3PGEA

Structure of sumoylated pcna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
173
structure length
172
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of SUMO-Modified Proliferating Cell Nuclear Antigen.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords SUMO-modified proliferating cell nuclear antigen
total genus 28
structure length 172
sequence length 173
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pgeA01
3.10.150.20 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III; Chain A, domain 2 3pgeA02
3A4RA 1J19A 2CHZA 2FCSA 3M62B 1E7UA 4W9GA 1MG8A 4NAWA 1KM7A 4URKA 3KUZA 2BYEA 2MSED 1YX5B 2BYFA 3U30A 2K8BA 2GBJA 3VTWA 1Q1OA 3RT3B 2KZRA 4XX5A 2KWUB 2EKEC 3VUXA 1WZ0A 2NBVB 2LRWA 1ZGUB 1GC7A 3B0AA 2KX0A 3TMPB 4YL8A 4ICUA 2Z0EB 1EUVB 4E71A 2JF5A 3A9KB 3DBHI 5G2NA 2DYMA 3R66C 2DX5B 4WQOB 1E5WA 2IO3B 4JIOU 4AWJA 2FIDA 4GB9A 2WDTB 4HPLB 2MCNB 3A9JA 4GSWA 1E90A 1WM3A 3CF6E 4JLCA 1YX6B 4EKUA 2O6VA 2LXCA 1SE9A 1UBIA 2IZVB 2N7EA 3PSEB 1WR1A 2KFJA 3N30A 1EF1A 4TQ1A 4KV2A 3JW0X 1T0YA 3TIXA 2GBRA 3DOWA 4HVBA 1GJZA 4IWOA 2LASA 4KIKA 5DPWA 3ZTDA 3ZW3A 3I3TB 4HWIB 4W9KA 1V6EA 1WYWB 2DENB 2K8CA 2AWTA 4FA6A 3H7PA 4HDQA 4FJVB 2K1FA 3UF8A 3NZSA 4E74A 1XQQA 1Y8RC 3IBEA 4KSLC 1E8XA 3WIMA 3L13A 4E3CA 3DVGX 3PTFC 2FCQA 1YQBA 4DBGA 4P7IA 1RAXA 4RM9A 1KJTA 2KNBA 2ZNVB 4KZCA 2C9WB 1UELA 4ANWA 4FADA 4OVVA 2RPQA 3B08A 5G55A 4GDLA 3DDCB 4K7WA 2FIFA 2MBEA 5CHWA 2JZZA 3VH4B 2V4LA 3VUWA 2G4DB 5JH5C 3H1UA 2KMAA 2KDBA 3QC8B 2XK5A 2Z0DB 2ZPYA 2K6DB 4KDLB 4PS7A 4MJSB 3DPDA 4DHJD 1G6JA 4HK2A 3RZFA 1Z5SB 4ANXA 4HXDA 3SU8X 4AUQC 3ML8A 2PE6B 3QX1A 2DAJA 1RLFA 1V5TA 4GDKA 4RMAA 3U8ZA 2GOWA 2WYQA 3JSVA 4HLEA 4ANUA 2IYDB 2AEHA 1WXVA 4DHJB 2D10A 2ZPNA 1YIWA 2LI5A 1VCBA 1P3QU 2MP2B 2AL3A 2PJHA 3WALA 3KYDD 4W9CA 4NPNA 2J0MA 3VTVA 4A3OA 2FCNA 4I6PA 1V80A 2BGFA 3PRMB 2IO0B 2N7DA 1TGZB 3V60A 3WAMA 3IVFA 2C60A 4ZRKA 4K7UA 3C0RB 4LJPB 5IA7A 3UGBB 3A33B 2MLBA 1RFAA 3UQBA 5CHFA 5HKHA 3L0WB 2QHOA 2BF8B 1SIFA 1WXSA 5CX3A 4PYUA 2KMCA 5L83A 1KLVA 1WMHA 4J6IA 5AZFA 2VRRB 3VQIA 3PLUA 2N1VA 2M4NA 4DK5A 3T9LA 2HD5B 2K6QA 2Y5BB 3ZVVA 4M0WB 3RD2A 1BT0A 3CSFA 1UD7A 3V61A 2FUHB 2KX3A 2NCNA 1LXDA 2BKFA 3BY4B 3NZUA 4FJZA 4GU2A 4DWFA 5C1ZA 2LGDA 1IP9A 2MWSB 4NQLB 4EZLA 3DBLI 3OLMD 3DVNU 3ZUNA 4LDTD 3W1YA 4A20A 3PV1A 2N4FA 3PT2B 4A3PA 1WI0A 1V49A 2KLGA 3VXWA 3UIOB 4GOCA 4MEMA 2PPHA 1P98A 3OJ4B 3APDA 3ONSA 3WAPA 3NOBA 4X57B 1WH3A 4JQWC 1I35A 1M94A 3ZKJC 2KTRA 4MELA 2MA9B 4NNJB 4TQ0A 2A5UA 4HDOA 3NY5A 2DZMA 3HM6X 2ZCBA 3RCZA 3PVLA 5C23A 2Z59B 4NQKE 4ZDVA 2KDEB 2DYBA 4LJOB 1OTRB 4MM3A 4MSQB 2K25A 2KFKB 3PZDA 1WX7A 3N3KB 4II2B 5JHBA 2DZJA 3QAQA 4AJWA 3ZNZB 4N9F4 3SDLC 1UH6A 1WXMA 2G45B 4MDKE 4M8NA 3WA0A 4BOZB 4MGZE 1WGYA 4FBJB 1V5OA 3QHTA 3QQ8B 5D6JB 3R7QA 1P0RA 2D2QA 2JPHA 2LD9A 1WX9A 2DAFA 4G11A 4BVUC 3WAOA 4DHZE 2MP2A 2C5LC 2GBMA 2N1WA 2BWES 4F1SA 5AZGA 3ZDTA 1WR6E 5D2MB 3L0XB 2GMIC 3JSVB 1E8WA 1WJUA 2BYVE 2FNJB 4AOFA 4M8MA 2IBIB 2GBNA 3X0WA 3PRPB 4W9HA 3RZWC 2ZVNA 2M17A 4WJOA 2KHWB 3UQAA 2JUOA 2EMTA 2L76A 2NPTA 3ZNGC 2MBQA 1J8CA 2ZNVC 3ENEA 1ISNA 1NDDA 2LUEA 4JL9A 2N9XA 1V81A 4G3XB 3H7SA 4PS3A 4G50A 3ZO5B 1WJ6A 3ZNID 3UINB 3EECA 2DHZA 4KIKB 3HHMA 2EMSA 3PGEA 1WGDA 3PREA 4IC7B 5KHOA 4ASWC 1OGWA 1NI2A 1WF9A 4BKSA 2KJ6A 2JRIB 3BINA 2O6VB 3K9PB 4ZRIA 2BPSA 4EUTA 4W9FA 4B9KA 5EDSA 1UZXB 2I1KA 3PHWB 4PYZA 2XEWA 3A1QB 2RD0A 2XBBC 2V1YA 4DXAB 5J17A 3W1SA 4MJSA 3MTNB 3AU5A 2R2QA 2XK5B 3DVGY 2M1MA 4F7ZA 2N9EB 5DPSA 3EFUA 4FN2A 2NBUA 3KH0A 2KJHB 4WWOA 1OEYJ 2D11A 3QWZB 1IPGA 2J0KA 4MGIE 2J7QB 3L16A 4IM0A 1V86A 5L95C 1WIAA 5J18A 2W9NA 4KSKC 3PS6A 2KWCA 3VAWA 2K8HA 3ML9A 1K8RB 2KANA 3TJPA 4NJ7A 4TV3A 3ZTCA 3KUCB 2RR9A 4K1RB 2KC2A 1ZW7A 2MQJA 1L2NA 1PQSA 1L7YA 2KQSA 2O2VB 2CR5A 1YD8U 2I1JA 2D3GA 4W9DA 3AULA 1HE8A 3EC8A 5D7GA 3X23A 2NPTB 4GDKB 1RRBA 5CTRC 4WAAA 1WJ4A 3K9OB 3S2AA 1WRDB 4FJYA 2MBOA 2OJRA 1WE7A 2HE7A 4EZKA 2FAZA 4GN1A 2D07B 3L17A 1WY8A 3VH3B 4NY0A 3LJ3A 2JT4B 3OAWA 2KLCA 3L54A 5LLIA 5JHAA 1D3ZA 2C7HA 1U4AA 3QK0A 2G4SA 1Z2MA 1FXTB 3AXCA 4IWQA 2PE9A 4EEWA 2NBWB 1WXAA 2DZKA 3VTUA 2MRPA 4BBNC 3U7DA 2HJ8A 4EOYA 4PS8A 2LVOA 4GMVA 2ASQA 4II3B 4W9IA 5JZEB 3VVWB 3RULA 3IFWB 4IUMB 4NAWB 1GC6A 1P1AA 1YJ1A 2WX1A 4WWPA 4DDGD 1KOTA 2DYOA 3W1SC 3LDZE 1XT9B 2CHXA 3GOEA 2KFKA 1E8ZA 4ZRJA 1C1YB 1H8CA 3H6NA 3PLVA 1VD2A 2WWZA 2NS5A 2KJRA 3MJWA 1QZEA 2KC1A 4GGQA 2JWZA 2KDIA 3VHTC 2KD0A 2LGYA 1UBQA 2B3AA 4IG7B 5AZHA 3M63B 2PEAA 4HJKA 3D32A 3HK0A 2V3SA 1LFDA 4EFOA 1WGHA 2WX0A 3TL5A 3ZRFA 1IYFA 3DVNV 1Q0WB 4TUUA 4MGYE 5DPRA 3VFKA 3KUDB 4W9LA 3WANA 4BKGA 3QJZA 3APFA 2KTFA 3H9DA 2CU1A 3NS8A 3TBLD 3B1LX 4F8CB 1R4MI 2IO1B 2L8JA 1SGHA 3JVZX 4K81A 4BBNF 4EZJA 4HPMB 2ZCCA 3ECIA 3R7RA 3DBRI 2KDFB 4G0NB 4HCNB 3HM3A 4IW0A 2UYZB 2L7RA 3VUYA 1TZ1A 1GUAB 2K39A 3V62A 1V9JA 5KHQA 4GIVA 4ANVA 2LWPA 2JRHA 2UWQA 3APCA 3ZIMA 1F9JA 5IAAC 1WMHB 3SD5A 4BFRA 4OVUA 4RM8A 1V2YA 4GXBA 4MSMB 3VDZA 4K7SA 2L0TA 2CKHB 2C7MB 2OOBB 1WM2A 2KVRA 2FCMA 2JY6A 2O6VD 2KOXA 1WJNA 3DBSA 2MBBB 3A4SC 1EF5A 1WE6A 1EO6A 4NJ6A 1OQYA 2DZIA 1C3TA 3M95A 3DCGA 3Q3JA 1X1MA 5LXIB 5GMVA 1TTNA 2KQ7A 1LM8B 4DDID 4FHJA 1AARA 3AI5A 2MX2A 5D94A 3PRZA 3V6CB 5BO4B 1NBFC 4B6WA 2MBHA 4CHKA 2AYOB 3N32A 3RUIB 3KW5B 2LRUA 2L05A 2BWFA 4KDIC 2RGFA 2HTHA 4BOSC 1XD3B 2LZ6A 3A1QA 2NR2A 4KZ0A 5FR6A 1I42A 5E6OA 5J2RA 2KWVB 2KO3A 2KN5A 4TKNA 3QARA 2J0JA 1GG3A 1JRUA 2L3ZA 4WWNA 2ZJDA 4XZ4A 3Q3FA 3T8MA 2RSUA 2REXA 2KK8A 4HCPB 1CMXB 5DCNA 3QIJA 2CS4A 3A9JB 1WZ3A 3JYUA 4FHKA 1GNUA 4CO7A 2YVCA 3ALBA 4ZYNA 1A5RA 1J0GA 4MH0E 2C7NB 4GDLB 4MGKE 4WJQA 2JZ3B 2L00B 4ICVA 4WJPA 1UGMA 3A9KA 2M8SA 4FLHA 4IWPA 4WJNA 3ZNHB 2LJ5A 2JXXA 5E6PA 2YLMA 2ZZPB 3PPAA 4B95A 3TCAA 4DHZB 5AEKB 2N9PC 2IY0B 5TR5A 3RYTA 2G3QB 2LVQA 1WGRA 3QA8A 4JGHB 4LDTB 2LVPA 2NVUI 3AU4A 3V6EB 4LCDE 3H7PB 2CHWA 4KVGB 5DPTA 2KXJA 4XC2A 2IY1B 3KYCD 3IHPC 1H4RA 1S3SG 3NHEB 3DQVA 2R2OA 4BKTA 2AL6A 1E8YA 3GZNI 2MW5A 3ZRCA 5E6NA 2LGXA 3M3JA 4AJYB 3QCAA 5CHVC 4IM2A 4IM3A 3MHSD 2JVCA 3PHXB 3UIPB 3O65B 4W9EA 2M0XA 5LXHA 2IO2B 2L0FA 2GBKA 3CMMB 4I6LB 4BKSD 1WX8A 2KTRB 3EHVA 3P2BA 2ZVOA 3L08A 2A4ZA 1TBEA 4CYEA 1LQBA 3KVFB 1S1QB 3ZDMC 1WFYA 2ZEQA 3ZLZA 4W9JA 1R4NI 1ZKHA 2O2VA 3CSTA 2KKCA 3L10B 3OJ3A 2LXAA 4I6NB 3SHQA 4AP4C 3R3MA 3HIZA 3IG3A 1P9DU 4FULA 1OEYA 1WGGA 1E7VA 1Q5WB 2BKRB
chains in the Genus database with same CATH superfamily
3IXSA 3SFDB 2ICIA 4RH6A 4OHJA 1YX5B 2BYFA 2L52A 3U30A 1XLQA 1Q1OA 3RT3B 1FNVA 2KZRA 1L0VB 1GC7A 2H89B 2WXOA 3B0AA 2Y5PA 2K22A 1SJED 5AGVA 3P63A 2DYMA 2IO3B 4JIOU 2FIDA 2LUMA 1WM3A 4EKUA 4TR6A 4KKIA 1EF1A 4TQ1A 1T0YA 2GBRA 1KF6B 4IWOA 2LASA 3ZTDA 1WYWB 2WLBA 3N20C 3MC9A 3UF8A 1JALA 3NZSA 3AEFB 1Y8RC 3P4QB 2GRIA 4M00A 3VR9B 2JXTA 4DBGA 1I4QA 1RAXA 1CZPA 4KZCA 5AUKA 5G55A 1MVKA 4GDLA 2FIFA 2MBEA 2WXHA 4LNIA 3ZGZA 1TZOA 1QILA 4RNAA 5JH5C 2IPKD 3QC8B 1GB1A 2ZPYA 4KDLB 4DHJD 3BVGA 1G6JA 3RZFA 5FKAC 5D3DA 4AS1A 2GOWA 3JSVA 4HLEA 4ANUA 3C19A 2IYDB 3ZJUA 2PJHA 3KYDD 4NPNA 3AMZA 4I6PA 3DHGC 2N7DA 1D5ZC 1VR9A 3DWGC 4K3MA 3UQBA 1NVID 1NI3A 2BF8B 1HTQA 1WXSA 1TS4A 2KMCA 1SF0A 4PNUA 2KN4A 5EE9A 1NYQA 1J7BA 5BYSA 2N1VA 4B0EA 2HD5B 4M0WB 3RD2A 1BT0A 3MFGA 4ARCA 2YEPF 3AEGB 3RNFC 2KX3A 2NCNA 1LXDA 1R4MB 1YN4A 3RNAC 3BVMA 4NQLB 4EZLA 3DVNU 2RDBC 4A20A 2POLA 2KLGA 1V49A 4N98A 4ZYSA 2PPHA 1P98A 3NOBA 1E7PB 4JQWC 1M94A 4MELA 3GE3C 4TQ0A 2BVCA 1YOVB 5I4DA 2DZMA 3HM6X 2JQRB 3PVLA 4ZDVA 2KDEB 4MM3A 2K0PA 2K25A 2KFKB 4II2B 5JHBA 2DZJA 4MDKE 1WGKA 2W82A 3QQ8B 1MJDA 2LHEA 3WCQA 2D2QA 2LD9A 1WX9A 4MJQA 2DAFA 2V3NA 4HJGE 2WXQA 1YMHE 4WAFA 3WAOA 1YN5A 5AH2A 5FVEA 1V8CA 3Q8AA 5D2MB 5H92C 2GMIC 3DWMA 3CIRB 3PRPB 4W9HA 2ZVNA 2M17A 1TJEA 2L76A 2NPTA 1J8CA 3F1VA 4G3XB 3ZO5B 4HRSA 3UINB 3EA6A 1C79A 4WWMA 5KHOA 3PREA 2K5PA 5HHDG 3K9PB 4ZRIA 1UZXB 3IT6B 4PYZA 4K3BA 1UWMA 2XBBC 2V1YA 3MTNB 2M0AA 1JWMD 2R2QA 2R61A 2M1MA 3BZDB 3BIID 1VRAB 4FN2A 4N6EB 3LYYA 4HROA 3KH0A 2KJHB 1KH0A 1IPGA 1QLBB 2W9NA 1E9MA 4KSKC 3IT4B 3PS6A 3ML9A 1K8RB 3TJPA 3KUCB 4RGOS 1FCCC 4K1RB 3Q4JA 1ZW7A 1PQSA 2KQSA 2O2VB 1YD8U 1DYQA 4LNKA 5C3JB 1ZDVA 1HE8A 3EC8A 1CK1A 3S2AA 3D1GA 4M02A 2OJRA 2HE7A 2VH1A 2PTLA 3P4RB 3L17A 4GN1A 4OVZA 3VH3B 3TEZA 5JHAA 4RGNA 2AVTA 1U4AA 3AXCA 4PT5A 3RNBC 4EEWA 5HG2A 3VTUA 1VPKA 4II3B 4LNFA 4M0WA 1YNTE 4IUMB 1GC6A 2WX1A 1FRDA 3B2GA 3TUOA 1XCTL 3H6NA 2WWZA 2NS5A 1N63A 3MJWA 2JWZA 2PLPA 3VHTC 2LGYA 1UBQA 4BZAA 1V1PB 2V3SA 1IBXB 2WX0A 3TL5A 3DVNV 4BKGA 4MGYE 3RPFC 3TEYA 3NVYA 2CU1A 1SE4A 4F8CB 2L8JA 4BBNF 2QDFA 4OVFA 2ZCCA 3ECIA 3QSBB 4YSZB 4HCNB 1C4PA 1TZ1A 1GUAB 1V1OA 5KHQA 1AWDA 1ZUD2 3APCA 2BB6A 1F9JA 2INNE 4BFRA 3N1XC 1DOYA 2C7MB 2OOBB 1WM2A 2JY6A 2KOXA 3FKYA 5C2TB 1DGJA 3ZXVA 3DCGA 4LLGM 1ZPSA 3DHIC 1X1MA 5GMVA 1TTNA 4EE2A 4FHJA 1AARA 2M19A 2MX2A 5D94A 2WXNA 5H8YE 2X8XX 2MBHA 3N32A 2HTHA 3A1QA 2NR2A 4KZ0A 2KN5A 1XCQL 3QARA 5G5HA 4ZHOA 4TSSA 2GB1A 3O13A 1CMXB 3ZJVA 5DCNA 2Y3AA 2CS4A 3A9JB 3JYUA 4FHKA 4XE0A 5HFYA 4CO7A 4WJPA 4IWPA 2BT6A 2JXXA 4DXFA 3AEBB 2YLMA 1EU3A 1F77A 2N9PC 1D4BA 3AB5A 3RYTA 2G3QB 2LVQA 1WGRA 4JGHB 3AU4A 4AQ7A 2VH2A 3H7PB 2CHWA 2KXJA 4LK0M 2IY1B 3IHPC 1C76A 1H4RA 2R2OA 3U4EG 3ZRCA 1TY2A 2BTEA 3M3JA 3MHSD 2FUG1 2JVCA 4OVGA 4W9EA 1ZDXA 2FBWB 3P2BA 2A4ZA 5AGUA 1WFYA 4I6NB 1R4NI 3L10B 1I7HA 2KKCA 3OJ3A 1EM7A 3R3MA 3HIZA 3IG3A 1P9DU 1FCLA 1AN8A 5IN7A 2BKRB 4TR7A 3A4RA 2AQ2B 2FCSA 4W9GA 5EE1A 2MH7A 3Q69A 1KM7A 5IP4D 2MSED 1KLGD 1TKEA 2W54A 1ZXIA 1JWSD 2KAJA 2KYWA 3TMPB 4ACFA 4L1BA 1L4DB 3MHZA 3SEBA 4E71A 2JF5A 3SFEB 3R66C 4WQOB 2MCNB 1E90A 3CF6E 2O6VA 1WR1A 3JW0X 2XN9C 3TIXA 5DPWA 3I3TB 1YQ3B 1V6EA 4FA6A 4FJVB 4E74A 5AH4A 3I9V1 1T0QC 4KSLC 4E3CA 3WIMA 3PTFC 2ON8A 4RM9A 2ZNVB 2HDEA 3L0XA 1SE3A 4A8XC 1ZXHA 3FC4A 3B08A 4YTMB 3KWLA 5CHWA 4XWWA 1M4VA 1T3QA 2K9XA 3E56A 3ZYYX 3MP9A 2XK5A 5BMGA 3Q14C 2K6DB 1Z5SB 3SU8X 4AUQC 3U8ZA 2DAJA 2N7JA 1WSPA 2AEHA 1WXVA 2LI5A 3WALA 4W9CA 1FXAA 2J0MA 2WDVB 1V80A 2BGFA 3WAMA 4UDUC 4N96A 3AE6B 1C9FA 4LJPB 3ABVB 3AEAB 3L0WB 2QHOA 5CX3A 4PYUA 5L83A 1KLVA 2KWDA 2M4NA 4XDDA 1EWYC 2QMTA 3AE7B 3DHHC 3V61A 2BKFA 3BY4B 1T0RC 1C4AA 2AQ3B 2MEKA 2PMVA 2V4IB 1RWSA 3DBLI 1F52A 3PT2B 3PV1A 4MM3B 3VXWA 3UIOB 4GOCA 4OVHA 3OJ4B 3APDA 3WAPA 2FE8A 1WH3A 1HA5A 3RNCC 2KTRA 2ZW0A 2BS3B 4HDOA 4ZRQA 2Z59B 3N1YC 3Q4KA 1OTRB 1EU4A 4MSQB 3AV8A 3AH7A 2OHFA 4AJWA 4N9F4 3SDLC 1WXMA 2N9LA 3QHTA 5TSSA 4K3CA 2JPHA 1ET6A 2J4XA 5GXGB 2WNMA 4DHZE 2MP2A 2C5LC 4F1SA 3ZDTA 1WR6E 3JSVB 1E8WA 1WJUA 2BYVE 2FNJB 2JYTA 4AOFA 1PGXA 4M8MA 2GBNA 3RZWC 1QKZA 4N99A 4WJOA 2KHWB 3UQAA 2EMTA 4US8A 3ZNGC 2MBQA 1XO3A 2ZNVC 1R7SA 3FILA 4G50A 1TY0A 2KVZA 5BMHA 1L5PA 2LJIA 4ITKA 3VR8B 2EMSA 1JQJA 1WF9A 4BKSA 2KJ6A 2O6VB 4EUTA 4W9FA 1FMAD 1BMLC 3PHWB 2D3BA 4C7YA 2XEWA 3BYYB 3W2DA 3W1SA 3AU5A 1HEZE 2N9EB 3EFUA 1ESFA 2Q5WD 3Q3OC 3RNEC 2X38A 4IM0A 5J18A 1MPEA 2KWCA 1UWXA 1UUPA 1JQLA 4NJ7A 4TV3A 3ZTCA 4WURA 2B76B 3NG0A 2NPTB 4GDKB 5CTRC 2HJ1A 4FJYA 2MBOA 1DOXA 4EZKA 3NUHB 2JT4B 4LNNA 4MJRA 2KLCA 4MT5A 2C7HA 4RKIA 3R2TA 1Z2MA 1FXTB 1UF0A 2PE9A 1MG4A 2NBWB 5FK9C 4BBNC 2HJ8A 4PS8A 2MJ3A 4BAXA 5JZEB 4RGTA 3RULA 3IFWB 2SEBD 2J52A 2D3CA 3Q2AC 4MJPA 3C8YA 1KLUD 3LDZE 2CHXA 4ZRJA 2KFKA 5IKCM 3W5UB 3URYA 2KC1A 2PKOA 2KDIA 3B2FA 4YSYB 2CJNA 4IG7B 1XLOA 4HJKA 4A55A 1J7AA 3HK0A 2IJ0A 1WGHA 1B1ZA 1IYFA 5DPRA 3H9DA 3NS8A 2OEDA 1SIJA 2TSSA 1SGHA 3JVZX 4TR8A 3DBRI 2KDFB 2RPVA 3HM3A 4IW0A 2UYZB 1K53A 1V9JA 1CJEA 1LGRA 2LWPA 4TSZA 3ZIMA 3SD5A 4P6VF 4KX6B 1V2YA 4MSMB 3NVZA 2WS3B 3VDZA 1ENFA 2CKHB 5BMIA 2FCMA 1N5XA 1DOIA 3DBSA 3D1EA 1C3TA 3M95A 3Q3JA 2BBCA 5T8IA 2DBYA 3NJTA 2KQ7A 4DDID 2WU2B 3AEDB 3AI5A 4YXDB 3V6CB 5BO4B 3AE4B 2D3AA 3UI3A 1T6BX 4H2AA 2LRUA 1FXIA 3U52E 1V97A 1FPYA 2PVOD 4BOSC 1XD3B 1I42A 2DWQA 5E6OA 1N60A 2L3ZA 3RI7C 1VZ6A 2RSUA 2REXA 3P16A 4HCPB 3TEWA 3AM9A 3Q3NC 3QIJA 1JRPA 1A5RA 1GNUA 2WXLA 3ALBA 4ZYNA 3PZ8A 3I63C 2JZ3B 2L00B 4ICVA 3A9KA 2M8SA 3BYTB 4B95A 5AEKB 4YWGG 2IY0B 3U7ZA 3NVVA 4LDTB 4PNVA 1P7FA 2WXRA 4LNOA 4S0RA 1L0XB 4RGMA 1YN3A 2MHJA 3ZJTA 2AL6A 4HPPA 4AJYB 1ZP0B 3QCAA 1UGJA 4IM3A 1FEHA 3UIPB 3U2SC 3O65B 2M0XA 5LXHA 4J3OD 1VJKA 2GBKA 2YEPB 4YTPB 3EHVA 3GS2A 4CYEA 1FNUA 3RNGC 1ZKHA 2O2VA 4JPSA 2LXAA 4AP4C 1OEYA 1WGGA 2CJOA 1STEA 2KACA 3M62B 3ZQ4A 1MG8A 1FRRA 2L32A 4URKA 2WHIA 2CU3A 2H88B 2K8BA 2PIAA 4C4VA 4XX5A 2KWUB 2EKEC 3VUXA 2LRWA 1ZGUB 2W55A 2KX0A 4YL8A 1IGCA 1C77A 2Z0EB 2BW2A 2WXGA 2BB5A 2DX5B 2NMQA 1C78A 1TS5A 4AWJA 4GB9A 1FNWA 4HPLB 3A9JA 4GSWA 2LXCA 2N7EA 1UBIA 2IZVB 2VZKD 3PSEB 2N0SB 2XNAC 1D5XC 2KQ4X 3ZW3A 4W9KA 3BWUD 1QOAA 2K8CA 5FR3A 2BS4B 1PDXA 4HDQA 1IBXA 1E8XA 2N9KA 3I5JC 1YQBA 4P7IA 4K3SA 1QOGA 2C9WB 1I4HA 3D1FA 3J9CA 2L83A 1FFVA 1A70A 3RB9A 2INDC 5G5GA 2K3UA 2JZZA 2QC8A 1N6ZA 2V4LA 3NRZA 4KKJA 2G4DB 4IDIA 1UNNA 3H1UA 2KMAA 4MACA 1HTOA 3ETRA 4XWTA 3AN1A 1I4XA 2SAKA 4MJSB 4PS7A 4QAYA 1MHXA 1FM0D 4HK2A 2BYTA 2PE6B 3QX1A 1V5TA 2WYQA 4D2KA 4DHJB 2D10A 2ZPNA 2MP2B 1VCBA 1P3QU 3MC8A 2AL3A 3PGEB 3VTVA 2FCNA 4N95A 3LXFA 1RM6C 3PRMB 2JX5A 1TGZB 2C60A 4ZRKA 2WU5B 3VRBB 4C7ZA 3T3NA 2MLBA 4C56C 5HKHA 1SIFA 5AZFA 1TKGA 3VQIA 2QCZA 4DK5A 2LMCA 2ZW1A 5IOIA 1F2RI 4C00A 2K6QA 3ZVVA 4DWFA 3NZUA 4FJZA 2MWSB 5MPOA 2QJLA 2N4FA 4A3PA 1WI0A 3ZXRA 1TS2A 3ONSA 3ZKJC 4NNJB 2A5UA 3MC0B 3NY5A 4OZAA 4YSXB 4XYCA 3RCZA 2DYBA 4C80A 1WX7A 2WDRB 3ZNZB 1UH6A 2G45B 4M8NA 4BOZB 4MGZE 1L0YB 1WGYA 1NEKB 4FBJB 1V5OA 3DBHB 4TMAB 1JWAD 4XGAB 2LHDA 2BS2B 4G11A 4RFBA 4ARIA 4N97A 4CQNA 2N1WA 2BWES 4IKGA 3HVZA 1MHHE 3L0WA 5LNK1 3W9CB 3FAHA 2JUOA 3ENEA 1NDDA 2LUEA 4JL9A 4PS3A 1PUTA 2N9XA 1FIQA 3H7SA 1JROA 3H8HA 3ZNID 2DHZA 1F1HA 1I4PA 1WGDA 1OGWA 1T0SC 2INPE 1OQRA 4KGRA 3BINA 2BPSA 5EE3A 5EDSA 4K3LA 2J53A 1L6UA 2INCC 3A1QB 4O1NA 2XK5B 4F7ZA 5DPSA 2NBUA 4WWOA 4DXGA 4ZOHC 3QWZB 2J0KA 3L16A 1V86A 5L95C 1HZ6A 3MJ5A 1FD6A 1FFUA 4REZA 1EWCA 5BYRA 2KC2A 2MQJA 1L2NA 1XXGA 4OZCA 1F2RC 2CR5A 2D3GA 3X23A 4P1CC 4WAAA 1WJ4A 3RN9C 2JU6X 1WRDB 4N9AA 4RF1A 3Q3MC 1GPXA 3LJ3A 1XLPA 5LLIA 2LFIA 2QIEB 1WXQA 1KRHA 1WXAA 4HEA1 2MRPA 3U7DA 1ZE3D 2LGIA 4GMVA 4W9IA 3VVWB 1HZ5A 4NAWB 1P1AA 1TS3A 2DYOA 3P42A 3W1SC 1XT9B 3GOEA 2QILA 3KQ4A 1E8ZA 2I2YA 1PGBA 4P1BC 1VD2A 2KJRA 1QZEA 4GGQA 1OFFA 1PYWD 2KD0A 1I4GA 2PEAA 3DBLB 1N62A 1LFDA 1SXTA 1Q0WB 4R3DA 4TUUA 4W9LA 2J42A 3APFA 5HI1A 3AE3B 1R4MI 2KDMA 2IO1B 5E6JA 4K81A 4HPMB 3R7RA 4G0NB 2WXPA 3AE9B 3V62A 2I38A 1ACCA 3IAM1 4N94A 4GIVA 4ANVA 4WIPA 4K3OA 1RFKA 2UWQA 1WMHB 2D5GA 1JMLA 1PFDA 3KLSX 2L0TA 3P4SB 2O6VD 1TYGB 4HKQA 1WRIA 4JWUC 2NTSA 1EO6A 4N58A 2DZIA 4L23A 1FO4A 3Q4LA 1OK7A 2JZPA 4PNWA 2V3PA 4CHKA 1T5XD 3RUIB 3KW5B 3P1MA 2BWFA 4KDIC 2IDYA 1VLBA 2RGFA 5J2RA 2KWVB 1MMIA 2KO3A 4TKNA 3E9SA 1GG3A 2V0GA 2KK8A 2V9HA 1WZ3A 1J0GA 4MH0E 4MGKE 4WJQA 1QOFA 1ZOYB 3V3XA 2ZZPB 1SB3C 3PPAA 1F0ZA 5TR5A 1GOZA 3V6EB 1HXYD 4MH8A 4JX1C 1Q10A 1E8YA 1I4RA 5E6NA 2LGXA 2VZKB 5CHVC 2IO2B 2L0FA 3CMMB 4I6LB 2GLSA 4BKSD 2ZVOA 1BUIC 3L08A 2E6XA 1S1QB 1N61A 4B0MA 3CSTA 1E10A 3SHQA 3GP7A 2WDQB 2AQ1B 2KTFA 1Q5WB 4ASWC 5D3IB 1J19A 2CHZA 1E7UA 2WXKA 4NAWA 1V1PA 2G9HD 3KUZA 2BYEA 3VTWA 2GBJA 3GZNB 3L10A 1WZ0A 2NBVB 3TEXA 1SSNA 1HQRD 3VRAB 4ICUA 4DQOC 1EUVB 3A9KB 2PW9A 4NZLB 3DBHI 5G2NA 1QOBA 1E5WA 2EELA 2KT7A 2WDTB 2Z8LA 4JLCA 1YX6B 2IGHA 1SE9A 2KFJA 3KWVA 3N30A 4KV2A 4S17A 3DOWA 4HVBA 3T3OA 1GJZA 3GB1A 3R2IA 4KIKA 4HWIB 2DENB 1SEBD 2AWTA 3BK1A 3H7PA 3Q8FA 4KGTA 2K1FA 1XQQA 3IBEA 3L13A 3DVGX 2FCQA 1KJTA 2KNBA 5JXVA 1UELA 4ANWA 2G1EA 3N1ZC 2JYEA 4FADA 4OVVA 2RPQA 4USAA 3DDCB 4K7WA 3VH4B 3VUWA 3CWIA 1D6EC 2KDBA 2JSVX 2Z0DB 1GB4A 3DPDA 3BEPA 3V05A 4ANXA 4HXDA 1UNSA 3ML8A 1RLFA 4GDKA 1Y56A 4RMAA 3AE8B 3R8BA 1YIWA 4A3OA 1P7EA 2IO0B 3V60A 3HRDD 3IVFA 4YTNB 4K7UA 3C0RB 5IA7A 3NS1A 3UGBB 2HTME 3A33B 4A90A 1RFAA 5CHFA 2WXIA 5EE0A 2WXMA 1WMHA 4J6IA 1TT5B 2VRRB 3PLUA 3T9LA 2Y5BB 4C4VB 1L6VA 3OG5A 3CSFA 1UD7A 2FUHB 5C1ZA 4GU2A 4Q2JA 1IP9A 2LGDA 3LB8C 1L4ZB 4N59A 3OLMD 1ET9A 4OZBA 1K50A 1N5WA 1YJJA 3ZUNA 4LDTD 3W1YA 1OQQA 4ZRPA 4MEMA 4JE3B 1B9RA 4X57B 1I35A 1KFYB 3PZ7A 2MA9B 1K52A 3DBRB 2ZCBA 3N9YC 5C23A 4NQKE 3Q8BA 4LJOB 1JWBD 3PZDA 2W3SA 3AECB 3N3KB 3QAQA 1JWUD 3WA0A 4GLSC 5D6JB 3R7QA 1P0RA 3AE1B 2LGSA 1MFWA 4US9A 1E0ZA 4BVUC 5FRQA 2GBMA 5AZGA 3L0XB 2E3TA 2IBIB 3X0WA 1AYFA 2DLBA 1ISNA 1VZ7A 1V81A 1QF6A 3B9JA 1WJ6A 4K74A 3EECA 4KIKB 1XF5L 3HHMA 3PGEA 4IC7B 3NVWA 3EGRA 1NI2A 3FILB 2JRIB 3SR6A 1RYJA 2QEJC 4B9KA 2WQYB 2I1KA 1VDVA 2DNFA 2XURA 2RD0A 5J17A 4DXAB 4MJSA 2UU7A 2JWUA 1QQRA 3DVGY 1OEYJ 2D11A 3HUIA 4MGIE 2J7QB 1TIFA 2M56B 2WGSA 1WIAA 4FXCA 1WWTA 2IGDA 3VAWA 2K8HA 4RF0A 2KANA 3W5VB 2RR9A 1L7YA 3L4PA 2I1JA 1JW9D 4W9DA 2MJEA 3AULA 4OW0A 5D7GA 1RRBA 3K9OB 2MJDA 4JWSC 1WE7A 4K3QA 5BYQA 2FAZA 2D07B 1WY8A 4NY0A 3RFZB 2W3RA 1XLNA 3L54A 3OAWA 1D3ZA 1IGDA 3QK0A 2G4SA 3TSSA 1J7CA 4IWQA 1WYGA 2WP9B 2DZKA 4EOYA 2LVOA 2PVGC 1GAQB 2ASQA 4P16A 1TKYA 4HKZE 1YJ1A 4WWPA 4DDGD 4A6QA 1KOTA 2EKIA 4PK1A 1C1YB 1H8CA 2AX5A 3PLVA 4L2YA 2GI9A 3OWEB 1YJIA 1K51A 3I57A 2B3AA 1E6EB 5AZHA 3M63B 2Y5CA 3D32A 4K3KA 2LEKA 4EFOA 3ZRFA 3VFKA 3WANA 3KUDB 2ONQA 3QJZA 5AUIA 2RDGA 2WXFA 4WQMA 4IOIE 3B1LX 1VZ8A 3TBLD 3QSBA 3HVDA 1D5MC 1SBBB 2QSDA 4EZJA 3BVZA 1BXTA 2L7RA 1NENB 3VUYA 2K39A 3T0PA 4S3IA 2AWAA 2JRHA 3BK2A 4K3PA 5IAAC 4OVUA 3P4PB 4RM8A 3IAS1 3AE2B 4GXBA 2L1AA 4K7SA 2KVRA 4YT0B 1WJNA 1MI0A 3AEEB 2MBBB 3EUB2 3A4SC 1EF5A 1WE6A 4NJ6A 1OQYA 4LTUA 3PO0A 5LXIB 2BQQA 4A9AA 1LM8B 1NYRA 3PRZA 1NBFC 4WH4A 4B6WA 2AYOB 3Q8CA 2L05A 1C4CA 3NZ3A 1R4NB 2IGGA 1KTKA 2LZ6A 1JCKB 5FR6A 4K3RA 2NTTA 2RDHA 2J0JA 1JRUA 2KMMA 2ACZB 2RMMA 2ZJDA 4WWNA 3Q3FA 4XZ4A 3T8MA 1LO5D 4M01A 2YVCA 2OJWA 3AE5B 3Q6BA 2C7NB 4GDLB 1UGMA 4FLHA 2WXJA 4WJNA 3ZNHB 2LJ5A 5E6PA 3TCAA 4DHZB 1JQ4A 4ZHPA 1SE2A 3Q8EA 4KGSA 1IUEA 1ROEA 3QA8A 2LVPA 2NVUI 4LCDE 4KVGB 5DPTA 4XC2A 3KYCD 3GE8C 1YQ4B 1S3SG 3NHEB 1XEEA 3DQVA 4BKTA 3GZNI 2MW5A 4NJCA 4XDCA 5IO9A 4RCOA 4IM2A 3PHXB 1SJHD 4TRTA 1PGAA 3EFCA 1WX8A 1AW7A 2KTRB 1TBEA 3PWEA 1CQVA 3KVFB 1QT9A 3ZDMC 2ZEQA 3ZLZA 4W9JA 4NAMA 4FULA 1LQBA 1E7VA 3RMKC
chains in the Genus database with same CATH topology
3A4RA 1J19A 2CHZA 2FCSA 3M62B 1E7UA 4W9GA 1MG8A 4NAWA 1KM7A 4URKA 3KUZA 2BYEA 2MSED 1YX5B 2BYFA 3U30A 2K8BA 2GBJA 3VTWA 1Q1OA 3RT3B 2KZRA 4XX5A 2KWUB 2EKEC 3VUXA 1WZ0A 2NBVB 2LRWA 1ZGUB 1GC7A 3B0AA 2KX0A 3TMPB 4YL8A 4ICUA 2Z0EB 1EUVB 4E71A 2JF5A 3A9KB 3DBHI 5G2NA 2DYMA 3R66C 2DX5B 4WQOB 1E5WA 2IO3B 4JIOU 4AWJA 2FIDA 4GB9A 2WDTB 4HPLB 2MCNB 3A9JA 4GSWA 1E90A 1WM3A 3CF6E 4JLCA 1YX6B 4EKUA 2O6VA 2LXCA 1SE9A 1UBIA 2IZVB 2N7EA 3PSEB 1WR1A 2KFJA 3N30A 1EF1A 4TQ1A 4KV2A 3JW0X 1T0YA 3TIXA 2GBRA 3DOWA 4HVBA 1GJZA 4IWOA 2LASA 4KIKA 5DPWA 3ZTDA 3ZW3A 3I3TB 4HWIB 4W9KA 1V6EA 1WYWB 2DENB 2K8CA 2AWTA 4FA6A 3H7PA 4HDQA 4FJVB 2K1FA 3UF8A 3NZSA 4E74A 1XQQA 1Y8RC 3IBEA 4KSLC 1E8XA 3WIMA 3L13A 4E3CA 3DVGX 3PTFC 2FCQA 1YQBA 4DBGA 4P7IA 1RAXA 4RM9A 1KJTA 2KNBA 2ZNVB 4KZCA 2C9WB 1UELA 4ANWA 4FADA 4OVVA 2RPQA 3B08A 5G55A 4GDLA 3DDCB 4K7WA 2FIFA 2MBEA 5CHWA 2JZZA 3VH4B 2V4LA 3VUWA 2G4DB 5JH5C 3H1UA 2KMAA 2KDBA 3QC8B 2XK5A 2Z0DB 2ZPYA 2K6DB 4KDLB 4PS7A 4MJSB 3DPDA 4DHJD 1G6JA 4HK2A 3RZFA 1Z5SB 4ANXA 4HXDA 3SU8X 4AUQC 3ML8A 2PE6B 3QX1A 2DAJA 1RLFA 1V5TA 4GDKA 4RMAA 3U8ZA 2GOWA 2WYQA 3JSVA 4HLEA 4ANUA 2IYDB 2AEHA 1WXVA 4DHJB 2D10A 2ZPNA 1YIWA 2LI5A 1VCBA 1P3QU 2MP2B 2AL3A 2PJHA 3WALA 3KYDD 4W9CA 4NPNA 2J0MA 3VTVA 4A3OA 2FCNA 4I6PA 1V80A 2BGFA 3PRMB 2IO0B 2N7DA 1TGZB 3V60A 3WAMA 3IVFA 2C60A 4ZRKA 4K7UA 3C0RB 4LJPB 5IA7A 3UGBB 3A33B 2MLBA 1RFAA 3UQBA 5CHFA 5HKHA 3L0WB 2QHOA 2BF8B 1SIFA 1WXSA 5CX3A 4PYUA 2KMCA 5L83A 1KLVA 1WMHA 4J6IA 5AZFA 2VRRB 3VQIA 3PLUA 2N1VA 2M4NA 4DK5A 3T9LA 2HD5B 2K6QA 2Y5BB 3ZVVA 4M0WB 3RD2A 1BT0A 3CSFA 1UD7A 3V61A 2FUHB 2KX3A 2NCNA 1LXDA 2BKFA 3BY4B 3NZUA 4FJZA 4GU2A 4DWFA 5C1ZA 2LGDA 1IP9A 2MWSB 4NQLB 4EZLA 3DBLI 3OLMD 3DVNU 3ZUNA 4LDTD 3W1YA 4A20A 3PV1A 2N4FA 3PT2B 4A3PA 1WI0A 1V49A 2KLGA 3VXWA 3UIOB 4GOCA 4MEMA 2PPHA 1P98A 3OJ4B 3APDA 3ONSA 3WAPA 3NOBA 4X57B 1WH3A 4JQWC 1I35A 1M94A 3ZKJC 2KTRA 4MELA 2MA9B 4NNJB 4TQ0A 2A5UA 4HDOA 3NY5A 2DZMA 3HM6X 2ZCBA 3RCZA 3PVLA 5C23A 2Z59B 4NQKE 4ZDVA 2KDEB 2DYBA 4LJOB 1OTRB 4MM3A 4MSQB 2K25A 2KFKB 3PZDA 1WX7A 3N3KB 4II2B 5JHBA 2DZJA 3QAQA 4AJWA 3ZNZB 4N9F4 3SDLC 1UH6A 1WXMA 2G45B 4MDKE 4M8NA 3WA0A 4BOZB 4MGZE 1WGYA 4FBJB 1V5OA 3QHTA 3QQ8B 5D6JB 3R7QA 1P0RA 2D2QA 2JPHA 2LD9A 1WX9A 2DAFA 4G11A 4BVUC 3WAOA 4DHZE 2MP2A 2C5LC 2GBMA 2N1WA 2BWES 4F1SA 5AZGA 3ZDTA 1WR6E 5D2MB 3L0XB 2GMIC 3JSVB 1E8WA 1WJUA 2BYVE 2FNJB 4AOFA 4M8MA 2IBIB 2GBNA 3X0WA 3PRPB 4W9HA 3RZWC 2ZVNA 2M17A 4WJOA 2KHWB 3UQAA 2JUOA 2EMTA 2L76A 2NPTA 3ZNGC 2MBQA 1J8CA 2ZNVC 3ENEA 1ISNA 1NDDA 2LUEA 4JL9A 2N9XA 1V81A 4G3XB 3H7SA 4PS3A 4G50A 3ZO5B 1WJ6A 3ZNID 3UINB 3EECA 2DHZA 4KIKB 3HHMA 2EMSA 3PGEA 1WGDA 3PREA 4IC7B 5KHOA 4ASWC 1OGWA 1NI2A 1WF9A 4BKSA 2KJ6A 2JRIB 3BINA 2O6VB 3K9PB 4ZRIA 2BPSA 4EUTA 4W9FA 4B9KA 5EDSA 1UZXB 2I1KA 3PHWB 4PYZA 2XEWA 3A1QB 2RD0A 2XBBC 2V1YA 4DXAB 5J17A 3W1SA 4MJSA 3MTNB 3AU5A 2R2QA 2XK5B 3DVGY 2M1MA 4F7ZA 2N9EB 5DPSA 3EFUA 4FN2A 2NBUA 3KH0A 2KJHB 4WWOA 1OEYJ 2D11A 3QWZB 1IPGA 2J0KA 4MGIE 2J7QB 3L16A 4IM0A 1V86A 5L95C 1WIAA 5J18A 2W9NA 4KSKC 3PS6A 2KWCA 3VAWA 2K8HA 3ML9A 1K8RB 2KANA 3TJPA 4NJ7A 4TV3A 3ZTCA 3KUCB 2RR9A 4K1RB 2KC2A 1ZW7A 2MQJA 1L2NA 1PQSA 1L7YA 2KQSA 2O2VB 2CR5A 1YD8U 2I1JA 2D3GA 4W9DA 3AULA 1HE8A 3EC8A 5D7GA 3X23A 2NPTB 4GDKB 1RRBA 5CTRC 4WAAA 1WJ4A 3K9OB 3S2AA 1WRDB 4FJYA 2MBOA 2OJRA 1WE7A 2HE7A 4EZKA 2FAZA 4GN1A 2D07B 3L17A 1WY8A 3VH3B 4NY0A 3LJ3A 2JT4B 3OAWA 2KLCA 3L54A 5LLIA 5JHAA 1D3ZA 2C7HA 1U4AA 3QK0A 2G4SA 1Z2MA 1FXTB 3AXCA 4IWQA 2PE9A 4EEWA 2NBWB 1WXAA 2DZKA 3VTUA 2MRPA 4BBNC 3U7DA 2HJ8A 4EOYA 4PS8A 2LVOA 4GMVA 2ASQA 4II3B 4W9IA 5JZEB 3VVWB 3RULA 3IFWB 4IUMB 4NAWB 1GC6A 1P1AA 1YJ1A 2WX1A 4WWPA 4DDGD 1KOTA 2DYOA 3W1SC 3LDZE 1XT9B 2CHXA 3GOEA 2KFKA 1E8ZA 4ZRJA 1C1YB 1H8CA 3H6NA 3PLVA 1VD2A 2WWZA 2NS5A 2KJRA 3MJWA 1QZEA 2KC1A 4GGQA 2JWZA 2KDIA 3VHTC 2KD0A 2LGYA 1UBQA 2B3AA 4IG7B 5AZHA 3M63B 2PEAA 4HJKA 3D32A 3HK0A 2V3SA 1LFDA 4EFOA 1WGHA 2WX0A 3TL5A 3ZRFA 1IYFA 3DVNV 1Q0WB 4TUUA 4MGYE 5DPRA 3VFKA 3KUDB 4W9LA 3WANA 4BKGA 3QJZA 3APFA 2KTFA 3H9DA 2CU1A 3NS8A 3TBLD 3B1LX 4F8CB 1R4MI 2IO1B 2L8JA 1SGHA 3JVZX 4K81A 4BBNF 4EZJA 4HPMB 2ZCCA 3ECIA 3R7RA 3DBRI 2KDFB 4G0NB 4HCNB 3HM3A 4IW0A 2UYZB 2L7RA 3VUYA 1TZ1A 1GUAB 2K39A 3V62A 1V9JA 5KHQA 4GIVA 4ANVA 2LWPA 2JRHA 2UWQA 3APCA 3ZIMA 1F9JA 5IAAC 1WMHB 3SD5A 4BFRA 4OVUA 4RM8A 1V2YA 4GXBA 4MSMB 3VDZA 4K7SA 2L0TA 2CKHB 2C7MB 2OOBB 1WM2A 2KVRA 2FCMA 2JY6A 2O6VD 2KOXA 1WJNA 3DBSA 2MBBB 3A4SC 1EF5A 1WE6A 1EO6A 4NJ6A 1OQYA 2DZIA 1C3TA 3M95A 3DCGA 3Q3JA 1X1MA 5LXIB 5GMVA 1TTNA 2KQ7A 1LM8B 4DDID 4FHJA 1AARA 3AI5A 2MX2A 5D94A 3PRZA 3V6CB 5BO4B 1NBFC 4B6WA 2MBHA 4CHKA 2AYOB 3N32A 3RUIB 3KW5B 2LRUA 2L05A 2BWFA 4KDIC 2RGFA 2HTHA 4BOSC 1XD3B 2LZ6A 3A1QA 2NR2A 4KZ0A 5FR6A 1I42A 5E6OA 5J2RA 2KWVB 2KO3A 2KN5A 4TKNA 3QARA 2J0JA 1GG3A 1JRUA 2L3ZA 4WWNA 2ZJDA 4XZ4A 3Q3FA 3T8MA 2RSUA 2REXA 2KK8A 4HCPB 1CMXB 5DCNA 3QIJA 2CS4A 3A9JB 1WZ3A 3JYUA 4FHKA 1GNUA 4CO7A 2YVCA 3ALBA 4ZYNA 1A5RA 1J0GA 4MH0E 2C7NB 4GDLB 4MGKE 4WJQA 2JZ3B 2L00B 4ICVA 4WJPA 1UGMA 3A9KA 2M8SA 4FLHA 4IWPA 4WJNA 3ZNHB 2LJ5A 2JXXA 5E6PA 2YLMA 2ZZPB 3PPAA 4B95A 3TCAA 4DHZB 5AEKB 2N9PC 2IY0B 5TR5A 3RYTA 2G3QB 2LVQA 1WGRA 3QA8A 4JGHB 4LDTB 2LVPA 2NVUI 3AU4A 3V6EB 4LCDE 3H7PB 2CHWA 4KVGB 5DPTA 2KXJA 4XC2A 2IY1B 3KYCD 3IHPC 1H4RA 1S3SG 3NHEB 3DQVA 2R2OA 4BKTA 2AL6A 1E8YA 3GZNI 2MW5A 3ZRCA 5E6NA 2LGXA 3M3JA 4AJYB 3QCAA 5CHVC 4IM2A 4IM3A 3MHSD 2JVCA 3PHXB 3UIPB 3O65B 4W9EA 2M0XA 5LXHA 2IO2B 2L0FA 2GBKA 3CMMB 4I6LB 4BKSD 1WX8A 2KTRB 3EHVA 3P2BA 2ZVOA 3L08A 2A4ZA 1TBEA 4CYEA 1LQBA 3KVFB 1S1QB 3ZDMC 1WFYA 2ZEQA 3ZLZA 4W9JA 1R4NI 1ZKHA 2O2VA 3CSTA 2KKCA 3L10B 3OJ3A 2LXAA 4I6NB 3SHQA 4AP4C 3R3MA 3HIZA 3IG3A 1P9DU 4FULA 1OEYA 1WGGA 1E7VA 1Q5WB 2BKRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A4R A;  1J19 A;  2CHZ A;  2FCS A;  3M62 B;  1E7U A;  4W9G A;  1MG8 A;  4NAW A;  1KM7 A;  4URK A;  3KUZ A;  2BYE A;  2MSE D;  1YX5 B;  2BYF A;  3U30 A;  2K8B A;  2GBJ A;  3VTW A;  1Q1O A;  3RT3 B;  2KZR A;  4XX5 A;  2KWU B;  2EKE C;  3VUX A;  1WZ0 A;  2NBV B;  2LRW A;  1ZGU B;  1GC7 A;  3B0A A;  2KX0 A;  3TMP B;  4YL8 A;  4ICU A;  2Z0E B;  1EUV B;  4E71 A;  2JF5 A;  3A9K B;  3DBH I;  5G2N A;  2DYM A;  3R66 C;  2DX5 B;  4WQO B;  1E5W A;  2IO3 B;  4JIO U;  4AWJ A;  2FID A;  4GB9 A;  2WDT B;  4HPL B;  2MCN B;  3A9J A;  4GSW A;  1E90 A;  1WM3 A;  3CF6 E;  4JLC A;  1YX6 B;  4EKU A;  2O6V A;  2LXC A;  1SE9 A;  1UBI A;  2IZV B;  2N7E A;  3PSE B;  1WR1 A;  2KFJ A;  3N30 A;  1EF1 A;  4TQ1 A;  4KV2 A;  3JW0 X;  1T0Y A;  3TIX A;  2GBR A;  3DOW A;  4HVB A;  1GJZ A;  4IWO A;  2LAS A;  4KIK A;  5DPW A;  3ZTD A;  3ZW3 A;  3I3T B;  4HWI B;  4W9K A;  1V6E A;  1WYW B;  2DEN B;  2K8C A;  2AWT A;  4FA6 A;  3H7P A;  4HDQ A;  4FJV B;  2K1F A;  3UF8 A;  3NZS A;  4E74 A;  1XQQ A;  1Y8R C;  3IBE A;  4KSL C;  1E8X A;  3WIM A;  3L13 A;  4E3C A;  3DVG X;  3PTF C;  2FCQ A;  1YQB A;  4DBG A;  4P7I A;  1RAX A;  4RM9 A;  1KJT A;  2KNB A;  2ZNV B;  4KZC A;  2C9W B;  1UEL A;  4ANW A;  4FAD A;  4OVV A;  2RPQ A;  3B08 A;  5G55 A;  4GDL A;  3DDC B;  4K7W A;  2FIF A;  2MBE A;  5CHW A;  2JZZ A;  3VH4 B;  2V4L A;  3VUW A;  2G4D B;  5JH5 C;  3H1U A;  2KMA A;  2KDB A;  3QC8 B;  2XK5 A;  2Z0D B;  2ZPY A;  2K6D B;  4KDL B;  4PS7 A;  4MJS B;  3DPD A;  4DHJ D;  1G6J A;  4HK2 A;  3RZF A;  1Z5S B;  4ANX A;  4HXD A;  3SU8 X;  4AUQ C;  3ML8 A;  2PE6 B;  3QX1 A;  2DAJ A;  1RLF A;  1V5T A;  4GDK A;  4RMA A;  3U8Z A;  2GOW A;  2WYQ A;  3JSV A;  4HLE A;  4ANU A;  2IYD B;  2AEH A;  1WXV A;  4DHJ B;  2D10 A;  2ZPN A;  1YIW A;  2LI5 A;  1VCB A;  1P3Q U;  2MP2 B;  2AL3 A;  2PJH A;  3WAL A;  3KYD D;  4W9C A;  4NPN A;  2J0M A;  3VTV A;  4A3O A;  2FCN A;  4I6P A;  1V80 A;  2BGF A;  3PRM B;  2IO0 B;  2N7D A;  1TGZ B;  3V60 A;  3WAM A;  3IVF A;  2C60 A;  4ZRK A;  4K7U A;  3C0R B;  4LJP B;  5IA7 A;  3UGB B;  3A33 B;  2MLB A;  1RFA A;  3UQB A;  5CHF A;  5HKH A;  3L0W B;  2QHO A;  2BF8 B;  1SIF A;  1WXS A;  5CX3 A;  4PYU A;  2KMC A;  5L83 A;  1KLV A;  1WMH A;  4J6I A;  5AZF A;  2VRR B;  3VQI A;  3PLU A;  2N1V A;  2M4N A;  4DK5 A;  3T9L A;  2HD5 B;  2K6Q A;  2Y5B B;  3ZVV A;  4M0W B;  3RD2 A;  1BT0 A;  3CSF A;  1UD7 A;  3V61 A;  2FUH B;  2KX3 A;  2NCN A;  1LXD A;  2BKF A;  3BY4 B;  3NZU A;  4FJZ A;  4GU2 A;  4DWF A;  5C1Z A;  2LGD A;  1IP9 A;  2MWS B;  4NQL B;  4EZL A;  3DBL I;  3OLM D;  3DVN U;  3ZUN A;  4LDT D;  3W1Y A;  4A20 A;  3PV1 A;  2N4F A;  3PT2 B;  4A3P A;  1WI0 A;  1V49 A;  2KLG A;  3VXW A;  3UIO B;  4GOC A;  4MEM A;  2PPH A;  1P98 A;  3OJ4 B;  3APD A;  3ONS A;  3WAP A;  3NOB A;  4X57 B;  1WH3 A;  4JQW C;  1I35 A;  1M94 A;  3ZKJ C;  2KTR A;  4MEL A;  2MA9 B;  4NNJ B;  4TQ0 A;  2A5U A;  4HDO A;  3NY5 A;  2DZM A;  3HM6 X;  2ZCB A;  3RCZ A;  3PVL A;  5C23 A;  2Z59 B;  4NQK E;  4ZDV A;  2KDE B;  2DYB A;  4LJO B;  1OTR B;  4MM3 A;  4MSQ B;  2K25 A;  2KFK B;  3PZD A;  1WX7 A;  3N3K B;  4II2 B;  5JHB A;  2DZJ A;  3QAQ A;  4AJW A;  3ZNZ B;  4N9F 4;  3SDL C;  1UH6 A;  1WXM A;  2G45 B;  4MDK E;  4M8N A;  3WA0 A;  4BOZ B;  4MGZ E;  1WGY A;  4FBJ B;  1V5O A;  3QHT A;  3QQ8 B;  5D6J B;  3R7Q A;  1P0R A;  2D2Q A;  2JPH A;  2LD9 A;  1WX9 A;  2DAF A;  4G11 A;  4BVU C;  3WAO A;  4DHZ E;  2MP2 A;  2C5L C;  2GBM A;  2N1W A;  2BWE S;  4F1S A;  5AZG A;  3ZDT A;  1WR6 E;  5D2M B;  3L0X B;  2GMI C;  3JSV B;  1E8W A;  1WJU A;  2BYV E;  2FNJ B;  4AOF A;  4M8M A;  2IBI B;  2GBN A;  3X0W A;  3PRP B;  4W9H A;  3RZW C;  2ZVN A;  2M17 A;  4WJO A;  2KHW B;  3UQA A;  2JUO A;  2EMT A;  2L76 A;  2NPT A;  3ZNG C;  2MBQ A;  1J8C A;  2ZNV C;  3ENE A;  1ISN A;  1NDD A;  2LUE A;  4JL9 A;  2N9X A;  1V81 A;  4G3X B;  3H7S A;  4PS3 A;  4G50 A;  3ZO5 B;  1WJ6 A;  3ZNI D;  3UIN B;  3EEC A;  2DHZ A;  4KIK B;  3HHM A;  2EMS A;  3PGE A;  1WGD A;  3PRE A;  4IC7 B;  5KHO A;  4ASW C;  1OGW A;  1NI2 A;  1WF9 A;  4BKS A;  2KJ6 A;  2JRI B;  3BIN A;  2O6V B;  3K9P B;  4ZRI A;  2BPS A;  4EUT A;  4W9F A;  4B9K A;  5EDS A;  1UZX B;  2I1K A;  3PHW B;  4PYZ A;  2XEW A;  3A1Q B;  2RD0 A;  2XBB C;  2V1Y A;  4DXA B;  5J17 A;  3W1S A;  4MJS A;  3MTN B;  3AU5 A;  2R2Q A;  2XK5 B;  3DVG Y;  2M1M A;  4F7Z A;  2N9E B;  5DPS A;  3EFU A;  4FN2 A;  2NBU A;  3KH0 A;  2KJH B;  4WWO A;  1OEY J;  2D11 A;  3QWZ B;  1IPG A;  2J0K A;  4MGI E;  2J7Q B;  3L16 A;  4IM0 A;  1V86 A;  5L95 C;  1WIA A;  5J18 A;  2W9N A;  4KSK C;  3PS6 A;  2KWC A;  3VAW A;  2K8H A;  3ML9 A;  1K8R B;  2KAN A;  3TJP A;  4NJ7 A;  4TV3 A;  3ZTC A;  3KUC B;  2RR9 A;  4K1R B;  2KC2 A;  1ZW7 A;  2MQJ A;  1L2N A;  1PQS A;  1L7Y A;  2KQS A;  2O2V B;  2CR5 A;  1YD8 U;  2I1J A;  2D3G A;  4W9D A;  3AUL A;  1HE8 A;  3EC8 A;  5D7G A;  3X23 A;  2NPT B;  4GDK B;  1RRB A;  5CTR C;  4WAA A;  1WJ4 A;  3K9O B;  3S2A A;  1WRD B;  4FJY A;  2MBO A;  2OJR A;  1WE7 A;  2HE7 A;  4EZK A;  2FAZ A;  4GN1 A;  2D07 B;  3L17 A;  1WY8 A;  3VH3 B;  4NY0 A;  3LJ3 A;  2JT4 B;  3OAW A;  2KLC A;  3L54 A;  5LLI A;  5JHA A;  1D3Z A;  2C7H A;  1U4A A;  3QK0 A;  2G4S A;  1Z2M A;  1FXT B;  3AXC A;  4IWQ A;  2PE9 A;  4EEW A;  2NBW B;  1WXA A;  2DZK A;  3VTU A;  2MRP A;  4BBN C;  3U7D A;  2HJ8 A;  4EOY A;  4PS8 A;  2LVO A;  4GMV A;  2ASQ A;  4II3 B;  4W9I A;  5JZE B;  3VVW B;  3RUL A;  3IFW B;  4IUM B;  4NAW B;  1GC6 A;  1P1A A;  1YJ1 A;  2WX1 A;  4WWP A;  4DDG D;  1KOT A;  2DYO A;  3W1S C;  3LDZ E;  1XT9 B;  2CHX A;  3GOE A;  2KFK A;  1E8Z A;  4ZRJ A;  1C1Y B;  1H8C A;  3H6N A;  3PLV A;  1VD2 A;  2WWZ A;  2NS5 A;  2KJR A;  3MJW A;  1QZE A;  2KC1 A;  4GGQ A;  2JWZ A;  2KDI A;  3VHT C;  2KD0 A;  2LGY A;  1UBQ A;  2B3A A;  4IG7 B;  5AZH A;  3M63 B;  2PEA A;  4HJK A;  3D32 A;  3HK0 A;  2V3S A;  1LFD A;  4EFO A;  1WGH A;  2WX0 A;  3TL5 A;  3ZRF A;  1IYF A;  3DVN V;  1Q0W B;  4TUU A;  4MGY E;  5DPR A;  3VFK A;  3KUD B;  4W9L A;  3WAN A;  4BKG A;  3QJZ A;  3APF A;  2KTF A;  3H9D A;  2CU1 A;  3NS8 A;  3TBL D;  3B1L X;  4F8C B;  1R4M I;  2IO1 B;  2L8J A;  1SGH A;  3JVZ X;  4K81 A;  4BBN F;  4EZJ A;  4HPM B;  2ZCC A;  3ECI A;  3R7R A;  3DBR I;  2KDF B;  4G0N B;  4HCN B;  3HM3 A;  4IW0 A;  2UYZ B;  2L7R A;  3VUY A;  1TZ1 A;  1GUA B;  2K39 A;  3V62 A;  1V9J A;  5KHQ A;  4GIV A;  4ANV A;  2LWP A;  2JRH A;  2UWQ A;  3APC A;  3ZIM A;  1F9J A;  5IAA C;  1WMH B;  3SD5 A;  4BFR A;  4OVU A;  4RM8 A;  1V2Y A;  4GXB A;  4MSM B;  3VDZ A;  4K7S A;  2L0T A;  2CKH B;  2C7M B;  2OOB B;  1WM2 A;  2KVR A;  2FCM A;  2JY6 A;  2O6V D;  2KOX A;  1WJN A;  3DBS A;  2MBB B;  3A4S C;  1EF5 A;  1WE6 A;  1EO6 A;  4NJ6 A;  1OQY A;  2DZI A;  1C3T A;  3M95 A;  3DCG A;  3Q3J A;  1X1M A;  5LXI B;  5GMV A;  1TTN A;  2KQ7 A;  1LM8 B;  4DDI D;  4FHJ A;  1AAR A;  3AI5 A;  2MX2 A;  5D94 A;  3PRZ A;  3V6C B;  5BO4 B;  1NBF C;  4B6W A;  2MBH A;  4CHK A;  2AYO B;  3N32 A;  3RUI B;  3KW5 B;  2LRU A;  2L05 A;  2BWF A;  4KDI C;  2RGF A;  2HTH A;  4BOS C;  1XD3 B;  2LZ6 A;  3A1Q A;  2NR2 A;  4KZ0 A;  5FR6 A;  1I42 A;  5E6O A;  5J2R A;  2KWV B;  2KO3 A;  2KN5 A;  4TKN A;  3QAR A;  2J0J A;  1GG3 A;  1JRU A;  2L3Z A;  4WWN A;  2ZJD A;  4XZ4 A;  3Q3F A;  3T8M A;  2RSU A;  2REX A;  2KK8 A;  4HCP B;  1CMX B;  5DCN A;  3QIJ A;  2CS4 A;  3A9J B;  1WZ3 A;  3JYU A;  4FHK A;  1GNU A;  4CO7 A;  2YVC A;  3ALB A;  4ZYN A;  1A5R A;  1J0G A;  4MH0 E;  2C7N B;  4GDL B;  4MGK E;  4WJQ A;  2JZ3 B;  2L00 B;  4ICV A;  4WJP A;  1UGM A;  3A9K A;  2M8S A;  4FLH A;  4IWP A;  4WJN A;  3ZNH B;  2LJ5 A;  2JXX A;  5E6P A;  2YLM A;  2ZZP B;  3PPA A;  4B95 A;  3TCA A;  4DHZ B;  5AEK B;  2N9P C;  2IY0 B;  5TR5 A;  3RYT A;  2G3Q B;  2LVQ A;  1WGR A;  3QA8 A;  4JGH B;  4LDT B;  2LVP A;  2NVU I;  3AU4 A;  3V6E B;  4LCD E;  3H7P B;  2CHW A;  4KVG B;  5DPT A;  2KXJ A;  4XC2 A;  2IY1 B;  3KYC D;  3IHP C;  1H4R A;  1S3S G;  3NHE B;  3DQV A;  2R2O A;  4BKT A;  2AL6 A;  1E8Y A;  3GZN I;  2MW5 A;  3ZRC A;  5E6N A;  2LGX A;  3M3J A;  4AJY B;  3QCA A;  5CHV C;  4IM2 A;  4IM3 A;  3MHS D;  2JVC A;  3PHX B;  3UIP B;  3O65 B;  4W9E A;  2M0X A;  5LXH A;  2IO2 B;  2L0F A;  2GBK A;  3CMM B;  4I6L B;  4BKS D;  1WX8 A;  2KTR B;  3EHV A;  3P2B A;  2ZVO A;  3L08 A;  2A4Z A;  1TBE A;  4CYE A;  1LQB A;  3KVF B;  1S1Q B;  3ZDM C;  1WFY A;  2ZEQ A;  3ZLZ A;  4W9J A;  1R4N I;  1ZKH A;  2O2V A;  3CST A;  2KKC A;  3L10 B;  3OJ3 A;  2LXA A;  4I6N B;  3SHQ A;  4AP4 C;  3R3M A;  3HIZ A;  3IG3 A;  1P9D U;  4FUL A;  1OEY A;  1WGG A;  1E7V A;  1Q5W B;  2BKR B; 
#chains in the Genus database with same CATH topology
 3IXS A;  3SFD B;  2ICI A;  4RH6 A;  4OHJ A;  1YX5 B;  2BYF A;  2L52 A;  3U30 A;  1XLQ A;  1Q1O A;  3RT3 B;  1FNV A;  2KZR A;  1L0V B;  1GC7 A;  2H89 B;  2WXO A;  3B0A A;  2Y5P A;  2K22 A;  1SJE D;  5AGV A;  3P63 A;  2DYM A;  2IO3 B;  4JIO U;  2FID A;  2LUM A;  1WM3 A;  4EKU A;  4TR6 A;  4KKI A;  1EF1 A;  4TQ1 A;  1T0Y A;  2GBR A;  1KF6 B;  4IWO A;  2LAS A;  3ZTD A;  1WYW B;  2WLB A;  3N20 C;  3MC9 A;  3UF8 A;  1JAL A;  3NZS A;  3AEF B;  1Y8R C;  3P4Q B;  2GRI A;  4M00 A;  3VR9 B;  2JXT A;  4DBG A;  1I4Q A;  1RAX A;  1CZP A;  4KZC A;  5AUK A;  5G55 A;  1MVK A;  4GDL A;  2FIF A;  2MBE A;  2WXH A;  4LNI A;  3ZGZ A;  1TZO A;  1QIL A;  4RNA A;  5JH5 C;  2IPK D;  3QC8 B;  1GB1 A;  2ZPY A;  4KDL B;  4DHJ D;  3BVG A;  1G6J A;  3RZF A;  5FKA C;  5D3D A;  4AS1 A;  2GOW A;  3JSV A;  4HLE A;  4ANU A;  3C19 A;  2IYD B;  3ZJU A;  2PJH A;  3KYD D;  4NPN A;  3AMZ A;  4I6P A;  3DHG C;  2N7D A;  1D5Z C;  1VR9 A;  3DWG C;  4K3M A;  3UQB A;  1NVI D;  1NI3 A;  2BF8 B;  1HTQ A;  1WXS A;  1TS4 A;  2KMC A;  1SF0 A;  4PNU A;  2KN4 A;  5EE9 A;  1NYQ A;  1J7B A;  5BYS A;  2N1V A;  4B0E A;  2HD5 B;  4M0W B;  3RD2 A;  1BT0 A;  3MFG A;  4ARC A;  2YEP F;  3AEG B;  3RNF C;  2KX3 A;  2NCN A;  1LXD A;  1R4M B;  1YN4 A;  3RNA C;  3BVM A;  4NQL B;  4EZL A;  3DVN U;  2RDB C;  4A20 A;  2POL A;  2KLG A;  1V49 A;  4N98 A;  4ZYS A;  2PPH A;  1P98 A;  3NOB A;  1E7P B;  4JQW C;  1M94 A;  4MEL A;  3GE3 C;  4TQ0 A;  2BVC A;  1YOV B;  5I4D A;  2DZM A;  3HM6 X;  2JQR B;  3PVL A;  4ZDV A;  2KDE B;  4MM3 A;  2K0P A;  2K25 A;  2KFK B;  4II2 B;  5JHB A;  2DZJ A;  4MDK E;  1WGK A;  2W82 A;  3QQ8 B;  1MJD A;  2LHE A;  3WCQ A;  2D2Q A;  2LD9 A;  1WX9 A;  4MJQ A;  2DAF A;  2V3N A;  4HJG E;  2WXQ A;  1YMH E;  4WAF A;  3WAO A;  1YN5 A;  5AH2 A;  5FVE A;  1V8C A;  3Q8A A;  5D2M B;  5H92 C;  2GMI C;  3DWM A;  3CIR B;  3PRP B;  4W9H A;  2ZVN A;  2M17 A;  1TJE A;  2L76 A;  2NPT A;  1J8C A;  3F1V A;  4G3X B;  3ZO5 B;  4HRS A;  3UIN B;  3EA6 A;  1C79 A;  4WWM A;  5KHO A;  3PRE A;  2K5P A;  5HHD G;  3K9P B;  4ZRI A;  1UZX B;  3IT6 B;  4PYZ A;  4K3B A;  1UWM A;  2XBB C;  2V1Y A;  3MTN B;  2M0A A;  1JWM D;  2R2Q A;  2R61 A;  2M1M A;  3BZD B;  3BII D;  1VRA B;  4FN2 A;  4N6E B;  3LYY A;  4HRO A;  3KH0 A;  2KJH B;  1KH0 A;  1IPG A;  1QLB B;  2W9N A;  1E9M A;  4KSK C;  3IT4 B;  3PS6 A;  3ML9 A;  1K8R B;  3TJP A;  3KUC B;  4RGO S;  1FCC C;  4K1R B;  3Q4J A;  1ZW7 A;  1PQS A;  2KQS A;  2O2V B;  1YD8 U;  1DYQ A;  4LNK A;  5C3J B;  1ZDV A;  1HE8 A;  3EC8 A;  1CK1 A;  3S2A A;  3D1G A;  4M02 A;  2OJR A;  2HE7 A;  2VH1 A;  2PTL A;  3P4R B;  3L17 A;  4GN1 A;  4OVZ A;  3VH3 B;  3TEZ A;  5JHA A;  4RGN A;  2AVT A;  1U4A A;  3AXC A;  4PT5 A;  3RNB C;  4EEW A;  5HG2 A;  3VTU A;  1VPK A;  4II3 B;  4LNF A;  4M0W A;  1YNT E;  4IUM B;  1GC6 A;  2WX1 A;  1FRD A;  3B2G A;  3TUO A;  1XCT L;  3H6N A;  2WWZ A;  2NS5 A;  1N63 A;  3MJW A;  2JWZ A;  2PLP A;  3VHT C;  2LGY A;  1UBQ A;  4BZA A;  1V1P B;  2V3S A;  1IBX B;  2WX0 A;  3TL5 A;  3DVN V;  4BKG A;  4MGY E;  3RPF C;  3TEY A;  3NVY A;  2CU1 A;  1SE4 A;  4F8C B;  2L8J A;  4BBN F;  2QDF A;  4OVF A;  2ZCC A;  3ECI A;  3QSB B;  4YSZ B;  4HCN B;  1C4P A;  1TZ1 A;  1GUA B;  1V1O A;  5KHQ A;  1AWD A;  1ZUD 2;  3APC A;  2BB6 A;  1F9J A;  2INN E;  4BFR A;  3N1X C;  1DOY A;  2C7M B;  2OOB B;  1WM2 A;  2JY6 A;  2KOX A;  3FKY A;  5C2T B;  1DGJ A;  3ZXV A;  3DCG A;  4LLG M;  1ZPS A;  3DHI C;  1X1M A;  5GMV A;  1TTN A;  4EE2 A;  4FHJ A;  1AAR A;  2M19 A;  2MX2 A;  5D94 A;  2WXN A;  5H8Y E;  2X8X X;  2MBH A;  3N32 A;  2HTH A;  3A1Q A;  2NR2 A;  4KZ0 A;  2KN5 A;  1XCQ L;  3QAR A;  5G5H A;  4ZHO A;  4TSS A;  2GB1 A;  3O13 A;  1CMX B;  3ZJV A;  5DCN A;  2Y3A A;  2CS4 A;  3A9J B;  3JYU A;  4FHK A;  4XE0 A;  5HFY A;  4CO7 A;  4WJP A;  4IWP A;  2BT6 A;  2JXX A;  4DXF A;  3AEB B;  2YLM A;  1EU3 A;  1F77 A;  2N9P C;  1D4B A;  3AB5 A;  3RYT A;  2G3Q B;  2LVQ A;  1WGR A;  4JGH B;  3AU4 A;  4AQ7 A;  2VH2 A;  3H7P B;  2CHW A;  2KXJ A;  4LK0 M;  2IY1 B;  3IHP C;  1C76 A;  1H4R A;  2R2O A;  3U4E G;  3ZRC A;  1TY2 A;  2BTE A;  3M3J A;  3MHS D;  2FUG 1;  2JVC A;  4OVG A;  4W9E A;  1ZDX A;  2FBW B;  3P2B A;  2A4Z A;  5AGU A;  1WFY A;  4I6N B;  1R4N I;  3L10 B;  1I7H A;  2KKC A;  3OJ3 A;  1EM7 A;  3R3M A;  3HIZ A;  3IG3 A;  1P9D U;  1FCL A;  1AN8 A;  5IN7 A;  2BKR B;  4TR7 A;  3A4R A;  2AQ2 B;  2FCS A;  4W9G A;  5EE1 A;  2MH7 A;  3Q69 A;  1KM7 A;  5IP4 D;  2MSE D;  1KLG D;  1TKE A;  2W54 A;  1ZXI A;  1JWS D;  2KAJ A;  2KYW A;  3TMP B;  4ACF A;  4L1B A;  1L4D B;  3MHZ A;  3SEB A;  4E71 A;  2JF5 A;  3SFE B;  3R66 C;  4WQO B;  2MCN B;  1E90 A;  3CF6 E;  2O6V A;  1WR1 A;  3JW0 X;  2XN9 C;  3TIX A;  5DPW A;  3I3T B;  1YQ3 B;  1V6E A;  4FA6 A;  4FJV B;  4E74 A;  5AH4 A;  3I9V 1;  1T0Q C;  4KSL C;  4E3C A;  3WIM A;  3PTF C;  2ON8 A;  4RM9 A;  2ZNV B;  2HDE A;  3L0X A;  1SE3 A;  4A8X C;  1ZXH A;  3FC4 A;  3B08 A;  4YTM B;  3KWL A;  5CHW A;  4XWW A;  1M4V A;  1T3Q A;  2K9X A;  3E56 A;  3ZYY X;  3MP9 A;  2XK5 A;  5BMG A;  3Q14 C;  2K6D B;  1Z5S B;  3SU8 X;  4AUQ C;  3U8Z A;  2DAJ A;  2N7J A;  1WSP A;  2AEH A;  1WXV A;  2LI5 A;  3WAL A;  4W9C A;  1FXA A;  2J0M A;  2WDV B;  1V80 A;  2BGF A;  3WAM A;  4UDU C;  4N96 A;  3AE6 B;  1C9F A;  4LJP B;  3ABV B;  3AEA B;  3L0W B;  2QHO A;  5CX3 A;  4PYU A;  5L83 A;  1KLV A;  2KWD A;  2M4N A;  4XDD A;  1EWY C;  2QMT A;  3AE7 B;  3DHH C;  3V61 A;  2BKF A;  3BY4 B;  1T0R C;  1C4A A;  2AQ3 B;  2MEK A;  2PMV A;  2V4I B;  1RWS A;  3DBL I;  1F52 A;  3PT2 B;  3PV1 A;  4MM3 B;  3VXW A;  3UIO B;  4GOC A;  4OVH A;  3OJ4 B;  3APD A;  3WAP A;  2FE8 A;  1WH3 A;  1HA5 A;  3RNC C;  2KTR A;  2ZW0 A;  2BS3 B;  4HDO A;  4ZRQ A;  2Z59 B;  3N1Y C;  3Q4K A;  1OTR B;  1EU4 A;  4MSQ B;  3AV8 A;  3AH7 A;  2OHF A;  4AJW A;  4N9F 4;  3SDL C;  1WXM A;  2N9L A;  3QHT A;  5TSS A;  4K3C A;  2JPH A;  1ET6 A;  2J4X A;  5GXG B;  2WNM A;  4DHZ E;  2MP2 A;  2C5L C;  4F1S A;  3ZDT A;  1WR6 E;  3JSV B;  1E8W A;  1WJU A;  2BYV E;  2FNJ B;  2JYT A;  4AOF A;  1PGX A;  4M8M A;  2GBN A;  3RZW C;  1QKZ A;  4N99 A;  4WJO A;  2KHW B;  3UQA A;  2EMT A;  4US8 A;  3ZNG C;  2MBQ A;  1XO3 A;  2ZNV C;  1R7S A;  3FIL A;  4G50 A;  1TY0 A;  2KVZ A;  5BMH A;  1L5P A;  2LJI A;  4ITK A;  3VR8 B;  2EMS A;  1JQJ A;  1WF9 A;  4BKS A;  2KJ6 A;  2O6V B;  4EUT A;  4W9F A;  1FMA D;  1BML C;  3PHW B;  2D3B A;  4C7Y A;  2XEW A;  3BYY B;  3W2D A;  3W1S A;  3AU5 A;  1HEZ E;  2N9E B;  3EFU A;  1ESF A;  2Q5W D;  3Q3O C;  3RNE C;  2X38 A;  4IM0 A;  5J18 A;  1MPE A;  2KWC A;  1UWX A;  1UUP A;  1JQL A;  4NJ7 A;  4TV3 A;  3ZTC A;  4WUR A;  2B76 B;  3NG0 A;  2NPT B;  4GDK B;  5CTR C;  2HJ1 A;  4FJY A;  2MBO A;  1DOX A;  4EZK A;  3NUH B;  2JT4 B;  4LNN A;  4MJR A;  2KLC A;  4MT5 A;  2C7H A;  4RKI A;  3R2T A;  1Z2M A;  1FXT B;  1UF0 A;  2PE9 A;  1MG4 A;  2NBW B;  5FK9 C;  4BBN C;  2HJ8 A;  4PS8 A;  2MJ3 A;  4BAX A;  5JZE B;  4RGT A;  3RUL A;  3IFW B;  2SEB D;  2J52 A;  2D3C A;  3Q2A C;  4MJP A;  3C8Y A;  1KLU D;  3LDZ E;  2CHX A;  4ZRJ A;  2KFK A;  5IKC M;  3W5U B;  3URY A;  2KC1 A;  2PKO A;  2KDI A;  3B2F A;  4YSY B;  2CJN A;  4IG7 B;  1XLO A;  4HJK A;  4A55 A;  1J7A A;  3HK0 A;  2IJ0 A;  1WGH A;  1B1Z A;  1IYF A;  5DPR A;  3H9D A;  3NS8 A;  2OED A;  1SIJ A;  2TSS A;  1SGH A;  3JVZ X;  4TR8 A;  3DBR I;  2KDF B;  2RPV A;  3HM3 A;  4IW0 A;  2UYZ B;  1K53 A;  1V9J A;  1CJE A;  1LGR A;  2LWP A;  4TSZ A;  3ZIM A;  3SD5 A;  4P6V F;  4KX6 B;  1V2Y A;  4MSM B;  3NVZ A;  2WS3 B;  3VDZ A;  1ENF A;  2CKH B;  5BMI A;  2FCM A;  1N5X A;  1DOI A;  3DBS A;  3D1E A;  1C3T A;  3M95 A;  3Q3J A;  2BBC A;  5T8I A;  2DBY A;  3NJT A;  2KQ7 A;  4DDI D;  2WU2 B;  3AED B;  3AI5 A;  4YXD B;  3V6C B;  5BO4 B;  3AE4 B;  2D3A A;  3UI3 A;  1T6B X;  4H2A A;  2LRU A;  1FXI A;  3U52 E;  1V97 A;  1FPY A;  2PVO D;  4BOS C;  1XD3 B;  1I42 A;  2DWQ A;  5E6O A;  1N60 A;  2L3Z A;  3RI7 C;  1VZ6 A;  2RSU A;  2REX A;  3P16 A;  4HCP B;  3TEW A;  3AM9 A;  3Q3N C;  3QIJ A;  1JRP A;  1A5R A;  1GNU A;  2WXL A;  3ALB A;  4ZYN A;  3PZ8 A;  3I63 C;  2JZ3 B;  2L00 B;  4ICV A;  3A9K A;  2M8S A;  3BYT B;  4B95 A;  5AEK B;  4YWG G;  2IY0 B;  3U7Z A;  3NVV A;  4LDT B;  4PNV A;  1P7F A;  2WXR A;  4LNO A;  4S0R A;  1L0X B;  4RGM A;  1YN3 A;  2MHJ A;  3ZJT A;  2AL6 A;  4HPP A;  4AJY B;  1ZP0 B;  3QCA A;  1UGJ A;  4IM3 A;  1FEH A;  3UIP B;  3U2S C;  3O65 B;  2M0X A;  5LXH A;  4J3O D;  1VJK A;  2GBK A;  2YEP B;  4YTP B;  3EHV A;  3GS2 A;  4CYE A;  1FNU A;  3RNG C;  1ZKH A;  2O2V A;  4JPS A;  2LXA A;  4AP4 C;  1OEY A;  1WGG A;  2CJO A;  1STE A;  2KAC A;  3M62 B;  3ZQ4 A;  1MG8 A;  1FRR A;  2L32 A;  4URK A;  2WHI A;  2CU3 A;  2H88 B;  2K8B A;  2PIA A;  4C4V A;  4XX5 A;  2KWU B;  2EKE C;  3VUX A;  2LRW A;  1ZGU B;  2W55 A;  2KX0 A;  4YL8 A;  1IGC A;  1C77 A;  2Z0E B;  2BW2 A;  2WXG A;  2BB5 A;  2DX5 B;  2NMQ A;  1C78 A;  1TS5 A;  4AWJ A;  4GB9 A;  1FNW A;  4HPL B;  3A9J A;  4GSW A;  2LXC A;  2N7E A;  1UBI A;  2IZV B;  2VZK D;  3PSE B;  2N0S B;  2XNA C;  1D5X C;  2KQ4 X;  3ZW3 A;  4W9K A;  3BWU D;  1QOA A;  2K8C A;  5FR3 A;  2BS4 B;  1PDX A;  4HDQ A;  1IBX A;  1E8X A;  2N9K A;  3I5J C;  1YQB A;  4P7I A;  4K3S A;  1QOG A;  2C9W B;  1I4H A;  3D1F A;  3J9C A;  2L83 A;  1FFV A;  1A70 A;  3RB9 A;  2IND C;  5G5G A;  2K3U A;  2JZZ A;  2QC8 A;  1N6Z A;  2V4L A;  3NRZ A;  4KKJ A;  2G4D B;  4IDI A;  1UNN A;  3H1U A;  2KMA A;  4MAC A;  1HTO A;  3ETR A;  4XWT A;  3AN1 A;  1I4X A;  2SAK A;  4MJS B;  4PS7 A;  4QAY A;  1MHX A;  1FM0 D;  4HK2 A;  2BYT A;  2PE6 B;  3QX1 A;  1V5T A;  2WYQ A;  4D2K A;  4DHJ B;  2D10 A;  2ZPN A;  2MP2 B;  1VCB A;  1P3Q U;  3MC8 A;  2AL3 A;  3PGE B;  3VTV A;  2FCN A;  4N95 A;  3LXF A;  1RM6 C;  3PRM B;  2JX5 A;  1TGZ B;  2C60 A;  4ZRK A;  2WU5 B;  3VRB B;  4C7Z A;  3T3N A;  2MLB A;  4C56 C;  5HKH A;  1SIF A;  5AZF A;  1TKG A;  3VQI A;  2QCZ A;  4DK5 A;  2LMC A;  2ZW1 A;  5IOI A;  1F2R I;  4C00 A;  2K6Q A;  3ZVV A;  4DWF A;  3NZU A;  4FJZ A;  2MWS B;  5MPO A;  2QJL A;  2N4F A;  4A3P A;  1WI0 A;  3ZXR A;  1TS2 A;  3ONS A;  3ZKJ C;  4NNJ B;  2A5U A;  3MC0 B;  3NY5 A;  4OZA A;  4YSX B;  4XYC A;  3RCZ A;  2DYB A;  4C80 A;  1WX7 A;  2WDR B;  3ZNZ B;  1UH6 A;  2G45 B;  4M8N A;  4BOZ B;  4MGZ E;  1L0Y B;  1WGY A;  1NEK B;  4FBJ B;  1V5O A;  3DBH B;  4TMA B;  1JWA D;  4XGA B;  2LHD A;  2BS2 B;  4G11 A;  4RFB A;  4ARI A;  4N97 A;  4CQN A;  2N1W A;  2BWE S;  4IKG A;  3HVZ A;  1MHH E;  3L0W A;  5LNK 1;  3W9C B;  3FAH A;  2JUO A;  3ENE A;  1NDD A;  2LUE A;  4JL9 A;  4PS3 A;  1PUT A;  2N9X A;  1FIQ A;  3H7S A;  1JRO A;  3H8H A;  3ZNI D;  2DHZ A;  1F1H A;  1I4P A;  1WGD A;  1OGW A;  1T0S C;  2INP E;  1OQR A;  4KGR A;  3BIN A;  2BPS A;  5EE3 A;  5EDS A;  4K3L A;  2J53 A;  1L6U A;  2INC C;  3A1Q B;  4O1N A;  2XK5 B;  4F7Z A;  5DPS A;  2NBU A;  4WWO A;  4DXG A;  4ZOH C;  3QWZ B;  2J0K A;  3L16 A;  1V86 A;  5L95 C;  1HZ6 A;  3MJ5 A;  1FD6 A;  1FFU A;  4REZ A;  1EWC A;  5BYR A;  2KC2 A;  2MQJ A;  1L2N A;  1XXG A;  4OZC A;  1F2R C;  2CR5 A;  2D3G A;  3X23 A;  4P1C C;  4WAA A;  1WJ4 A;  3RN9 C;  2JU6 X;  1WRD B;  4N9A A;  4RF1 A;  3Q3M C;  1GPX A;  3LJ3 A;  1XLP A;  5LLI A;  2LFI A;  2QIE B;  1WXQ A;  1KRH A;  1WXA A;  4HEA 1;  2MRP A;  3U7D A;  1ZE3 D;  2LGI A;  4GMV A;  4W9I A;  3VVW B;  1HZ5 A;  4NAW B;  1P1A A;  1TS3 A;  2DYO A;  3P42 A;  3W1S C;  1XT9 B;  3GOE A;  2QIL A;  3KQ4 A;  1E8Z A;  2I2Y A;  1PGB A;  4P1B C;  1VD2 A;  2KJR A;  1QZE A;  4GGQ A;  1OFF A;  1PYW D;  2KD0 A;  1I4G A;  2PEA A;  3DBL B;  1N62 A;  1LFD A;  1SXT A;  1Q0W B;  4R3D A;  4TUU A;  4W9L A;  2J42 A;  3APF A;  5HI1 A;  3AE3 B;  1R4M I;  2KDM A;  2IO1 B;  5E6J A;  4K81 A;  4HPM B;  3R7R A;  4G0N B;  2WXP A;  3AE9 B;  3V62 A;  2I38 A;  1ACC A;  3IAM 1;  4N94 A;  4GIV A;  4ANV A;  4WIP A;  4K3O A;  1RFK A;  2UWQ A;  1WMH B;  2D5G A;  1JML A;  1PFD A;  3KLS X;  2L0T A;  3P4S B;  2O6V D;  1TYG B;  4HKQ A;  1WRI A;  4JWU C;  2NTS A;  1EO6 A;  4N58 A;  2DZI A;  4L23 A;  1FO4 A;  3Q4L A;  1OK7 A;  2JZP A;  4PNW A;  2V3P A;  4CHK A;  1T5X D;  3RUI B;  3KW5 B;  3P1M A;  2BWF A;  4KDI C;  2IDY A;  1VLB A;  2RGF A;  5J2R A;  2KWV B;  1MMI A;  2KO3 A;  4TKN A;  3E9S A;  1GG3 A;  2V0G A;  2KK8 A;  2V9H A;  1WZ3 A;  1J0G A;  4MH0 E;  4MGK E;  4WJQ A;  1QOF A;  1ZOY B;  3V3X A;  2ZZP B;  1SB3 C;  3PPA A;  1F0Z A;  5TR5 A;  1GOZ A;  3V6E B;  1HXY D;  4MH8 A;  4JX1 C;  1Q10 A;  1E8Y A;  1I4R A;  5E6N A;  2LGX A;  2VZK B;  5CHV C;  2IO2 B;  2L0F A;  3CMM B;  4I6L B;  2GLS A;  4BKS D;  2ZVO A;  1BUI C;  3L08 A;  2E6X A;  1S1Q B;  1N61 A;  4B0M A;  3CST A;  1E10 A;  3SHQ A;  3GP7 A;  2WDQ B;  2AQ1 B;  2KTF A;  1Q5W B;  4ASW C;  5D3I B;  1J19 A;  2CHZ A;  1E7U A;  2WXK A;  4NAW A;  1V1P A;  2G9H D;  3KUZ A;  2BYE A;  3VTW A;  2GBJ A;  3GZN B;  3L10 A;  1WZ0 A;  2NBV B;  3TEX A;  1SSN A;  1HQR D;  3VRA B;  4ICU A;  4DQO C;  1EUV B;  3A9K B;  2PW9 A;  4NZL B;  3DBH I;  5G2N A;  1QOB A;  1E5W A;  2EEL A;  2KT7 A;  2WDT B;  2Z8L A;  4JLC A;  1YX6 B;  2IGH A;  1SE9 A;  2KFJ A;  3KWV A;  3N30 A;  4KV2 A;  4S17 A;  3DOW A;  4HVB A;  3T3O A;  1GJZ A;  3GB1 A;  3R2I A;  4KIK A;  4HWI B;  2DEN B;  1SEB D;  2AWT A;  3BK1 A;  3H7P A;  3Q8F A;  4KGT A;  2K1F A;  1XQQ A;  3IBE A;  3L13 A;  3DVG X;  2FCQ A;  1KJT A;  2KNB A;  5JXV A;  1UEL A;  4ANW A;  2G1E A;  3N1Z C;  2JYE A;  4FAD A;  4OVV A;  2RPQ A;  4USA A;  3DDC B;  4K7W A;  3VH4 B;  3VUW A;  3CWI A;  1D6E C;  2KDB A;  2JSV X;  2Z0D B;  1GB4 A;  3DPD A;  3BEP A;  3V05 A;  4ANX A;  4HXD A;  1UNS A;  3ML8 A;  1RLF A;  4GDK A;  1Y56 A;  4RMA A;  3AE8 B;  3R8B A;  1YIW A;  4A3O A;  1P7E A;  2IO0 B;  3V60 A;  3HRD D;  3IVF A;  4YTN B;  4K7U A;  3C0R B;  5IA7 A;  3NS1 A;  3UGB B;  2HTM E;  3A33 B;  4A90 A;  1RFA A;  5CHF A;  2WXI A;  5EE0 A;  2WXM A;  1WMH A;  4J6I A;  1TT5 B;  2VRR B;  3PLU A;  3T9L A;  2Y5B B;  4C4V B;  1L6V A;  3OG5 A;  3CSF A;  1UD7 A;  2FUH B;  5C1Z A;  4GU2 A;  4Q2J A;  1IP9 A;  2LGD A;  3LB8 C;  1L4Z B;  4N59 A;  3OLM D;  1ET9 A;  4OZB A;  1K50 A;  1N5W A;  1YJJ A;  3ZUN A;  4LDT D;  3W1Y A;  1OQQ A;  4ZRP A;  4MEM A;  4JE3 B;  1B9R A;  4X57 B;  1I35 A;  1KFY B;  3PZ7 A;  2MA9 B;  1K52 A;  3DBR B;  2ZCB A;  3N9Y C;  5C23 A;  4NQK E;  3Q8B A;  4LJO B;  1JWB D;  3PZD A;  2W3S A;  3AEC B;  3N3K B;  3QAQ A;  1JWU D;  3WA0 A;  4GLS C;  5D6J B;  3R7Q A;  1P0R A;  3AE1 B;  2LGS A;  1MFW A;  4US9 A;  1E0Z A;  4BVU C;  5FRQ A;  2GBM A;  5AZG A;  3L0X B;  2E3T A;  2IBI B;  3X0W A;  1AYF A;  2DLB A;  1ISN A;  1VZ7 A;  1V81 A;  1QF6 A;  3B9J A;  1WJ6 A;  4K74 A;  3EEC A;  4KIK B;  1XF5 L;  3HHM A;  3PGE A;  4IC7 B;  3NVW A;  3EGR A;  1NI2 A;  3FIL B;  2JRI B;  3SR6 A;  1RYJ A;  2QEJ C;  4B9K A;  2WQY B;  2I1K A;  1VDV A;  2DNF A;  2XUR A;  2RD0 A;  5J17 A;  4DXA B;  4MJS A;  2UU7 A;  2JWU A;  1QQR A;  3DVG Y;  1OEY J;  2D11 A;  3HUI A;  4MGI E;  2J7Q B;  1TIF A;  2M56 B;  2WGS A;  1WIA A;  4FXC A;  1WWT A;  2IGD A;  3VAW A;  2K8H A;  4RF0 A;  2KAN A;  3W5V B;  2RR9 A;  1L7Y A;  3L4P A;  2I1J A;  1JW9 D;  4W9D A;  2MJE A;  3AUL A;  4OW0 A;  5D7G A;  1RRB A;  3K9O B;  2MJD A;  4JWS C;  1WE7 A;  4K3Q A;  5BYQ A;  2FAZ A;  2D07 B;  1WY8 A;  4NY0 A;  3RFZ B;  2W3R A;  1XLN A;  3L54 A;  3OAW A;  1D3Z A;  1IGD A;  3QK0 A;  2G4S A;  3TSS A;  1J7C A;  4IWQ A;  1WYG A;  2WP9 B;  2DZK A;  4EOY A;  2LVO A;  2PVG C;  1GAQ B;  2ASQ A;  4P16 A;  1TKY A;  4HKZ E;  1YJ1 A;  4WWP A;  4DDG D;  4A6Q A;  1KOT A;  2EKI A;  4PK1 A;  1C1Y B;  1H8C A;  2AX5 A;  3PLV A;  4L2Y A;  2GI9 A;  3OWE B;  1YJI A;  1K51 A;  3I57 A;  2B3A A;  1E6E B;  5AZH A;  3M63 B;  2Y5C A;  3D32 A;  4K3K A;  2LEK A;  4EFO A;  3ZRF A;  3VFK A;  3WAN A;  3KUD B;  2ONQ A;  3QJZ A;  5AUI A;  2RDG A;  2WXF A;  4WQM A;  4IOI E;  3B1L X;  1VZ8 A;  3TBL D;  3QSB A;  3HVD A;  1D5M C;  1SBB B;  2QSD A;  4EZJ A;  3BVZ A;  1BXT A;  2L7R A;  1NEN B;  3VUY A;  2K39 A;  3T0P A;  4S3I A;  2AWA A;  2JRH A;  3BK2 A;  4K3P A;  5IAA C;  4OVU A;  3P4P B;  4RM8 A;  3IAS 1;  3AE2 B;  4GXB A;  2L1A A;  4K7S A;  2KVR A;  4YT0 B;  1WJN A;  1MI0 A;  3AEE B;  2MBB B;  3EUB 2;  3A4S C;  1EF5 A;  1WE6 A;  4NJ6 A;  1OQY A;  4LTU A;  3PO0 A;  5LXI B;  2BQQ A;  4A9A A;  1LM8 B;  1NYR A;  3PRZ A;  1NBF C;  4WH4 A;  4B6W A;  2AYO B;  3Q8C A;  2L05 A;  1C4C A;  3NZ3 A;  1R4N B;  2IGG A;  1KTK A;  2LZ6 A;  1JCK B;  5FR6 A;  4K3R A;  2NTT A;  2RDH A;  2J0J A;  1JRU A;  2KMM A;  2ACZ B;  2RMM A;  2ZJD A;  4WWN A;  3Q3F A;  4XZ4 A;  3T8M A;  1LO5 D;  4M01 A;  2YVC A;  2OJW A;  3AE5 B;  3Q6B A;  2C7N B;  4GDL B;  1UGM A;  4FLH A;  2WXJ A;  4WJN A;  3ZNH B;  2LJ5 A;  5E6P A;  3TCA A;  4DHZ B;  1JQ4 A;  4ZHP A;  1SE2 A;  3Q8E A;  4KGS A;  1IUE A;  1ROE A;  3QA8 A;  2LVP A;  2NVU I;  4LCD E;  4KVG B;  5DPT A;  4XC2 A;  3KYC D;  3GE8 C;  1YQ4 B;  1S3S G;  3NHE B;  1XEE A;  3DQV A;  4BKT A;  3GZN I;  2MW5 A;  4NJC A;  4XDC A;  5IO9 A;  4RCO A;  4IM2 A;  3PHX B;  1SJH D;  4TRT A;  1PGA A;  3EFC A;  1WX8 A;  1AW7 A;  2KTR B;  1TBE A;  3PWE A;  1CQV A;  3KVF B;  1QT9 A;  3ZDM C;  2ZEQ A;  3ZLZ A;  4W9J A;  4NAM A;  4FUL A;  1LQB A;  1E7V A;  3RMK C; 
#chains in the Genus database with same CATH homology
 3A4R A;  1J19 A;  2CHZ A;  2FCS A;  3M62 B;  1E7U A;  4W9G A;  1MG8 A;  4NAW A;  1KM7 A;  4URK A;  3KUZ A;  2BYE A;  2MSE D;  1YX5 B;  2BYF A;  3U30 A;  2K8B A;  2GBJ A;  3VTW A;  1Q1O A;  3RT3 B;  2KZR A;  4XX5 A;  2KWU B;  2EKE C;  3VUX A;  1WZ0 A;  2NBV B;  2LRW A;  1ZGU B;  1GC7 A;  3B0A A;  2KX0 A;  3TMP B;  4YL8 A;  4ICU A;  2Z0E B;  1EUV B;  4E71 A;  2JF5 A;  3A9K B;  3DBH I;  5G2N A;  2DYM A;  3R66 C;  2DX5 B;  4WQO B;  1E5W A;  2IO3 B;  4JIO U;  4AWJ A;  2FID A;  4GB9 A;  2WDT B;  4HPL B;  2MCN B;  3A9J A;  4GSW A;  1E90 A;  1WM3 A;  3CF6 E;  4JLC A;  1YX6 B;  4EKU A;  2O6V A;  2LXC A;  1SE9 A;  1UBI A;  2IZV B;  2N7E A;  3PSE B;  1WR1 A;  2KFJ A;  3N30 A;  1EF1 A;  4TQ1 A;  4KV2 A;  3JW0 X;  1T0Y A;  3TIX A;  2GBR A;  3DOW A;  4HVB A;  1GJZ A;  4IWO A;  2LAS A;  4KIK A;  5DPW A;  3ZTD A;  3ZW3 A;  3I3T B;  4HWI B;  4W9K A;  1V6E A;  1WYW B;  2DEN B;  2K8C A;  2AWT A;  4FA6 A;  3H7P A;  4HDQ A;  4FJV B;  2K1F A;  3UF8 A;  3NZS A;  4E74 A;  1XQQ A;  1Y8R C;  3IBE A;  4KSL C;  1E8X A;  3WIM A;  3L13 A;  4E3C A;  3DVG X;  3PTF C;  2FCQ A;  1YQB A;  4DBG A;  4P7I A;  1RAX A;  4RM9 A;  1KJT A;  2KNB A;  2ZNV B;  4KZC A;  2C9W B;  1UEL A;  4ANW A;  4FAD A;  4OVV A;  2RPQ A;  3B08 A;  5G55 A;  4GDL A;  3DDC B;  4K7W A;  2FIF A;  2MBE A;  5CHW A;  2JZZ A;  3VH4 B;  2V4L A;  3VUW A;  2G4D B;  5JH5 C;  3H1U A;  2KMA A;  2KDB A;  3QC8 B;  2XK5 A;  2Z0D B;  2ZPY A;  2K6D B;  4KDL B;  4PS7 A;  4MJS B;  3DPD A;  4DHJ D;  1G6J A;  4HK2 A;  3RZF A;  1Z5S B;  4ANX A;  4HXD A;  3SU8 X;  4AUQ C;  3ML8 A;  2PE6 B;  3QX1 A;  2DAJ A;  1RLF A;  1V5T A;  4GDK A;  4RMA A;  3U8Z A;  2GOW A;  2WYQ A;  3JSV A;  4HLE A;  4ANU A;  2IYD B;  2AEH A;  1WXV A;  4DHJ B;  2D10 A;  2ZPN A;  1YIW A;  2LI5 A;  1VCB A;  1P3Q U;  2MP2 B;  2AL3 A;  2PJH A;  3WAL A;  3KYD D;  4W9C A;  4NPN A;  2J0M A;  3VTV A;  4A3O A;  2FCN A;  4I6P A;  1V80 A;  2BGF A;  3PRM B;  2IO0 B;  2N7D A;  1TGZ B;  3V60 A;  3WAM A;  3IVF A;  2C60 A;  4ZRK A;  4K7U A;  3C0R B;  4LJP B;  5IA7 A;  3UGB B;  3A33 B;  2MLB A;  1RFA A;  3UQB A;  5CHF A;  5HKH A;  3L0W B;  2QHO A;  2BF8 B;  1SIF A;  1WXS A;  5CX3 A;  4PYU A;  2KMC A;  5L83 A;  1KLV A;  1WMH A;  4J6I A;  5AZF A;  2VRR B;  3VQI A;  3PLU A;  2N1V A;  2M4N A;  4DK5 A;  3T9L A;  2HD5 B;  2K6Q A;  2Y5B B;  3ZVV A;  4M0W B;  3RD2 A;  1BT0 A;  3CSF A;  1UD7 A;  3V61 A;  2FUH B;  2KX3 A;  2NCN A;  1LXD A;  2BKF A;  3BY4 B;  3NZU A;  4FJZ A;  4GU2 A;  4DWF A;  5C1Z A;  2LGD A;  1IP9 A;  2MWS B;  4NQL B;  4EZL A;  3DBL I;  3OLM D;  3DVN U;  3ZUN A;  4LDT D;  3W1Y A;  4A20 A;  3PV1 A;  2N4F A;  3PT2 B;  4A3P A;  1WI0 A;  1V49 A;  2KLG A;  3VXW A;  3UIO B;  4GOC A;  4MEM A;  2PPH A;  1P98 A;  3OJ4 B;  3APD A;  3ONS A;  3WAP A;  3NOB A;  4X57 B;  1WH3 A;  4JQW C;  1I35 A;  1M94 A;  3ZKJ C;  2KTR A;  4MEL A;  2MA9 B;  4NNJ B;  4TQ0 A;  2A5U A;  4HDO A;  3NY5 A;  2DZM A;  3HM6 X;  2ZCB A;  3RCZ A;  3PVL A;  5C23 A;  2Z59 B;  4NQK E;  4ZDV A;  2KDE B;  2DYB A;  4LJO B;  1OTR B;  4MM3 A;  4MSQ B;  2K25 A;  2KFK B;  3PZD A;  1WX7 A;  3N3K B;  4II2 B;  5JHB A;  2DZJ A;  3QAQ A;  4AJW A;  3ZNZ B;  4N9F 4;  3SDL C;  1UH6 A;  1WXM A;  2G45 B;  4MDK E;  4M8N A;  3WA0 A;  4BOZ B;  4MGZ E;  1WGY A;  4FBJ B;  1V5O A;  3QHT A;  3QQ8 B;  5D6J B;  3R7Q A;  1P0R A;  2D2Q A;  2JPH A;  2LD9 A;  1WX9 A;  2DAF A;  4G11 A;  4BVU C;  3WAO A;  4DHZ E;  2MP2 A;  2C5L C;  2GBM A;  2N1W A;  2BWE S;  4F1S A;  5AZG A;  3ZDT A;  1WR6 E;  5D2M B;  3L0X B;  2GMI C;  3JSV B;  1E8W A;  1WJU A;  2BYV E;  2FNJ B;  4AOF A;  4M8M A;  2IBI B;  2GBN A;  3X0W A;  3PRP B;  4W9H A;  3RZW C;  2ZVN A;  2M17 A;  4WJO A;  2KHW B;  3UQA A;  2JUO A;  2EMT A;  2L76 A;  2NPT A;  3ZNG C;  2MBQ A;  1J8C A;  2ZNV C;  3ENE A;  1ISN A;  1NDD A;  2LUE A;  4JL9 A;  2N9X A;  1V81 A;  4G3X B;  3H7S A;  4PS3 A;  4G50 A;  3ZO5 B;  1WJ6 A;  3ZNI D;  3UIN B;  3EEC A;  2DHZ A;  4KIK B;  3HHM A;  2EMS A;  3PGE A;  1WGD A;  3PRE A;  4IC7 B;  5KHO A;  4ASW C;  1OGW A;  1NI2 A;  1WF9 A;  4BKS A;  2KJ6 A;  2JRI B;  3BIN A;  2O6V B;  3K9P B;  4ZRI A;  2BPS A;  4EUT A;  4W9F A;  4B9K A;  5EDS A;  1UZX B;  2I1K A;  3PHW B;  4PYZ A;  2XEW A;  3A1Q B;  2RD0 A;  2XBB C;  2V1Y A;  4DXA B;  5J17 A;  3W1S A;  4MJS A;  3MTN B;  3AU5 A;  2R2Q A;  2XK5 B;  3DVG Y;  2M1M A;  4F7Z A;  2N9E B;  5DPS A;  3EFU A;  4FN2 A;  2NBU A;  3KH0 A;  2KJH B;  4WWO A;  1OEY J;  2D11 A;  3QWZ B;  1IPG A;  2J0K A;  4MGI E;  2J7Q B;  3L16 A;  4IM0 A;  1V86 A;  5L95 C;  1WIA A;  5J18 A;  2W9N A;  4KSK C;  3PS6 A;  2KWC A;  3VAW A;  2K8H A;  3ML9 A;  1K8R B;  2KAN A;  3TJP A;  4NJ7 A;  4TV3 A;  3ZTC A;  3KUC B;  2RR9 A;  4K1R B;  2KC2 A;  1ZW7 A;  2MQJ A;  1L2N A;  1PQS A;  1L7Y A;  2KQS A;  2O2V B;  2CR5 A;  1YD8 U;  2I1J A;  2D3G A;  4W9D A;  3AUL A;  1HE8 A;  3EC8 A;  5D7G A;  3X23 A;  2NPT B;  4GDK B;  1RRB A;  5CTR C;  4WAA A;  1WJ4 A;  3K9O B;  3S2A A;  1WRD B;  4FJY A;  2MBO A;  2OJR A;  1WE7 A;  2HE7 A;  4EZK A;  2FAZ A;  4GN1 A;  2D07 B;  3L17 A;  1WY8 A;  3VH3 B;  4NY0 A;  3LJ3 A;  2JT4 B;  3OAW A;  2KLC A;  3L54 A;  5LLI A;  5JHA A;  1D3Z A;  2C7H A;  1U4A A;  3QK0 A;  2G4S A;  1Z2M A;  1FXT B;  3AXC A;  4IWQ A;  2PE9 A;  4EEW A;  2NBW B;  1WXA A;  2DZK A;  3VTU A;  2MRP A;  4BBN C;  3U7D A;  2HJ8 A;  4EOY A;  4PS8 A;  2LVO A;  4GMV A;  2ASQ A;  4II3 B;  4W9I A;  5JZE B;  3VVW B;  3RUL A;  3IFW B;  4IUM B;  4NAW B;  1GC6 A;  1P1A A;  1YJ1 A;  2WX1 A;  4WWP A;  4DDG D;  1KOT A;  2DYO A;  3W1S C;  3LDZ E;  1XT9 B;  2CHX A;  3GOE A;  2KFK A;  1E8Z A;  4ZRJ A;  1C1Y B;  1H8C A;  3H6N A;  3PLV A;  1VD2 A;  2WWZ A;  2NS5 A;  2KJR A;  3MJW A;  1QZE A;  2KC1 A;  4GGQ A;  2JWZ A;  2KDI A;  3VHT C;  2KD0 A;  2LGY A;  1UBQ A;  2B3A A;  4IG7 B;  5AZH A;  3M63 B;  2PEA A;  4HJK A;  3D32 A;  3HK0 A;  2V3S A;  1LFD A;  4EFO A;  1WGH A;  2WX0 A;  3TL5 A;  3ZRF A;  1IYF A;  3DVN V;  1Q0W B;  4TUU A;  4MGY E;  5DPR A;  3VFK A;  3KUD B;  4W9L A;  3WAN A;  4BKG A;  3QJZ A;  3APF A;  2KTF A;  3H9D A;  2CU1 A;  3NS8 A;  3TBL D;  3B1L X;  4F8C B;  1R4M I;  2IO1 B;  2L8J A;  1SGH A;  3JVZ X;  4K81 A;  4BBN F;  4EZJ A;  4HPM B;  2ZCC A;  3ECI A;  3R7R A;  3DBR I;  2KDF B;  4G0N B;  4HCN B;  3HM3 A;  4IW0 A;  2UYZ B;  2L7R A;  3VUY A;  1TZ1 A;  1GUA B;  2K39 A;  3V62 A;  1V9J A;  5KHQ A;  4GIV A;  4ANV A;  2LWP A;  2JRH A;  2UWQ A;  3APC A;  3ZIM A;  1F9J A;  5IAA C;  1WMH B;  3SD5 A;  4BFR A;  4OVU A;  4RM8 A;  1V2Y A;  4GXB A;  4MSM B;  3VDZ A;  4K7S A;  2L0T A;  2CKH B;  2C7M B;  2OOB B;  1WM2 A;  2KVR A;  2FCM A;  2JY6 A;  2O6V D;  2KOX A;  1WJN A;  3DBS A;  2MBB B;  3A4S C;  1EF5 A;  1WE6 A;  1EO6 A;  4NJ6 A;  1OQY A;  2DZI A;  1C3T A;  3M95 A;  3DCG A;  3Q3J A;  1X1M A;  5LXI B;  5GMV A;  1TTN A;  2KQ7 A;  1LM8 B;  4DDI D;  4FHJ A;  1AAR A;  3AI5 A;  2MX2 A;  5D94 A;  3PRZ A;  3V6C B;  5BO4 B;  1NBF C;  4B6W A;  2MBH A;  4CHK A;  2AYO B;  3N32 A;  3RUI B;  3KW5 B;  2LRU A;  2L05 A;  2BWF A;  4KDI C;  2RGF A;  2HTH A;  4BOS C;  1XD3 B;  2LZ6 A;  3A1Q A;  2NR2 A;  4KZ0 A;  5FR6 A;  1I42 A;  5E6O A;  5J2R A;  2KWV B;  2KO3 A;  2KN5 A;  4TKN A;  3QAR A;  2J0J A;  1GG3 A;  1JRU A;  2L3Z A;  4WWN A;  2ZJD A;  4XZ4 A;  3Q3F A;  3T8M A;  2RSU A;  2REX A;  2KK8 A;  4HCP B;  1CMX B;  5DCN A;  3QIJ A;  2CS4 A;  3A9J B;  1WZ3 A;  3JYU A;  4FHK A;  1GNU A;  4CO7 A;  2YVC A;  3ALB A;  4ZYN A;  1A5R A;  1J0G A;  4MH0 E;  2C7N B;  4GDL B;  4MGK E;  4WJQ A;  2JZ3 B;  2L00 B;  4ICV A;  4WJP A;  1UGM A;  3A9K A;  2M8S A;  4FLH A;  4IWP A;  4WJN A;  3ZNH B;  2LJ5 A;  2JXX A;  5E6P A;  2YLM A;  2ZZP B;  3PPA A;  4B95 A;  3TCA A;  4DHZ B;  5AEK B;  2N9P C;  2IY0 B;  5TR5 A;  3RYT A;  2G3Q B;  2LVQ A;  1WGR A;  3QA8 A;  4JGH B;  4LDT B;  2LVP A;  2NVU I;  3AU4 A;  3V6E B;  4LCD E;  3H7P B;  2CHW A;  4KVG B;  5DPT A;  2KXJ A;  4XC2 A;  2IY1 B;  3KYC D;  3IHP C;  1H4R A;  1S3S G;  3NHE B;  3DQV A;  2R2O A;  4BKT A;  2AL6 A;  1E8Y A;  3GZN I;  2MW5 A;  3ZRC A;  5E6N A;  2LGX A;  3M3J A;  4AJY B;  3QCA A;  5CHV C;  4IM2 A;  4IM3 A;  3MHS D;  2JVC A;  3PHX B;  3UIP B;  3O65 B;  4W9E A;  2M0X A;  5LXH A;  2IO2 B;  2L0F A;  2GBK A;  3CMM B;  4I6L B;  4BKS D;  1WX8 A;  2KTR B;  3EHV A;  3P2B A;  2ZVO A;  3L08 A;  2A4Z A;  1TBE A;  4CYE A;  1LQB A;  3KVF B;  1S1Q B;  3ZDM C;  1WFY A;  2ZEQ A;  3ZLZ A;  4W9J A;  1R4N I;  1ZKH A;  2O2V A;  3CST A;  2KKC A;  3L10 B;  3OJ3 A;  2LXA A;  4I6N B;  3SHQ A;  4AP4 C;  3R3M A;  3HIZ A;  3IG3 A;  1P9D U;  4FUL A;  1OEY A;  1WGG A;  1E7V A;  1Q5W B;  2BKR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...