 5T64A 4J2HA 2NUAA 3GRPA 1Y8QA 3F47A 4XR9A 5TRTA 1EUDA 4UVHA 2C7VA 2W2KB 3AM5A 3C1AA 1U2GA 4BO3A 5ITVA 4FQ8A 4XRGA 4IUYA 4J4HA 4OYRA 2JFHA 1TT5B 1SMKA 3GNQA 2XXJA 2D5CA 3CUKA 4IXWA 1J49A 2YQ4A 5IJZA 2VWQA 3WBFA 1QMGA 1X13A 1I32A 4E0BA 1HETA 2E37A 5L3ZA 2RIRA 3KSUA 1HYGA 1EK6A 1EUDB 1SBYA 3K31A 8LDHA 1NBOA 2X8LA 4RVHA 2YY7A 1V6AA 4IPTA 2X5KO 1LLCA 1YGYA 3TJRA 3ZN2A 4DA9A 1ZJZA 4RF3A 5BNFA 3PJGA 4QSMA 5EINA 3EY4A 3ZDFA 5IAAA 1XSEA 4XYLA 3PFWO 3PTZA 4YVFA 1OFGA 4FC6A 1NTOA 2OP0A 4R4JA 4BO5A 4E12A 4RZHA 3WMWA 3L0DA 2P4QA 1V3TA 4YQZA 4CMAA 4CM9D 3DR3A 2HO5A 2VWGA 4XIYA 3DL2A 3TZHA 2Q1SA 4FFLA 2I6TA 3H9JA 3WIDA 2BFAA 3HFGA 1SAYA 1GD1O 3NDRA 4D46A 1Z75A 1KIFA 4KMSA 2PV7A 3UN1A 1A4UA 1KVQA 2JAHA 4J2OA 4BO4A 1LSUA 5C7LO 2B5WA 1YBMA 1KC3A 2A92A 3H3FA 1GADO 1RWBA 3HUDA 3GH3A 1T25A 3DOOA 1HLPA 3RQSA 1U5CA 1N9GB 3G49A 4FW8A 1I3KA 5ENVA 1MUUA 5JAQA 1DLIA 3LK7A 4LW8A 3TL2A 3DZIA 3ST7A 1C1DB 2B36A 4EZBA 2V6BA 4GX2A 4LVUA 4W9NC 4EBFA 5L95A 2ZJ0A 3PYXA 1DEHA 3U9LA 3FTPA 4E5YA 3IS3A 2BMAA 2B4RO 3FSRA 3GVCA 6ADHA 3M2PA 4JQCA 3A28A 5ER6A 1XU9A 4XIJA 4QT0A 1OOEA 1VPDA 4MP6A 3WYBA 4WCFA 1UUFA 3GR6A 3IC5A 4EJ6A 3D64A 3ONEA 4PLGA 2CY0A 3CMMA 2C07A 2PD3A 1IZ9A 3GGGA 1LX6A 5KKAA 1K89A 2YV3A 3ENKA 4IZHA 4O5OA 5AYVA 3P19A 4NBUA 1YBVA 1U4OA 3O8QA 2AA3A 1Z7EA 4RCVA 3C1TA 4PLYA 1XELA 2BGKA 1DOHA 1QYCA 2A4KA 1ZK1A 4L0QA 3QWFA 1KBZA 1M6HA 4IGEA 4DYVA 4E33A 4RV9A 4XQCA 3VDQA 4ZQGA 1TXGA 2X5OA 4II3A 3O4RA 2DUWA 3HDJA 1GZ3A 4RPLA 3ZWCA 5KWEA 3O8QB 5CDGA 4DLBA 5CPFA 1T2CA 1LRKA 4B4UA 1UZMA 5JY6A 2Y93A 3GY0A 2J8ZA 2JHGA 1WMBA 4YWJA 4BNIA 2PGLA 1NP3A 4BO2A 4PG8A 1O94A 3JD0A 4J1TA 2JD1A 3TZQA 4YJGA 4J0EA 2CZCA 2D8AA 5CP8A 3TPCA 1U9JA 2EW8A 2R6JA 4Q3EA 3RSHA 4AJPA 4DQVA 4EUHA 5I8ZA 4DTIA 4Y6PA 2VYND 1J5PA 2AE2A 4MVJP 1YOVA 1X15A 4TRMA 2QHXA 4ZN6A 3C8MA 1FDTA 1SNYA 4ZQBA 5BR7A 5FI3A 4M55A 2Y1GA 4PLCA 3DZHA 5TT0A 2ZQZA 4K9DA 3WGGA 4AJ1A 3DOJA 4ROSA 5GZ1A 5ICMA 1OBFO 4YJGB 1YO6A 3C24A 3RFVA 2FPPB 2FPGB 2UAGA 3GUYA 1UDBA 1QYWA 1IE3A 1P0FA 3B1FA 1ZK4A 3HFSA 1YL6A 1BTOA 4J90A 3ULKA 1IHXA 1GZ4A 3FBGA 2EP5A 1P1RA 1E3LA 2BD0A 1ISJA 2OZPA 3PYMA 2PGDA 4IY1A 2HRBA 4HADA 1OC4A 1VE9A 3G1TA 5L51A 1LSSA 1OC2A 5KVQA 4BO6A 3GZ4A 1ADCA 1GPJA 3BHJA 3H5NA 4UVDA 1L1FA 3I4FA 1XQ6A 5TX7A 3A1NA 4PN3A 2QIOA 3PHHA 2B4TO 2D3TA 2CVZA 1PWXA 2UV8A 2EERA 4UVGA 1G1AA 1K2WA 3MTGA 2Q1WA 3OQBA 4J7UA 4L76A 1XGKA 1HDYA 4ND4A 2IEBA 2UUOA 5JAMA 2EF1A 3LC7O 2IZ1A 3I6QA 4R9RA 2FR8A 3UF0A 4CODB 4HNGA 4D79A 1T1RA 4AJHA 3D3EA 4FPXA 4Q3NA 2FWMX 4CR8A 1HDZA 3RU7A 1M2WA 1XCBA 4XA8A 4BNJA 5IDQA 4MVJI 3WSVA 1QRRA 3HDYA 2I9PA 3D0OA 3E82A 2OBYA 3QSGA 3VVBA 3AI3A 4RDIA 1B26A 2FR1A 5G0UA 3ZNQA 1GY8A 3CKYA 4KTTE 3JYQA 1E1NA 3VZRA 4KDEA 1H5QA 3EK2A 4FFNA 2NVUB 4BOYA 4HXYA 1I5RA 4Q3AA 3CIFA 1E3WB 1GQQA 1IB6A 2YHIA 1J0XO 4ALMA 2ZCVA 1OZAA 3CSDA 3RAJA 4Z0TA 2J3JA 5KVVA 1ZK0A 2Y1EA 5DCWA 2D1YA 3FWNA 3ZI0A 3PVZA 2IYPA 1VLLA 1XHLA 3HG7A 3OETA 1KEWA 2YFHA 3F46A 3UFXA 1VJ1A 2NSDA 4UVEA 3GEMA 3A06A 1C0LA 5CPBA 2GCGA 2G82A 4RQUA 2GO1A 2D0IA 2R00A 3DZBA 3OHSX 2YHIB 2R2GA 4NZ9A 5KIAA 1LDEA 3GHHA 4J16A 3BMQA 4P4GA 4MIOA 1PZHA 4HKTA 3KXDA 1ULSA 2DBRA 1C3VA 1MC5A 2I65A 2AE1A 1R6DA 4BNNA 1S6YA 4P4NA 4X54A 4XYGA 3UCXA 3UFXB 4HFMA 4IS2A 5JCJD 4M86A 3IKTA 2BRUA 2DLDA 4LGVA 4ZQHA 1Y9EA 4O59O 3RBZA 2VOEA 3N74A 1JKJA 1NHGA 4XJSA 5I7VA 3BMQB 1F12A 2ZATA 4P4LA 1P74A 3DBRB 2ZTUA 2GF2A 3LQFA 3DAGA 3K30A 3R0IA 3ZZNA 1OMOA 3D4NA 4YT4A 5I7SA 3LF2A 3OFSA 1NAIA 3E9NA 3Q2IA 3KRTA 4YJDA 2IXAA 4IQ0A 4J91A 3DQPA 3AOGA 2X58A 1CF2O 3TOZA 3QWAA 1WP4A 3NTOA 4XKJA 1JKJB 1A4IA 4DIFA 4AVYA 1HE5A 2Y05A 2VUUA 2ZTVA 4Y67A 1BHSA 1VJ0A 3ZHXA 5JO0A 1A71A 1RM3A 4EUFA 1F8FA 1H6BA 1H94A 3L9WA 2QRKA 4KZPA 1HDXA 4BQRA 2J3HA 1GYRA 1HWYA 3FR8A 1U3UA 1RJWA 3GFGA 2ZTMA 2Z1NA 4PLVA 3CINA 1NFQA 4OO3A 2Q45A 1QYXA 3EGOA 3LT4A 3RC2A 5TJ9A 1E3EA 1MXFA 3WFIA 1W4ZA 3KSDO 4LN1A 3IKVA 1KY4A 5C3MA 1MG0A 3EZLA 3MOGA 3VZPA 3O26A 5L4LA 1Q2XA 1KVUA 3P5SA 2VTDA 1XG5A 4OH1A 3R3SA 3WQRA 2HAEA 4E32A 5MGBA 4XGKA 1WZEA 4BNYA 1DDOA 5I9MA 2W2LD 1HDCA 4MVJM 3UCFA 2Y0DA 1NXQA 2IYOA 1ONNA 4RPKA 3OP4A 1LDYA 2I5PO 3D3WB 4WOJA 2ZIZA 3DBVO 4Z6KA 1N7GA 2CF6A 4GLLA 4ALKA 5U4QA 3OSUA 1EBFA 4OKIA 2GZ1A 4Z0HO 3OM9A 3W4KA 2WD8A 4C4OA 2I66A 4YJHA 3A4VA 5AQ1A 3H9EO 1EZ4A 4XWYA 3I52A 2YQ5A 3KEQA 3STHA 1ARZA 4TKLA 4F46A 2VWHA 2GRAA 2NU8B 5DP1A 3W6UA 4Y6RA 3VKUA 2V6GA 1E7WA 3AJRA 2VRCD 1M76A 2BGMA 2B0JA 1TB4A 5A4DA 2X6TA 5T67A 3RC9A 1MA0A 2BLLA 3DONA 4ND2A 3ICPA 4BNHA 4RPHA 3NTQA 1B8UA 2X9GA 2CMDA 3P7MA 3NAQA 1N2SA 1Y7TA 1PGPA 1LSJA 1E5LA 2I99A 3WIEA 4BS9A 4CM8A 2VHXA 3RUFA 4B8WA 1D1TA 4A03A 3PYLA 4B7XA 5K6AA 3JQ7A 2C20A 5L45A 2PZKA 4OGWA 3GC6A 2Q1UA 4PCVA 4Z3DA 2IZZA 5CEJA 3RVDA 1QLHA 3V2GA 3T4XA 4MJLA 1JVBA 3S2GA 2AQKA 3PFFA 2BFMA 3KSZO 5K0ZA 2NQTA 2P5UA 4MIEA 4BKPA 2I76A 3RUDA 1K6XA 2FPIA 4F6CA 4FGWA 1TI7A 1I0ZA 3L4BC 3F9IA 3FCOA 3QLJA 3S2IA 5HTOA 2HDHA 4CM8B 3U62A 1UJMA 3WGOA 2C5EA 3JQ7B 3I9LA 4CLRB 3QVTA 1U2DA 3EAGA 1F0YA 4JXKA 5KJFA 3NGXA 2BGLA 1UAGA 1NR1A 3QHAA 5KJEA 3TF5A 1XA0A 1FDSA 1AHIA 3V1TC 3PJFA 5ES3A 2X0JA 2GYYA 1E77A 2O3TA 3HQ4O 3KYDA 4BMSA 4B79A 1HT0A 1ZJYA 3GVIA 3ZU5A 3DZJA 4QUKA 4XB2A 1T2DA 4XGNA 3QWBA 3CMCO 3GG2A 5JS6A 1SPXA 3KM0A 4GVXA 4BVAA 1MFPA 1R0LA 1ZSNA 1C0IA 3KTDA 3VKVA 4L9RA 4HUJA 5CDTA 3L77A 4B3HA 3KETA 1O8CA 3PGXA 4JBHA 4KTVE 3VTFA 1Z7BA 4LMRA 5TIIA 1DFGA 1VM6A 4K6CA 1LRLA 4JBIA 1ZVMA 2H6EA 4TROA 2HMSA 3H3JA 1JAYA 3MOIA 1JWBB 1XWFA 2E82A 4CLDA 4GGPA 3VPXA 3EZYA 3FNEA 2EJVA 5LCXA 3GGPA 4O0LA 3D7LA 4GSLA 2FP4A 1PJCA 4RF4A 4B4VA 1ZKMA 3BMNA 2GR9A 3UXYA 2Y67A 1O6ZA 4I1IA 1YQGA 2GPTA 3L4SO 3DZKA 2HK8A 3FR7A 5H81A 3OA0A 4DBZA 2Y68A 4CR7A 2UUPA 1YS4A 4GQAA 5JAIA 3ROMA 3E18A 5BSHA 3GDOA 2AEFA 1X7GA 1A9ZA 2NU7A 2FSSA 3IP1A 2I3GA 2FP4B 1UZNA 1AXGA 4J3FA 4N7RA 3JQFA 2RHRA 4CJXA 3BMNB 1E6EA 3HNPA 3A14A 1O5IA 4L4XA 3ONDA 3GVPA 4W82A 4JNKA 5JO9A 2ZB8A 4Z3KA 5EESA 2QQ5A 3L6DA 1PL6A 4CM4A 3ASUA 4NBRA 1Q0QA 2OL4A 4JP2A 4NIMA 5JMWA 3ZV5A 1U28A 2DTXA 4ALIA 5L9AA 1T4DA 3B20A 5HA5A 5I7EA 5BSGA 2DQ4A 5G0VA 1Q0LA 4MVJE 5ER9A 4E21A 5HS6A 1M75A 2RH4A 4IM7A 4XB1A 3WGQA 2VWPA 3OF2A 4XX0A 5DF1A 3AM3A 5EPOA 1R66A 1YB4A 5GZ3A 3GEGA 2PK3A 1DBVO 2P9CA 3INTA 3PJDA 4IZIA 2C5AA 2VNAA 3TFQA 4G81A 5AXAA 4BO1A 2IDZA 3UGKA 1Z74A 3ONFA 3E5RA 2X22A 3DBHA 2EEZA 2GN6A 2WD7B 4J4TA 1AN9A 1VL0A 1LLQA 3SBOA 3U4CA 4B4WA 4XX0B 4E2XA 4FJ1A 4M8SA 3PHGA 1SB9A 4Z9FA 4ID9A 3ZV6A 3K2EA 4PZDA 3I83A 4PRLA 4I5GA 4W4TA 3GOHA 3RBXA 2QG4A 3RBVA 1LEHA 3C1OA 1AHHA 1ZSYA 1JW9B 1SEVA 1EVYA 3WNQA 5L40A 2SCUA 4W7IA 4D44A 4GL4A 1ZEMA 2VHWA 4MKZA 1CEQA 5DN9A 2DBVO 1I3MA 3KBOA 4MP8A 4IDBA 4M49A 1GQ2A 4NFHA 1PR9A 3F3SA 4A10A 3JQGA 1Q7CA 4RF2A 1DRUA 2EV9A 3K73O 3WSWA 4CUJA 2EKQA 1P9LA 1DHTA 4J9UE 4JCOA 1NNUA 1BXGA 3BMOA 3KHUA 4DVJA 4D43A 3K92A 1PGJA 3L07A 3SJUA 4JGBA 2NADA 3U5TA 1AXEA 4N5MA 4INAA 4ZRNA 5TSDA 1NVMB 1EBUA 1H6CA 2F1KA 2XF8A 1JVSA 3IOYA 3Q1LA 1YE3A 4PG5A 3JQGB 1KYQA 1R4NA 3AY6A 3KZVA 4B3IA 4J4BA 5IZCC 1A27A 4IJUA 1DPGA 2EKPA 3ZH2A 1Y81A 2DBQA 3HJAA 3KYBA 1BXGB 3BMOB 4YT5A 5A03A 3CE6A 3M1AA 3QJ5A 4BNUA 4CV2A 3K5PA 1LLUA 2O50A 1N1GA 1EFKA 1E0DA 1YWGO 4YA6A 4WUVA 1HTBA 4QO7A 4NQZA 2XAAA 2PFGA 3SJ7A 2GN9A 1QV7A 3SXPA 1E6WA 1P1KA 3MWDA 1NX6A 1R4NB 1YL7A 1LC0A 2XPCA 5TS3A 1FXSA 2WWRA 2NUAB 3PIIA 1Y8QB 3DZFA 1M67A 2XXBA 5AVOA 4DGSA 3SLKA 1FDWA 1KC1A 4GVLA 1MV8A 2O7QA 5EQFA 3W6ZA 4QFCA 2YDXA 4OHUA 2NQ8A 4GKBA 2VUSA 1QSGA 1FDUA 2PKRA 2R00C 3K6JA 1Y5RA 1VC2A 2RAFA 4R9SA 4DQUA 1K6JA 1SB8A 4CL8A 2Z5LA 4GAEA 3BTSA 1YVEI 3MWDB 1A5ZA 1P44A 1XLTA 3PIDA 4FIZA 1YJQA 2YW9A 4GX5A 4I5EA 1V3VA 1YBAA 2X5JO 1ID1A 4H7PA 3K96A 3H7AA 3WJ7A 2X23A 3GEDA 1D3AA 1NHWA 1ULUA 5ADHA 1VKOA 4O6VA 3V1YA 4BNXA 2W90A 3PI7A 1ZSVA 3VH1A 3WTBA 3PQFA 2Y1OA 5MDHA 4GX1A 1LSOA 4RLSA 3MWEA 5DT9A 3OEYA 1KOLA 4PLFA 2AQ8A 3CZMA 4LVCA 2PKQO 4PG6A 5CAEA 4KQXA 5CG2A 1I2CA 1CQIA 3OMLA 3E9QA 4ZQFA 4AJ2A 5HBRA 4B4OA 3INGA 3N7UA 4XYBA 5F1OA 1UH5A 5EIOA 5JDIA 1NM5A 4UEJA 4E5PA 3JYOA 4BNMA 1Z82A 4BMVA 1QXSA 1HYHA 4ZU3A 1F17A 1PQWA 4WK6A 3DHNA 4NJOA
chains in the Genus database with same CATH superfamily
3LXMA 3WJAA 1JJVA 4CDMA 3M6IA 2CHQA 3OJ0A 1RLUA 1P2UA 1V8DA 3ORRA 3HDTA 1JPJA 2H07A 5HBRB 2NPIA 4XPZA 2GAJA 1ZM7A 5KTMA 4EM6A 3N0WA 4ZI7B 1OFUA 1QDEA 1UZLA 1PT5A 3GGSA 1XZAA 4FS8A 3GROA 3S2YA 3WK9A 4EKYA 3IFSA 4MJ3A 3OX4A 2JVIA 1R12A 3IE0A 1XA3A 3QVGA 3U80A 5A4JA 4E7OA 4FGUA 3A3KA 3PC6A 3K2QA 2WKPA 4JLBA 1R16A 1N2BA 3FPCA 2HSEA 1LDNA 1SFRA 4K9NA 3AR8A 3TSWA 1GRNA 1PDWA 4PLZA 4YAWA 5HX7A 1ENOA 2QTRA 2WE7A 5DI3B 4EI9A 1AY0A 5IJAA 3S2EA 1VG1A 2ECOA 4U02A 4NYMQ 4N6GA 3VHXB 1NKSA 4CCAA 2D0OB 5JXGA 4NZOA 1ZOOA 2BV3A 2EWVA 3ZE2B 5EMNA 3TZKA 2VF2A 1H65A 4WV3A 4MW5A 5D3MB 4L9WA 3O9ZA 1TAGA 2HHLA 4CZ2A 4Q18A 5ALRA 5ALMA 5IJWA 2J48A 1P3Y1 5EIXA 4X95A 4NZMA 3VYRB 2BL4A 2A5JA 4TS3A 2G5PA 3IYLW 1X7YA 2QW8A 3VJKA 1U4SA 3IVGA 4R01A 2UUBB 4RK1A 5C1PA 1L5HA 1C1XB 4ESOA 1GGVA 2NQ2C 2VAXA 3JXEA 5M7EA 1GPH1 4F96A 3EWAA 1IG3A 3THYB 1ESCA 2PQ0A 2ERCA 2ZRNA 5A9TA 4KBFA 1GUAA 1GGFA 1VBKA 1OJ7A 3GFSA 1FA9A 1TU3A 4FU0A 3ZHOA 4FDLA 3QKSB 3ADOA 3AZQA 2PH1A 5H3HA 2ZWIA 2RHBA 3GZJA 3ASYA 3SMVA 1H2YA 2PZLA 1Z4MA 5KHLB 1TW3A 4KP7A 1NUTA 2AG8A 2ANBA 3FKQA 3ZWQA 1L4GA 3K16A 4YRDA 5EZYA 3WGKA 3WWZA 3NVMB 1OBCA 1BQEA 3DZGA 3OFVA 4ENSA 4GH5A 4KVAA 1L8QA 4GZ6A 5LC1A 3QUQA 4X0EA 4YUVA 1RPZA 3ND7A 3NFRA 4Z8YA 2P27A 3NW9A 4K5QA 2QXYA 2Q2VA 1T2EA 3ORYA 4JEUA 4MW6A 1QPZA 1DFHA 1HR0B 3HE3A 4LH6A 1J90A 1R5OA 2A30A 2W2OA 1QX4A 3AIOA 3OPXA 2IRWA 3NIGB 4DQXA 1DXYA 1ORIA 1KY2A 1RPNA 2GBIA 1S3SA 3Q7QA 4EJSA 4DZRA 2AYXA 3HWWA 5HK9A 2FEMA 1HDRA 4IMIB 2VHQA 2ZAYA 4WLOA 2PL1A 3A6ZA 2OGWA 1EZZA 1Z0UA 4PTYA 2FTKE 1ZLYA 4GC5A 4A0QA 1ECLA 1SOUA 1W6UA 2CNVA 3HB9A 4MO9A 4YRRA 5JDCA 3KQMA 4R3WA 3I0MA 3EDQA 1A82A 1HDOA 3O2QB 4MRVA 4MI3A 4U5QA 4Z7QB 5C7YA 3Q7IA 2R6CA 2ZW9A 2FI1A 3RG2A 5H16A 3ZXUB 3WLQA 1BXRA 1VL8A 2HPZA 2OO3A 3EMKA 3TLJA 3ZXXA 3BREA 1ZXBA 1TYBE 1L7QA 3LHSA 2ZLBA 4HNHA 3ROXA 4F04A 1YKGA 1MENA 2NNLD 2ZT6A 2HT1A 3S81A 1FK8A 1GL6A 4EYEA 2VCYA 1AKWA 5KPJA 4MVJA 1E2DA 2FKNA 2Z8XA 3K8OE 5F9MA 4W5QA 4OHYA 4HMOA 3AHCA 1L4LA 2Q1YA 3EEYA 3KXPA 3Q3CA 3GGDA 3BTVA 4NS4A 5BVHA 2QP4A 5L6LB 4WDQA 2WJYA 5ES4B 1JFFB 3ACBA 3A25A 5CXXA 3C98A 2V7BA 1GLVA 1GG5A 3B48A 3LRTA 3OEEA 4IFBA 5FBWB 3LUKA 4PQGA 5HMMA 2VJDA 4B1FA 1CEEA 2XUOA 4P3OA 2VQFB 1D2EA 2ORED 3QELA 1S02A 4MTLA 4RIFA 3M6WA 1QOQB 5IXJA 3Q87B 1MORA 1RZUA 1PTJA 1GZ7A 1W8IA 4IUBS 4UBJA 1MH9A 3U16A 5JD5A 1DJOA 2XRFA 1J2YA 4IR7A 3BZBA 2IUUA 1YDEA 5A1TA 5EJ2A 1DELA 3UHOA 3IBYA 5IP5A 4MV5A 3TLZA 4M54A 2B35A 4FGRA 4G97A 3KJQA 1WKBA 2K2QB 2IOQA 2WMYA 2XE4A 3A4IA 4IF4A 5IUKC 2D2VA 4KYUA 4U7GA 1N1EA 2BDUA 2CJPA 4DEYA 1LF0A 1Q83A 3DOFA 1KORA 1ENZA 3OOYA 1DQPA 3KPYA 4N7JA 4RORA 3WL5A 1N36B 3CH4B 2VTBB 3AL0C 4ZRMA 3MS4A 4QXRA 1Y63A 3G02A 3FOCA 1JU3A 2R1TA 4LNUA 3DA8A 2X7JA 4JA2A 1P1FA 2EL7A 4RTQA 3DD5A 2J9YB 1XXHB 4IJMA 5COBA 1LTQA 3RKUA 1WKCA 1I2ZA 1R0ZA 2GD6A 3W6NA 3HXOA 1PT6A 1THZA 1EYZA 4NZPA 2V65A 5BWWA 3FTNA 4Z9YA 1CJTC 3IVXA 5AOCA 1DO8A 2XHZA 4N4AA 1V1RB 5F33A 2E5LB 3DKVA 5A4KA 1JIJA 1M66A 3NDPA 2E55A 4KMRA 5FYDA 1Q6YA 3P9ZA 2VBCA 2JH8A 1GCAA 2Q3CA 2QR5A 3HU2A 3QVVA 4DQKA 5B4VA 4IMPA 4WXHA 2VN8A 4MWDA 1NX9A 3B6ZA 1V9CA 2F00A 3IQDB 2LWIA 3EC7A 2Y0BA 4XVUA 2O3JA 2Z6VA 1OXKB 4FW9A 2YWHA 3ND9A 1TA9A 4D4GA 3L93A 2C98A 1I51A 4UNRA 3DB1A 2X0KA 4EMUA 2GLUA 5A9SA 5I9LA 4GOND 5CR5A 3R5SA 2J6CA 3P2OA 3OLQA 1KJQA 4M8LA 1WNTA 2DE0X 3B70A 3H2YA 4RIIA 3ZY4A 4PM4A 1JBKA 5DLEA 4FTWA 4GOLD 3UMJA 2C9YA 3AFOA 4TROA 1LDMA 1U0JA 3GNSA 4QFDA 1O4VA 4BLTA 1YQ9A 2WJIA 2X0DA 4RHEA 5TVGA 4A82A 2WE8A 3GT3A 1G8YA 3R0XA 3GWGA 4QBGB 4PZ9A 1IBMB 2ZZKA 5L53A 2Q4EA 4J03A 1LS1A 2QZ9A 2XDAA 4C9BA 3TOSA 2EIHA 4Q9AA 3F78A 2ZCJA 2B1JA 1HT2E 2B4QA 2PH5A 3B7GA 3RVMA 5JS1A 4OAPA 1QV9A 1HGXA 1QYIA 1E3TA 4R6WA 3ZCRA 4CLOB 4RMNA 3W3AH 4LGMA 5IUNC 5KKNB 2FSVA 2OTCA 3CS3A 3HWSA 1RWXA 4HNUA 3ZZTA 4E3WA 1VGQA 2AMFA 3M34A 2PFSA 1S1CA 4LOHA 4EWLA 1MX1A 3KQTA 1D9ZA 4FZJA 3FYHA 3LT1A 5JAPA 4XOIA 3IP5A 3M6XA 4EHLA 3GCZA 1YA8A 3M5WA 3OE4A 4RGVA 5HFJA 3F6EX 2HLDD 1IUOA 1Y6FA 1E92A 5ELMA 4TTTS 5B5SA 2FV8A 3B1VA 2V97A 1AKEA 3KYCA 5KVAA 4TMYA 3EXG2 2P3SA 3ZE7A 3G2IA 1V3UA 2B99A 4C3OB 1VFPA 4Q01A 4C7MA 5C8DA 1Z6AA 1AKMA 2GRUA 3DWGA 1RFLA 4DV1B 2QI9F 2QNIA 4YRIA 5K09A 3WMEA 4IX9A 1XCPA 4FXOA 4ISBA 3OWHA 3ROGA 4B9AA 2HBYA 3DE6X 3VR1A 4LYFA 2QWXA 3O2JA 2X76A 3MWKA 1LK0A 2IOFA 3OP1A 5D1PA 5KVSA 3BXGA 4CTNA 4Z9AA 3CBQA 3E1KA 1X8XA 3KLOA 3RSCA 5I3ZA 1HF3A 2HKIA 4ND5A 2QX4A 1SC4A 3W5HA 3CLTC 5G0WA 3LECA 5BWOA 4H3KB 3RS0A 2RJ3A 4JAVC 1ZA2A 1Q7EA 1OIXA 1AUPA 2MYTA 2OXFA 3O9MA 1MOZA 4EI8A 3ZLJA 5EA2A 2PSJA 2QJFA 3WB0A 3X3HA 1A8IA 4MW7A 1O4WA 3NOOA 3BWCA 1RP1A 3I39X 1THGA 2GAIA 2J3QA 2RSLA 4KACA 4XOUA 2GPSA 1LFDB 1ZO8A 2B82A 1VI6A 3G2HA 3C4JA 3ITEA 1TIBA 4CV3A 3B2EA 4K8OA 4WQMA 1O6GA 3U7GA 1X92A 1UKZA 4EB0A 1VGRA 4DUZB 1R8JA 3PWKA 2EVWX 4CETA 5IPFA 2A9VA 4JROA 1RS0A 4WN9B 1ZDMA 4RJTA 3MWYW 3PE6A 4RVSA 3KAKA 1AKRA 4FYHA 4ZT5A 5CUQA 5KUTA 4MS4A 2JFOA 1TM4E 2EJUA 3DT9A 3M9WA 5B2ZA 5B12A 4L95C 2HU2A 2BKVA 5LP6A 1OX4B 4I81A 4XW2A 1F51E 3CX4A 3B1ZA 2OFWA 4F4CA 3ZWAA 2XT6A 1G6KA 2ODNA 1RRKA 3IO3A 3JVDA 1TM3E 1T6BY 3IQIX 1C7IA 4N82A 1H2FA 5K8UA 2H5EA 5CM2Z 5E6SA 1LU9A 3UMRA 2COKA 3KWLA 4RGQA 4BRSA 3OQJA 2QX7A 4XUCA 1MQAA 1KAEA 3A1DA 3GNTA 3TY8A 3H8VA 4PZZA 4Q39A 5AKIA 3U3JA 1UKAA 4DMMA 1PYDA 2XE6A 3H4VA 3WYFA 4IGFA 3GLHE 2YYYA 3C5VA 4JJ4A 5FOSA 1M1UA 1VJCA 4EH1A 1S8FA 3AUAA 4KK3A 4WK2B 4A0HA 1D1SA 3PXCX 5MN6A 1H05A 3HLTA 3FHTA 2A5GA 2JGMA 3KVNA 5F64A 1YS9A 1EFDN 3CB4A 1U0TA 2WAMA 4B45A 5E1MA 2P62A 3HBJA 1OV4A 3WGYA 1VBMA 5B4UA 4DV7B 3F90A 4G56A 1T8PA 4P3KA 3SY8A 4FHZA 1LW7A 4GI7A 4PAGA 1MPXA 2AN5A 1NW6A 3LQRA 1ORRA 4TXNA 2EWMA 3H8SA 3QRWA 1NT2A 1J5XA 1Z29A 4WNYA 4D41A 3ZW8A 1KQ3A 4INZA 4ZZ3A 2WJAA 4BWVA 3AB3A 1Q5PA 3KQOA 5JDIC 2JA1A 1NLUA 3F8WA 2I6UA 3VI3B 1CUBA 1PR2A 1ZJ5A 5KHAA 3VUFA 4F1JA 3HNOA 5K3SA 1V8OA 2VDJA 3W4IA 4G8CA 4LYAA 1T5HX 1IPFA 1J0BA 1REQB 1USIA 3I58A 4PXAA 3U3DA 3V33A 4E70A 5BWCA 5EIEA 4QOEA 5KREA 2EFHB 5GQSA 1EFAA 3F7OA 3ZZUA 4H16A 5CX4A 4WJLA 3I62A 3D1LA 3USES 2VAVA 5HRUA 1O54A 5IRCD 2I87A 1CJCA 3V8QA 2PBFA 1ZMBA 3GFVA 5IJ9B 2HHJA 3HGMA 1BOOA 3RKSA 1YRAA 3WQQA 1SKUA 4IMRA 1OPXA 4DV6B 5BRAA 3OECA 5AK0A 1GP2A 1TJ3A 1X1TA 5LD2C 1OHHA 2P69A 5IK2A 3OKFA 4WCFC 1I6WA 2O3QA 4OB6A 3W1WA 2DH6A 3S5JA 5ELLA 2DT5A 3DMTA 3KYDB 1EA5A 3OH8A 3L9XA 3GUUA 3VVCA 4UDYX 1CETA 4BLPA 1QORA 1IJKA 2BBTA 2CMKA 1BGXT 3OBBA 3A9SA 2JJ2A 3OY7A 4HQKA 1UBEA 3OQIA 4ZEMA 3R8FA 3TSCA 3QP9A 4X92A 1JE0A 2VUTA 1VYTA 4ALNA 1MAHA 2INGX 2J41A 5CNIA 1A9QA 2NVOA 4IAOA 4KR9A 5B1YA 2FWRA 1RJ9A 3LHIA 1VI2A 2UVPB 4DL9A 4R1PA 2SNIE 4V38A 1JT2A 1T1SA 1U8XX 1QKJA 3VV3A 4GPAA 4ZKDA 5GPBA 1GPWB 3BMCB 4G5QA 2J9FA 3NBXX 3T7IA 4MI9A 3ZXYA 4B6SA 1G2PA 3ZBTA 4I1UA 1HYEA 4J8PA 3JU3A 5D5PA 3GJXC 2QD5A 3TOCA 2ZI4A 3A1UA 3WGZA 4WOBA 3HO8A 1ZUIA 4FMCF 2EHDA 2O06A 4KOEC 1Q15A 1Y1TA 3EFOB 4D4LA 2D3WA 1P5HA 3K0FA 5FPYA 2IHJA 1QP4A 5JI2E 4YJ2A 1KP9A 3FOWA 3J7AC 2FQXA 1HDGO 1M0WA 1SXHA 1E9DA 1SU7A 3SQMA 5KQLA 4PLTA 4LF9B 3NDBB 4HXGA 4V0OA 3MYYA 3QEAZ 4XASA 1IM2A 1H2RS 3G68A 3VH4A 1C9NA 1H2EA 5AD1A 3UQ8A 2B8WA 4KVFA 3SXJA 3Q8KA 2H54A 2MDTA 3K9LA 4DM7A 1NKVA 1E9CA 2JBHA 2JCGA 2Q2OA 1QP7A 1JHMA 1ONBA 1QS0A 3HV0A 4XDGA 4CW7A 2XIQA 2CDRA 4LCJA 1A8QA 2C0CA 4NFYA 5BN4B 4QUGA 2IEDA 4IDCA 4R3NA 4NBWA 4IQGA 5CH8A 2C82A 5JI3E 1K5HA 4CBVA 2DPGA 2Y6VA 4NFSA 1OSNA 1VLQA 3EEIA 4PSUA 4R9NA 4QJ4A 4WNAA 3UJ9A 5BWNA 4B3SB 5I5GA 1YR6A 4H18A 4O2BB 2UVDA 1EQUA 4HDNB 1WHSB 1SVUA 5DSTA 4LNAA 3HXLA 2JASA 5LLTA 4NH4A 4BDSA 2RAPA 3ZCXA 5LBUA 2RH8A 3M5PA 4AUMA 1ZUNB 1Z26A 3I6ZA 5KSPA 1JI0A 1BGVA 1N6IA 1PWYE 2E48A 2V6FA 2C99A 3JYLA 3OFND 4GUAA 4IJWA 4EJSC 5BSUA 5IF9A 4AD8A 2PX6A 4REOA 2XF2A 4EHAA 2OMEA 4CMKA 5JDCC 3QVLA 3KOOA 1E1RD 2DQYA 3C5WP 5AM0A 3U40A 1XXLA 3KZMA 1FUKA 3E0XA 3QK7A 1CZHA 1IFXA 2C1ZA 3C5HA 4G0XA 1IWBB 4XWKA 3AF6A 4RA6B 1JMVA 3KJZA 4V2IA 5K3WA 2GVNA 3DBHB 1JEQB 1XTTA 2G4CA 2KYRA 1OLSA 1QHNA 2Q8QA 4RQTA 1DNPA 1K5PA 1XRNA 1PZGA 3KB6A 5HIAA 4TSKA 3PQ5A 1FUUA 1E9SA 2OBXA 3EDCA 4Q9KA 3GW8A 3SDZA 2Z95A 1QFYA 1OGIA 2BFFB 1YAJA 3E9ZA 1NJ1A 3BHNA 4CDGA 1TU0A 4DPLA 2UUCB 4OI0A 3ICQB 2HMVA 3TZEA 2QAGC 4HN9A 4MO2A 1K9VF 2XNHA 4YAEA 4QM6A 2PJDA 5F7JA 1XQ1A 2C4HA 1OX6A 1V48A 3OU6A 5EHGA 5HZMA 3SC4A 3H42B 3UCEA 2QM8A 3EVBA 2WJ3A 3PRHA 3D8SA 4YAJB 1JTFA 2SCUB 1C4XA 1BA2A 1G8FA 3CRZA 1NFRA 2DF8A 3F98A 4PW0A 1R9NA 1JG7A 3BC1A 3JWGA 2A88A 2PSEA 4IICA 3I6MA 4RKEA 4CMGA 5JC1A 1P4HA 4D5GA 2V3WA 4K9SA 3U4DA 4AICA 4ZI7F 4MEBA 2ZBVA 4YDHB 2GVDC 2ZJAA 3PHCA 4ZODA 2Q49A 3DFMA 4HAXA 5FHRA 3T5MA 2H1WA 3S1AB 5LB4A 5A7HA 5JE8A 1NBHA 2J1LA 2YHAA 2IU6A 2C29D 3TJZA 4ZGWA 4DA8A 3PUXA 3EARA 3ODGA 3RC7A 2P7IA 1NJFA 4XB6B 4M0FA 2ZANA 4TZKA 3I01A 3U3RA 3DQZA 4M9RA 4Q16A 1W76A 4GEGA 3WX0A 2A7XA 2ZRGA 3U3KA 1E2BA 1R7RA 5AVKA 4LG1A 1BMDA 1AF4A 2WZDA 2O48X 4G0YA 1H93A 3BRSA 4AIIA 3NJ8A 4OHWA 3TBHA 4YMTA 1T9GR 1U1FA 3OPNA 4IHJA 1H4QA 4JKYA 1L7PA 2LIVA 1HDEA 4FR0A 2EGUA 2IYLD 4DIEA 1KQPA 3BRWD 3Q6MA 2ZIUB 4JASB 4AF8A 4G07A 1DX6A 5L8VA 3PHJA 1OI2A 1M5RA 2ZUDA 4LXQA 3BXXA 2JGEA 3JX9A 4B7AA 1SELA 1YDHA 2G0TA 4OQDA 2FK7A 3L84A 3R5FA 2IGBA 2ZG6A 1AGRA 1FDVA 1SG9A 1X1EA 3LOUA 3M81A 4N03A 4U5XA 3UFBA 3R9XB 1ONPA 4YMSA 4Y30A 2VZLA 2QMHA 2NXCA 2YZNA 4JYCA 3CFYA 4HT3B 2HUNA 2P5YA 2P91A 1I4EB 4J6EA 1MO2A 4KFCA 4ZDKA 3UH1A 3RNOA 3CT6A 1G63A 5LXTB 2HGWA 1HG1A 1DWOA 1D6NA 1RQPA 2HXGA 3RYHA 5A3SA 3SGLA 1FMTA 2PLWA 4NENA 4RGBA 5JISA 1BFUA 1THMA 5HR5A 2BAGA 2J3IA 4K81B 3OEHA 4I4TB 1SQSA 2G06A 3C7DB 4D9HA 3RC8A 1DRJA 3EY9A 3U7QA 1QZTA 5BQ3A 2CJXA 4UUQA 4PS1A 3TINA 1FMCA 3BWVA 3IA2A 4AY6A 4F4HA 3SR4A 3N53A 3UJPA 2WF6A 2ZIEA 1MLDA 3CPEA 2XX3A 4K6KA 4BZPA 3KEOA 3KOXA 1FNNA 1UBNA 3AEUB 1DAKA 3B1JA 4DPKA 1PWZA 1CU1A 2C95A 2EL9A 4ZI3A 5JAZA 4AP9A 1PHPA 1AUVA 3C6XA 4X3PA 3W9SA 4JCCA 2P8JA 1VHDA 3OZSA 1DQNA 1GPYA 5EHXA 4I8IA 1OT3A 1T2VA 4MQBA 4O4LB 5JZVA 1EE1A 4G9EA 1M0TA 2COGA 1RYNA 1RXSA 2HH9A 1J0DA 3ETDA 1W73A 2FSVC 3FYCA 8ADHA 4JP3A 3MWEB 3JQDA 1TF5A 1XEXB 3IV6A 5J1SB 2WB4A 3BXFA 2PGJA 3RUEA 3UZUA 3ZNPA 2PX4A 3AUKA 1U2ZA 1EIZA 5AKGA 1BIFA 1DLJA 1QO0A 1T26A 1WIWA 2GPAA 4M46A 2DQKA 4GF5A 4E7PA 5H8WA 5CVCA 5DNWA 2ISSD 5EHNA 2I7TA 4EABA 5IWCA 3ABOB 1I2DA 1LUAA 4LZNA 3ELDA 4CMHA 4TTJA 4FHGA 3O8NA 1Z2PX 4LJYA 3P0JA 4DDHA 3N6VA 3REQA 5C37A 4MWTA 2IKSA 4PWZA 5FWYA 1P7VA 4Q3DA 3L8MA 2GERA 2W2VA 4WWHA 1O0CA 2YWVA 2Z58A 2Q07A 1SPBS 3LOPA 4JL6A 4GEKA 4DANA 3RGWS 2GYUA 4NNJA 1ZNQO 1XR3A 3OZXA 4KFRA 1AIPA 2BI7A 3G88A 3GQBA 4Y6SA 2A9QA 2JS7A 3NBFA 2QUAA 1QUFA 4BB6A 4KI0A 5JTTA 4E4RA 1BC5A 1A9RA 5JSKA 1GQRA 1YKFA 1KTIA 4MMZB 2FZ5A 3ETHA 2YWRA 3NBYC 4HLNA 4P6VF 3LCCA 3T9EA 4MV8A 3BGVA 4NL4H 5JYDA 4RTMA 2QR3A 1IK6A 4AKEA 2IYUA 2O8BA 2BHNA 3K8ZA 4Q3OA 3QBTA 1HMPA 1IG0A 4KKXB 1YC2A 2C1XA 1FYWA 1AV7A 1I3NA 1U6KA 1X8LA 2R1UA 4QAJA 3QFFA 4D80A 3NDJA 1QYVA 4GRAA 1IBSA 1DIOB 2Q21A 2HA5A 3BQNB 4W7HA 3ZDXB 1XWWA 4Q7QA 3GJ7A 2V55B 5LBTA 4ZEWA 5MFZA 2PDAA 5ALUA 4COKA 3EJWA 3LXRA 3JAMA 1JDEA 4ILKA 1Q0ZA 1IOZA 2R66A 2V7QA 4KXUA 2E87A 3AP1A 4GGMX 2R4TA 2SECE 4N0EA 4WZBA 3HJFA 3OT4A 2FG7C 2VCEA 3RWOA 1UEJA 1Z5ZA 5CVJA 3AG6A 1KO7A 1PJ2A 5DLDA 1B6GA 2H1OA 2HA7A 2PCLA 2YXNA 2CBGA 2GAFA 5A9RA 2KB0A 2GM9A 4L6IA 3RJ5A 1LV7A 4NU0A 3R1IA 3RE1A 3U17A 1G8JA 4FYWA 1XTBA 1KP3A 4AY5A 4MQMA 3D4OA 3A37A 3K8YA 4N3AA 5KTNA 4EY4A 2Q7OE 5K3FA 2TYSB 5LP6C 2I2WA 2JZOA 4QLBA 3TG2A 4JEHA 2WG0A 1SD2A 4JY7A 4OIMA 3AFGA 4RENA 4DG5A 2E9SA 1W94A 1A2KC 4JUAA 4M8NE 4MUJA 2YUTA 4WTOA 5LUAA 1CUSA 3FRJA 4LTDA 2YYSA 4LUCA 2ONZA 1RQRA 3WAJA 3E9YA 2ZPTX 3E05A 3HUTA 3IT2A 3WGVA 1NBMD 4UHKA 2FVYA 1CB0A 4U2GA 3HDVA 5LJLA 4R5MA 1EUCB 4TXMA 5FNVA 1MMFB 5KYGA 2A94A 1NY5A 4A92A 3L7JA 3FZQA 2O4CA 3BFVA 3TQTA 3QIAA 3HMKA 3T34A 1W2HA 2D2EA 2OLEA 3LF1A 2XNSA 1JAIA 1OBVA 1ONOA 3NEJA 3C5EA 4QGBA 2DC1A 1G5RA 1L5ZA 4B47A 5J59A 1IYDA 4R7TA 3CSSA 2OE2A 4KXFB 4DXHA 5FDFA 1FS5A 3V4FA 1G5TA 3W2TA 2WIKA 2ZUUA 4R84A 3WFJA 4DNFA 3T3OA 3HB4X 2A35A 3PLAE 4ICIA 3V4LA 2VS1A 6LDHA 2NUTA 4WACA 4O4HA 1EJ2A 3W7VA 1YJ8A 4ALLA 4FR5A 3FNHA 3FBWA 1SH7A 1XVLA 3H86A 3C8UA 3H9QA 3QM1A 4QYXA 1EDOA 5AXBA 4BC0A 3CONA 2X1LA 1X1QA 1YQUA 3SXUB 2HMUA 3KUDA 1Y37A 1Q1GA 2LW7A 1ENPA 2PMDA 4CFSA 3N76A 1WWKA 2PZJA 5KNDA 4DLWA 3KTAB 3SKXA 3DDOA 3F6SA 1I7LA 3MAAC 3DEAA 5C3UA 4C5AA 1Z8FA 2JFWA 3E3LA 4M1TA 1W0CA 3HFRA 1LX7A 3L6EA 5HKKD 5KTTA 3H0EA 3PUZA 4XD7D 2P4UA 5LYJA 3IEIA 4JVLA 4GX0A 4KBYA 1GLNA 1C7EA 3I6BA 4L50A 1XEWX 2KHZA 1BDBA 3AK4A 4G4SO 3VPFA 3II6X 4CDRA 2DWUA 2HV8A 1SBIA 1SVIA 2QNRA 3VBCA 4C30A 4UUBA 1NBEA 2J59A 4BKQA 5IT4A 3DMTC 2FDRA 2OAGA 1Z7GA 3ISVA 1MTOA 4E3ZA 4G8JA 3GK3A 3H2GA 4PO3X 5AK6A 3WL4A 4CIXA 4F6LA 3HJGA 3K9GA 4B43A 9GPBA 3U54A 2F55A 4C22A 4YXWD 2ESRA 2HMYB 1XVUA 3FH0A 4ZU6X 3GZNA 4J7XA 2UXDB 1MB2A 1E9RA 1TEVA 3R7WB 4UXHA 5IKPA 2HVRA 1LNQA 4RXUA 3V6LA 4RTNA 3F1KA 4R41A 2I6GA 3QPVA 4EOGA 2C7BA 4GRDA 5C9ZA 2L69A 2X4LA 3L0ZA 4MVYA 3UC9A 3B8HA 3ZU2A 4ND8A 5JH7A 1WMFA 4D9FA 1VYVA 3K94A 4W9RA 2HNKA 4W9MC 4XQ9A 1F4PA 2VDWA 1H1TA 3NBUA 4MI1A 3EWIA 3BGWA 1NMYA 4QQKA 4X8HA 4KE8A 2WT4A 4ECEA 1C3XA 1IHYA 1VSUA 4OA5A 5BN3B 4AY2A 2ZDHA 1JYSA 2VK2A 3ZJ4A 1Z13A 2V9PA 5A7GA 5FPRA 4NQRA 4BVGA 4F1WA 1PR6A 3VU8A 1RMYA 5C1OA 3BKXA 1EWYA 3H6HA 4EA7A 5TXGA 5ALNA 5KSZA 3T5AA 4DB4A 4L28A 3ZIAA 1HO3A 4DBLE 1GPAA 1XU7A 5CLQA 4P93A 4V0NA 1X7WA 1QIIA 2ZYWX 2H11A 3L41A 4RFSB 4BE9A 4UCOA 1V5WA 3L8DA 2C59A 1XTQA 4FN4A 4BCBA 4WBNB 2YJTD 4LXYA 2XOKD 1H2ZA 1G2IA 4PONA 4V1CA 5KNCH 1GNVA 5U1PA 1CV2A 1TD9A 4CIBA 4FFPA 2I6XA 4UUAA 3SVLA 5IT0A 3E5MA 1B6RA 4LF4B 4ABTA 4LJAA 5KEIA 3DULA 4M0KA 3L7YA 1JDPA 3IAAA 3JQAD 4GOMD 1E18A 3KJFA 5BWMA 2VDQB 5IW8A 2VHYA 3DHYA 3SQLA 4OHXA 3SBEA 1F20A 2FLWA 2W43A 5G1NA 5B3KA 1G5PA 3K6SA 1Y8RB 3CLKA 1R0KA 1H5NA 4LBVA 2KMLA 1LQTA 3HM9A 2ZSIA 2WC1A 5EFOA 1C80A 3FPLA 4RM3A 1SC9A 3LUDA 5CJ2A 5J4LA 1XNRB 4QXQA 1ZRMA 1TADA 4K9OA 4RPIA 3COJA 4Q1AA 2R86A 1NPTO 1QAOA 1XEWY 1HE1C 4IDPA 4O5AA 5ECGC 3VO9A 4P3YA 2O7VA 4IQ8A 4OOFA 5DLYA 1Y3DE 1YDFA 4JX9A 3QTBA 1TZ2A 2O05A 4KWCA 5JRJA 1KO5A 5EXEA 1SBNE 3WGHA 1W88A 3NH9A 5BMVA 221PA 1CQPA 1RMQA 3CW8X 1KJJA 1OI7A 1XP8A 4MQ6A 4U7WA 2O1WA 3KOUA 2WUWE 4WN3A 4JI8B 1OXSC 2BCJQ 1BS2A 3QOXA 4R5HA 4AMGA 4MVCA 4KH1A 5F21A 3G2PA 3HH8A 4K46A 3SM9A 4ZOQI 1EI9A 3A70A 2F8TA 4BASA 3OJOA 4HTFA 4JR2A 3EXHA 3ZV3A 3P9XA 2IYYA 2O2JA 4JIMA 4QTXA 4C3ZA 3WIUA 4Q9LA 1R27A 3BBPA 2WY2D 3KQLA 3ECCA 1V0JA 5B3JA 1UZAA 1YR3A 1L7EA 2ZXFA 4YLGA 2B2XA 5DHQA 4GFDA 2J9RA 1EG7A 3SOPA 1CDDA 4M83A 2RHHA 1BYUA 1FBTA 5IBCA 5JFOA 1D4FA 1EFVA 3B2QA 5EVCA 3MT0A 4R9VA 7AT1A 1BOFA 3JYHA 4FXPA 5KYTA 1WO8A 3F7NA 3RVSA 1GYQA 1WB5A 3HZHA 4ENVA 5TPZA 1ZH6A 2QM7A 3AJ9A 1RKXA 3TQQA 1CRQA 3C70A 4EFBA 3U39A 4E5SA 2HFJA 1QGYA 4IVRA 1RI1A 1II0A 3ABZA 2AXPA 5DNYB 4ESEA 3V42A 4IQ4A 3ZCVA 3F8TA 4TQ9A 1L4UA 1R4MB 4EMBA 4N3CA 1YACA 3TZCA 6YASA 1I1LA 3AUXA 1HOXA 3BTOA 1DAHA 5EP4A 4DPMA 5BVGA 1JFSA 3EMBA 2A0WA 1KR5A 3FLAA 3SZ3A 4IDEA 2W6IA 2C4TA 1TJ4A 2NYRA 3CRVA 4LWPA 1VL5A 3JQ6A 4BUJA 3RK0A 3TECE 1ZCJA 4LXXA 4HH0A 2CE2X 4LKRA 4DA6A 1WB4A 4BJ5A 2NG1A 1KI6A 1KDVA 1TZMA 1IB0A 4OBWA 3RVPA 1AQ6A 5GJCA 1CRZA 2FPRA 3MCWA 3QE3A 3H6KA 3EGXB 4O1MA 1P4GA 1V5IA 2C96A 3PQ6A 3E9DA 5EI5A 3TSOA 2O0HA 1WUTA 4K6HA 4KU4A 1E1KA 4GKAA 4YO8A 3DQQA 4EAAA 1UANA 2H1VA 1W4BA 4MYHA 1MF7A 3G1UA 4GZLA 3BE8A 4IEIA 1GV0A 3AF0A 2GD0A 5CA1B 2K5UA 2AC4A 2DAAA 4H35A 1KI1A 1U8EA 5E2AA 1DRVA 1EG2A 1F2UA 1I9CA 2VUHB 2O1EA 1ZITA 3R6DA 2B37A 4PPFA 1N2IA 2JK0A 1M0SA 3GRKA 5EJFA 2C4MA 4QULA 5BWTA 3I9MA 1EVJA 1Y1RA 2C9MA 4MV9A 1B3RA 1W96A 2AW5A 2QLMA 3F4BA 1M5TA 2WTBA 1G20E 4G3XA 2LGJA 4JIGA 4R2HA 4X00A 3GP8A 5SY6A 1WG8A 4HO1X 3DE7X 1SIWA 5LQKA 3T9AA 1CULC 4G65A 1XTKA 4CMIA 1B2LA 1K68A 1B4DA 1BCRA 2FZEA 2CK3D 4KX5A 4KN8A 4HI0E 1DBQA 3GAZA 5MHTA 1CUYA 1Y82A 1EM6A 3Q8WA 3AU8A 1GKKA 4ND3A 2L42A 2PVPA 3VDXA 4HNRA 4CLRA 1TLTA 1B04A 1J07A 2J3KA 2ZIAA 2FRXA 3GYGA 2XDQA 4EPRA 2Z3WA 3R5HA 4O2BF 1KQNA 1NM5C 2NO6A 1XZQA 1TUBB 1LLFA 3H9GA 2ZUBA 3TNLA 4Y2JA 2JGIA 5DMHA 3PJEA 4ZXFA 4IX1A 3A31A 4TV8A 1A0GA 1CNEA 2Z0MA 4D9BA 1L7AA 1XDWA 1QKIA 3E23A 3HVJA 3BFPA 3IVCA 4G1UC 3OUTA 4CLHA 1SUIA 2DHQA 1EHCA 4GWLA 1T29A 4MSUA 4UNIA 2TMDA 5AJYA 1Z0FA 2I33A 1IMOA 4HP8A 3C6KA 3HJCA 5I9TA 2JGRA 5T6BA 3UK6A 1CIPA 3WGTA 5HJ7A 2GZ2A 3DVQX 4JT9A 4KAJA 3VKGA 4QGGA 3Q9SA 4GLFA 2XZPA 2HWYA 2QTGA 3GGOA 4BFUA 4GNRA 5CYGA 4B74A 4DREA 1F0PA 4XUDA 2WWYA 3DE0X 1IH8A 1RHKA 1XI2A 3GDFA 4UM5A 5KYYA 2Z3ZA 3FDJA 1V45E 5JBQA 2C9OA 1RXEA 3ZWDA 2IZ6A 2ZBPA 3UJ7A 4RZUA 3M7IA 4CEHB 4AJKA 4MJ7A 3D4PA 4OM8A 1I1MA 4L1KA 3JAKA 4O1IA 5DISB 3FF4A 5A2QA 1TFUA 4JLSA 5HXAA 2NWQA 3ZD9A 1GAJA 1S2LA 4KE6A 2BKXA 1XTSA 4QM7A 3FETA 3B9QA 3K35A 2CMFA 1USUA 2GMWA 1E1DA 1GQYA 1RBZA 1XZDA 2D4AA 4TQGA 4KUHA 2NPOA 5KMGB 2OK7A 2WJPA 1HK7A 3IIEA 4QUJA 3AESB 1RXCA 3R41A 3A7DA 1DVRA 1H0SA 4I9GA 1GCOA 3TAXA 2RC5A 1B23P 3TGPA 1TO1E 5FBHA 5CIYA 1C1YA 2QYHA 4IDGA 1QHGA 4TZTA 4BJ1A 3GDGA 1LA2A 3GBPA 4B3FX 3I1IA 4D2IA 5L7TA 3I64A 5ICCA 2YYAA 2OYSA 2VOJA 5CIWA 5AIBA 1QG6A 1ZUWA 3WIVA 3RM3A 4LV5B 4CQLB 1RXVA 4PG7A 4IIJB 3MUFA 1FTGA 1XYGA 3PGA1 3L2OB 4YBZA 1KA9H 1SUAA 4UEWA 1G9SA 3SHVA 2YJZA 1G19A 2BDTA 1UT8A 3C3AA 5BSVA 2J30A 2GD1O 1FX0A 1RYYA 3AWIA 3ZHBA 3WS7A 2ZE6A 5AVXA 1A96A 1DOZA 3F2VA 2XQKA 5J2TB 1YRQA 2BEVA 2R60A 3FUVA 1JDSA 3B7PA 2QBYA 3KFLA 1AGYA 1UMDB 2VBGA 5EZSA 3OAAD 2P9FA 4KO2S 5AH0A 2C2KA 1BE6A 4UTNA 2Q4OA 1ZN7A 2WDZA 3I09A 4FDAA 2IY8A 3IUQA 4RC9A 4YTEA 3ZYCA 4BNTA 4I99A 3JARB 3S6JA 3STVA 4GKJB 2P2CA 1JLSA 2QN8A 3AUJB 4B4KA 1I36A 1ZVJA 3CCBA 3SZLA 4YAGA 1NNSA 1YONA 4ZOLB 4D3SA 3EEOA 5ILQA 3QX3A 3ZS8A 4BUCA 1HE2A 3KLBA 5GVRA 4YRTA 3H84A 2IX9A 2IYAA 4DDUA 1DGQA 3BCSA 2OMKA 1TVKA 4QPPA 3D8TA 4R2MA 4FE4A 4RIHA 5JS2A 3BJEA 3U49A 4A6XA 4J3JA 1DG9A 4YGYA 2VHVA 3GF4A 3RANA 2QN1A 3I0NA 3ZTWA 5JROA 1CUUA 1QIDA 2PL9A 1Z2AA 3DOCA 4HATA 2AN9A 1Y7IA 5LXTF 2QL9A 5EPUA 3TH5A 1BFKA 2EQAA 1O0SA 1SEPA 1UKCA 4IJKA 1TTQB 1MC4A 1ZZGA 1CQJB 1NF3A 2D4HA 2HCRA 4MAAA 4UM9D 4EJ0A 3P0HA 1E1CA 3DAYA 4I4TF 1XALA 3KCQA 3S8MA 3V2HA 5IEBA 3HXPA 4UEOA 5FIUA 1UK7A 1JQKA 1P6QA 2RAVA 4MRRA 1UM9A 3DBLB 1VJTA 2DXIA 1RACA 3FVQA 1O1YA 2AHOA 3OQPA 1M34B 2J08A 1I2AA 2RHGB 3BB1A 3BXEA 4IRXA 1M1YA 2RGYA 2A1TR 4MB6A 1WZIA 1M1XB 5HK8A 3CHYA 1Z15A 4JLNA 1EK5A 2HB6A 3TMAA 4O4LF 2OO5A 3R0VA 1YTUA 4BNDB 2REXB 3IPYA 2YNMD 1RBMA 2EFDB 2WNSA 2X0NA 3OEWA 3IEPA 4OXKA 3I8SA 1LJUA 4R1SA 4BATA 2DQSA 5D86A 5FV4A 1KO1A 3MS2A 3UB4A 3CEMA 4D81A 3M1LA 4CM5A 4ITUA 2ZQYA 4Y6LA 3GLGA 3ITDA 3O8BA 5DOVA 1JSZA 1AJEA 1Y9ZA 2AEJA 3VR6A 4YHBA 1NQ5A 1T4CA 2FUNB 2JCVA 3AVWA 2DJIA 2KJQA 4XZ3B 1YTLA 2FZWA 3NRCA 4OQQA 2OLSA 4HGPA 2YVKA 2ILTA 1BDIA 2H1LA 3UUEA 3GNLA 3HKDB 1GQSA 2A33A 3T5GA 2HHCA 2FJUA 1ORDA 4Z4QA 4FM9A 4HFJA 4I9UA 2CYBA 4XUGB 3C8ZA 2AEEA 2ARKA 2VPQA 1XEAA 2O57A 2H85A 2QTLA 1CRWG 1P5FA 3KKZA 2ZJ2A 3KVOA 3NRBA 4ZAFA 1PNRA 3AR5A 3M6FA 2F8SA 5T7BA 2QUJA 3M6UA 4NBLA 4RSGA 4CT5A 3PTAA 4XQEA 4DLRA 1XFDA 1U7HA 2IEGA 1DC4A 2BEUB 1DDIA 2ZDQA 2WHQA 5DBGA 3OPVA 2GARA 2DPLA 2V3CC 4LNHA 2H1FA 1L4BA 2ZK7A 1M2GA 3OCVA 4N48A 1A48A 1OFVA 4H7JA 4MLPA 3RFTA 2ZI7A 4TL6A 4UATA 3STWA 4CG3A 3VR5A 1S2DA 2EQBA 4L9SA 3GN1A 1YJAA 4DWVA 4K0RA 1UPFA 1V1JA 4J2HA 5K8TA 1VKZA 1P29A 2PUWA 4RJKA