3PGEA

Structure of sumoylated pcna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
173
structure length
172
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-modified proliferating cell nuclear antigen
publication title Crystal Structure of SUMO-Modified Proliferating Cell Nuclear Antigen.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 28
structure length 172
sequence length 173
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pgeA01
3.10.150.20 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III; Chain A, domain 2 3pgeA02
2DZIA 3GOEA 1T0YA 2LRWA 4MDKE 3RZWC 3W1YA 1V5OA 1OQYA 2G4SA 2UYZB 4RM9A 4JGHB 1V9JA 2R2OA 4GDLB 2VRRB 3PHXB 4DDID 4BKTA 3HK0A 4HJKA 4WWNA 2ZNVC 5D6JB 4W9CA 1H8CA 5AZHA 1TBEA 2K8HA 1V2YA 2KX0A 4BOSC 3JYUA 2N7EA 4AP4C 4W9EA 1YQBA 2JVCA 2L05A 3PRZA 4GXBA 2LVOA 2IO3B 3QAQA 3EHVA 2GBJA 4EUTA 4FHJA 3B0AA 3APCA 2CU1A 5CHVC 3DBHI 5JHAA 1UH6A 1WXAA 4MM3A 2REXA 4NJ6A 4DXAB 2BKFA 3B1LX 3A1QA 2FIDA 2J0JA 3QIJA 2JY6A 4DHZE 3VTWA 2KQSA 2LD9A 5D94A 4TQ0A 1Q0WB 5AZFA 2W9NA 4NY0A 1E7VA 4GN1A 2NBUA 2XK5B 3PGEA 4ZRIA 1VCBA 4IWOA 4OVVA 1WM2A 1CMXB 4IC7B 2ZEQA 1OEYJ 3QX1A 4BKSA 3L10B 2K25A 1G6JA 5J18A 4G0NB 4LJPB 2JUOA 1IYFA 3JVZX 5GMVA 4ANUA 2J0MA 2ZPNA 2L0TA 2RSUA 1WJUA 1WXMA 4FJVB 2ZJDA 4FHKA 1RRBA 4P7IA 3ZRFA 4K7UA 4URKA 1K8RB 2DZJA 2ZVOA 1C1YB 1X1MA 4B6WA 2MBQA 1M94A 3V61A 3VDZA 3L0XB 2GOWA 2RGFA 5CTRC 2KANA 3DOWA 2KOXA 2FIFA 2KTRB 2GBNA 2LXAA 2RPQA 3NZSA 3PVLA 4MJSA 4AUQC 3WANA 2EMTA 3TL5A 1TGZB 2KMCA 2M4NA 2C7NB 3IVFA 2GMIC 4HWIB 1E8XA 2CHXA 3PHWB 2WX1A 2EMSA 4KSKC 2JRHA 1RFAA 1KLVA 4N9F4 2WWZA 4TQ1A 3RUIB 1LFDA 1WE6A 2BYVE 1GNUA 3PRMB 2BKRB 3PZDA 4K1RB 2MRPA 4AJYB 2JXXA 4BVUC 5IA7A 2G3QB 3DBRI 3VUWA 3WAPA 3NZUA 3KYCD 1OGWA 2I1KA 2C60A 1WM3A 1Z5SB 1WR1A 3ZTDA 4KV2A 4E74A 2B3AA 4AWJA 1GJZA 4BOZB 2AYOB 3ECIA 2NBVB 4CYEA 3AU4A 3P2BA 4EOYA 2Z0EB 2DAFA 4WWPA 4ZRKA 2KFJA 1WGRA 4DHZB 3T9LA 1WZ3A 4HCPB 4FLHA 2MQJA 1WE7A 4FJZA 4EEWA 2LASA 3VAWA 2NS5A 2LWPA 2C7HA 1UBIA 1WGDA 2KK8A 2LZ6A 1WH3A 3SHQA 1WIAA 5CHWA 1XT9B 2MBEA 4NJ7A 3DBLI 3LJ3A 3L17A 3L54A 3ZVVA 2KKCA 3OJ4B 3AXCA 1WY8A 3UIPB 4JLCA 2BWFA 3VTVA 2KC2A 3ZO5B 1TTNA 4KIKB 3DVNV 4HK2A 1WGHA 2R2QA 1E8YA 3A9KB 3OJ3A 2HJ8A 2A5UA 5LXIB 1V81A 1QZEA 4GSWA 2WX0A 2C5LC 2N1WA 4B95A 1OTRB 2ASQA 3S2AA 1IP9A 5E6NA 3LDZE 4EZJA 3DVNU 3H7PB 1D3ZA 3W1SA 3EECA 1WX8A 3ZNID 4A3PA 1GUAB 5E6PA 1SE9A 3R7RA 3QC8B 3H9DA 2AL6A 2C7MB 4RMAA 5AZGA 3V6EB 2JZZA 2JF5A 3DVGX 3VXWA 4GDKA 3RD2A 3ZNHB 4ANVA 2QHOA 3N3KB 3KH0A 4I6PA 1GC6A 4HPLB 3RCZA 4TUUA 3RYTA 1E5WA 1U4AA 1LM8B 4XC2A 3DVGY 2KN5A 5JZEB 1Y8RC 4NQLB 5KHQA 1V49A 2KVRA 3DBSA 4NAWA 4OVUA 1WMHA 2NPTA 2BYEA 3H7SA 3O65B 4BBNF 2K6QA 3DDCB 3PSEB 4WJPA 4A3OA 2K6DB 3N30A 4ZYNA 4W9JA 3U8ZA 3UGBB 4HDOA 5JH5C 3HHMA 2A4ZA 4YL8A 3T8MA 4NNJB 4GGQA 3ZRCA 2KX3A 2MP2B 3IFWB 4WJQA 3JW0X 2KLCA 4FBJB 2YVCA 3KYDD 4GIVA 2K8BA 1NBFC 2GBKA 3TMPB 1H4RA 3BY4B 2DYBA 4GDLA 2MBOA 1VD2A 2V4LA 2IY1B 5G55A 3KUCB 2MCNB 1WXSA 3QWZB 4MGIE 4PS7A 1SIFA 4XZ4A 2BPSA 3JSVB 1WF9A 3VTUA 5L83A 1WXVA 3RZFA 2LUEA 3ML8A 2CKHB 4EFOA 3IHPC 2KQ7A 2PJHA 3HIZA 4II2B 4WJNA 4DWFA 4FA6A 2Z0DB 4TKNA 3X0WA 4MSMB 1R4MI 2KDIA 3M95A 2ZNVB 1I35A 3IBEA 2LGDA 2IBIB 4WAAA 2DZMA 3TCAA 3TJPA 2JT4B 4RM8A 3RT3B 2D11A 4PYUA 1V5TA 1FXTB 4JQWC 4WQOB 2KDEB 3L0WB 3VH3B 3ZDTA 1V80A 5IAAC 3M63B 2O6VB 4MH0E 5L95C 2HE7A 3L13A 4W9GA 2DYOA 1KJTA 2AEHA 2V1YA 4X57B 2MP2A 2ZPYA 4JL9A 4IG7B 1LQBA 2KD0A 4LJOB 2LI5A 2O2VB 4ANWA 2XK5A 4DHJB 4W9DA 4ICUA 1WRDB 5EDSA 5J17A 3U30A 4F8CB 2M8SA 3QJZA 3R3MA 3AULA 4G3XB 4IUMB 1ZKHA 3A9JB 3W1SC 2FCMA 3WAMA 2KNBA 2KFKB 2KWCA 2LRUA 3QCAA 2IYDB 2DHZA 3TBLD 1ZW7A 2M1MA 2FNJB 2KHWB 2BYFA 3UINB 4G50A 5LXHA 3AU5A 3Q3FA 3QQ8B 3M62B 3R66C 1XD3B 2KJRA 3MJWA 1RAXA 2KO3A 4F7ZA 2M17A 3MTNB 2AL3A 3V6CB 2JPHA 1WJNA 4K81A 2NBWB 4MSQB 2N9PC 2M0XA 2IO1B 2MBBB 2NVUI 3KUDB 4GB9A 2KXJA 3A4SC 4NPNA 4ZRJA 3SDLC 3UF8A 3VUXA 2KMAA 2PEAA 2KJ6A 4FADA 1UZXB 2KC1A 3HM3A 4MELA 4BKGA 4IM3A 1NDDA 2KTRA 2PE9A 4LDTB 4DDGD 1WJ4A 4BFRA 4IWPA 1NI2A 3VUYA 3PLUA 2DZKA 2L00B 2GBRA 2J0KA 3K9PB 3ZNGC 1JRUA 2RR9A 2L3ZA 4IM0A 2N9EB 5CX3A 2OOBB 3OAWA 2HD5B 4KSLC 4MGKE 4NQKE 3ZNZB 3K9OB 1J19A 2NR2A 5DCNA 1SGHA 3A4RA 4FJYA 4WJOA 5LLIA 2LVPA 4KVGB 4IWQA 3PREA 3PRPB 1J0GA 3QA8A 1ISNA 1RLFA 1A5RA 1WFYA 2IO0B 2L76A 2IY0B 3HM6X 1WYWB 4ICVA 2D3GA 2PE6B 1J8CA 2G45B 4PS8A 3SD5A 3I3TB 2D07B 1XQQA 2LGXA 4F1SA 2KWUB 1WX9A 3V62A 2CHZA 3DCGA 4MEMA 4MGYE 2AWTA 2FCNA 4CHKA 4G11A 4XX5A 3ZKJC 2KLGA 3PLVA 1Q1OA 2BWES 1S3SG 2IZVB 2WYQA 3A1QB 4HCNB 4W9IA 4DK5A 3UQBA 2HTHA 3SU8X 2MA9B 2MWSB 3WA0A 1R4NI 3ZLZA 5CHFA 4KZCA 5FR6A 4PYZA 3KVFB 4AOFA 3CMMB 3EC8A 2MSED 2BGFA 3ZTCA 3Q3JA 1WZ0A 5DPRA 3CSTA 2MW5A 2MX2A 1LXDA 1IPGA 1PQSA 1UBQA 2XEWA 1TZ1A 2N4FA 4HXDA 1C3TA 1WI0A 4LCDE 1EF5A 2DENB 2L7RA 4KIKA 2KJHB 3X23A 3ZW3A 3A9KA 2ZZPB 4KZ0A 1Q5WB 1OEYA 4M8NA 3VVWB 5BO4B 3B08A 3UIOB 2XBBC 1P98A 4DBGA 3GZNI 2GBMA 2Y5BB 4KDLB 3RULA 2RD0A 3H7PA 3V60A 2K8CA 3PT2B 4IM2A 4FN2A 2KDFB 4ZDVA 4AJWA 1UGMA 4HPMB 2O6VD 4E71A 1E7UA 1MG8A 3NY5A 2PPHA 3VQIA 1WGYA 2FCSA 5KHOA 3CSFA 1S1QB 2V3SA 4EKUA 2N7DA 1YJ1A 4MJSB 5J2RA 4ASWC 3WALA 3VFKA 1L7YA 1WR6E 1EF1A 2MLBA 2CR5A 4DHJD 2KWVB 2KDBA 4I6LB 5D7GA 2FAZA 4A20A 4HDQA 2LJ5A 4BBNC 4ANXA 3WIMA 3CF6E 1KOTA 4J6IA 1V86A 2DAJA 3OLMD 5DPSA 5HKHA 2JZ3B 3VHTC 1F9JA 1EO6A 1YD8U 3H1UA 2L8JA 3KW5B 2DX5B 2ZCCA 2KZRA 3QARA 4PS3A 4HLEA 2I1JA 5DPTA 4B9KA 3VH4B 2IO2B 3UQAA 3QHTA 4EZKA 2Z59B 2LVQA 2J7QB 4M8MA 4W9HA 1WGGA 4W9FA 3ZDMC 1GG3A 1WX7A 2WDTB 2EKEC 3APFA 3DPDA 3PTFC 3JSVA 3MHSD 5JHBA 2LGYA 2D2QA 2D10A 3ZIMA 3WAOA 1AARA 4IW0A 4LDTD 4EZLA 3D32A 3IG3A 2BF8B 3APDA 4GOCA 5G2NA 2C9WB 3ML9A 2NCNA 4I6NB 3L08A 1E8ZA 1HE8A 2DYMA 4WWOA 1E90A 2ZVNA 3ONSA 2FUHB 4K7WA 1P3QU 1EUVB 2JWZA 2O6VA 3AI5A 4K7SA 2JRIB 2MBHA 3L16A 2FCQA 4E3CA 1YX5B 1V6EA 1YIWA 2CS4A 3NHEB 1ZGUB 5C23A 3ALBA 1E8WA 3U7DA 2O2VA 1Z2MA 4HVBA 3PPAA 2L0FA 1KM7A 2KTFA 2G4DB 4M0WB 4KDIC 1P1AA 1P0RA 3A9JA 2K1FA 3H6NA 3NS8A 3PS6A 1L2NA 2KFKA 4MGZE 2N9XA 1UD7A 2OJRA 2N1VA 3NOBA 1UELA 1WJ6A 1BT0A 3TIXA 2LXCA 3DQVA 4GMVA 3R7QA 5C1ZA 1I42A 1YX6B 4GDKB 2K39A 3A33B 5DPWA 1GC7A 4JIOU 1P9DU 3ZUNA 2ZCBA 5TR5A 4TV3A 4FULA 3BINA 3EFUA 3M3JA 4II3B 3N32A 4NAWB 2CHWA 1WMHB 2NPTB 5E6OA 3QK0A 5AEKB 2YLMA 4W9KA 3ENEA 3C0RB 3KUZA 2UWQA 3PV1A 4BKSD 4GU2A 4CO7A 5D2MB 4W9LA
chains in the Genus database with same CATH superfamily
3GOEA 3HVDA 1T0YA 3W1YA 3VR9B 1OQYA 2G4SA 1TYGB 2IGDA 4UDUC 2VRRB 4DXFA 2WHIA 4TR8A 1SE3A 3TUOA 4K74A 2BT6A 3AM9A 4C80A 5D6JB 5G5HA 1N61A 4W9CA 3D1EA 1V2YA 2KX0A 2MJDA 4AP4C 3AE2B 4W9EA 4GXBA 3EHVA 4FHJA 3B0AA 5CHVC 3I5JC 2REXA 4NJ6A 4DHZE 2J0JA 2JY6A 1FEHA 2LD9A 4TQ0A 2JX5A 2UU7A 2W9NA 1T5XD 4GN1A 3PGEA 1PUTA 4OVZA 4OVVA 1WM2A 4IC7B 3U7ZA 3BEPA 1G6JA 3W9CB 5GMVA 3FC4A 2J0MA 2LJIA 1WJUA 4FHKA 4P7IA 2BB5A 1PGBA 2ZVOA 1QT9A 3VDZA 3L0XB 5CTRC 2JWUA 4ZRPA 2LXAA 3NZSA 2J52A 1YN4A 3B2GA 3KQ4A 1EWCA 1E8XA 2EMSA 2RDGA 4KSKC 3GE8C 1NENB 2H89B 1OQQA 3NVYA 1GNUA 3Q8CA 4K1RB 2D3CA 2JXXA 3W2DA 5IA7A 3VUWA 3NZUA 2I1KA 2C60A 1UNSA 1WR1A 3ZTDA 4E74A 5G5GA 4AWJA 4ZRKA 2WXOA 5I4DA 2NS5A 1WGDA 5CHWA 1XT9B 3DBLI 3L17A 3L54A 2G9HD 1N5XA 1VR9A 2W55A 3ZO5B 3DVNV 2Y5CA 3A9KB 2HJ8A 2TSSA 1D5XC 3N20C 3O13A 4GSWA 2LFIA 2WX0A 1ESFA 2N1WA 4FXCA 4B95A 4PK1A 1OTRB 3S2AA 1QOFA 4TRTA 1WX8A 2PVOD 1GUAB 5E6PA 1SE9A 2DBYA 3QC8B 1JQJA 4RMAA 4RGTA 3VXWA 4GDKA 4I6PA 1GC6A 3RCZA 2DWQA 5KHQA 1V49A 4OVUA 1WMHA 4N97A 2K6QA 4A3OA 5JH5C 4HDOA 3HHMA 4YL8A 3NUHB 2SEBD 3ZRCA 4REZA 1L4DB 3TEWA 1NBFC 1H4RA 2DYBA 1ZXIA 4GDLA 1K53A 2IY1B 2MCNB 1WXSA 2PVGC 4XDDA 3Q3OC 2CKHB 4EFOA 1WRIA 2KQ7A 2PJHA 3HIZA 4II2B 4WJNA 4FA6A 2IGHA 3BYTB 3TJPA 2JT4B 2Y5PA 4RM8A 2YEPB 1KRHA 3AE3B 3VH3B 3M63B 3DHIC 1N5WA 2WGSA 3C19A 4W9GA 1KJTA 4QAYA 4PNUA 2O2VB 1WWTA 4ANWA 4W9DA 5EDSA 5J17A 2M8SA 3AULA 3KWLA 4S17A 3W1SC 3WAMA 4YXDB 2WXPA 3VRBB 2IYDB 2DHZA 3RNFC 2FNJB 2L1AA 2GB1A 3AU5A 3M62B 4F7ZA 3PWEA 3MTNB 3V6CB 4K3OA 1WJNA 4N95A 4K81A 3KUDB 1C4CA 1V1OA 3SDLC 2Z8LA 3VUXA 2PEAA 1R4MB 1TJEA 3BVZA 4IM3A 2KTRA 4C00A 4LDTB 4DDGD 1WJ4A 4BFRA 3TEZA 3P42A 3ABVB 1T3QA 1F2RC 2OOBB 4GLSC 2WP9B 4KVGB 4IWQA 1VJKA 2YEPF 1WFYA 2IO0B 2L76A 2QDFA 4OVHA 3I3TB 1MI0A 1L0YB 1WX9A 3TEYA 2CHZA 3RNGC 2IGGA 5BMIA 4G11A 2IZVB 2WYQA 1JCKB 3WA0A 1YN3A 4PYZA 3PGEB 4LLGM 3LB8C 2BGFA 3ZTCA 1VZ6A 3CSTA 2NTSA 1IPGA 1UBQA 1Y56A 3Q8AA 3SEBA 2L7RA 1OEYA 5E6JA 3B08A 4KDLB 3H7PA 4IM2A 3PT2B 2RPVA 4HPMB 3NY5A 2FCSA 3SFEB 4K3CA 4EKUA 1K52A 4N9AA 1WR6E 1ZXHA 4DHJD 2BB6A 2KDBA 4A20A 1FMAD 2Q5WD 4HDQA 4BBNC 1XO3A 3NVZA 4J6IA 2LEKA 4YSZB 2DAJA 5DPSA 4ZHOA 2GLSA 3E56A 2KZRA 4PS3A 2OEDA 2IO2B 3QHTA 1PGAA 2Z59B 4DXGA 2WXMA 4M8MA 1C4AA 3ZDMC 3PTFC 1WX7A 3DPDA 1K50A 1JROA 2D2QA 5AH4A 3WAOA 1TKYA 3GZNB 1QOAA 1PYWD 1P7FA 2NCNA 3L08A 4WWOA 2M0AA 4YSXB 2ZVNA 2FUHB 2O6VA 3AI5A 2ON8A 3L16A 1YQ4B 1E8WA 2K0PA 1Z2MA 5IKCM 3PZ8A 3W5VB 1CQVA 1P0RA 3NS8A 1L2NA 2KFKA 4GDKB 3MJ5A 1FFUA 3A33B 3AEEB 1P9DU 1IGDA 1D6EC 2ZCBA 4TV3A 1E6EB 2NMQA 4WAFA 2CHWA 1WMHB 5E6OA 4R3DA 5AEKB 3WCQA 4W9KA 5D2MB 1I4QA 3RZWC 1V5OA 2UYZB 1V9JA 2R2OA 4GDLB 1C79A 3AE9B 4BKTA 2JYTA 3B9JA 1TBEA 2GI9A 1TS5A 5IOIA 3Q6BA 2L05A 1SIJA 3PRZA 2IO3B 1ZDXA 2GBJA 2WXFA 4L23A 2VH2A 4N6EB 3APCA 1NEKB 4LNFA 1SJED 2BKFA 4A55A 2FIDA 5AZFA 1RWSA 1VRAB 3ZJVA 2AQ2B 2WXJA 2NBUA 4Q2JA 2RMMA 1I4RA 1FCLA 2ZW1A 1L0VB 2ZEQA 3QX1A 4BKSA 1JW9D 3BWUD 1E9MA 2VZKB 1HTQA 2JUOA 1JQLA 4ANUA 2ZPNA 2RSUA 3P16A 3P4SB 2ZJDA 3P4PB 5BMHA 1MMIA 1X1MA 3ZJUA 1GB4A 1M94A 3V61A 2GOWA 2RGFA 2FIFA 2KTRB 4JWSC 3PVLA 4MJSA 1FXAA 1WYGA 3U4EG 4AUQC 2EMTA 4AS1A 1K51A 3P4RB 3EGRA 1C78A 2KMCA 1T0RC 2M4NA 2C7NB 3IVFA 3MHZA 2N9LA 4HWIB 3PHWB 4PT5A 4DQOC 4N9F4 2WWZA 4K3SA 1LFDA 4K3QA 3PZDA 4AJYB 4US8A 1HZ5A 4KGRA 1OGWA 1WM3A 1Z5SB 3Q69A 4KV2A 3RNCC 1OK7A 1GJZA 3V3XA 2I2YA 4CYEA 3AU4A 4EOYA 5EE3A 4DHZB 2KVZA 4FLHA 4FJZA 4EEWA 3VAWA 2WU2B 1C77A 2LWPA 1UBIA 2LZ6A 1WH3A 3SHQA 1WIAA 4WH4A 4NJ7A 3B2FA 3OWEB 3OJ4B 3GB1A 1CJEA 1I4XA 1L4ZB 3VTVA 2Y3AA 4HK2A 1WGHA 1E8YA 5H8YE 1M4VA 3N1YC 1FNVA 1QZEA 2JQRB 4ZYSA 2C5LC 2ASQA 4EZJA 1EU3A 5JXVA 3H7PB 3W1SA 3EECA 2WDRB 1Q10A 2WXHA 2AL6A 4PNVA 3V6EB 3ZNHB 4ZRQA 1IGCA 3EFCA 1Y8RC 4NQLB 4NAWA 3D1GA 4C4VA 2NPTA 2BYEA 3GP7A 4WJPA 2X38A 1F1HA 3P63A 4GGQA 2KX3A 2KLCA 1SF0A 2K8BA 2GBKA 2LUMA 3QWZB 3Q2AC 1SIFA 2WS3B 3RZFA 2L32A 3BVMA 3ZQ4A 4DWFA 2MH7A 2Z0DB 1E10A 1R4MI 3M95A 2LGDA 2IBIB 2KT7A 3NRZA 4RGOS 3TCAA 4N59A 1FNUA 3RT3B 4JQWC 2KDEB 3ZDTA 2IJ0A 2KMMA 2O6VB 4MH0E 3Q4JA 2WQYB 1FRDA 2AEHA 2V1YA 4X57B 3RFZB 2W3SA 2MP2A 2ZPYA 4JL9A 4LTUA 4XDCA 2N7JA 2QIEB 2XK5A 4ICUA 4K3BA 3U30A 1TKGA 4F8CB 4G3XB 5BMGA 1ZKHA 2KFKB 2LRUA 1HQRD 3TBLD 1ZW7A 2M1MA 2KHWB 3RB9A 4G50A 4A9AA 4HROA 3R2TA 1XD3B 1YQ3B 3AECB 2KJRA 2IPKD 2EKIA 3AEBB 1JWUD 2M0XA 4NPNA 1F52A 1ZE3D 3UF8A 1MJDA 1MFWA 3AEDB 4OZCA 2KMAA 2BYTA 3AE7B 1WSPA 1NDDA 1QLBB 2L00B 3PZ7A 3BK2A 3ZNGC 2L3ZA 4IM0A 2N9EB 4S0RA 1CZPA 2AQ1B 3OAWA 2HD5B 3K9OB 1FM0D 4IDIA 4WJOA 3AE8B 2LVPA 1ZUD2 3HM6X 2D3GA 2G45B 4PS8A 1XQQA 4F1SA 1JWAD 3N1XC 2LGIA 3DCGA 4MEMA 2AWTA 3PLVA 1Q1OA 2PLPA 2K9XA 2RDBC 4W9IA 3CWIA 3GE3C 4RCOA 4CQNA 3SU8X 2MA9B 5FR6A 3KVFB 4AOFA 1YNTE 3EC8A 3NVVA 3HVZA 5BYQA 3Q4LA 2KDMA 3Q3JA 1QOGA 1WZ0A 4ARCA 3LJ3A 2MW5A 2MX2A 1PQSA 1SSNA 1TZ1A 2N4FA 3SR6A 1WI0A 4LCDE 4KIKA 2KJHB 2ZZPB 2KYWA 4KZ0A 1ZDVA 1ZPSA 1P7EA 3VVWB 4OZAA 5BO4B 2XBBC 1P98A 3GZNI 3RULA 2RD0A 3V60A 4ZDVA 4FN2A 4AJWA 5HG2A 4E71A 1WGYA 5KHOA 5HFYA 1S1QB 1YJ1A 3AE4B 3DWMA 4MJSB 5J2RA 3VFKA 2MHJA 1L7YA 2CR5A 3P1MA 4LNNA 2LJ5A 4ANXA 1T0SC 2BQQA 1R4NB 2JZ3B 3VHTC 3H1UA 2L8JA 3KW5B 2DX5B 4HLEA 4B9KA 1UNNA 3U52E 2WDQB 4BZAA 2BVCA 4WIPA 2WDTB 2EKEC 3JSVA 3AE5B 4HPPA 1TS3A 3FKYA 1KLGD 5AGUA 4LDTD 3IG3A 3APDA 5G2NA 1MVKA 2C9WB 3ML9A 1XCQL 2JWZA 4K7SA 2JRIB 2MBHA 4A90A 2FCQA 1QF6A 2GRIA 4RH6A 1YIWA 4HVBA 2INDC 3PPAA 4N99A 3Q4KA 4KDIC 1ET6A 3A9JA 3PS6A 1NI3A 4KKIA 2N9XA 1TIFA 1GB1A 2FUG1 3TIXA 2EELA 3MC0B 4GMVA 5C3JB 2K39A 5D3DA 5DPWA 2WXGA 1L5PA 1SXTA 4RGMA 2QC8A 5TR5A 4FULA 1XEEA 3M3JA 4II3B 4NAWB 4C4VB 2NPTB 1ZOYB 1IBXA 2E6XA 1DOXA 1XLNA 4LNOA 4MDKE 4JGHB 1GOZA 1NYQA 3PHXB 1HEZE 4DDID 5HHDG 3HK0A 4HJKA 1SBBB 2ZNVC 1H8CA 5AZHA 3AEGB 2N7EA 1B9RA 1XXGA 2JVCA 3QAQA 1N6ZA 3NVWA 4XYCA 1WGKA 4EUTA 2CU1A 5BYSA 5JHAA 2B76B 3FILA 1E7VA 1N63A 2XK5B 4IWOA 1TT5B 1YN5A 1A70A 3NZ3A 5J18A 2HJ1A 2KACA 1HA5A 1IYFA 2L0TA 4FJVB 4K7UA 4URKA 1K8RB 3RNEC 1B1ZA 1C1YB 2XURA 5FK9C 1FO4A 2KANA 3IT6B 3RNBC 1VZ7A 2PIAA 3WANA 5IO9A 3TL5A 3L4PA 4KX6B 3DBHB 4C7YA 3FAHA 2SAKA 4B0EA 2CHXA 2JRHA 1RFAA 4TR7A 2WXNA 4MT5A 4TQ1A 2BS4B 3TEXA 2BYVE 3PRMB 2BKRB 2MRPA 4BVUC 3WAPA 3KYCD 1DGJA 2WXRA 2B3AA 2AYOB 3EUB2 3ECIA 2NBVB 3P2BA 2Z0EB 2KFJA 1WGRA 3T9LA 5TSSA 1WZ3A 4HCPB 1VPKA 2MQJA 1UWXA 1D5ZC 3Q8EA 2LASA 1C9FA 1XF5L 2C7HA 2KK8A 2MBEA 2KAJA 2FE8A 2KKCA 3AXCA 1WY8A 3UIPB 4PNWA 1TTNA 2FBWB 4KIKB 2BS3B 2R2QA 3OJ3A 3RN9C 5LXIB 2QEJC 3KLSX 2LMCA 3AB5A 4NJCA 1IP9A 3Q8FA 5E6NA 1D3ZA 2INNE 3R7RA 1KF6B 2C7MB 4K3LA 5AZGA 3I9V1 1V97A 2QHOA 3NS1A 4XGAB 2H88B 3DBRB 3KH0A 4N96A 4HPLB 4TUUA 3RYTA 1U4AA 1LM8B 3DVGY 2KN5A 3RMKC 4K3MA 1NVID 3DBSA 4L1BA 1R7SA 4BBNF 3DDCB 3PSEB 3N30A 3UGBB 4P1CC 3IFWB 3IXSA 4WJQA 2VZKD 3JW0X 2YVCA 3KYDD 3SFDB 4YWGG 3TMPB 2OHFA 1YOVB 4P6VF 2MBOA 1VD2A 5G55A 3AEAB 3KUCB 4XZ4A 2BPSA 3QSBA 3JSVB 2WLBA 4ZHPA 1WXVA 3I63C 2LUEA 3DHGC 4A6QA 3IHPC 3X0WA 2KDIA 4WQMA 1I35A 1J7CA 1TY0A 1VZ8A 4WAAA 2J4XA 4YTNB 3TSSA 5IAAC 4MJPA 3L13A 4TSZA 2DYOA 5AUKA 5FVEA 4IG7B 1LQBA 4JE3B 2LI5A 1QILA 1WRDB 3F1VA 4ACFA 3N9YC 3QJZA 3R3MA 4IUMB 3A9JB 2KNBA 2KWCA 3L10A 3QCAA 1QOBA 3N1ZC 4OZBA 3UINB 3R66C 4OVFA 2KO3A 4US9A 2JPHA 4MSQB 2MBBB 2NVUI 2KXJA 3A4SC 4N94A 2D3BA 3HRDD 4ZRJA 4FADA 2WXLA 2K5PA 1IBXB 1TKEA 3H8HA 2W82A 3VUYA 4KGTA 2GBRA 3J9CA 5H92C 1PDXA 1JRUA 4NZLB 1HTOA 2RR9A 1XLOA 3W5UB 5HI1A 4KSLC 3T3NA 3ZNZB 2NR2A 1SB3C 5DCNA 3A4RA 2CJOA 4FJYA 4WURA 5IP4D 3PREA 3PRPB 1J0GA 3EA6A 4ICVA 2IY0B 2PE6B 1J8CA 1JWBD 2D07B 2WXKA 3IT4B 2KWUB 2FCNA 4CHKA 5BYRA 3ZKJC 2BWES 3T3OA 1S3SG 3FILB 2V9HA 3GS2A 4DK5A 1QQRA 1T6BX 2MWSB 1R4NI 4MJQA 3ZLZA 1I4GA 4KZCA 3AMZA 3CMMB 4L2YA 4N58A 2L83A 4K3PA 5DPRA 2XEWA 4RFBA 4HXDA 4MH8A 2DENB 4H2AA 3DWGC 4IOIE 4KKJA 3T0PA 1Q5WB 2V3NA 4M8NA 3UIOB 4DBGA 2GBMA 1MPEA 2K8CA 2KDFB 4YSYB 3Q8BA 2O6VD 1MG8A 5GXGB 2N7DA 4ASWC 3WALA 3ZYYX 2MLBA 1EU4A 2M56B 2MJEA 5D7GA 2X8XX 2FAZA 3WIMA 3CF6E 2INCC 5EE1A 5HKHA 1JQ4A 1YD8U 3MC9A 1XCTL 3QARA 3VH4B 2G1EA 4RNAA 3MC8A 3D1FA 3RI7C 2LVQA 2J7QB 1ZP0B 4W9HA 4W9FA 3APFA 1I7HA 5JHBA 2D3AA 3ZXVA 2LGYA 2D10A 1UUPA 1AARA 3D32A 4HKZE 4GOCA 2QSDA 1E8ZA 3AEFB 3L0WA 2AX5A 4K7WA 1P3QU 2NTTA 2V3PA 3ZGZA 4E3CA 1PGXA 1C76A 2R61A 1AN8A 1F2RI 1ZGUB 2CS4A 3ALBA 3NHEB 5C23A 2L0FA 1KM7A 2WXQA 3AH7A 2KTFA 2G4DB 1P1AA 2V4IB 3H6NA 2LGSA 4ITKA 4MGZE 1UD7A 2OJRA 1UELA 1VDVA 4YT0B 1ET9A 1T0QC 4TMAB 5C1ZA 1I42A 1YX6B 4XE0A 3VRAB 1JWSD 1GC7A 4JIOU 3ZUNA 3BINA 3EFUA 2PMVA 2QMTA 3N32A 4HJGE 2YLMA 3ENEA 3PV1A 4BKSD 2UWQA 2D5GA 3OG5A 4GU2A 4CO7A 1D5MC 2DZIA 2LRWA 5AUIA 3AE6B 4RM9A 1E7PB 1IUEA 3QSBB 3PO0A 4WWNA 3URYA 2M19A 2K8HA 1DYQA 4BOSC 3JYUA 4AQ7A 1YQBA 1FRRA 2LVOA 4TSSA 1DOYA 3DBHI 1UH6A 1WXAA 1RYJA 4MM3A 4DXAB 4K3KA 2HDEA 3A1QA 3AV8A 3B1LX 3QIJA 3VTWA 2KQSA 5D94A 1Q0WB 1KLUD 4NY0A 4LK0M 2KN4A 1LGRA 4ZRIA 1VCBA 1CMXB 1OEYJ 2KQ4X 3L10B 1SE4A 2K25A 1V8CA 3ETRA 1ENFA 4OHJA 4G0NB 4LJPB 1MHXA 3LXFA 3JVZX 1RM6C 1YJIA 1WXMA 1RRBA 3ZRFA 2DZJA 1KH0A 4B6WA 2MBQA 1FCCC 3DOWA 1NYRA 2KOXA 2V0GA 2GBNA 1JALA 2RPQA 2POLA 3BIID 2L52A 5FKAC 1L0XB 1GPXA 3ZJTA 1TGZB 4MJRA 2KWDA 1ACCA 3RNAC 4TR6A 5D3IB 2GMIC 1BMLC 3AN1A 2WX1A 2PTLA 4P16A 2ICIA 2XNAC 1KLVA 3RUIB 1WE6A 3I57A 4M01A 2DLBA 2G3QB 3DBRI 2AVTA 2MEKA 1YMHE 4BOZB 4HKQA 2DAFA 4WWPA 1FIQA 3HUIA 4OVGA 4LNIA 4O1NA 1WE7A 2QCZA 2WDVB 4K3RA 3ZXRA 1JMLA 3ZVVA 1V1PA 4JLCA 2BWFA 1FXIA 2KC2A 2A5UA 1J7AA 1V81A 4M0WA 3LDZE 3DVNU 3ZNID 4A3PA 4RF0A 4B0MA 3H9DA 2BBCA 2JZZA 2HTME 2JF5A 3DVGX 2J42A 3RD2A 4ANVA 2BS2B 3N3KB 4LNKA 1E5WA 5JZEB 4XC2A 5IN7A 2KVRA 3H7SA 1C4PA 3O65B 4M02A 1TY2A 2K6DB 4ZYNA 4W9JA 3U8ZA 1D4BA 2A4ZA 3T8MA 4NNJB 2AQ3B 2MP2B 4FBJB 4GIVA 3DBLB 1OFFA 3BY4B 1STEA 3RPFC 2V4LA 3E9SA 2I38A 5EE0A 4MGIE 4PS7A 4YTPB 2QILA 1WF9A 3VTUA 5L83A 3ML8A 5FR3A 2MJ3A 4TKNA 4MSMB 4M00A 2ZNVB 3IBEA 2W54A 2DZMA 5AH2A 1JWMD 2N0SB 1L6UA 2D11A 1V5TA 1FXTB 4PYUA 4WQOB 2LHEA 5T8IA 3L0WB 1V80A 1J7BA 4YTMB 1I4HA 2HE7A 4NAMA 3BYYB 1N62A 4J3OD 4LJOB 2KD0A 2BW2A 4DHJB 2DNFA 1XLPA 2FCMA 1BUIC 1PFDA 2JYEA 4MACA 4JX1C 1JRPA 2BYFA 2INPE 5LXHA 1ROEA 3Q3FA 3QQ8B 1SE2A 5EE9A 3MJWA 1RAXA 2AWAA 1I4PA 2M17A 2AL3A 1QKZA 2NBWB 2N9PC 2IO1B 4GB9A 1AW7A 1FPYA 2CU3A 3UI3A 4C56C 1L6VA 4KGSA 2KJ6A 1FD6A 3L0XA 3LYYA 1UZXB 1F77A 2KC1A 3HM3A 4MELA 4BKGA 2PE9A 4XWTA 4IWPA 1YJJA 1NI2A 3PLUA 2E3TA 2DZKA 3V05A 3VR8B 4RF1A 2J0KA 2WXIA 3K9PB 2XN9C 1TS2A 1UF0A 5CX3A 4MGKE 4NQKE 2ACZB 1J19A 1HXYD 1SGHA 4D2KA 2JXTA 1MHHE 5LLIA 5LNK1 2VH1A 3QA8A 1ISNA 1RLFA 1A5RA 1WYWB 3BVGA 4HRSA 3SD5A 2LGXA 5AGVA 4RKIA 3P4QB 1DOIA 3V62A 1LO5D 2WU5B 5C2TB 4MGYE 4MM3B 4XX5A 2KLGA 3A1QB 4HCNB 3MP9A 3UQBA 2HTHA 1UWMA 1UGJA 2WNMA 5CHFA 2MSED 3R2IA 2IDYA 2BTEA 3IAM1 5L95C 1LXDA 1EWYC 2QJLA 1C3TA 2N9KA 1EF5A 3ZW3A 3X23A 1KTKA 3A9KA 1F0ZA 2PW9A 4XWWA 4ZOHC 3R8BA 2Y5BB 3CIRB 1UGMA 4ARIA 3KWVA 3NJTA 1E7UA 3VQIA 2PPHA 3CSFA 2V3SA 4IKGA 3Q14C 1GAQB 1HZ6A 1EF1A 3Q3NC 1KFYB 2KWVB 4I6LB 2K22A 3NG0A 4USAA 2PKOA 1KOTA 1V86A 3OLMD 2ZW0A 1F9JA 1EO6A 1EM7A 2ZCCA 4JWUC 4OW0A 2I1JA 5DPTA 1FNWA 3UQAA 2RDHA 2K3UA 4EZKA 1WXQA 1WGGA 1GG3A 4N98A 3MFGA 3Q3MC 4P1BC 3MHSD 1AWDA 3ZIMA 1XLQA 2ONQA 4IW0A 4EZLA 1CK1A 2BF8B 3BK1A 4A8XC 2JSVX 1TZOA 4I6NB 4C7ZA 1AYFA 1HE8A 2DYMA 3DHHC 1E90A 4HEA1 3ONSA 3AE1B 1EUVB 1OQRA 1MG4A 2JZPA 1SJHD 1RFKA 5FRQA 1V1PB 1YX5B 2JU6X 1V6EA 3U7DA 2LHDA 2O2VA 4WWMA 1E0ZA 4M0WB 2K1FA 4BAXA 4RGNA 3NOBA 2N1VA 3C8YA 1WJ6A 1BT0A 2LXCA 2J53A 3DQVA 3R7QA 1N60A 4EE2A 2CJNA 1BXTA 4JPSA 1VLBA 5MPOA 1SEBD 2OJWA 1TS4A 3QK0A 3BZDB 4S3IA 3C0RB 3KUZA 3U2SC 3IAS1 2W3RA 4W9LA 1FFVA
chains in the Genus database with same CATH topology
2DZIA 3GOEA 1T0YA 2LRWA 4MDKE 3RZWC 3W1YA 1V5OA 1OQYA 2G4SA 2UYZB 4RM9A 4JGHB 1V9JA 2R2OA 4GDLB 2VRRB 3PHXB 4DDID 4BKTA 3HK0A 4HJKA 4WWNA 2ZNVC 5D6JB 4W9CA 1H8CA 5AZHA 1TBEA 2K8HA 1V2YA 2KX0A 4BOSC 3JYUA 2N7EA 4AP4C 4W9EA 1YQBA 2JVCA 2L05A 3PRZA 4GXBA 2LVOA 2IO3B 3QAQA 3EHVA 2GBJA 4EUTA 4FHJA 3B0AA 3APCA 2CU1A 5CHVC 3DBHI 5JHAA 1UH6A 1WXAA 4MM3A 2REXA 4NJ6A 4DXAB 2BKFA 3B1LX 3A1QA 2FIDA 2J0JA 3QIJA 2JY6A 4DHZE 3VTWA 2KQSA 2LD9A 5D94A 4TQ0A 1Q0WB 5AZFA 2W9NA 4NY0A 1E7VA 4GN1A 2NBUA 2XK5B 3PGEA 4ZRIA 1VCBA 4IWOA 4OVVA 1WM2A 1CMXB 4IC7B 2ZEQA 1OEYJ 3QX1A 4BKSA 3L10B 2K25A 1G6JA 5J18A 4G0NB 4LJPB 2JUOA 1IYFA 3JVZX 5GMVA 4ANUA 2J0MA 2ZPNA 2L0TA 2RSUA 1WJUA 1WXMA 4FJVB 2ZJDA 4FHKA 1RRBA 4P7IA 3ZRFA 4K7UA 4URKA 1K8RB 2DZJA 2ZVOA 1C1YB 1X1MA 4B6WA 2MBQA 1M94A 3V61A 3VDZA 3L0XB 2GOWA 2RGFA 5CTRC 2KANA 3DOWA 2KOXA 2FIFA 2KTRB 2GBNA 2LXAA 2RPQA 3NZSA 3PVLA 4MJSA 4AUQC 3WANA 2EMTA 3TL5A 1TGZB 2KMCA 2M4NA 2C7NB 3IVFA 2GMIC 4HWIB 1E8XA 2CHXA 3PHWB 2WX1A 2EMSA 4KSKC 2JRHA 1RFAA 1KLVA 4N9F4 2WWZA 4TQ1A 3RUIB 1LFDA 1WE6A 2BYVE 1GNUA 3PRMB 2BKRB 3PZDA 4K1RB 2MRPA 4AJYB 2JXXA 4BVUC 5IA7A 2G3QB 3DBRI 3VUWA 3WAPA 3NZUA 3KYCD 1OGWA 2I1KA 2C60A 1WM3A 1Z5SB 1WR1A 3ZTDA 4KV2A 4E74A 2B3AA 4AWJA 1GJZA 4BOZB 2AYOB 3ECIA 2NBVB 4CYEA 3AU4A 3P2BA 4EOYA 2Z0EB 2DAFA 4WWPA 4ZRKA 2KFJA 1WGRA 4DHZB 3T9LA 1WZ3A 4HCPB 4FLHA 2MQJA 1WE7A 4FJZA 4EEWA 2LASA 3VAWA 2NS5A 2LWPA 2C7HA 1UBIA 1WGDA 2KK8A 2LZ6A 1WH3A 3SHQA 1WIAA 5CHWA 1XT9B 2MBEA 4NJ7A 3DBLI 3LJ3A 3L17A 3L54A 3ZVVA 2KKCA 3OJ4B 3AXCA 1WY8A 3UIPB 4JLCA 2BWFA 3VTVA 2KC2A 3ZO5B 1TTNA 4KIKB 3DVNV 4HK2A 1WGHA 2R2QA 1E8YA 3A9KB 3OJ3A 2HJ8A 2A5UA 5LXIB 1V81A 1QZEA 4GSWA 2WX0A 2C5LC 2N1WA 4B95A 1OTRB 2ASQA 3S2AA 1IP9A 5E6NA 3LDZE 4EZJA 3DVNU 3H7PB 1D3ZA 3W1SA 3EECA 1WX8A 3ZNID 4A3PA 1GUAB 5E6PA 1SE9A 3R7RA 3QC8B 3H9DA 2AL6A 2C7MB 4RMAA 5AZGA 3V6EB 2JZZA 2JF5A 3DVGX 3VXWA 4GDKA 3RD2A 3ZNHB 4ANVA 2QHOA 3N3KB 3KH0A 4I6PA 1GC6A 4HPLB 3RCZA 4TUUA 3RYTA 1E5WA 1U4AA 1LM8B 4XC2A 3DVGY 2KN5A 5JZEB 1Y8RC 4NQLB 5KHQA 1V49A 2KVRA 3DBSA 4NAWA 4OVUA 1WMHA 2NPTA 2BYEA 3H7SA 3O65B 4BBNF 2K6QA 3DDCB 3PSEB 4WJPA 4A3OA 2K6DB 3N30A 4ZYNA 4W9JA 3U8ZA 3UGBB 4HDOA 5JH5C 3HHMA 2A4ZA 4YL8A 3T8MA 4NNJB 4GGQA 3ZRCA 2KX3A 2MP2B 3IFWB 4WJQA 3JW0X 2KLCA 4FBJB 2YVCA 3KYDD 4GIVA 2K8BA 1NBFC 2GBKA 3TMPB 1H4RA 3BY4B 2DYBA 4GDLA 2MBOA 1VD2A 2V4LA 2IY1B 5G55A 3KUCB 2MCNB 1WXSA 3QWZB 4MGIE 4PS7A 1SIFA 4XZ4A 2BPSA 3JSVB 1WF9A 3VTUA 5L83A 1WXVA 3RZFA 2LUEA 3ML8A 2CKHB 4EFOA 3IHPC 2KQ7A 2PJHA 3HIZA 4II2B 4WJNA 4DWFA 4FA6A 2Z0DB 4TKNA 3X0WA 4MSMB 1R4MI 2KDIA 3M95A 2ZNVB 1I35A 3IBEA 2LGDA 2IBIB 4WAAA 2DZMA 3TCAA 3TJPA 2JT4B 4RM8A 3RT3B 2D11A 4PYUA 1V5TA 1FXTB 4JQWC 4WQOB 2KDEB 3L0WB 3VH3B 3ZDTA 1V80A 5IAAC 3M63B 2O6VB 4MH0E 5L95C 2HE7A 3L13A 4W9GA 2DYOA 1KJTA 2AEHA 2V1YA 4X57B 2MP2A 2ZPYA 4JL9A 4IG7B 1LQBA 2KD0A 4LJOB 2LI5A 2O2VB 4ANWA 2XK5A 4DHJB 4W9DA 4ICUA 1WRDB 5EDSA 5J17A 3U30A 4F8CB 2M8SA 3QJZA 3R3MA 3AULA 4G3XB 4IUMB 1ZKHA 3A9JB 3W1SC 2FCMA 3WAMA 2KNBA 2KFKB 2KWCA 2LRUA 3QCAA 2IYDB 2DHZA 3TBLD 1ZW7A 2M1MA 2FNJB 2KHWB 2BYFA 3UINB 4G50A 5LXHA 3AU5A 3Q3FA 3QQ8B 3M62B 3R66C 1XD3B 2KJRA 3MJWA 1RAXA 2KO3A 4F7ZA 2M17A 3MTNB 2AL3A 3V6CB 2JPHA 1WJNA 4K81A 2NBWB 4MSQB 2N9PC 2M0XA 2IO1B 2MBBB 2NVUI 3KUDB 4GB9A 2KXJA 3A4SC 4NPNA 4ZRJA 3SDLC 3UF8A 3VUXA 2KMAA 2PEAA 2KJ6A 4FADA 1UZXB 2KC1A 3HM3A 4MELA 4BKGA 4IM3A 1NDDA 2KTRA 2PE9A 4LDTB 4DDGD 1WJ4A 4BFRA 4IWPA 1NI2A 3VUYA 3PLUA 2DZKA 2L00B 2GBRA 2J0KA 3K9PB 3ZNGC 1JRUA 2RR9A 2L3ZA 4IM0A 2N9EB 5CX3A 2OOBB 3OAWA 2HD5B 4KSLC 4MGKE 4NQKE 3ZNZB 3K9OB 1J19A 2NR2A 5DCNA 1SGHA 3A4RA 4FJYA 4WJOA 5LLIA 2LVPA 4KVGB 4IWQA 3PREA 3PRPB 1J0GA 3QA8A 1ISNA 1RLFA 1A5RA 1WFYA 2IO0B 2L76A 2IY0B 3HM6X 1WYWB 4ICVA 2D3GA 2PE6B 1J8CA 2G45B 4PS8A 3SD5A 3I3TB 2D07B 1XQQA 2LGXA 4F1SA 2KWUB 1WX9A 3V62A 2CHZA 3DCGA 4MEMA 4MGYE 2AWTA 2FCNA 4CHKA 4G11A 4XX5A 3ZKJC 2KLGA 3PLVA 1Q1OA 2BWES 1S3SG 2IZVB 2WYQA 3A1QB 4HCNB 4W9IA 4DK5A 3UQBA 2HTHA 3SU8X 2MA9B 2MWSB 3WA0A 1R4NI 3ZLZA 5CHFA 4KZCA 5FR6A 4PYZA 3KVFB 4AOFA 3CMMB 3EC8A 2MSED 2BGFA 3ZTCA 3Q3JA 1WZ0A 5DPRA 3CSTA 2MW5A 2MX2A 1LXDA 1IPGA 1PQSA 1UBQA 2XEWA 1TZ1A 2N4FA 4HXDA 1C3TA 1WI0A 4LCDE 1EF5A 2DENB 2L7RA 4KIKA 2KJHB 3X23A 3ZW3A 3A9KA 2ZZPB 4KZ0A 1Q5WB 1OEYA 4M8NA 3VVWB 5BO4B 3B08A 3UIOB 2XBBC 1P98A 4DBGA 3GZNI 2GBMA 2Y5BB 4KDLB 3RULA 2RD0A 3H7PA 3V60A 2K8CA 3PT2B 4IM2A 4FN2A 2KDFB 4ZDVA 4AJWA 1UGMA 4HPMB 2O6VD 4E71A 1E7UA 1MG8A 3NY5A 2PPHA 3VQIA 1WGYA 2FCSA 5KHOA 3CSFA 1S1QB 2V3SA 4EKUA 2N7DA 1YJ1A 4MJSB 5J2RA 4ASWC 3WALA 3VFKA 1L7YA 1WR6E 1EF1A 2MLBA 2CR5A 4DHJD 2KWVB 2KDBA 4I6LB 5D7GA 2FAZA 4A20A 4HDQA 2LJ5A 4BBNC 4ANXA 3WIMA 3CF6E 1KOTA 4J6IA 1V86A 2DAJA 3OLMD 5DPSA 5HKHA 2JZ3B 3VHTC 1F9JA 1EO6A 1YD8U 3H1UA 2L8JA 3KW5B 2DX5B 2ZCCA 2KZRA 3QARA 4PS3A 4HLEA 2I1JA 5DPTA 4B9KA 3VH4B 2IO2B 3UQAA 3QHTA 4EZKA 2Z59B 2LVQA 2J7QB 4M8MA 4W9HA 1WGGA 4W9FA 3ZDMC 1GG3A 1WX7A 2WDTB 2EKEC 3APFA 3DPDA 3PTFC 3JSVA 3MHSD 5JHBA 2LGYA 2D2QA 2D10A 3ZIMA 3WAOA 1AARA 4IW0A 4LDTD 4EZLA 3D32A 3IG3A 2BF8B 3APDA 4GOCA 5G2NA 2C9WB 3ML9A 2NCNA 4I6NB 3L08A 1E8ZA 1HE8A 2DYMA 4WWOA 1E90A 2ZVNA 3ONSA 2FUHB 4K7WA 1P3QU 1EUVB 2JWZA 2O6VA 3AI5A 4K7SA 2JRIB 2MBHA 3L16A 2FCQA 4E3CA 1YX5B 1V6EA 1YIWA 2CS4A 3NHEB 1ZGUB 5C23A 3ALBA 1E8WA 3U7DA 2O2VA 1Z2MA 4HVBA 3PPAA 2L0FA 1KM7A 2KTFA 2G4DB 4M0WB 4KDIC 1P1AA 1P0RA 3A9JA 2K1FA 3H6NA 3NS8A 3PS6A 1L2NA 2KFKA 4MGZE 2N9XA 1UD7A 2OJRA 2N1VA 3NOBA 1UELA 1WJ6A 1BT0A 3TIXA 2LXCA 3DQVA 4GMVA 3R7QA 5C1ZA 1I42A 1YX6B 4GDKB 2K39A 3A33B 5DPWA 1GC7A 4JIOU 1P9DU 3ZUNA 2ZCBA 5TR5A 4TV3A 4FULA 3BINA 3EFUA 3M3JA 4II3B 3N32A 4NAWB 2CHWA 1WMHB 2NPTB 5E6OA 3QK0A 5AEKB 2YLMA 4W9KA 3ENEA 3C0RB 3KUZA 2UWQA 3PV1A 4BKSD 4GU2A 4CO7A 5D2MB 4W9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZI A;  3GOE A;  1T0Y A;  2LRW A;  4MDK E;  3RZW C;  3W1Y A;  1V5O A;  1OQY A;  2G4S A;  2UYZ B;  4RM9 A;  4JGH B;  1V9J A;  2R2O A;  4GDL B;  2VRR B;  3PHX B;  4DDI D;  4BKT A;  3HK0 A;  4HJK A;  4WWN A;  2ZNV C;  5D6J B;  4W9C A;  1H8C A;  5AZH A;  1TBE A;  2K8H A;  1V2Y A;  2KX0 A;  4BOS C;  3JYU A;  2N7E A;  4AP4 C;  4W9E A;  1YQB A;  2JVC A;  2L05 A;  3PRZ A;  4GXB A;  2LVO A;  2IO3 B;  3QAQ A;  3EHV A;  2GBJ A;  4EUT A;  4FHJ A;  3B0A A;  3APC A;  2CU1 A;  5CHV C;  3DBH I;  5JHA A;  1UH6 A;  1WXA A;  4MM3 A;  2REX A;  4NJ6 A;  4DXA B;  2BKF A;  3B1L X;  3A1Q A;  2FID A;  2J0J A;  3QIJ A;  2JY6 A;  4DHZ E;  3VTW A;  2KQS A;  2LD9 A;  5D94 A;  4TQ0 A;  1Q0W B;  5AZF A;  2W9N A;  4NY0 A;  1E7V A;  4GN1 A;  2NBU A;  2XK5 B;  3PGE A;  4ZRI A;  1VCB A;  4IWO A;  4OVV A;  1WM2 A;  1CMX B;  4IC7 B;  2ZEQ A;  1OEY J;  3QX1 A;  4BKS A;  3L10 B;  2K25 A;  1G6J A;  5J18 A;  4G0N B;  4LJP B;  2JUO A;  1IYF A;  3JVZ X;  5GMV A;  4ANU A;  2J0M A;  2ZPN A;  2L0T A;  2RSU A;  1WJU A;  1WXM A;  4FJV B;  2ZJD A;  4FHK A;  1RRB A;  4P7I A;  3ZRF A;  4K7U A;  4URK A;  1K8R B;  2DZJ A;  2ZVO A;  1C1Y B;  1X1M A;  4B6W A;  2MBQ A;  1M94 A;  3V61 A;  3VDZ A;  3L0X B;  2GOW A;  2RGF A;  5CTR C;  2KAN A;  3DOW A;  2KOX A;  2FIF A;  2KTR B;  2GBN A;  2LXA A;  2RPQ A;  3NZS A;  3PVL A;  4MJS A;  4AUQ C;  3WAN A;  2EMT A;  3TL5 A;  1TGZ B;  2KMC A;  2M4N A;  2C7N B;  3IVF A;  2GMI C;  4HWI B;  1E8X A;  2CHX A;  3PHW B;  2WX1 A;  2EMS A;  4KSK C;  2JRH A;  1RFA A;  1KLV A;  4N9F 4;  2WWZ A;  4TQ1 A;  3RUI B;  1LFD A;  1WE6 A;  2BYV E;  1GNU A;  3PRM B;  2BKR B;  3PZD A;  4K1R B;  2MRP A;  4AJY B;  2JXX A;  4BVU C;  5IA7 A;  2G3Q B;  3DBR I;  3VUW A;  3WAP A;  3NZU A;  3KYC D;  1OGW A;  2I1K A;  2C60 A;  1WM3 A;  1Z5S B;  1WR1 A;  3ZTD A;  4KV2 A;  4E74 A;  2B3A A;  4AWJ A;  1GJZ A;  4BOZ B;  2AYO B;  3ECI A;  2NBV B;  4CYE A;  3AU4 A;  3P2B A;  4EOY A;  2Z0E B;  2DAF A;  4WWP A;  4ZRK A;  2KFJ A;  1WGR A;  4DHZ B;  3T9L A;  1WZ3 A;  4HCP B;  4FLH A;  2MQJ A;  1WE7 A;  4FJZ A;  4EEW A;  2LAS A;  3VAW A;  2NS5 A;  2LWP A;  2C7H A;  1UBI A;  1WGD A;  2KK8 A;  2LZ6 A;  1WH3 A;  3SHQ A;  1WIA A;  5CHW A;  1XT9 B;  2MBE A;  4NJ7 A;  3DBL I;  3LJ3 A;  3L17 A;  3L54 A;  3ZVV A;  2KKC A;  3OJ4 B;  3AXC A;  1WY8 A;  3UIP B;  4JLC A;  2BWF A;  3VTV A;  2KC2 A;  3ZO5 B;  1TTN A;  4KIK B;  3DVN V;  4HK2 A;  1WGH A;  2R2Q A;  1E8Y A;  3A9K B;  3OJ3 A;  2HJ8 A;  2A5U A;  5LXI B;  1V81 A;  1QZE A;  4GSW A;  2WX0 A;  2C5L C;  2N1W A;  4B95 A;  1OTR B;  2ASQ A;  3S2A A;  1IP9 A;  5E6N A;  3LDZ E;  4EZJ A;  3DVN U;  3H7P B;  1D3Z A;  3W1S A;  3EEC A;  1WX8 A;  3ZNI D;  4A3P A;  1GUA B;  5E6P A;  1SE9 A;  3R7R A;  3QC8 B;  3H9D A;  2AL6 A;  2C7M B;  4RMA A;  5AZG A;  3V6E B;  2JZZ A;  2JF5 A;  3DVG X;  3VXW A;  4GDK A;  3RD2 A;  3ZNH B;  4ANV A;  2QHO A;  3N3K B;  3KH0 A;  4I6P A;  1GC6 A;  4HPL B;  3RCZ A;  4TUU A;  3RYT A;  1E5W A;  1U4A A;  1LM8 B;  4XC2 A;  3DVG Y;  2KN5 A;  5JZE B;  1Y8R C;  4NQL B;  5KHQ A;  1V49 A;  2KVR A;  3DBS A;  4NAW A;  4OVU A;  1WMH A;  2NPT A;  2BYE A;  3H7S A;  3O65 B;  4BBN F;  2K6Q A;  3DDC B;  3PSE B;  4WJP A;  4A3O A;  2K6D B;  3N30 A;  4ZYN A;  4W9J A;  3U8Z A;  3UGB B;  4HDO A;  5JH5 C;  3HHM A;  2A4Z A;  4YL8 A;  3T8M A;  4NNJ B;  4GGQ A;  3ZRC A;  2KX3 A;  2MP2 B;  3IFW B;  4WJQ A;  3JW0 X;  2KLC A;  4FBJ B;  2YVC A;  3KYD D;  4GIV A;  2K8B A;  1NBF C;  2GBK A;  3TMP B;  1H4R A;  3BY4 B;  2DYB A;  4GDL A;  2MBO A;  1VD2 A;  2V4L A;  2IY1 B;  5G55 A;  3KUC B;  2MCN B;  1WXS A;  3QWZ B;  4MGI E;  4PS7 A;  1SIF A;  4XZ4 A;  2BPS A;  3JSV B;  1WF9 A;  3VTU A;  5L83 A;  1WXV A;  3RZF A;  2LUE A;  3ML8 A;  2CKH B;  4EFO A;  3IHP C;  2KQ7 A;  2PJH A;  3HIZ A;  4II2 B;  4WJN A;  4DWF A;  4FA6 A;  2Z0D B;  4TKN A;  3X0W A;  4MSM B;  1R4M I;  2KDI A;  3M95 A;  2ZNV B;  1I35 A;  3IBE A;  2LGD A;  2IBI B;  4WAA A;  2DZM A;  3TCA A;  3TJP A;  2JT4 B;  4RM8 A;  3RT3 B;  2D11 A;  4PYU A;  1V5T A;  1FXT B;  4JQW C;  4WQO B;  2KDE B;  3L0W B;  3VH3 B;  3ZDT A;  1V80 A;  5IAA C;  3M63 B;  2O6V B;  4MH0 E;  5L95 C;  2HE7 A;  3L13 A;  4W9G A;  2DYO A;  1KJT A;  2AEH A;  2V1Y A;  4X57 B;  2MP2 A;  2ZPY A;  4JL9 A;  4IG7 B;  1LQB A;  2KD0 A;  4LJO B;  2LI5 A;  2O2V B;  4ANW A;  2XK5 A;  4DHJ B;  4W9D A;  4ICU A;  1WRD B;  5EDS A;  5J17 A;  3U30 A;  4F8C B;  2M8S A;  3QJZ A;  3R3M A;  3AUL A;  4G3X B;  4IUM B;  1ZKH A;  3A9J B;  3W1S C;  2FCM A;  3WAM A;  2KNB A;  2KFK B;  2KWC A;  2LRU A;  3QCA A;  2IYD B;  2DHZ A;  3TBL D;  1ZW7 A;  2M1M A;  2FNJ B;  2KHW B;  2BYF A;  3UIN B;  4G50 A;  5LXH A;  3AU5 A;  3Q3F A;  3QQ8 B;  3M62 B;  3R66 C;  1XD3 B;  2KJR A;  3MJW A;  1RAX A;  2KO3 A;  4F7Z A;  2M17 A;  3MTN B;  2AL3 A;  3V6C B;  2JPH A;  1WJN A;  4K81 A;  2NBW B;  4MSQ B;  2N9P C;  2M0X A;  2IO1 B;  2MBB B;  2NVU I;  3KUD B;  4GB9 A;  2KXJ A;  3A4S C;  4NPN A;  4ZRJ A;  3SDL C;  3UF8 A;  3VUX A;  2KMA A;  2PEA A;  2KJ6 A;  4FAD A;  1UZX B;  2KC1 A;  3HM3 A;  4MEL A;  4BKG A;  4IM3 A;  1NDD A;  2KTR A;  2PE9 A;  4LDT B;  4DDG D;  1WJ4 A;  4BFR A;  4IWP A;  1NI2 A;  3VUY A;  3PLU A;  2DZK A;  2L00 B;  2GBR A;  2J0K A;  3K9P B;  3ZNG C;  1JRU A;  2RR9 A;  2L3Z A;  4IM0 A;  2N9E B;  5CX3 A;  2OOB B;  3OAW A;  2HD5 B;  4KSL C;  4MGK E;  4NQK E;  3ZNZ B;  3K9O B;  1J19 A;  2NR2 A;  5DCN A;  1SGH A;  3A4R A;  4FJY A;  4WJO A;  5LLI A;  2LVP A;  4KVG B;  4IWQ A;  3PRE A;  3PRP B;  1J0G A;  3QA8 A;  1ISN A;  1RLF A;  1A5R A;  1WFY A;  2IO0 B;  2L76 A;  2IY0 B;  3HM6 X;  1WYW B;  4ICV A;  2D3G A;  2PE6 B;  1J8C A;  2G45 B;  4PS8 A;  3SD5 A;  3I3T B;  2D07 B;  1XQQ A;  2LGX A;  4F1S A;  2KWU B;  1WX9 A;  3V62 A;  2CHZ A;  3DCG A;  4MEM A;  4MGY E;  2AWT A;  2FCN A;  4CHK A;  4G11 A;  4XX5 A;  3ZKJ C;  2KLG A;  3PLV A;  1Q1O A;  2BWE S;  1S3S G;  2IZV B;  2WYQ A;  3A1Q B;  4HCN B;  4W9I A;  4DK5 A;  3UQB A;  2HTH A;  3SU8 X;  2MA9 B;  2MWS B;  3WA0 A;  1R4N I;  3ZLZ A;  5CHF A;  4KZC A;  5FR6 A;  4PYZ A;  3KVF B;  4AOF A;  3CMM B;  3EC8 A;  2MSE D;  2BGF A;  3ZTC A;  3Q3J A;  1WZ0 A;  5DPR A;  3CST A;  2MW5 A;  2MX2 A;  1LXD A;  1IPG A;  1PQS A;  1UBQ A;  2XEW A;  1TZ1 A;  2N4F A;  4HXD A;  1C3T A;  1WI0 A;  4LCD E;  1EF5 A;  2DEN B;  2L7R A;  4KIK A;  2KJH B;  3X23 A;  3ZW3 A;  3A9K A;  2ZZP B;  4KZ0 A;  1Q5W B;  1OEY A;  4M8N A;  3VVW B;  5BO4 B;  3B08 A;  3UIO B;  2XBB C;  1P98 A;  4DBG A;  3GZN I;  2GBM A;  2Y5B B;  4KDL B;  3RUL A;  2RD0 A;  3H7P A;  3V60 A;  2K8C A;  3PT2 B;  4IM2 A;  4FN2 A;  2KDF B;  4ZDV A;  4AJW A;  1UGM A;  4HPM B;  2O6V D;  4E71 A;  1E7U A;  1MG8 A;  3NY5 A;  2PPH A;  3VQI A;  1WGY A;  2FCS A;  5KHO A;  3CSF A;  1S1Q B;  2V3S A;  4EKU A;  2N7D A;  1YJ1 A;  4MJS B;  5J2R A;  4ASW C;  3WAL A;  3VFK A;  1L7Y A;  1WR6 E;  1EF1 A;  2MLB A;  2CR5 A;  4DHJ D;  2KWV B;  2KDB A;  4I6L B;  5D7G A;  2FAZ A;  4A20 A;  4HDQ A;  2LJ5 A;  4BBN C;  4ANX A;  3WIM A;  3CF6 E;  1KOT A;  4J6I A;  1V86 A;  2DAJ A;  3OLM D;  5DPS A;  5HKH A;  2JZ3 B;  3VHT C;  1F9J A;  1EO6 A;  1YD8 U;  3H1U A;  2L8J A;  3KW5 B;  2DX5 B;  2ZCC A;  2KZR A;  3QAR A;  4PS3 A;  4HLE A;  2I1J A;  5DPT A;  4B9K A;  3VH4 B;  2IO2 B;  3UQA A;  3QHT A;  4EZK A;  2Z59 B;  2LVQ A;  2J7Q B;  4M8M A;  4W9H A;  1WGG A;  4W9F A;  3ZDM C;  1GG3 A;  1WX7 A;  2WDT B;  2EKE C;  3APF A;  3DPD A;  3PTF C;  3JSV A;  3MHS D;  5JHB A;  2LGY A;  2D2Q A;  2D10 A;  3ZIM A;  3WAO A;  1AAR A;  4IW0 A;  4LDT D;  4EZL A;  3D32 A;  3IG3 A;  2BF8 B;  3APD A;  4GOC A;  5G2N A;  2C9W B;  3ML9 A;  2NCN A;  4I6N B;  3L08 A;  1E8Z A;  1HE8 A;  2DYM A;  4WWO A;  1E90 A;  2ZVN A;  3ONS A;  2FUH B;  4K7W A;  1P3Q U;  1EUV B;  2JWZ A;  2O6V A;  3AI5 A;  4K7S A;  2JRI B;  2MBH A;  3L16 A;  2FCQ A;  4E3C A;  1YX5 B;  1V6E A;  1YIW A;  2CS4 A;  3NHE B;  1ZGU B;  5C23 A;  3ALB A;  1E8W A;  3U7D A;  2O2V A;  1Z2M A;  4HVB A;  3PPA A;  2L0F A;  1KM7 A;  2KTF A;  2G4D B;  4M0W B;  4KDI C;  1P1A A;  1P0R A;  3A9J A;  2K1F A;  3H6N A;  3NS8 A;  3PS6 A;  1L2N A;  2KFK A;  4MGZ E;  2N9X A;  1UD7 A;  2OJR A;  2N1V A;  3NOB A;  1UEL A;  1WJ6 A;  1BT0 A;  3TIX A;  2LXC A;  3DQV A;  4GMV A;  3R7Q A;  5C1Z A;  1I42 A;  1YX6 B;  4GDK B;  2K39 A;  3A33 B;  5DPW A;  1GC7 A;  4JIO U;  1P9D U;  3ZUN A;  2ZCB A;  5TR5 A;  4TV3 A;  4FUL A;  3BIN A;  3EFU A;  3M3J A;  4II3 B;  3N32 A;  4NAW B;  2CHW A;  1WMH B;  2NPT B;  5E6O A;  3QK0 A;  5AEK B;  2YLM A;  4W9K A;  3ENE A;  3C0R B;  3KUZ A;  2UWQ A;  3PV1 A;  4BKS D;  4GU2 A;  4CO7 A;  5D2M B;  4W9L A; 
#chains in the Genus database with same CATH topology
 3GOE A;  3HVD A;  1T0Y A;  3W1Y A;  3VR9 B;  1OQY A;  2G4S A;  1TYG B;  2IGD A;  4UDU C;  2VRR B;  4DXF A;  2WHI A;  4TR8 A;  1SE3 A;  3TUO A;  4K74 A;  2BT6 A;  3AM9 A;  4C80 A;  5D6J B;  5G5H A;  1N61 A;  4W9C A;  3D1E A;  1V2Y A;  2KX0 A;  2MJD A;  4AP4 C;  3AE2 B;  4W9E A;  4GXB A;  3EHV A;  4FHJ A;  3B0A A;  5CHV C;  3I5J C;  2REX A;  4NJ6 A;  4DHZ E;  2J0J A;  2JY6 A;  1FEH A;  2LD9 A;  4TQ0 A;  2JX5 A;  2UU7 A;  2W9N A;  1T5X D;  4GN1 A;  3PGE A;  1PUT A;  4OVZ A;  4OVV A;  1WM2 A;  4IC7 B;  3U7Z A;  3BEP A;  1G6J A;  3W9C B;  5GMV A;  3FC4 A;  2J0M A;  2LJI A;  1WJU A;  4FHK A;  4P7I A;  2BB5 A;  1PGB A;  2ZVO A;  1QT9 A;  3VDZ A;  3L0X B;  5CTR C;  2JWU A;  4ZRP A;  2LXA A;  3NZS A;  2J52 A;  1YN4 A;  3B2G A;  3KQ4 A;  1EWC A;  1E8X A;  2EMS A;  2RDG A;  4KSK C;  3GE8 C;  1NEN B;  2H89 B;  1OQQ A;  3NVY A;  1GNU A;  3Q8C A;  4K1R B;  2D3C A;  2JXX A;  3W2D A;  5IA7 A;  3VUW A;  3NZU A;  2I1K A;  2C60 A;  1UNS A;  1WR1 A;  3ZTD A;  4E74 A;  5G5G A;  4AWJ A;  4ZRK A;  2WXO A;  5I4D A;  2NS5 A;  1WGD A;  5CHW A;  1XT9 B;  3DBL I;  3L17 A;  3L54 A;  2G9H D;  1N5X A;  1VR9 A;  2W55 A;  3ZO5 B;  3DVN V;  2Y5C A;  3A9K B;  2HJ8 A;  2TSS A;  1D5X C;  3N20 C;  3O13 A;  4GSW A;  2LFI A;  2WX0 A;  1ESF A;  2N1W A;  4FXC A;  4B95 A;  4PK1 A;  1OTR B;  3S2A A;  1QOF A;  4TRT A;  1WX8 A;  2PVO D;  1GUA B;  5E6P A;  1SE9 A;  2DBY A;  3QC8 B;  1JQJ A;  4RMA A;  4RGT A;  3VXW A;  4GDK A;  4I6P A;  1GC6 A;  3RCZ A;  2DWQ A;  5KHQ A;  1V49 A;  4OVU A;  1WMH A;  4N97 A;  2K6Q A;  4A3O A;  5JH5 C;  4HDO A;  3HHM A;  4YL8 A;  3NUH B;  2SEB D;  3ZRC A;  4REZ A;  1L4D B;  3TEW A;  1NBF C;  1H4R A;  2DYB A;  1ZXI A;  4GDL A;  1K53 A;  2IY1 B;  2MCN B;  1WXS A;  2PVG C;  4XDD A;  3Q3O C;  2CKH B;  4EFO A;  1WRI A;  2KQ7 A;  2PJH A;  3HIZ A;  4II2 B;  4WJN A;  4FA6 A;  2IGH A;  3BYT B;  3TJP A;  2JT4 B;  2Y5P A;  4RM8 A;  2YEP B;  1KRH A;  3AE3 B;  3VH3 B;  3M63 B;  3DHI C;  1N5W A;  2WGS A;  3C19 A;  4W9G A;  1KJT A;  4QAY A;  4PNU A;  2O2V B;  1WWT A;  4ANW A;  4W9D A;  5EDS A;  5J17 A;  2M8S A;  3AUL A;  3KWL A;  4S17 A;  3W1S C;  3WAM A;  4YXD B;  2WXP A;  3VRB B;  2IYD B;  2DHZ A;  3RNF C;  2FNJ B;  2L1A A;  2GB1 A;  3AU5 A;  3M62 B;  4F7Z A;  3PWE A;  3MTN B;  3V6C B;  4K3O A;  1WJN A;  4N95 A;  4K81 A;  3KUD B;  1C4C A;  1V1O A;  3SDL C;  2Z8L A;  3VUX A;  2PEA A;  1R4M B;  1TJE A;  3BVZ A;  4IM3 A;  2KTR A;  4C00 A;  4LDT B;  4DDG D;  1WJ4 A;  4BFR A;  3TEZ A;  3P42 A;  3ABV B;  1T3Q A;  1F2R C;  2OOB B;  4GLS C;  2WP9 B;  4KVG B;  4IWQ A;  1VJK A;  2YEP F;  1WFY A;  2IO0 B;  2L76 A;  2QDF A;  4OVH A;  3I3T B;  1MI0 A;  1L0Y B;  1WX9 A;  3TEY A;  2CHZ A;  3RNG C;  2IGG A;  5BMI A;  4G11 A;  2IZV B;  2WYQ A;  1JCK B;  3WA0 A;  1YN3 A;  4PYZ A;  3PGE B;  4LLG M;  3LB8 C;  2BGF A;  3ZTC A;  1VZ6 A;  3CST A;  2NTS A;  1IPG A;  1UBQ A;  1Y56 A;  3Q8A A;  3SEB A;  2L7R A;  1OEY A;  5E6J A;  3B08 A;  4KDL B;  3H7P A;  4IM2 A;  3PT2 B;  2RPV A;  4HPM B;  3NY5 A;  2FCS A;  3SFE B;  4K3C A;  4EKU A;  1K52 A;  4N9A A;  1WR6 E;  1ZXH A;  4DHJ D;  2BB6 A;  2KDB A;  4A20 A;  1FMA D;  2Q5W D;  4HDQ A;  4BBN C;  1XO3 A;  3NVZ A;  4J6I A;  2LEK A;  4YSZ B;  2DAJ A;  5DPS A;  4ZHO A;  2GLS A;  3E56 A;  2KZR A;  4PS3 A;  2OED A;  2IO2 B;  3QHT A;  1PGA A;  2Z59 B;  4DXG A;  2WXM A;  4M8M A;  1C4A A;  3ZDM C;  3PTF C;  1WX7 A;  3DPD A;  1K50 A;  1JRO A;  2D2Q A;  5AH4 A;  3WAO A;  1TKY A;  3GZN B;  1QOA A;  1PYW D;  1P7F A;  2NCN A;  3L08 A;  4WWO A;  2M0A A;  4YSX B;  2ZVN A;  2FUH B;  2O6V A;  3AI5 A;  2ON8 A;  3L16 A;  1YQ4 B;  1E8W A;  2K0P A;  1Z2M A;  5IKC M;  3PZ8 A;  3W5V B;  1CQV A;  1P0R A;  3NS8 A;  1L2N A;  2KFK A;  4GDK B;  3MJ5 A;  1FFU A;  3A33 B;  3AEE B;  1P9D U;  1IGD A;  1D6E C;  2ZCB A;  4TV3 A;  1E6E B;  2NMQ A;  4WAF A;  2CHW A;  1WMH B;  5E6O A;  4R3D A;  5AEK B;  3WCQ A;  4W9K A;  5D2M B;  1I4Q A;  3RZW C;  1V5O A;  2UYZ B;  1V9J A;  2R2O A;  4GDL B;  1C79 A;  3AE9 B;  4BKT A;  2JYT A;  3B9J A;  1TBE A;  2GI9 A;  1TS5 A;  5IOI A;  3Q6B A;  2L05 A;  1SIJ A;  3PRZ A;  2IO3 B;  1ZDX A;  2GBJ A;  2WXF A;  4L23 A;  2VH2 A;  4N6E B;  3APC A;  1NEK B;  4LNF A;  1SJE D;  2BKF A;  4A55 A;  2FID A;  5AZF A;  1RWS A;  1VRA B;  3ZJV A;  2AQ2 B;  2WXJ A;  2NBU A;  4Q2J A;  2RMM A;  1I4R A;  1FCL A;  2ZW1 A;  1L0V B;  2ZEQ A;  3QX1 A;  4BKS A;  1JW9 D;  3BWU D;  1E9M A;  2VZK B;  1HTQ A;  2JUO A;  1JQL A;  4ANU A;  2ZPN A;  2RSU A;  3P16 A;  3P4S B;  2ZJD A;  3P4P B;  5BMH A;  1MMI A;  1X1M A;  3ZJU A;  1GB4 A;  1M94 A;  3V61 A;  2GOW A;  2RGF A;  2FIF A;  2KTR B;  4JWS C;  3PVL A;  4MJS A;  1FXA A;  1WYG A;  3U4E G;  4AUQ C;  2EMT A;  4AS1 A;  1K51 A;  3P4R B;  3EGR A;  1C78 A;  2KMC A;  1T0R C;  2M4N A;  2C7N B;  3IVF A;  3MHZ A;  2N9L A;  4HWI B;  3PHW B;  4PT5 A;  4DQO C;  4N9F 4;  2WWZ A;  4K3S A;  1LFD A;  4K3Q A;  3PZD A;  4AJY B;  4US8 A;  1HZ5 A;  4KGR A;  1OGW A;  1WM3 A;  1Z5S B;  3Q69 A;  4KV2 A;  3RNC C;  1OK7 A;  1GJZ A;  3V3X A;  2I2Y A;  4CYE A;  3AU4 A;  4EOY A;  5EE3 A;  4DHZ B;  2KVZ A;  4FLH A;  4FJZ A;  4EEW A;  3VAW A;  2WU2 B;  1C77 A;  2LWP A;  1UBI A;  2LZ6 A;  1WH3 A;  3SHQ A;  1WIA A;  4WH4 A;  4NJ7 A;  3B2F A;  3OWE B;  3OJ4 B;  3GB1 A;  1CJE A;  1I4X A;  1L4Z B;  3VTV A;  2Y3A A;  4HK2 A;  1WGH A;  1E8Y A;  5H8Y E;  1M4V A;  3N1Y C;  1FNV A;  1QZE A;  2JQR B;  4ZYS A;  2C5L C;  2ASQ A;  4EZJ A;  1EU3 A;  5JXV A;  3H7P B;  3W1S A;  3EEC A;  2WDR B;  1Q10 A;  2WXH A;  2AL6 A;  4PNV A;  3V6E B;  3ZNH B;  4ZRQ A;  1IGC A;  3EFC A;  1Y8R C;  4NQL B;  4NAW A;  3D1G A;  4C4V A;  2NPT A;  2BYE A;  3GP7 A;  4WJP A;  2X38 A;  1F1H A;  3P63 A;  4GGQ A;  2KX3 A;  2KLC A;  1SF0 A;  2K8B A;  2GBK A;  2LUM A;  3QWZ B;  3Q2A C;  1SIF A;  2WS3 B;  3RZF A;  2L32 A;  3BVM A;  3ZQ4 A;  4DWF A;  2MH7 A;  2Z0D B;  1E10 A;  1R4M I;  3M95 A;  2LGD A;  2IBI B;  2KT7 A;  3NRZ A;  4RGO S;  3TCA A;  4N59 A;  1FNU A;  3RT3 B;  4JQW C;  2KDE B;  3ZDT A;  2IJ0 A;  2KMM A;  2O6V B;  4MH0 E;  3Q4J A;  2WQY B;  1FRD A;  2AEH A;  2V1Y A;  4X57 B;  3RFZ B;  2W3S A;  2MP2 A;  2ZPY A;  4JL9 A;  4LTU A;  4XDC A;  2N7J A;  2QIE B;  2XK5 A;  4ICU A;  4K3B A;  3U30 A;  1TKG A;  4F8C B;  4G3X B;  5BMG A;  1ZKH A;  2KFK B;  2LRU A;  1HQR D;  3TBL D;  1ZW7 A;  2M1M A;  2KHW B;  3RB9 A;  4G50 A;  4A9A A;  4HRO A;  3R2T A;  1XD3 B;  1YQ3 B;  3AEC B;  2KJR A;  2IPK D;  2EKI A;  3AEB B;  1JWU D;  2M0X A;  4NPN A;  1F52 A;  1ZE3 D;  3UF8 A;  1MJD A;  1MFW A;  3AED B;  4OZC A;  2KMA A;  2BYT A;  3AE7 B;  1WSP A;  1NDD A;  1QLB B;  2L00 B;  3PZ7 A;  3BK2 A;  3ZNG C;  2L3Z A;  4IM0 A;  2N9E B;  4S0R A;  1CZP A;  2AQ1 B;  3OAW A;  2HD5 B;  3K9O B;  1FM0 D;  4IDI A;  4WJO A;  3AE8 B;  2LVP A;  1ZUD 2;  3HM6 X;  2D3G A;  2G45 B;  4PS8 A;  1XQQ A;  4F1S A;  1JWA D;  3N1X C;  2LGI A;  3DCG A;  4MEM A;  2AWT A;  3PLV A;  1Q1O A;  2PLP A;  2K9X A;  2RDB C;  4W9I A;  3CWI A;  3GE3 C;  4RCO A;  4CQN A;  3SU8 X;  2MA9 B;  5FR6 A;  3KVF B;  4AOF A;  1YNT E;  3EC8 A;  3NVV A;  3HVZ A;  5BYQ A;  3Q4L A;  2KDM A;  3Q3J A;  1QOG A;  1WZ0 A;  4ARC A;  3LJ3 A;  2MW5 A;  2MX2 A;  1PQS A;  1SSN A;  1TZ1 A;  2N4F A;  3SR6 A;  1WI0 A;  4LCD E;  4KIK A;  2KJH B;  2ZZP B;  2KYW A;  4KZ0 A;  1ZDV A;  1ZPS A;  1P7E A;  3VVW B;  4OZA A;  5BO4 B;  2XBB C;  1P98 A;  3GZN I;  3RUL A;  2RD0 A;  3V60 A;  4ZDV A;  4FN2 A;  4AJW A;  5HG2 A;  4E71 A;  1WGY A;  5KHO A;  5HFY A;  1S1Q B;  1YJ1 A;  3AE4 B;  3DWM A;  4MJS B;  5J2R A;  3VFK A;  2MHJ A;  1L7Y A;  2CR5 A;  3P1M A;  4LNN A;  2LJ5 A;  4ANX A;  1T0S C;  2BQQ A;  1R4N B;  2JZ3 B;  3VHT C;  3H1U A;  2L8J A;  3KW5 B;  2DX5 B;  4HLE A;  4B9K A;  1UNN A;  3U52 E;  2WDQ B;  4BZA A;  2BVC A;  4WIP A;  2WDT B;  2EKE C;  3JSV A;  3AE5 B;  4HPP A;  1TS3 A;  3FKY A;  1KLG D;  5AGU A;  4LDT D;  3IG3 A;  3APD A;  5G2N A;  1MVK A;  2C9W B;  3ML9 A;  1XCQ L;  2JWZ A;  4K7S A;  2JRI B;  2MBH A;  4A90 A;  2FCQ A;  1QF6 A;  2GRI A;  4RH6 A;  1YIW A;  4HVB A;  2IND C;  3PPA A;  4N99 A;  3Q4K A;  4KDI C;  1ET6 A;  3A9J A;  3PS6 A;  1NI3 A;  4KKI A;  2N9X A;  1TIF A;  1GB1 A;  2FUG 1;  3TIX A;  2EEL A;  3MC0 B;  4GMV A;  5C3J B;  2K39 A;  5D3D A;  5DPW A;  2WXG A;  1L5P A;  1SXT A;  4RGM A;  2QC8 A;  5TR5 A;  4FUL A;  1XEE A;  3M3J A;  4II3 B;  4NAW B;  4C4V B;  2NPT B;  1ZOY B;  1IBX A;  2E6X A;  1DOX A;  1XLN A;  4LNO A;  4MDK E;  4JGH B;  1GOZ A;  1NYQ A;  3PHX B;  1HEZ E;  4DDI D;  5HHD G;  3HK0 A;  4HJK A;  1SBB B;  2ZNV C;  1H8C A;  5AZH A;  3AEG B;  2N7E A;  1B9R A;  1XXG A;  2JVC A;  3QAQ A;  1N6Z A;  3NVW A;  4XYC A;  1WGK A;  4EUT A;  2CU1 A;  5BYS A;  5JHA A;  2B76 B;  3FIL A;  1E7V A;  1N63 A;  2XK5 B;  4IWO A;  1TT5 B;  1YN5 A;  1A70 A;  3NZ3 A;  5J18 A;  2HJ1 A;  2KAC A;  1HA5 A;  1IYF A;  2L0T A;  4FJV B;  4K7U A;  4URK A;  1K8R B;  3RNE C;  1B1Z A;  1C1Y B;  2XUR A;  5FK9 C;  1FO4 A;  2KAN A;  3IT6 B;  3RNB C;  1VZ7 A;  2PIA A;  3WAN A;  5IO9 A;  3TL5 A;  3L4P A;  4KX6 B;  3DBH B;  4C7Y A;  3FAH A;  2SAK A;  4B0E A;  2CHX A;  2JRH A;  1RFA A;  4TR7 A;  2WXN A;  4MT5 A;  4TQ1 A;  2BS4 B;  3TEX A;  2BYV E;  3PRM B;  2BKR B;  2MRP A;  4BVU C;  3WAP A;  3KYC D;  1DGJ A;  2WXR A;  2B3A A;  2AYO B;  3EUB 2;  3ECI A;  2NBV B;  3P2B A;  2Z0E B;  2KFJ A;  1WGR A;  3T9L A;  5TSS A;  1WZ3 A;  4HCP B;  1VPK A;  2MQJ A;  1UWX A;  1D5Z C;  3Q8E A;  2LAS A;  1C9F A;  1XF5 L;  2C7H A;  2KK8 A;  2MBE A;  2KAJ A;  2FE8 A;  2KKC A;  3AXC A;  1WY8 A;  3UIP B;  4PNW A;  1TTN A;  2FBW B;  4KIK B;  2BS3 B;  2R2Q A;  3OJ3 A;  3RN9 C;  5LXI B;  2QEJ C;  3KLS X;  2LMC A;  3AB5 A;  4NJC A;  1IP9 A;  3Q8F A;  5E6N A;  1D3Z A;  2INN E;  3R7R A;  1KF6 B;  2C7M B;  4K3L A;  5AZG A;  3I9V 1;  1V97 A;  2QHO A;  3NS1 A;  4XGA B;  2H88 B;  3DBR B;  3KH0 A;  4N96 A;  4HPL B;  4TUU A;  3RYT A;  1U4A A;  1LM8 B;  3DVG Y;  2KN5 A;  3RMK C;  4K3M A;  1NVI D;  3DBS A;  4L1B A;  1R7S A;  4BBN F;  3DDC B;  3PSE B;  3N30 A;  3UGB B;  4P1C C;  3IFW B;  3IXS A;  4WJQ A;  2VZK D;  3JW0 X;  2YVC A;  3KYD D;  3SFD B;  4YWG G;  3TMP B;  2OHF A;  1YOV B;  4P6V F;  2MBO A;  1VD2 A;  5G55 A;  3AEA B;  3KUC B;  4XZ4 A;  2BPS A;  3QSB A;  3JSV B;  2WLB A;  4ZHP A;  1WXV A;  3I63 C;  2LUE A;  3DHG C;  4A6Q A;  3IHP C;  3X0W A;  2KDI A;  4WQM A;  1I35 A;  1J7C A;  1TY0 A;  1VZ8 A;  4WAA A;  2J4X A;  4YTN B;  3TSS A;  5IAA C;  4MJP A;  3L13 A;  4TSZ A;  2DYO A;  5AUK A;  5FVE A;  4IG7 B;  1LQB A;  4JE3 B;  2LI5 A;  1QIL A;  1WRD B;  3F1V A;  4ACF A;  3N9Y C;  3QJZ A;  3R3M A;  4IUM B;  3A9J B;  2KNB A;  2KWC A;  3L10 A;  3QCA A;  1QOB A;  3N1Z C;  4OZB A;  3UIN B;  3R66 C;  4OVF A;  2KO3 A;  4US9 A;  2JPH A;  4MSQ B;  2MBB B;  2NVU I;  2KXJ A;  3A4S C;  4N94 A;  2D3B A;  3HRD D;  4ZRJ A;  4FAD A;  2WXL A;  2K5P A;  1IBX B;  1TKE A;  3H8H A;  2W82 A;  3VUY A;  4KGT A;  2GBR A;  3J9C A;  5H92 C;  1PDX A;  1JRU A;  4NZL B;  1HTO A;  2RR9 A;  1XLO A;  3W5U B;  5HI1 A;  4KSL C;  3T3N A;  3ZNZ B;  2NR2 A;  1SB3 C;  5DCN A;  3A4R A;  2CJO A;  4FJY A;  4WUR A;  5IP4 D;  3PRE A;  3PRP B;  1J0G A;  3EA6 A;  4ICV A;  2IY0 B;  2PE6 B;  1J8C A;  1JWB D;  2D07 B;  2WXK A;  3IT4 B;  2KWU B;  2FCN A;  4CHK A;  5BYR A;  3ZKJ C;  2BWE S;  3T3O A;  1S3S G;  3FIL B;  2V9H A;  3GS2 A;  4DK5 A;  1QQR A;  1T6B X;  2MWS B;  1R4N I;  4MJQ A;  3ZLZ A;  1I4G A;  4KZC A;  3AMZ A;  3CMM B;  4L2Y A;  4N58 A;  2L83 A;  4K3P A;  5DPR A;  2XEW A;  4RFB A;  4HXD A;  4MH8 A;  2DEN B;  4H2A A;  3DWG C;  4IOI E;  4KKJ A;  3T0P A;  1Q5W B;  2V3N A;  4M8N A;  3UIO B;  4DBG A;  2GBM A;  1MPE A;  2K8C A;  2KDF B;  4YSY B;  3Q8B A;  2O6V D;  1MG8 A;  5GXG B;  2N7D A;  4ASW C;  3WAL A;  3ZYY X;  2MLB A;  1EU4 A;  2M56 B;  2MJE A;  5D7G A;  2X8X X;  2FAZ A;  3WIM A;  3CF6 E;  2INC C;  5EE1 A;  5HKH A;  1JQ4 A;  1YD8 U;  3MC9 A;  1XCT L;  3QAR A;  3VH4 B;  2G1E A;  4RNA A;  3MC8 A;  3D1F A;  3RI7 C;  2LVQ A;  2J7Q B;  1ZP0 B;  4W9H A;  4W9F A;  3APF A;  1I7H A;  5JHB A;  2D3A A;  3ZXV A;  2LGY A;  2D10 A;  1UUP A;  1AAR A;  3D32 A;  4HKZ E;  4GOC A;  2QSD A;  1E8Z A;  3AEF B;  3L0W A;  2AX5 A;  4K7W A;  1P3Q U;  2NTT A;  2V3P A;  3ZGZ A;  4E3C A;  1PGX A;  1C76 A;  2R61 A;  1AN8 A;  1F2R I;  1ZGU B;  2CS4 A;  3ALB A;  3NHE B;  5C23 A;  2L0F A;  1KM7 A;  2WXQ A;  3AH7 A;  2KTF A;  2G4D B;  1P1A A;  2V4I B;  3H6N A;  2LGS A;  4ITK A;  4MGZ E;  1UD7 A;  2OJR A;  1UEL A;  1VDV A;  4YT0 B;  1ET9 A;  1T0Q C;  4TMA B;  5C1Z A;  1I42 A;  1YX6 B;  4XE0 A;  3VRA B;  1JWS D;  1GC7 A;  4JIO U;  3ZUN A;  3BIN A;  3EFU A;  2PMV A;  2QMT A;  3N32 A;  4HJG E;  2YLM A;  3ENE A;  3PV1 A;  4BKS D;  2UWQ A;  2D5G A;  3OG5 A;  4GU2 A;  4CO7 A;  1D5M C;  2DZI A;  2LRW A;  5AUI A;  3AE6 B;  4RM9 A;  1E7P B;  1IUE A;  3QSB B;  3PO0 A;  4WWN A;  3URY A;  2M19 A;  2K8H A;  1DYQ A;  4BOS C;  3JYU A;  4AQ7 A;  1YQB A;  1FRR A;  2LVO A;  4TSS A;  1DOY A;  3DBH I;  1UH6 A;  1WXA A;  1RYJ A;  4MM3 A;  4DXA B;  4K3K A;  2HDE A;  3A1Q A;  3AV8 A;  3B1L X;  3QIJ A;  3VTW A;  2KQS A;  5D94 A;  1Q0W B;  1KLU D;  4NY0 A;  4LK0 M;  2KN4 A;  1LGR A;  4ZRI A;  1VCB A;  1CMX B;  1OEY J;  2KQ4 X;  3L10 B;  1SE4 A;  2K25 A;  1V8C A;  3ETR A;  1ENF A;  4OHJ A;  4G0N B;  4LJP B;  1MHX A;  3LXF A;  3JVZ X;  1RM6 C;  1YJI A;  1WXM A;  1RRB A;  3ZRF A;  2DZJ A;  1KH0 A;  4B6W A;  2MBQ A;  1FCC C;  3DOW A;  1NYR A;  2KOX A;  2V0G A;  2GBN A;  1JAL A;  2RPQ A;  2POL A;  3BII D;  2L52 A;  5FKA C;  1L0X B;  1GPX A;  3ZJT A;  1TGZ B;  4MJR A;  2KWD A;  1ACC A;  3RNA C;  4TR6 A;  5D3I B;  2GMI C;  1BML C;  3AN1 A;  2WX1 A;  2PTL A;  4P16 A;  2ICI A;  2XNA C;  1KLV A;  3RUI B;  1WE6 A;  3I57 A;  4M01 A;  2DLB A;  2G3Q B;  3DBR I;  2AVT A;  2MEK A;  1YMH E;  4BOZ B;  4HKQ A;  2DAF A;  4WWP A;  1FIQ A;  3HUI A;  4OVG A;  4LNI A;  4O1N A;  1WE7 A;  2QCZ A;  2WDV B;  4K3R A;  3ZXR A;  1JML A;  3ZVV A;  1V1P A;  4JLC A;  2BWF A;  1FXI A;  2KC2 A;  2A5U A;  1J7A A;  1V81 A;  4M0W A;  3LDZ E;  3DVN U;  3ZNI D;  4A3P A;  4RF0 A;  4B0M A;  3H9D A;  2BBC A;  2JZZ A;  2HTM E;  2JF5 A;  3DVG X;  2J42 A;  3RD2 A;  4ANV A;  2BS2 B;  3N3K B;  4LNK A;  1E5W A;  5JZE B;  4XC2 A;  5IN7 A;  2KVR A;  3H7S A;  1C4P A;  3O65 B;  4M02 A;  1TY2 A;  2K6D B;  4ZYN A;  4W9J A;  3U8Z A;  1D4B A;  2A4Z A;  3T8M A;  4NNJ B;  2AQ3 B;  2MP2 B;  4FBJ B;  4GIV A;  3DBL B;  1OFF A;  3BY4 B;  1STE A;  3RPF C;  2V4L A;  3E9S A;  2I38 A;  5EE0 A;  4MGI E;  4PS7 A;  4YTP B;  2QIL A;  1WF9 A;  3VTU A;  5L83 A;  3ML8 A;  5FR3 A;  2MJ3 A;  4TKN A;  4MSM B;  4M00 A;  2ZNV B;  3IBE A;  2W54 A;  2DZM A;  5AH2 A;  1JWM D;  2N0S B;  1L6U A;  2D11 A;  1V5T A;  1FXT B;  4PYU A;  4WQO B;  2LHE A;  5T8I A;  3L0W B;  1V80 A;  1J7B A;  4YTM B;  1I4H A;  2HE7 A;  4NAM A;  3BYY B;  1N62 A;  4J3O D;  4LJO B;  2KD0 A;  2BW2 A;  4DHJ B;  2DNF A;  1XLP A;  2FCM A;  1BUI C;  1PFD A;  2JYE A;  4MAC A;  4JX1 C;  1JRP A;  2BYF A;  2INP E;  5LXH A;  1ROE A;  3Q3F A;  3QQ8 B;  1SE2 A;  5EE9 A;  3MJW A;  1RAX A;  2AWA A;  1I4P A;  2M17 A;  2AL3 A;  1QKZ A;  2NBW B;  2N9P C;  2IO1 B;  4GB9 A;  1AW7 A;  1FPY A;  2CU3 A;  3UI3 A;  4C56 C;  1L6V A;  4KGS A;  2KJ6 A;  1FD6 A;  3L0X A;  3LYY A;  1UZX B;  1F77 A;  2KC1 A;  3HM3 A;  4MEL A;  4BKG A;  2PE9 A;  4XWT A;  4IWP A;  1YJJ A;  1NI2 A;  3PLU A;  2E3T A;  2DZK A;  3V05 A;  3VR8 B;  4RF1 A;  2J0K A;  2WXI A;  3K9P B;  2XN9 C;  1TS2 A;  1UF0 A;  5CX3 A;  4MGK E;  4NQK E;  2ACZ B;  1J19 A;  1HXY D;  1SGH A;  4D2K A;  2JXT A;  1MHH E;  5LLI A;  5LNK 1;  2VH1 A;  3QA8 A;  1ISN A;  1RLF A;  1A5R A;  1WYW B;  3BVG A;  4HRS A;  3SD5 A;  2LGX A;  5AGV A;  4RKI A;  3P4Q B;  1DOI A;  3V62 A;  1LO5 D;  2WU5 B;  5C2T B;  4MGY E;  4MM3 B;  4XX5 A;  2KLG A;  3A1Q B;  4HCN B;  3MP9 A;  3UQB A;  2HTH A;  1UWM A;  1UGJ A;  2WNM A;  5CHF A;  2MSE D;  3R2I A;  2IDY A;  2BTE A;  3IAM 1;  5L95 C;  1LXD A;  1EWY C;  2QJL A;  1C3T A;  2N9K A;  1EF5 A;  3ZW3 A;  3X23 A;  1KTK A;  3A9K A;  1F0Z A;  2PW9 A;  4XWW A;  4ZOH C;  3R8B A;  2Y5B B;  3CIR B;  1UGM A;  4ARI A;  3KWV A;  3NJT A;  1E7U A;  3VQI A;  2PPH A;  3CSF A;  2V3S A;  4IKG A;  3Q14 C;  1GAQ B;  1HZ6 A;  1EF1 A;  3Q3N C;  1KFY B;  2KWV B;  4I6L B;  2K22 A;  3NG0 A;  4USA A;  2PKO A;  1KOT A;  1V86 A;  3OLM D;  2ZW0 A;  1F9J A;  1EO6 A;  1EM7 A;  2ZCC A;  4JWU C;  4OW0 A;  2I1J A;  5DPT A;  1FNW A;  3UQA A;  2RDH A;  2K3U A;  4EZK A;  1WXQ A;  1WGG A;  1GG3 A;  4N98 A;  3MFG A;  3Q3M C;  4P1B C;  3MHS D;  1AWD A;  3ZIM A;  1XLQ A;  2ONQ A;  4IW0 A;  4EZL A;  1CK1 A;  2BF8 B;  3BK1 A;  4A8X C;  2JSV X;  1TZO A;  4I6N B;  4C7Z A;  1AYF A;  1HE8 A;  2DYM A;  3DHH C;  1E90 A;  4HEA 1;  3ONS A;  3AE1 B;  1EUV B;  1OQR A;  1MG4 A;  2JZP A;  1SJH D;  1RFK A;  5FRQ A;  1V1P B;  1YX5 B;  2JU6 X;  1V6E A;  3U7D A;  2LHD A;  2O2V A;  4WWM A;  1E0Z A;  4M0W B;  2K1F A;  4BAX A;  4RGN A;  3NOB A;  2N1V A;  3C8Y A;  1WJ6 A;  1BT0 A;  2LXC A;  2J53 A;  3DQV A;  3R7Q A;  1N60 A;  4EE2 A;  2CJN A;  1BXT A;  4JPS A;  1VLB A;  5MPO A;  1SEB D;  2OJW A;  1TS4 A;  3QK0 A;  3BZD B;  4S3I A;  3C0R B;  3KUZ A;  3U2S C;  3IAS 1;  2W3R A;  4W9L A;  1FFV A; 
#chains in the Genus database with same CATH homology
 2DZI A;  3GOE A;  1T0Y A;  2LRW A;  4MDK E;  3RZW C;  3W1Y A;  1V5O A;  1OQY A;  2G4S A;  2UYZ B;  4RM9 A;  4JGH B;  1V9J A;  2R2O A;  4GDL B;  2VRR B;  3PHX B;  4DDI D;  4BKT A;  3HK0 A;  4HJK A;  4WWN A;  2ZNV C;  5D6J B;  4W9C A;  1H8C A;  5AZH A;  1TBE A;  2K8H A;  1V2Y A;  2KX0 A;  4BOS C;  3JYU A;  2N7E A;  4AP4 C;  4W9E A;  1YQB A;  2JVC A;  2L05 A;  3PRZ A;  4GXB A;  2LVO A;  2IO3 B;  3QAQ A;  3EHV A;  2GBJ A;  4EUT A;  4FHJ A;  3B0A A;  3APC A;  2CU1 A;  5CHV C;  3DBH I;  5JHA A;  1UH6 A;  1WXA A;  4MM3 A;  2REX A;  4NJ6 A;  4DXA B;  2BKF A;  3B1L X;  3A1Q A;  2FID A;  2J0J A;  3QIJ A;  2JY6 A;  4DHZ E;  3VTW A;  2KQS A;  2LD9 A;  5D94 A;  4TQ0 A;  1Q0W B;  5AZF A;  2W9N A;  4NY0 A;  1E7V A;  4GN1 A;  2NBU A;  2XK5 B;  3PGE A;  4ZRI A;  1VCB A;  4IWO A;  4OVV A;  1WM2 A;  1CMX B;  4IC7 B;  2ZEQ A;  1OEY J;  3QX1 A;  4BKS A;  3L10 B;  2K25 A;  1G6J A;  5J18 A;  4G0N B;  4LJP B;  2JUO A;  1IYF A;  3JVZ X;  5GMV A;  4ANU A;  2J0M A;  2ZPN A;  2L0T A;  2RSU A;  1WJU A;  1WXM A;  4FJV B;  2ZJD A;  4FHK A;  1RRB A;  4P7I A;  3ZRF A;  4K7U A;  4URK A;  1K8R B;  2DZJ A;  2ZVO A;  1C1Y B;  1X1M A;  4B6W A;  2MBQ A;  1M94 A;  3V61 A;  3VDZ A;  3L0X B;  2GOW A;  2RGF A;  5CTR C;  2KAN A;  3DOW A;  2KOX A;  2FIF A;  2KTR B;  2GBN A;  2LXA A;  2RPQ A;  3NZS A;  3PVL A;  4MJS A;  4AUQ C;  3WAN A;  2EMT A;  3TL5 A;  1TGZ B;  2KMC A;  2M4N A;  2C7N B;  3IVF A;  2GMI C;  4HWI B;  1E8X A;  2CHX A;  3PHW B;  2WX1 A;  2EMS A;  4KSK C;  2JRH A;  1RFA A;  1KLV A;  4N9F 4;  2WWZ A;  4TQ1 A;  3RUI B;  1LFD A;  1WE6 A;  2BYV E;  1GNU A;  3PRM B;  2BKR B;  3PZD A;  4K1R B;  2MRP A;  4AJY B;  2JXX A;  4BVU C;  5IA7 A;  2G3Q B;  3DBR I;  3VUW A;  3WAP A;  3NZU A;  3KYC D;  1OGW A;  2I1K A;  2C60 A;  1WM3 A;  1Z5S B;  1WR1 A;  3ZTD A;  4KV2 A;  4E74 A;  2B3A A;  4AWJ A;  1GJZ A;  4BOZ B;  2AYO B;  3ECI A;  2NBV B;  4CYE A;  3AU4 A;  3P2B A;  4EOY A;  2Z0E B;  2DAF A;  4WWP A;  4ZRK A;  2KFJ A;  1WGR A;  4DHZ B;  3T9L A;  1WZ3 A;  4HCP B;  4FLH A;  2MQJ A;  1WE7 A;  4FJZ A;  4EEW A;  2LAS A;  3VAW A;  2NS5 A;  2LWP A;  2C7H A;  1UBI A;  1WGD A;  2KK8 A;  2LZ6 A;  1WH3 A;  3SHQ A;  1WIA A;  5CHW A;  1XT9 B;  2MBE A;  4NJ7 A;  3DBL I;  3LJ3 A;  3L17 A;  3L54 A;  3ZVV A;  2KKC A;  3OJ4 B;  3AXC A;  1WY8 A;  3UIP B;  4JLC A;  2BWF A;  3VTV A;  2KC2 A;  3ZO5 B;  1TTN A;  4KIK B;  3DVN V;  4HK2 A;  1WGH A;  2R2Q A;  1E8Y A;  3A9K B;  3OJ3 A;  2HJ8 A;  2A5U A;  5LXI B;  1V81 A;  1QZE A;  4GSW A;  2WX0 A;  2C5L C;  2N1W A;  4B95 A;  1OTR B;  2ASQ A;  3S2A A;  1IP9 A;  5E6N A;  3LDZ E;  4EZJ A;  3DVN U;  3H7P B;  1D3Z A;  3W1S A;  3EEC A;  1WX8 A;  3ZNI D;  4A3P A;  1GUA B;  5E6P A;  1SE9 A;  3R7R A;  3QC8 B;  3H9D A;  2AL6 A;  2C7M B;  4RMA A;  5AZG A;  3V6E B;  2JZZ A;  2JF5 A;  3DVG X;  3VXW A;  4GDK A;  3RD2 A;  3ZNH B;  4ANV A;  2QHO A;  3N3K B;  3KH0 A;  4I6P A;  1GC6 A;  4HPL B;  3RCZ A;  4TUU A;  3RYT A;  1E5W A;  1U4A A;  1LM8 B;  4XC2 A;  3DVG Y;  2KN5 A;  5JZE B;  1Y8R C;  4NQL B;  5KHQ A;  1V49 A;  2KVR A;  3DBS A;  4NAW A;  4OVU A;  1WMH A;  2NPT A;  2BYE A;  3H7S A;  3O65 B;  4BBN F;  2K6Q A;  3DDC B;  3PSE B;  4WJP A;  4A3O A;  2K6D B;  3N30 A;  4ZYN A;  4W9J A;  3U8Z A;  3UGB B;  4HDO A;  5JH5 C;  3HHM A;  2A4Z A;  4YL8 A;  3T8M A;  4NNJ B;  4GGQ A;  3ZRC A;  2KX3 A;  2MP2 B;  3IFW B;  4WJQ A;  3JW0 X;  2KLC A;  4FBJ B;  2YVC A;  3KYD D;  4GIV A;  2K8B A;  1NBF C;  2GBK A;  3TMP B;  1H4R A;  3BY4 B;  2DYB A;  4GDL A;  2MBO A;  1VD2 A;  2V4L A;  2IY1 B;  5G55 A;  3KUC B;  2MCN B;  1WXS A;  3QWZ B;  4MGI E;  4PS7 A;  1SIF A;  4XZ4 A;  2BPS A;  3JSV B;  1WF9 A;  3VTU A;  5L83 A;  1WXV A;  3RZF A;  2LUE A;  3ML8 A;  2CKH B;  4EFO A;  3IHP C;  2KQ7 A;  2PJH A;  3HIZ A;  4II2 B;  4WJN A;  4DWF A;  4FA6 A;  2Z0D B;  4TKN A;  3X0W A;  4MSM B;  1R4M I;  2KDI A;  3M95 A;  2ZNV B;  1I35 A;  3IBE A;  2LGD A;  2IBI B;  4WAA A;  2DZM A;  3TCA A;  3TJP A;  2JT4 B;  4RM8 A;  3RT3 B;  2D11 A;  4PYU A;  1V5T A;  1FXT B;  4JQW C;  4WQO B;  2KDE B;  3L0W B;  3VH3 B;  3ZDT A;  1V80 A;  5IAA C;  3M63 B;  2O6V B;  4MH0 E;  5L95 C;  2HE7 A;  3L13 A;  4W9G A;  2DYO A;  1KJT A;  2AEH A;  2V1Y A;  4X57 B;  2MP2 A;  2ZPY A;  4JL9 A;  4IG7 B;  1LQB A;  2KD0 A;  4LJO B;  2LI5 A;  2O2V B;  4ANW A;  2XK5 A;  4DHJ B;  4W9D A;  4ICU A;  1WRD B;  5EDS A;  5J17 A;  3U30 A;  4F8C B;  2M8S A;  3QJZ A;  3R3M A;  3AUL A;  4G3X B;  4IUM B;  1ZKH A;  3A9J B;  3W1S C;  2FCM A;  3WAM A;  2KNB A;  2KFK B;  2KWC A;  2LRU A;  3QCA A;  2IYD B;  2DHZ A;  3TBL D;  1ZW7 A;  2M1M A;  2FNJ B;  2KHW B;  2BYF A;  3UIN B;  4G50 A;  5LXH A;  3AU5 A;  3Q3F A;  3QQ8 B;  3M62 B;  3R66 C;  1XD3 B;  2KJR A;  3MJW A;  1RAX A;  2KO3 A;  4F7Z A;  2M17 A;  3MTN B;  2AL3 A;  3V6C B;  2JPH A;  1WJN A;  4K81 A;  2NBW B;  4MSQ B;  2N9P C;  2M0X A;  2IO1 B;  2MBB B;  2NVU I;  3KUD B;  4GB9 A;  2KXJ A;  3A4S C;  4NPN A;  4ZRJ A;  3SDL C;  3UF8 A;  3VUX A;  2KMA A;  2PEA A;  2KJ6 A;  4FAD A;  1UZX B;  2KC1 A;  3HM3 A;  4MEL A;  4BKG A;  4IM3 A;  1NDD A;  2KTR A;  2PE9 A;  4LDT B;  4DDG D;  1WJ4 A;  4BFR A;  4IWP A;  1NI2 A;  3VUY A;  3PLU A;  2DZK A;  2L00 B;  2GBR A;  2J0K A;  3K9P B;  3ZNG C;  1JRU A;  2RR9 A;  2L3Z A;  4IM0 A;  2N9E B;  5CX3 A;  2OOB B;  3OAW A;  2HD5 B;  4KSL C;  4MGK E;  4NQK E;  3ZNZ B;  3K9O B;  1J19 A;  2NR2 A;  5DCN A;  1SGH A;  3A4R A;  4FJY A;  4WJO A;  5LLI A;  2LVP A;  4KVG B;  4IWQ A;  3PRE A;  3PRP B;  1J0G A;  3QA8 A;  1ISN A;  1RLF A;  1A5R A;  1WFY A;  2IO0 B;  2L76 A;  2IY0 B;  3HM6 X;  1WYW B;  4ICV A;  2D3G A;  2PE6 B;  1J8C A;  2G45 B;  4PS8 A;  3SD5 A;  3I3T B;  2D07 B;  1XQQ A;  2LGX A;  4F1S A;  2KWU B;  1WX9 A;  3V62 A;  2CHZ A;  3DCG A;  4MEM A;  4MGY E;  2AWT A;  2FCN A;  4CHK A;  4G11 A;  4XX5 A;  3ZKJ C;  2KLG A;  3PLV A;  1Q1O A;  2BWE S;  1S3S G;  2IZV B;  2WYQ A;  3A1Q B;  4HCN B;  4W9I A;  4DK5 A;  3UQB A;  2HTH A;  3SU8 X;  2MA9 B;  2MWS B;  3WA0 A;  1R4N I;  3ZLZ A;  5CHF A;  4KZC A;  5FR6 A;  4PYZ A;  3KVF B;  4AOF A;  3CMM B;  3EC8 A;  2MSE D;  2BGF A;  3ZTC A;  3Q3J A;  1WZ0 A;  5DPR A;  3CST A;  2MW5 A;  2MX2 A;  1LXD A;  1IPG A;  1PQS A;  1UBQ A;  2XEW A;  1TZ1 A;  2N4F A;  4HXD A;  1C3T A;  1WI0 A;  4LCD E;  1EF5 A;  2DEN B;  2L7R A;  4KIK A;  2KJH B;  3X23 A;  3ZW3 A;  3A9K A;  2ZZP B;  4KZ0 A;  1Q5W B;  1OEY A;  4M8N A;  3VVW B;  5BO4 B;  3B08 A;  3UIO B;  2XBB C;  1P98 A;  4DBG A;  3GZN I;  2GBM A;  2Y5B B;  4KDL B;  3RUL A;  2RD0 A;  3H7P A;  3V60 A;  2K8C A;  3PT2 B;  4IM2 A;  4FN2 A;  2KDF B;  4ZDV A;  4AJW A;  1UGM A;  4HPM B;  2O6V D;  4E71 A;  1E7U A;  1MG8 A;  3NY5 A;  2PPH A;  3VQI A;  1WGY A;  2FCS A;  5KHO A;  3CSF A;  1S1Q B;  2V3S A;  4EKU A;  2N7D A;  1YJ1 A;  4MJS B;  5J2R A;  4ASW C;  3WAL A;  3VFK A;  1L7Y A;  1WR6 E;  1EF1 A;  2MLB A;  2CR5 A;  4DHJ D;  2KWV B;  2KDB A;  4I6L B;  5D7G A;  2FAZ A;  4A20 A;  4HDQ A;  2LJ5 A;  4BBN C;  4ANX A;  3WIM A;  3CF6 E;  1KOT A;  4J6I A;  1V86 A;  2DAJ A;  3OLM D;  5DPS A;  5HKH A;  2JZ3 B;  3VHT C;  1F9J A;  1EO6 A;  1YD8 U;  3H1U A;  2L8J A;  3KW5 B;  2DX5 B;  2ZCC A;  2KZR A;  3QAR A;  4PS3 A;  4HLE A;  2I1J A;  5DPT A;  4B9K A;  3VH4 B;  2IO2 B;  3UQA A;  3QHT A;  4EZK A;  2Z59 B;  2LVQ A;  2J7Q B;  4M8M A;  4W9H A;  1WGG A;  4W9F A;  3ZDM C;  1GG3 A;  1WX7 A;  2WDT B;  2EKE C;  3APF A;  3DPD A;  3PTF C;  3JSV A;  3MHS D;  5JHB A;  2LGY A;  2D2Q A;  2D10 A;  3ZIM A;  3WAO A;  1AAR A;  4IW0 A;  4LDT D;  4EZL A;  3D32 A;  3IG3 A;  2BF8 B;  3APD A;  4GOC A;  5G2N A;  2C9W B;  3ML9 A;  2NCN A;  4I6N B;  3L08 A;  1E8Z A;  1HE8 A;  2DYM A;  4WWO A;  1E90 A;  2ZVN A;  3ONS A;  2FUH B;  4K7W A;  1P3Q U;  1EUV B;  2JWZ A;  2O6V A;  3AI5 A;  4K7S A;  2JRI B;  2MBH A;  3L16 A;  2FCQ A;  4E3C A;  1YX5 B;  1V6E A;  1YIW A;  2CS4 A;  3NHE B;  1ZGU B;  5C23 A;  3ALB A;  1E8W A;  3U7D A;  2O2V A;  1Z2M A;  4HVB A;  3PPA A;  2L0F A;  1KM7 A;  2KTF A;  2G4D B;  4M0W B;  4KDI C;  1P1A A;  1P0R A;  3A9J A;  2K1F A;  3H6N A;  3NS8 A;  3PS6 A;  1L2N A;  2KFK A;  4MGZ E;  2N9X A;  1UD7 A;  2OJR A;  2N1V A;  3NOB A;  1UEL A;  1WJ6 A;  1BT0 A;  3TIX A;  2LXC A;  3DQV A;  4GMV A;  3R7Q A;  5C1Z A;  1I42 A;  1YX6 B;  4GDK B;  2K39 A;  3A33 B;  5DPW A;  1GC7 A;  4JIO U;  1P9D U;  3ZUN A;  2ZCB A;  5TR5 A;  4TV3 A;  4FUL A;  3BIN A;  3EFU A;  3M3J A;  4II3 B;  3N32 A;  4NAW B;  2CHW A;  1WMH B;  2NPT B;  5E6O A;  3QK0 A;  5AEK B;  2YLM A;  4W9K A;  3ENE A;  3C0R B;  3KUZ A;  2UWQ A;  3PV1 A;  4BKS D;  4GU2 A;  4CO7 A;  5D2M B;  4W9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...