3PG0A

Crystal structure of designed 3-fold symmetric protein, threefoil
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
b'DGYYKLVARHSGKALDVENASTSDGANVIQYSYSGGDNQQWRLVDLGDGYYKLVARHSGKALDVENASTSDGANVIQYSYSGGDNQQWRLVDLGDGYYKLVARHSGKALDVENASTSDGANVIQYSYSGGDNQQWRLVDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThreeFoil
publication title Modular evolution and the origins of symmetry: reconstruction of a three-fold symmetric globular protein.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 51
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pg0A00
1Z2VA 2VSEA 8I1BA 1S0FA 3FJDA 3UJ0A 4QALA 2Y9WC 3BAHA 1YTOA 1NZKA 1PUUB 3PUBA 4QO3A 2HZ9A 4ISRA 3HSMA 4QBCA 1AVUA 3FUOA 2IHOA 4I7IA 3WA1A 1NUNA 2DS0A 2RSTA 4GAFA 4HJJA 3FJEA 1DQOA 3CA6A 5DSSB 4X37A 3BAUA 3CQAA 3NBEA 2Y9XE 4P0JA 2J3PA 3V79C 3RSJA 2VU9A 7I1BA 1G9BA 1T9FA 1WBAA 2MIBA 2D7RA 1A8DA 3VT2A 1JQZA 4HA2A 1AF9A 1KNMA 3FUQA 4ISQA 1BFFA 3ZXDA 4X38A 5BXTA 2K43A 4P0KA 3AZVA 4L4HA 1IOBA 4ZFWB 1VCLA 2BFHA 3VWCA 3P6JA 2MC2A 4JRAA 5BQUA 3O4AA 2VLCA 3CA0A 4I4VA 4A7ZA 1ISWA 1BA7A 4IY8A 3H6SE 1XG6A 1P63A 3IM5A 1AXMA 1N4KA 2X2SA 4XFSA 1SZ6B 3AKGA 3F1RA 3FJJA 1E0OA 3CAHA 3OJ2A 4ENDA 1DFQA 1BFGA 4I8MA 4J2KA 2BEBA 5E24E 3D7WB 3O4CA 1EYLA 3ZC8A 1RZOB 2FFVA 1SR4C 4OWJA 1V6VA 1EPWA 2L5XA 4LO3C 3R4UA 1DQGA 3JUTA 3A07A 4EFRA 3LLPA 3BA4A 2D43A 2GO2A 5FZUA 2KH2A 2FO1A 3BADA 3WMUA 5BP5C 1K5UA 1W3AA 1IRAX 2AFGA 2R9KB 1HIBA 1V6XA 3IIRA 4I1EA 4KEIA 5F8YA 2GZBA 1TIEA 3HMYA 4J2XA 1BLAA 4HR6C 3AJ5A 2P39A 4J2YA 4ZBVB 4G6MA 3HBWA 3AKIA 5DVHA 4X39A 5EC5A 1IJTA 3N0KA 4KC3A 31BIA 4QD2C 4OEGA 1AFCA 3FJ9A 5FZZA 3QYDA 3TC2A 1IILA 3T8SA 2I1BA 1Q03A 4LO7B 5F8SA 1EVTA 3FJCA 9ILBA 3Q7WA 1ISZA 1HCEA 4F83A 1QQLA 4G9MA 1DIWA 1FMMS 4I4SA 3NBNA 3BAVA 3O4DA 2D7IA 3AH4A 3RMYA 3FJ8A 2P23A 2D1ZA 3NBCA 3UDAA 4GOVA 3VSZA 3WO4A 3C9ZA 5F8WA 3FJFA 4DCKC 2VUAA 4EFQA 5I1BA 1Z4SA 1I1EA 4KEKA 4I37A 1QQKA 4I1BA 1G82A 1PC8B 1I1BA 2HWMA 1PZZA 3A22A 3AKFA 4TLPA 4ZFUB 5BP5A 1G9AA 1HWOB 4LO2C 4QBVA 4JQ0A 5GAQA 3AZWA 1ISVA 1Z0HA 3S8KA 1AVAC 2ESUA 4OW4A 3S8JA 1UPSA 3CA5A 3O4OA 4I96A 2AXMA 1S0BA 4IY9A 2VXRA 3EF2A 1II4A 3I29B 1R8NA 1JT3A 3RMXA 2AQZA 2NYYA 1JTCA 3RTIB 1TWEA 3VUOA 5DZUA 5FZYA 4ZFYB 3ZXGA 4EFPA 1JT4A 1TOOA 5BXPA 4ZLBB 4A7YA 4KBBA 2VXTI 2ZQNA 5HPZA 4JAWA 3AH2A 1F31A 1IHKA 1MC9A 2D22A 3BRGC 4KEJA 4LO1C 1TP0A 1D0HA 1Q1UA 3CRIA 3LTQA 4ZOTA 2DRYA 4LO0C 3FGMA 1TWMA 3HOMA 5BXRA 2FGFA 1Q04A 5DUYA 5EHAA 3WINC 3OBTA 1DLLA 1RG8A 1V6UA 3N7KA 3BAQA 3B9UA 1FMZA 5FNXA 1G9DA 4D0TA 4Q9PA 1XZZA 4JKQA 3OGGA 2ERMA 3OJMA 4FGFA 4I0YA 1RY7A 4CJMA 4GAIA 4JPZA 5EG6C 2D20A 3VSFA 1S0CA 41BIA 2E4MC 3OJVA 2QYIB 4I4XA 1BFBA 3PHZA 1EV2A 3V0BB 2F2FC 3OGFA 4QC4A 3AJ6A 4AN6A 3ZC9A 4L4IA 4ZGRB 2AAIB 1MD6A 1PWAA 3NJ5A 1BARA 3JRRA 3V0BA 2RQ9A 3BB2A 3POKA 3UD9A 3N7LA 4IYBA 4AN7B 4P6AA 3A23A 3O5WB 4EKXB 3PMEA 2DREA 4ZA3B 3O44A 4I4PA 3BRDA 1CVSA 3HN1A 4IZEA 4OUJA 1W3GA 4Q91A 1S0DA 4H04A 4Z8SB 3HALA 2YUGA 1K5VA 1V6WA 4IQPA 1DZDA 1JT7A 1SR4A 2ZQOA 2NTDA 4GP3A 1FWUA 2ZR1B 2Q3NB 4LO3A 1FWVA 1OQLB 3P53A 4USPA 3FJBA 3KMVA 2F8XC 1AVWB 2FFUA 3MALA 5BQUC 3I2AA 1HWPB 1YYNA 1BFCA 5F90A 2D44A 3O4BA 1YBIA 2UUSA 2RG9B 3BRFA 1DFCA 2Y9GA 1FN0A 1AVXB 4F34A 2K8RA 2NZ9A 2NVHA 4QKRA 1BLDA 3A21A 2F2FA 1JLYA 3VT1A 4QD2B 1YXWA 2Q9XA 4I3NA 3WMVA 2D24A 3PG0A 3AKHA 3BA7A 4D0ZA 1IRPA 3WO3A 3CA1A 1M16A 2LIQA 4DEPA 1TFMB 4X3AA 5BVPI 3RTJB 3QR5A 1FV3A 3UJ4A 5BXSA 1HWMB 2DRZA 2HWAA 2WBCA 2KI4A 2ET2A 1S0EA 3BAGA 4JKXB 1BASA 2Z48A 4I2SA 4OWKA 1ILR1 5BOWA 1JLXA 4II0A 4JP0A 2NM1A 1W3FA 4IONA 4LO8B 1ITBA 1JY0A 4I4UA 4A7KA 3BA5A 3P6IA 4G1RA 4IHZA 3MPPG 5D62A 5B2HA 1S0GA 1PUMB 3H6QA 3ZX7A 1DZCA 4Q9GA 1R8OA 3O3QA 4I4OA 5D61A 3NBDA 3SNVA 4QKSA 1ABRB 4J2SA 1IT0A 3BX1C 4J23B 4XFUA 5FNWA 1G9CA 2KKIA 2QN4A 1YF8B 2K4AB 4LO2A 3Q7XA 2M49A 1ISXA 3Q7YA 2KLLA 4H9WA 3IAGC 4EEEB 4G6JA 4EB2B 4OWLA 2HW9A 1HKNA 1T4QA 4LO7C 4PC4A 2VSAA 2X2TA 3CRHA 4I4YA 3VEQA 1L2HA 3V0AB 3AH1A 5G00A 4XKIA 3IM6A 3CU1B 4FVVA 4ZKTB 4USOA 2KI6B 2MLLB 3FJAA 3V0AA 1CE7B 4OEEA 3N7MA 1WBCA 1QXMA 2XOAA 1HCDA 4IZXA 3BAOA 3I2XA 1GGPB 1RMLA 1XHBA 2IWTB 5JLVA 2NP0A 2D23A 1ONKB 3F62B 4YOLA 3FJKA 1M2TB 1WD3A 2WRYA 4I4QA 3CRGA 3CA4A 4OEFA 4GOYA 2Z49A 3UD7A 3O49A 4DENA 3FJHA 4I4RA 5D63A 1ISYA 4GP0A 4LO1A 3VT0A 4Z9WB 1JT5A 1S0LA 1HWNB 4G9NA 2Y9FA 4LO0A 3FJIA 6I1BA 3E8LC 3BTAA 4I6IA 3WINA 1FGAA 3H6RB 1TTUA 2FDBM 1FQ9A 1DJSB 2LIEA 3IM7A 4P0LA 2BEAA 4R6UB 3R4SA 1XYFA 4D8HA 5JMCA 3H6RA 1FV2A 3OBRA 4WBCA 3UD8A 3N7JA 3W9TA 21BIA 3WO2A 1WD4A 2E4MA 1J0SA 4XFTA 3CA3A 3ILAA 3FFZA 3K1XA
chains in the Genus database with same CATH superfamily
1Z2VA 2VSEA 8I1BA 1S0FA 3FJDA 3UJ0A 4QALA 2Y9WC 3BAHA 1YTOA 1NZKA 1PUUB 3PUBA 4QO3A 2HZ9A 4ISRA 3HSMA 4QBCA 1AVUA 3FUOA 2IHOA 4I7IA 3WA1A 1NUNA 2DS0A 2RSTA 4GAFA 4HJJA 3FJEA 1DQOA 3CA6A 5DSSB 4X37A 3BAUA 3CQAA 3NBEA 2Y9XE 4P0JA 2J3PA 3V79C 3RSJA 2VU9A 7I1BA 1G9BA 1T9FA 1WBAA 2MIBA 2D7RA 1A8DA 3VT2A 1JQZA 4HA2A 1AF9A 1KNMA 3FUQA 4ISQA 1BFFA 3ZXDA 4X38A 5BXTA 2K43A 4P0KA 3AZVA 4L4HA 1IOBA 4ZFWB 1VCLA 2BFHA 3VWCA 3P6JA 2MC2A 4JRAA 5BQUA 3O4AA 2VLCA 3CA0A 4I4VA 4A7ZA 1ISWA 1BA7A 4IY8A 3H6SE 1XG6A 1P63A 3IM5A 1AXMA 1N4KA 2X2SA 4XFSA 1SZ6B 3AKGA 3F1RA 3FJJA 1E0OA 3CAHA 3OJ2A 4ENDA 1DFQA 1BFGA 4I8MA 4J2KA 2BEBA 5E24E 3D7WB 3O4CA 1EYLA 3ZC8A 1RZOB 2FFVA 1SR4C 4OWJA 1V6VA 1EPWA 2L5XA 4LO3C 3R4UA 1DQGA 3JUTA 3A07A 4EFRA 3LLPA 3BA4A 2D43A 2GO2A 5FZUA 2KH2A 2FO1A 3BADA 3WMUA 5BP5C 1K5UA 1W3AA 1IRAX 2AFGA 2R9KB 1HIBA 1V6XA 3IIRA 4I1EA 4KEIA 5F8YA 2GZBA 1TIEA 3HMYA 4J2XA 1BLAA 4HR6C 3AJ5A 2P39A 4J2YA 4ZBVB 4G6MA 3HBWA 3AKIA 5DVHA 4X39A 5EC5A 1IJTA 3N0KA 4KC3A 31BIA 4QD2C 4OEGA 1AFCA 3FJ9A 5FZZA 3QYDA 3TC2A 1IILA 3T8SA 2I1BA 1Q03A 4LO7B 5F8SA 1EVTA 3FJCA 9ILBA 3Q7WA 1ISZA 1HCEA 4F83A 1QQLA 4G9MA 1DIWA 1FMMS 4I4SA 3NBNA 3BAVA 3O4DA 2D7IA 3AH4A 3RMYA 3FJ8A 2P23A 2D1ZA 3NBCA 3UDAA 4GOVA 3VSZA 3WO4A 3C9ZA 5F8WA 3FJFA 4DCKC 2VUAA 4EFQA 5I1BA 1Z4SA 1I1EA 4KEKA 4I37A 1QQKA 4I1BA 1G82A 1PC8B 1I1BA 2HWMA 1PZZA 3A22A 3AKFA 4TLPA 4ZFUB 5BP5A 1G9AA 1HWOB 4LO2C 4QBVA 4JQ0A 5GAQA 3AZWA 1ISVA 1Z0HA 3S8KA 1AVAC 2ESUA 4UY4A 4OW4A 3S8JA 1UPSA 3CA5A 3O4OA 4I96A 2AXMA 1S0BA 4IY9A 2VXRA 3EF2A 1II4A 3I29B 1R8NA 1JT3A 3RMXA 2AQZA 2NYYA 1JTCA 3RTIB 1TWEA 4MZGB 3VUOA 5DZUA 5FZYA 4ZFYB 3ZXGA 4EFPA 1JT4A 1TOOA 5BXPA 4ZLBB 4A7YA 4KBBA 2VXTI 2ZQNA 5HPZA 4JAWA 3AH2A 1F31A 1IHKA 1MC9A 2D22A 3BRGC 4KEJA 4LO1C 1TP0A 1D0HA 1Q1UA 3CRIA 3LTQA 4ZOTA 2DRYA 4LO0C 3FGMA 1TWMA 3HOMA 5BXRA 2FGFA 1Q04A 5DUYA 5EHAA 3WINC 3OBTA 1DLLA 1RG8A 1V6UA 3N7KA 3BAQA 3B9UA 1FMZA 5FNXA 1G9DA 4D0TA 4Q9PA 1XZZA 4JKQA 3OGGA 2ERMA 3OJMA 4FGFA 4I0YA 1RY7A 4CJMA 4GAIA 4JPZA 5EG6C 2D20A 3VSFA 1S0CA 41BIA 2E4MC 3OJVA 2QYIB 4I4XA 1BFBA 3PHZA 1EV2A 3V0BB 2F2FC 3OGFA 4QC4A 3AJ6A 4AN6A 3ZC9A 4L4IA 4ZGRB 2AAIB 1MD6A 1PWAA 3NJ5A 1BARA 3JRRA 3V0BA 2RQ9A 3BB2A 3POKA 3UD9A 3N7LA 4IYBA 4AN7B 4P6AA 3A23A 3O5WB 4EKXB 3PMEA 2DREA 4ZA3B 3O44A 4I4PA 3BRDA 1CVSA 3HN1A 2NS2A 4IZEA 4OUJA 1W3GA 4Q91A 1S0DA 4H04A 4Z8SB 3HALA 2YUGA 1K5VA 1V6WA 4IQPA 1DZDA 1JT7A 1SR4A 2ZQOA 2NTDA 4GP3A 1FWUA 2ZR1B 2Q3NB 4LO3A 4MZFB 1FWVA 1OQLB 3P53A 4USPA 3FJBA 3KMVA 2F8XC 1AVWB 2FFUA 3MALA 5BQUC 3I2AA 1HWPB 1YYNA 1BFCA 5F90A 2D44A 3O4BA 1YBIA 2UUSA 2RG9B 3BRFA 1DFCA 2Y9GA 1FN0A 1AVXB 4F34A 2K8RA 2NZ9A 2NVHA 4QKRA 1BLDA 3A21A 2F2FA 1JLYA 3VT1A 4QD2B 1YXWA 2Q9XA 4I3NA 3WMVA 2D24A 3PG0A 3AKHA 3BA7A 4D0ZA 1IRPA 3WO3A 3CA1A 1M16A 2LIQA 4DEPA 1TFMB 4X3AA 5BVPI 3RTJB 3QR5A 1FV3A 3UJ4A 5BXSA 1HWMB 2DRZA 2HWAA 2WBCA 2KI4A 2ET2A 1S0EA 3BAGA 4JKXB 1BASA 2Z48A 4I2SA 4OWKA 1ILR1 5BOWA 1JLXA 4II0A 4JP0A 2NM1A 1W3FA 4IONA 4LO8B 1ITBA 1JY0A 4I4UA 4A7KA 3BA5A 3P6IA 4G1RA 4IHZA 3MPPG 5D62A 5B2HA 1S0GA 1PUMB 3H6QA 3ZX7A 1DZCA 4Q9GA 1R8OA 3O3QA 4I4OA 5D61A 3NBDA 3SNVA 4QKSA 1ABRB 4J2SA 1IT0A 3BX1C 4J23B 4XFUA 5FNWA 1G9CA 2KKIA 2QN4A 1YF8B 2K4AB 4LO2A 3Q7XA 2M49A 1ISXA 3Q7YA 2KLLA 4H9WA 3IAGC 4EEEB 4G6JA 4EB2B 4H75A 4OWLA 2HW9A 1HKNA 1T4QA 4LO7C 4PC4A 2VSAA 2X2TA 3CRHA 4I4YA 3VEQA 1L2HA 3V0AB 3AH1A 5G00A 4XKIA 3IM6A 3CU1B 4FVVA 4ZKTB 4USOA 2KI6B 4MZHA 2MLLB 3FJAA 3V0AA 1CE7B 4OEEA 3N7MA 1WBCA 1QXMA 2XOAA 1HCDA 4IZXA 3BAOA 3I2XA 1GGPB 1RMLA 1XHBA 2IWTB 5JLVA 2NP0A 2D23A 1ONKB 3F62B 4YOLA 3FJKA 1M2TB 1WD3A 2WRYA 4I4QA 3CRGA 3CA4A 4OEFA 4GOYA 2Z49A 3UD7A 3O49A 4DENA 3FJHA 4I4RA 5D63A 1ISYA 4GP0A 4LO1A 3VT0A 4Z9WB 1JT5A 1S0LA 1HWNB 4G9NA 2Y9FA 4LO0A 3FJIA 6I1BA 3E8LC 3BTAA 4I6IA 3WINA 1FGAA 3H6RB 1TTUA 2FDBM 1FQ9A 1DJSB 2LIEA 3IM7A 4P0LA 2BEAA 4R6UB 3R4SA 1XYFA 4D8HA 5JMCA 3H6RA 1FV2A 3OBRA 4WBCA 3UD8A 3N7JA 3W9TA 21BIA 3WO2A 1WD4A 2E4MA 1J0SA 4XFTA 3CA3A 3ILAA 3FFZA 3K1XA
chains in the Genus database with same CATH topology
1Z2VA 2VSEA 8I1BA 1S0FA 3FJDA 3UJ0A 4QALA 2Y9WC 3BAHA 1YTOA 1NZKA 1PUUB 3PUBA 4QO3A 2HZ9A 4ISRA 3HSMA 4QBCA 1AVUA 3FUOA 2IHOA 4I7IA 3WA1A 1NUNA 2DS0A 2RSTA 4GAFA 4HJJA 3FJEA 1DQOA 3CA6A 5DSSB 4X37A 3BAUA 3CQAA 3NBEA 2Y9XE 4P0JA 2J3PA 3V79C 3RSJA 2VU9A 7I1BA 1G9BA 1T9FA 1WBAA 2MIBA 2D7RA 1A8DA 3VT2A 1JQZA 4HA2A 1AF9A 1KNMA 3FUQA 4ISQA 1BFFA 3ZXDA 4X38A 5BXTA 2K43A 4P0KA 3AZVA 4L4HA 1IOBA 4ZFWB 1VCLA 2BFHA 3VWCA 3P6JA 2MC2A 4JRAA 5BQUA 3O4AA 2VLCA 3CA0A 4I4VA 4A7ZA 1ISWA 1BA7A 4IY8A 3H6SE 1XG6A 1P63A 3IM5A 1AXMA 1N4KA 2X2SA 4XFSA 1SZ6B 3AKGA 3F1RA 3FJJA 1E0OA 3CAHA 3OJ2A 4ENDA 1DFQA 1BFGA 4I8MA 4J2KA 2BEBA 5E24E 3D7WB 3O4CA 1EYLA 3ZC8A 1RZOB 2FFVA 1SR4C 4OWJA 1V6VA 1EPWA 2L5XA 4LO3C 3R4UA 1DQGA 3JUTA 3A07A 4EFRA 3LLPA 3BA4A 2D43A 2GO2A 5FZUA 2KH2A 2FO1A 3BADA 3WMUA 5BP5C 1K5UA 1W3AA 1IRAX 2AFGA 2R9KB 1HIBA 1V6XA 3IIRA 4I1EA 4KEIA 5F8YA 2GZBA 1TIEA 3HMYA 4J2XA 1BLAA 4HR6C 3AJ5A 2P39A 4J2YA 4ZBVB 4G6MA 3HBWA 3AKIA 5DVHA 4X39A 5EC5A 1IJTA 3N0KA 4KC3A 31BIA 4QD2C 4OEGA 1AFCA 3FJ9A 5FZZA 3QYDA 3TC2A 1IILA 3T8SA 2I1BA 1Q03A 4LO7B 5F8SA 1EVTA 3FJCA 9ILBA 3Q7WA 1ISZA 1HCEA 4F83A 1QQLA 4G9MA 1DIWA 1FMMS 4I4SA 3NBNA 3BAVA 3O4DA 2D7IA 3AH4A 3RMYA 3FJ8A 2P23A 2D1ZA 3NBCA 3UDAA 4GOVA 3VSZA 3WO4A 3C9ZA 5F8WA 3FJFA 4DCKC 2VUAA 4EFQA 5I1BA 1Z4SA 1I1EA 4KEKA 4I37A 1QQKA 4I1BA 1G82A 1PC8B 1I1BA 2HWMA 1PZZA 3A22A 3AKFA 4TLPA 4ZFUB 5BP5A 1G9AA 1HWOB 4LO2C 4QBVA 4JQ0A 5GAQA 3AZWA 1ISVA 1Z0HA 3S8KA 1AVAC 2ESUA 4UY4A 4OW4A 3S8JA 1UPSA 3CA5A 3O4OA 4I96A 2AXMA 1S0BA 4IY9A 2VXRA 3EF2A 1II4A 3I29B 1R8NA 1JT3A 3RMXA 2AQZA 2NYYA 1JTCA 3RTIB 1TWEA 4MZGB 3VUOA 5DZUA 5FZYA 4ZFYB 3ZXGA 4EFPA 1JT4A 1TOOA 5BXPA 4ZLBB 4A7YA 4KBBA 2VXTI 2ZQNA 5HPZA 4JAWA 3AH2A 1F31A 1IHKA 1MC9A 2D22A 3BRGC 4KEJA 4LO1C 1TP0A 1D0HA 1Q1UA 3CRIA 3LTQA 4ZOTA 2DRYA 4LO0C 3FGMA 1TWMA 3HOMA 5BXRA 2FGFA 1Q04A 5DUYA 5EHAA 3WINC 3OBTA 1DLLA 1RG8A 1V6UA 3N7KA 3BAQA 3B9UA 1FMZA 5FNXA 1G9DA 4D0TA 4Q9PA 1XZZA 4JKQA 3OGGA 2ERMA 3OJMA 4FGFA 4I0YA 1RY7A 4CJMA 4GAIA 4JPZA 5EG6C 2D20A 3VSFA 1S0CA 41BIA 2E4MC 3OJVA 2QYIB 4I4XA 1BFBA 3PHZA 1EV2A 3V0BB 2F2FC 3OGFA 4QC4A 3AJ6A 4AN6A 3ZC9A 4L4IA 4ZGRB 2AAIB 1MD6A 1PWAA 3NJ5A 1BARA 3JRRA 3V0BA 2RQ9A 3BB2A 3POKA 3UD9A 3N7LA 4IYBA 4AN7B 4P6AA 3A23A 3O5WB 4EKXB 3PMEA 2DREA 4ZA3B 3O44A 4I4PA 3BRDA 1CVSA 3HN1A 2NS2A 4IZEA 4OUJA 1W3GA 4Q91A 1S0DA 4H04A 4Z8SB 3HALA 2YUGA 1K5VA 1V6WA 4IQPA 1DZDA 1JT7A 1SR4A 2ZQOA 2NTDA 4GP3A 1FWUA 2ZR1B 2Q3NB 4LO3A 4MZFB 1FWVA 1OQLB 3P53A 4USPA 3FJBA 3KMVA 2F8XC 1AVWB 2FFUA 3MALA 5BQUC 3I2AA 1HWPB 1YYNA 1BFCA 5F90A 2D44A 3O4BA 1YBIA 2UUSA 2RG9B 3BRFA 1DFCA 2Y9GA 1FN0A 1AVXB 4F34A 2K8RA 2NZ9A 2NVHA 4QKRA 1BLDA 3A21A 2F2FA 1JLYA 3VT1A 4QD2B 1YXWA 2Q9XA 4I3NA 3WMVA 2D24A 3PG0A 3AKHA 3BA7A 4D0ZA 1IRPA 3WO3A 3CA1A 1M16A 2LIQA 4DEPA 1TFMB 4X3AA 5BVPI 3RTJB 3QR5A 1FV3A 3UJ4A 5BXSA 1HWMB 2DRZA 2HWAA 2WBCA 2KI4A 2ET2A 1S0EA 3BAGA 4JKXB 1BASA 2Z48A 4I2SA 4OWKA 1ILR1 5BOWA 1JLXA 4II0A 4JP0A 2NM1A 1W3FA 4IONA 4LO8B 1ITBA 1JY0A 4I4UA 4A7KA 3BA5A 3P6IA 4G1RA 4IHZA 3MPPG 5D62A 5B2HA 1S0GA 1PUMB 3H6QA 3ZX7A 1DZCA 4Q9GA 1R8OA 3O3QA 4I4OA 5D61A 3NBDA 3SNVA 4QKSA 1ABRB 4J2SA 1IT0A 3BX1C 4J23B 4XFUA 5FNWA 1G9CA 2KKIA 2QN4A 1YF8B 2K4AB 4LO2A 3Q7XA 2M49A 1ISXA 3Q7YA 2KLLA 4H9WA 3IAGC 4EEEB 4G6JA 4EB2B 4H75A 4OWLA 2HW9A 1HKNA 1T4QA 4LO7C 4PC4A 2VSAA 2X2TA 3CRHA 4I4YA 3VEQA 1L2HA 3V0AB 3AH1A 5G00A 4XKIA 3IM6A 3CU1B 4FVVA 4ZKTB 4USOA 2KI6B 4MZHA 2MLLB 3FJAA 3V0AA 1CE7B 4OEEA 3N7MA 1WBCA 1QXMA 2XOAA 1HCDA 4IZXA 3BAOA 3I2XA 1GGPB 1RMLA 1XHBA 2IWTB 5JLVA 2NP0A 2D23A 1ONKB 3F62B 4YOLA 3FJKA 1M2TB 1WD3A 2WRYA 4I4QA 3CRGA 3CA4A 4OEFA 4GOYA 2Z49A 3UD7A 3O49A 4DENA 3FJHA 4I4RA 5D63A 1ISYA 4GP0A 4LO1A 3VT0A 4Z9WB 1JT5A 1S0LA 1HWNB 4G9NA 2Y9FA 4LO0A 3FJIA 6I1BA 3E8LC 3BTAA 4I6IA 3WINA 1FGAA 3H6RB 1TTUA 2FDBM 1FQ9A 1DJSB 2LIEA 3IM7A 4P0LA 2BEAA 4R6UB 3R4SA 1XYFA 4D8HA 5JMCA 3H6RA 1FV2A 3OBRA 4WBCA 3UD8A 3N7JA 3W9TA 21BIA 3WO2A 1WD4A 2E4MA 1J0SA 4XFTA 3CA3A 3ILAA 3FFZA 3K1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2V A;  2VSE A;  8I1B A;  1S0F A;  3FJD A;  3UJ0 A;  4QAL A;  2Y9W C;  3BAH A;  1YTO A;  1NZK A;  1PUU B;  3PUB A;  4QO3 A;  2HZ9 A;  4ISR A;  3HSM A;  4QBC A;  1AVU A;  3FUO A;  2IHO A;  4I7I A;  3WA1 A;  1NUN A;  2DS0 A;  2RST A;  4GAF A;  4HJJ A;  3FJE A;  1DQO A;  3CA6 A;  5DSS B;  4X37 A;  3BAU A;  3CQA A;  3NBE A;  2Y9X E;  4P0J A;  2J3P A;  3V79 C;  3RSJ A;  2VU9 A;  7I1B A;  1G9B A;  1T9F A;  1WBA A;  2MIB A;  2D7R A;  1A8D A;  3VT2 A;  1JQZ A;  4HA2 A;  1AF9 A;  1KNM A;  3FUQ A;  4ISQ A;  1BFF A;  3ZXD A;  4X38 A;  5BXT A;  2K43 A;  4P0K A;  3AZV A;  4L4H A;  1IOB A;  4ZFW B;  1VCL A;  2BFH A;  3VWC A;  3P6J A;  2MC2 A;  4JRA A;  5BQU A;  3O4A A;  2VLC A;  3CA0 A;  4I4V A;  4A7Z A;  1ISW A;  1BA7 A;  4IY8 A;  3H6S E;  1XG6 A;  1P63 A;  3IM5 A;  1AXM A;  1N4K A;  2X2S A;  4XFS A;  1SZ6 B;  3AKG A;  3F1R A;  3FJJ A;  1E0O A;  3CAH A;  3OJ2 A;  4END A;  1DFQ A;  1BFG A;  4I8M A;  4J2K A;  2BEB A;  5E24 E;  3D7W B;  3O4C A;  1EYL A;  3ZC8 A;  1RZO B;  2FFV A;  1SR4 C;  4OWJ A;  1V6V A;  1EPW A;  2L5X A;  4LO3 C;  3R4U A;  1DQG A;  3JUT A;  3A07 A;  4EFR A;  3LLP A;  3BA4 A;  2D43 A;  2GO2 A;  5FZU A;  2KH2 A;  2FO1 A;  3BAD A;  3WMU A;  5BP5 C;  1K5U A;  1W3A A;  1IRA X;  2AFG A;  2R9K B;  1HIB A;  1V6X A;  3IIR A;  4I1E A;  4KEI A;  5F8Y A;  2GZB A;  1TIE A;  3HMY A;  4J2X A;  1BLA A;  4HR6 C;  3AJ5 A;  2P39 A;  4J2Y A;  4ZBV B;  4G6M A;  3HBW A;  3AKI A;  5DVH A;  4X39 A;  5EC5 A;  1IJT A;  3N0K A;  4KC3 A;  31BI A;  4QD2 C;  4OEG A;  1AFC A;  3FJ9 A;  5FZZ A;  3QYD A;  3TC2 A;  1IIL A;  3T8S A;  2I1B A;  1Q03 A;  4LO7 B;  5F8S A;  1EVT A;  3FJC A;  9ILB A;  3Q7W A;  1ISZ A;  1HCE A;  4F83 A;  1QQL A;  4G9M A;  1DIW A;  1FMM S;  4I4S A;  3NBN A;  3BAV A;  3O4D A;  2D7I A;  3AH4 A;  3RMY A;  3FJ8 A;  2P23 A;  2D1Z A;  3NBC A;  3UDA A;  4GOV A;  3VSZ A;  3WO4 A;  3C9Z A;  5F8W A;  3FJF A;  4DCK C;  2VUA A;  4EFQ A;  5I1B A;  1Z4S A;  1I1E A;  4KEK A;  4I37 A;  1QQK A;  4I1B A;  1G82 A;  1PC8 B;  1I1B A;  2HWM A;  1PZZ A;  3A22 A;  3AKF A;  4TLP A;  4ZFU B;  5BP5 A;  1G9A A;  1HWO B;  4LO2 C;  4QBV A;  4JQ0 A;  5GAQ A;  3AZW A;  1ISV A;  1Z0H A;  3S8K A;  1AVA C;  2ESU A;  4OW4 A;  3S8J A;  1UPS A;  3CA5 A;  3O4O A;  4I96 A;  2AXM A;  1S0B A;  4IY9 A;  2VXR A;  3EF2 A;  1II4 A;  3I29 B;  1R8N A;  1JT3 A;  3RMX A;  2AQZ A;  2NYY A;  1JTC A;  3RTI B;  1TWE A;  3VUO A;  5DZU A;  5FZY A;  4ZFY B;  3ZXG A;  4EFP A;  1JT4 A;  1TOO A;  5BXP A;  4ZLB B;  4A7Y A;  4KBB A;  2VXT I;  2ZQN A;  5HPZ A;  4JAW A;  3AH2 A;  1F31 A;  1IHK A;  1MC9 A;  2D22 A;  3BRG C;  4KEJ A;  4LO1 C;  1TP0 A;  1D0H A;  1Q1U A;  3CRI A;  3LTQ A;  4ZOT A;  2DRY A;  4LO0 C;  3FGM A;  1TWM A;  3HOM A;  5BXR A;  2FGF A;  1Q04 A;  5DUY A;  5EHA A;  3WIN C;  3OBT A;  1DLL A;  1RG8 A;  1V6U A;  3N7K A;  3BAQ A;  3B9U A;  1FMZ A;  5FNX A;  1G9D A;  4D0T A;  4Q9P A;  1XZZ A;  4JKQ A;  3OGG A;  2ERM A;  3OJM A;  4FGF A;  4I0Y A;  1RY7 A;  4CJM A;  4GAI A;  4JPZ A;  5EG6 C;  2D20 A;  3VSF A;  1S0C A;  41BI A;  2E4M C;  3OJV A;  2QYI B;  4I4X A;  1BFB A;  3PHZ A;  1EV2 A;  3V0B B;  2F2F C;  3OGF A;  4QC4 A;  3AJ6 A;  4AN6 A;  3ZC9 A;  4L4I A;  4ZGR B;  2AAI B;  1MD6 A;  1PWA A;  3NJ5 A;  1BAR A;  3JRR A;  3V0B A;  2RQ9 A;  3BB2 A;  3POK A;  3UD9 A;  3N7L A;  4IYB A;  4AN7 B;  4P6A A;  3A23 A;  3O5W B;  4EKX B;  3PME A;  2DRE A;  4ZA3 B;  3O44 A;  4I4P A;  3BRD A;  1CVS A;  3HN1 A;  4IZE A;  4OUJ A;  1W3G A;  4Q91 A;  1S0D A;  4H04 A;  4Z8S B;  3HAL A;  2YUG A;  1K5V A;  1V6W A;  4IQP A;  1DZD A;  1JT7 A;  1SR4 A;  2ZQO A;  2NTD A;  4GP3 A;  1FWU A;  2ZR1 B;  2Q3N B;  4LO3 A;  1FWV A;  1OQL B;  3P53 A;  4USP A;  3FJB A;  3KMV A;  2F8X C;  1AVW B;  2FFU A;  3MAL A;  5BQU C;  3I2A A;  1HWP B;  1YYN A;  1BFC A;  5F90 A;  2D44 A;  3O4B A;  1YBI A;  2UUS A;  2RG9 B;  3BRF A;  1DFC A;  2Y9G A;  1FN0 A;  1AVX B;  4F34 A;  2K8R A;  2NZ9 A;  2NVH A;  4QKR A;  1BLD A;  3A21 A;  2F2F A;  1JLY A;  3VT1 A;  4QD2 B;  1YXW A;  2Q9X A;  4I3N A;  3WMV A;  2D24 A;  3PG0 A;  3AKH A;  3BA7 A;  4D0Z A;  1IRP A;  3WO3 A;  3CA1 A;  1M16 A;  2LIQ A;  4DEP A;  1TFM B;  4X3A A;  5BVP I;  3RTJ B;  3QR5 A;  1FV3 A;  3UJ4 A;  5BXS A;  1HWM B;  2DRZ A;  2HWA A;  2WBC A;  2KI4 A;  2ET2 A;  1S0E A;  3BAG A;  4JKX B;  1BAS A;  2Z48 A;  4I2S A;  4OWK A;  1ILR 1;  5BOW A;  1JLX A;  4II0 A;  4JP0 A;  2NM1 A;  1W3F A;  4ION A;  4LO8 B;  1ITB A;  1JY0 A;  4I4U A;  4A7K A;  3BA5 A;  3P6I A;  4G1R A;  4IHZ A;  3MPP G;  5D62 A;  5B2H A;  1S0G A;  1PUM B;  3H6Q A;  3ZX7 A;  1DZC A;  4Q9G A;  1R8O A;  3O3Q A;  4I4O A;  5D61 A;  3NBD A;  3SNV A;  4QKS A;  1ABR B;  4J2S A;  1IT0 A;  3BX1 C;  4J23 B;  4XFU A;  5FNW A;  1G9C A;  2KKI A;  2QN4 A;  1YF8 B;  2K4A B;  4LO2 A;  3Q7X A;  2M49 A;  1ISX A;  3Q7Y A;  2KLL A;  4H9W A;  3IAG C;  4EEE B;  4G6J A;  4EB2 B;  4OWL A;  2HW9 A;  1HKN A;  1T4Q A;  4LO7 C;  4PC4 A;  2VSA A;  2X2T A;  3CRH A;  4I4Y A;  3VEQ A;  1L2H A;  3V0A B;  3AH1 A;  5G00 A;  4XKI A;  3IM6 A;  3CU1 B;  4FVV A;  4ZKT B;  4USO A;  2KI6 B;  2MLL B;  3FJA A;  3V0A A;  1CE7 B;  4OEE A;  3N7M A;  1WBC A;  1QXM A;  2XOA A;  1HCD A;  4IZX A;  3BAO A;  3I2X A;  1GGP B;  1RML A;  1XHB A;  2IWT B;  5JLV A;  2NP0 A;  2D23 A;  1ONK B;  3F62 B;  4YOL A;  3FJK A;  1M2T B;  1WD3 A;  2WRY A;  4I4Q A;  3CRG A;  3CA4 A;  4OEF A;  4GOY A;  2Z49 A;  3UD7 A;  3O49 A;  4DEN A;  3FJH A;  4I4R A;  5D63 A;  1ISY A;  4GP0 A;  4LO1 A;  3VT0 A;  4Z9W B;  1JT5 A;  1S0L A;  1HWN B;  4G9N A;  2Y9F A;  4LO0 A;  3FJI A;  6I1B A;  3E8L C;  3BTA A;  4I6I A;  3WIN A;  1FGA A;  3H6R B;  1TTU A;  2FDB M;  1FQ9 A;  1DJS B;  2LIE A;  3IM7 A;  4P0L A;  2BEA A;  4R6U B;  3R4S A;  1XYF A;  4D8H A;  5JMC A;  3H6R A;  1FV2 A;  3OBR A;  4WBC A;  3UD8 A;  3N7J A;  3W9T A;  21BI A;  3WO2 A;  1WD4 A;  2E4M A;  1J0S A;  4XFT A;  3CA3 A;  3ILA A;  3FFZ A;  3K1X A; 
#chains in the Genus database with same CATH topology
 1Z2V A;  2VSE A;  8I1B A;  1S0F A;  3FJD A;  3UJ0 A;  4QAL A;  2Y9W C;  3BAH A;  1YTO A;  1NZK A;  1PUU B;  3PUB A;  4QO3 A;  2HZ9 A;  4ISR A;  3HSM A;  4QBC A;  1AVU A;  3FUO A;  2IHO A;  4I7I A;  3WA1 A;  1NUN A;  2DS0 A;  2RST A;  4GAF A;  4HJJ A;  3FJE A;  1DQO A;  3CA6 A;  5DSS B;  4X37 A;  3BAU A;  3CQA A;  3NBE A;  2Y9X E;  4P0J A;  2J3P A;  3V79 C;  3RSJ A;  2VU9 A;  7I1B A;  1G9B A;  1T9F A;  1WBA A;  2MIB A;  2D7R A;  1A8D A;  3VT2 A;  1JQZ A;  4HA2 A;  1AF9 A;  1KNM A;  3FUQ A;  4ISQ A;  1BFF A;  3ZXD A;  4X38 A;  5BXT A;  2K43 A;  4P0K A;  3AZV A;  4L4H A;  1IOB A;  4ZFW B;  1VCL A;  2BFH A;  3VWC A;  3P6J A;  2MC2 A;  4JRA A;  5BQU A;  3O4A A;  2VLC A;  3CA0 A;  4I4V A;  4A7Z A;  1ISW A;  1BA7 A;  4IY8 A;  3H6S E;  1XG6 A;  1P63 A;  3IM5 A;  1AXM A;  1N4K A;  2X2S A;  4XFS A;  1SZ6 B;  3AKG A;  3F1R A;  3FJJ A;  1E0O A;  3CAH A;  3OJ2 A;  4END A;  1DFQ A;  1BFG A;  4I8M A;  4J2K A;  2BEB A;  5E24 E;  3D7W B;  3O4C A;  1EYL A;  3ZC8 A;  1RZO B;  2FFV A;  1SR4 C;  4OWJ A;  1V6V A;  1EPW A;  2L5X A;  4LO3 C;  3R4U A;  1DQG A;  3JUT A;  3A07 A;  4EFR A;  3LLP A;  3BA4 A;  2D43 A;  2GO2 A;  5FZU A;  2KH2 A;  2FO1 A;  3BAD A;  3WMU A;  5BP5 C;  1K5U A;  1W3A A;  1IRA X;  2AFG A;  2R9K B;  1HIB A;  1V6X A;  3IIR A;  4I1E A;  4KEI A;  5F8Y A;  2GZB A;  1TIE A;  3HMY A;  4J2X A;  1BLA A;  4HR6 C;  3AJ5 A;  2P39 A;  4J2Y A;  4ZBV B;  4G6M A;  3HBW A;  3AKI A;  5DVH A;  4X39 A;  5EC5 A;  1IJT A;  3N0K A;  4KC3 A;  31BI A;  4QD2 C;  4OEG A;  1AFC A;  3FJ9 A;  5FZZ A;  3QYD A;  3TC2 A;  1IIL A;  3T8S A;  2I1B A;  1Q03 A;  4LO7 B;  5F8S A;  1EVT A;  3FJC A;  9ILB A;  3Q7W A;  1ISZ A;  1HCE A;  4F83 A;  1QQL A;  4G9M A;  1DIW A;  1FMM S;  4I4S A;  3NBN A;  3BAV A;  3O4D A;  2D7I A;  3AH4 A;  3RMY A;  3FJ8 A;  2P23 A;  2D1Z A;  3NBC A;  3UDA A;  4GOV A;  3VSZ A;  3WO4 A;  3C9Z A;  5F8W A;  3FJF A;  4DCK C;  2VUA A;  4EFQ A;  5I1B A;  1Z4S A;  1I1E A;  4KEK A;  4I37 A;  1QQK A;  4I1B A;  1G82 A;  1PC8 B;  1I1B A;  2HWM A;  1PZZ A;  3A22 A;  3AKF A;  4TLP A;  4ZFU B;  5BP5 A;  1G9A A;  1HWO B;  4LO2 C;  4QBV A;  4JQ0 A;  5GAQ A;  3AZW A;  1ISV A;  1Z0H A;  3S8K A;  1AVA C;  2ESU A;  4UY4 A;  4OW4 A;  3S8J A;  1UPS A;  3CA5 A;  3O4O A;  4I96 A;  2AXM A;  1S0B A;  4IY9 A;  2VXR A;  3EF2 A;  1II4 A;  3I29 B;  1R8N A;  1JT3 A;  3RMX A;  2AQZ A;  2NYY A;  1JTC A;  3RTI B;  1TWE A;  4MZG B;  3VUO A;  5DZU A;  5FZY A;  4ZFY B;  3ZXG A;  4EFP A;  1JT4 A;  1TOO A;  5BXP A;  4ZLB B;  4A7Y A;  4KBB A;  2VXT I;  2ZQN A;  5HPZ A;  4JAW A;  3AH2 A;  1F31 A;  1IHK A;  1MC9 A;  2D22 A;  3BRG C;  4KEJ A;  4LO1 C;  1TP0 A;  1D0H A;  1Q1U A;  3CRI A;  3LTQ A;  4ZOT A;  2DRY A;  4LO0 C;  3FGM A;  1TWM A;  3HOM A;  5BXR A;  2FGF A;  1Q04 A;  5DUY A;  5EHA A;  3WIN C;  3OBT A;  1DLL A;  1RG8 A;  1V6U A;  3N7K A;  3BAQ A;  3B9U A;  1FMZ A;  5FNX A;  1G9D A;  4D0T A;  4Q9P A;  1XZZ A;  4JKQ A;  3OGG A;  2ERM A;  3OJM A;  4FGF A;  4I0Y A;  1RY7 A;  4CJM A;  4GAI A;  4JPZ A;  5EG6 C;  2D20 A;  3VSF A;  1S0C A;  41BI A;  2E4M C;  3OJV A;  2QYI B;  4I4X A;  1BFB A;  3PHZ A;  1EV2 A;  3V0B B;  2F2F C;  3OGF A;  4QC4 A;  3AJ6 A;  4AN6 A;  3ZC9 A;  4L4I A;  4ZGR B;  2AAI B;  1MD6 A;  1PWA A;  3NJ5 A;  1BAR A;  3JRR A;  3V0B A;  2RQ9 A;  3BB2 A;  3POK A;  3UD9 A;  3N7L A;  4IYB A;  4AN7 B;  4P6A A;  3A23 A;  3O5W B;  4EKX B;  3PME A;  2DRE A;  4ZA3 B;  3O44 A;  4I4P A;  3BRD A;  1CVS A;  3HN1 A;  2NS2 A;  4IZE A;  4OUJ A;  1W3G A;  4Q91 A;  1S0D A;  4H04 A;  4Z8S B;  3HAL A;  2YUG A;  1K5V A;  1V6W A;  4IQP A;  1DZD A;  1JT7 A;  1SR4 A;  2ZQO A;  2NTD A;  4GP3 A;  1FWU A;  2ZR1 B;  2Q3N B;  4LO3 A;  4MZF B;  1FWV A;  1OQL B;  3P53 A;  4USP A;  3FJB A;  3KMV A;  2F8X C;  1AVW B;  2FFU A;  3MAL A;  5BQU C;  3I2A A;  1HWP B;  1YYN A;  1BFC A;  5F90 A;  2D44 A;  3O4B A;  1YBI A;  2UUS A;  2RG9 B;  3BRF A;  1DFC A;  2Y9G A;  1FN0 A;  1AVX B;  4F34 A;  2K8R A;  2NZ9 A;  2NVH A;  4QKR A;  1BLD A;  3A21 A;  2F2F A;  1JLY A;  3VT1 A;  4QD2 B;  1YXW A;  2Q9X A;  4I3N A;  3WMV A;  2D24 A;  3PG0 A;  3AKH A;  3BA7 A;  4D0Z A;  1IRP A;  3WO3 A;  3CA1 A;  1M16 A;  2LIQ A;  4DEP A;  1TFM B;  4X3A A;  5BVP I;  3RTJ B;  3QR5 A;  1FV3 A;  3UJ4 A;  5BXS A;  1HWM B;  2DRZ A;  2HWA A;  2WBC A;  2KI4 A;  2ET2 A;  1S0E A;  3BAG A;  4JKX B;  1BAS A;  2Z48 A;  4I2S A;  4OWK A;  1ILR 1;  5BOW A;  1JLX A;  4II0 A;  4JP0 A;  2NM1 A;  1W3F A;  4ION A;  4LO8 B;  1ITB A;  1JY0 A;  4I4U A;  4A7K A;  3BA5 A;  3P6I A;  4G1R A;  4IHZ A;  3MPP G;  5D62 A;  5B2H A;  1S0G A;  1PUM B;  3H6Q A;  3ZX7 A;  1DZC A;  4Q9G A;  1R8O A;  3O3Q A;  4I4O A;  5D61 A;  3NBD A;  3SNV A;  4QKS A;  1ABR B;  4J2S A;  1IT0 A;  3BX1 C;  4J23 B;  4XFU A;  5FNW A;  1G9C A;  2KKI A;  2QN4 A;  1YF8 B;  2K4A B;  4LO2 A;  3Q7X A;  2M49 A;  1ISX A;  3Q7Y A;  2KLL A;  4H9W A;  3IAG C;  4EEE B;  4G6J A;  4EB2 B;  4H75 A;  4OWL A;  2HW9 A;  1HKN A;  1T4Q A;  4LO7 C;  4PC4 A;  2VSA A;  2X2T A;  3CRH A;  4I4Y A;  3VEQ A;  1L2H A;  3V0A B;  3AH1 A;  5G00 A;  4XKI A;  3IM6 A;  3CU1 B;  4FVV A;  4ZKT B;  4USO A;  2KI6 B;  4MZH A;  2MLL B;  3FJA A;  3V0A A;  1CE7 B;  4OEE A;  3N7M A;  1WBC A;  1QXM A;  2XOA A;  1HCD A;  4IZX A;  3BAO A;  3I2X A;  1GGP B;  1RML A;  1XHB A;  2IWT B;  5JLV A;  2NP0 A;  2D23 A;  1ONK B;  3F62 B;  4YOL A;  3FJK A;  1M2T B;  1WD3 A;  2WRY A;  4I4Q A;  3CRG A;  3CA4 A;  4OEF A;  4GOY A;  2Z49 A;  3UD7 A;  3O49 A;  4DEN A;  3FJH A;  4I4R A;  5D63 A;  1ISY A;  4GP0 A;  4LO1 A;  3VT0 A;  4Z9W B;  1JT5 A;  1S0L A;  1HWN B;  4G9N A;  2Y9F A;  4LO0 A;  3FJI A;  6I1B A;  3E8L C;  3BTA A;  4I6I A;  3WIN A;  1FGA A;  3H6R B;  1TTU A;  2FDB M;  1FQ9 A;  1DJS B;  2LIE A;  3IM7 A;  4P0L A;  2BEA A;  4R6U B;  3R4S A;  1XYF A;  4D8H A;  5JMC A;  3H6R A;  1FV2 A;  3OBR A;  4WBC A;  3UD8 A;  3N7J A;  3W9T A;  21BI A;  3WO2 A;  1WD4 A;  2E4M A;  1J0S A;  4XFT A;  3CA3 A;  3ILA A;  3FFZ A;  3K1X A; 
#chains in the Genus database with same CATH homology
 1Z2V A;  2VSE A;  8I1B A;  1S0F A;  3FJD A;  3UJ0 A;  4QAL A;  2Y9W C;  3BAH A;  1YTO A;  1NZK A;  1PUU B;  3PUB A;  4QO3 A;  2HZ9 A;  4ISR A;  3HSM A;  4QBC A;  1AVU A;  3FUO A;  2IHO A;  4I7I A;  3WA1 A;  1NUN A;  2DS0 A;  2RST A;  4GAF A;  4HJJ A;  3FJE A;  1DQO A;  3CA6 A;  5DSS B;  4X37 A;  3BAU A;  3CQA A;  3NBE A;  2Y9X E;  4P0J A;  2J3P A;  3V79 C;  3RSJ A;  2VU9 A;  7I1B A;  1G9B A;  1T9F A;  1WBA A;  2MIB A;  2D7R A;  1A8D A;  3VT2 A;  1JQZ A;  4HA2 A;  1AF9 A;  1KNM A;  3FUQ A;  4ISQ A;  1BFF A;  3ZXD A;  4X38 A;  5BXT A;  2K43 A;  4P0K A;  3AZV A;  4L4H A;  1IOB A;  4ZFW B;  1VCL A;  2BFH A;  3VWC A;  3P6J A;  2MC2 A;  4JRA A;  5BQU A;  3O4A A;  2VLC A;  3CA0 A;  4I4V A;  4A7Z A;  1ISW A;  1BA7 A;  4IY8 A;  3H6S E;  1XG6 A;  1P63 A;  3IM5 A;  1AXM A;  1N4K A;  2X2S A;  4XFS A;  1SZ6 B;  3AKG A;  3F1R A;  3FJJ A;  1E0O A;  3CAH A;  3OJ2 A;  4END A;  1DFQ A;  1BFG A;  4I8M A;  4J2K A;  2BEB A;  5E24 E;  3D7W B;  3O4C A;  1EYL A;  3ZC8 A;  1RZO B;  2FFV A;  1SR4 C;  4OWJ A;  1V6V A;  1EPW A;  2L5X A;  4LO3 C;  3R4U A;  1DQG A;  3JUT A;  3A07 A;  4EFR A;  3LLP A;  3BA4 A;  2D43 A;  2GO2 A;  5FZU A;  2KH2 A;  2FO1 A;  3BAD A;  3WMU A;  5BP5 C;  1K5U A;  1W3A A;  1IRA X;  2AFG A;  2R9K B;  1HIB A;  1V6X A;  3IIR A;  4I1E A;  4KEI A;  5F8Y A;  2GZB A;  1TIE A;  3HMY A;  4J2X A;  1BLA A;  4HR6 C;  3AJ5 A;  2P39 A;  4J2Y A;  4ZBV B;  4G6M A;  3HBW A;  3AKI A;  5DVH A;  4X39 A;  5EC5 A;  1IJT A;  3N0K A;  4KC3 A;  31BI A;  4QD2 C;  4OEG A;  1AFC A;  3FJ9 A;  5FZZ A;  3QYD A;  3TC2 A;  1IIL A;  3T8S A;  2I1B A;  1Q03 A;  4LO7 B;  5F8S A;  1EVT A;  3FJC A;  9ILB A;  3Q7W A;  1ISZ A;  1HCE A;  4F83 A;  1QQL A;  4G9M A;  1DIW A;  1FMM S;  4I4S A;  3NBN A;  3BAV A;  3O4D A;  2D7I A;  3AH4 A;  3RMY A;  3FJ8 A;  2P23 A;  2D1Z A;  3NBC A;  3UDA A;  4GOV A;  3VSZ A;  3WO4 A;  3C9Z A;  5F8W A;  3FJF A;  4DCK C;  2VUA A;  4EFQ A;  5I1B A;  1Z4S A;  1I1E A;  4KEK A;  4I37 A;  1QQK A;  4I1B A;  1G82 A;  1PC8 B;  1I1B A;  2HWM A;  1PZZ A;  3A22 A;  3AKF A;  4TLP A;  4ZFU B;  5BP5 A;  1G9A A;  1HWO B;  4LO2 C;  4QBV A;  4JQ0 A;  5GAQ A;  3AZW A;  1ISV A;  1Z0H A;  3S8K A;  1AVA C;  2ESU A;  4UY4 A;  4OW4 A;  3S8J A;  1UPS A;  3CA5 A;  3O4O A;  4I96 A;  2AXM A;  1S0B A;  4IY9 A;  2VXR A;  3EF2 A;  1II4 A;  3I29 B;  1R8N A;  1JT3 A;  3RMX A;  2AQZ A;  2NYY A;  1JTC A;  3RTI B;  1TWE A;  4MZG B;  3VUO A;  5DZU A;  5FZY A;  4ZFY B;  3ZXG A;  4EFP A;  1JT4 A;  1TOO A;  5BXP A;  4ZLB B;  4A7Y A;  4KBB A;  2VXT I;  2ZQN A;  5HPZ A;  4JAW A;  3AH2 A;  1F31 A;  1IHK A;  1MC9 A;  2D22 A;  3BRG C;  4KEJ A;  4LO1 C;  1TP0 A;  1D0H A;  1Q1U A;  3CRI A;  3LTQ A;  4ZOT A;  2DRY A;  4LO0 C;  3FGM A;  1TWM A;  3HOM A;  5BXR A;  2FGF A;  1Q04 A;  5DUY A;  5EHA A;  3WIN C;  3OBT A;  1DLL A;  1RG8 A;  1V6U A;  3N7K A;  3BAQ A;  3B9U A;  1FMZ A;  5FNX A;  1G9D A;  4D0T A;  4Q9P A;  1XZZ A;  4JKQ A;  3OGG A;  2ERM A;  3OJM A;  4FGF A;  4I0Y A;  1RY7 A;  4CJM A;  4GAI A;  4JPZ A;  5EG6 C;  2D20 A;  3VSF A;  1S0C A;  41BI A;  2E4M C;  3OJV A;  2QYI B;  4I4X A;  1BFB A;  3PHZ A;  1EV2 A;  3V0B B;  2F2F C;  3OGF A;  4QC4 A;  3AJ6 A;  4AN6 A;  3ZC9 A;  4L4I A;  4ZGR B;  2AAI B;  1MD6 A;  1PWA A;  3NJ5 A;  1BAR A;  3JRR A;  3V0B A;  2RQ9 A;  3BB2 A;  3POK A;  3UD9 A;  3N7L A;  4IYB A;  4AN7 B;  4P6A A;  3A23 A;  3O5W B;  4EKX B;  3PME A;  2DRE A;  4ZA3 B;  3O44 A;  4I4P A;  3BRD A;  1CVS A;  3HN1 A;  2NS2 A;  4IZE A;  4OUJ A;  1W3G A;  4Q91 A;  1S0D A;  4H04 A;  4Z8S B;  3HAL A;  2YUG A;  1K5V A;  1V6W A;  4IQP A;  1DZD A;  1JT7 A;  1SR4 A;  2ZQO A;  2NTD A;  4GP3 A;  1FWU A;  2ZR1 B;  2Q3N B;  4LO3 A;  4MZF B;  1FWV A;  1OQL B;  3P53 A;  4USP A;  3FJB A;  3KMV A;  2F8X C;  1AVW B;  2FFU A;  3MAL A;  5BQU C;  3I2A A;  1HWP B;  1YYN A;  1BFC A;  5F90 A;  2D44 A;  3O4B A;  1YBI A;  2UUS A;  2RG9 B;  3BRF A;  1DFC A;  2Y9G A;  1FN0 A;  1AVX B;  4F34 A;  2K8R A;  2NZ9 A;  2NVH A;  4QKR A;  1BLD A;  3A21 A;  2F2F A;  1JLY A;  3VT1 A;  4QD2 B;  1YXW A;  2Q9X A;  4I3N A;  3WMV A;  2D24 A;  3PG0 A;  3AKH A;  3BA7 A;  4D0Z A;  1IRP A;  3WO3 A;  3CA1 A;  1M16 A;  2LIQ A;  4DEP A;  1TFM B;  4X3A A;  5BVP I;  3RTJ B;  3QR5 A;  1FV3 A;  3UJ4 A;  5BXS A;  1HWM B;  2DRZ A;  2HWA A;  2WBC A;  2KI4 A;  2ET2 A;  1S0E A;  3BAG A;  4JKX B;  1BAS A;  2Z48 A;  4I2S A;  4OWK A;  1ILR 1;  5BOW A;  1JLX A;  4II0 A;  4JP0 A;  2NM1 A;  1W3F A;  4ION A;  4LO8 B;  1ITB A;  1JY0 A;  4I4U A;  4A7K A;  3BA5 A;  3P6I A;  4G1R A;  4IHZ A;  3MPP G;  5D62 A;  5B2H A;  1S0G A;  1PUM B;  3H6Q A;  3ZX7 A;  1DZC A;  4Q9G A;  1R8O A;  3O3Q A;  4I4O A;  5D61 A;  3NBD A;  3SNV A;  4QKS A;  1ABR B;  4J2S A;  1IT0 A;  3BX1 C;  4J23 B;  4XFU A;  5FNW A;  1G9C A;  2KKI A;  2QN4 A;  1YF8 B;  2K4A B;  4LO2 A;  3Q7X A;  2M49 A;  1ISX A;  3Q7Y A;  2KLL A;  4H9W A;  3IAG C;  4EEE B;  4G6J A;  4EB2 B;  4H75 A;  4OWL A;  2HW9 A;  1HKN A;  1T4Q A;  4LO7 C;  4PC4 A;  2VSA A;  2X2T A;  3CRH A;  4I4Y A;  3VEQ A;  1L2H A;  3V0A B;  3AH1 A;  5G00 A;  4XKI A;  3IM6 A;  3CU1 B;  4FVV A;  4ZKT B;  4USO A;  2KI6 B;  4MZH A;  2MLL B;  3FJA A;  3V0A A;  1CE7 B;  4OEE A;  3N7M A;  1WBC A;  1QXM A;  2XOA A;  1HCD A;  4IZX A;  3BAO A;  3I2X A;  1GGP B;  1RML A;  1XHB A;  2IWT B;  5JLV A;  2NP0 A;  2D23 A;  1ONK B;  3F62 B;  4YOL A;  3FJK A;  1M2T B;  1WD3 A;  2WRY A;  4I4Q A;  3CRG A;  3CA4 A;  4OEF A;  4GOY A;  2Z49 A;  3UD7 A;  3O49 A;  4DEN A;  3FJH A;  4I4R A;  5D63 A;  1ISY A;  4GP0 A;  4LO1 A;  3VT0 A;  4Z9W B;  1JT5 A;  1S0L A;  1HWN B;  4G9N A;  2Y9F A;  4LO0 A;  3FJI A;  6I1B A;  3E8L C;  3BTA A;  4I6I A;  3WIN A;  1FGA A;  3H6R B;  1TTU A;  2FDB M;  1FQ9 A;  1DJS B;  2LIE A;  3IM7 A;  4P0L A;  2BEA A;  4R6U B;  3R4S A;  1XYF A;  4D8H A;  5JMC A;  3H6R A;  1FV2 A;  3OBR A;  4WBC A;  3UD8 A;  3N7J A;  3W9T A;  21BI A;  3WO2 A;  1WD4 A;  2E4M A;  1J0S A;  4XFT A;  3CA3 A;  3ILA A;  3FFZ A;  3K1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...