3PFSA

Pwwp domain of human bromodomain and phd finger-containing protein 3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
134
structure length
134
Chain Sequence
b'GRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain and PHD finger-containing protein 3
publication title Structural and histone binding ability characterizations of human PWWP domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pfsA00
5M9OA 4A4GA 2EQJA 3L2WA 3BDLA 4BD3A 3OYNA 3MEWA 5J39A 3PNWC 2VYTA 3L2VA 3MEAA 3LLRA 4E7LA 3ME9A 2LDMA 2G3RA 3MP1A 4EDUA 2GFAA 4FU6A 3OYIA 4BE1A 3L42A 1KHCA 2BKDN 3OYFA 2RO0A 1RI0A 3H6ZA 3PMIA 4E7KA 2LRQA 1WJQA 5C6SA 2R5MA 5KE3A 2DIQA 2RI3A 3S6WA 1XNIA 5D6YA 3OB9A 4C5EA 2XDPA 1OI1A 2RHIA 1WJRA 3OYJA 3OY9A 1N27A 3H8ZA 4A4FA 4QQDA 4QQ6A 2R5AA 2LCCA 3FDRA 3QBYA 2RJDA 1OZ3A 4N4GA 2JTFA 4IUTA 2L89A 1WGSA 3E9GA 2L3RA 2DIGA 2BUDA 2RHYA 4GY5A 3P8DA 4L59A 2EKOA 4N4IA 4QQGA 2R57A 4BDZA 3NTIA 2K3YA 4C5HA 3OYGA 3CEYA 5FRMA 4Q5WA 2QQSA 4LD6A 2E5QA 3OS0A 2HQEA 4OVAA 5IN1A 1OZ2A 2L8DA 3OQ5A 4BE2A 3E9FA 2X35A 3GOXA 2RJEA 3FEOA 4B9WA 3OYCA 2RI2A 2M16A 4C5GA 4PLIA 3Q1JA 3UWNA 3OYDA 2RHUA 4ZTJA 3S3MA 2YRVA 4X34A 5J26A 3SD4A 3LGLA 5FRNA 3F70A 2P0KA 4QVZA 3OA6A 4PL6A 2R58A 4A4HA 3UT1A 2X4YA 2PQWA 4CRIA 4E7HA 4IUQA 3FC3A 3M9QA 1OYXA 3LH0A 2LVMA 3LGFA 3QJ6A 3MP8A 5D6WA 5KCOA 3FLGA 2B8AA 3MO8A 2DAQA 4RG2A 3OYEA 3OS1A 3NTHA 5KCHA 4E7IA 4FL6A 2MWOA 2XK0A 3OYHA 3O8VA 2RI5A 2RJCA 5C0MA 3OYBA 3LYIA 2QQRA 1WJSA 1G5VA 4Z02A 4ZTFA 3OMCA 4IURA 4C5IA 3OYMA 3OYLA 4E7JA 2EQUA 3PFSA 3QKJA 4HCZA 2IG0A 3EAEA 2M1HA 4PLLA 3OYKA 2BIVA 3KUFA 4IUPA 3MP6A 3DLMA 4A4EA 2O4XA 4B9XA 3NTKA 3ZEHA 2HQXA 2O4XB 4II1A 5CIUA 3PMTA 4NS5A 1H3ZA 2NLUA 1MHNA 2D9TA 2CKKA 2JZ2A 2EQKA 3QIIA 2RJFA 2K3XA 4IUVA 2M0OA 2FHDA 5KE2A 3OS2A 2EFIA 3MEVA 4QW2A 5KH6A 3L2RA 2RHXA 1SSFA 5IAYA 2E6NA 2RHZA 3P8HA 4N4HA 2WACA 3LX7A 2F5KA 3C4SA 2LTOA 3DB4A 5D6XA 3L2QA 2MWPA 3OYAA 3L2UA 4BDYA 3META 3DB3A 3OMGA 4IKFA 2GFUA 4UC4A 3S3OA 2GF7A 2X4XA 2X4WA 4BACA 4BE0A 4IUUA 5FROA 3MEUA 3ASKA 3S3NA 2EQMA
chains in the Genus database with same CATH superfamily
1Q7YC 1M3BA 1QCOA 1YFNA 2LZ6B 3T9NA 2EJFA 3NHNA 2RO0A 3OYYA 2DYBA 5AT1B 2AHJB 5GAMg 3CMEQ 2AKKA 4ZGDB 4C0GA 1VOMA 1FWZA 3A8GB 3QDRB 1UGSB 3H8ZA 3CD6A 2EGAA 1A0NB 3CCEA 5GMKm 3G71A 1UEBA 1ZQ1A 2O9SA 2Y4XA 1N8RC 3CCMA 1VQLT 4C92G 2HAXA 4RKUE 3FEOA 4J9FA 2DJZA 3X28B 1UTIA 3S3MA 1PG5B 3SD4A 4HKEA 4J9EA 2QQAA 4XU1A 2R58A 4J7IA 2AIRB 5KYYA 5KYXB 1BCOA 1DJ7B 1KD1C 2HSPA 2M9UA 3JB9H 3C0CA 4M7DF 3OYEA 2KMTA 3BDUA 5GAOl 1RI9A 3HPWA 4JZ3A 3QYHB 3DLLA 4XK8E 4M7DB 2Y4YA 3CC7A 1QVGA 2VV5A 2ZPGB 5J3BA 1VQ7T 5FU6B 2BIVA 2K5FA 4CC3A 3NTKA 1VQ6T 3RBBB 1ZSZB 2K3XA 3QSUA 1X01A 3FJ5A 1ZHIA 2F69A 1NJIR 2KT8A 4LNPA 3EH2A 4JJCA 5CVIA 1K73U 1NLPC 2HL5C 3CBOA 1D1CA 4F7UE 4A4GA 2EQJA 2FZCB 1AWOA 5GMKi 5CQYA 2GGRA 2MK5A 3L42A 2BKDN 3JAME 1NE8A 1D1AA 2JM9A 1R8OB 2HNIA 1M2VB 2KY9A 5GAOq 1S72Q 4OGCA 1VQ4A 2MYSA 1WQWA 2DRKA 4ORZA 3QBYA 1NPRA 3EG2A 4QQGA 3PVQA 3VUBA 3CCVT 4C5HA 3HP9A 1RUWA 2E5KA 2DL7A 2HDAA 1E6GA 1QLYA 2E4HA 3JCMd 4MMKA 1VQ5A 2QA4A 2FPFA 2RJEA 3M5AA 4LUDA 2K5LA 5GAOp 2RHUA 1QKWA 4M7DC 2J6OA 1Q81R 7AT1B 3MCAB 1UDLA 2CP2A 5FU6C 1JO8A 4PL6A 2LCLA 3V7RA 3EG9B 2M02A 2X4YA 3NMZC 2K6DA 3WVEB 3RKYA 3FLGA 4RG2A 3R6NA 3TQ7P 3NTHA 4J9BA 3CCJA 5LJ3h 1V76A 2OTJA 3G71Q 2DZ9A 3O8VA 1BIBA 2X9HA 1PRMC 3CCQA 2RQTA 2QYZA 3NFCA 2DZCA 2DXBA 1RLQC 4BB7A 1VQPA 2NYSA 2MF2A 4M7AG 2QEXA 2DMOA 4FYVB 1H3ZA 4C8QC 3VV0A 3M57A 1TWBA 2RJFA 1NYFA 3H41A 3QHSA 4OMOA 2ESWA 2A36A 5LJ5g 1VQMA 1IGQA 3X26B 5I11A 1U8RA 3L2QA 3CXCA 3HTRA 1V1CA 4UC4A 3AHUA 4HCBA 4JLGA 2MPXC 3ER0A 1WYXA 3OYNA 1VQ7Q 4A53A 3CC7Q 2CZ0B 1LVKA 3CC2A 4LN2A 1TTHB 1KC8R 3M0TA 5KE3A 1CKBA 2BZXA 1UG1A 1I07A 1YJ9T 5A0DA 2XKOC 1SHGA 4XTZA 1VQKA 1RAHB 1RAAB 3HFOA 4EMGA 4IUTA 1QW1A 1VQ9Q 4L6V5 2KDSA 4BDZA 1X2QA 3ZL7C 3VRZA 3GNFB 1YI2A 4BE2A 1M30A 4B9WA 4AT1B 1TOVA 4C92C 2YRVA 5LJ3e 4ME7A 1W2BA 1JJ2A 3EFSA 4V2SA 3UT1A 1M1KU 1GRIA 2KYBA 1XOVA 1AWXA 1S1NA 3I5RA 3JCMh 1I1JA 2QAZA 3CCVQ 3A5ZB 4PJOF 1JEGA 4KH1B 1V29B 5GAMe 1OQKA 3LYIA 2WSCE 4J8OA 5LJ3f 2YRDA 3L1AA 3OYLA 4HCZA 2ATCB 4PJOB 2F2XA 2DL8A 4AFQC 2D8JA 4B9XA 4Z89A 1YJWA 4PFPA 3QZ5B 2D9TA 1MUZA 3VS6A 3SDZA 2KRSA 1WXUA 1SSFA 2B86A 1PKSA 2VXFA 3V7CA 5GAOn 4ZN1A 1BU1A 4M78E 3OMGA 3CCSA 1M1GA 1W1FA 1WX6A 3PIPA 1ZX6A 2YT6A 2CYZB 3MEWA 1SF9A 3L2VA 1I0CA 5CKEA 5CKDA 2A37A 4NL2A 4OF1A 2QEXQ 4PJMA 2KNBB 1F1BB 4QVDA 2CDTA 2A28A 4M75G 4QQ6A 2R5AA 3UATA 5FW9A 2EVRA 2FVUA 5LJ3j 1UJ0A 2DF6A 1YHQT 4J5YA 3TSWA 1OX9A 2QQSA 4R56A 2DBMA 1YITA 4D8KA 1LOJA 2ZAEA 3GOXA 3LW5E 2KGTA 3EFOB 4X1VA 3FRNA 4HVWA 1RLPC 2V26A 1ZSGA 5GAMj 4PJOC 3E19A 3VS1A 1WHJA 3HRSA 2SEMA 3OA6A 1BKBA 4M77F 1KHIA 2DETA 1AHJB 3DKMA 3FC3A 1VQKQ 1PD0A 3A8MB 3RMSA 4OB2B 2RQVA 5D6WA 2EGEA 4LUEA 1OOTA 4M77B 3RERA 2OAWA 5IHNA 2MWOA 3REAB 2ZPBB 1N6AA 3EGXA 4ELYC 1M1KR 1JB0E 4WTOB 1Y96B 3QJYA 8AT1B 2GTOA 2E12A 3HSBA 1C6VX 1MV3A 1UGVA 1JU5C 3DLMA 1NEBA 4JJNK 1QP3A 2IVWA 4J6YA 3SWNB 5DLOA 2CKKA 2EQKA 3WVDB 3M4YA 1K73C 2RB6A 4M7AC 4XTYA 5D6XA 3X25B 3EH1A 2KR3A 1R0BG 3CQTA 2HL3A 3EFRA 1RAFB 3NPFA 1NBEB 5GANh 1WQ7A 1K4US 1GCPA 1ZBJA 3LLRA 5FWCA 1X69A 3ME9A 2G3RA 1B34B 3RDVA 1GBRA 2KEAA 3FJPA 1K76A 3JCMJ 1T0HA 2AKLA 1OI1A 3GF5A 1CSKA 2P4RA 2LCCA 3TU4K 4RTYA 4LDVA 5IXBA 3E9GA 2GBQA 3EHRA 2BUDA 1QVFA 2R57A 2X4JA 4CI0C 4M77C 3SEMA 3CCRA 1X6BA 2JNGA 5HKCA 1Q95G 5LJ5e 3RESA 2V8IA 3OW2P 2OTLT 4KT0E 3BY7A 2DLPA 4X34A 1EFNA 1MMGA 2YUOA 2JXBA 2EPDA 1Y07A 1WNLA 4OB0B 2HD0A 2KVQG 5A0GA 3SWNC 4FIBA 4KGZB 1OYXA 3CC4T 1KJWA 3QJ6A 3I55A 1YHQQ 2J6FA 2FPEA 4M7DG 5KCHA 4F7UF 1Y7XA 1QMCA 2QQRA 1SHFA 4Z88A 2KK4A 1B3QA 1TUDA 4IURA 2JT4A 2YWWA 4F7UB 1VIEA 4C8QA 2QGGA 4A4EA 2O4XA 3PVLA 1BYMA 2CS7A 5GANe 4DEXA 4ZN3A 4E2FB 2BE9B 3EG0A 2K2MA 3OW2S 4J9GA 1C0MA 1T3LA 4KH0B 2LTOA 2J7IA 1PD1A 1GCQC 3PGGA 2NUZA 2RN8A 4J9CA 1VQ8T 4AMCA 2ZPEB 2O9VA 4DBHA 5GANf 4JRQA 2ZZDA 5IH2A 2O31A 1KHCA 3QZ9B 1JXMA 3M4GA 3O5ZA 5EG2A 2RI3A 2BZYA 2LJ3A 5CAIA 1I8FA 3JV3A 5LJ5j 4A4FA 2HEQA 4KBMB 4EMKA 2NUPA 3H9NA 1R77A 1WGSA 3VU3C 4XU3A 3P8DA 1JXOA 4M75C 3NTIA 2K3YA 2V1RA 4Q5WA 5IN1A 1OZ2A 4M78D 3OYDA 3LGLA 4QVCA 5FRNA 4DBQA 2HQHA 2KRMA 4FYYB 1BCMA 3PTAA 4CRIA 1QVGP 4KULA 1K9MC 4RTTA 3CD6T 1Q81U 2LX7A 3MO8A 5GANj 3CCET 4E7ZA 4CC7A 3G71T 3RUXA 4KUDK 4M4ZA 2RI5A 2FRYA 4F14A 3CCMT 1QWEA 5LJ3d 2JVVA 2KI7A 2RA2A 2EQUA 2OTLQ 3CCRQ 2MMPA 2IG0A 1ZUUA 1G83A 2E3IA 5CCAA 3CCLA 1EIFA 3MP6A 1RAGB 1TU0B 1FMKA 2QK0A 5CKFA 1U1TA 2D1XA 2D6FA 2RQRA 1G8XA 5GMKj 3CC4Q 1BI1A 4HA8A 5IAYA 5GAMd 3P8HA 2WACA 3VJPA 3I55Q 3M53A 2VWFA 2FG0A 3DB3A 2D0QB 2GFUA 4IKFA 1K8AU 4PFZA 4J9IA 3A1PA 4B6MA 2ZGWA 4BY6B 1YWOA 1QVGS 3UPUA 2ROTA 3CC7T 5IXFA 2VGNA 2YRCA 4IIMA 2BZ8A 2J06A 2DL3A 3INZA 3MP1A 4F17A 2COWA 5L23A 1IHVA 2PZ1A 2HMAA 1PKTA 4OB3B 2DE0X 2MOXA 1KIKA 1VQOA 1X2KA 2RHIA 1WJRA 4Z8AA 1HJDA 1U5SA 1I81A 4QQDA 1OZ3A 1KC8U 1VQ9T 4J7FA 1VQ8Q 2ZPFB 5KYWB 4X9DA 1Y57A 1Q82U 4N4IA 3SB2A 4C0ZA 4MZTA 3JCMP 5FRMA 2K9GA 1BBZA 3JCMg 2L8DA 3OQ5A 3FIFA 2JTMA 3GPLA 1NLOC 1NM7A 2NUTA 3G4SA 3F70A 5DLQE 3OSSC 4QVZA 1UFFA 1GBQA 1VQ4T 2E64A 2A7YA 3LGFA 2KBTA 3N5BB 2YUQA 3LWHA 1MGQA 4QKUA 3I9QA 4M78F 2ROLA 5I2MA 5GAN3 4E7IA 1EZZB 4PJOG 1M1FA 2CP6A 3BFMA 1IB8A 4M78B 3GLXA 3OMCA 5FU7B 2QA4T 1VQ5T 3CXCP 3KUFA 1AVZC 3PMTA 3HRUA 2VUBA 3QIIA 1T0JA 1ZSZC 4HT8A 4CC2A 3EG1A 1SSHA 3CD6Q 1M90R 3CCEQ 1MV0B 3JRZA 3CCJT 1VYUA 3EGDA 3CCMQ 2OTJT 2X4XA 1OV3A 4BE0A 5FROA 2JMAA 4JJBA 1IREB 3CCQT 2D8HA 1VQNA 5I2SA 2A0FB 3MEAA 4JRPA 3M55A 1YNZA 4EDUA 4C0DB 1VQPT 4J6WA 2RQUA 4BE1A 1YIJA 2QEXT 5GAMh 3CCLQ 1K8AR 4E7KA 4D8DA 2KXDA 2YXYA 3A8HB 3CMAA 1W4SA 2DPPB 4QT7A 4MZMA 2Z0WA 1VQMT 2DEQA 2DYIA 3CCUA 3A8OB 3OY9A 2J05A 4PJLA 2RQWA 3RKWA 1D1BA 4JZ4A 2RHYA 2EKOA 1W2BP 3OYGA 1JJ2P 2DA9A 2HQEA 4OVAA 2RF0A 2I0NA 3CC2T 1ABOA 1G3SA 2K5IA 2KE9A 2DRMA 4BI8B 5CR2A 1Q82R 2ZPHB 2DKGA 3JB9J 4M78C 5J26A 2JMCA 2CREA 1VQKT 5KYYB 4M77G 3VYGA 2GNCA 2XHCA 3C94A 3A8LB 1IXDA 1TS9A 1Y71A 4FW2A 3G6EA 5LJ5d 2FO0A 2AT1B 4AFUC 3NGPA 4R0KA 1G2BA 1WJSA 3X24B 1WHGA 1AOJA 2MI6A 2XI9A 1D3BA 3M54A 5CQXA 2ECZA 2EKHA 4ZNXA 1BIAA 1JJ2S 4PNOA 5AYFA 5GAOm 1VQ4Q 2NWMA 1WI7A 5KYUA 4IUVA 4C0DC 1AEYA 1RL2A 2DD4A 2EFIA 1RAIB 4HT9A 1W6XA 4MDXA 1B07A 1Q7YU 1NJIC 3C4SA 3RMQA 4HVUA 2G6FX 4BACA 1VQ5Q 2CP0A 2EQMA 3JCMV 2QA4Q 5J39A 3QPHA 5GANd 3THKA 2X3XD 3D7SB 4F04B 2L0AA 3CPWA 1YN8A 1YJWT 3OYFA 3JCMQ 1Q86C 1XNIA 5GAMf 2AZVA 1NZ9A 2FYKA 1N8RU 1QP2A 3CCJQ 2X3WD 4OGEA 2OTJQ 2JTFA 3CCST 1VYTA 1VUBA 2EBPA 4M75A 1FMWA 3VS2A 1IHWA 3CCQQ 2DL5A 4KGXB 4LD6A 1WZOA 1MMDA 1VQPQ 4TVRA 2EAYA 3GNGA 3MHXA 1YIJQ 3Q1JA 1VYVA 2CH4W 2RH2A 2P0PA 3CPFA 3G1JA 1I5OB 1Q81C 2M0YA 2COZA 1VQMQ 3LWIA 4JUVA 2DFUA 1B7TA 4J9HA 1YJNA 4KGVB 1J3TA 1HD3A 2H3JA 4RTXA 3M58A 4PJJA 3M0PA 2E70A 2PU9B 2PTKA 3TEEA 2XU8A 1YITT 5C0MA 3OYBA 4FYXB 4F7UG 3CC2Q 1QCNA 3EGDB 3VS0A 1M2OA 3QKJA 3PFSA 1M5Q1 2QTVA 4PLLA 4RTZA 3VRYA 2A3LA 2MIOA 4DA4A 3KXTA 1OPLA 1UGRB 3UA6A 4FSXA 4E6RA 3LH5A 5LJ5h 1TUGB 1BI2A 2V8KA 1MMNA 2LT1A 3GBQA 3SHWA 3CBPA 3BW1A 2F1LA 3L2UA 2YLBA 3META 1AWWA 2FB7A 1YI2Q 2ED0A 5A2QE 5I22A 4FCYA 3QWXX 2CSQA 2PVOB 4ZGEB 2DO3A 2RK2A 1Q7YR 3QG1A 4BD3A 4MMLA 2EIFA 1HSQA 1QVFP 1KC8C 2FEIA 1TG0A 4LE9A 1Y0MA 5C6SA 3RNJA 4AFSC 5GMKl 3OB9A 3HKSA 3OYJA 5A0LA 2EJGA 1QWFA 4KRTA 2E1HA 3VYHB 4GY5A 3I56A 1WDXA 1N8RR 1MMAA 3C95A 2AZSA 1TUCA 3OS0A 1GL5A 4A54A 4N0AC 2XDDA 2K4YA 1LNXA 2GCXA 1YJWQ 2RM4A 4PLIA 4GLKA 1ZBXA 1G3YA 1WHKA 4R55A 5GMKh 4FT2A 1MNDA 1GFCA 3CMEA 3HL8A 1LJOA 2COYA 4E7HA 4A4KA 3CCSQ 1KD1R 3H0IA 4JLIA 3LH0A 3IQLA 4RCBA 2QDYB 1BI0A 1QVFS 4NL3A 2B8AA 2JM8A 1M27C 4FM4B 3M56A 1CKAA 4F16A 3OYHA 4M7DA 2LT4A 1ZLMA 3CCRT 3V8JA 1U06A 3VS4A 2EW3A 4BI3A 4LDUA 1WHHA 2Y90A 1OULA 2EYQA 2K79A 4MDWA 1ABQA 3V8LA 2K7AA 3TVTA 3PE0A 2FHDA 5KE2A 1UJYA 2RHXA 1ZUKA 2SRCA 3I55T 5LJ5f 3RKXA 4AG1C 2XD0A 1BK2A 1KQSA 3KFVA 1YITQ 3S3OA 2CT4A 2YLCA 2VASA 2CP7A 5M9OA 3BDLA 2LQKA 5CKBA 3PNWC 3M0QA 2EJ9A 3M59A 2GFAA 1H641 2EYYA 4YTLA 4M7DD 1RI0A 2LRQA 4LDWA 2E41A 2DIQA 1M2VA 1UGPB 1KK7A 2K57A 3WXMB 4N4GA 2I2LA 5GAN2 4DOVA 2KSSA 5GMKe 4HCKA 2GQVA 1E7OA 4PK4A 4Y91A 1YCSB 2D0NA 1XQHA 1U1SA 1LCKA 1X75C 4RTWA 4C8QD 1N5ZA 2F2VA 3JB9D 1M8MA 2LC4A 1D0YA 3EG9A 1C1AA 3OS5A 4K11A 2C0IA 4IUQA 1PCXA 4PKCC 4RG8A 2FZKB 1K1ZA 1S72A 1E6HA 4WF2A 4M78G 2VKNA 1D0ZA 4GBQA 5LJ3g 3EGXB 1M1KC 1PWTA 4C92A 3J81E 4E7JA 4A63B 2O01E 5GJVB 1PHTA 2VC8A 3ULRB 4IUPA 2DTOA 2HSEB 1P92A 5CIUA 1FXXA 1D0XA 2PVGB 3L2ZA 5GAOr 2F2WA 3L2RA 1VA7A 1TXQA 5D7UA 1WIEA 2DX1A 2ZCFB 4D6WA 1AZEA 4LDYA 2QTXA 2GF7A 2LNVA 1YCYA 1HYOA 3MEUA 4RMOA 3UDCA 4DBFA 4JJDA 4EPCA 1SPKA 1T3SA 1M90U 1D09B 1VQLA 3CCLT 1X43A 1PSEA 3TREA 2QG9B 5ECAA 1ZA2B 4E47A 2C0OA 2E10A 4C92D 2DXCA 2E6ZA 1KG1A 4C5EA 2DXUA 3H0HA 2LQWA 2DL4A 1R0CB 3PIOA 1RACB 3EGUA 4XTUA 2K2VA 1N27A 2L3QA 3U23A 2L3RA 4RTVA 2DIGA 4XAXB 1LPLA 4X9CA 2FRWA 2E5QA 2GQIA 1SRLA 4O5VA 4OMPA 5HK3A 3E9FA 1BB9A 6AT1B 1VQ7A 1WFWA 3ZFJA 3C12A 1OU9A 1VQ6A 1VQOT 3V7SA 2LCSA 1AT1B 3SFMA 4A4HA 3J80E 4M75E 5IHKA 2H3EB 1UGQB 1X6GA 2VVKA 3OS1A 4Y92A 2HZYA 3CBMA 4ELZC 2RJCA 1VQ9A 4ESRA 4C8QF 3R6OA 4XTVA 2ZPIB 4PJOA 3JB9F 4MZPA 2CSIA 3OYKA 2DVJA 4OMNA 2EGCA 3MPUB 2CH4A 3G4ST 4C8QB 1SG5A 1O9SA 2HQXA 2O4XB 4II1A 2FZGB 2NLUA 2OAUA 1XJWB 2P84A 1Q86R 4N4HA 2OX7A 2ED1A 4P5NA 2MWPA 3M0RA 5CK9A 1FMVA 1RABB 3RIRA 1IO6A 2X4WA 4IUUA 2QXFA 3CCVA 1HXDA 1UHFA 4BY6C 3I5SA 1WHMA 2CGHA 2CZ6B 2HKNA 2EQIA 1PC0A 1M9SA 4M7AA 4OMQA 3PMIA 3VS7A 4PJOD 2RMOA 2VB6A 2BE7D 4LD9K 8ATCB 4OMLA 1JQQA 1TSFA 4HCCA 3HRTA 2HCKA 4BI4A 3EG3A 3FDRA 1AD5A 4VUBA 4O6JA 4EMKB 2V1QA 2NUPB 2C06A 1BI3A 1KQ2A 2DNUA 2LX9A 4WCIA 1MNEA 3CEYA 4C92F 4N0AA 1VQNT 4ANJA 3I35A 3A98A 1M3CA 2IIMA 1VQLQ 2X35A 2XIDA 1YIJT 3EFOA 1WLPB 2H8HA 2M16A 2DILA 4C92B 3CMAT 3REBB 3CXCS 3OBYA 2LQ8A 4LXCA 1H3HA 3CCUT 1AWJA 4M7AD 2HBPA 5FWBA 2DJQA 2CUBA 3M9QA 5IHIA 4M77A 5GAN6 2J6KA 1KFZA 2BTTA 2LP5A 1Y96A 4BUGA 4AFZC 2WSFE 4RCCA 3M0SA 5L8RE 4FW1A 2KXCA 5FU7C 2EWNA 1QKXA 1VQOQ 2DM1A 3SWNA 3ZEHA 3HHTB 1VQ6Q 5I21A 2OI3A 1K73R 2QI2A 3OS2A 1YJ9A 2OJ2A 2E6NA 2DTHA 2RHZA 2X51A 3MKDA 3CPWP 2LMJA 2YUNA 1RAEB 1YI2T 4EMHA 3G6ET 4M7DE 4DQ2A 1PRLC 1UECA 5DY9A 1FX7A 1EX4A 2IPOB 4EMKC 2KROA 1PSFA 1VIFA 4E7SA 1FYNA 5GANg 3AT1B 3L2WA 2C0TA 4M77D 1UHCA 1W2BS 3GP8A 1OU8A 2GTJA 3G4SQ 3OSVA 1B34A 2KYMA 3OYIA 2HKQB 2KQWA 1WPYA 3H6ZA 2DVEA 9ATCB 2L5QA 1GCQA 2PVDB 4IIOA 2JUFA 2W10A 3G7ZA 4JRKA 2RJDA 3PT9A 1GXIE 1JRIA 1YWPA 2QQ9A 2CT3A 4C8QE 1H92A 4JS5A 2CZ7B 2DEUA 1K0SA 2HBWA 4L5GA 1UUEA 2JW4A 4JS4A 3CPWS 4PJNA 4NOYA 1JBMA 3OYCA 2RI2A 4FT4A 1M4ZA 3UWNA 4FYWB 1K9MU 2QGFB 2NUTB 2P0KA 2QQBA 4XU2A 2VXEA 1YP5A 5CO7A 2EYXA 1OEBA 3MP8A 2JTEA 2DK3A 1PNJA 4JDSA 1VQNQ 1K9AA 2XG8D 4GLMA 2K3BA 2EYWA 1KD1U 3QUIA 4HXJA 2CZ1B 4KUIA 2XDBA 1UB4A 3J7AF 2DBKA 3TSZA 1IZ6A 4F7UA 3CMAQ 2M1HA 4M7AF 2KRNA 1N9SA 1SKUB 3CCUQ 1MHNA 2JZ2A 2RK1A 5HK0A 1YJNT 2M0OA 2PNIA 4ZGJB 1XTDA 4M7AB 1ZUYA 1M90C 3DB4A 3QWYA 3VS5A 3OYAA 4C92E 4M75D 1SEMA 1YHQA 3X20B 2KT1A 2P4TA 3ZBDA 1NYGA 2EYZA 5DM7R 3H0FA 4XTWA 4E7LA 4OP0A 3V8KA 2XMFA 1K8AC 1X27A 1IGUA 4DEYA 3JCMe 3S6WA 3HFNA 5D6YA 3EHQA 1G3TA 3UF4A 3JCMW 1W70A 1TH7A 1YJ9Q 3E2UA 3QDFA 4J83A 3G6EQ 2RD1A 3VS3A 1KSWA 4L59A 5GAN8 1WA7A 2DERA 1U3OA 1AZGB 5CKHA 3KBGA 5HY6A 3OBWA 3JCMf 2WSEE 4RTUA 4DOWA 1NPPA 4C5GA 1Q82C 2FL7A 2YUPA 4HVVA 2FPDA 4OB1B 2M51A 2PUKB 2W0ZA 1PM3A 2L2PA 4C0FA 1X6OA 2JS2A 3MJXA 1I4K1 3URGA 1K9MR 5KCOA 3I56T 2E65A 3JSCA 3VUZA 1O75A 2PUOB 2L3SA 1ARKA 1G5VA 4C5IA 5FLXE 4Y28E 4FSSA 1M3AA 1KQSP 1D3BB 1OX8A 5KYXA 2LQNA 4NS5A 1ZA1B 1I5LA 1WHLA 3CMET 5KYUB 2QASA 2F5TX 2JOYA 4QW2A 4XU0A 3LX7A 1WXTA 1UE9A 3VKIA 2MAMA 2RPNA 4BDYA 3FB9A 2JJ9A 3E1SA 2DXTA 3QYGB 4PJOE 4ATOA 4J9DA 3S3NA 1OPKA 3TCJA 4CC4B 3JCMX 2A08A 2JN0A 2KAFA 2VYTA 3P8BB 1ZSZA 2LDMA 4FU6A 1HK9A 1K0XA 2OTLA 2RNAA 1YJNQ 2LJ0A 1WJQA 3BE3A 2R5MA 1SRMA 2XICA 3UA7A 2V8JA 2XDPA 4M75F 3M0UA 2CUDA 2CP5A 2O2OA 1QQJA 5HCKA 1KQSS 5EC7A 1ACMB 2MCNA 3CC4A 5KYWA 2L3PA 2L89A 1KQ1A 4DBRA 2LNHB 4M75B 2YHTA 2P0QA 4LDXA 5LL6S 4M7AE 2E3HA 2QDLA 2DD5A 4OMMA 4ZTJA 1NEGA 1IRXA 2DTIA 4JPBW 1N9RA 2O88A 1Z9ZA 5GAN7 4PFOA 2PQWA 4XQ3A 4J6XA 3RR6A 1G3WA 1NG2A 5GAN4 4XTXA 2LVMA 2ENMA 4RUGA 3JCMb 2CP3A 5GJWB 3QO3A 3OW2A 2DAQA 3JB9I 5GAN5 2JS0A 1WXBA 2AK5A 3QXEB 4FL6A 1VQ8A 2XK0A 2VGMA 4M78A 4Z02A 1QVPA 4ZTFA 4JRIA 3OYMA 4C8QG 2YDLA 4OMFB 3EAEA 1NJIU 4AG2C 5KYNA 3JB9G 3GIBA 4EIKA 1YBYA 5IT9E 2YSQA 1Z9QA 1H8KA 1RADB 3MEVA 2ABLA 4M77E 5KH6A 1QCFA 1GFDA 3I56Q 1M8VA 1S72T 2F5KA 3JCMc 1Q86U 2LJ1A 3ASKA
chains in the Genus database with same CATH topology
1WQ7A 4BY6C 1Q7YC 5J39A 3QPHA 5GANd 3LLRA 3T9NA 2CGHA 3ME9A 2EJFA 2CZ6B 2G3RA 3CPWA 1B34B 1YJWT 1M9SA 3JCMQ 3FJPA 2RO0A 3OYYA 3OYFA 4M7AA 3PMIA 2AHJB 5GAMg 1Q86C 4PJOD 4ZGDB 3JCMJ 4C0GA 4LD9K 1XNIA 5GAMf 1FWZA 1NZ9A 1OI1A 2FYKA 3A8GB 3GF5A 3QDRB 1N8RU 4HCCA 3HRTA 1UGSB 3H8ZA 4BI4A 1QP2A 2LCCA 3FDRA 4VUBA 3TU4K 4O6JA 4OGEA 4EMKB 2JTFA 3CCST 1VUBA 4LDVA 3E9GA 1BI3A 4M75A 2C06A 1KQ2A 3CD6A 2BUDA 1QVFA 2LX9A 2R57A 3CCEA 5GMKm 3G71A 1UEBA 1ZQ1A 3CEYA 4C92F 2Y4XA 4N0AA 1N8RC 4LD6A 2X4JA 4CI0C 1VQNT 3CCMA 1VQLT 4C92G 4M77C 2HAXA 4TVRA 4RKUE 3CCRA 2EAYA 2X35A 2JNGA 2XIDA 3FEOA 5HKCA 2DJZA 3GNGA 5LJ5e 1YIJT 3RESA 2M16A 2V8IA 2OTLT 3X28B 3MHXA 4KT0E 3Q1JA 4C92B 3BY7A 3CMAT 3S3MA 4X34A 2RH2A 3SD4A 4HKEA 2P0PA 3CPFA 3CXCS 1Q81C 2QQAA 3OBYA 3LWIA 4JUVA 2LQ8A 1Y07A 1WNLA 4XU1A 3CCUT 4OB0B 2R58A 4J7IA 1YJNA 4M7AD 2HD0A 2HBPA 2KVQG 5A0GA 1DJ7B 3SWNC 4FIBA 3M9QA 1OYXA 3CC4T 1KD1C 3QJ6A 3I55A 2M9UA 3JB9H 2H3JA 4M7DF 4M77A 3M58A 3OYEA 5GAN6 2KMTA 4M7DG 2E70A 5KCHA 3BDUA 2PU9B 4F7UF 5GAOl 3TEEA 3HPWA 2XU8A 1YITT 1Y96A 5C0MA 4BUGA 3OYBA 3QYHB 1Y7XA 3DLLA 2QQRA 2WSFE 4RCCA 4F7UG 2KK4A 4XK8E 4M7DB 2Y4YA 4IURA 3CC7A 5L8RE 1QVGA 3QKJA 3PFSA 5FU7C 2VV5A 2ZPGB 5J3BA 1VQ7T 1M5Q1 5FU6B 4PLLA 2EWNA 2BIVA 4F7UB 2K5FA 1VIEA 4C8QA 4A4EA 2O4XA 3SWNA 3NTKA 1VQ6T 3ZEHA 2A3LA 4DA4A 2CS7A 1BYMA 3HHTB 3KXTA 5GANe 1UGRB 5I21A 4FSXA 2K3XA 3QSUA 4ZN3A 1X01A 2QI2A 5LJ5h 3OS2A 1BI2A 2V8KA 1ZHIA 2F69A 1YJ9A 2E6NA 2DTHA 2LT1A 2RHZA 3OW2S 3CBPA 3BW1A 2LTOA 3L2UA 2YLBA 1YI2T 4EMHA 3META 3G6ET 4M7DE 5CVIA 4DQ2A 3PGGA 2FB7A 1VQ8T 5DY9A 1K73U 5A2QE 1FX7A 3CBOA 2PVOB 2ZPEB 4F7UE 2DO3A 4EMKC 2RK2A 4ZGEB 1PSFA 1VIFA 4A4GA 2EQJA 3QG1A 4BD3A 5GANg 3L2WA 4M77D 4MMLA 5GANf 5GMKi 5CQYA 4JRQA 2EIFA 3GP8A 1W2BS 3OSVA 1B34A 2ZZDA 3OYIA 2KQWA 3L42A 1KHCA 2BKDN 1NE8A 3JAME 3QZ9B 1WPYA 3M4GA 1KC8C 3H6ZA 5C6SA 5EG2A 2RI3A 5GMKl 3OB9A 2DVEA 1R8OB 2L5QA 2HNIA 5CAIA 2KY9A 3HKSA 1I8FA 5GAOq 2PVDB 4OGCA 3OYJA 2JUFA 5LJ5j 3G7ZA 4JRKA 4A4FA 1WQWA 1VQ4A 5A0LA 4KBMB 3QBYA 3JCMV 2RJDA 4EMKA 2EJGA 3PT9A 1GXIE 1JRIA 1WGSA 1NPRA 3VU3C 2E1HA 3VYHB 2QQ9A 4GY5A 4C8QE 4XU3A 3P8DA 3I56A 4JS5A 2CZ7B 4M75C 4QQGA 3VUBA 3CCVT 3NTIA 2K3YA 4C5HA 3HP9A 3C95A 4Q5WA 4L5GA 3OS0A 5IN1A 4A54A 4JS4A 4N0AC 1OZ2A 2XDDA 3JCMd 3CPWS 2K4YA 4M78D 1LNXA 4MMKA 4NOYA 2GCXA 1JBMA 1VQ5A 2QA4A 2RJEA 3M5AA 3OYCA 2RI2A 2K5LA 2RM4A 5GAOp 4PLIA 4FT4A 4GLKA 1M4ZA 3UWNA 3OYDA 1ZBXA 2RHUA 1K9MU 4M7DC 1G3YA 3LGLA 4QVCA 5FRNA 2P0KA 2QQBA 4XU2A 2VXEA 3MCAB 5GMKh 4R55A 5FU6C 4FT2A 4PL6A 2LCLA 3V7RA 3PTAA 2X4YA 3CMEA 3HL8A 1LJOA 4CRIA 4E7HA 4A4KA 4KULA 5CO7A 3WVEB 3RKYA 4JLIA 3LH0A 4RCBA 2QDYB 3MP8A 1BI0A 1QVFS 1K9MC 3CD6T 4NL3A 1Q81U 3FLGA 2B8AA 3MO8A 4RG2A 2DK3A 5GANj 4FM4B 3M56A 3NTHA 3G71T 4JDSA 3CCET 3CCJA 3RUXA 5LJ3h 4KUDK 2OTJA 2XG8D 3OYHA 2DZ9A 2RI5A 3O8VA 3CCMT 1BIBA 1KD1U 3QUIA 4M7DA 2CZ1B 2LT4A 4KUIA 2JVVA 5LJ3d 3CCRT 3V8JA 2XDBA 4BI3A 1UB4A 3CCQA 3J7AF 2RA2A 2EQUA 4LDUA 2Y90A 2DZCA 1IZ6A 2IG0A 2MMPA 2DXBA 2M1HA 3NFCA 4F7UA 2EYQA 4M7AF 5CCAA 3CCLA 1EIFA 3MP6A 4BB7A 1N9SA 1VQPA 2MF2A 4MDWA 1VQ5T 4M7AG 2QEXA 3V8LA 4C8QC 1H3ZA 1MHNA 2JZ2A 1U1TA 2RK1A 3M57A 5CKFA 3VV0A 2RJFA 3QHSA 5HK0A 1YJNT 2M0OA 2FHDA 5KE2A 4ZGJB 2D6FA 1XTDA 4M7AB 5GMKj 1BI1A 2RHXA 5LJ5g 1VQMA 4HA8A 5IAYA 3X26B 3I55T 1U8RA 5GAMd 3P8HA 5LJ5f 3RKXA 2WACA 3VJPA 1M90C 3DB4A 3M53A 3L2QA 3OYAA 3CXCA 2XD0A 1KQSA 4C92E 3DB3A 2D0QB 2GFUA 4UC4A 3S3OA 4JLGA 4M75D 1K8AU 2YLCA 4IKFA 4HCBA 3AHUA 1YHQA 3X20B 2ZGWA 3ER0A 4BY6B 1QVGS 2P4TA 3UPUA 3ZBDA 5M9OA 3BDLA 3OYNA 3CC7T 5DM7R 4A53A 2LQKA 5CKBA 2VGNA 3PNWC 2EJ9A 3M59A 4XTWA 2CZ0B 4E7LA 4OP0A 3INZA 3MP1A 3V8KA 2GFAA 1H641 3CC2A 4YTLA 1K8AC 4M7DD 1RI0A 4OB3B 2LRQA 4LDWA 2E41A 5KE3A 3JCMe 2DIQA 3S6WA 3HFNA 5D6YA 1VQOA 1G3TA 3JCMW 2RHIA 1YJ9T 1WJRA 5A0DA 2XKOC 4XTZA 1I81A 1TH7A 1VQKA 1UGPB 4QQDA 2K57A 3WXMB 4J83A 1OZ3A 1KC8U 1VQ9T 3HFOA 4J7FA 4N4GA 4EMGA 4IUTA 1QW1A 2I2LA 2ZPFB 2RD1A 4X9DA 4L6V5 5GAN2 4DOVA 2KDSA 4L59A 4BDZA 5GAN8 1Q82U 2KSSA 4N4IA 3SB2A 4C0ZA 5GMKe 2GQVA 4MZTA 3KBGA 5CKHA 3JCMP 5FRMA 3JCMg 5HY6A 3OBWA 1YI2A 3GNFB 2L8DA 3OQ5A 3JCMf 4BE2A 2WSEE 4Y91A 3FIFA 2JTMA 4B9WA 4DOWA 3GPLA 1NPPA 1XQHA 1U1SA 4C5GA 1Q82C 1X75C 4C92C 2YRVA 4C8QD 2FL7A 5LJ3e 3G4SA 3F70A 4ME7A 5DLQE 1W2BA 3OSSC 4QVZA 3JB9D 2LC4A 1JJ2A 4OB1B 3EFSA 4V2SA 3OS5A 2PUKB 3UT1A 1VQ4T 2E64A 1M1KU 4C0FA 4IUQA 1X6OA 1XOVA 2A7YA 4PKCC 4RG8A 1I4K1 3LGFA 3URGA 3N5BB 3LWHA 3JCMh 1MGQA 5KCOA 1S72A 4M78F 3I56T 4WF2A 3A5ZB 4PJOF 2E65A 5I2MA 4M78G 5GAN3 4E7IA 3JSCA 3VUZA 4PJOG 1M1FA 1O75A 1V29B 2PUOB 5GAMe 5LJ3g 3BFMA 3LYIA 1M1KC 4C92A 1G5VA 2WSCE 4J8OA 5LJ3f 4M78B 3GLXA 3OMCA 5FU7B 4C5IA 4Y28E 5FLXE 3L1AA 3J81E 3OYLA 4HCZA 2QA4T 4E7JA 4PJOB 2O01E 2VC8A 3KUFA 4IUPA 2DTOA 1D3BB 4B9XA 1P92A 1YJWA 5CIUA 3PMTA 4NS5A 3QZ5B 1FXXA 2D9TA 1I5LA 3HRUA 2VUBA 3QIIA 2PVGB 3SDZA 3L2ZA 3CCVA 5GAOr 3CMET 4HT8A 2F5TX 2JOYA 4QW2A 3L2RA 1SSFA 2VXFA 2ZCFB 4XU0A 3LX7A 3V7CA 4D6WA 5GAOn 4ZN1A 3VKIA 2MAMA 4BDYA 3FB9A 3JRZA 3OMGA 4M78E 3E1SA 3CCJT 1M1GA 3CCSA 2DXTA 4LDYA 2QTXA 2GF7A 2X4XA 2LNVA 3QYGB 4ATOA 4PJOE 4BE0A 2OTJT 5FROA 1YCYA 3PIPA 3MEUA 4RMOA 3S3NA 3TCJA 3UDCA 1IREB 2CYZB 4EPCA 3JCMX 3MEWA 2JN0A 3CCQT 2KAFA 1M90U 1VQNA 5I2SA 2VYTA 3L2VA 3MEAA 3P8BB 3M55A 4JRPA 1VQLA 5CKEA 2LDMA 5CKDA 4NL2A 3TREA 1PSEA 4FU6A 4C0DB 4EDUA 4J6WA 3CCLT 4BE1A 1YIJA 1HK9A 1VQPT 4OF1A 4E47A 5GAMh 2QEXT 2E10A 4C92D 2OTLA 2DXCA 4E7KA 2E6ZA 3A8HB 3CMAA 1WJQA 1KG1A 1W4SA 2R5MA 2XICA 4C5EA 2DXUA 2DPPB 4QVDA 4MZMA 2V8JA 2XDPA 4M75F 3PIOA 1VQMT 2DEQA 4XTUA 3CCUA 3A8OB 2K2VA 3OY9A 1N27A 4M75G 4QQ6A 2R5AA 1KQSS 3RKWA 3CC4A 2L89A 1KQ1A 2FVUA 2L3RA 5LJ3j 2DIGA 2RHYA 2YHTA 4M75B 4XAXB 1YHQT 2EKOA 4J5YA 3OYGA 4X9CA 2P0QA 4LDXA 2QQSA 4R56A 2E5QA 2HQEA 4OVAA 1YITA 4O5VA 5LL6S 4M7AE 1LOJA 5HK3A 3E9FA 3GOXA 3CC2T 3LW5E 1G3SA 2K5IA 2DD5A 4BI8B 5CR2A 1VQ7A 3FRNA 2ZPHB 2DKGA 4ZTJA 3JB9J 4M78C 2DTIA 5J26A 3ZFJA 3C12A 5GAMj 1VQ6A 1VQOT 4PJOC 3E19A 1N9RA 3V7SA 3HRSA 3SFMA 5GAN7 3OA6A 1BKBA 4M77F 4A4HA 3J80E 1VQKT 1KHIA 2PQWA 4M75E 4XQ3A 1AHJB 4J6XA 4M77G 3DKMA 3VYGA 3FC3A 1G3WA 3A8MB 3RMSA 5GAN4 4OB2B 2LVMA 2XHCA 4XTXA 3JCMb 1UGQB 5D6WA 3C94A 3A8LB 3QO3A 3OW2A 2DAQA 3JB9I 1Y71A 5GAN5 4M77B 3OS1A 3RERA 3G6EA 5LJ5d 3QXEB 4FL6A 1VQ8A 3CBMA 2MWOA 2XK0A 2VGMA 1N6AA 2RJCA 2ZPBB 4ELYC 4ELZC 1VQ9A 1JB0E 4C8QF 1WJSA 1Y96B 3R6OA 3QJYA 4M78A 1QVPA 4XTVA 4Z02A 2E12A 2ZPIB 3X24B 4ZTFA 4JRIA 3OYMA 4C8QG 3HSBA 4PJOA 4OMFB 2MI6A 3JB9F 4MZPA 2XI9A 3EAEA 3OYKA 1NJIU 1D3BA 3JB9G 3M54A 5CQXA 3DLMA 4JJNK 3GIBA 3G4ST 1QP3A 1YBYA 2IVWA 4C8QB 5IT9E 4J6YA 1BIAA 1O9SA 2HQXA 2O4XB 4II1A 3SWNB 4PNOA 2NLUA 5DLOA 1JJ2S 2CKKA 5AYFA 2EQKA 5GAOm 3WVDB 4IUVA 2OAUA 3M4YA 1RL2A 4C0DC 2DD4A 2EFIA 1K73C 3MEVA 4M77E 5KH6A 2RB6A 4HT9A 4MDXA 4M7AC 1Q7YU 1NJIC 4XTYA 4N4HA 1M8VA 1S72T 2F5KA 3C4SA 4P5NA 5D6XA 3X25B 2MWPA 3RMQA 5CK9A 3RIRA 3JCMc 3EFRA 2X4WA 4BACA 4IUUA 5GANh 1Q86U 2QXFA 3ASKA 1HXDA 2EQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M9O A;  4A4G A;  2EQJ A;  3L2W A;  3BDL A;  4BD3 A;  3OYN A;  3MEW A;  5J39 A;  3PNW C;  2VYT A;  3L2V A;  3MEA A;  3LLR A;  4E7L A;  3ME9 A;  2LDM A;  2G3R A;  3MP1 A;  4EDU A;  2GFA A;  4FU6 A;  3OYI A;  4BE1 A;  3L42 A;  1KHC A;  2BKD N;  3OYF A;  2RO0 A;  1RI0 A;  3H6Z A;  3PMI A;  4E7K A;  2LRQ A;  1WJQ A;  5C6S A;  2R5M A;  5KE3 A;  2DIQ A;  2RI3 A;  3S6W A;  1XNI A;  5D6Y A;  3OB9 A;  4C5E A;  2XDP A;  1OI1 A;  2RHI A;  1WJR A;  3OYJ A;  3OY9 A;  1N27 A;  3H8Z A;  4A4F A;  4QQD A;  4QQ6 A;  2R5A A;  2LCC A;  3FDR A;  3QBY A;  2RJD A;  1OZ3 A;  4N4G A;  2JTF A;  4IUT A;  2L89 A;  1WGS A;  3E9G A;  2L3R A;  2DIG A;  2BUD A;  2RHY A;  4GY5 A;  3P8D A;  4L59 A;  2EKO A;  4N4I A;  4QQG A;  2R57 A;  4BDZ A;  3NTI A;  2K3Y A;  4C5H A;  3OYG A;  3CEY A;  5FRM A;  4Q5W A;  2QQS A;  4LD6 A;  2E5Q A;  3OS0 A;  2HQE A;  4OVA A;  5IN1 A;  1OZ2 A;  2L8D A;  3OQ5 A;  4BE2 A;  3E9F A;  2X35 A;  3GOX A;  2RJE A;  3FEO A;  4B9W A;  3OYC A;  2RI2 A;  2M16 A;  4C5G A;  4PLI A;  3Q1J A;  3UWN A;  3OYD A;  2RHU A;  4ZTJ A;  3S3M A;  2YRV A;  4X34 A;  5J26 A;  3SD4 A;  3LGL A;  5FRN A;  3F70 A;  2P0K A;  4QVZ A;  3OA6 A;  4PL6 A;  2R58 A;  4A4H A;  3UT1 A;  2X4Y A;  2PQW A;  4CRI A;  4E7H A;  4IUQ A;  3FC3 A;  3M9Q A;  1OYX A;  3LH0 A;  2LVM A;  3LGF A;  3QJ6 A;  3MP8 A;  5D6W A;  5KCO A;  3FLG A;  2B8A A;  3MO8 A;  2DAQ A;  4RG2 A;  3OYE A;  3OS1 A;  3NTH A;  5KCH A;  4E7I A;  4FL6 A;  2MWO A;  2XK0 A;  3OYH A;  3O8V A;  2RI5 A;  2RJC A;  5C0M A;  3OYB A;  3LYI A;  2QQR A;  1WJS A;  1G5V A;  4Z02 A;  4ZTF A;  3OMC A;  4IUR A;  4C5I A;  3OYM A;  3OYL A;  4E7J A;  2EQU A;  3PFS A;  3QKJ A;  4HCZ A;  2IG0 A;  3EAE A;  2M1H A;  4PLL A;  3OYK A;  2BIV A;  3KUF A;  4IUP A;  3MP6 A;  3DLM A;  4A4E A;  2O4X A;  4B9X A;  3NTK A;  3ZEH A;  2HQX A;  2O4X B;  4II1 A;  5CIU A;  3PMT A;  4NS5 A;  1H3Z A;  2NLU A;  1MHN A;  2D9T A;  2CKK A;  2JZ2 A;  2EQK A;  3QII A;  2RJF A;  2K3X A;  4IUV A;  2M0O A;  2FHD A;  5KE2 A;  3OS2 A;  2EFI A;  3MEV A;  4QW2 A;  5KH6 A;  3L2R A;  2RHX A;  1SSF A;  5IAY A;  2E6N A;  2RHZ A;  3P8H A;  4N4H A;  2WAC A;  3LX7 A;  2F5K A;  3C4S A;  2LTO A;  3DB4 A;  5D6X A;  3L2Q A;  2MWP A;  3OYA A;  3L2U A;  4BDY A;  3MET A;  3DB3 A;  3OMG A;  4IKF A;  2GFU A;  4UC4 A;  3S3O A;  2GF7 A;  2X4X A;  2X4W A;  4BAC A;  4BE0 A;  4IUU A;  5FRO A;  3MEU A;  3ASK A;  3S3N A;  2EQM A; 
#chains in the Genus database with same CATH topology
 1Q7Y C;  1M3B A;  1QCO A;  1YFN A;  2LZ6 B;  3T9N A;  2EJF A;  3NHN A;  2RO0 A;  3OYY A;  2DYB A;  5AT1 B;  2AHJ B;  5GAM g;  3CME Q;  2AKK A;  4ZGD B;  4C0G A;  1VOM A;  1FWZ A;  3A8G B;  3QDR B;  1UGS B;  3H8Z A;  3CD6 A;  2EGA A;  1A0N B;  3CCE A;  5GMK m;  3G71 A;  1UEB A;  1ZQ1 A;  2O9S A;  2Y4X A;  1N8R C;  3CCM A;  1VQL T;  4C92 G;  2HAX A;  4RKU E;  3FEO A;  4J9F A;  2DJZ A;  3X28 B;  1UTI A;  3S3M A;  1PG5 B;  3SD4 A;  4HKE A;  4J9E A;  2QQA A;  4XU1 A;  2R58 A;  4J7I A;  2AIR B;  5KYY A;  5KYX B;  1BCO A;  1DJ7 B;  1KD1 C;  2HSP A;  2M9U A;  3JB9 H;  3C0C A;  4M7D F;  3OYE A;  2KMT A;  3BDU A;  5GAO l;  1RI9 A;  3HPW A;  4JZ3 A;  3QYH B;  3DLL A;  4XK8 E;  4M7D B;  2Y4Y A;  3CC7 A;  1QVG A;  2VV5 A;  2ZPG B;  5J3B A;  1VQ7 T;  5FU6 B;  2BIV A;  2K5F A;  4CC3 A;  3NTK A;  1VQ6 T;  3RBB B;  1ZSZ B;  2K3X A;  3QSU A;  1X01 A;  3FJ5 A;  1ZHI A;  2F69 A;  1NJI R;  2KT8 A;  4LNP A;  3EH2 A;  4JJC A;  5CVI A;  1K73 U;  1NLP C;  2HL5 C;  3CBO A;  1D1C A;  4F7U E;  4A4G A;  2EQJ A;  2FZC B;  1AWO A;  5GMK i;  5CQY A;  2GGR A;  2MK5 A;  3L42 A;  2BKD N;  3JAM E;  1NE8 A;  1D1A A;  2JM9 A;  1R8O B;  2HNI A;  1M2V B;  2KY9 A;  5GAO q;  1S72 Q;  4OGC A;  1VQ4 A;  2MYS A;  1WQW A;  2DRK A;  4ORZ A;  3QBY A;  1NPR A;  3EG2 A;  4QQG A;  3PVQ A;  3VUB A;  3CCV T;  4C5H A;  3HP9 A;  1RUW A;  2E5K A;  2DL7 A;  2HDA A;  1E6G A;  1QLY A;  2E4H A;  3JCM d;  4MMK A;  1VQ5 A;  2QA4 A;  2FPF A;  2RJE A;  3M5A A;  4LUD A;  2K5L A;  5GAO p;  2RHU A;  1QKW A;  4M7D C;  2J6O A;  1Q81 R;  7AT1 B;  3MCA B;  1UDL A;  2CP2 A;  5FU6 C;  1JO8 A;  4PL6 A;  2LCL A;  3V7R A;  3EG9 B;  2M02 A;  2X4Y A;  3NMZ C;  2K6D A;  3WVE B;  3RKY A;  3FLG A;  4RG2 A;  3R6N A;  3TQ7 P;  3NTH A;  4J9B A;  3CCJ A;  5LJ3 h;  1V76 A;  2OTJ A;  3G71 Q;  2DZ9 A;  3O8V A;  1BIB A;  2X9H A;  1PRM C;  3CCQ A;  2RQT A;  2QYZ A;  3NFC A;  2DZC A;  2DXB A;  1RLQ C;  4BB7 A;  1VQP A;  2NYS A;  2MF2 A;  4M7A G;  2QEX A;  2DMO A;  4FYV B;  1H3Z A;  4C8Q C;  3VV0 A;  3M57 A;  1TWB A;  2RJF A;  1NYF A;  3H41 A;  3QHS A;  4OMO A;  2ESW A;  2A36 A;  5LJ5 g;  1VQM A;  1IGQ A;  3X26 B;  5I11 A;  1U8R A;  3L2Q A;  3CXC A;  3HTR A;  1V1C A;  4UC4 A;  3AHU A;  4HCB A;  4JLG A;  2MPX C;  3ER0 A;  1WYX A;  3OYN A;  1VQ7 Q;  4A53 A;  3CC7 Q;  2CZ0 B;  1LVK A;  3CC2 A;  4LN2 A;  1TTH B;  1KC8 R;  3M0T A;  5KE3 A;  1CKB A;  2BZX A;  1UG1 A;  1I07 A;  1YJ9 T;  5A0D A;  2XKO C;  1SHG A;  4XTZ A;  1VQK A;  1RAH B;  1RAA B;  3HFO A;  4EMG A;  4IUT A;  1QW1 A;  1VQ9 Q;  4L6V 5;  2KDS A;  4BDZ A;  1X2Q A;  3ZL7 C;  3VRZ A;  3GNF B;  1YI2 A;  4BE2 A;  1M30 A;  4B9W A;  4AT1 B;  1TOV A;  4C92 C;  2YRV A;  5LJ3 e;  4ME7 A;  1W2B A;  1JJ2 A;  3EFS A;  4V2S A;  3UT1 A;  1M1K U;  1GRI A;  2KYB A;  1XOV A;  1AWX A;  1S1N A;  3I5R A;  3JCM h;  1I1J A;  2QAZ A;  3CCV Q;  3A5Z B;  4PJO F;  1JEG A;  4KH1 B;  1V29 B;  5GAM e;  1OQK A;  3LYI A;  2WSC E;  4J8O A;  5LJ3 f;  2YRD A;  3L1A A;  3OYL A;  4HCZ A;  2ATC B;  4PJO B;  2F2X A;  2DL8 A;  4AFQ C;  2D8J A;  4B9X A;  4Z89 A;  1YJW A;  4PFP A;  3QZ5 B;  2D9T A;  1MUZ A;  3VS6 A;  3SDZ A;  2KRS A;  1WXU A;  1SSF A;  2B86 A;  1PKS A;  2VXF A;  3V7C A;  5GAO n;  4ZN1 A;  1BU1 A;  4M78 E;  3OMG A;  3CCS A;  1M1G A;  1W1F A;  1WX6 A;  3PIP A;  1ZX6 A;  2YT6 A;  2CYZ B;  3MEW A;  1SF9 A;  3L2V A;  1I0C A;  5CKE A;  5CKD A;  2A37 A;  4NL2 A;  4OF1 A;  2QEX Q;  4PJM A;  2KNB B;  1F1B B;  4QVD A;  2CDT A;  2A28 A;  4M75 G;  4QQ6 A;  2R5A A;  3UAT A;  5FW9 A;  2EVR A;  2FVU A;  5LJ3 j;  1UJ0 A;  2DF6 A;  1YHQ T;  4J5Y A;  3TSW A;  1OX9 A;  2QQS A;  4R56 A;  2DBM A;  1YIT A;  4D8K A;  1LOJ A;  2ZAE A;  3GOX A;  3LW5 E;  2KGT A;  3EFO B;  4X1V A;  3FRN A;  4HVW A;  1RLP C;  2V26 A;  1ZSG A;  5GAM j;  4PJO C;  3E19 A;  3VS1 A;  1WHJ A;  3HRS A;  2SEM A;  3OA6 A;  1BKB A;  4M77 F;  1KHI A;  2DET A;  1AHJ B;  3DKM A;  3FC3 A;  1VQK Q;  1PD0 A;  3A8M B;  3RMS A;  4OB2 B;  2RQV A;  5D6W A;  2EGE A;  4LUE A;  1OOT A;  4M77 B;  3RER A;  2OAW A;  5IHN A;  2MWO A;  3REA B;  2ZPB B;  1N6A A;  3EGX A;  4ELY C;  1M1K R;  1JB0 E;  4WTO B;  1Y96 B;  3QJY A;  8AT1 B;  2GTO A;  2E12 A;  3HSB A;  1C6V X;  1MV3 A;  1UGV A;  1JU5 C;  3DLM A;  1NEB A;  4JJN K;  1QP3 A;  2IVW A;  4J6Y A;  3SWN B;  5DLO A;  2CKK A;  2EQK A;  3WVD B;  3M4Y A;  1K73 C;  2RB6 A;  4M7A C;  4XTY A;  5D6X A;  3X25 B;  3EH1 A;  2KR3 A;  1R0B G;  3CQT A;  2HL3 A;  3EFR A;  1RAF B;  3NPF A;  1NBE B;  5GAN h;  1WQ7 A;  1K4U S;  1GCP A;  1ZBJ A;  3LLR A;  5FWC A;  1X69 A;  3ME9 A;  2G3R A;  1B34 B;  3RDV A;  1GBR A;  2KEA A;  3FJP A;  1K76 A;  3JCM J;  1T0H A;  2AKL A;  1OI1 A;  3GF5 A;  1CSK A;  2P4R A;  2LCC A;  3TU4 K;  4RTY A;  4LDV A;  5IXB A;  3E9G A;  2GBQ A;  3EHR A;  2BUD A;  1QVF A;  2R57 A;  2X4J A;  4CI0 C;  4M77 C;  3SEM A;  3CCR A;  1X6B A;  2JNG A;  5HKC A;  1Q95 G;  5LJ5 e;  3RES A;  2V8I A;  3OW2 P;  2OTL T;  4KT0 E;  3BY7 A;  2DLP A;  4X34 A;  1EFN A;  1MMG A;  2YUO A;  2JXB A;  2EPD A;  1Y07 A;  1WNL A;  4OB0 B;  2HD0 A;  2KVQ G;  5A0G A;  3SWN C;  4FIB A;  4KGZ B;  1OYX A;  3CC4 T;  1KJW A;  3QJ6 A;  3I55 A;  1YHQ Q;  2J6F A;  2FPE A;  4M7D G;  5KCH A;  4F7U F;  1Y7X A;  1QMC A;  2QQR A;  1SHF A;  4Z88 A;  2KK4 A;  1B3Q A;  1TUD A;  4IUR A;  2JT4 A;  2YWW A;  4F7U B;  1VIE A;  4C8Q A;  2QGG A;  4A4E A;  2O4X A;  3PVL A;  1BYM A;  2CS7 A;  5GAN e;  4DEX A;  4ZN3 A;  4E2F B;  2BE9 B;  3EG0 A;  2K2M A;  3OW2 S;  4J9G A;  1C0M A;  1T3L A;  4KH0 B;  2LTO A;  2J7I A;  1PD1 A;  1GCQ C;  3PGG A;  2NUZ A;  2RN8 A;  4J9C A;  1VQ8 T;  4AMC A;  2ZPE B;  2O9V A;  4DBH A;  5GAN f;  4JRQ A;  2ZZD A;  5IH2 A;  2O31 A;  1KHC A;  3QZ9 B;  1JXM A;  3M4G A;  3O5Z A;  5EG2 A;  2RI3 A;  2BZY A;  2LJ3 A;  5CAI A;  1I8F A;  3JV3 A;  5LJ5 j;  4A4F A;  2HEQ A;  4KBM B;  4EMK A;  2NUP A;  3H9N A;  1R77 A;  1WGS A;  3VU3 C;  4XU3 A;  3P8D A;  1JXO A;  4M75 C;  3NTI A;  2K3Y A;  2V1R A;  4Q5W A;  5IN1 A;  1OZ2 A;  4M78 D;  3OYD A;  3LGL A;  4QVC A;  5FRN A;  4DBQ A;  2HQH A;  2KRM A;  4FYY B;  1BCM A;  3PTA A;  4CRI A;  1QVG P;  4KUL A;  1K9M C;  4RTT A;  3CD6 T;  1Q81 U;  2LX7 A;  3MO8 A;  5GAN j;  3CCE T;  4E7Z A;  4CC7 A;  3G71 T;  3RUX A;  4KUD K;  4M4Z A;  2RI5 A;  2FRY A;  4F14 A;  3CCM T;  1QWE A;  5LJ3 d;  2JVV A;  2KI7 A;  2RA2 A;  2EQU A;  2OTL Q;  3CCR Q;  2MMP A;  2IG0 A;  1ZUU A;  1G83 A;  2E3I A;  5CCA A;  3CCL A;  1EIF A;  3MP6 A;  1RAG B;  1TU0 B;  1FMK A;  2QK0 A;  5CKF A;  1U1T A;  2D1X A;  2D6F A;  2RQR A;  1G8X A;  5GMK j;  3CC4 Q;  1BI1 A;  4HA8 A;  5IAY A;  5GAM d;  3P8H A;  2WAC A;  3VJP A;  3I55 Q;  3M53 A;  2VWF A;  2FG0 A;  3DB3 A;  2D0Q B;  2GFU A;  4IKF A;  1K8A U;  4PFZ A;  4J9I A;  3A1P A;  4B6M A;  2ZGW A;  4BY6 B;  1YWO A;  1QVG S;  3UPU A;  2ROT A;  3CC7 T;  5IXF A;  2VGN A;  2YRC A;  4IIM A;  2BZ8 A;  2J06 A;  2DL3 A;  3INZ A;  3MP1 A;  4F17 A;  2COW A;  5L23 A;  1IHV A;  2PZ1 A;  2HMA A;  1PKT A;  4OB3 B;  2DE0 X;  2MOX A;  1KIK A;  1VQO A;  1X2K A;  2RHI A;  1WJR A;  4Z8A A;  1HJD A;  1U5S A;  1I81 A;  4QQD A;  1OZ3 A;  1KC8 U;  1VQ9 T;  4J7F A;  1VQ8 Q;  2ZPF B;  5KYW B;  4X9D A;  1Y57 A;  1Q82 U;  4N4I A;  3SB2 A;  4C0Z A;  4MZT A;  3JCM P;  5FRM A;  2K9G A;  1BBZ A;  3JCM g;  2L8D A;  3OQ5 A;  3FIF A;  2JTM A;  3GPL A;  1NLO C;  1NM7 A;  2NUT A;  3G4S A;  3F70 A;  5DLQ E;  3OSS C;  4QVZ A;  1UFF A;  1GBQ A;  1VQ4 T;  2E64 A;  2A7Y A;  3LGF A;  2KBT A;  3N5B B;  2YUQ A;  3LWH A;  1MGQ A;  4QKU A;  3I9Q A;  4M78 F;  2ROL A;  5I2M A;  5GAN 3;  4E7I A;  1EZZ B;  4PJO G;  1M1F A;  2CP6 A;  3BFM A;  1IB8 A;  4M78 B;  3GLX A;  3OMC A;  5FU7 B;  2QA4 T;  1VQ5 T;  3CXC P;  3KUF A;  1AVZ C;  3PMT A;  3HRU A;  2VUB A;  3QII A;  1T0J A;  1ZSZ C;  4HT8 A;  4CC2 A;  3EG1 A;  1SSH A;  3CD6 Q;  1M90 R;  3CCE Q;  1MV0 B;  3JRZ A;  3CCJ T;  1VYU A;  3EGD A;  3CCM Q;  2OTJ T;  2X4X A;  1OV3 A;  4BE0 A;  5FRO A;  2JMA A;  4JJB A;  1IRE B;  3CCQ T;  2D8H A;  1VQN A;  5I2S A;  2A0F B;  3MEA A;  4JRP A;  3M55 A;  1YNZ A;  4EDU A;  4C0D B;  1VQP T;  4J6W A;  2RQU A;  4BE1 A;  1YIJ A;  2QEX T;  5GAM h;  3CCL Q;  1K8A R;  4E7K A;  4D8D A;  2KXD A;  2YXY A;  3A8H B;  3CMA A;  1W4S A;  2DPP B;  4QT7 A;  4MZM A;  2Z0W A;  1VQM T;  2DEQ A;  2DYI A;  3CCU A;  3A8O B;  3OY9 A;  2J05 A;  4PJL A;  2RQW A;  3RKW A;  1D1B A;  4JZ4 A;  2RHY A;  2EKO A;  1W2B P;  3OYG A;  1JJ2 P;  2DA9 A;  2HQE A;  4OVA A;  2RF0 A;  2I0N A;  3CC2 T;  1ABO A;  1G3S A;  2K5I A;  2KE9 A;  2DRM A;  4BI8 B;  5CR2 A;  1Q82 R;  2ZPH B;  2DKG A;  3JB9 J;  4M78 C;  5J26 A;  2JMC A;  2CRE A;  1VQK T;  5KYY B;  4M77 G;  3VYG A;  2GNC A;  2XHC A;  3C94 A;  3A8L B;  1IXD A;  1TS9 A;  1Y71 A;  4FW2 A;  3G6E A;  5LJ5 d;  2FO0 A;  2AT1 B;  4AFU C;  3NGP A;  4R0K A;  1G2B A;  1WJS A;  3X24 B;  1WHG A;  1AOJ A;  2MI6 A;  2XI9 A;  1D3B A;  3M54 A;  5CQX A;  2ECZ A;  2EKH A;  4ZNX A;  1BIA A;  1JJ2 S;  4PNO A;  5AYF A;  5GAO m;  1VQ4 Q;  2NWM A;  1WI7 A;  5KYU A;  4IUV A;  4C0D C;  1AEY A;  1RL2 A;  2DD4 A;  2EFI A;  1RAI B;  4HT9 A;  1W6X A;  4MDX A;  1B07 A;  1Q7Y U;  1NJI C;  3C4S A;  3RMQ A;  4HVU A;  2G6F X;  4BAC A;  1VQ5 Q;  2CP0 A;  2EQM A;  3JCM V;  2QA4 Q;  5J39 A;  3QPH A;  5GAN d;  3THK A;  2X3X D;  3D7S B;  4F04 B;  2L0A A;  3CPW A;  1YN8 A;  1YJW T;  3OYF A;  3JCM Q;  1Q86 C;  1XNI A;  5GAM f;  2AZV A;  1NZ9 A;  2FYK A;  1N8R U;  1QP2 A;  3CCJ Q;  2X3W D;  4OGE A;  2OTJ Q;  2JTF A;  3CCS T;  1VYT A;  1VUB A;  2EBP A;  4M75 A;  1FMW A;  3VS2 A;  1IHW A;  3CCQ Q;  2DL5 A;  4KGX B;  4LD6 A;  1WZO A;  1MMD A;  1VQP Q;  4TVR A;  2EAY A;  3GNG A;  3MHX A;  1YIJ Q;  3Q1J A;  1VYV A;  2CH4 W;  2RH2 A;  2P0P A;  3CPF A;  3G1J A;  1I5O B;  1Q81 C;  2M0Y A;  2COZ A;  1VQM Q;  3LWI A;  4JUV A;  2DFU A;  1B7T A;  4J9H A;  1YJN A;  4KGV B;  1J3T A;  1HD3 A;  2H3J A;  4RTX A;  3M58 A;  4PJJ A;  3M0P A;  2E70 A;  2PU9 B;  2PTK A;  3TEE A;  2XU8 A;  1YIT T;  5C0M A;  3OYB A;  4FYX B;  4F7U G;  3CC2 Q;  1QCN A;  3EGD B;  3VS0 A;  1M2O A;  3QKJ A;  3PFS A;  1M5Q 1;  2QTV A;  4PLL A;  4RTZ A;  3VRY A;  2A3L A;  2MIO A;  4DA4 A;  3KXT A;  1OPL A;  1UGR B;  3UA6 A;  4FSX A;  4E6R A;  3LH5 A;  5LJ5 h;  1TUG B;  1BI2 A;  2V8K A;  1MMN A;  2LT1 A;  3GBQ A;  3SHW A;  3CBP A;  3BW1 A;  2F1L A;  3L2U A;  2YLB A;  3MET A;  1AWW A;  2FB7 A;  1YI2 Q;  2ED0 A;  5A2Q E;  5I22 A;  4FCY A;  3QWX X;  2CSQ A;  2PVO B;  4ZGE B;  2DO3 A;  2RK2 A;  1Q7Y R;  3QG1 A;  4BD3 A;  4MML A;  2EIF A;  1HSQ A;  1QVF P;  1KC8 C;  2FEI A;  1TG0 A;  4LE9 A;  1Y0M A;  5C6S A;  3RNJ A;  4AFS C;  5GMK l;  3OB9 A;  3HKS A;  3OYJ A;  5A0L A;  2EJG A;  1QWF A;  4KRT A;  2E1H A;  3VYH B;  4GY5 A;  3I56 A;  1WDX A;  1N8R R;  1MMA A;  3C95 A;  2AZS A;  1TUC A;  3OS0 A;  1GL5 A;  4A54 A;  4N0A C;  2XDD A;  2K4Y A;  1LNX A;  2GCX A;  1YJW Q;  2RM4 A;  4PLI A;  4GLK A;  1ZBX A;  1G3Y A;  1WHK A;  4R55 A;  5GMK h;  4FT2 A;  1MND A;  1GFC A;  3CME A;  3HL8 A;  1LJO A;  2COY A;  4E7H A;  4A4K A;  3CCS Q;  1KD1 R;  3H0I A;  4JLI A;  3LH0 A;  3IQL A;  4RCB A;  2QDY B;  1BI0 A;  1QVF S;  4NL3 A;  2B8A A;  2JM8 A;  1M27 C;  4FM4 B;  3M56 A;  1CKA A;  4F16 A;  3OYH A;  4M7D A;  2LT4 A;  1ZLM A;  3CCR T;  3V8J A;  1U06 A;  3VS4 A;  2EW3 A;  4BI3 A;  4LDU A;  1WHH A;  2Y90 A;  1OUL A;  2EYQ A;  2K79 A;  4MDW A;  1ABQ A;  3V8L A;  2K7A A;  3TVT A;  3PE0 A;  2FHD A;  5KE2 A;  1UJY A;  2RHX A;  1ZUK A;  2SRC A;  3I55 T;  5LJ5 f;  3RKX A;  4AG1 C;  2XD0 A;  1BK2 A;  1KQS A;  3KFV A;  1YIT Q;  3S3O A;  2CT4 A;  2YLC A;  2VAS A;  2CP7 A;  5M9O A;  3BDL A;  2LQK A;  5CKB A;  3PNW C;  3M0Q A;  2EJ9 A;  3M59 A;  2GFA A;  1H64 1;  2EYY A;  4YTL A;  4M7D D;  1RI0 A;  2LRQ A;  4LDW A;  2E41 A;  2DIQ A;  1M2V A;  1UGP B;  1KK7 A;  2K57 A;  3WXM B;  4N4G A;  2I2L A;  5GAN 2;  4DOV A;  2KSS A;  5GMK e;  4HCK A;  2GQV A;  1E7O A;  4PK4 A;  4Y91 A;  1YCS B;  2D0N A;  1XQH A;  1U1S A;  1LCK A;  1X75 C;  4RTW A;  4C8Q D;  1N5Z A;  2F2V A;  3JB9 D;  1M8M A;  2LC4 A;  1D0Y A;  3EG9 A;  1C1A A;  3OS5 A;  4K11 A;  2C0I A;  4IUQ A;  1PCX A;  4PKC C;  4RG8 A;  2FZK B;  1K1Z A;  1S72 A;  1E6H A;  4WF2 A;  4M78 G;  2VKN A;  1D0Z A;  4GBQ A;  5LJ3 g;  3EGX B;  1M1K C;  1PWT A;  4C92 A;  3J81 E;  4E7J A;  4A63 B;  2O01 E;  5GJV B;  1PHT A;  2VC8 A;  3ULR B;  4IUP A;  2DTO A;  2HSE B;  1P92 A;  5CIU A;  1FXX A;  1D0X A;  2PVG B;  3L2Z A;  5GAO r;  2F2W A;  3L2R A;  1VA7 A;  1TXQ A;  5D7U A;  1WIE A;  2DX1 A;  2ZCF B;  4D6W A;  1AZE A;  4LDY A;  2QTX A;  2GF7 A;  2LNV A;  1YCY A;  1HYO A;  3MEU A;  4RMO A;  3UDC A;  4DBF A;  4JJD A;  4EPC A;  1SPK A;  1T3S A;  1M90 U;  1D09 B;  1VQL A;  3CCL T;  1X43 A;  1PSE A;  3TRE A;  2QG9 B;  5ECA A;  1ZA2 B;  4E47 A;  2C0O A;  2E10 A;  4C92 D;  2DXC A;  2E6Z A;  1KG1 A;  4C5E A;  2DXU A;  3H0H A;  2LQW A;  2DL4 A;  1R0C B;  3PIO A;  1RAC B;  3EGU A;  4XTU A;  2K2V A;  1N27 A;  2L3Q A;  3U23 A;  2L3R A;  4RTV A;  2DIG A;  4XAX B;  1LPL A;  4X9C A;  2FRW A;  2E5Q A;  2GQI A;  1SRL A;  4O5V A;  4OMP A;  5HK3 A;  3E9F A;  1BB9 A;  6AT1 B;  1VQ7 A;  1WFW A;  3ZFJ A;  3C12 A;  1OU9 A;  1VQ6 A;  1VQO T;  3V7S A;  2LCS A;  1AT1 B;  3SFM A;  4A4H A;  3J80 E;  4M75 E;  5IHK A;  2H3E B;  1UGQ B;  1X6G A;  2VVK A;  3OS1 A;  4Y92 A;  2HZY A;  3CBM A;  4ELZ C;  2RJC A;  1VQ9 A;  4ESR A;  4C8Q F;  3R6O A;  4XTV A;  2ZPI B;  4PJO A;  3JB9 F;  4MZP A;  2CSI A;  3OYK A;  2DVJ A;  4OMN A;  2EGC A;  3MPU B;  2CH4 A;  3G4S T;  4C8Q B;  1SG5 A;  1O9S A;  2HQX A;  2O4X B;  4II1 A;  2FZG B;  2NLU A;  2OAU A;  1XJW B;  2P84 A;  1Q86 R;  4N4H A;  2OX7 A;  2ED1 A;  4P5N A;  2MWP A;  3M0R A;  5CK9 A;  1FMV A;  1RAB B;  3RIR A;  1IO6 A;  2X4W A;  4IUU A;  2QXF A;  3CCV A;  1HXD A;  1UHF A;  4BY6 C;  3I5S A;  1WHM A;  2CGH A;  2CZ6 B;  2HKN A;  2EQI A;  1PC0 A;  1M9S A;  4M7A A;  4OMQ A;  3PMI A;  3VS7 A;  4PJO D;  2RMO A;  2VB6 A;  2BE7 D;  4LD9 K;  8ATC B;  4OML A;  1JQQ A;  1TSF A;  4HCC A;  3HRT A;  2HCK A;  4BI4 A;  3EG3 A;  3FDR A;  1AD5 A;  4VUB A;  4O6J A;  4EMK B;  2V1Q A;  2NUP B;  2C06 A;  1BI3 A;  1KQ2 A;  2DNU A;  2LX9 A;  4WCI A;  1MNE A;  3CEY A;  4C92 F;  4N0A A;  1VQN T;  4ANJ A;  3I35 A;  3A98 A;  1M3C A;  2IIM A;  1VQL Q;  2X35 A;  2XID A;  1YIJ T;  3EFO A;  1WLP B;  2H8H A;  2M16 A;  2DIL A;  4C92 B;  3CMA T;  3REB B;  3CXC S;  3OBY A;  2LQ8 A;  4LXC A;  1H3H A;  3CCU T;  1AWJ A;  4M7A D;  2HBP A;  5FWB A;  2DJQ A;  2CUB A;  3M9Q A;  5IHI A;  4M77 A;  5GAN 6;  2J6K A;  1KFZ A;  2BTT A;  2LP5 A;  1Y96 A;  4BUG A;  4AFZ C;  2WSF E;  4RCC A;  3M0S A;  5L8R E;  4FW1 A;  2KXC A;  5FU7 C;  2EWN A;  1QKX A;  1VQO Q;  2DM1 A;  3SWN A;  3ZEH A;  3HHT B;  1VQ6 Q;  5I21 A;  2OI3 A;  1K73 R;  2QI2 A;  3OS2 A;  1YJ9 A;  2OJ2 A;  2E6N A;  2DTH A;  2RHZ A;  2X51 A;  3MKD A;  3CPW P;  2LMJ A;  2YUN A;  1RAE B;  1YI2 T;  4EMH A;  3G6E T;  4M7D E;  4DQ2 A;  1PRL C;  1UEC A;  5DY9 A;  1FX7 A;  1EX4 A;  2IPO B;  4EMK C;  2KRO A;  1PSF A;  1VIF A;  4E7S A;  1FYN A;  5GAN g;  3AT1 B;  3L2W A;  2C0T A;  4M77 D;  1UHC A;  1W2B S;  3GP8 A;  1OU8 A;  2GTJ A;  3G4S Q;  3OSV A;  1B34 A;  2KYM A;  3OYI A;  2HKQ B;  2KQW A;  1WPY A;  3H6Z A;  2DVE A;  9ATC B;  2L5Q A;  1GCQ A;  2PVD B;  4IIO A;  2JUF A;  2W10 A;  3G7Z A;  4JRK A;  2RJD A;  3PT9 A;  1GXI E;  1JRI A;  1YWP A;  2QQ9 A;  2CT3 A;  4C8Q E;  1H92 A;  4JS5 A;  2CZ7 B;  2DEU A;  1K0S A;  2HBW A;  4L5G A;  1UUE A;  2JW4 A;  4JS4 A;  3CPW S;  4PJN A;  4NOY A;  1JBM A;  3OYC A;  2RI2 A;  4FT4 A;  1M4Z A;  3UWN A;  4FYW B;  1K9M U;  2QGF B;  2NUT B;  2P0K A;  2QQB A;  4XU2 A;  2VXE A;  1YP5 A;  5CO7 A;  2EYX A;  1OEB A;  3MP8 A;  2JTE A;  2DK3 A;  1PNJ A;  4JDS A;  1VQN Q;  1K9A A;  2XG8 D;  4GLM A;  2K3B A;  2EYW A;  1KD1 U;  3QUI A;  4HXJ A;  2CZ1 B;  4KUI A;  2XDB A;  1UB4 A;  3J7A F;  2DBK A;  3TSZ A;  1IZ6 A;  4F7U A;  3CMA Q;  2M1H A;  4M7A F;  2KRN A;  1N9S A;  1SKU B;  3CCU Q;  1MHN A;  2JZ2 A;  2RK1 A;  5HK0 A;  1YJN T;  2M0O A;  2PNI A;  4ZGJ B;  1XTD A;  4M7A B;  1ZUY A;  1M90 C;  3DB4 A;  3QWY A;  3VS5 A;  3OYA A;  4C92 E;  4M75 D;  1SEM A;  1YHQ A;  3X20 B;  2KT1 A;  2P4T A;  3ZBD A;  1NYG A;  2EYZ A;  5DM7 R;  3H0F A;  4XTW A;  4E7L A;  4OP0 A;  3V8K A;  2XMF A;  1K8A C;  1X27 A;  1IGU A;  4DEY A;  3JCM e;  3S6W A;  3HFN A;  5D6Y A;  3EHQ A;  1G3T A;  3UF4 A;  3JCM W;  1W70 A;  1TH7 A;  1YJ9 Q;  3E2U A;  3QDF A;  4J83 A;  3G6E Q;  2RD1 A;  3VS3 A;  1KSW A;  4L59 A;  5GAN 8;  1WA7 A;  2DER A;  1U3O A;  1AZG B;  5CKH A;  3KBG A;  5HY6 A;  3OBW A;  3JCM f;  2WSE E;  4RTU A;  4DOW A;  1NPP A;  4C5G A;  1Q82 C;  2FL7 A;  2YUP A;  4HVV A;  2FPD A;  4OB1 B;  2M51 A;  2PUK B;  2W0Z A;  1PM3 A;  2L2P A;  4C0F A;  1X6O A;  2JS2 A;  3MJX A;  1I4K 1;  3URG A;  1K9M R;  5KCO A;  3I56 T;  2E65 A;  3JSC A;  3VUZ A;  1O75 A;  2PUO B;  2L3S A;  1ARK A;  1G5V A;  4C5I A;  5FLX E;  4Y28 E;  4FSS A;  1M3A A;  1KQS P;  1D3B B;  1OX8 A;  5KYX A;  2LQN A;  4NS5 A;  1ZA1 B;  1I5L A;  1WHL A;  3CME T;  5KYU B;  2QAS A;  2F5T X;  2JOY A;  4QW2 A;  4XU0 A;  3LX7 A;  1WXT A;  1UE9 A;  3VKI A;  2MAM A;  2RPN A;  4BDY A;  3FB9 A;  2JJ9 A;  3E1S A;  2DXT A;  3QYG B;  4PJO E;  4ATO A;  4J9D A;  3S3N A;  1OPK A;  3TCJ A;  4CC4 B;  3JCM X;  2A08 A;  2JN0 A;  2KAF A;  2VYT A;  3P8B B;  1ZSZ A;  2LDM A;  4FU6 A;  1HK9 A;  1K0X A;  2OTL A;  2RNA A;  1YJN Q;  2LJ0 A;  1WJQ A;  3BE3 A;  2R5M A;  1SRM A;  2XIC A;  3UA7 A;  2V8J A;  2XDP A;  4M75 F;  3M0U A;  2CUD A;  2CP5 A;  2O2O A;  1QQJ A;  5HCK A;  1KQS S;  5EC7 A;  1ACM B;  2MCN A;  3CC4 A;  5KYW A;  2L3P A;  2L89 A;  1KQ1 A;  4DBR A;  2LNH B;  4M75 B;  2YHT A;  2P0Q A;  4LDX A;  5LL6 S;  4M7A E;  2E3H A;  2QDL A;  2DD5 A;  4OMM A;  4ZTJ A;  1NEG A;  1IRX A;  2DTI A;  4JPB W;  1N9R A;  2O88 A;  1Z9Z A;  5GAN 7;  4PFO A;  2PQW A;  4XQ3 A;  4J6X A;  3RR6 A;  1G3W A;  1NG2 A;  5GAN 4;  4XTX A;  2LVM A;  2ENM A;  4RUG A;  3JCM b;  2CP3 A;  5GJW B;  3QO3 A;  3OW2 A;  2DAQ A;  3JB9 I;  5GAN 5;  2JS0 A;  1WXB A;  2AK5 A;  3QXE B;  4FL6 A;  1VQ8 A;  2XK0 A;  2VGM A;  4M78 A;  4Z02 A;  1QVP A;  4ZTF A;  4JRI A;  3OYM A;  4C8Q G;  2YDL A;  4OMF B;  3EAE A;  1NJI U;  4AG2 C;  5KYN A;  3JB9 G;  3GIB A;  4EIK A;  1YBY A;  5IT9 E;  2YSQ A;  1Z9Q A;  1H8K A;  1RAD B;  3MEV A;  2ABL A;  4M77 E;  5KH6 A;  1QCF A;  1GFD A;  3I56 Q;  1M8V A;  1S72 T;  2F5K A;  3JCM c;  1Q86 U;  2LJ1 A;  3ASK A; 
#chains in the Genus database with same CATH homology
 1WQ7 A;  4BY6 C;  1Q7Y C;  5J39 A;  3QPH A;  5GAN d;  3LLR A;  3T9N A;  2CGH A;  3ME9 A;  2EJF A;  2CZ6 B;  2G3R A;  3CPW A;  1B34 B;  1YJW T;  1M9S A;  3JCM Q;  3FJP A;  2RO0 A;  3OYY A;  3OYF A;  4M7A A;  3PMI A;  2AHJ B;  5GAM g;  1Q86 C;  4PJO D;  4ZGD B;  3JCM J;  4C0G A;  4LD9 K;  1XNI A;  5GAM f;  1FWZ A;  1NZ9 A;  1OI1 A;  2FYK A;  3A8G B;  3GF5 A;  3QDR B;  1N8R U;  4HCC A;  3HRT A;  1UGS B;  3H8Z A;  4BI4 A;  1QP2 A;  2LCC A;  3FDR A;  4VUB A;  3TU4 K;  4O6J A;  4OGE A;  4EMK B;  2JTF A;  3CCS T;  1VUB A;  4LDV A;  3E9G A;  1BI3 A;  4M75 A;  2C06 A;  1KQ2 A;  3CD6 A;  2BUD A;  1QVF A;  2LX9 A;  2R57 A;  3CCE A;  5GMK m;  3G71 A;  1UEB A;  1ZQ1 A;  3CEY A;  4C92 F;  2Y4X A;  4N0A A;  1N8R C;  4LD6 A;  2X4J A;  4CI0 C;  1VQN T;  3CCM A;  1VQL T;  4C92 G;  4M77 C;  2HAX A;  4TVR A;  4RKU E;  3CCR A;  2EAY A;  2X35 A;  2JNG A;  2XID A;  3FEO A;  5HKC A;  2DJZ A;  3GNG A;  5LJ5 e;  1YIJ T;  3RES A;  2M16 A;  2V8I A;  2OTL T;  3X28 B;  3MHX A;  4KT0 E;  3Q1J A;  4C92 B;  3BY7 A;  3CMA T;  3S3M A;  4X34 A;  2RH2 A;  3SD4 A;  4HKE A;  2P0P A;  3CPF A;  3CXC S;  1Q81 C;  2QQA A;  3OBY A;  3LWI A;  4JUV A;  2LQ8 A;  1Y07 A;  1WNL A;  4XU1 A;  3CCU T;  4OB0 B;  2R58 A;  4J7I A;  1YJN A;  4M7A D;  2HD0 A;  2HBP A;  2KVQ G;  5A0G A;  1DJ7 B;  3SWN C;  4FIB A;  3M9Q A;  1OYX A;  3CC4 T;  1KD1 C;  3QJ6 A;  3I55 A;  2M9U A;  3JB9 H;  2H3J A;  4M7D F;  4M77 A;  3M58 A;  3OYE A;  5GAN 6;  2KMT A;  4M7D G;  2E70 A;  5KCH A;  3BDU A;  2PU9 B;  4F7U F;  5GAO l;  3TEE A;  3HPW A;  2XU8 A;  1YIT T;  1Y96 A;  5C0M A;  4BUG A;  3OYB A;  3QYH B;  1Y7X A;  3DLL A;  2QQR A;  2WSF E;  4RCC A;  4F7U G;  2KK4 A;  4XK8 E;  4M7D B;  2Y4Y A;  4IUR A;  3CC7 A;  5L8R E;  1QVG A;  3QKJ A;  3PFS A;  5FU7 C;  2VV5 A;  2ZPG B;  5J3B A;  1VQ7 T;  1M5Q 1;  5FU6 B;  4PLL A;  2EWN A;  2BIV A;  4F7U B;  2K5F A;  1VIE A;  4C8Q A;  4A4E A;  2O4X A;  3SWN A;  3NTK A;  1VQ6 T;  3ZEH A;  2A3L A;  4DA4 A;  2CS7 A;  1BYM A;  3HHT B;  3KXT A;  5GAN e;  1UGR B;  5I21 A;  4FSX A;  2K3X A;  3QSU A;  4ZN3 A;  1X01 A;  2QI2 A;  5LJ5 h;  3OS2 A;  1BI2 A;  2V8K A;  1ZHI A;  2F69 A;  1YJ9 A;  2E6N A;  2DTH A;  2LT1 A;  2RHZ A;  3OW2 S;  3CBP A;  3BW1 A;  2LTO A;  3L2U A;  2YLB A;  1YI2 T;  4EMH A;  3MET A;  3G6E T;  4M7D E;  5CVI A;  4DQ2 A;  3PGG A;  2FB7 A;  1VQ8 T;  5DY9 A;  1K73 U;  5A2Q E;  1FX7 A;  3CBO A;  2PVO B;  2ZPE B;  4F7U E;  2DO3 A;  4EMK C;  2RK2 A;  4ZGE B;  1PSF A;  1VIF A;  4A4G A;  2EQJ A;  3QG1 A;  4BD3 A;  5GAN g;  3L2W A;  4M77 D;  4MML A;  5GAN f;  5GMK i;  5CQY A;  4JRQ A;  2EIF A;  3GP8 A;  1W2B S;  3OSV A;  1B34 A;  2ZZD A;  3OYI A;  2KQW A;  3L42 A;  1KHC A;  2BKD N;  1NE8 A;  3JAM E;  3QZ9 B;  1WPY A;  3M4G A;  1KC8 C;  3H6Z A;  5C6S A;  5EG2 A;  2RI3 A;  5GMK l;  3OB9 A;  2DVE A;  1R8O B;  2L5Q A;  2HNI A;  5CAI A;  2KY9 A;  3HKS A;  1I8F A;  5GAO q;  2PVD B;  4OGC A;  3OYJ A;  2JUF A;  5LJ5 j;  3G7Z A;  4JRK A;  4A4F A;  1WQW A;  1VQ4 A;  5A0L A;  4KBM B;  3QBY A;  3JCM V;  2RJD A;  4EMK A;  2EJG A;  3PT9 A;  1GXI E;  1JRI A;  1WGS A;  1NPR A;  3VU3 C;  2E1H A;  3VYH B;  2QQ9 A;  4GY5 A;  4C8Q E;  4XU3 A;  3P8D A;  3I56 A;  4JS5 A;  2CZ7 B;  4M75 C;  4QQG A;  3VUB A;  3CCV T;  3NTI A;  2K3Y A;  4C5H A;  3HP9 A;  3C95 A;  4Q5W A;  4L5G A;  3OS0 A;  5IN1 A;  4A54 A;  4JS4 A;  4N0A C;  1OZ2 A;  2XDD A;  3JCM d;  3CPW S;  2K4Y A;  4M78 D;  1LNX A;  4MMK A;  4NOY A;  2GCX A;  1JBM A;  1VQ5 A;  2QA4 A;  2RJE A;  3M5A A;  3OYC A;  2RI2 A;  2K5L A;  2RM4 A;  5GAO p;  4PLI A;  4FT4 A;  4GLK A;  1M4Z A;  3UWN A;  3OYD A;  1ZBX A;  2RHU A;  1K9M U;  4M7D C;  1G3Y A;  3LGL A;  4QVC A;  5FRN A;  2P0K A;  2QQB A;  4XU2 A;  2VXE A;  3MCA B;  5GMK h;  4R55 A;  5FU6 C;  4FT2 A;  4PL6 A;  2LCL A;  3V7R A;  3PTA A;  2X4Y A;  3CME A;  3HL8 A;  1LJO A;  4CRI A;  4E7H A;  4A4K A;  4KUL A;  5CO7 A;  3WVE B;  3RKY A;  4JLI A;  3LH0 A;  4RCB A;  2QDY B;  3MP8 A;  1BI0 A;  1QVF S;  1K9M C;  3CD6 T;  4NL3 A;  1Q81 U;  3FLG A;  2B8A A;  3MO8 A;  4RG2 A;  2DK3 A;  5GAN j;  4FM4 B;  3M56 A;  3NTH A;  3G71 T;  4JDS A;  3CCE T;  3CCJ A;  3RUX A;  5LJ3 h;  4KUD K;  2OTJ A;  2XG8 D;  3OYH A;  2DZ9 A;  2RI5 A;  3O8V A;  3CCM T;  1BIB A;  1KD1 U;  3QUI A;  4M7D A;  2CZ1 B;  2LT4 A;  4KUI A;  2JVV A;  5LJ3 d;  3CCR T;  3V8J A;  2XDB A;  4BI3 A;  1UB4 A;  3CCQ A;  3J7A F;  2RA2 A;  2EQU A;  4LDU A;  2Y90 A;  2DZC A;  1IZ6 A;  2IG0 A;  2MMP A;  2DXB A;  2M1H A;  3NFC A;  4F7U A;  2EYQ A;  4M7A F;  5CCA A;  3CCL A;  1EIF A;  3MP6 A;  4BB7 A;  1N9S A;  1VQP A;  2MF2 A;  4MDW A;  1VQ5 T;  4M7A G;  2QEX A;  3V8L A;  4C8Q C;  1H3Z A;  1MHN A;  2JZ2 A;  1U1T A;  2RK1 A;  3M57 A;  5CKF A;  3VV0 A;  2RJF A;  3QHS A;  5HK0 A;  1YJN T;  2M0O A;  2FHD A;  5KE2 A;  4ZGJ B;  2D6F A;  1XTD A;  4M7A B;  5GMK j;  1BI1 A;  2RHX A;  5LJ5 g;  1VQM A;  4HA8 A;  5IAY A;  3X26 B;  3I55 T;  1U8R A;  5GAM d;  3P8H A;  5LJ5 f;  3RKX A;  2WAC A;  3VJP A;  1M90 C;  3DB4 A;  3M53 A;  3L2Q A;  3OYA A;  3CXC A;  2XD0 A;  1KQS A;  4C92 E;  3DB3 A;  2D0Q B;  2GFU A;  4UC4 A;  3S3O A;  4JLG A;  4M75 D;  1K8A U;  2YLC A;  4IKF A;  4HCB A;  3AHU A;  1YHQ A;  3X20 B;  2ZGW A;  3ER0 A;  4BY6 B;  1QVG S;  2P4T A;  3UPU A;  3ZBD A;  5M9O A;  3BDL A;  3OYN A;  3CC7 T;  5DM7 R;  4A53 A;  2LQK A;  5CKB A;  2VGN A;  3PNW C;  2EJ9 A;  3M59 A;  4XTW A;  2CZ0 B;  4E7L A;  4OP0 A;  3INZ A;  3MP1 A;  3V8K A;  2GFA A;  1H64 1;  3CC2 A;  4YTL A;  1K8A C;  4M7D D;  1RI0 A;  4OB3 B;  2LRQ A;  4LDW A;  2E41 A;  5KE3 A;  3JCM e;  2DIQ A;  3S6W A;  3HFN A;  5D6Y A;  1VQO A;  1G3T A;  3JCM W;  2RHI A;  1YJ9 T;  1WJR A;  5A0D A;  2XKO C;  4XTZ A;  1I81 A;  1TH7 A;  1VQK A;  1UGP B;  4QQD A;  2K57 A;  3WXM B;  4J83 A;  1OZ3 A;  1KC8 U;  1VQ9 T;  3HFO A;  4J7F A;  4N4G A;  4EMG A;  4IUT A;  1QW1 A;  2I2L A;  2ZPF B;  2RD1 A;  4X9D A;  4L6V 5;  5GAN 2;  4DOV A;  2KDS A;  4L59 A;  4BDZ A;  5GAN 8;  1Q82 U;  2KSS A;  4N4I A;  3SB2 A;  4C0Z A;  5GMK e;  2GQV A;  4MZT A;  3KBG A;  5CKH A;  3JCM P;  5FRM A;  3JCM g;  5HY6 A;  3OBW A;  1YI2 A;  3GNF B;  2L8D A;  3OQ5 A;  3JCM f;  4BE2 A;  2WSE E;  4Y91 A;  3FIF A;  2JTM A;  4B9W A;  4DOW A;  3GPL A;  1NPP A;  1XQH A;  1U1S A;  4C5G A;  1Q82 C;  1X75 C;  4C92 C;  2YRV A;  4C8Q D;  2FL7 A;  5LJ3 e;  3G4S A;  3F70 A;  4ME7 A;  5DLQ E;  1W2B A;  3OSS C;  4QVZ A;  3JB9 D;  2LC4 A;  1JJ2 A;  4OB1 B;  3EFS A;  4V2S A;  3OS5 A;  2PUK B;  3UT1 A;  1VQ4 T;  2E64 A;  1M1K U;  4C0F A;  4IUQ A;  1X6O A;  1XOV A;  2A7Y A;  4PKC C;  4RG8 A;  1I4K 1;  3LGF A;  3URG A;  3N5B B;  3LWH A;  3JCM h;  1MGQ A;  5KCO A;  1S72 A;  4M78 F;  3I56 T;  4WF2 A;  3A5Z B;  4PJO F;  2E65 A;  5I2M A;  4M78 G;  5GAN 3;  4E7I A;  3JSC A;  3VUZ A;  4PJO G;  1M1F A;  1O75 A;  1V29 B;  2PUO B;  5GAM e;  5LJ3 g;  3BFM A;  3LYI A;  1M1K C;  4C92 A;  1G5V A;  2WSC E;  4J8O A;  5LJ3 f;  4M78 B;  3GLX A;  3OMC A;  5FU7 B;  4C5I A;  4Y28 E;  5FLX E;  3L1A A;  3J81 E;  3OYL A;  4HCZ A;  2QA4 T;  4E7J A;  4PJO B;  2O01 E;  2VC8 A;  3KUF A;  4IUP A;  2DTO A;  1D3B B;  4B9X A;  1P92 A;  1YJW A;  5CIU A;  3PMT A;  4NS5 A;  3QZ5 B;  1FXX A;  2D9T A;  1I5L A;  3HRU A;  2VUB A;  3QII A;  2PVG B;  3SDZ A;  3L2Z A;  3CCV A;  5GAO r;  3CME T;  4HT8 A;  2F5T X;  2JOY A;  4QW2 A;  3L2R A;  1SSF A;  2VXF A;  2ZCF B;  4XU0 A;  3LX7 A;  3V7C A;  4D6W A;  5GAO n;  4ZN1 A;  3VKI A;  2MAM A;  4BDY A;  3FB9 A;  3JRZ A;  3OMG A;  4M78 E;  3E1S A;  3CCJ T;  1M1G A;  3CCS A;  2DXT A;  4LDY A;  2QTX A;  2GF7 A;  2X4X A;  2LNV A;  3QYG B;  4ATO A;  4PJO E;  4BE0 A;  2OTJ T;  5FRO A;  1YCY A;  3PIP A;  3MEU A;  4RMO A;  3S3N A;  3TCJ A;  3UDC A;  1IRE B;  2CYZ B;  4EPC A;  3JCM X;  3MEW A;  2JN0 A;  3CCQ T;  2KAF A;  1M90 U;  1VQN A;  5I2S A;  2VYT A;  3L2V A;  3MEA A;  3P8B B;  3M55 A;  4JRP A;  1VQL A;  5CKE A;  2LDM A;  5CKD A;  4NL2 A;  3TRE A;  1PSE A;  4FU6 A;  4C0D B;  4EDU A;  4J6W A;  3CCL T;  4BE1 A;  1YIJ A;  1HK9 A;  1VQP T;  4OF1 A;  4E47 A;  5GAM h;  2QEX T;  2E10 A;  4C92 D;  2OTL A;  2DXC A;  4E7K A;  2E6Z A;  3A8H B;  3CMA A;  1WJQ A;  1KG1 A;  1W4S A;  2R5M A;  2XIC A;  4C5E A;  2DXU A;  2DPP B;  4QVD A;  4MZM A;  2V8J A;  2XDP A;  4M75 F;  3PIO A;  1VQM T;  2DEQ A;  4XTU A;  3CCU A;  3A8O B;  2K2V A;  3OY9 A;  1N27 A;  4M75 G;  4QQ6 A;  2R5A A;  1KQS S;  3RKW A;  3CC4 A;  2L89 A;  1KQ1 A;  2FVU A;  2L3R A;  5LJ3 j;  2DIG A;  2RHY A;  2YHT A;  4M75 B;  4XAX B;  1YHQ T;  2EKO A;  4J5Y A;  3OYG A;  4X9C A;  2P0Q A;  4LDX A;  2QQS A;  4R56 A;  2E5Q A;  2HQE A;  4OVA A;  1YIT A;  4O5V A;  5LL6 S;  4M7A E;  1LOJ A;  5HK3 A;  3E9F A;  3GOX A;  3CC2 T;  3LW5 E;  1G3S A;  2K5I A;  2DD5 A;  4BI8 B;  5CR2 A;  1VQ7 A;  3FRN A;  2ZPH B;  2DKG A;  4ZTJ A;  3JB9 J;  4M78 C;  2DTI A;  5J26 A;  3ZFJ A;  3C12 A;  5GAM j;  1VQ6 A;  1VQO T;  4PJO C;  3E19 A;  1N9R A;  3V7S A;  3HRS A;  3SFM A;  5GAN 7;  3OA6 A;  1BKB A;  4M77 F;  4A4H A;  3J80 E;  1VQK T;  1KHI A;  2PQW A;  4M75 E;  4XQ3 A;  1AHJ B;  4J6X A;  4M77 G;  3DKM A;  3VYG A;  3FC3 A;  1G3W A;  3A8M B;  3RMS A;  5GAN 4;  4OB2 B;  2LVM A;  2XHC A;  4XTX A;  3JCM b;  1UGQ B;  5D6W A;  3C94 A;  3A8L B;  3QO3 A;  3OW2 A;  2DAQ A;  3JB9 I;  1Y71 A;  5GAN 5;  4M77 B;  3OS1 A;  3RER A;  3G6E A;  5LJ5 d;  3QXE B;  4FL6 A;  1VQ8 A;  3CBM A;  2MWO A;  2XK0 A;  2VGM A;  1N6A A;  2RJC A;  2ZPB B;  4ELY C;  4ELZ C;  1VQ9 A;  1JB0 E;  4C8Q F;  1WJS A;  1Y96 B;  3R6O A;  3QJY A;  4M78 A;  1QVP A;  4XTV A;  4Z02 A;  2E12 A;  2ZPI B;  3X24 B;  4ZTF A;  4JRI A;  3OYM A;  4C8Q G;  3HSB A;  4PJO A;  4OMF B;  2MI6 A;  3JB9 F;  4MZP A;  2XI9 A;  3EAE A;  3OYK A;  1NJI U;  1D3B A;  3JB9 G;  3M54 A;  5CQX A;  3DLM A;  4JJN K;  3GIB A;  3G4S T;  1QP3 A;  1YBY A;  2IVW A;  4C8Q B;  5IT9 E;  4J6Y A;  1BIA A;  1O9S A;  2HQX A;  2O4X B;  4II1 A;  3SWN B;  4PNO A;  2NLU A;  5DLO A;  1JJ2 S;  2CKK A;  5AYF A;  2EQK A;  5GAO m;  3WVD B;  4IUV A;  2OAU A;  3M4Y A;  1RL2 A;  4C0D C;  2DD4 A;  2EFI A;  1K73 C;  3MEV A;  4M77 E;  5KH6 A;  2RB6 A;  4HT9 A;  4MDX A;  4M7A C;  1Q7Y U;  1NJI C;  4XTY A;  4N4H A;  1M8V A;  1S72 T;  2F5K A;  3C4S A;  4P5N A;  5D6X A;  3X25 B;  2MWP A;  3RMQ A;  5CK9 A;  3RIR A;  3JCM c;  3EFR A;  2X4W A;  4BAC A;  4IUU A;  5GAN h;  1Q86 U;  2QXF A;  3ASK A;  1HXD A;  2EQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...