3PFSA

Pwwp domain of human bromodomain and phd finger-containing protein 3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
b'GRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain and PHD finger-containing protein 3
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pfsA00
3NTIA 3OYMA 3L42A 3QBYA 2RI2A 3DB4A 5C0MA 3S3OA 3OYNA 2GFUA 2K3XA 2LRQA 3FEOA 3EAEA 4L59A 4PL6A 3PFSA 3S3MA 2RI5A 4E7JA 3META 4C5IA 2X4WA 2K3YA 4NS5A 1OI1A 4IKFA 4Z02A 4BACA 3OQ5A 3MEWA 5D6XA 2RI3A 4BDYA 4Q5WA 3OA6A 2EQMA 3PMIA 5D6WA 4IUTA 1OYXA 4UC4A 3OYFA 4E7KA 3BDLA 4A4EA 1WGSA 1H3ZA 1SSFA 3MEUA 3MP8A 5KCOA 2XDPA 1OZ3A 3PNWC 3MO8A 3OYJA 1OZ2A 2M1HA 4LD6A 2F5KA 1XNIA 2O4XB 3C4SA 4PLLA 4II1A 3CEYA 2L3RA 3QKJA 4BDZA 2D9TA 3FLGA 2MWOA 3LLRA 3ME9A 3OYLA 5KH6A 3NTKA 3E9FA 3QIIA 3QJ6A 4A4GA 4C5EA 5M9OA 4BD3A 3L2QA 4ZTJA 4N4IA 2DIQA 2RHXA 4GY5A 2XK0A 2PQWA 2R5AA 4EDUA 4QQ6A 2X35A 2P0KA 4QW2A 2WACA 2X4XA 2RHYA 2YRVA 1MHNA 3MEVA 4N4GA 3OYBA 2JTFA 4B9WA 2DIGA 4E7HA 2NLUA 2VYTA 4E7LA 5IAYA 4BE1A 3GOXA 4QQGA 5FRMA 3P8HA 2LTOA 3ASKA 3OS2A 2EFIA 5FRNA 2EQUA 3ZEHA 3LX7A 2QQSA 3OMGA 2LVMA 4A4HA 2JZ2A 1WJQA 2EQJA 3OS0A 3O8VA 2HQXA 4QVZA 2G3RA 3UWNA 3OYEA 2LCCA 3M9QA 2R5MA 4IUQA 2B8AA 4FU6A 5J26A 3OYGA 2GFAA 4OVAA 4BE0A 3H8ZA 3DLMA 1RI0A 2L8DA 2RO0A 4HCZA 4PLIA 3LH0A 3SD4A 2R58A 3LGLA 3L2VA 4C5HA 4IURA 5CIUA 2L89A 3MP1A 3MP6A 2EQKA 2QQRA 2DAQA 5J39A 2MWPA 2BKDN 2E6NA 1KHCA 2BUDA 3E9GA 3L2UA 3L2RA 2BIVA 2M16A 3PMTA 4QQDA 3UT1A 2HQEA 1WJSA 2RJDA 3MEAA 2RHIA 5FROA 5KE2A 3OYAA 2LDMA 3OYHA 4E7IA 2EKOA 5D6YA 3OY9A 3OYDA 2O4XA 4RG2A 3H6ZA 3NTHA 3OS1A 2FHDA 2IG0A 2RHZA 4ZTFA 2RJCA 1N27A 2M0OA 3P8DA 3FC3A 2GF7A 4IUPA 4N4HA 2X4YA 4C5GA 3Q1JA 2E5QA 4FL6A 4IUVA 2RJFA 3OYCA 3OYKA 3LGFA 4IUUA 1WJRA 5IN1A 3OB9A 3L2WA 3LYIA 3OMCA 5C6SA 4BE2A 1G5VA 5KCHA 3F70A 3FDRA 2RHUA 3DB3A 3S3NA 3OYIA 4A4FA 2CKKA 2R57A 3S6WA 4CRIA 2RJEA 4X34A 4B9XA 3KUFA 5KE3A
chains in the Genus database with same CATH superfamily
3OYMA 2AZSA 3UF4A 3FEOA 2LRQA 1S72A 1N8RR 1N9SA 1VQ5T 4C8QD 4XU1A 1VQMQ 4FYWB 3VYGA 4AMCA 1RAGB 2ZGWA 5GMKj 3PNWC 1ZUUA 1R0CB 2A0FB 4BB7A 1NZ9A 3UA6A 2M9UA 3HSBA 2VASA 5GMKm 4M78F 3ME9A 2WSFE 2CDTA 1F1BB 2YUQA 2XD0A 3CD6Q 1RAFB 2F2VA 4ESRA 1VQKA 1QVGA 4LDWA 1GRIA 2JTFA 3PTAA 1B34A 3SWNA 2QDLA 4BE1A 5CKEA 3KXTA 3GLXA 5IXFA 1Q81C 4M4ZA 4QQGA 5I21A 4JRKA 4PJJA 1SRMA 3I55A 3GP8A 1VQMA 4RCCA 4M7AE 3GBQA 2CP2A 4M78C 4HCCA 3H9NA 3P8BB 2CSIA 3RKWA 1JJ2A 3AT1B 2GFAA 3CC7Q 3LGLA 1RAIB 4XU0A 1RABB 3X24B 2A36A 2MWPA 2J6FA 2LT4A 3CD6A 2K2VA 3PMTA 2KSSA 3OYAA 2KVQG 1Q7YC 1K8AR 2IVWA 2X3XD 1NG2A 2Y90A 2LDMA 4ZN3A 2I0NA 1M5Q1 3NTHA 4C0DB 1KQSP 2RQWA 4TVRA 4AFZC 3MJXA 2JT4A 5CQXA 2XIDA 1JQQA 3OYCA 3LGFA 2O31A 4PJMA 3EGDB 3CCRQ 2Z0WA 4RTWA 1KFZA 1G3WA 2KGTA 2RNAA 1E6GA 1JXMA 2M0YA 2KRMA 2RI5A 4JDSA 1VQ5Q 4M77B 1ZUYA 2DTOA 2DJZA 1PKSA 2KY9A 4ATOA 3D7SB 1M1GA 2M02A 5FU7B 5ECAA 4AFQC 4KT0E 3C4SA 1NJIC 3BY7A 2QYZA 3SHWA 4JRPA 3CC4Q 1HK9A 5FLXE 4XU3A 1TU0B 5GAMg 5CR2A 4NOYA 3E2UA 4EIKA 4X9CA 2DIQA 2LMJA 4ZNXA 5L8RE 2DXTA 1G83A 2VXFA 2X4XA 4E2FB 2YRVA 2NLUA 4QKUA 1VQ5A 2D6FA 1KD1C 2FPDA 1VQLT 2XMFA 1JU5C 3JV3A 5CO7A 2NUPA 4PJOF 3QPHA 4J9DA 5KYYA 3WVDB 4OGEA 3PE0A 3VS6A 3CCLQ 3JAME 2L3QA 4C8QF 4XU2A 2QGGA 2V1RA 1GFCA 1M90U 1M3BA 1I8FA 1RAEB 3A8LB 1Y71A 5KE2A 2M51A 1Q86R 5GAOr 2XU8A 5GAMj 3H6ZA 4M77G 5GMKl 1O75A 1AEYA 4ZTFA 4PNOA 3FC3A 2LJ0A 4J9GA 4QVDA 1NLOC 2X4YA 3CPWS 4RTUA 3QDRB 1KSWA 1AWWA 4C8QC 1N8RC 1OQKA 3FB9A 3DKMA 2O01E 1WA7A 2R57A 4CRIA 4ME7A 4FM4B 1RADB 2GFUA 2YRCA 3PFSA 1VQ7T 3S3MA 4RTXA 5GAN2 5GAN4 1XQHA 3VS7A 3A8HB 2QEXT 3OQ5A 2DE0X 1NM7A 2OI3A 1X75C 5GAMd 1U06A 1UB4A 1YI2T 2O88A 3CPFA 3EFSA 3REAB 5CCAA 2A28A 2EQIA 1VQOQ 1M1FA 1I81A 4GLKA 3I5RA 5LJ5h 1Q82R 2KRNA 4Y28E 1SPKA 1C0MA 4QW2A 2WACA 3EHQA 2EAYA 2YSQA 2HNIA 2LCLA 5CVIA 2KT8A 2GCXA 1I1JA 2CT4A 2RK1A 4PJNA 1QKWA 3M59A 1J3TA 2XKOC 3JRZA 1MGQA 1ZSZB 4EMKA 1Y96A 1K1ZA 1AZGB 4JJNK 4JPBW 1VQLQ 1Z9QA 1TUCA 2LVMA 3J7AF 4PKCC 3CPWA 1VQOA 1X01A 4BE0A 1RI0A 5IHKA 2XDBA 3UATA 1K8AC 3GF5A 2SEMA 2ZPIB 1NEGA 2B86A 1AWJA 1Z9ZA 2FL7A 3MP6A 3GPLA 2P4RA 2FRYA 2KE9A 3CBPA 3E9GA 2M16A 4QQDA 4F17A 2DTHA 3OY9A 1N5ZA 1BYMA 1IO6A 1PRMC 2H3JA 3VS5A 7AT1B 1WPYA 4N4HA 2C06A 1VQLA 5IN1A 5GAN6 1PKTA 2KQWA 2C0IA 1IB8A 3OBYA 3OYIA 4EMHA 3ZL7C 4AG2C 1D1BA 4FSXA 1YIJT 2C0TA 2E70A 5LJ5e 3FIFA 1VQ7Q 2E12A 4C5IA 5IHIA 2K3YA 2MAMA 2HAXA 4C92A 2V1QA 1B34B 3SWNB 4DEYA 2HSPA 1YI2Q 3OYFA 1M8VA 3BDLA 2ZZDA 4LD9K 4AT1B 1VQ6Q 3PVLA 2YXYA 1MV0B 2QQ9A 4LN2A 1Y57A 3OSSC 4LUDA 5CKHA 2YHTA 4M77D 4DBFA 1YJ9T 5I2MA 1BB9A 1FMVA 4AFUC 4RUGA 4QQ6A 2X35A 1K9MC 1VQ8T 3EG2A 3MPUB 5GANg 3EFRA 2JS0A 1VQPT 2DIGA 3OBWA 1IRXA 2DD4A 1VQ7A 3GOXA 2CH4W 1I0CA 1RI9A 4IIOA 2MF2A 1YI2A 2MCNA 2A7YA 2K4YA 2VWFA 4XTZA 3HRSA 4OMLA 1NPRA 2LCCA 4A63B 2VC8A 3X28B 1LJOA 4E7ZA 4PLIA 1Q86C 5HY6A 3I56Q 4L5GA 2O9SA 2KYBA 2KBTA 4XQ3A 2W10A 4L6V5 4MZTA 2E4HA 2L0AA 2CGHA 4GLMA 2VGMA 2JUFA 1PSFA 2OJ2A 3QZ5B 5FU6C 1TG0A 2GQVA 1B3QA 4ZGJB 1M27C 1KC8C 2E5QA 3EG9A 2K2MA 5GANj 2QI2A 1BI2A 3OMCA 1OU9A 1VYVA 2CUBA 1M8MA 4A4FA 1BIAA 4KUIA 2K57A 1K73U 1ZQ1A 2J7IA 4OMFB 4HKEA 3PIPA 2DXBA 2QQAA 3META 1B7TA 1M3CA 1PRLC 2DZCA 4C8QE 2HZYA 1OYXA 3QJYA 4RCBA 2Y4XA 2P84A 1GCQA 5KCOA 2DKGA 2O4XB 1BIBA 5GANd 1EX4A 2I2LA 2HKNA 2NUPB 3ER0A 5KYYB 1V29B 4DOWA 4YTLA 2F69A 1VQ8Q 3QWXX 1WHLA 2RHYA 2MK5A 1TWBA 1YITQ 1D0XA 4M75A 3OYBA 3SDZA 4AFSC 5HKCA 2KT1A 3NGPA 1OV3A 1OU8A 1OPLA 2E65A 2ABLA 2EQUA 1SKUB 3M54A 5LJ3f 1RLPC 2G6FX 2RQUA 1PG5B 3G6ET 2EJFA 3OYGA 3C94A 3CD6T 3VKIA 1U8RA 2CSQA 2DFUA 3V7CA 1E7OA 1YJ9A 3NPFA 1OULA 3G7ZA 3WXMB 2OTJQ 3URGA 2BUDA 2EYWA 4J7IA 1VQ8A 3G71T 1E6HA 4FW2A 2HCKA 1SRLA 1WZOA 4E7IA 4FT4A 1M90R 3CC2Q 2ZAEA 2EGEA 4LDUA 3CBOA 3JCMP 2RHZA 1N27A 2EGAA 1G3YA 2FRWA 4M77F 4R0KA 4C0DC 2J6KA 3CC7T 1U1SA 3IQLA 3CCUQ 4CC7A 1XOVA 1YBYA 2CKKA 2KI7A 3RNJA 1V76A 1KG1A 4BY6B 4JRQA 3A8MB 1KK7A 4NS5A 2DL5A 4OB3B 4BDYA 1JBMA 2EQMA 4M77C 5GAN3 3L2ZA 1LPLA 1Y96B 2GQIA 3EH2A 3MP8A 4QVCA 3CCRT 2DLPA 3MO8A 5FU7C 4FYYB 4BDZA 2RN8A 3WVEB 1RACB 2CP0A 2Y4YA 3VRZA 5KH6A 3QJ6A 3EG1A 1H641 2V8IA 4N4IA 2GTJA 4GY5A 8AT1B 3QO3A 4HVWA 1W2BP 1C6VX 4P5NA 1GFDA 3RESA 5GMKh 2DVJA 2YUOA 5GJWB 3G4SQ 1VUBA 3M0UA 2JS2A 4NL3A 3P8HA 4MZPA 2LCSA 4J9EA 1M1KU 2XICA 4KUDK 3CC4T 1R77A 3H41A 4A4HA 1AOJA 3G6EQ 4XTVA 1QQJA 1VA7A 2PTKA 4LDVA 3SD4A 2MMPA 1JO8A 2DBMA 2E1HA 1YFNA 2R58A 4IURA 5J39A 1QMCA 2YLCA 3QZ9B 1QVFP 3E19A 4R56A 3LWIA 3G71Q 1UEBA 4HCKA 2DTIA 3A98A 4C92B 1D1CA 1T3LA 4PJOA 3CCEQ 3FJ5A 3G4SA 2QAZA 2FB7A 2CUDA 2OTLQ 4OMNA 2DNUA 4IUPA 3PT9A 5FWBA 3CCLT 3CCVQ 1YNZA 3G6EA 2BZXA 3QBYA 2HDAA 1M2OA 3G71A 5GMKe 1SHFA 3M4YA 5LJ5f 1WQ7A 2DMOA 2E3IA 3OYJA 2IPOB 4OB0B 2F5KA 4J6XA 1Q81U 2COYA 1WHJA 3JCMg 3CEYA 2OTLA 2ESWA 3FLGA 3CCJQ 2MWOA 4LDYA 4J9CA 2EWNA 3CC7A 4EDUA 1VYUA 5GAN8 2QK0A 3UPUA 2YWWA 4MMKA 4CC2A 1QW1A 2JOYA 5IAYA 1ZX6A 4JLIA 3TCJA 1TOVA 2X51A 4OB1B 5FRMA 2LTOA 1U5SA 1VQOT 3OS2A 2D8HA 4OMOA 1Q7YU 4C92G 1ZSZC 1M3AA 4LXCA 1PWTA 1WJQA 2HQXA 3M57A 5AYFA 3CCRA 3M4GA 4IUQA 1NBEB 3EG9B 2QTVA 1UE9A 2IIMA 1QVGP 2FEIA 5GAOl 2CYZB 9ATCB 3JB9F 4LUEA 8ATCB 1BCMA 3M5AA 3CBMA 2FYKA 1PSEA 1PNJA 3CQTA 1SF9A 2ROLA 3OW2S 4HVUA 3I35A 4J8OA 3EG3A 2LQ8A 2LP5A 2ROTA 5HK3A 2O4XA 1JJ2P 1YJNQ 4MMLA 1NLPC 4XK8E 2ATCB 4BI4A 1WLPB 4E6RA 2RJCA 1TS9A 2PZ1A 5EC7A 2ZPBB 3VS4A 3HL8A 1BK2A 3CC4A 1XJWB 5I22A 4F7UA 4BE2A 1KQ1A 2DYBA 3H0HA 3RBBB 1NJIU 2LT1A 1X2KA 1ABQA 5GAMh 1WHKA 4L59A 4PK4A 4E7JA 1YCYA 1HJDA 3JCMd 2O9VA 4M75B 2X4JA 3RIRA 2PUOB 3THKA 4RTYA 4A4EA 3SWNC 2NWMA 4PLLA 5KYWA 1KD1U 1D1AA 3E9FA 2A08A 2F1LA 1Y7XA 2FZKB 3CCLA 3BDUA 2RH2A 4M77E 1QVPA 3EFOA 2K5LA 2YT6A 3JCMb 3OW2A 4B9WA 2XHCA 3E1SA 3M0PA 1X27A 1VQ6T 3PVQA 3DLLA 1RUWA 5D7UA 3LX7A 1UHFA 1JXOA 2D0QB 3REBB 4M7AA 2EBPA 3QG1A 4KRTA 1UGSB 2EVRA 2KK4A 2X9HA 4OVAA 1MMGA 1NE8A 1WNLA 1MMAA 1YJWQ 5J3BA 2EJGA 2PUKB 3M0TA 1LOJA 2GBQA 4KGVB 4F14A 1N8RU 4QT7A 1MMDA 2RJDA 2VVKA 3OSVA 2YLBA 5GAMe 5KYUB 2DEQA 3OS1A 1IHWA 1JRIA 4HVVA 4M75G 2GNCA 1IHVA 3P8DA 2P0QA 1WFWA 3HPWA 1WXBA 2RB6A 1OX8A 4Z8AA 2C0OA 2D8JA 3I56T 2CP7A 1G5VA 4J83A 3DB3A 3AHUA 3OYYA 5CKDA 1X6GA 3CMEQ 2LQNA 3S6WA 3J80E 4X34A 4C92D 1AWOA 2PVOB 2DJQA 3NTIA 1QCOA 5LL6S 1YJWA 3M0RA 2D0NA 3QWYA 4F16A 4M75E 4N0AA 4IKFA 3JCMV 3CXCP 2EJ9A 2RA2A 1VYTA 1UJYA 3CCMQ 5DM7R 1CSKA 1Q95G 2XDPA 1KJWA 1OZ3A 5DLOA 1UUEA 3TREA 1XNIA 3A8GB 3LW5E 1OEBA 1TXQA 2DERA 3RMSA 3BE3A 2XK0A 1O9SA 2AKLA 2ENMA 1T0JA 3CMEA 3VYHB 4KH1B 1MHNA 1K8AU 2E10A 2YRDA 2YUPA 2EGCA 1VQNQ 1AT1B 1T3SA 2YDLA 2CZ6B 2EFIA 3TSZA 4PJOB 4Z88A 3MKDA 2EYQA 3OS0A 3OYEA 1UGQB 2B8AA 4RTZA 3RKYA 4PJLA 3CMAQ 2AHJB 4DA4A 1YITT 4C5HA 3PIOA 1TUDA 2DF6A 4KH0B 2E6NA 3L2UA 4XTYA 4BI3A 2HD0A 3OYHA 3MCAB 3M0QA 2EKOA 5D6YA 3OYDA 3EGXA 3CPWP 1WXTA 1FMKA 2K6DA 1ZBJA 2FHDA 1VQNA 5A0DA 1VQ6A 4J6YA 2JM8A 2M0OA 1NYGA 1G8XA 2GF7A 1WXUA 1BCOA 2DYIA 4FL6A 4IUVA 2RJFA 3OYKA 4J9BA 1WJRA 1R8OB 2W0ZA 2DRKA 3F70A 4CC3A 2L3SA 2FVUA 1GBRA 3JCMQ 2OTJT 4JZ3A 5FW9A 1BU1A 1K76A 2AIRB 3CMAA 2BZYA 1AD5A 2K3XA 4Y92A 3CC2T 1G2BA 3R6OA 3RR6A 2ZPFB 4WTOB 4BY6C 1K9MU 3MEWA 4M7DA 4Q5WA 5GANh 1MV3A 4F04B 1G3SA 1W2BS 2VXEA 2KMTA 2KXCA 3BFMA 4X1VA 1H3ZA 3CCUT 4IIMA 1OZ2A 2M1HA 2EW3A 5IXBA 4HA8A 4PJOG 4EMKC 3VV0A 4ZN1A 3L2QA 5A2QE 2H3EB 2BE9B 3I56A 1Q81R 4M75D 2ZPEB 4DBQA 2J06A 1K9AA 4OMPA 5AT1B 1XTDA 3VS1A 1Q86U 5EG2A 4E7HA 3SFMA 3C0CA 2ED1A 1Q82C 1UJ0A 3NMZC 1Y07A 5FRNA 2VGNA 2NUTB 3NHNA 3O5ZA 2AK5A 3TSWA 3R6NA 1Q7YR 2LNVA 5IT9E 4F7UB 2O2OA 1M2VA 2EIFA 1UG1A 1KC8U 3CCQT 2DEUA 1U3OA 4O6JA 3V7RA 3T9NA 2EQKA 1EIFA 4RKUE 1PM3A 5A0LA 3G4ST 3X20B 2V8KA 1A0NB 3VS2A 2K7AA 2GGRA 2HQEA 4J6WA 4M78A 1NEBA 1MMNA 1I5OB 3V8LA 3QUIA 1PCXA 1AHJB 2A3LA 2ZCFB 1QCNA 2DXCA 2JN0A 4C92C 2FPFA 1TSFA 3JCMJ 1TUGB 1LVKA 1M9SA 5GANe 1KQSS 3TEEA 3ZFJA 5KYWB 3INZA 4A4KA 3OS5A 3X26B 1D0YA 1ARKA 2K5FA 1HD3A 5KE3A 2HL5C 5CKFA 3C95A 3DB4A 4JJDA 1FMWA 1YITA 1ZA2B 3EFOB 4DBHA 4RG8A 1NJIR 2YUNA 2KAFA 3CCET 2E41A 5CKBA 2LQKA 2OTLT 4X9DA 1YHQT 1NYFA 4MDWA 5HCKA 2E3HA 3CCVT 2MPXC 4LD6A 2CREA 4M7AB 1QCFA 1KQ2A 2VB6A 2RQRA 2RHXA 2ED0A 2CS7A 2CZ0B 1GCPA 2PQWA 3EG0A 1KD1R 4F7UG 5KYUA 2OTJA 1VIFA 3MEVA 1FYNA 1IGQA 1WHHA 1X43A 2K3BA 2L2PA 3CC2A 2MYSA 2WSCE 1NPPA 1FX7A 1H3HA 2LJ3A 4FW1A 2F2WA 2DO3A 4LDXA 3CCJT 4JRIA 5L23A 3M9QA 3CCUA 1KQSA 1X6BA 4HCZA 1JJ2S 3CCQQ 1EFNA 3VUZA 3I9QA 4KBMB 4JS4A 4WCIA 2DL4A 4PJOD 3CCSQ 3L2RA 5FROA 4WF2A 3HFOA 2RQTA 5KYXA 1V1CA 4JUVA 3FRNA 3SB2A 1QLYA 2IG0A 3QYHB 2XI9A 3I55Q 1PC0A 5CQYA 3C12A 3GNGA 4C5GA 2E5KA 4GBQA 4M75F 2RPNA 5LJ3g 5GAMf 5C6SA 3JB9I 4D8DA 1DJ7B 1GCQC 4M7AG 2CZ7B 1BI3A 3KUFA 1QKXA 2HBWA 5C0MA 2QA4Q 3OYNA 1I4K1 1WX6A 2BZ8A 3CCQA 1KIKA 1YJNT 2FZCB 2A37A 1LCKA 4VUBA 1AWXA 3UDCA 3CCSA 5GJVB 3OA6A 5D6WA 1YHQQ 4M75C 3VS0A 4C8QA 1GXIE 5CK9A 2AT1B 4EPCA 3NFCA 2PVDB 3UA7A 4HT9A 4E7SA 2HQHA 1UGPB 3QKJA 2EYYA 4LNPA 4MDXA 3LLRA 3NTKA 1UECA 3MHXA 1ZLMA 2OAWA 5LJ3h 2EKHA 3TVTA 1H8KA 2QA4A 1K4US 1W1FA 5LJ3j 3JB9J 2FO0A 3H0FA 1RAHB 2BE7D 3CCEA 4FYXB 3EGXB 2MI6A 2V8JA 2X3WD 1YHQA 1MNDA 5KYNA 4QVZA 3UWNA 3U23A 3CCVA 2XDDA 1Y0MA 3H8ZA 2RO0A 2L8DA 3QDFA 3LH0A 4DOVA 3ULRB 3GIBA 3MP1A 4O5VA 1W4SA 2RHIA 5LJ3d 4J9HA 4RG2A 4M7DB 1MUZA 2XG8D 2AZVA 2QASA 3VS3A 1WDXA 3Q1JA 1QP2A 1MNEA 3CCJA 1ZBXA 2L5QA 1HSQA 1YJWT 3M0SA 3FDRA 1M90C 2RHUA 5HK0A 3CXCS 2HMAA 4J5YA 3JCMh 2AKKA 1HYOA 1YWPA 2DX1A 2LC4A 4C92E 3EH1A 1X69A 1ABOA 2X4WA 2NUTA 1OI1A 2COWA 3A8OB 4FIBA 4RTVA 1ACMB 1UFFA 2E64A 5LJ3e 1WGSA 1K9MR 4FSSA 2DBKA 4II1A 2DD5A 3CMET 3RUXA 2RM4A 2RD1A 4OMMA 2ECZA 5M9OA 4A4GA 4BD3A 4ZGDB 1RLQC 4JZ4A 1M2VB 2R5AA 4PFPA 4K11A 6AT1B 3RMQA 2JW4A 1K73R 3A5ZB 1TH7A 2HSEB 2QDYB 3RERA 1YJNA 3CCMT 2KROA 4M7AD 1R0BG 4M78B 1D3BB 1K0SA 3ASKA 2LQWA 1IGUA 2HL3A 5LJ5g 4ANJA 4A54A 5IH2A 4M7DG 2G3RA 2JM9A 4PJOC 2NYSA 1GL5A 1N9RA 2FPEA 4ORZA 2KR3A 3CXCA 2LX7A 1BKBA 1I07A 3H0IA 1VIEA 2DL7A 1VQNT 1H92A 3TU4K 1T0HA 1KC8R 2BIVA 3JCMe 2F5TX 1WJSA 2WSEE 5GAOp 4XTUA 1P92A 2CP5A 4M7DE 5GAN7 2PU9B 1PD1A 2FG0A 1B07A 3GNFB 2DXUA 4KGZB 3CMAT 1U1TA 2K9GA 5GMKi 5KCHA 1AVZC 3BW1A 4OGCA 1SG5A 2CH4A 2RJEA 3HRUA 2HKQB 3L42A 5GANf 2EPDA 5LJ5j 4PL6A 3KBGA 1TTHB 4OMQA 5I2SA 1OPKA 3QXEB 1SEMA 1KHIA 3PGGA 2DPPB 5D6XA 3PMIA 2L3PA 4IUTA 4UC4A 4C0FA 4XAXB 3HFNA 1SSFA 3MEUA 4M78G 2EYXA 2VUBA 4D6WA 2L3RA 1S1NA 4FT2A 1BI0A 4C5EA 3A1PA 1ZHIA 3JCMc 2COZA 5CAIA 5LJ5d 2JNGA 3N5BB 1ZUKA 4N4GA 5IHNA 1WQWA 4F7UF 2QTXA 2LJ1A 4E7LA 1WHGA 4JJBA 3M53A 4M78E 1BBZA 4RTTA 4CI0C 4Y91A 5KYXB 2KEAA 1G3TA 2DZ9A 1IREB 3G1JA 4JJCA 4PFOA 4XTWA 1CKAA 2JZ2A 1HXDA 1VQ4T 4ELZC 4V2SA 2R5MA 4HXJA 3KFVA 2FZGB 3OW2P 2J05A 4J9IA 3L2VA 5CIUA 2QQRA 4HCBA 1YWOA 1C1AA 3TQ7P 1VOMA 2LNHB 1M4ZA 3UT1A 3QHSA 1IZ6A 4ZGEB 1AZEA 3VUBA 3V8KA 3CCMA 2JTMA 2QEXQ 3V8JA 1M1KR 1FXXA 4C0ZA 2DL8A 4C8QB 4IUUA 1VQ9T 3LYIA 1M30A 4C0GA 2DETA 2QGFB 3HP9A 2VV5A 4B9XA 1N6AA 2KYMA 4A53A 3S3OA 4M7DD 2LZ6B 3LWHA 4M7AF 4AG1C 2V26A 1RL2A 3M58A 3VU3C 2CP6A 4Z02A 2MOXA 2RI3A 4KULA 4RMOA 2F2XA 1UDLA 2CT3A 2KDSA 2QEXA 3EGDA 1LNXA 1YCSB 4KGXB 1K73C 1GBQA 5FWCA 1OX9A 3FJPA 3J81E 4FCYA 3OYLA 3HRTA 3M56A 3QIIA 4JS5A 4M7AC 2D1XA 3JB9G 3SEMA 2QXFA 2JJ9A 1SSHA 4M77A 2EYZA 4B6MA 2VYTA 3ZBDA 3HTRA 2RMOA 4E47A 1QWEA 1I5LA 2RQVA 2VKNA 2JMCA 3EHRA 2DM1A 4JLGA 1QWFA 1VQ4Q 1IXDA 2DRMA 3JSCA 4J7FA 2ZPGB 4C8QG 4ELYC 4NL2A 2BTTA 4FYVB 1UGVA 2DVEA 4M78D 2L89A 1ZSGA 2K79A 2P4TA 1S72T 4R55A 1KHCA 2MIOA 1YIJQ 1UGRB 3RKXA 1YP5A 4E7KA 2RF0A 4PJOE 2JVVA 2K5IA 1QP3A 3L1AA 2HBPA 1QVFS 2QQBA 2KXDA 4C92F 5DY9A 4OP0A 4N0AC 4OF1A 2PNIA 1VQ9Q 4HT8A 2P0PA 1VQ4A 5GAOn 2CZ1B 1W70A 2KRSA 3X25B 3VRYA 2E6ZA 1VQKT 5GAOq 3CCST 1PHTA 1JEGA 2NUZA 2H8HA 2RI2A 4J9FA 1YJ9Q 1D3BA 1YN8A 1D0ZA 3EAEA 2HEQA 4EMGA 4BACA 3I55T 1W2BA 1VQMT 1YIJA 4DBRA 2J6OA 1VQPQ 3QYGB 1EZZB 3HHTB 2PVGB 1JB0E 3VJPA 3I5SA 2DA9A 1Q82U 1WHMA 2D9TA 3JCMX 4ZTJA 1VQ9A 2QA4T 4CC4B 2LX9A 1D09B 4D8KA 2P0KA 1WI7A 2DILA 3EGUA 1CKBA 5A0GA 2QG9B 1SHGA 4Z89A 1RAAB 4XTXA 2KNBB 1X6OA 1QVFA 3ZEHA 2QQSA 1UHCA 1VQPA 2RK2A 3OMGA 1W6XA 2EQJA 3O8VA 2CP3A 1X2QA 2JTEA 4FU6A 5J26A 2DK3A 3DLMA 3LH5A 4M7DF 3HKSA 4LE9A 1WIEA 2GTOA 5DLQE 1S72Q 2ZPHB 2DAQA 4BUGA 1QVGS 1K0XA 2BKDN 3QSUA 1FWZA 1OOTA 1M1KC 3MEAA 4PFZA 1ZSZA 5FU6B 2SRCA 4MZMA 3JB9H 4BI8B 4DQ2A 1PD0A 1BI1A 5GAOm 4DEXA 3JB9D 2DL3A 4OB2B 2OAUA 5GAN5 3JCMW 4F7UE 2JMAA 3JCMf 2OX7A 4M7DC 3V7SA 4EMKB 1UTIA 3OB9A 1ZA1B 3L2WA 5I11A 3S3NA 2JXBA 3RDVA 1WYXA 1VQKQ 3M55A
chains in the Genus database with same CATH topology
1W2BS 3NTIA 3OYMA 1K73U 1ZQ1A 2LC4A 4C92E 4OMFB 4HKEA 3FEOA 5LL6S 2LRQA 1YJWA 3PIPA 2DXBA 2QQAA 1S72A 3META 1N9SA 2X4WA 4M75E 1VQ5T 1OI1A 4N0AA 4C8QD 4IKFA 4XU1A 3JCMV 3A8OB 4FIBA 3VYGA 2DZCA 4C8QE 2ZGWA 1OYXA 2EJ9A 2E64A 2RA2A 3QJYA 5GMKj 4RCBA 2Y4XA 5LJ3e 1WGSA 5DM7R 5KCOA 2DKGA 2XDPA 1OZ3A 3PNWC 5DLOA 3TREA 1XNIA 2O4XB 1NZ9A 4BB7A 4II1A 1BIBA 5GANd 2DD5A 2M9UA 3CMET 2I2LA 3HSBA 5GMKm 3A8GB 3LW5E 3ME9A 2RM4A 4M78F 2RD1A 3RUXA 3RMSA 5M9OA 2WSFE 4A4GA 4BD3A 3ER0A 4ZGDB 2XD0A 2XK0A 1O9SA 1V29B 4DOWA 4YTLA 2F69A 2R5AA 3RMQA 3CMEA 1VQKA 3VYHB 3A5ZB 2RHYA 1TH7A 1MHNA 1K8AU 1QVGA 4LDWA 2E10A 4M75A 2JTFA 3SDZA 3OYBA 2QDYB 3PTAA 3RERA 1B34A 5HKCA 3SWNA 4BE1A 1YJNA 3CCMT 5CKEA 3KXTA 3GLXA 1Q81C 4M7AD 4QQGA 4M78B 5I21A 1D3BB 4JRKA 3ASKA 3I55A 2CZ6B 3GP8A 2E65A 1VQMA 4RCCA 2EFIA 4M7AE 2EQUA 4PJOB 5LJ5g 4M78C 4A54A 4HCCA 3M54A 2EYQA 3OS0A 4M7DG 5LJ3f 3OYEA 3P8BB 2G3RA 3RKWA 1JJ2A 4PJOC 1UGQB 3G6ET 2B8AA 2EJFA 1N9RA 3OYGA 3RKYA 3C94A 2GFAA 3CD6T 3VKIA 1U8RA 2AHJB 3CXCA 4DA4A 1YITT 3LGLA 1BKBA 4XU0A 3V7CA 4C5HA 3PIOA 1VIEA 3X24B 1YJ9A 3G7ZA 3WXMB 1VQNT 2MWPA 2E6NA 3TU4K 2LT4A 3CD6A 3URGA 2BUDA 2K2VA 3L2UA 4J7IA 1VQ8A 2BIVA 3PMTA 2KSSA 2F5TX 2KVQG 1WJSA 2HD0A 2WSEE 2IVWA 4XTYA 4BI3A 5GAOp 2Y90A 2LDMA 3MCAB 3OYHA 4E7IA 2EKOA 4FT4A 5D6YA 4ZN3A 3OYDA 4XTUA 1P92A 1M5Q1 4M7DE 3NTHA 5GAN7 2FHDA 2PU9B 4C0DB 4LDUA 3CBOA 1VQNA 4TVRA 5A0DA 3JCMP 2RHZA 4J6YA 1VQ6A 1N27A 2M0OA 5CQXA 1G3YA 2GF7A 2XIDA 4M77F 3GNFB 4C0DC 4FL6A 2DXUA 2RJFA 4IUVA 3OYCA 3OYKA 3CMAT 1U1TA 3LGFA 1WJRA 3CC7T 1R8OB 1U1SA 5GMKi 5KCHA 3F70A 2FVUA 3BW1A 4OGCA 1XOVA 1YBYA 2CKKA 3JCMQ 2OTJT 2RJEA 3HRUA 3CMAA 3L42A 1KG1A 5GANf 1G3WA 5LJ5j 2K3XA 4PL6A 4BY6B 3KBGA 3CC2T 4JRQA 2RI5A 3A8MB 5I2SA 4JDSA 3R6OA 4NS5A 3QXEB 4M77B 2ZPFB 1KHIA 3PGGA 2DPPB 2DTOA 4BY6C 2DJZA 1K9MU 3MEWA 5D6XA 2KY9A 4OB3B 4BDYA 4ATOA 4Q5WA 5GANh 1JBMA 4M7DA 2EQMA 3PMIA 1M1GA 4IUTA 1G3SA 4M77C 4UC4A 2VXEA 5FU7B 4C0FA 5GAN3 3L2ZA 2KMTA 3BFMA 4XAXB 3HFNA 1H3ZA 1SSFA 1Y96B 3MEUA 3MP8A 4QVCA 4M78G 3CCRT 3CCUT 3MO8A 4KT0E 1OZ2A 2M1HA 5FU7C 3C4SA 2VUBA 4D6WA 1NJIC 3BY7A 2L3RA 4JRPA 4HA8A 4PJOG 4EMKC 4BDZA 3VV0A 1HK9A 4FT2A 3WVEB 5FLXE 1BI0A 4XU3A 5GAMg 2Y4YA 4ZN1A 5KH6A 4C5EA 4NOYA 3QJ6A 5CR2A 3L2QA 5A2QE 1H641 2V8IA 4N4IA 4X9CA 3I56A 2DIQA 4GY5A 4M75D 2ZPEB 3QO3A 5L8RE 1ZHIA 2DXTA 4P5NA 3JCMc 2VXFA 3RESA 5CAIA 1XTDA 2X4XA 5LJ5d 5GMKh 2YRVA 2JNGA 3N5BB 4N4GA 1WQWA 5EG2A 1Q86U 4E7HA 4F7UF 2QTXA 3SFMA 2NLUA 4E7LA 3M53A 4M78E 1Q82C 1VUBA 4CI0C 4NL3A 3P8HA 1VQ5A 4MZPA 2D6FA 1KD1C 1M1KU 4Y91A 1Y07A 2XICA 4KUDK 5FRNA 1G3TA 2DZ9A 1IREB 2VGNA 3CC4T 1VQLT 4XTWA 4A4HA 2JZ2A 1HXDA 5CO7A 4ELZC 1VQ4T 4PJOF 3JCMe 4V2SA 3QPHA 2R5MA 4XTVA 2LNVA 3WVDB 5IT9E 4LDVA 4OGEA 4F7UB 3SD4A 2EIFA 2MMPA 1KC8U 2E1HA 3CCQT 2R58A 3L2VA 3JAME 4IURA 5CIUA 4C8QF 4O6JA 3V7RA 3T9NA 2EQKA 2QQRA 4XU2A 5J39A 4HCBA 1M90U 1EIFA 4RKUE 2YLCA 3QZ9B 5A0LA 3X20B 3E19A 3OYAA 3G4ST 4R56A 1I8FA 3LWIA 2V8KA 3A8LB 1Y71A 5KE2A 1M4ZA 3UT1A 2HQEA 3QHSA 1UEBA 1IZ6A 4J6WA 4ZGEB 2DTIA 4M78A 5GAOr 2XU8A 3VUBA 4C92B 5GAMj 3H6ZA 3V8LA 3G71T 4M77G 3QUIA 3V8KA 4PJOA 1AHJB 5GMKl 2A3LA 3CCMA 2JTMA 2ZCFB 1O75A 2DXCA 3G4SA 3V8JA 2FB7A 4ZTFA 4PNOA 2JN0A 4C92C 1FXXA 3FC3A 4C0ZA 4QVDA 4IUPA 3JCMJ 2X4YA 4C8QB 3CPWS 5GANe 1M9SA 4IUUA 1VQ9T 3PT9A 1KQSS 3LYIA 3TEEA 3ZFJA 4C0GA 3CCLT 3QDRB 3INZA 4A4KA 3HP9A 4C8QC 1N8RC 3FB9A 3DKMA 3G6EA 2VV5A 2O01E 3OS5A 2R57A 3X26B 4CRIA 4ME7A 4B9XA 2K5FA 1N6AA 4A53A 5KE3A 5CKFA 3QBYA 4FM4B 3C95A 3DB4A 3S3OA 1YITA 4M7DD 2GFUA 3LWHA 4M7AF 3PFSA 1VQ7T 3S3MA 1RL2A 4RG8A 5GAN2 5GAN4 1XQHA 3M58A 2KAFA 3VU3C 3A8HB 3CCET 4Z02A 2QEXT 2E41A 3OQ5A 2LQKA 5CKBA 2OTLT 3G71A 2RI3A 4KULA 4X9DA 5GAMd 1X75C 4RMOA 1UB4A 5GMKe 1YI2T 3CPFA 3M4YA 1YHQT 3EFSA 5LJ5f 1WQ7A 4MDWA 2KDSA 5CCAA 3CCVT 3OYJA 4LD6A 4OB0B 1M1FA 2F5KA 4J6XA 3JCMg 2QEXA 1Q81U 1LNXA 3CEYA 2OTLA 4M7AB 1I81A 3FLGA 2MWOA 4GLKA 1K73C 4LDYA 3FJPA 1KQ2A 3J81E 5LJ5h 3HRTA 3M56A 3OYLA 2EWNA 3QIIA 3CC7A 4JS5A 2RHXA 2CS7A 4M7AC 4Y28E 2CZ0B 2PQWA 4EDUA 3JB9G 2QXFA 5GAN8 4F7UG 2OTJA 3UPUA 4QW2A 2WACA 1VIFA 2EAYA 4M77A 2HNIA 2LCLA 3MEVA 4MMKA 5CVIA 2GCXA 2RK1A 1QW1A 2VYTA 2JOYA 3ZBDA 5IAYA 2WSCE 3M59A 2XKOC 4JLIA 3TCJA 3CC2A 4E47A 3JRZA 1MGQA 4OB1B 5FRMA 2LTOA 4EMKA 1NPPA 1I5LA 1Y96A 1VQOT 1FX7A 3OS2A 2DO3A 1Q7YU 4JJNK 4C92G 4LDXA 3CCJT 4JLGA 2LVMA 3J7AF 1WJQA 2HQXA 4JRIA 3M57A 4PKCC 3M9QA 5AYFA 3CPWA 3M4GA 4IUQA 3JSCA 3CCRA 3CCUA 4J7FA 1VQOA 1X01A 4BE0A 2ZPGB 1KQSA 1RI0A 4HCZA 4C8QG 4NL2A 4ELYC 1JJ2S 2XDBA 1K8AC 5GAOl 3GF5A 2ZPIB 2CYZB 2FL7A 3VUZA 3JB9F 2DVEA 4M78D 2L89A 2P4TA 3M5AA 3CBMA 2FYKA 3MP6A 4KBMB 3GPLA 1S72T 4JS4A 1PSEA 4R55A 3OW2S 1KHCA 4PJOD 3CBPA 3E9GA 1UGRB 4J8OA 2M16A 4QQDA 2LQ8A 3RKXA 3L2RA 4E7KA 5FROA 4PJOE 5HK3A 2JVVA 2DTHA 2K5IA 3HFOA 4WF2A 3OY9A 1BYMA 1QP3A 2O4XA 4MMLA 3L1AA 4XK8E 2H3JA 2HBPA 4JUVA 1QVFS 2QQBA 3FRNA 3SB2A 4BI4A 2IG0A 3QYHB 2XI9A 2RJCA 4C92F 5DY9A 5CQYA 4OP0A 4N0AC 1WPYA 3C12A 4OF1A 4N4HA 2ZPBB 3GNGA 4C5GA 3HL8A 3CC4A 4M75F 2C06A 1VQLA 5IN1A 5LJ3g 4HT8A 4F7UA 5GAMf 5GAN6 2P0PA 5C6SA 1DJ7B 1KQ1A 2KQWA 3JB9I 4BE2A 5GAOn 1VQ4A 2CZ1B 3OBYA 3OYIA 4EMHA 3X25B 2E6ZA 2CZ7B 1VQKT 4M7AG 1NJIU 5GAOq 1BI3A 3KUFA 4FSXA 3CCST 2LT1A 1YIJT 2RI2A 5GAMh 5C0MA 2E70A 1D3BA 1I4K1 4L59A 3FIFA 5LJ5e 3OYNA 3EAEA 3CCQA 2E12A 1YJNT 4E7JA 4C5IA 1YCYA 2HAXA 2K3YA 2MAMA 4VUBA 4C92A 3JCMd 4EMGA 4M75B 3UDCA 3I55T 4BACA 1W2BA 1VQMT 2X4JA 1B34B 3RIRA 3CCSA 1YIJA 3SWNB 3OA6A 3QYGB 2PUOB 5D6WA 3OYFA 3HHTB 1M8VA 3BDLA 4M75C 2ZZDA 4A4EA 4LD9K 4C8QA 2PVGB 1JB0E 3VJPA 1GXIE 3SWNC 5CK9A 4EPCA 2QQ9A 3NFCA 4PLLA 1Q82U 2PVDB 4HT9A 3OSSC 3QKJA 1UGPB 2D9TA 1KD1U 4MDXA 3LLRA 5CKHA 3NTKA 3E9FA 2YHTA 3JCMX 4ZTJA 1VQ9A 4M77D 1Y7XA 1YJ9T 2QA4T 5I2MA 3CCLA 2LX9A 3BDUA 2RH2A 4M77E 4QQ6A 1QVPA 2X35A 1K9MC 1VQ8T 3MHXA 2P0KA 5GANg 2K5LA 3EFRA 3JCMb 5LJ3h 3OW2A 4B9WA 5A0GA 1VQPT 2DIGA 3OBWA 2QA4A 2XHCA 5LJ3j 3E1SA 3JB9J 2DD4A 4XTXA 1VQ7A 3GOXA 1VQ6T 3CCEA 3DLLA 2MI6A 1X6OA 2V8JA 1QVFA 3ZEHA 3LX7A 2QQSA 1VQPA 2MF2A 2RK2A 3OMGA 1YI2A 2A7YA 2D0QB 2K4YA 4XTZA 3HRSA 1YHQA 4M7AA 2EQJA 3O8VA 4QVZA 3UWNA 3QG1A 1NPRA 2LCCA 1UGSB 3CCVA 2XDDA 4FU6A 5J26A 2KK4A 4OVAA 2DK3A 2VC8A 2RO0A 1LJOA 2L8DA 3DLMA 3H8ZA 4PLIA 3X28B 4M7DF 3HKSA 3LH0A 4DOVA 5HY6A 1NE8A 1WNLA 1Q86C 3GIBA 5DLQE 4L5GA 5J3BA 2EJGA 2PUKB 3MP1A 2ZPHB 1LOJA 2DAQA 4XQ3A 4BUGA 1Q7YC 1QVGS 2BKDN 1N8RU 3QSUA 1FWZA 1W4SA 4O5VA 1M1KC 4L6V5 4MZTA 2RJDA 3MEAA 2RHIA 2CGHA 5FU6B 5LJ3d 3OSVA 4MZMA 2VGMA 2JUFA 3JB9H 1PSFA 2YLBA 4RG2A 4BI8B 5GAMe 4DQ2A 1BI1A 5GAOm 2DEQA 3OS1A 3JB9D 3QZ5B 1JRIA 4M7DB 4M75G 4OB2B 5FU6C 2XG8D 2GQVA 2OAUA 5GAN5 3P8DA 2P0QA 4ZGJB 3JCMW 4F7UE 3JCMf 1KC8C 3Q1JA 2E5QA 1QP2A 4M7DC 3HPWA 2QI2A 1BI2A 3V7SA 3CCJA 5GANj 2RB6A 4EMKB 3L2WA 1ZBXA 2L5QA 3OB9A 3OMCA 1YJWT 3I56T 1G5VA 3FDRA 4J83A 1M90C 2RHUA 3DB3A 3S3NA 3OYYA 3AHUA 5HK0A 3CXCS 5CKDA 4J5YA 4A4FA 1BIAA 3S6WA 3J80E 3JCMh 4KUIA 4X34A 3M55A 4C92D 2PVOB 2K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTI A;  3OYM A;  3L42 A;  3QBY A;  2RI2 A;  3DB4 A;  5C0M A;  3S3O A;  3OYN A;  2GFU A;  2K3X A;  2LRQ A;  3FEO A;  3EAE A;  4L59 A;  4PL6 A;  3PFS A;  3S3M A;  2RI5 A;  4E7J A;  3MET A;  4C5I A;  2X4W A;  2K3Y A;  4NS5 A;  1OI1 A;  4IKF A;  4Z02 A;  4BAC A;  3OQ5 A;  3MEW A;  5D6X A;  2RI3 A;  4BDY A;  4Q5W A;  3OA6 A;  2EQM A;  3PMI A;  5D6W A;  4IUT A;  1OYX A;  4UC4 A;  3OYF A;  4E7K A;  3BDL A;  4A4E A;  1WGS A;  1H3Z A;  1SSF A;  3MEU A;  3MP8 A;  5KCO A;  2XDP A;  1OZ3 A;  3PNW C;  3MO8 A;  3OYJ A;  1OZ2 A;  2M1H A;  4LD6 A;  2F5K A;  1XNI A;  2O4X B;  3C4S A;  4PLL A;  4II1 A;  3CEY A;  2L3R A;  3QKJ A;  4BDZ A;  2D9T A;  3FLG A;  2MWO A;  3LLR A;  3ME9 A;  3OYL A;  5KH6 A;  3NTK A;  3E9F A;  3QII A;  3QJ6 A;  4A4G A;  4C5E A;  5M9O A;  4BD3 A;  3L2Q A;  4ZTJ A;  4N4I A;  2DIQ A;  2RHX A;  4GY5 A;  2XK0 A;  2PQW A;  2R5A A;  4EDU A;  4QQ6 A;  2X35 A;  2P0K A;  4QW2 A;  2WAC A;  2X4X A;  2RHY A;  2YRV A;  1MHN A;  3MEV A;  4N4G A;  3OYB A;  2JTF A;  4B9W A;  2DIG A;  4E7H A;  2NLU A;  2VYT A;  4E7L A;  5IAY A;  4BE1 A;  3GOX A;  4QQG A;  5FRM A;  3P8H A;  2LTO A;  3ASK A;  3OS2 A;  2EFI A;  5FRN A;  2EQU A;  3ZEH A;  3LX7 A;  2QQS A;  3OMG A;  2LVM A;  4A4H A;  2JZ2 A;  1WJQ A;  2EQJ A;  3OS0 A;  3O8V A;  2HQX A;  4QVZ A;  2G3R A;  3UWN A;  3OYE A;  2LCC A;  3M9Q A;  2R5M A;  4IUQ A;  2B8A A;  4FU6 A;  5J26 A;  3OYG A;  2GFA A;  4OVA A;  4BE0 A;  3H8Z A;  3DLM A;  1RI0 A;  2L8D A;  2RO0 A;  4HCZ A;  4PLI A;  3LH0 A;  3SD4 A;  2R58 A;  3LGL A;  3L2V A;  4C5H A;  4IUR A;  5CIU A;  2L89 A;  3MP1 A;  3MP6 A;  2EQK A;  2QQR A;  2DAQ A;  5J39 A;  2MWP A;  2BKD N;  2E6N A;  1KHC A;  2BUD A;  3E9G A;  3L2U A;  3L2R A;  2BIV A;  2M16 A;  3PMT A;  4QQD A;  3UT1 A;  2HQE A;  1WJS A;  2RJD A;  3MEA A;  2RHI A;  5FRO A;  5KE2 A;  3OYA A;  2LDM A;  3OYH A;  4E7I A;  2EKO A;  5D6Y A;  3OY9 A;  3OYD A;  2O4X A;  4RG2 A;  3H6Z A;  3NTH A;  3OS1 A;  2FHD A;  2IG0 A;  2RHZ A;  4ZTF A;  2RJC A;  1N27 A;  2M0O A;  3P8D A;  3FC3 A;  2GF7 A;  4IUP A;  4N4H A;  2X4Y A;  4C5G A;  3Q1J A;  2E5Q A;  4FL6 A;  4IUV A;  2RJF A;  3OYC A;  3OYK A;  3LGF A;  4IUU A;  1WJR A;  5IN1 A;  3OB9 A;  3L2W A;  3LYI A;  3OMC A;  5C6S A;  4BE2 A;  1G5V A;  5KCH A;  3F70 A;  3FDR A;  2RHU A;  3DB3 A;  3S3N A;  3OYI A;  4A4F A;  2CKK A;  2R57 A;  3S6W A;  4CRI A;  2RJE A;  4X34 A;  4B9X A;  3KUF A;  5KE3 A; 
#chains in the Genus database with same CATH topology
 3OYM A;  2AZS A;  3UF4 A;  3FEO A;  2LRQ A;  1S72 A;  1N8R R;  1N9S A;  1VQ5 T;  4C8Q D;  4XU1 A;  1VQM Q;  4FYW B;  3VYG A;  4AMC A;  1RAG B;  2ZGW A;  5GMK j;  3PNW C;  1ZUU A;  1R0C B;  2A0F B;  4BB7 A;  1NZ9 A;  3UA6 A;  2M9U A;  3HSB A;  2VAS A;  5GMK m;  4M78 F;  3ME9 A;  2WSF E;  2CDT A;  1F1B B;  2YUQ A;  2XD0 A;  3CD6 Q;  1RAF B;  2F2V A;  4ESR A;  1VQK A;  1QVG A;  4LDW A;  1GRI A;  2JTF A;  3PTA A;  1B34 A;  3SWN A;  2QDL A;  4BE1 A;  5CKE A;  3KXT A;  3GLX A;  5IXF A;  1Q81 C;  4M4Z A;  4QQG A;  5I21 A;  4JRK A;  4PJJ A;  1SRM A;  3I55 A;  3GP8 A;  1VQM A;  4RCC A;  4M7A E;  3GBQ A;  2CP2 A;  4M78 C;  4HCC A;  3H9N A;  3P8B B;  2CSI A;  3RKW A;  1JJ2 A;  3AT1 B;  2GFA A;  3CC7 Q;  3LGL A;  1RAI B;  4XU0 A;  1RAB B;  3X24 B;  2A36 A;  2MWP A;  2J6F A;  2LT4 A;  3CD6 A;  2K2V A;  3PMT A;  2KSS A;  3OYA A;  2KVQ G;  1Q7Y C;  1K8A R;  2IVW A;  2X3X D;  1NG2 A;  2Y90 A;  2LDM A;  4ZN3 A;  2I0N A;  1M5Q 1;  3NTH A;  4C0D B;  1KQS P;  2RQW A;  4TVR A;  4AFZ C;  3MJX A;  2JT4 A;  5CQX A;  2XID A;  1JQQ A;  3OYC A;  3LGF A;  2O31 A;  4PJM A;  3EGD B;  3CCR Q;  2Z0W A;  4RTW A;  1KFZ A;  1G3W A;  2KGT A;  2RNA A;  1E6G A;  1JXM A;  2M0Y A;  2KRM A;  2RI5 A;  4JDS A;  1VQ5 Q;  4M77 B;  1ZUY A;  2DTO A;  2DJZ A;  1PKS A;  2KY9 A;  4ATO A;  3D7S B;  1M1G A;  2M02 A;  5FU7 B;  5ECA A;  4AFQ C;  4KT0 E;  3C4S A;  1NJI C;  3BY7 A;  2QYZ A;  3SHW A;  4JRP A;  3CC4 Q;  1HK9 A;  5FLX E;  4XU3 A;  1TU0 B;  5GAM g;  5CR2 A;  4NOY A;  3E2U A;  4EIK A;  4X9C A;  2DIQ A;  2LMJ A;  4ZNX A;  5L8R E;  2DXT A;  1G83 A;  2VXF A;  2X4X A;  4E2F B;  2YRV A;  2NLU A;  4QKU A;  1VQ5 A;  2D6F A;  1KD1 C;  2FPD A;  1VQL T;  2XMF A;  1JU5 C;  3JV3 A;  5CO7 A;  2NUP A;  4PJO F;  3QPH A;  4J9D A;  5KYY A;  3WVD B;  4OGE A;  3PE0 A;  3VS6 A;  3CCL Q;  3JAM E;  2L3Q A;  4C8Q F;  4XU2 A;  2QGG A;  2V1R A;  1GFC A;  1M90 U;  1M3B A;  1I8F A;  1RAE B;  3A8L B;  1Y71 A;  5KE2 A;  2M51 A;  1Q86 R;  5GAO r;  2XU8 A;  5GAM j;  3H6Z A;  4M77 G;  5GMK l;  1O75 A;  1AEY A;  4ZTF A;  4PNO A;  3FC3 A;  2LJ0 A;  4J9G A;  4QVD A;  1NLO C;  2X4Y A;  3CPW S;  4RTU A;  3QDR B;  1KSW A;  1AWW A;  4C8Q C;  1N8R C;  1OQK A;  3FB9 A;  3DKM A;  2O01 E;  1WA7 A;  2R57 A;  4CRI A;  4ME7 A;  4FM4 B;  1RAD B;  2GFU A;  2YRC A;  3PFS A;  1VQ7 T;  3S3M A;  4RTX A;  5GAN 2;  5GAN 4;  1XQH A;  3VS7 A;  3A8H B;  2QEX T;  3OQ5 A;  2DE0 X;  1NM7 A;  2OI3 A;  1X75 C;  5GAM d;  1U06 A;  1UB4 A;  1YI2 T;  2O88 A;  3CPF A;  3EFS A;  3REA B;  5CCA A;  2A28 A;  2EQI A;  1VQO Q;  1M1F A;  1I81 A;  4GLK A;  3I5R A;  5LJ5 h;  1Q82 R;  2KRN A;  4Y28 E;  1SPK A;  1C0M A;  4QW2 A;  2WAC A;  3EHQ A;  2EAY A;  2YSQ A;  2HNI A;  2LCL A;  5CVI A;  2KT8 A;  2GCX A;  1I1J A;  2CT4 A;  2RK1 A;  4PJN A;  1QKW A;  3M59 A;  1J3T A;  2XKO C;  3JRZ A;  1MGQ A;  1ZSZ B;  4EMK A;  1Y96 A;  1K1Z A;  1AZG B;  4JJN K;  4JPB W;  1VQL Q;  1Z9Q A;  1TUC A;  2LVM A;  3J7A F;  4PKC C;  3CPW A;  1VQO A;  1X01 A;  4BE0 A;  1RI0 A;  5IHK A;  2XDB A;  3UAT A;  1K8A C;  3GF5 A;  2SEM A;  2ZPI B;  1NEG A;  2B86 A;  1AWJ A;  1Z9Z A;  2FL7 A;  3MP6 A;  3GPL A;  2P4R A;  2FRY A;  2KE9 A;  3CBP A;  3E9G A;  2M16 A;  4QQD A;  4F17 A;  2DTH A;  3OY9 A;  1N5Z A;  1BYM A;  1IO6 A;  1PRM C;  2H3J A;  3VS5 A;  7AT1 B;  1WPY A;  4N4H A;  2C06 A;  1VQL A;  5IN1 A;  5GAN 6;  1PKT A;  2KQW A;  2C0I A;  1IB8 A;  3OBY A;  3OYI A;  4EMH A;  3ZL7 C;  4AG2 C;  1D1B A;  4FSX A;  1YIJ T;  2C0T A;  2E70 A;  5LJ5 e;  3FIF A;  1VQ7 Q;  2E12 A;  4C5I A;  5IHI A;  2K3Y A;  2MAM A;  2HAX A;  4C92 A;  2V1Q A;  1B34 B;  3SWN B;  4DEY A;  2HSP A;  1YI2 Q;  3OYF A;  1M8V A;  3BDL A;  2ZZD A;  4LD9 K;  4AT1 B;  1VQ6 Q;  3PVL A;  2YXY A;  1MV0 B;  2QQ9 A;  4LN2 A;  1Y57 A;  3OSS C;  4LUD A;  5CKH A;  2YHT A;  4M77 D;  4DBF A;  1YJ9 T;  5I2M A;  1BB9 A;  1FMV A;  4AFU C;  4RUG A;  4QQ6 A;  2X35 A;  1K9M C;  1VQ8 T;  3EG2 A;  3MPU B;  5GAN g;  3EFR A;  2JS0 A;  1VQP T;  2DIG A;  3OBW A;  1IRX A;  2DD4 A;  1VQ7 A;  3GOX A;  2CH4 W;  1I0C A;  1RI9 A;  4IIO A;  2MF2 A;  1YI2 A;  2MCN A;  2A7Y A;  2K4Y A;  2VWF A;  4XTZ A;  3HRS A;  4OML A;  1NPR A;  2LCC A;  4A63 B;  2VC8 A;  3X28 B;  1LJO A;  4E7Z A;  4PLI A;  1Q86 C;  5HY6 A;  3I56 Q;  4L5G A;  2O9S A;  2KYB A;  2KBT A;  4XQ3 A;  2W10 A;  4L6V 5;  4MZT A;  2E4H A;  2L0A A;  2CGH A;  4GLM A;  2VGM A;  2JUF A;  1PSF A;  2OJ2 A;  3QZ5 B;  5FU6 C;  1TG0 A;  2GQV A;  1B3Q A;  4ZGJ B;  1M27 C;  1KC8 C;  2E5Q A;  3EG9 A;  2K2M A;  5GAN j;  2QI2 A;  1BI2 A;  3OMC A;  1OU9 A;  1VYV A;  2CUB A;  1M8M A;  4A4F A;  1BIA A;  4KUI A;  2K57 A;  1K73 U;  1ZQ1 A;  2J7I A;  4OMF B;  4HKE A;  3PIP A;  2DXB A;  2QQA A;  3MET A;  1B7T A;  1M3C A;  1PRL C;  2DZC A;  4C8Q E;  2HZY A;  1OYX A;  3QJY A;  4RCB A;  2Y4X A;  2P84 A;  1GCQ A;  5KCO A;  2DKG A;  2O4X B;  1BIB A;  5GAN d;  1EX4 A;  2I2L A;  2HKN A;  2NUP B;  3ER0 A;  5KYY B;  1V29 B;  4DOW A;  4YTL A;  2F69 A;  1VQ8 Q;  3QWX X;  1WHL A;  2RHY A;  2MK5 A;  1TWB A;  1YIT Q;  1D0X A;  4M75 A;  3OYB A;  3SDZ A;  4AFS C;  5HKC A;  2KT1 A;  3NGP A;  1OV3 A;  1OU8 A;  1OPL A;  2E65 A;  2ABL A;  2EQU A;  1SKU B;  3M54 A;  5LJ3 f;  1RLP C;  2G6F X;  2RQU A;  1PG5 B;  3G6E T;  2EJF A;  3OYG A;  3C94 A;  3CD6 T;  3VKI A;  1U8R A;  2CSQ A;  2DFU A;  3V7C A;  1E7O A;  1YJ9 A;  3NPF A;  1OUL A;  3G7Z A;  3WXM B;  2OTJ Q;  3URG A;  2BUD A;  2EYW A;  4J7I A;  1VQ8 A;  3G71 T;  1E6H A;  4FW2 A;  2HCK A;  1SRL A;  1WZO A;  4E7I A;  4FT4 A;  1M90 R;  3CC2 Q;  2ZAE A;  2EGE A;  4LDU A;  3CBO A;  3JCM P;  2RHZ A;  1N27 A;  2EGA A;  1G3Y A;  2FRW A;  4M77 F;  4R0K A;  4C0D C;  2J6K A;  3CC7 T;  1U1S A;  3IQL A;  3CCU Q;  4CC7 A;  1XOV A;  1YBY A;  2CKK A;  2KI7 A;  3RNJ A;  1V76 A;  1KG1 A;  4BY6 B;  4JRQ A;  3A8M B;  1KK7 A;  4NS5 A;  2DL5 A;  4OB3 B;  4BDY A;  1JBM A;  2EQM A;  4M77 C;  5GAN 3;  3L2Z A;  1LPL A;  1Y96 B;  2GQI A;  3EH2 A;  3MP8 A;  4QVC A;  3CCR T;  2DLP A;  3MO8 A;  5FU7 C;  4FYY B;  4BDZ A;  2RN8 A;  3WVE B;  1RAC B;  2CP0 A;  2Y4Y A;  3VRZ A;  5KH6 A;  3QJ6 A;  3EG1 A;  1H64 1;  2V8I A;  4N4I A;  2GTJ A;  4GY5 A;  8AT1 B;  3QO3 A;  4HVW A;  1W2B P;  1C6V X;  4P5N A;  1GFD A;  3RES A;  5GMK h;  2DVJ A;  2YUO A;  5GJW B;  3G4S Q;  1VUB A;  3M0U A;  2JS2 A;  4NL3 A;  3P8H A;  4MZP A;  2LCS A;  4J9E A;  1M1K U;  2XIC A;  4KUD K;  3CC4 T;  1R77 A;  3H41 A;  4A4H A;  1AOJ A;  3G6E Q;  4XTV A;  1QQJ A;  1VA7 A;  2PTK A;  4LDV A;  3SD4 A;  2MMP A;  1JO8 A;  2DBM A;  2E1H A;  1YFN A;  2R58 A;  4IUR A;  5J39 A;  1QMC A;  2YLC A;  3QZ9 B;  1QVF P;  3E19 A;  4R56 A;  3LWI A;  3G71 Q;  1UEB A;  4HCK A;  2DTI A;  3A98 A;  4C92 B;  1D1C A;  1T3L A;  4PJO A;  3CCE Q;  3FJ5 A;  3G4S A;  2QAZ A;  2FB7 A;  2CUD A;  2OTL Q;  4OMN A;  2DNU A;  4IUP A;  3PT9 A;  5FWB A;  3CCL T;  3CCV Q;  1YNZ A;  3G6E A;  2BZX A;  3QBY A;  2HDA A;  1M2O A;  3G71 A;  5GMK e;  1SHF A;  3M4Y A;  5LJ5 f;  1WQ7 A;  2DMO A;  2E3I A;  3OYJ A;  2IPO B;  4OB0 B;  2F5K A;  4J6X A;  1Q81 U;  2COY A;  1WHJ A;  3JCM g;  3CEY A;  2OTL A;  2ESW A;  3FLG A;  3CCJ Q;  2MWO A;  4LDY A;  4J9C A;  2EWN A;  3CC7 A;  4EDU A;  1VYU A;  5GAN 8;  2QK0 A;  3UPU A;  2YWW A;  4MMK A;  4CC2 A;  1QW1 A;  2JOY A;  5IAY A;  1ZX6 A;  4JLI A;  3TCJ A;  1TOV A;  2X51 A;  4OB1 B;  5FRM A;  2LTO A;  1U5S A;  1VQO T;  3OS2 A;  2D8H A;  4OMO A;  1Q7Y U;  4C92 G;  1ZSZ C;  1M3A A;  4LXC A;  1PWT A;  1WJQ A;  2HQX A;  3M57 A;  5AYF A;  3CCR A;  3M4G A;  4IUQ A;  1NBE B;  3EG9 B;  2QTV A;  1UE9 A;  2IIM A;  1QVG P;  2FEI A;  5GAO l;  2CYZ B;  9ATC B;  3JB9 F;  4LUE A;  8ATC B;  1BCM A;  3M5A A;  3CBM A;  2FYK A;  1PSE A;  1PNJ A;  3CQT A;  1SF9 A;  2ROL A;  3OW2 S;  4HVU A;  3I35 A;  4J8O A;  3EG3 A;  2LQ8 A;  2LP5 A;  2ROT A;  5HK3 A;  2O4X A;  1JJ2 P;  1YJN Q;  4MML A;  1NLP C;  4XK8 E;  2ATC B;  4BI4 A;  1WLP B;  4E6R A;  2RJC A;  1TS9 A;  2PZ1 A;  5EC7 A;  2ZPB B;  3VS4 A;  3HL8 A;  1BK2 A;  3CC4 A;  1XJW B;  5I22 A;  4F7U A;  4BE2 A;  1KQ1 A;  2DYB A;  3H0H A;  3RBB B;  1NJI U;  2LT1 A;  1X2K A;  1ABQ A;  5GAM h;  1WHK A;  4L59 A;  4PK4 A;  4E7J A;  1YCY A;  1HJD A;  3JCM d;  2O9V A;  4M75 B;  2X4J A;  3RIR A;  2PUO B;  3THK A;  4RTY A;  4A4E A;  3SWN C;  2NWM A;  4PLL A;  5KYW A;  1KD1 U;  1D1A A;  3E9F A;  2A08 A;  2F1L A;  1Y7X A;  2FZK B;  3CCL A;  3BDU A;  2RH2 A;  4M77 E;  1QVP A;  3EFO A;  2K5L A;  2YT6 A;  3JCM b;  3OW2 A;  4B9W A;  2XHC A;  3E1S A;  3M0P A;  1X27 A;  1VQ6 T;  3PVQ A;  3DLL A;  1RUW A;  5D7U A;  3LX7 A;  1UHF A;  1JXO A;  2D0Q B;  3REB B;  4M7A A;  2EBP A;  3QG1 A;  4KRT A;  1UGS B;  2EVR A;  2KK4 A;  2X9H A;  4OVA A;  1MMG A;  1NE8 A;  1WNL A;  1MMA A;  1YJW Q;  5J3B A;  2EJG A;  2PUK B;  3M0T A;  1LOJ A;  2GBQ A;  4KGV B;  4F14 A;  1N8R U;  4QT7 A;  1MMD A;  2RJD A;  2VVK A;  3OSV A;  2YLB A;  5GAM e;  5KYU B;  2DEQ A;  3OS1 A;  1IHW A;  1JRI A;  4HVV A;  4M75 G;  2GNC A;  1IHV A;  3P8D A;  2P0Q A;  1WFW A;  3HPW A;  1WXB A;  2RB6 A;  1OX8 A;  4Z8A A;  2C0O A;  2D8J A;  3I56 T;  2CP7 A;  1G5V A;  4J83 A;  3DB3 A;  3AHU A;  3OYY A;  5CKD A;  1X6G A;  3CME Q;  2LQN A;  3S6W A;  3J80 E;  4X34 A;  4C92 D;  1AWO A;  2PVO B;  2DJQ A;  3NTI A;  1QCO A;  5LL6 S;  1YJW A;  3M0R A;  2D0N A;  3QWY A;  4F16 A;  4M75 E;  4N0A A;  4IKF A;  3JCM V;  3CXC P;  2EJ9 A;  2RA2 A;  1VYT A;  1UJY A;  3CCM Q;  5DM7 R;  1CSK A;  1Q95 G;  2XDP A;  1KJW A;  1OZ3 A;  5DLO A;  1UUE A;  3TRE A;  1XNI A;  3A8G B;  3LW5 E;  1OEB A;  1TXQ A;  2DER A;  3RMS A;  3BE3 A;  2XK0 A;  1O9S A;  2AKL A;  2ENM A;  1T0J A;  3CME A;  3VYH B;  4KH1 B;  1MHN A;  1K8A U;  2E10 A;  2YRD A;  2YUP A;  2EGC A;  1VQN Q;  1AT1 B;  1T3S A;  2YDL A;  2CZ6 B;  2EFI A;  3TSZ A;  4PJO B;  4Z88 A;  3MKD A;  2EYQ A;  3OS0 A;  3OYE A;  1UGQ B;  2B8A A;  4RTZ A;  3RKY A;  4PJL A;  3CMA Q;  2AHJ B;  4DA4 A;  1YIT T;  4C5H A;  3PIO A;  1TUD A;  2DF6 A;  4KH0 B;  2E6N A;  3L2U A;  4XTY A;  4BI3 A;  2HD0 A;  3OYH A;  3MCA B;  3M0Q A;  2EKO A;  5D6Y A;  3OYD A;  3EGX A;  3CPW P;  1WXT A;  1FMK A;  2K6D A;  1ZBJ A;  2FHD A;  1VQN A;  5A0D A;  1VQ6 A;  4J6Y A;  2JM8 A;  2M0O A;  1NYG A;  1G8X A;  2GF7 A;  1WXU A;  1BCO A;  2DYI A;  4FL6 A;  4IUV A;  2RJF A;  3OYK A;  4J9B A;  1WJR A;  1R8O B;  2W0Z A;  2DRK A;  3F70 A;  4CC3 A;  2L3S A;  2FVU A;  1GBR A;  3JCM Q;  2OTJ T;  4JZ3 A;  5FW9 A;  1BU1 A;  1K76 A;  2AIR B;  3CMA A;  2BZY A;  1AD5 A;  2K3X A;  4Y92 A;  3CC2 T;  1G2B A;  3R6O A;  3RR6 A;  2ZPF B;  4WTO B;  4BY6 C;  1K9M U;  3MEW A;  4M7D A;  4Q5W A;  5GAN h;  1MV3 A;  4F04 B;  1G3S A;  1W2B S;  2VXE A;  2KMT A;  2KXC A;  3BFM A;  4X1V A;  1H3Z A;  3CCU T;  4IIM A;  1OZ2 A;  2M1H A;  2EW3 A;  5IXB A;  4HA8 A;  4PJO G;  4EMK C;  3VV0 A;  4ZN1 A;  3L2Q A;  5A2Q E;  2H3E B;  2BE9 B;  3I56 A;  1Q81 R;  4M75 D;  2ZPE B;  4DBQ A;  2J06 A;  1K9A A;  4OMP A;  5AT1 B;  1XTD A;  3VS1 A;  1Q86 U;  5EG2 A;  4E7H A;  3SFM A;  3C0C A;  2ED1 A;  1Q82 C;  1UJ0 A;  3NMZ C;  1Y07 A;  5FRN A;  2VGN A;  2NUT B;  3NHN A;  3O5Z A;  2AK5 A;  3TSW A;  3R6N A;  1Q7Y R;  2LNV A;  5IT9 E;  4F7U B;  2O2O A;  1M2V A;  2EIF A;  1UG1 A;  1KC8 U;  3CCQ T;  2DEU A;  1U3O A;  4O6J A;  3V7R A;  3T9N A;  2EQK A;  1EIF A;  4RKU E;  1PM3 A;  5A0L A;  3G4S T;  3X20 B;  2V8K A;  1A0N B;  3VS2 A;  2K7A A;  2GGR A;  2HQE A;  4J6W A;  4M78 A;  1NEB A;  1MMN A;  1I5O B;  3V8L A;  3QUI A;  1PCX A;  1AHJ B;  2A3L A;  2ZCF B;  1QCN A;  2DXC A;  2JN0 A;  4C92 C;  2FPF A;  1TSF A;  3JCM J;  1TUG B;  1LVK A;  1M9S A;  5GAN e;  1KQS S;  3TEE A;  3ZFJ A;  5KYW B;  3INZ A;  4A4K A;  3OS5 A;  3X26 B;  1D0Y A;  1ARK A;  2K5F A;  1HD3 A;  5KE3 A;  2HL5 C;  5CKF A;  3C95 A;  3DB4 A;  4JJD A;  1FMW A;  1YIT A;  1ZA2 B;  3EFO B;  4DBH A;  4RG8 A;  1NJI R;  2YUN A;  2KAF A;  3CCE T;  2E41 A;  5CKB A;  2LQK A;  2OTL T;  4X9D A;  1YHQ T;  1NYF A;  4MDW A;  5HCK A;  2E3H A;  3CCV T;  2MPX C;  4LD6 A;  2CRE A;  4M7A B;  1QCF A;  1KQ2 A;  2VB6 A;  2RQR A;  2RHX A;  2ED0 A;  2CS7 A;  2CZ0 B;  1GCP A;  2PQW A;  3EG0 A;  1KD1 R;  4F7U G;  5KYU A;  2OTJ A;  1VIF A;  3MEV A;  1FYN A;  1IGQ A;  1WHH A;  1X43 A;  2K3B A;  2L2P A;  3CC2 A;  2MYS A;  2WSC E;  1NPP A;  1FX7 A;  1H3H A;  2LJ3 A;  4FW1 A;  2F2W A;  2DO3 A;  4LDX A;  3CCJ T;  4JRI A;  5L23 A;  3M9Q A;  3CCU A;  1KQS A;  1X6B A;  4HCZ A;  1JJ2 S;  3CCQ Q;  1EFN A;  3VUZ A;  3I9Q A;  4KBM B;  4JS4 A;  4WCI A;  2DL4 A;  4PJO D;  3CCS Q;  3L2R A;  5FRO A;  4WF2 A;  3HFO A;  2RQT A;  5KYX A;  1V1C A;  4JUV A;  3FRN A;  3SB2 A;  1QLY A;  2IG0 A;  3QYH B;  2XI9 A;  3I55 Q;  1PC0 A;  5CQY A;  3C12 A;  3GNG A;  4C5G A;  2E5K A;  4GBQ A;  4M75 F;  2RPN A;  5LJ3 g;  5GAM f;  5C6S A;  3JB9 I;  4D8D A;  1DJ7 B;  1GCQ C;  4M7A G;  2CZ7 B;  1BI3 A;  3KUF A;  1QKX A;  2HBW A;  5C0M A;  2QA4 Q;  3OYN A;  1I4K 1;  1WX6 A;  2BZ8 A;  3CCQ A;  1KIK A;  1YJN T;  2FZC B;  2A37 A;  1LCK A;  4VUB A;  1AWX A;  3UDC A;  3CCS A;  5GJV B;  3OA6 A;  5D6W A;  1YHQ Q;  4M75 C;  3VS0 A;  4C8Q A;  1GXI E;  5CK9 A;  2AT1 B;  4EPC A;  3NFC A;  2PVD B;  3UA7 A;  4HT9 A;  4E7S A;  2HQH A;  1UGP B;  3QKJ A;  2EYY A;  4LNP A;  4MDX A;  3LLR A;  3NTK A;  1UEC A;  3MHX A;  1ZLM A;  2OAW A;  5LJ3 h;  2EKH A;  3TVT A;  1H8K A;  2QA4 A;  1K4U S;  1W1F A;  5LJ3 j;  3JB9 J;  2FO0 A;  3H0F A;  1RAH B;  2BE7 D;  3CCE A;  4FYX B;  3EGX B;  2MI6 A;  2V8J A;  2X3W D;  1YHQ A;  1MND A;  5KYN A;  4QVZ A;  3UWN A;  3U23 A;  3CCV A;  2XDD A;  1Y0M A;  3H8Z A;  2RO0 A;  2L8D A;  3QDF A;  3LH0 A;  4DOV A;  3ULR B;  3GIB A;  3MP1 A;  4O5V A;  1W4S A;  2RHI A;  5LJ3 d;  4J9H A;  4RG2 A;  4M7D B;  1MUZ A;  2XG8 D;  2AZV A;  2QAS A;  3VS3 A;  1WDX A;  3Q1J A;  1QP2 A;  1MNE A;  3CCJ A;  1ZBX A;  2L5Q A;  1HSQ A;  1YJW T;  3M0S A;  3FDR A;  1M90 C;  2RHU A;  5HK0 A;  3CXC S;  2HMA A;  4J5Y A;  3JCM h;  2AKK A;  1HYO A;  1YWP A;  2DX1 A;  2LC4 A;  4C92 E;  3EH1 A;  1X69 A;  1ABO A;  2X4W A;  2NUT A;  1OI1 A;  2COW A;  3A8O B;  4FIB A;  4RTV A;  1ACM B;  1UFF A;  2E64 A;  5LJ3 e;  1WGS A;  1K9M R;  4FSS A;  2DBK A;  4II1 A;  2DD5 A;  3CME T;  3RUX A;  2RM4 A;  2RD1 A;  4OMM A;  2ECZ A;  5M9O A;  4A4G A;  4BD3 A;  4ZGD B;  1RLQ C;  4JZ4 A;  1M2V B;  2R5A A;  4PFP A;  4K11 A;  6AT1 B;  3RMQ A;  2JW4 A;  1K73 R;  3A5Z B;  1TH7 A;  2HSE B;  2QDY B;  3RER A;  1YJN A;  3CCM T;  2KRO A;  4M7A D;  1R0B G;  4M78 B;  1D3B B;  1K0S A;  3ASK A;  2LQW A;  1IGU A;  2HL3 A;  5LJ5 g;  4ANJ A;  4A54 A;  5IH2 A;  4M7D G;  2G3R A;  2JM9 A;  4PJO C;  2NYS A;  1GL5 A;  1N9R A;  2FPE A;  4ORZ A;  2KR3 A;  3CXC A;  2LX7 A;  1BKB A;  1I07 A;  3H0I A;  1VIE A;  2DL7 A;  1VQN T;  1H92 A;  3TU4 K;  1T0H A;  1KC8 R;  2BIV A;  3JCM e;  2F5T X;  1WJS A;  2WSE E;  5GAO p;  4XTU A;  1P92 A;  2CP5 A;  4M7D E;  5GAN 7;  2PU9 B;  1PD1 A;  2FG0 A;  1B07 A;  3GNF B;  2DXU A;  4KGZ B;  3CMA T;  1U1T A;  2K9G A;  5GMK i;  5KCH A;  1AVZ C;  3BW1 A;  4OGC A;  1SG5 A;  2CH4 A;  2RJE A;  3HRU A;  2HKQ B;  3L42 A;  5GAN f;  2EPD A;  5LJ5 j;  4PL6 A;  3KBG A;  1TTH B;  4OMQ A;  5I2S A;  1OPK A;  3QXE B;  1SEM A;  1KHI A;  3PGG A;  2DPP B;  5D6X A;  3PMI A;  2L3P A;  4IUT A;  4UC4 A;  4C0F A;  4XAX B;  3HFN A;  1SSF A;  3MEU A;  4M78 G;  2EYX A;  2VUB A;  4D6W A;  2L3R A;  1S1N A;  4FT2 A;  1BI0 A;  4C5E A;  3A1P A;  1ZHI A;  3JCM c;  2COZ A;  5CAI A;  5LJ5 d;  2JNG A;  3N5B B;  1ZUK A;  4N4G A;  5IHN A;  1WQW A;  4F7U F;  2QTX A;  2LJ1 A;  4E7L A;  1WHG A;  4JJB A;  3M53 A;  4M78 E;  1BBZ A;  4RTT A;  4CI0 C;  4Y91 A;  5KYX B;  2KEA A;  1G3T A;  2DZ9 A;  1IRE B;  3G1J A;  4JJC A;  4PFO A;  4XTW A;  1CKA A;  2JZ2 A;  1HXD A;  1VQ4 T;  4ELZ C;  4V2S A;  2R5M A;  4HXJ A;  3KFV A;  2FZG B;  3OW2 P;  2J05 A;  4J9I A;  3L2V A;  5CIU A;  2QQR A;  4HCB A;  1YWO A;  1C1A A;  3TQ7 P;  1VOM A;  2LNH B;  1M4Z A;  3UT1 A;  3QHS A;  1IZ6 A;  4ZGE B;  1AZE A;  3VUB A;  3V8K A;  3CCM A;  2JTM A;  2QEX Q;  3V8J A;  1M1K R;  1FXX A;  4C0Z A;  2DL8 A;  4C8Q B;  4IUU A;  1VQ9 T;  3LYI A;  1M30 A;  4C0G A;  2DET A;  2QGF B;  3HP9 A;  2VV5 A;  4B9X A;  1N6A A;  2KYM A;  4A53 A;  3S3O A;  4M7D D;  2LZ6 B;  3LWH A;  4M7A F;  4AG1 C;  2V26 A;  1RL2 A;  3M58 A;  3VU3 C;  2CP6 A;  4Z02 A;  2MOX A;  2RI3 A;  4KUL A;  4RMO A;  2F2X A;  1UDL A;  2CT3 A;  2KDS A;  2QEX A;  3EGD A;  1LNX A;  1YCS B;  4KGX B;  1K73 C;  1GBQ A;  5FWC A;  1OX9 A;  3FJP A;  3J81 E;  4FCY A;  3OYL A;  3HRT A;  3M56 A;  3QII A;  4JS5 A;  4M7A C;  2D1X A;  3JB9 G;  3SEM A;  2QXF A;  2JJ9 A;  1SSH A;  4M77 A;  2EYZ A;  4B6M A;  2VYT A;  3ZBD A;  3HTR A;  2RMO A;  4E47 A;  1QWE A;  1I5L A;  2RQV A;  2VKN A;  2JMC A;  3EHR A;  2DM1 A;  4JLG A;  1QWF A;  1VQ4 Q;  1IXD A;  2DRM A;  3JSC A;  4J7F A;  2ZPG B;  4C8Q G;  4ELY C;  4NL2 A;  2BTT A;  4FYV B;  1UGV A;  2DVE A;  4M78 D;  2L89 A;  1ZSG A;  2K79 A;  2P4T A;  1S72 T;  4R55 A;  1KHC A;  2MIO A;  1YIJ Q;  1UGR B;  3RKX A;  1YP5 A;  4E7K A;  2RF0 A;  4PJO E;  2JVV A;  2K5I A;  1QP3 A;  3L1A A;  2HBP A;  1QVF S;  2QQB A;  2KXD A;  4C92 F;  5DY9 A;  4OP0 A;  4N0A C;  4OF1 A;  2PNI A;  1VQ9 Q;  4HT8 A;  2P0P A;  1VQ4 A;  5GAO n;  2CZ1 B;  1W70 A;  2KRS A;  3X25 B;  3VRY A;  2E6Z A;  1VQK T;  5GAO q;  3CCS T;  1PHT A;  1JEG A;  2NUZ A;  2H8H A;  2RI2 A;  4J9F A;  1YJ9 Q;  1D3B A;  1YN8 A;  1D0Z A;  3EAE A;  2HEQ A;  4EMG A;  4BAC A;  3I55 T;  1W2B A;  1VQM T;  1YIJ A;  4DBR A;  2J6O A;  1VQP Q;  3QYG B;  1EZZ B;  3HHT B;  2PVG B;  1JB0 E;  3VJP A;  3I5S A;  2DA9 A;  1Q82 U;  1WHM A;  2D9T A;  3JCM X;  4ZTJ A;  1VQ9 A;  2QA4 T;  4CC4 B;  2LX9 A;  1D09 B;  4D8K A;  2P0K A;  1WI7 A;  2DIL A;  3EGU A;  1CKB A;  5A0G A;  2QG9 B;  1SHG A;  4Z89 A;  1RAA B;  4XTX A;  2KNB B;  1X6O A;  1QVF A;  3ZEH A;  2QQS A;  1UHC A;  1VQP A;  2RK2 A;  3OMG A;  1W6X A;  2EQJ A;  3O8V A;  2CP3 A;  1X2Q A;  2JTE A;  4FU6 A;  5J26 A;  2DK3 A;  3DLM A;  3LH5 A;  4M7D F;  3HKS A;  4LE9 A;  1WIE A;  2GTO A;  5DLQ E;  1S72 Q;  2ZPH B;  2DAQ A;  4BUG A;  1QVG S;  1K0X A;  2BKD N;  3QSU A;  1FWZ A;  1OOT A;  1M1K C;  3MEA A;  4PFZ A;  1ZSZ A;  5FU6 B;  2SRC A;  4MZM A;  3JB9 H;  4BI8 B;  4DQ2 A;  1PD0 A;  1BI1 A;  5GAO m;  4DEX A;  3JB9 D;  2DL3 A;  4OB2 B;  2OAU A;  5GAN 5;  3JCM W;  4F7U E;  2JMA A;  3JCM f;  2OX7 A;  4M7D C;  3V7S A;  4EMK B;  1UTI A;  3OB9 A;  1ZA1 B;  3L2W A;  5I11 A;  3S3N A;  2JXB A;  3RDV A;  1WYX A;  1VQK Q;  3M55 A; 
#chains in the Genus database with same CATH homology
 1W2B S;  3NTI A;  3OYM A;  1K73 U;  1ZQ1 A;  2LC4 A;  4C92 E;  4OMF B;  4HKE A;  3FEO A;  5LL6 S;  2LRQ A;  1YJW A;  3PIP A;  2DXB A;  2QQA A;  1S72 A;  3MET A;  1N9S A;  2X4W A;  4M75 E;  1VQ5 T;  1OI1 A;  4N0A A;  4C8Q D;  4IKF A;  4XU1 A;  3JCM V;  3A8O B;  4FIB A;  3VYG A;  2DZC A;  4C8Q E;  2ZGW A;  1OYX A;  2EJ9 A;  2E64 A;  2RA2 A;  3QJY A;  5GMK j;  4RCB A;  2Y4X A;  5LJ3 e;  1WGS A;  5DM7 R;  5KCO A;  2DKG A;  2XDP A;  1OZ3 A;  3PNW C;  5DLO A;  3TRE A;  1XNI A;  2O4X B;  1NZ9 A;  4BB7 A;  4II1 A;  1BIB A;  5GAN d;  2DD5 A;  2M9U A;  3CME T;  2I2L A;  3HSB A;  5GMK m;  3A8G B;  3LW5 E;  3ME9 A;  2RM4 A;  4M78 F;  2RD1 A;  3RUX A;  3RMS A;  5M9O A;  2WSF E;  4A4G A;  4BD3 A;  3ER0 A;  4ZGD B;  2XD0 A;  2XK0 A;  1O9S A;  1V29 B;  4DOW A;  4YTL A;  2F69 A;  2R5A A;  3RMQ A;  3CME A;  1VQK A;  3VYH B;  3A5Z B;  2RHY A;  1TH7 A;  1MHN A;  1K8A U;  1QVG A;  4LDW A;  2E10 A;  4M75 A;  2JTF A;  3SDZ A;  3OYB A;  2QDY B;  3PTA A;  3RER A;  1B34 A;  5HKC A;  3SWN A;  4BE1 A;  1YJN A;  3CCM T;  5CKE A;  3KXT A;  3GLX A;  1Q81 C;  4M7A D;  4QQG A;  4M78 B;  5I21 A;  1D3B B;  4JRK A;  3ASK A;  3I55 A;  2CZ6 B;  3GP8 A;  2E65 A;  1VQM A;  4RCC A;  2EFI A;  4M7A E;  2EQU A;  4PJO B;  5LJ5 g;  4M78 C;  4A54 A;  4HCC A;  3M54 A;  2EYQ A;  3OS0 A;  4M7D G;  5LJ3 f;  3OYE A;  3P8B B;  2G3R A;  3RKW A;  1JJ2 A;  4PJO C;  1UGQ B;  3G6E T;  2B8A A;  2EJF A;  1N9R A;  3OYG A;  3RKY A;  3C94 A;  2GFA A;  3CD6 T;  3VKI A;  1U8R A;  2AHJ B;  3CXC A;  4DA4 A;  1YIT T;  3LGL A;  1BKB A;  4XU0 A;  3V7C A;  4C5H A;  3PIO A;  1VIE A;  3X24 B;  1YJ9 A;  3G7Z A;  3WXM B;  1VQN T;  2MWP A;  2E6N A;  3TU4 K;  2LT4 A;  3CD6 A;  3URG A;  2BUD A;  2K2V A;  3L2U A;  4J7I A;  1VQ8 A;  2BIV A;  3PMT A;  2KSS A;  2F5T X;  2KVQ G;  1WJS A;  2HD0 A;  2WSE E;  2IVW A;  4XTY A;  4BI3 A;  5GAO p;  2Y90 A;  2LDM A;  3MCA B;  3OYH A;  4E7I A;  2EKO A;  4FT4 A;  5D6Y A;  4ZN3 A;  3OYD A;  4XTU A;  1P92 A;  1M5Q 1;  4M7D E;  3NTH A;  5GAN 7;  2FHD A;  2PU9 B;  4C0D B;  4LDU A;  3CBO A;  1VQN A;  4TVR A;  5A0D A;  3JCM P;  2RHZ A;  4J6Y A;  1VQ6 A;  1N27 A;  2M0O A;  5CQX A;  1G3Y A;  2GF7 A;  2XID A;  4M77 F;  3GNF B;  4C0D C;  4FL6 A;  2DXU A;  2RJF A;  4IUV A;  3OYC A;  3OYK A;  3CMA T;  1U1T A;  3LGF A;  1WJR A;  3CC7 T;  1R8O B;  1U1S A;  5GMK i;  5KCH A;  3F70 A;  2FVU A;  3BW1 A;  4OGC A;  1XOV A;  1YBY A;  2CKK A;  3JCM Q;  2OTJ T;  2RJE A;  3HRU A;  3CMA A;  3L42 A;  1KG1 A;  5GAN f;  1G3W A;  5LJ5 j;  2K3X A;  4PL6 A;  4BY6 B;  3KBG A;  3CC2 T;  4JRQ A;  2RI5 A;  3A8M B;  5I2S A;  4JDS A;  3R6O A;  4NS5 A;  3QXE B;  4M77 B;  2ZPF B;  1KHI A;  3PGG A;  2DPP B;  2DTO A;  4BY6 C;  2DJZ A;  1K9M U;  3MEW A;  5D6X A;  2KY9 A;  4OB3 B;  4BDY A;  4ATO A;  4Q5W A;  5GAN h;  1JBM A;  4M7D A;  2EQM A;  3PMI A;  1M1G A;  4IUT A;  1G3S A;  4M77 C;  4UC4 A;  2VXE A;  5FU7 B;  4C0F A;  5GAN 3;  3L2Z A;  2KMT A;  3BFM A;  4XAX B;  3HFN A;  1H3Z A;  1SSF A;  1Y96 B;  3MEU A;  3MP8 A;  4QVC A;  4M78 G;  3CCR T;  3CCU T;  3MO8 A;  4KT0 E;  1OZ2 A;  2M1H A;  5FU7 C;  3C4S A;  2VUB A;  4D6W A;  1NJI C;  3BY7 A;  2L3R A;  4JRP A;  4HA8 A;  4PJO G;  4EMK C;  4BDZ A;  3VV0 A;  1HK9 A;  4FT2 A;  3WVE B;  5FLX E;  1BI0 A;  4XU3 A;  5GAM g;  2Y4Y A;  4ZN1 A;  5KH6 A;  4C5E A;  4NOY A;  3QJ6 A;  5CR2 A;  3L2Q A;  5A2Q E;  1H64 1;  2V8I A;  4N4I A;  4X9C A;  3I56 A;  2DIQ A;  4GY5 A;  4M75 D;  2ZPE B;  3QO3 A;  5L8R E;  1ZHI A;  2DXT A;  4P5N A;  3JCM c;  2VXF A;  3RES A;  5CAI A;  1XTD A;  2X4X A;  5LJ5 d;  5GMK h;  2YRV A;  2JNG A;  3N5B B;  4N4G A;  1WQW A;  5EG2 A;  1Q86 U;  4E7H A;  4F7U F;  2QTX A;  3SFM A;  2NLU A;  4E7L A;  3M53 A;  4M78 E;  1Q82 C;  1VUB A;  4CI0 C;  4NL3 A;  3P8H A;  1VQ5 A;  4MZP A;  2D6F A;  1KD1 C;  1M1K U;  4Y91 A;  1Y07 A;  2XIC A;  4KUD K;  5FRN A;  1G3T A;  2DZ9 A;  1IRE B;  2VGN A;  3CC4 T;  1VQL T;  4XTW A;  4A4H A;  2JZ2 A;  1HXD A;  5CO7 A;  4ELZ C;  1VQ4 T;  4PJO F;  3JCM e;  4V2S A;  3QPH A;  2R5M A;  4XTV A;  2LNV A;  3WVD B;  5IT9 E;  4LDV A;  4OGE A;  4F7U B;  3SD4 A;  2EIF A;  2MMP A;  1KC8 U;  2E1H A;  3CCQ T;  2R58 A;  3L2V A;  3JAM E;  4IUR A;  5CIU A;  4C8Q F;  4O6J A;  3V7R A;  3T9N A;  2EQK A;  2QQR A;  4XU2 A;  5J39 A;  4HCB A;  1M90 U;  1EIF A;  4RKU E;  2YLC A;  3QZ9 B;  5A0L A;  3X20 B;  3E19 A;  3OYA A;  3G4S T;  4R56 A;  1I8F A;  3LWI A;  2V8K A;  3A8L B;  1Y71 A;  5KE2 A;  1M4Z A;  3UT1 A;  2HQE A;  3QHS A;  1UEB A;  1IZ6 A;  4J6W A;  4ZGE B;  2DTI A;  4M78 A;  5GAO r;  2XU8 A;  3VUB A;  4C92 B;  5GAM j;  3H6Z A;  3V8L A;  3G71 T;  4M77 G;  3QUI A;  3V8K A;  4PJO A;  1AHJ B;  5GMK l;  2A3L A;  3CCM A;  2JTM A;  2ZCF B;  1O75 A;  2DXC A;  3G4S A;  3V8J A;  2FB7 A;  4ZTF A;  4PNO A;  2JN0 A;  4C92 C;  1FXX A;  3FC3 A;  4C0Z A;  4QVD A;  4IUP A;  3JCM J;  2X4Y A;  4C8Q B;  3CPW S;  5GAN e;  1M9S A;  4IUU A;  1VQ9 T;  3PT9 A;  1KQS S;  3LYI A;  3TEE A;  3ZFJ A;  4C0G A;  3CCL T;  3QDR B;  3INZ A;  4A4K A;  3HP9 A;  4C8Q C;  1N8R C;  3FB9 A;  3DKM A;  3G6E A;  2VV5 A;  2O01 E;  3OS5 A;  2R57 A;  3X26 B;  4CRI A;  4ME7 A;  4B9X A;  2K5F A;  1N6A A;  4A53 A;  5KE3 A;  5CKF A;  3QBY A;  4FM4 B;  3C95 A;  3DB4 A;  3S3O A;  1YIT A;  4M7D D;  2GFU A;  3LWH A;  4M7A F;  3PFS A;  1VQ7 T;  3S3M A;  1RL2 A;  4RG8 A;  5GAN 2;  5GAN 4;  1XQH A;  3M58 A;  2KAF A;  3VU3 C;  3A8H B;  3CCE T;  4Z02 A;  2QEX T;  2E41 A;  3OQ5 A;  2LQK A;  5CKB A;  2OTL T;  3G71 A;  2RI3 A;  4KUL A;  4X9D A;  5GAM d;  1X75 C;  4RMO A;  1UB4 A;  5GMK e;  1YI2 T;  3CPF A;  3M4Y A;  1YHQ T;  3EFS A;  5LJ5 f;  1WQ7 A;  4MDW A;  2KDS A;  5CCA A;  3CCV T;  3OYJ A;  4LD6 A;  4OB0 B;  1M1F A;  2F5K A;  4J6X A;  3JCM g;  2QEX A;  1Q81 U;  1LNX A;  3CEY A;  2OTL A;  4M7A B;  1I81 A;  3FLG A;  2MWO A;  4GLK A;  1K73 C;  4LDY A;  3FJP A;  1KQ2 A;  3J81 E;  5LJ5 h;  3HRT A;  3M56 A;  3OYL A;  2EWN A;  3QII A;  3CC7 A;  4JS5 A;  2RHX A;  2CS7 A;  4M7A C;  4Y28 E;  2CZ0 B;  2PQW A;  4EDU A;  3JB9 G;  2QXF A;  5GAN 8;  4F7U G;  2OTJ A;  3UPU A;  4QW2 A;  2WAC A;  1VIF A;  2EAY A;  4M77 A;  2HNI A;  2LCL A;  3MEV A;  4MMK A;  5CVI A;  2GCX A;  2RK1 A;  1QW1 A;  2VYT A;  2JOY A;  3ZBD A;  5IAY A;  2WSC E;  3M59 A;  2XKO C;  4JLI A;  3TCJ A;  3CC2 A;  4E47 A;  3JRZ A;  1MGQ A;  4OB1 B;  5FRM A;  2LTO A;  4EMK A;  1NPP A;  1I5L A;  1Y96 A;  1VQO T;  1FX7 A;  3OS2 A;  2DO3 A;  1Q7Y U;  4JJN K;  4C92 G;  4LDX A;  3CCJ T;  4JLG A;  2LVM A;  3J7A F;  1WJQ A;  2HQX A;  4JRI A;  3M57 A;  4PKC C;  3M9Q A;  5AYF A;  3CPW A;  3M4G A;  4IUQ A;  3JSC A;  3CCR A;  3CCU A;  4J7F A;  1VQO A;  1X01 A;  4BE0 A;  2ZPG B;  1KQS A;  1RI0 A;  4HCZ A;  4C8Q G;  4NL2 A;  4ELY C;  1JJ2 S;  2XDB A;  1K8A C;  5GAO l;  3GF5 A;  2ZPI B;  2CYZ B;  2FL7 A;  3VUZ A;  3JB9 F;  2DVE A;  4M78 D;  2L89 A;  2P4T A;  3M5A A;  3CBM A;  2FYK A;  3MP6 A;  4KBM B;  3GPL A;  1S72 T;  4JS4 A;  1PSE A;  4R55 A;  3OW2 S;  1KHC A;  4PJO D;  3CBP A;  3E9G A;  1UGR B;  4J8O A;  2M16 A;  4QQD A;  2LQ8 A;  3RKX A;  3L2R A;  4E7K A;  5FRO A;  4PJO E;  5HK3 A;  2JVV A;  2DTH A;  2K5I A;  3HFO A;  4WF2 A;  3OY9 A;  1BYM A;  1QP3 A;  2O4X A;  4MML A;  3L1A A;  4XK8 E;  2H3J A;  2HBP A;  4JUV A;  1QVF S;  2QQB A;  3FRN A;  3SB2 A;  4BI4 A;  2IG0 A;  3QYH B;  2XI9 A;  2RJC A;  4C92 F;  5DY9 A;  5CQY A;  4OP0 A;  4N0A C;  1WPY A;  3C12 A;  4OF1 A;  4N4H A;  2ZPB B;  3GNG A;  4C5G A;  3HL8 A;  3CC4 A;  4M75 F;  2C06 A;  1VQL A;  5IN1 A;  5LJ3 g;  4HT8 A;  4F7U A;  5GAM f;  5GAN 6;  2P0P A;  5C6S A;  1DJ7 B;  1KQ1 A;  2KQW A;  3JB9 I;  4BE2 A;  5GAO n;  1VQ4 A;  2CZ1 B;  3OBY A;  3OYI A;  4EMH A;  3X25 B;  2E6Z A;  2CZ7 B;  1VQK T;  4M7A G;  1NJI U;  5GAO q;  1BI3 A;  3KUF A;  4FSX A;  3CCS T;  2LT1 A;  1YIJ T;  2RI2 A;  5GAM h;  5C0M A;  2E70 A;  1D3B A;  1I4K 1;  4L59 A;  3FIF A;  5LJ5 e;  3OYN A;  3EAE A;  3CCQ A;  2E12 A;  1YJN T;  4E7J A;  4C5I A;  1YCY A;  2HAX A;  2K3Y A;  2MAM A;  4VUB A;  4C92 A;  3JCM d;  4EMG A;  4M75 B;  3UDC A;  3I55 T;  4BAC A;  1W2B A;  1VQM T;  2X4J A;  1B34 B;  3RIR A;  3CCS A;  1YIJ A;  3SWN B;  3OA6 A;  3QYG B;  2PUO B;  5D6W A;  3OYF A;  3HHT B;  1M8V A;  3BDL A;  4M75 C;  2ZZD A;  4A4E A;  4LD9 K;  4C8Q A;  2PVG B;  1JB0 E;  3VJP A;  1GXI E;  3SWN C;  5CK9 A;  4EPC A;  2QQ9 A;  3NFC A;  4PLL A;  1Q82 U;  2PVD B;  4HT9 A;  3OSS C;  3QKJ A;  1UGP B;  2D9T A;  1KD1 U;  4MDX A;  3LLR A;  5CKH A;  3NTK A;  3E9F A;  2YHT A;  3JCM X;  4ZTJ A;  1VQ9 A;  4M77 D;  1Y7X A;  1YJ9 T;  2QA4 T;  5I2M A;  3CCL A;  2LX9 A;  3BDU A;  2RH2 A;  4M77 E;  4QQ6 A;  1QVP A;  2X35 A;  1K9M C;  1VQ8 T;  3MHX A;  2P0K A;  5GAN g;  2K5L A;  3EFR A;  3JCM b;  5LJ3 h;  3OW2 A;  4B9W A;  5A0G A;  1VQP T;  2DIG A;  3OBW A;  2QA4 A;  2XHC A;  5LJ3 j;  3E1S A;  3JB9 J;  2DD4 A;  4XTX A;  1VQ7 A;  3GOX A;  1VQ6 T;  3CCE A;  3DLL A;  2MI6 A;  1X6O A;  2V8J A;  1QVF A;  3ZEH A;  3LX7 A;  2QQS A;  1VQP A;  2MF2 A;  2RK2 A;  3OMG A;  1YI2 A;  2A7Y A;  2D0Q B;  2K4Y A;  4XTZ A;  3HRS A;  1YHQ A;  4M7A A;  2EQJ A;  3O8V A;  4QVZ A;  3UWN A;  3QG1 A;  1NPR A;  2LCC A;  1UGS B;  3CCV A;  2XDD A;  4FU6 A;  5J26 A;  2KK4 A;  4OVA A;  2DK3 A;  2VC8 A;  2RO0 A;  1LJO A;  2L8D A;  3DLM A;  3H8Z A;  4PLI A;  3X28 B;  4M7D F;  3HKS A;  3LH0 A;  4DOV A;  5HY6 A;  1NE8 A;  1WNL A;  1Q86 C;  3GIB A;  5DLQ E;  4L5G A;  5J3B A;  2EJG A;  2PUK B;  3MP1 A;  2ZPH B;  1LOJ A;  2DAQ A;  4XQ3 A;  4BUG A;  1Q7Y C;  1QVG S;  2BKD N;  1N8R U;  3QSU A;  1FWZ A;  1W4S A;  4O5V A;  1M1K C;  4L6V 5;  4MZT A;  2RJD A;  3MEA A;  2RHI A;  2CGH A;  5FU6 B;  5LJ3 d;  3OSV A;  4MZM A;  2VGM A;  2JUF A;  3JB9 H;  1PSF A;  2YLB A;  4RG2 A;  4BI8 B;  5GAM e;  4DQ2 A;  1BI1 A;  5GAO m;  2DEQ A;  3OS1 A;  3JB9 D;  3QZ5 B;  1JRI A;  4M7D B;  4M75 G;  4OB2 B;  5FU6 C;  2XG8 D;  2GQV A;  2OAU A;  5GAN 5;  3P8D A;  2P0Q A;  4ZGJ B;  3JCM W;  4F7U E;  3JCM f;  1KC8 C;  3Q1J A;  2E5Q A;  1QP2 A;  4M7D C;  3HPW A;  2QI2 A;  1BI2 A;  3V7S A;  3CCJ A;  5GAN j;  2RB6 A;  4EMK B;  3L2W A;  1ZBX A;  2L5Q A;  3OB9 A;  3OMC A;  1YJW T;  3I56 T;  1G5V A;  3FDR A;  4J83 A;  1M90 C;  2RHU A;  3DB3 A;  3S3N A;  3OYY A;  3AHU A;  5HK0 A;  3CXC S;  5CKD A;  4J5Y A;  4A4F A;  1BIA A;  3S6W A;  3J80 E;  3JCM h;  4KUI A;  4X34 A;  3M55 A;  4C92 D;  2PVO B;  2K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...