3PGEA

Structure of sumoylated pcna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
173
structure length
172
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of SUMO-Modified Proliferating Cell Nuclear Antigen.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords SUMO-modified proliferating cell nuclear antigen
total genus 28
structure length 172
sequence length 173
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pgeA01
3.10.150.20 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III; Chain A, domain 2 3pgeA02
3ALBA 5J17A 1WX7A 4TUUA 2J0KA 3VTUA 4K7WA 5LLIA 4MGKE 5E6PA 5IA7A 4DHJD 2KQ7A 5CX3A 2KKCA 3A33B 1E5WA 1R4MI 2AL3A 4WWOA 4DBGA 4EZJA 2IO3B 5DPRA 2UYZB 2I1KA 1P9DU 1WI0A 2KX0A 3L08A 3SHQA 2XBBC 1K8RB 3D32A 2NBVB 2GBRA 4LJPB 4DK5A 3RULA 3ENEA 3X23A 2MBOA 4FLHA 1WGYA 2KOXA 2XEWA 1E7UA 4ASWC 1I35A 2KVRA 4K81A 1WMHA 2DAJA 3ONSA 2MBQA 3WA0A 4HCPB 3BINA 5DPWA 2R2OA 3MHSD 3R7QA 3VH4B 2PJHA 1TGZB 2LRWA 4BKSD 4GXBA 4GDKB 2KMCA 4MM3A 4W9EA 2MWSB 4DHJB 2LWPA 1WH3A 3DDCB 1VCBA 3SD5A 3WANA 3KH0A 4BVUC 3QARA 4MDKE 3MTNB 4W9HA 3W1SC 5AEKB 5DPSA 3A4SC 3ZNID 3PHXB 4BBNC 4HVBA 3IFWB 2DYMA 1YIWA 3VTVA 3PT2B 5AZHA 3VAWA 4F8CB 2ZNVB 4TV3A 2LZ6A 1WXVA 2NBWB 2Z0EB 2KC2A 1D3ZA 4IWQA 3ZUNA 3DCGA 1WX8A 1WRDB 2N9XA 4KSKC 4ANXA 4NJ7A 4RM9A 4W9KA 1X1MA 3ZTDA 1OTRB 2LVOA 2JZ3B 1UD7A 4MGIE 3TIXA 2KO3A 4IUMB 3NZUA 2C7NB 2C60A 2L0TA 3RZFA 2BPSA 3IG3A 4ZYNA 3EHVA 3PRMB 4KV2A 4MEMA 2DZJA 3M63B 1Q1OA 2KDFB 2KTFA 2HE7A 3CMMB 3NZSA 2A4ZA 2C9WB 2W9NA 3PRZA 4PYZA 1E8XA 5AZGA 3ZTCA 1WXMA 2V3SA 3H1UA 1YQBA 1NDDA 2MP2A 2QHOA 2AL6A 4HCNB 4N9F4 1P0RA 2CKHB 4XC2A 3S2AA 1V2YA 1G6JA 1S3SG 4A3PA 1WJ4A 4OVUA 3KYDD 1WZ3A 2DAFA 4DHZE 2AEHA 3VFKA 2PE9A 4KZCA 3X0WA 2C7HA 2ZPYA 3WAPA 3JSVA 2L3ZA 3HM6X 3AU5A 2FIFA 4FHKA 3EFUA 3UIOB 2WYQA 4DDGD 3QQ8B 3VDZA 1UGMA 2D3GA 2KFJA 1M94A 2LD9A 3B08A 4FJYA 2D11A 1KLVA 3RCZA 4E71A 1SE9A 4URKA 3U30A 2KWUB 3Q3FA 4RMAA 2ZPNA 3DBRI 4OVVA 2GMIC 2CHWA 2DZKA 2XK5B 1QZEA 3L13A 1WE6A 2HD5B 4WJQA 2MLBA 1LFDA 5E6NA 2WX0A 3GZNI 3GOEA 4WJPA 5JHBA 4NY0A 1WGGA 4GDLA 1ZKHA 3PHWB 3PTFC 3M3JA 2G4SA 3NS8A 4DDID 3MJWA 2CHXA 2HJ8A 2RD0A 2K1FA 4DHZB 2K6QA 2JRIB 4K7SA 2LVQA 3RT3B 1YD8U 4I6NB 2JRHA 2LI5A 3PSEB 2KNBA 2JVCA 4J6IA 2OJRA 4IG7B 5CHVC 5IAAC 3H9DA 4JL9A 3QK0A 5CHWA 4ANUA 2KN5A 3EC8A 2IZVB 3R3MA 3M95A 5D94A 4GDLB 3ZNGC 3V61A 3T9LA 2M17A 4K1RB 4BBNF 1EF5A 1OGWA 4XX5A 2KJ6A 3ZRFA 2IO1B 2KWCA 2N7EA 2M0XA 3NOBA 4FA6A 3RYTA 4EEWA 1WGDA 1V5TA 1WX9A 2ZEQA 4E3CA 2UWQA 2CS4A 3R7RA 4MJSB 2JT4B 5DCNA 3KUDB 3VTWA 4EZKA 3WIMA 1GC7A 3A9KA 4IW0A 1T0YA 2DX5B 3AI5A 4PS3A 2N1WA 4JIOU 2GBMA 4HPMB 1SIFA 5BO4B 2JZZA 4HJKA 4EZLA 2LXCA 5CTRC 2MA9B 5JH5C 2G3QB 4ZRKA 5G2NA 4IC7B 3UIPB 1I42A 4FJVB 4NNJB 3ZLZA 2DZMA 3UQBA 3KVFB 2MRPA 2O2VB 1WE7A 3A9KB 2HTHA 3KYCD 1V6EA 4HLEA 1UBIA 4G50A 4WJNA 3QA8A 1ISNA 5C1ZA 2KDIA 2KFKA 4HWIB 2ZCCA 2BWES 2LGXA 3QAQA 4M8MA 5L95C 2J0JA 2GBNA 4GB9A 3VUXA 4CHKA 4GN1A 3ZKJC 4TKNA 2CR5A 4KVGB 2BYEA 4EFOA 3NHEB 1JRUA 2PEAA 3DVGY 3JW0X 3M62B 2PPHA 1WXAA 3V62A 2EKEC 1WR1A 1VD2A 4FHJA 3AXCA 1L2NA 3K9OB 2AWTA 4W9FA 3PPAA 3L10B 4WWPA 2Z59B 4W9JA 4B9KA 3Q3JA 3SDLC 1ZGUB 1U4AA 5GMVA 4MGZE 3R66C 5KHQA 3JVZX 3DVNV 1RFAA 1UELA 3EECA 3KUCB 4HPLB 4CO7A 4TQ1A 2O6VB 4FBJB 4FADA 4IM3A 2KJRA 3A9JA 3WAOA 4X57B 1E8WA 3IBEA 4GSWA 1OEYJ 3QX1A 4BOZB 3IHPC 2MX2A 1SGHA 3APFA 4LDTD 3JSVB 4MH0E 2IO0B 3A1QA 2MQJA 1EO6A 1P1AA 1WMHB 4HDOA 3RUIB 4NAWB 1J0GA 4G11A 2O6VA 3ZO5B 1C3TA 2ZZPB 5D6JB 1EF1A 3ZRCA 2G4DB 3QCAA 1OEYA 4G0NB 1RRBA 2BGFA 2KZRA 2R2QA 2ZCBA 2LGYA 2IYDB 4GIVA 4LJOB 2VRRB 1WIAA 1LXDA 1GNUA 1WGRA 3SU8X 2KD0A 4W9DA 3V6CB 3W1YA 1WJ6A 4GOCA 1EUVB 4FN2A 1PQSA 3HM3A 1R4NI 3K9PB 4I6PA 4KIKA 4A3OA 1RLFA 2J7QB 2KLGA 1KOTA 2K8HA 3HIZA 2DYOA 3PS6A 1GC6A 2K39A 2DZIA 4DWFA 4AJWA 1YX5B 1ZW7A 3H6NA 4NJ6A 2BKFA 1XT9B 2ZJDA 2N9EB 1Z5SB 2WDTB 3LJ3A 4LCDE 2KANA 2KDBA 3TBLD 4HDQA 3U7DA 5TR5A 3CSTA 5FR6A 1LQBA 2XK5A 3AULA 3N30A 4ZRJA 3ML9A 1TZ1A 3BY4B 4AOFA 3PRPB 4P7IA 2JUOA 5JHAA 4AP4C 1E7VA 1V86A 1WM2A 2ASQA 5J2RA 2V1YA 3PLVA 3DVGX 5D2MB 3KUZA 1WR6E 2L8JA 3ZW3A 3VXWA 4W9GA 2EMTA 1XQQA 4ZDVA 1WJUA 2I1JA 5KHOA 4AJYB 1E90A 2YLMA 2D2QA 3WALA 4B95A 1H4RA 1MG8A 1TBEA 1KM7A 2MCNB 4MELA 3OLMD 3V6EB 2FCSA 1WYWB 2KX3A 1J8CA 3L17A 4KDIC 3OAWA 2L00B 2K25A 2JY6A 2D10A 3H7PB 4BKGA 3DPDA 2MBEA 1TTNA 3L0WB 4GDKA 2KTRB 1E8YA 2DENB 4RM8A 3ZNHB 2OOBB 2BYVE 5HKHA 3PVLA 3ECIA 4WWNA 1AARA 4EKUA 2GBKA 4BKTA 3PREA 3NY5A 2FAZA 4JLCA 2G45B 4ANWA 1NBFC 2N4FA 3TCAA 5LXIB 2WX1A 5J18A 2M8SA 4G3XB 2J0MA 3DBSA 4K7UA 4DXAB 2C7MB 2RGFA 3I3TB 3DBLI 2EMSA 2JWZA 1WM3A 4GMVA 4MGYE 3PV1A 3PZDA 4ZRIA 2N9PC 1GJZA 1L7YA 2RSUA 2Z0DB 2C5LC 3APCA 4KDLB 4AUQC 3VUYA 4F1SA 4JQWC 1GUAB 3U8ZA 2NVUI 3T8MA 3ZIMA 3ZNZB 1FXTB 2LXAA 2ZVNA 3ZVVA 2FCQA 3VUWA 3P2BA 3A9JB 1WF9A 1J19A 1V80A 2KDEB 4I6LB 3UF8A 2L76A 2KFKB 2KK8A 4MSQB 2MBBB 3H7SA 3QIJA 4II3B 2IBIB 4FJZA 2NCNA 4NQLB 1E8ZA 5D7GA 1V5OA 2M1MA 2CHZA 4NQKE 1LM8B 2BWFA 4WQOB 1KJTA 1V9JA 2D07B 4NAWA 2N7DA 4WAAA 2REXA 1WGHA 2MBHA 3L0XB 2JPHA 3ML8A 3QJZA 3QC8B 1IYFA 2GOWA 4NPNA 5CHFA 1IP9A 4WJOA 1V81A 4IWPA 5LXHA 2O6VD 3HHMA 2BF8B 1RAXA 2FNJB 2JXXA 2K8CA 1UH6A 2KJHB 2MSED 1YJ1A 2LRUA 2NBUA 5AZFA 3V60A 4BKSA 2IY1B 3N3KB 5EDSA 2GBJA 3UINB 2KLCA 2WWZA 4TQ0A 4BOSC 1GG3A 3DQVA 1WJNA 2LGDA 1P3QU 4JGHB 4A20A 1OQYA 5E6OA 3VHTC 3QHTA 3RZWC 3W1SA 1BT0A 1Z2MA 2IO2B 3B1LX 3WAMA 3VQIA 4E74A 4AWJA 4IM2A 2MW5A 1V49A 1Q0WB 3A1QB 1NI2A 4CYEA 2JF5A 2MP2B 1A5RA 1C1YB 2LUEA 3OJ4B 2N1VA 3VH3B 3N32A 3IVFA 1UBQA 4LDTB 2V4LA 4M0WB 3LDZE 1S1QB 3JYUA 4XZ4A 3C0RB 4W9CA 2RR9A 3HK0A 4IWOA 5G55A 3APDA 2DHZA 2FIDA 3VVWB 2LASA 2NPTA 3AU4A 1WFYA 4PS7A 2KMAA 2ZNVC 4F7ZA 4IM0A 3PLUA 1P98A 3UQAA 5L83A 2ZVOA 1Q5WB 3OJ3A 3PGEA 4HK2A 4W9IA 3ZDMC 1Y8RC 3DBHI 2AYOB 4PS8A 2B3AA 4W9LA 4B6WA 4II2B 2KWVB 2M4NA 2FCMA 4FULA 2YVCA 4MJSA 4ANVA 2L7RA 2Y5BB 3A4RA 2LJ5A 2NPTB 4GU2A 5DPTA 2DYBA 3CF6E 3DVNU 3UGBB 1WXSA 2KTRA 3KW5B 3ZDTA 2KHWB 4EUTA 4KZ0A 2IY0B 2L05A 4HXDA 4KSLC 2KC1A 1IPGA 4EOYA 2FCNA 1H8CA 3QWZB 2NR2A 4BFRA 3DOWA 2BKRB 2PE6B 2RPQA 4PYUA 1F9JA 2O2VA 2CU1A 2L0FA 3O65B 4ICUA 4ICVA 4MSMB 3L54A 3TL5A 1YX6B 2A5UA 3L16A 3CSFA 1XD3B 2K6DB 2KXJA 2K8BA 3TJPA 4M8NA 4YL8A 1WY8A 3B0AA 2BYFA 4GGQA 3RD2A 1HE8A 4KIKB 5C23A 2KQSA 5JZEB 1UZXB 1CMXB 3H7PA 2FUHB 2LVPA 1WZ0A 3TMPB 2NS5A
chains in the Genus database with same CATH superfamily
3ZJVA 2YEPF 1FPYA 3VTUA 4MGKE 5IA7A 5CX3A 3A33B 1N5WA 4WWOA 4DBGA 5DPRA 2I1KA 3HUIA 1K8RB 4LJPB 5BYQA 1AWDA 4K74A 2MBQA 1QQRA 3Q69A 5DPWA 1KH0A 3U52E 2PJHA 1TGZB 2LRWA 4BKSD 1MG4A 2KMCA 4W9EA 2MWSB 4DHJB 2LWPA 1CZPA 2WU2B 3KH0A 3AH7A 1TKYA 3N20C 4K3OA 5AEKB 3DHHC 3PHXB 3IXSA 2KACA 1YIWA 4B0MA 4F8CB 2Z0EB 2KC2A 1FD6A 2JSVX 2FE8A 1F0ZA 4W9KA 1OTRB 1BXTA 3TIXA 4MGIE 2KO3A 3NZUA 2C7NB 4XYCA 4DQOC 2RDBC 3IG3A 5FKAC 3RNAC 3R2IA 3N1XC 2MEKA 1UWMA 4KV2A 4MEMA 1IBXA 3DHIC 4XWWA 2C9WB 1E8XA 1TS5A 1MJDA 1HZ6A 1VDVA 2AL6A 3DBLB 1L0VB 2HJ1A 1GPXA 4DHZE 2AEHA 3X0WA 2C7HA 2CU3A 2ONQA 3WAPA 4FHKA 3EFUA 5BMIA 1Q10A 1TKGA 2LD9A 1MVKA 2D11A 1JWMD 2M0AA 2KWUB 4L23A 4BZAA 2WXQA 3Q3OC 4OVVA 2CHWA 3L13A 4WJQA 1QZEA 2HD5B 2SAKA 5E6NA 1GAQB 2HDEA 2WX0A 3GOEA 1ACCA 5JHBA 4NY0A 1WGGA 1TZOA 1R4NB 2W3RA 3M3JA 3RT3B 3AEEB 3MP9A 3H9DA 1KRHA 1JRPA 3QK0A 4ZYSA 2EELA 1N61A 3T9LA 1JMLA 1FEHA 4XX5A 3E56A 2IO1B 1YN5A 3H8HA 3NOBA 4FA6A 4EEWA 3AV8A 3RNBC 3Q8CA 2CS4A 2CJOA 2JZPA 3MC9A 3VTWA 4HJGE 1GC7A 2W3SA 2WDVB 3AI5A 2BS4B 5IO9A 1C77A 1SIFA 4HJKA 4K3PA 2L32A 2MA9B 3TSSA 1I42A 4NNJB 3ZLZA 3UQBA 2MRPA 2W55A 3AE8B 4HLEA 1MHXA 5L95C 2ZCCA 2POLA 3I5JC 2PKOA 3MC8A 4KKJA 4GN1A 2GRIA 4N6EB 1JRUA 1AYFA 4YTPB 3N9YC 1WR1A 2I38A 4N58A 2AWTA 1PUTA 4WWPA 3GE8C 3SDLC 2XN9C 2XURA 5KHQA 2WXGA 2JXTA 2KMMA 1RFAA 3CIRB 3RNEC 4CO7A 3KWVA 4FADA 1TT5B 3PGEB 2KJRA 4X57B 1E8WA 4GSWA 1FFVA 3APFA 2AWAA 2IO0B 3P42A 4KX6B 4S3IA 2N0SB 1J0GA 4G11A 2ZZPB 3ZRCA 5LNK1 4MM3B 1OQRA 2R2QA 4ARIA 1QKZA 2LGYA 1FNVA 2VH1A 1JROA 5T8IA 1GB1A 3CWIA 4LJOB 1GNUA 3SU8X 4KGRA 3V6CB 1IUEA 4A6QA 3W1YA 4RH6A 4GOCA 4YTNB 2D5GA 3HM3A 3K9PB 1STEA 1RLFA 2J7QB 1EM7A 1FNWA 2X38A 2UU7A 3PS6A 4DWFA 4AJWA 2BYTA 1MFWA 1YX5B 1ZW7A 2PIAA 1I4RA 2WDTB 1Z5SB 3BIID 5FR6A 2XK5A 3N30A 3AECB 5JHAA 1D5ZC 1JQ4A 2V9HA 3E9SA 3PWEA 2W54A 2EMTA 1WJUA 4AJYB 1EWCA 2L83A 3KLSX 3V6EB 2KX3A 2BVCA 4AS1A 2L00B 4MACA 1UF0A 2BW2A 2KTRB 1OFFA 3ZNHB 2OOBB 1HTOA 1E10A 1PGBA 3PVLA 4BKTA 2FAZA 3MC0B 2V0GA 1NI3A 2N4FA 1SF0A 2WX1A 1E9MA 4O1NA 4DXAB 4ITKA 3I3TB 4MGYE 4RGMA 3PV1A 3PZDA 4RGTA 3VUYA 3T8MA 3ZNZB 1FXTB 3LYYA 3P2BA 2HTME 2KDEB 5HI1A 2V3NA 4A8XC 1FRDA 1YMHE 3RFZB 4II3B 2K5PA 3NVYA 1I4GA 1D6EC 3Q8AA 4M01A 1KJTA 2WXMA 2N7DA 4WAAA 4IDIA 2REXA 2MBHA 3D1EA 3ML8A 3QJZA 1IYFA 4WJOA 1V81A 1RM6C 3ABVB 5LXHA 4MJRA 2I2YA 1YJ1A 2LRUA 3V60A 1OK7A 2IY1B 4LNNA 4R3DA 5BMHA 4TQ0A 1DOYA 5H8YE 1TS3A 2WXNA 3QHTA 3RZWC 2W82A 4XWTA 4E74A 4TSSA 1NI2A 1C79A 3VRAB 2MP2B 2WDRB 4LDTB 2DWQA 1EWYC 4BAXA 1L5PA 1S1QB 2ZNVC 4F7ZA 5C2TB 2YEPB 3UQAA 3OJ3A 4M0WA 2IDYA 2AYOB 4N99A 1K50A 2KWVB 2M4NA 4FULA 2JYTA 4N59A 4MJSA 4ANVA 2L7RA 1VZ6A 1WXSA 2V4IB 2KTRA 3KW5B 4EUTA 2BB6A 4EOYA 2FCNA 3QWZB 4BFRA 2PE6B 1F9JA 2CU1A 2JQRB 2L0FA 1CQVA 4ICVA 3Q4LA 2BS3B 3L16A 2FBWB 4K3MA 2KXJA 2CJNA 4WURA 3TJPA 1WY8A 3B0AA 4KIKB 5C23A 2KQSA 4HROA 1WZ0A 2NS5A 5J17A 3ZXVA 1WX7A 4TUUA 5LLIA 1FM0D 4DHJD 3QSBB 3AEFB 2UYZB 1WI0A 2KX0A 3TEXA 1FRRA 2GBRA 3C8YA 3RULA 3X23A 2MBOA 1NEKB 3AN1A 4LK0M 2KOXA 2BT6A 2XEWA 3T0PA 4ASWC 3Q8FA 4JX1C 4MH8A 3ONSA 4HCPB 1JALA 2R2OA 4GXBA 1F2RC 4GDKB 1ZPSA 4FXCA 2AQ3B 4A55A 3SD5A 3WANA 1VPKA 4BVUC 1I4XA 4MDKE 3W1SC 4HVBA 3IFWB 4HRSA 3PT2B 5AZHA 4QAYA 4TV3A 2LZ6A 1B9RA 2NBWB 5MPOA 3ZUNA 3DCGA 4ANXA 2XNAC 2LVOA 3KQ4A 3Q8BA 2C60A 2LGIA 3RZFA 1ESFA 4ZYNA 4KKIA 1AN8A 1K53A 3NS1A 2LHEA 2ZW0A 2HE7A 3NZSA 1TS4A 1MPEA 2W9NA 1ROEA 5AZGA 3ZTCA 3H1UA 1C4CA 2MP2A 2QHOA 4HCNB 2WHIA 2QSDA 4XC2A 2CKHB 3AM9A 4A3PA 1WJ4A 4OVUA 1WZ3A 3VFKA 1T0QC 2LJIA 1J7AA 2GLSA 2L3ZA 3HM6X 3OG5A 4LTUA 2WYQA 4DDGD 3QQ8B 2D3GA 2WGSA 1KLVA 4E71A 2KVZA 1YJJA 3Q3FA 3KWLA 1HTQA 4TSZA 2N7JA 3DWMA 3BYYB 3ZJUA 4GDLA 1ZKHA 4OVGA 3PTFC 2OHFA 3NS8A 1DOIA 1FMAD 2IPKD 2HJ8A 2RD0A 2K1FA 4DHZB 4K7SA 1XXGA 2JRIB 2LVQA 4I6NB 4J6IA 3PSEB 2KNBA 2JVCA 4IG7B 1LGRA 4JL9A 5C3JB 1SE4A 1FXAA 3R3MA 3T3OA 1ZP0B 1EF5A 3BZDB 2KJ6A 3EUB2 4OZAA 3RYTA 4E3CA 3R7RA 1YOVB 2JT4B 5G5HA 3KUDB 4ZRPA 1T0YA 4PS3A 4JIOU 1N63A 4YTMB 3F1VA 1SEBD 3Q4JA 5CTRC 4YWGG 5I4DA 4MJPA 2KDMA 3UIPB 4FJVB 3KYCD 3A9KB 4PNUA 2KDIA 4HWIB 2BWES 2LGXA 3NVWA 4REZA 1D4BA 4GB9A 2RMMA 3ZKJC 3ZXRA 2CR5A 4KVGB 2AVTA 5FVEA 3NHEB 2PEAA 3JW0X 2PPHA 1WXAA 3D1GA 3AXCA 2PLPA 2Z59B 4W9JA 2AX5A 1TS2A 3Q3JA 1I4QA 5GMVA 3U2SC 3JVZX 1C9FA 3EECA 2WXIA 4FBJB 1ET6A 3IBEA 1L4DB 3NUHB 2X8XX 3QX1A 2MX2A 4LDTD 1ZDXA 3A1QA 1KTKA 4HDOA 4B0EA 4NAWB 4H2AA 1CK1A 3ZO5B 1C3TA 4G0NB 1RRBA 2BGFA 4K3RA 4NAMA 1NENB 1XF5L 2IYDB 1WIAA 2Y5CA 2WXFA 1WJ6A 1XLOA 3ZJTA 1PQSA 2KN4A 1R4NI 4PK1A 1TIFA 3B2GA 1JWUD 1BUIC 1GC6A 3P4PB 3H6NA 1JQJA 4YSYB 1IBXB 1D5MC 1XCTL 2PTLA 2JUOA 4AP4C 1E7VA 2ASQA 5J2RA 2OJWA 2R61A 2DNFA 2V1YA 3AB5A 3DVGX 1QOBA 3PLVA 2L8JA 3VXWA 1K52A 2D2QA 1V8CA 3WALA 4B95A 1SJED 1MG8A 2WXPA 1WYWB 3GP7A 1V1PA 1WYGA 5TSSA 2JY6A 2D10A 4BKGA 1TTNA 4RM8A 2NMQA 1VJKA 3IT4B 1AARA 4EKUA 2GBKA 3AE2B 3B2FA 5LXIB 1XLPA 1TJEA 2M8SA 1A70A 4G3XB 5IKCM 3BK2A 2RGFA 1GOZA 1KLUD 2EMSA 2FUG1 2JWZA 4ZRIA 2ON8A 3APCA 2PVGC 2KQ4X 4F1SA 3ZIMA 2NVUI 1RFKA 2LXAA 2ZVNA 3ZVVA 1FNUA 3SEBA 4JPSA 4M02A 3A9JB 1WF9A 3OWEB 2K9XA 3UF8A 2L76A 1VZ7A 4Q2JA 3QIJA 2D3CA 1E8ZA 3BEPA 2M1MA 2CHZA 4WQOB 1YN4A 3PO0A 4NAWA 1WGHA 4LNIA 5CHFA 2JWUA 4IWPA 4UDUC 2O6VD 3HHMA 1C4PA 2QJLA 2FNJB 2K8CA 2KJHB 2NBUA 3W5UB 2GBJA 4RF0A 3UINB 2RPVA 4BOSC 4TR8A 3L4PA 1WJNA 2LGDA 3L0XA 2EKIA 4A20A 1OQYA 5E6OA 3AE6B 3ZGZA 4AWJA 2J53A 1TY2A 4IM2A 3A1QB 1HXYD 2JF5A 3LXFA 4TR6A 1A5RA 1C1YB 2LUEA 1HZ5A 3NZ3A 4JWSC 1UBQA 2QDFA 2KT7A 4RKIA 3WCQA 2JX5A 3C0RB 1HQRD 2KAJA 3APDA 3VVWB 1I7HA 2BBCA 5FRQA 4PS7A 3TEYA 3PLUA 1Q5WB 3PGEA 3ZDMC 3DBHI 1ZXHA 2WXJA 4PS8A 4W9LA 4II2B 2WXKA 2FCMA 4MT5A 1L6UA 3A4RA 3SFEB 4KGSA 4GU2A 2KHWB 2IY0B 1HA5A 1XO3A 2KC1A 2MJDA 1H8CA 1TKEA 5FR3A 2KWDA 1PGXA 1WWTA 4ICUA 4OW0A 4MSMB 3AE9B 3L54A 3TL5A 1T5XD 3CSFA 4USAA 2K22A 1PDXA 2K8BA 4M8NA 4YXDB 4C80A 1HE8A 2RDHA 2BTEA 2L52A 4P16A 1C4AA 4ZRQA 3ALBA 4IOIE 1QOGA 2J0KA 3L10A 1TYGB 2KQ7A 3EGRA 2N9LA 1R4MI 2AL3A 2IO3B 3BVMA 1V1OA 4WAFA 1OQQA 1ZOYB 2NTTA 4XDDA 4DK5A 3ENEA 1WGYA 2TSSA 4C4VB 4XGAB 1I35A 1WMHA 1LO5D 2DAJA 2KYWA 3WA0A 3MHSD 3R7QA 3VH4B 2IJ0A 4C56C 3L0WA 2MH7A 4MM3A 1WH3A 1VCBA 1T0SC 1ZDVA 3QARA 1J7BA 3A4SC 2DYMA 3VTVA 2BB5A 3VAWA 1QLBB 3D1FA 2ZNVB 1D3ZA 1WX8A 4RNAA 5BYSA 3ETRA 1X1MA 2JZ3B 1UD7A 2L0TA 2BPSA 2WXRA 4DXGA 4L2YA 3PZ7A 2D3BA 3Q6BA 2E3TA 2DZJA 2PVOD 1Q1OA 2KDFB 2KTFA 3CMMB 3GB1A 4PYZA 3PRZA 1FXIA 1WXMA 1YQBA 4N9F4 3S2AA 1S3SG 3KYDD 4KZCA 2ZPYA 2FIFA 3UI3A 3UIOB 1T0RC 1UGMA 3P1MA 2KFJA 1M94A 3B08A 1R4MB 3RCZA 1JQLA 1SE9A 4URKA 3U30A 4RMAA 3DBRI 2GMIC 3Q8EA 3AE5B 4S0RA 1WE6A 3Q3MC 3GZNI 4WJPA 3AE1B 2WS3B 4DDID 2G4SA 3MJWA 1YD8U 2LI5A 2OJRA 5IAAC 5CHWA 2KN5A 2IZVB 3AEGB 5D94A 3ZNGC 3V61A 2M17A 1OGWA 3ZRFA 2KWCA 4WWMA 2QMTA 2K0PA 1V5TA 2ZEQA 2UWQA 1PGAA 5DCNA 4EZKA 5H92C 2INPE 2DX5B 2N1WA 2GBMA 4HPMB 5BO4B 4CQNA 5JH5C 3QSBA 4ZRKA 5G2NA 3FC4A 3AEBB 3KVFB 1KLGD 1V1PB 2O2VB 2HTHA 3P4QB 4G50A 4WJNA 5HHDG 1ISNA 1SJHD 5C1ZA 2KFKA 4K3SA 4M8MA 2VH2A 2J0JA 1L0XB 2GBNA 3VUXA 1L4ZB 4TKNA 1UUPA 3SFDB 3M62B 1B1ZA 1QOFA 4OVFA 5EE1A 3V62A 3TUOA 1L2NA 1I4PA 1VRAB 3K9OB 4W9FA 5EE0A 3PPAA 1NVID 3Q4KA 1U4AA 4MGZE 3R66C 1N62A 3IAS1 2OEDA 3IT6B 4HPLB 4TQ1A 2QEJC 3TEWA 3A9JA 3WAOA 2ICIA 1SXTA 2DBYA 1FIQA 3IHPC 4MH0E 2MQJA 1EO6A 4PNWA 3RUIB 2AQ1B 1T6BX 2O6VA 5D6JB 2G4DB 1OEYA 5AGVA 3VR8B 1NYQA 3P63A 4GIVA 3FILB 2VRRB 3N1YC 1L0YB 1LXDA 3AE4B 2KD0A 5HG2A 3MFGA 4FN2A 2QILA 4KIKA 3HRDD 2KLGA 1KOTA 4HEA1 4LNOA 2LGSA 3HIZA 2K39A 2DZIA 1MMIA 3W9CB 1XT9B 2AQ2B 3LJ3A 5TR5A 3CSTA 1LQBA 4ZRJA 4N9AA 3ML9A 1TZ1A 1YN3A 5D2MB 3ZW3A 1WR6E 2VZKD 4W9GA 1XQQA 2I1JA 1E90A 2YLMA 5BMGA 3BVZA 1H4RA 2MCNB 4JWUC 2FCSA 1XEEA 3L17A 4KDIC 3OAWA 3RNFC 2K25A 2NTSA 4WIPA 3H7PB 3DPDA 2PW9A 3NJTA 5AUKA 2BYVE 2WXLA 3ECIA 4US9A 2LUMA 4ANWA 3TCAA 5J18A 1T3QA 3DBSA 4YT0B 2WXHA 3HVZA 1WM3A 3C19A 2IGGA 2N9PC 1L7YA 2BQQA 2Z0DB 1CJEA 2C5LC 4AUQC 3VRBB 4S17A 4WQMA 4AQ7A 2FCQA 3VUWA 3I9V1 1ZE3D 1J19A 4I6LB 3J9CA 2KK8A 5FK9C 2MBBB 3BYTB 2IBIB 4NQLB 1V5OA 4NQKE 1YNTE 2BWFA 5IP4D 4ZHPA 4IKGA 2ZW1A 1QILA 3RN9C 4NPNA 1JWAD 1RAXA 4MJQA 1UH6A 3N3KB 2JU6X 5EDSA 2KLCA 3TEZA 3NVVA 1Z2MA 2IO2B 3WAMA 3VQIA 4N96A 1N5XA 1M4VA 4C7ZA 2K3UA 1Y56A 3OJ4B 3VH3B 3N32A 3IVFA 4NZLB 2V4LA 4M0WB 3LDZE 3JYUA 4XZ4A 3HK0A 3O13A 3DHGC 1WFYA 1P98A 4YSZB 1UGJA 2ZVOA 1MHHE 4K3CA 2ACZB 2B3AA 4B6WA 3R2TA 4TR7A 2YVCA 2Z8LA 2Y5BB 1PFDA 2LJ5A 2NPTB 3RB9A 2DYBA 5E6JA 3CF6E 3P4RB 4P6VF 3DVNU 1P7EA 3ZDTA 4KZ0A 4HXDA 4DXFA 4NJCA 3V05A 1IPGA 2NR2A 3BVGA 2RPQA 4PYUA 3O65B 3DBRB 1YX6B 2A5UA 3P16A 2K6DB 4P1BC 2MJEA 3B9JA 2WDQB 5JZEB 1UZXB 1CMXB 5EE3A 2LVPA 3TMPB 2L1AA 1L6VA 1EU4A 2M19A 4K7WA 5E6PA 4C4VA 2KKCA 1E5WA 4EZJA 1SBBB 4J3OD 1P9DU 3L08A 4L1BA 3SHQA 1SE3A 2XBBC 3D32A 2NBVB 3AMZA 3ZYYX 4OHJA 1PYWD 5IN7A 4FLHA 3I57A 1E7UA 3RI7C 2KVRA 4K81A 5HFYA 2WP9B 2M56B 3BINA 3Q3NC 1YJIA 3U7ZA 3AEAB 3DDCB 2B76B 1SSNA 3GE3C 3LB8C 3MTNB 1AW7A 4W9HA 1FCCC 5DPSA 3ZNID 4BBNC 1WXVA 1F1HA 3I63C 4IWQA 1KFYB 1QT9A 4KSKC 1WRDB 2N9XA 4ZHOA 4OVHA 4NJ7A 4RM9A 3ZTDA 3RNGC 3W5VB 4IUMB 4OZBA 4YSXB 2WLBA 3MJ5A 2Y3AA 3EA6A 2V3PA 3EHVA 3PRMB 1XLQA 3M63B 2A4ZA 2QIEB 2V3SA 1NDDA 5AUIA 1P0RA 1SIJA 1V2YA 1G6JA 3NG0A 2DAFA 2PE9A 1QF6A 3JSVA 3AU5A 4K3QA 3VDZA 1NYRA 2J42A 3Q2AC 4FJYA 3URYA 4KGTA 2ZPNA 1SE2A 2DZKA 2XK5B 2MLBA 1LFDA 1E7PB 3PZ8A 5EE9A 3ZQ4A 1D5XC 4LNKA 2IGHA 1DGJA 3PHWB 1YQ3B 2CHXA 4XDCA 2K6QA 3NVZA 2JRHA 4JE3B 5CHVC 1WXQA 1ET9A 4ANUA 3EC8A 1WRIA 3M95A 1V97A 4GDLB 1XCQL 4N97A 4K1RB 4BBNF 2JYEA 1MI0A 2N7EA 2WXOA 2M0XA 4TMAB 2D3AA 1P7FA 1WGDA 1WX9A 1KF6B 4MJSB 3V3XA 3WIMA 3A9KA 4IW0A 3P4SB 3Q14C 2Q5WD 2JZZA 4EZLA 2LXCA 1FFUA 2G3QB 1I4HA 2QC8A 2N9KA 3SR6A 4IC7B 2DZMA 3FKYA 1WE7A 1V6EA 1UBIA 2MHJA 5AGUA 3QA8A 3QAQA 2WNMA 4CHKA 4RFBA 2INCC 1ENFA 2BYEA 4EFOA 4US8A 2H89B 3DVGY 3AE3B 2EKEC 1VD2A 4FHJA 1JCKB 1RWSA 3L10B 3N1ZC 4B9KA 1ZGUB 4LLGM 2INNE 4XE0A 1UNNA 3DVNV 3RMKC 1UELA 3KUCB 2O6VB 4N95A 4IM3A 4PT5A 1VR9A 1OEYJ 4BOZB 1SGHA 4C7YA 3JSVB 1P1AA 1WMHB 5AH4A 1EF1A 3QCAA 2GI9A 2KZRA 2ZCBA 4ZOHC 4N98A 1E6EB 1IGCA 1HEZE 3IAM1 3HVDA 1WGRA 4W9DA 3W2DA 1EUVB 1DOXA 4LNFA 4N94A 4I6PA 4A3OA 4GLSC 4HKQA 1WSPA 2K8HA 3DWGC 2DYOA 5BYRA 1WGKA 4NJ6A 2BKFA 2INDC 2ZJDA 2N9EB 4LCDE 2BS2B 2KANA 2KDBA 3TBLD 4HDQA 3U7DA 3AULA 2H88B 2J52A 2LFIA 1XLNA 3BY4B 3PRPB 4P7IA 4AOFA 4ARCA 1V86A 1WM2A 3KUZA 4ZDVA 5KHOA 4HKZE 1F2RI 2LHDA 3T3NA 1BMLC 2IGDA 2Y5PA 1TBEA 1KM7A 4OVZA 4MELA 3OLMD 1J8CA 2PMVA 1VLBA 1ZUD2 2MBEA 5GXGB 4OZCA 3L0WB 5G5GA 4GDKA 1E8YA 2DENB 1R7SA 5HKHA 4WWNA 3NRZA 3PREA 3NY5A 4JLCA 2G45B 4D2KA 2MJ3A 1F77A 1NBFC 5D3DA 2J0MA 4WH4A 4K7UA 2C7MB 3DBLI 4GMVA 1GJZA 2RSUA 2SEBD 4KDLB 1K51A 4JQWC 1GUAB 3U8ZA 2GB1A 1F52A 2G1EA 1V80A 4A9AA 2KFKB 1J7CA 4MSQB 1UNSA 1N6ZA 2QCZA 3BK1A 3H7SA 4FJZA 2NCNA 3RPFC 5D7GA 2RDGA 1LM8B 1V9JA 2D07B 1SB3C 2LMCA 5IOIA 4K3KA 3L0XB 2JPHA 3QC8B 2GOWA 4K3BA 1IP9A 3MHZA 2BF8B 2JXXA 2MSED 1ZXIA 5AZFA 4BKSA 1JWBD 1GB4A 2WWZA 1GG3A 3DQVA 4RF1A 1E0ZA 1EU3A 1P3QU 4JGHB 3VHTC 2E6XA 2G9HD 3W1SA 3VR9B 1BT0A 2LEKA 4TRTA 3B1LX 4HPPA 2MW5A 1V49A 1Q0WB 4CYEA 1UWXA 2WU5B 2N1VA 4ACFA 4EE2A 3R8BA 1C78A 1FO4A 4W9CA 2RR9A 4IWOA 1JWSD 2WQYB 5G55A 2DHZA 2FIDA 4A90A 1DYQA 2LASA 3FILA 2NPTA 4RGNA 4RGOS 5D3IB 2KMAA 4IM0A 1IGDA 1YQ4B 4C00A 5L83A 2J4XA 4HK2A 4W9IA 1Y8RC 4P1CC 2DLBA 1C76A 1QOAA 1VZ8A 1TY0A 3AEDB 1RYJA 1FCLA 5DPTA 3UGBB 4M00A 3FAHA 3RNCC 3GS2A 3AE7B 4PNVA 3DBHB 2L05A 5JXVA 4KSLC 3DOWA 2BKRB 3U4EG 2O2VA 3BWUD 3EFCA 4RCOA 4K3LA 1N60A 5AH2A 1XD3B 3GZNB 4YL8A 3RD2A 2BYFA 4GGQA 1JW9D 3H7PA 2FUHB 2VZKB 3AU4A
chains in the Genus database with same CATH topology
3ALBA 5J17A 1WX7A 4TUUA 2J0KA 3VTUA 4K7WA 5LLIA 4MGKE 5E6PA 5IA7A 4DHJD 2KQ7A 5CX3A 2KKCA 3A33B 1E5WA 1R4MI 2AL3A 4WWOA 4DBGA 4EZJA 2IO3B 5DPRA 2UYZB 2I1KA 1P9DU 1WI0A 2KX0A 3L08A 3SHQA 2XBBC 1K8RB 3D32A 2NBVB 2GBRA 4LJPB 4DK5A 3RULA 3ENEA 3X23A 2MBOA 4FLHA 1WGYA 2KOXA 2XEWA 1E7UA 4ASWC 1I35A 2KVRA 4K81A 1WMHA 2DAJA 3ONSA 2MBQA 3WA0A 4HCPB 3BINA 5DPWA 2R2OA 3MHSD 3R7QA 3VH4B 2PJHA 1TGZB 2LRWA 4BKSD 4GXBA 4GDKB 2KMCA 4MM3A 4W9EA 2MWSB 4DHJB 2LWPA 1WH3A 3DDCB 1VCBA 3SD5A 3WANA 3KH0A 4BVUC 3QARA 4MDKE 3MTNB 4W9HA 3W1SC 5AEKB 5DPSA 3A4SC 3ZNID 3PHXB 4BBNC 4HVBA 3IFWB 2DYMA 1YIWA 3VTVA 3PT2B 5AZHA 3VAWA 4F8CB 2ZNVB 4TV3A 2LZ6A 1WXVA 2NBWB 2Z0EB 2KC2A 1D3ZA 4IWQA 3ZUNA 3DCGA 1WX8A 1WRDB 2N9XA 4KSKC 4ANXA 4NJ7A 4RM9A 4W9KA 1X1MA 3ZTDA 1OTRB 2LVOA 2JZ3B 1UD7A 4MGIE 3TIXA 2KO3A 4IUMB 3NZUA 2C7NB 2C60A 2L0TA 3RZFA 2BPSA 3IG3A 4ZYNA 3EHVA 3PRMB 4KV2A 4MEMA 2DZJA 3M63B 1Q1OA 2KDFB 2KTFA 2HE7A 3CMMB 3NZSA 2A4ZA 2C9WB 2W9NA 3PRZA 4PYZA 1E8XA 5AZGA 3ZTCA 1WXMA 2V3SA 3H1UA 1YQBA 1NDDA 2MP2A 2QHOA 2AL6A 4HCNB 4N9F4 1P0RA 2CKHB 4XC2A 3S2AA 1V2YA 1G6JA 1S3SG 4A3PA 1WJ4A 4OVUA 3KYDD 1WZ3A 2DAFA 4DHZE 2AEHA 3VFKA 2PE9A 4KZCA 3X0WA 2C7HA 2ZPYA 3WAPA 3JSVA 2L3ZA 3HM6X 3AU5A 2FIFA 4FHKA 3EFUA 3UIOB 2WYQA 4DDGD 3QQ8B 3VDZA 1UGMA 2D3GA 2KFJA 1M94A 2LD9A 3B08A 4FJYA 2D11A 1KLVA 3RCZA 4E71A 1SE9A 4URKA 3U30A 2KWUB 3Q3FA 4RMAA 2ZPNA 3DBRI 4OVVA 2GMIC 2CHWA 2DZKA 2XK5B 1QZEA 3L13A 1WE6A 2HD5B 4WJQA 2MLBA 1LFDA 5E6NA 2WX0A 3GZNI 3GOEA 4WJPA 5JHBA 4NY0A 1WGGA 4GDLA 1ZKHA 3PHWB 3PTFC 3M3JA 2G4SA 3NS8A 4DDID 3MJWA 2CHXA 2HJ8A 2RD0A 2K1FA 4DHZB 2K6QA 2JRIB 4K7SA 2LVQA 3RT3B 1YD8U 4I6NB 2JRHA 2LI5A 3PSEB 2KNBA 2JVCA 4J6IA 2OJRA 4IG7B 5CHVC 5IAAC 3H9DA 4JL9A 3QK0A 5CHWA 4ANUA 2KN5A 3EC8A 2IZVB 3R3MA 3M95A 5D94A 4GDLB 3ZNGC 3V61A 3T9LA 2M17A 4K1RB 4BBNF 1EF5A 1OGWA 4XX5A 2KJ6A 3ZRFA 2IO1B 2KWCA 2N7EA 2M0XA 3NOBA 4FA6A 3RYTA 4EEWA 1WGDA 1V5TA 1WX9A 2ZEQA 4E3CA 2UWQA 2CS4A 3R7RA 4MJSB 2JT4B 5DCNA 3KUDB 3VTWA 4EZKA 3WIMA 1GC7A 3A9KA 4IW0A 1T0YA 2DX5B 3AI5A 4PS3A 2N1WA 4JIOU 2GBMA 4HPMB 1SIFA 5BO4B 2JZZA 4HJKA 4EZLA 2LXCA 5CTRC 2MA9B 5JH5C 2G3QB 4ZRKA 5G2NA 4IC7B 3UIPB 1I42A 4FJVB 4NNJB 3ZLZA 2DZMA 3UQBA 3KVFB 2MRPA 2O2VB 1WE7A 3A9KB 2HTHA 3KYCD 1V6EA 4HLEA 1UBIA 4G50A 4WJNA 3QA8A 1ISNA 5C1ZA 2KDIA 2KFKA 4HWIB 2ZCCA 2BWES 2LGXA 3QAQA 4M8MA 5L95C 2J0JA 2GBNA 4GB9A 3VUXA 4CHKA 4GN1A 3ZKJC 4TKNA 2CR5A 4KVGB 2BYEA 4EFOA 3NHEB 1JRUA 2PEAA 3DVGY 3JW0X 3M62B 2PPHA 1WXAA 3V62A 2EKEC 1WR1A 1VD2A 4FHJA 3AXCA 1L2NA 3K9OB 2AWTA 4W9FA 3PPAA 3L10B 4WWPA 2Z59B 4W9JA 4B9KA 3Q3JA 3SDLC 1ZGUB 1U4AA 5GMVA 4MGZE 3R66C 5KHQA 3JVZX 3DVNV 1RFAA 1UELA 3EECA 3KUCB 4HPLB 4CO7A 4TQ1A 2O6VB 4FBJB 4FADA 4IM3A 2KJRA 3A9JA 3WAOA 4X57B 1E8WA 3IBEA 4GSWA 1OEYJ 3QX1A 4BOZB 3IHPC 2MX2A 1SGHA 3APFA 4LDTD 3JSVB 4MH0E 2IO0B 3A1QA 2MQJA 1EO6A 1P1AA 1WMHB 4HDOA 3RUIB 4NAWB 1J0GA 4G11A 2O6VA 3ZO5B 1C3TA 2ZZPB 5D6JB 1EF1A 3ZRCA 2G4DB 3QCAA 1OEYA 4G0NB 1RRBA 2BGFA 2KZRA 2R2QA 2ZCBA 2LGYA 2IYDB 4GIVA 4LJOB 2VRRB 1WIAA 1LXDA 1GNUA 1WGRA 3SU8X 2KD0A 4W9DA 3V6CB 3W1YA 1WJ6A 4GOCA 1EUVB 4FN2A 1PQSA 3HM3A 1R4NI 3K9PB 4I6PA 4KIKA 4A3OA 1RLFA 2J7QB 2KLGA 1KOTA 2K8HA 3HIZA 2DYOA 3PS6A 1GC6A 2K39A 2DZIA 4DWFA 4AJWA 1YX5B 1ZW7A 3H6NA 4NJ6A 2BKFA 1XT9B 2ZJDA 2N9EB 1Z5SB 2WDTB 3LJ3A 4LCDE 2KANA 2KDBA 3TBLD 4HDQA 3U7DA 5TR5A 3CSTA 5FR6A 1LQBA 2XK5A 3AULA 3N30A 4ZRJA 3ML9A 1TZ1A 3BY4B 4AOFA 3PRPB 4P7IA 2JUOA 5JHAA 4AP4C 1E7VA 1V86A 1WM2A 2ASQA 5J2RA 2V1YA 3PLVA 3DVGX 5D2MB 3KUZA 1WR6E 2L8JA 3ZW3A 3VXWA 4W9GA 2EMTA 1XQQA 4ZDVA 1WJUA 2I1JA 5KHOA 4AJYB 1E90A 2YLMA 2D2QA 3WALA 4B95A 1H4RA 1MG8A 1TBEA 1KM7A 2MCNB 4MELA 3OLMD 3V6EB 2FCSA 1WYWB 2KX3A 1J8CA 3L17A 4KDIC 3OAWA 2L00B 2K25A 2JY6A 2D10A 3H7PB 4BKGA 3DPDA 2MBEA 1TTNA 3L0WB 4GDKA 2KTRB 1E8YA 2DENB 4RM8A 3ZNHB 2OOBB 2BYVE 5HKHA 3PVLA 3ECIA 4WWNA 1AARA 4EKUA 2GBKA 4BKTA 3PREA 3NY5A 2FAZA 4JLCA 2G45B 4ANWA 1NBFC 2N4FA 3TCAA 5LXIB 2WX1A 5J18A 2M8SA 4G3XB 2J0MA 3DBSA 4K7UA 4DXAB 2C7MB 2RGFA 3I3TB 3DBLI 2EMSA 2JWZA 1WM3A 4GMVA 4MGYE 3PV1A 3PZDA 4ZRIA 2N9PC 1GJZA 1L7YA 2RSUA 2Z0DB 2C5LC 3APCA 4KDLB 4AUQC 3VUYA 4F1SA 4JQWC 1GUAB 3U8ZA 2NVUI 3T8MA 3ZIMA 3ZNZB 1FXTB 2LXAA 2ZVNA 3ZVVA 2FCQA 3VUWA 3P2BA 3A9JB 1WF9A 1J19A 1V80A 2KDEB 4I6LB 3UF8A 2L76A 2KFKB 2KK8A 4MSQB 2MBBB 3H7SA 3QIJA 4II3B 2IBIB 4FJZA 2NCNA 4NQLB 1E8ZA 5D7GA 1V5OA 2M1MA 2CHZA 4NQKE 1LM8B 2BWFA 4WQOB 1KJTA 1V9JA 2D07B 4NAWA 2N7DA 4WAAA 2REXA 1WGHA 2MBHA 3L0XB 2JPHA 3ML8A 3QJZA 3QC8B 1IYFA 2GOWA 4NPNA 5CHFA 1IP9A 4WJOA 1V81A 4IWPA 5LXHA 2O6VD 3HHMA 2BF8B 1RAXA 2FNJB 2JXXA 2K8CA 1UH6A 2KJHB 2MSED 1YJ1A 2LRUA 2NBUA 5AZFA 3V60A 4BKSA 2IY1B 3N3KB 5EDSA 2GBJA 3UINB 2KLCA 2WWZA 4TQ0A 4BOSC 1GG3A 3DQVA 1WJNA 2LGDA 1P3QU 4JGHB 4A20A 1OQYA 5E6OA 3VHTC 3QHTA 3RZWC 3W1SA 1BT0A 1Z2MA 2IO2B 3B1LX 3WAMA 3VQIA 4E74A 4AWJA 4IM2A 2MW5A 1V49A 1Q0WB 3A1QB 1NI2A 4CYEA 2JF5A 2MP2B 1A5RA 1C1YB 2LUEA 3OJ4B 2N1VA 3VH3B 3N32A 3IVFA 1UBQA 4LDTB 2V4LA 4M0WB 3LDZE 1S1QB 3JYUA 4XZ4A 3C0RB 4W9CA 2RR9A 3HK0A 4IWOA 5G55A 3APDA 2DHZA 2FIDA 3VVWB 2LASA 2NPTA 3AU4A 1WFYA 4PS7A 2KMAA 2ZNVC 4F7ZA 4IM0A 3PLUA 1P98A 3UQAA 5L83A 2ZVOA 1Q5WB 3OJ3A 3PGEA 4HK2A 4W9IA 3ZDMC 1Y8RC 3DBHI 2AYOB 4PS8A 2B3AA 4W9LA 4B6WA 4II2B 2KWVB 2M4NA 2FCMA 4FULA 2YVCA 4MJSA 4ANVA 2L7RA 2Y5BB 3A4RA 2LJ5A 2NPTB 4GU2A 5DPTA 2DYBA 3CF6E 3DVNU 3UGBB 1WXSA 2KTRA 3KW5B 3ZDTA 2KHWB 4EUTA 4KZ0A 2IY0B 2L05A 4HXDA 4KSLC 2KC1A 1IPGA 4EOYA 2FCNA 1H8CA 3QWZB 2NR2A 4BFRA 3DOWA 2BKRB 2PE6B 2RPQA 4PYUA 1F9JA 2O2VA 2CU1A 2L0FA 3O65B 4ICUA 4ICVA 4MSMB 3L54A 3TL5A 1YX6B 2A5UA 3L16A 3CSFA 1XD3B 2K6DB 2KXJA 2K8BA 3TJPA 4M8NA 4YL8A 1WY8A 3B0AA 2BYFA 4GGQA 3RD2A 1HE8A 4KIKB 5C23A 2KQSA 5JZEB 1UZXB 1CMXB 3H7PA 2FUHB 2LVPA 1WZ0A 3TMPB 2NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALB A;  5J17 A;  1WX7 A;  4TUU A;  2J0K A;  3VTU A;  4K7W A;  5LLI A;  4MGK E;  5E6P A;  5IA7 A;  4DHJ D;  2KQ7 A;  5CX3 A;  2KKC A;  3A33 B;  1E5W A;  1R4M I;  2AL3 A;  4WWO A;  4DBG A;  4EZJ A;  2IO3 B;  5DPR A;  2UYZ B;  2I1K A;  1P9D U;  1WI0 A;  2KX0 A;  3L08 A;  3SHQ A;  2XBB C;  1K8R B;  3D32 A;  2NBV B;  2GBR A;  4LJP B;  4DK5 A;  3RUL A;  3ENE A;  3X23 A;  2MBO A;  4FLH A;  1WGY A;  2KOX A;  2XEW A;  1E7U A;  4ASW C;  1I35 A;  2KVR A;  4K81 A;  1WMH A;  2DAJ A;  3ONS A;  2MBQ A;  3WA0 A;  4HCP B;  3BIN A;  5DPW A;  2R2O A;  3MHS D;  3R7Q A;  3VH4 B;  2PJH A;  1TGZ B;  2LRW A;  4BKS D;  4GXB A;  4GDK B;  2KMC A;  4MM3 A;  4W9E A;  2MWS B;  4DHJ B;  2LWP A;  1WH3 A;  3DDC B;  1VCB A;  3SD5 A;  3WAN A;  3KH0 A;  4BVU C;  3QAR A;  4MDK E;  3MTN B;  4W9H A;  3W1S C;  5AEK B;  5DPS A;  3A4S C;  3ZNI D;  3PHX B;  4BBN C;  4HVB A;  3IFW B;  2DYM A;  1YIW A;  3VTV A;  3PT2 B;  5AZH A;  3VAW A;  4F8C B;  2ZNV B;  4TV3 A;  2LZ6 A;  1WXV A;  2NBW B;  2Z0E B;  2KC2 A;  1D3Z A;  4IWQ A;  3ZUN A;  3DCG A;  1WX8 A;  1WRD B;  2N9X A;  4KSK C;  4ANX A;  4NJ7 A;  4RM9 A;  4W9K A;  1X1M A;  3ZTD A;  1OTR B;  2LVO A;  2JZ3 B;  1UD7 A;  4MGI E;  3TIX A;  2KO3 A;  4IUM B;  3NZU A;  2C7N B;  2C60 A;  2L0T A;  3RZF A;  2BPS A;  3IG3 A;  4ZYN A;  3EHV A;  3PRM B;  4KV2 A;  4MEM A;  2DZJ A;  3M63 B;  1Q1O A;  2KDF B;  2KTF A;  2HE7 A;  3CMM B;  3NZS A;  2A4Z A;  2C9W B;  2W9N A;  3PRZ A;  4PYZ A;  1E8X A;  5AZG A;  3ZTC A;  1WXM A;  2V3S A;  3H1U A;  1YQB A;  1NDD A;  2MP2 A;  2QHO A;  2AL6 A;  4HCN B;  4N9F 4;  1P0R A;  2CKH B;  4XC2 A;  3S2A A;  1V2Y A;  1G6J A;  1S3S G;  4A3P A;  1WJ4 A;  4OVU A;  3KYD D;  1WZ3 A;  2DAF A;  4DHZ E;  2AEH A;  3VFK A;  2PE9 A;  4KZC A;  3X0W A;  2C7H A;  2ZPY A;  3WAP A;  3JSV A;  2L3Z A;  3HM6 X;  3AU5 A;  2FIF A;  4FHK A;  3EFU A;  3UIO B;  2WYQ A;  4DDG D;  3QQ8 B;  3VDZ A;  1UGM A;  2D3G A;  2KFJ A;  1M94 A;  2LD9 A;  3B08 A;  4FJY A;  2D11 A;  1KLV A;  3RCZ A;  4E71 A;  1SE9 A;  4URK A;  3U30 A;  2KWU B;  3Q3F A;  4RMA A;  2ZPN A;  3DBR I;  4OVV A;  2GMI C;  2CHW A;  2DZK A;  2XK5 B;  1QZE A;  3L13 A;  1WE6 A;  2HD5 B;  4WJQ A;  2MLB A;  1LFD A;  5E6N A;  2WX0 A;  3GZN I;  3GOE A;  4WJP A;  5JHB A;  4NY0 A;  1WGG A;  4GDL A;  1ZKH A;  3PHW B;  3PTF C;  3M3J A;  2G4S A;  3NS8 A;  4DDI D;  3MJW A;  2CHX A;  2HJ8 A;  2RD0 A;  2K1F A;  4DHZ B;  2K6Q A;  2JRI B;  4K7S A;  2LVQ A;  3RT3 B;  1YD8 U;  4I6N B;  2JRH A;  2LI5 A;  3PSE B;  2KNB A;  2JVC A;  4J6I A;  2OJR A;  4IG7 B;  5CHV C;  5IAA C;  3H9D A;  4JL9 A;  3QK0 A;  5CHW A;  4ANU A;  2KN5 A;  3EC8 A;  2IZV B;  3R3M A;  3M95 A;  5D94 A;  4GDL B;  3ZNG C;  3V61 A;  3T9L A;  2M17 A;  4K1R B;  4BBN F;  1EF5 A;  1OGW A;  4XX5 A;  2KJ6 A;  3ZRF A;  2IO1 B;  2KWC A;  2N7E A;  2M0X A;  3NOB A;  4FA6 A;  3RYT A;  4EEW A;  1WGD A;  1V5T A;  1WX9 A;  2ZEQ A;  4E3C A;  2UWQ A;  2CS4 A;  3R7R A;  4MJS B;  2JT4 B;  5DCN A;  3KUD B;  3VTW A;  4EZK A;  3WIM A;  1GC7 A;  3A9K A;  4IW0 A;  1T0Y A;  2DX5 B;  3AI5 A;  4PS3 A;  2N1W A;  4JIO U;  2GBM A;  4HPM B;  1SIF A;  5BO4 B;  2JZZ A;  4HJK A;  4EZL A;  2LXC A;  5CTR C;  2MA9 B;  5JH5 C;  2G3Q B;  4ZRK A;  5G2N A;  4IC7 B;  3UIP B;  1I42 A;  4FJV B;  4NNJ B;  3ZLZ A;  2DZM A;  3UQB A;  3KVF B;  2MRP A;  2O2V B;  1WE7 A;  3A9K B;  2HTH A;  3KYC D;  1V6E A;  4HLE A;  1UBI A;  4G50 A;  4WJN A;  3QA8 A;  1ISN A;  5C1Z A;  2KDI A;  2KFK A;  4HWI B;  2ZCC A;  2BWE S;  2LGX A;  3QAQ A;  4M8M A;  5L95 C;  2J0J A;  2GBN A;  4GB9 A;  3VUX A;  4CHK A;  4GN1 A;  3ZKJ C;  4TKN A;  2CR5 A;  4KVG B;  2BYE A;  4EFO A;  3NHE B;  1JRU A;  2PEA A;  3DVG Y;  3JW0 X;  3M62 B;  2PPH A;  1WXA A;  3V62 A;  2EKE C;  1WR1 A;  1VD2 A;  4FHJ A;  3AXC A;  1L2N A;  3K9O B;  2AWT A;  4W9F A;  3PPA A;  3L10 B;  4WWP A;  2Z59 B;  4W9J A;  4B9K A;  3Q3J A;  3SDL C;  1ZGU B;  1U4A A;  5GMV A;  4MGZ E;  3R66 C;  5KHQ A;  3JVZ X;  3DVN V;  1RFA A;  1UEL A;  3EEC A;  3KUC B;  4HPL B;  4CO7 A;  4TQ1 A;  2O6V B;  4FBJ B;  4FAD A;  4IM3 A;  2KJR A;  3A9J A;  3WAO A;  4X57 B;  1E8W A;  3IBE A;  4GSW A;  1OEY J;  3QX1 A;  4BOZ B;  3IHP C;  2MX2 A;  1SGH A;  3APF A;  4LDT D;  3JSV B;  4MH0 E;  2IO0 B;  3A1Q A;  2MQJ A;  1EO6 A;  1P1A A;  1WMH B;  4HDO A;  3RUI B;  4NAW B;  1J0G A;  4G11 A;  2O6V A;  3ZO5 B;  1C3T A;  2ZZP B;  5D6J B;  1EF1 A;  3ZRC A;  2G4D B;  3QCA A;  1OEY A;  4G0N B;  1RRB A;  2BGF A;  2KZR A;  2R2Q A;  2ZCB A;  2LGY A;  2IYD B;  4GIV A;  4LJO B;  2VRR B;  1WIA A;  1LXD A;  1GNU A;  1WGR A;  3SU8 X;  2KD0 A;  4W9D A;  3V6C B;  3W1Y A;  1WJ6 A;  4GOC A;  1EUV B;  4FN2 A;  1PQS A;  3HM3 A;  1R4N I;  3K9P B;  4I6P A;  4KIK A;  4A3O A;  1RLF A;  2J7Q B;  2KLG A;  1KOT A;  2K8H A;  3HIZ A;  2DYO A;  3PS6 A;  1GC6 A;  2K39 A;  2DZI A;  4DWF A;  4AJW A;  1YX5 B;  1ZW7 A;  3H6N A;  4NJ6 A;  2BKF A;  1XT9 B;  2ZJD A;  2N9E B;  1Z5S B;  2WDT B;  3LJ3 A;  4LCD E;  2KAN A;  2KDB A;  3TBL D;  4HDQ A;  3U7D A;  5TR5 A;  3CST A;  5FR6 A;  1LQB A;  2XK5 A;  3AUL A;  3N30 A;  4ZRJ A;  3ML9 A;  1TZ1 A;  3BY4 B;  4AOF A;  3PRP B;  4P7I A;  2JUO A;  5JHA A;  4AP4 C;  1E7V A;  1V86 A;  1WM2 A;  2ASQ A;  5J2R A;  2V1Y A;  3PLV A;  3DVG X;  5D2M B;  3KUZ A;  1WR6 E;  2L8J A;  3ZW3 A;  3VXW A;  4W9G A;  2EMT A;  1XQQ A;  4ZDV A;  1WJU A;  2I1J A;  5KHO A;  4AJY B;  1E90 A;  2YLM A;  2D2Q A;  3WAL A;  4B95 A;  1H4R A;  1MG8 A;  1TBE A;  1KM7 A;  2MCN B;  4MEL A;  3OLM D;  3V6E B;  2FCS A;  1WYW B;  2KX3 A;  1J8C A;  3L17 A;  4KDI C;  3OAW A;  2L00 B;  2K25 A;  2JY6 A;  2D10 A;  3H7P B;  4BKG A;  3DPD A;  2MBE A;  1TTN A;  3L0W B;  4GDK A;  2KTR B;  1E8Y A;  2DEN B;  4RM8 A;  3ZNH B;  2OOB B;  2BYV E;  5HKH A;  3PVL A;  3ECI A;  4WWN A;  1AAR A;  4EKU A;  2GBK A;  4BKT A;  3PRE A;  3NY5 A;  2FAZ A;  4JLC A;  2G45 B;  4ANW A;  1NBF C;  2N4F A;  3TCA A;  5LXI B;  2WX1 A;  5J18 A;  2M8S A;  4G3X B;  2J0M A;  3DBS A;  4K7U A;  4DXA B;  2C7M B;  2RGF A;  3I3T B;  3DBL I;  2EMS A;  2JWZ A;  1WM3 A;  4GMV A;  4MGY E;  3PV1 A;  3PZD A;  4ZRI A;  2N9P C;  1GJZ A;  1L7Y A;  2RSU A;  2Z0D B;  2C5L C;  3APC A;  4KDL B;  4AUQ C;  3VUY A;  4F1S A;  4JQW C;  1GUA B;  3U8Z A;  2NVU I;  3T8M A;  3ZIM A;  3ZNZ B;  1FXT B;  2LXA A;  2ZVN A;  3ZVV A;  2FCQ A;  3VUW A;  3P2B A;  3A9J B;  1WF9 A;  1J19 A;  1V80 A;  2KDE B;  4I6L B;  3UF8 A;  2L76 A;  2KFK B;  2KK8 A;  4MSQ B;  2MBB B;  3H7S A;  3QIJ A;  4II3 B;  2IBI B;  4FJZ A;  2NCN A;  4NQL B;  1E8Z A;  5D7G A;  1V5O A;  2M1M A;  2CHZ A;  4NQK E;  1LM8 B;  2BWF A;  4WQO B;  1KJT A;  1V9J A;  2D07 B;  4NAW A;  2N7D A;  4WAA A;  2REX A;  1WGH A;  2MBH A;  3L0X B;  2JPH A;  3ML8 A;  3QJZ A;  3QC8 B;  1IYF A;  2GOW A;  4NPN A;  5CHF A;  1IP9 A;  4WJO A;  1V81 A;  4IWP A;  5LXH A;  2O6V D;  3HHM A;  2BF8 B;  1RAX A;  2FNJ B;  2JXX A;  2K8C A;  1UH6 A;  2KJH B;  2MSE D;  1YJ1 A;  2LRU A;  2NBU A;  5AZF A;  3V60 A;  4BKS A;  2IY1 B;  3N3K B;  5EDS A;  2GBJ A;  3UIN B;  2KLC A;  2WWZ A;  4TQ0 A;  4BOS C;  1GG3 A;  3DQV A;  1WJN A;  2LGD A;  1P3Q U;  4JGH B;  4A20 A;  1OQY A;  5E6O A;  3VHT C;  3QHT A;  3RZW C;  3W1S A;  1BT0 A;  1Z2M A;  2IO2 B;  3B1L X;  3WAM A;  3VQI A;  4E74 A;  4AWJ A;  4IM2 A;  2MW5 A;  1V49 A;  1Q0W B;  3A1Q B;  1NI2 A;  4CYE A;  2JF5 A;  2MP2 B;  1A5R A;  1C1Y B;  2LUE A;  3OJ4 B;  2N1V A;  3VH3 B;  3N32 A;  3IVF A;  1UBQ A;  4LDT B;  2V4L A;  4M0W B;  3LDZ E;  1S1Q B;  3JYU A;  4XZ4 A;  3C0R B;  4W9C A;  2RR9 A;  3HK0 A;  4IWO A;  5G55 A;  3APD A;  2DHZ A;  2FID A;  3VVW B;  2LAS A;  2NPT A;  3AU4 A;  1WFY A;  4PS7 A;  2KMA A;  2ZNV C;  4F7Z A;  4IM0 A;  3PLU A;  1P98 A;  3UQA A;  5L83 A;  2ZVO A;  1Q5W B;  3OJ3 A;  3PGE A;  4HK2 A;  4W9I A;  3ZDM C;  1Y8R C;  3DBH I;  2AYO B;  4PS8 A;  2B3A A;  4W9L A;  4B6W A;  4II2 B;  2KWV B;  2M4N A;  2FCM A;  4FUL A;  2YVC A;  4MJS A;  4ANV A;  2L7R A;  2Y5B B;  3A4R A;  2LJ5 A;  2NPT B;  4GU2 A;  5DPT A;  2DYB A;  3CF6 E;  3DVN U;  3UGB B;  1WXS A;  2KTR A;  3KW5 B;  3ZDT A;  2KHW B;  4EUT A;  4KZ0 A;  2IY0 B;  2L05 A;  4HXD A;  4KSL C;  2KC1 A;  1IPG A;  4EOY A;  2FCN A;  1H8C A;  3QWZ B;  2NR2 A;  4BFR A;  3DOW A;  2BKR B;  2PE6 B;  2RPQ A;  4PYU A;  1F9J A;  2O2V A;  2CU1 A;  2L0F A;  3O65 B;  4ICU A;  4ICV A;  4MSM B;  3L54 A;  3TL5 A;  1YX6 B;  2A5U A;  3L16 A;  3CSF A;  1XD3 B;  2K6D B;  2KXJ A;  2K8B A;  3TJP A;  4M8N A;  4YL8 A;  1WY8 A;  3B0A A;  2BYF A;  4GGQ A;  3RD2 A;  1HE8 A;  4KIK B;  5C23 A;  2KQS A;  5JZE B;  1UZX B;  1CMX B;  3H7P A;  2FUH B;  2LVP A;  1WZ0 A;  3TMP B;  2NS5 A; 
#chains in the Genus database with same CATH topology
 3ZJV A;  2YEP F;  1FPY A;  3VTU A;  4MGK E;  5IA7 A;  5CX3 A;  3A33 B;  1N5W A;  4WWO A;  4DBG A;  5DPR A;  2I1K A;  3HUI A;  1K8R B;  4LJP B;  5BYQ A;  1AWD A;  4K74 A;  2MBQ A;  1QQR A;  3Q69 A;  5DPW A;  1KH0 A;  3U52 E;  2PJH A;  1TGZ B;  2LRW A;  4BKS D;  1MG4 A;  2KMC A;  4W9E A;  2MWS B;  4DHJ B;  2LWP A;  1CZP A;  2WU2 B;  3KH0 A;  3AH7 A;  1TKY A;  3N20 C;  4K3O A;  5AEK B;  3DHH C;  3PHX B;  3IXS A;  2KAC A;  1YIW A;  4B0M A;  4F8C B;  2Z0E B;  2KC2 A;  1FD6 A;  2JSV X;  2FE8 A;  1F0Z A;  4W9K A;  1OTR B;  1BXT A;  3TIX A;  4MGI E;  2KO3 A;  3NZU A;  2C7N B;  4XYC A;  4DQO C;  2RDB C;  3IG3 A;  5FKA C;  3RNA C;  3R2I A;  3N1X C;  2MEK A;  1UWM A;  4KV2 A;  4MEM A;  1IBX A;  3DHI C;  4XWW A;  2C9W B;  1E8X A;  1TS5 A;  1MJD A;  1HZ6 A;  1VDV A;  2AL6 A;  3DBL B;  1L0V B;  2HJ1 A;  1GPX A;  4DHZ E;  2AEH A;  3X0W A;  2C7H A;  2CU3 A;  2ONQ A;  3WAP A;  4FHK A;  3EFU A;  5BMI A;  1Q10 A;  1TKG A;  2LD9 A;  1MVK A;  2D11 A;  1JWM D;  2M0A A;  2KWU B;  4L23 A;  4BZA A;  2WXQ A;  3Q3O C;  4OVV A;  2CHW A;  3L13 A;  4WJQ A;  1QZE A;  2HD5 B;  2SAK A;  5E6N A;  1GAQ B;  2HDE A;  2WX0 A;  3GOE A;  1ACC A;  5JHB A;  4NY0 A;  1WGG A;  1TZO A;  1R4N B;  2W3R A;  3M3J A;  3RT3 B;  3AEE B;  3MP9 A;  3H9D A;  1KRH A;  1JRP A;  3QK0 A;  4ZYS A;  2EEL A;  1N61 A;  3T9L A;  1JML A;  1FEH A;  4XX5 A;  3E56 A;  2IO1 B;  1YN5 A;  3H8H A;  3NOB A;  4FA6 A;  4EEW A;  3AV8 A;  3RNB C;  3Q8C A;  2CS4 A;  2CJO A;  2JZP A;  3MC9 A;  3VTW A;  4HJG E;  1GC7 A;  2W3S A;  2WDV B;  3AI5 A;  2BS4 B;  5IO9 A;  1C77 A;  1SIF A;  4HJK A;  4K3P A;  2L32 A;  2MA9 B;  3TSS A;  1I42 A;  4NNJ B;  3ZLZ A;  3UQB A;  2MRP A;  2W55 A;  3AE8 B;  4HLE A;  1MHX A;  5L95 C;  2ZCC A;  2POL A;  3I5J C;  2PKO A;  3MC8 A;  4KKJ A;  4GN1 A;  2GRI A;  4N6E B;  1JRU A;  1AYF A;  4YTP B;  3N9Y C;  1WR1 A;  2I38 A;  4N58 A;  2AWT A;  1PUT A;  4WWP A;  3GE8 C;  3SDL C;  2XN9 C;  2XUR A;  5KHQ A;  2WXG A;  2JXT A;  2KMM A;  1RFA A;  3CIR B;  3RNE C;  4CO7 A;  3KWV A;  4FAD A;  1TT5 B;  3PGE B;  2KJR A;  4X57 B;  1E8W A;  4GSW A;  1FFV A;  3APF A;  2AWA A;  2IO0 B;  3P42 A;  4KX6 B;  4S3I A;  2N0S B;  1J0G A;  4G11 A;  2ZZP B;  3ZRC A;  5LNK 1;  4MM3 B;  1OQR A;  2R2Q A;  4ARI A;  1QKZ A;  2LGY A;  1FNV A;  2VH1 A;  1JRO A;  5T8I A;  1GB1 A;  3CWI A;  4LJO B;  1GNU A;  3SU8 X;  4KGR A;  3V6C B;  1IUE A;  4A6Q A;  3W1Y A;  4RH6 A;  4GOC A;  4YTN B;  2D5G A;  3HM3 A;  3K9P B;  1STE A;  1RLF A;  2J7Q B;  1EM7 A;  1FNW A;  2X38 A;  2UU7 A;  3PS6 A;  4DWF A;  4AJW A;  2BYT A;  1MFW A;  1YX5 B;  1ZW7 A;  2PIA A;  1I4R A;  2WDT B;  1Z5S B;  3BII D;  5FR6 A;  2XK5 A;  3N30 A;  3AEC B;  5JHA A;  1D5Z C;  1JQ4 A;  2V9H A;  3E9S A;  3PWE A;  2W54 A;  2EMT A;  1WJU A;  4AJY B;  1EWC A;  2L83 A;  3KLS X;  3V6E B;  2KX3 A;  2BVC A;  4AS1 A;  2L00 B;  4MAC A;  1UF0 A;  2BW2 A;  2KTR B;  1OFF A;  3ZNH B;  2OOB B;  1HTO A;  1E10 A;  1PGB A;  3PVL A;  4BKT A;  2FAZ A;  3MC0 B;  2V0G A;  1NI3 A;  2N4F A;  1SF0 A;  2WX1 A;  1E9M A;  4O1N A;  4DXA B;  4ITK A;  3I3T B;  4MGY E;  4RGM A;  3PV1 A;  3PZD A;  4RGT A;  3VUY A;  3T8M A;  3ZNZ B;  1FXT B;  3LYY A;  3P2B A;  2HTM E;  2KDE B;  5HI1 A;  2V3N A;  4A8X C;  1FRD A;  1YMH E;  3RFZ B;  4II3 B;  2K5P A;  3NVY A;  1I4G A;  1D6E C;  3Q8A A;  4M01 A;  1KJT A;  2WXM A;  2N7D A;  4WAA A;  4IDI A;  2REX A;  2MBH A;  3D1E A;  3ML8 A;  3QJZ A;  1IYF A;  4WJO A;  1V81 A;  1RM6 C;  3ABV B;  5LXH A;  4MJR A;  2I2Y A;  1YJ1 A;  2LRU A;  3V60 A;  1OK7 A;  2IY1 B;  4LNN A;  4R3D A;  5BMH A;  4TQ0 A;  1DOY A;  5H8Y E;  1TS3 A;  2WXN A;  3QHT A;  3RZW C;  2W82 A;  4XWT A;  4E74 A;  4TSS A;  1NI2 A;  1C79 A;  3VRA B;  2MP2 B;  2WDR B;  4LDT B;  2DWQ A;  1EWY C;  4BAX A;  1L5P A;  1S1Q B;  2ZNV C;  4F7Z A;  5C2T B;  2YEP B;  3UQA A;  3OJ3 A;  4M0W A;  2IDY A;  2AYO B;  4N99 A;  1K50 A;  2KWV B;  2M4N A;  4FUL A;  2JYT A;  4N59 A;  4MJS A;  4ANV A;  2L7R A;  1VZ6 A;  1WXS A;  2V4I B;  2KTR A;  3KW5 B;  4EUT A;  2BB6 A;  4EOY A;  2FCN A;  3QWZ B;  4BFR A;  2PE6 B;  1F9J A;  2CU1 A;  2JQR B;  2L0F A;  1CQV A;  4ICV A;  3Q4L A;  2BS3 B;  3L16 A;  2FBW B;  4K3M A;  2KXJ A;  2CJN A;  4WUR A;  3TJP A;  1WY8 A;  3B0A A;  4KIK B;  5C23 A;  2KQS A;  4HRO A;  1WZ0 A;  2NS5 A;  5J17 A;  3ZXV A;  1WX7 A;  4TUU A;  5LLI A;  1FM0 D;  4DHJ D;  3QSB B;  3AEF B;  2UYZ B;  1WI0 A;  2KX0 A;  3TEX A;  1FRR A;  2GBR A;  3C8Y A;  3RUL A;  3X23 A;  2MBO A;  1NEK B;  3AN1 A;  4LK0 M;  2KOX A;  2BT6 A;  2XEW A;  3T0P A;  4ASW C;  3Q8F A;  4JX1 C;  4MH8 A;  3ONS A;  4HCP B;  1JAL A;  2R2O A;  4GXB A;  1F2R C;  4GDK B;  1ZPS A;  4FXC A;  2AQ3 B;  4A55 A;  3SD5 A;  3WAN A;  1VPK A;  4BVU C;  1I4X A;  4MDK E;  3W1S C;  4HVB A;  3IFW B;  4HRS A;  3PT2 B;  5AZH A;  4QAY A;  4TV3 A;  2LZ6 A;  1B9R A;  2NBW B;  5MPO A;  3ZUN A;  3DCG A;  4ANX A;  2XNA C;  2LVO A;  3KQ4 A;  3Q8B A;  2C60 A;  2LGI A;  3RZF A;  1ESF A;  4ZYN A;  4KKI A;  1AN8 A;  1K53 A;  3NS1 A;  2LHE A;  2ZW0 A;  2HE7 A;  3NZS A;  1TS4 A;  1MPE A;  2W9N A;  1ROE A;  5AZG A;  3ZTC A;  3H1U A;  1C4C A;  2MP2 A;  2QHO A;  4HCN B;  2WHI A;  2QSD A;  4XC2 A;  2CKH B;  3AM9 A;  4A3P A;  1WJ4 A;  4OVU A;  1WZ3 A;  3VFK A;  1T0Q C;  2LJI A;  1J7A A;  2GLS A;  2L3Z A;  3HM6 X;  3OG5 A;  4LTU A;  2WYQ A;  4DDG D;  3QQ8 B;  2D3G A;  2WGS A;  1KLV A;  4E71 A;  2KVZ A;  1YJJ A;  3Q3F A;  3KWL A;  1HTQ A;  4TSZ A;  2N7J A;  3DWM A;  3BYY B;  3ZJU A;  4GDL A;  1ZKH A;  4OVG A;  3PTF C;  2OHF A;  3NS8 A;  1DOI A;  1FMA D;  2IPK D;  2HJ8 A;  2RD0 A;  2K1F A;  4DHZ B;  4K7S A;  1XXG A;  2JRI B;  2LVQ A;  4I6N B;  4J6I A;  3PSE B;  2KNB A;  2JVC A;  4IG7 B;  1LGR A;  4JL9 A;  5C3J B;  1SE4 A;  1FXA A;  3R3M A;  3T3O A;  1ZP0 B;  1EF5 A;  3BZD B;  2KJ6 A;  3EUB 2;  4OZA A;  3RYT A;  4E3C A;  3R7R A;  1YOV B;  2JT4 B;  5G5H A;  3KUD B;  4ZRP A;  1T0Y A;  4PS3 A;  4JIO U;  1N63 A;  4YTM B;  3F1V A;  1SEB D;  3Q4J A;  5CTR C;  4YWG G;  5I4D A;  4MJP A;  2KDM A;  3UIP B;  4FJV B;  3KYC D;  3A9K B;  4PNU A;  2KDI A;  4HWI B;  2BWE S;  2LGX A;  3NVW A;  4REZ A;  1D4B A;  4GB9 A;  2RMM A;  3ZKJ C;  3ZXR A;  2CR5 A;  4KVG B;  2AVT A;  5FVE A;  3NHE B;  2PEA A;  3JW0 X;  2PPH A;  1WXA A;  3D1G A;  3AXC A;  2PLP A;  2Z59 B;  4W9J A;  2AX5 A;  1TS2 A;  3Q3J A;  1I4Q A;  5GMV A;  3U2S C;  3JVZ X;  1C9F A;  3EEC A;  2WXI A;  4FBJ B;  1ET6 A;  3IBE A;  1L4D B;  3NUH B;  2X8X X;  3QX1 A;  2MX2 A;  4LDT D;  1ZDX A;  3A1Q A;  1KTK A;  4HDO A;  4B0E A;  4NAW B;  4H2A A;  1CK1 A;  3ZO5 B;  1C3T A;  4G0N B;  1RRB A;  2BGF A;  4K3R A;  4NAM A;  1NEN B;  1XF5 L;  2IYD B;  1WIA A;  2Y5C A;  2WXF A;  1WJ6 A;  1XLO A;  3ZJT A;  1PQS A;  2KN4 A;  1R4N I;  4PK1 A;  1TIF A;  3B2G A;  1JWU D;  1BUI C;  1GC6 A;  3P4P B;  3H6N A;  1JQJ A;  4YSY B;  1IBX B;  1D5M C;  1XCT L;  2PTL A;  2JUO A;  4AP4 C;  1E7V A;  2ASQ A;  5J2R A;  2OJW A;  2R61 A;  2DNF A;  2V1Y A;  3AB5 A;  3DVG X;  1QOB A;  3PLV A;  2L8J A;  3VXW A;  1K52 A;  2D2Q A;  1V8C A;  3WAL A;  4B95 A;  1SJE D;  1MG8 A;  2WXP A;  1WYW B;  3GP7 A;  1V1P A;  1WYG A;  5TSS A;  2JY6 A;  2D10 A;  4BKG A;  1TTN A;  4RM8 A;  2NMQ A;  1VJK A;  3IT4 B;  1AAR A;  4EKU A;  2GBK A;  3AE2 B;  3B2F A;  5LXI B;  1XLP A;  1TJE A;  2M8S A;  1A70 A;  4G3X B;  5IKC M;  3BK2 A;  2RGF A;  1GOZ A;  1KLU D;  2EMS A;  2FUG 1;  2JWZ A;  4ZRI A;  2ON8 A;  3APC A;  2PVG C;  2KQ4 X;  4F1S A;  3ZIM A;  2NVU I;  1RFK A;  2LXA A;  2ZVN A;  3ZVV A;  1FNU A;  3SEB A;  4JPS A;  4M02 A;  3A9J B;  1WF9 A;  3OWE B;  2K9X A;  3UF8 A;  2L76 A;  1VZ7 A;  4Q2J A;  3QIJ A;  2D3C A;  1E8Z A;  3BEP A;  2M1M A;  2CHZ A;  4WQO B;  1YN4 A;  3PO0 A;  4NAW A;  1WGH A;  4LNI A;  5CHF A;  2JWU A;  4IWP A;  4UDU C;  2O6V D;  3HHM A;  1C4P A;  2QJL A;  2FNJ B;  2K8C A;  2KJH B;  2NBU A;  3W5U B;  2GBJ A;  4RF0 A;  3UIN B;  2RPV A;  4BOS C;  4TR8 A;  3L4P A;  1WJN A;  2LGD A;  3L0X A;  2EKI A;  4A20 A;  1OQY A;  5E6O A;  3AE6 B;  3ZGZ A;  4AWJ A;  2J53 A;  1TY2 A;  4IM2 A;  3A1Q B;  1HXY D;  2JF5 A;  3LXF A;  4TR6 A;  1A5R A;  1C1Y B;  2LUE A;  1HZ5 A;  3NZ3 A;  4JWS C;  1UBQ A;  2QDF A;  2KT7 A;  4RKI A;  3WCQ A;  2JX5 A;  3C0R B;  1HQR D;  2KAJ A;  3APD A;  3VVW B;  1I7H A;  2BBC A;  5FRQ A;  4PS7 A;  3TEY A;  3PLU A;  1Q5W B;  3PGE A;  3ZDM C;  3DBH I;  1ZXH A;  2WXJ A;  4PS8 A;  4W9L A;  4II2 B;  2WXK A;  2FCM A;  4MT5 A;  1L6U A;  3A4R A;  3SFE B;  4KGS A;  4GU2 A;  2KHW B;  2IY0 B;  1HA5 A;  1XO3 A;  2KC1 A;  2MJD A;  1H8C A;  1TKE A;  5FR3 A;  2KWD A;  1PGX A;  1WWT A;  4ICU A;  4OW0 A;  4MSM B;  3AE9 B;  3L54 A;  3TL5 A;  1T5X D;  3CSF A;  4USA A;  2K22 A;  1PDX A;  2K8B A;  4M8N A;  4YXD B;  4C80 A;  1HE8 A;  2RDH A;  2BTE A;  2L52 A;  4P16 A;  1C4A A;  4ZRQ A;  3ALB A;  4IOI E;  1QOG A;  2J0K A;  3L10 A;  1TYG B;  2KQ7 A;  3EGR A;  2N9L A;  1R4M I;  2AL3 A;  2IO3 B;  3BVM A;  1V1O A;  4WAF A;  1OQQ A;  1ZOY B;  2NTT A;  4XDD A;  4DK5 A;  3ENE A;  1WGY A;  2TSS A;  4C4V B;  4XGA B;  1I35 A;  1WMH A;  1LO5 D;  2DAJ A;  2KYW A;  3WA0 A;  3MHS D;  3R7Q A;  3VH4 B;  2IJ0 A;  4C56 C;  3L0W A;  2MH7 A;  4MM3 A;  1WH3 A;  1VCB A;  1T0S C;  1ZDV A;  3QAR A;  1J7B A;  3A4S C;  2DYM A;  3VTV A;  2BB5 A;  3VAW A;  1QLB B;  3D1F A;  2ZNV B;  1D3Z A;  1WX8 A;  4RNA A;  5BYS A;  3ETR A;  1X1M A;  2JZ3 B;  1UD7 A;  2L0T A;  2BPS A;  2WXR A;  4DXG A;  4L2Y A;  3PZ7 A;  2D3B A;  3Q6B A;  2E3T A;  2DZJ A;  2PVO D;  1Q1O A;  2KDF B;  2KTF A;  3CMM B;  3GB1 A;  4PYZ A;  3PRZ A;  1FXI A;  1WXM A;  1YQB A;  4N9F 4;  3S2A A;  1S3S G;  3KYD D;  4KZC A;  2ZPY A;  2FIF A;  3UI3 A;  3UIO B;  1T0R C;  1UGM A;  3P1M A;  2KFJ A;  1M94 A;  3B08 A;  1R4M B;  3RCZ A;  1JQL A;  1SE9 A;  4URK A;  3U30 A;  4RMA A;  3DBR I;  2GMI C;  3Q8E A;  3AE5 B;  4S0R A;  1WE6 A;  3Q3M C;  3GZN I;  4WJP A;  3AE1 B;  2WS3 B;  4DDI D;  2G4S A;  3MJW A;  1YD8 U;  2LI5 A;  2OJR A;  5IAA C;  5CHW A;  2KN5 A;  2IZV B;  3AEG B;  5D94 A;  3ZNG C;  3V61 A;  2M17 A;  1OGW A;  3ZRF A;  2KWC A;  4WWM A;  2QMT A;  2K0P A;  1V5T A;  2ZEQ A;  2UWQ A;  1PGA A;  5DCN A;  4EZK A;  5H92 C;  2INP E;  2DX5 B;  2N1W A;  2GBM A;  4HPM B;  5BO4 B;  4CQN A;  5JH5 C;  3QSB A;  4ZRK A;  5G2N A;  3FC4 A;  3AEB B;  3KVF B;  1KLG D;  1V1P B;  2O2V B;  2HTH A;  3P4Q B;  4G50 A;  4WJN A;  5HHD G;  1ISN A;  1SJH D;  5C1Z A;  2KFK A;  4K3S A;  4M8M A;  2VH2 A;  2J0J A;  1L0X B;  2GBN A;  3VUX A;  1L4Z B;  4TKN A;  1UUP A;  3SFD B;  3M62 B;  1B1Z A;  1QOF A;  4OVF A;  5EE1 A;  3V62 A;  3TUO A;  1L2N A;  1I4P A;  1VRA B;  3K9O B;  4W9F A;  5EE0 A;  3PPA A;  1NVI D;  3Q4K A;  1U4A A;  4MGZ E;  3R66 C;  1N62 A;  3IAS 1;  2OED A;  3IT6 B;  4HPL B;  4TQ1 A;  2QEJ C;  3TEW A;  3A9J A;  3WAO A;  2ICI A;  1SXT A;  2DBY A;  1FIQ A;  3IHP C;  4MH0 E;  2MQJ A;  1EO6 A;  4PNW A;  3RUI B;  2AQ1 B;  1T6B X;  2O6V A;  5D6J B;  2G4D B;  1OEY A;  5AGV A;  3VR8 B;  1NYQ A;  3P63 A;  4GIV A;  3FIL B;  2VRR B;  3N1Y C;  1L0Y B;  1LXD A;  3AE4 B;  2KD0 A;  5HG2 A;  3MFG A;  4FN2 A;  2QIL A;  4KIK A;  3HRD D;  2KLG A;  1KOT A;  4HEA 1;  4LNO A;  2LGS A;  3HIZ A;  2K39 A;  2DZI A;  1MMI A;  3W9C B;  1XT9 B;  2AQ2 B;  3LJ3 A;  5TR5 A;  3CST A;  1LQB A;  4ZRJ A;  4N9A A;  3ML9 A;  1TZ1 A;  1YN3 A;  5D2M B;  3ZW3 A;  1WR6 E;  2VZK D;  4W9G A;  1XQQ A;  2I1J A;  1E90 A;  2YLM A;  5BMG A;  3BVZ A;  1H4R A;  2MCN B;  4JWU C;  2FCS A;  1XEE A;  3L17 A;  4KDI C;  3OAW A;  3RNF C;  2K25 A;  2NTS A;  4WIP A;  3H7P B;  3DPD A;  2PW9 A;  3NJT A;  5AUK A;  2BYV E;  2WXL A;  3ECI A;  4US9 A;  2LUM A;  4ANW A;  3TCA A;  5J18 A;  1T3Q A;  3DBS A;  4YT0 B;  2WXH A;  3HVZ A;  1WM3 A;  3C19 A;  2IGG A;  2N9P C;  1L7Y A;  2BQQ A;  2Z0D B;  1CJE A;  2C5L C;  4AUQ C;  3VRB B;  4S17 A;  4WQM A;  4AQ7 A;  2FCQ A;  3VUW A;  3I9V 1;  1ZE3 D;  1J19 A;  4I6L B;  3J9C A;  2KK8 A;  5FK9 C;  2MBB B;  3BYT B;  2IBI B;  4NQL B;  1V5O A;  4NQK E;  1YNT E;  2BWF A;  5IP4 D;  4ZHP A;  4IKG A;  2ZW1 A;  1QIL A;  3RN9 C;  4NPN A;  1JWA D;  1RAX A;  4MJQ A;  1UH6 A;  3N3K B;  2JU6 X;  5EDS A;  2KLC A;  3TEZ A;  3NVV A;  1Z2M A;  2IO2 B;  3WAM A;  3VQI A;  4N96 A;  1N5X A;  1M4V A;  4C7Z A;  2K3U A;  1Y56 A;  3OJ4 B;  3VH3 B;  3N32 A;  3IVF A;  4NZL B;  2V4L A;  4M0W B;  3LDZ E;  3JYU A;  4XZ4 A;  3HK0 A;  3O13 A;  3DHG C;  1WFY A;  1P98 A;  4YSZ B;  1UGJ A;  2ZVO A;  1MHH E;  4K3C A;  2ACZ B;  2B3A A;  4B6W A;  3R2T A;  4TR7 A;  2YVC A;  2Z8L A;  2Y5B B;  1PFD A;  2LJ5 A;  2NPT B;  3RB9 A;  2DYB A;  5E6J A;  3CF6 E;  3P4R B;  4P6V F;  3DVN U;  1P7E A;  3ZDT A;  4KZ0 A;  4HXD A;  4DXF A;  4NJC A;  3V05 A;  1IPG A;  2NR2 A;  3BVG A;  2RPQ A;  4PYU A;  3O65 B;  3DBR B;  1YX6 B;  2A5U A;  3P16 A;  2K6D B;  4P1B C;  2MJE A;  3B9J A;  2WDQ B;  5JZE B;  1UZX B;  1CMX B;  5EE3 A;  2LVP A;  3TMP B;  2L1A A;  1L6V A;  1EU4 A;  2M19 A;  4K7W A;  5E6P A;  4C4V A;  2KKC A;  1E5W A;  4EZJ A;  1SBB B;  4J3O D;  1P9D U;  3L08 A;  4L1B A;  3SHQ A;  1SE3 A;  2XBB C;  3D32 A;  2NBV B;  3AMZ A;  3ZYY X;  4OHJ A;  1PYW D;  5IN7 A;  4FLH A;  3I57 A;  1E7U A;  3RI7 C;  2KVR A;  4K81 A;  5HFY A;  2WP9 B;  2M56 B;  3BIN A;  3Q3N C;  1YJI A;  3U7Z A;  3AEA B;  3DDC B;  2B76 B;  1SSN A;  3GE3 C;  3LB8 C;  3MTN B;  1AW7 A;  4W9H A;  1FCC C;  5DPS A;  3ZNI D;  4BBN C;  1WXV A;  1F1H A;  3I63 C;  4IWQ A;  1KFY B;  1QT9 A;  4KSK C;  1WRD B;  2N9X A;  4ZHO A;  4OVH A;  4NJ7 A;  4RM9 A;  3ZTD A;  3RNG C;  3W5V B;  4IUM B;  4OZB A;  4YSX B;  2WLB A;  3MJ5 A;  2Y3A A;  3EA6 A;  2V3P A;  3EHV A;  3PRM B;  1XLQ A;  3M63 B;  2A4Z A;  2QIE B;  2V3S A;  1NDD A;  5AUI A;  1P0R A;  1SIJ A;  1V2Y A;  1G6J A;  3NG0 A;  2DAF A;  2PE9 A;  1QF6 A;  3JSV A;  3AU5 A;  4K3Q A;  3VDZ A;  1NYR A;  2J42 A;  3Q2A C;  4FJY A;  3URY A;  4KGT A;  2ZPN A;  1SE2 A;  2DZK A;  2XK5 B;  2MLB A;  1LFD A;  1E7P B;  3PZ8 A;  5EE9 A;  3ZQ4 A;  1D5X C;  4LNK A;  2IGH A;  1DGJ A;  3PHW B;  1YQ3 B;  2CHX A;  4XDC A;  2K6Q A;  3NVZ A;  2JRH A;  4JE3 B;  5CHV C;  1WXQ A;  1ET9 A;  4ANU A;  3EC8 A;  1WRI A;  3M95 A;  1V97 A;  4GDL B;  1XCQ L;  4N97 A;  4K1R B;  4BBN F;  2JYE A;  1MI0 A;  2N7E A;  2WXO A;  2M0X A;  4TMA B;  2D3A A;  1P7F A;  1WGD A;  1WX9 A;  1KF6 B;  4MJS B;  3V3X A;  3WIM A;  3A9K A;  4IW0 A;  3P4S B;  3Q14 C;  2Q5W D;  2JZZ A;  4EZL A;  2LXC A;  1FFU A;  2G3Q B;  1I4H A;  2QC8 A;  2N9K A;  3SR6 A;  4IC7 B;  2DZM A;  3FKY A;  1WE7 A;  1V6E A;  1UBI A;  2MHJ A;  5AGU A;  3QA8 A;  3QAQ A;  2WNM A;  4CHK A;  4RFB A;  2INC C;  1ENF A;  2BYE A;  4EFO A;  4US8 A;  2H89 B;  3DVG Y;  3AE3 B;  2EKE C;  1VD2 A;  4FHJ A;  1JCK B;  1RWS A;  3L10 B;  3N1Z C;  4B9K A;  1ZGU B;  4LLG M;  2INN E;  4XE0 A;  1UNN A;  3DVN V;  3RMK C;  1UEL A;  3KUC B;  2O6V B;  4N95 A;  4IM3 A;  4PT5 A;  1VR9 A;  1OEY J;  4BOZ B;  1SGH A;  4C7Y A;  3JSV B;  1P1A A;  1WMH B;  5AH4 A;  1EF1 A;  3QCA A;  2GI9 A;  2KZR A;  2ZCB A;  4ZOH C;  4N98 A;  1E6E B;  1IGC A;  1HEZ E;  3IAM 1;  3HVD A;  1WGR A;  4W9D A;  3W2D A;  1EUV B;  1DOX A;  4LNF A;  4N94 A;  4I6P A;  4A3O A;  4GLS C;  4HKQ A;  1WSP A;  2K8H A;  3DWG C;  2DYO A;  5BYR A;  1WGK A;  4NJ6 A;  2BKF A;  2IND C;  2ZJD A;  2N9E B;  4LCD E;  2BS2 B;  2KAN A;  2KDB A;  3TBL D;  4HDQ A;  3U7D A;  3AUL A;  2H88 B;  2J52 A;  2LFI A;  1XLN A;  3BY4 B;  3PRP B;  4P7I A;  4AOF A;  4ARC A;  1V86 A;  1WM2 A;  3KUZ A;  4ZDV A;  5KHO A;  4HKZ E;  1F2R I;  2LHD A;  3T3N A;  1BML C;  2IGD A;  2Y5P A;  1TBE A;  1KM7 A;  4OVZ A;  4MEL A;  3OLM D;  1J8C A;  2PMV A;  1VLB A;  1ZUD 2;  2MBE A;  5GXG B;  4OZC A;  3L0W B;  5G5G A;  4GDK A;  1E8Y A;  2DEN B;  1R7S A;  5HKH A;  4WWN A;  3NRZ A;  3PRE A;  3NY5 A;  4JLC A;  2G45 B;  4D2K A;  2MJ3 A;  1F77 A;  1NBF C;  5D3D A;  2J0M A;  4WH4 A;  4K7U A;  2C7M B;  3DBL I;  4GMV A;  1GJZ A;  2RSU A;  2SEB D;  4KDL B;  1K51 A;  4JQW C;  1GUA B;  3U8Z A;  2GB1 A;  1F52 A;  2G1E A;  1V80 A;  4A9A A;  2KFK B;  1J7C A;  4MSQ B;  1UNS A;  1N6Z A;  2QCZ A;  3BK1 A;  3H7S A;  4FJZ A;  2NCN A;  3RPF C;  5D7G A;  2RDG A;  1LM8 B;  1V9J A;  2D07 B;  1SB3 C;  2LMC A;  5IOI A;  4K3K A;  3L0X B;  2JPH A;  3QC8 B;  2GOW A;  4K3B A;  1IP9 A;  3MHZ A;  2BF8 B;  2JXX A;  2MSE D;  1ZXI A;  5AZF A;  4BKS A;  1JWB D;  1GB4 A;  2WWZ A;  1GG3 A;  3DQV A;  4RF1 A;  1E0Z A;  1EU3 A;  1P3Q U;  4JGH B;  3VHT C;  2E6X A;  2G9H D;  3W1S A;  3VR9 B;  1BT0 A;  2LEK A;  4TRT A;  3B1L X;  4HPP A;  2MW5 A;  1V49 A;  1Q0W B;  4CYE A;  1UWX A;  2WU5 B;  2N1V A;  4ACF A;  4EE2 A;  3R8B A;  1C78 A;  1FO4 A;  4W9C A;  2RR9 A;  4IWO A;  1JWS D;  2WQY B;  5G55 A;  2DHZ A;  2FID A;  4A90 A;  1DYQ A;  2LAS A;  3FIL A;  2NPT A;  4RGN A;  4RGO S;  5D3I B;  2KMA A;  4IM0 A;  1IGD A;  1YQ4 B;  4C00 A;  5L83 A;  2J4X A;  4HK2 A;  4W9I A;  1Y8R C;  4P1C C;  2DLB A;  1C76 A;  1QOA A;  1VZ8 A;  1TY0 A;  3AED B;  1RYJ A;  1FCL A;  5DPT A;  3UGB B;  4M00 A;  3FAH A;  3RNC C;  3GS2 A;  3AE7 B;  4PNV A;  3DBH B;  2L05 A;  5JXV A;  4KSL C;  3DOW A;  2BKR B;  3U4E G;  2O2V A;  3BWU D;  3EFC A;  4RCO A;  4K3L A;  1N60 A;  5AH2 A;  1XD3 B;  3GZN B;  4YL8 A;  3RD2 A;  2BYF A;  4GGQ A;  1JW9 D;  3H7P A;  2FUH B;  2VZK B;  3AU4 A; 
#chains in the Genus database with same CATH homology
 3ALB A;  5J17 A;  1WX7 A;  4TUU A;  2J0K A;  3VTU A;  4K7W A;  5LLI A;  4MGK E;  5E6P A;  5IA7 A;  4DHJ D;  2KQ7 A;  5CX3 A;  2KKC A;  3A33 B;  1E5W A;  1R4M I;  2AL3 A;  4WWO A;  4DBG A;  4EZJ A;  2IO3 B;  5DPR A;  2UYZ B;  2I1K A;  1P9D U;  1WI0 A;  2KX0 A;  3L08 A;  3SHQ A;  2XBB C;  1K8R B;  3D32 A;  2NBV B;  2GBR A;  4LJP B;  4DK5 A;  3RUL A;  3ENE A;  3X23 A;  2MBO A;  4FLH A;  1WGY A;  2KOX A;  2XEW A;  1E7U A;  4ASW C;  1I35 A;  2KVR A;  4K81 A;  1WMH A;  2DAJ A;  3ONS A;  2MBQ A;  3WA0 A;  4HCP B;  3BIN A;  5DPW A;  2R2O A;  3MHS D;  3R7Q A;  3VH4 B;  2PJH A;  1TGZ B;  2LRW A;  4BKS D;  4GXB A;  4GDK B;  2KMC A;  4MM3 A;  4W9E A;  2MWS B;  4DHJ B;  2LWP A;  1WH3 A;  3DDC B;  1VCB A;  3SD5 A;  3WAN A;  3KH0 A;  4BVU C;  3QAR A;  4MDK E;  3MTN B;  4W9H A;  3W1S C;  5AEK B;  5DPS A;  3A4S C;  3ZNI D;  3PHX B;  4BBN C;  4HVB A;  3IFW B;  2DYM A;  1YIW A;  3VTV A;  3PT2 B;  5AZH A;  3VAW A;  4F8C B;  2ZNV B;  4TV3 A;  2LZ6 A;  1WXV A;  2NBW B;  2Z0E B;  2KC2 A;  1D3Z A;  4IWQ A;  3ZUN A;  3DCG A;  1WX8 A;  1WRD B;  2N9X A;  4KSK C;  4ANX A;  4NJ7 A;  4RM9 A;  4W9K A;  1X1M A;  3ZTD A;  1OTR B;  2LVO A;  2JZ3 B;  1UD7 A;  4MGI E;  3TIX A;  2KO3 A;  4IUM B;  3NZU A;  2C7N B;  2C60 A;  2L0T A;  3RZF A;  2BPS A;  3IG3 A;  4ZYN A;  3EHV A;  3PRM B;  4KV2 A;  4MEM A;  2DZJ A;  3M63 B;  1Q1O A;  2KDF B;  2KTF A;  2HE7 A;  3CMM B;  3NZS A;  2A4Z A;  2C9W B;  2W9N A;  3PRZ A;  4PYZ A;  1E8X A;  5AZG A;  3ZTC A;  1WXM A;  2V3S A;  3H1U A;  1YQB A;  1NDD A;  2MP2 A;  2QHO A;  2AL6 A;  4HCN B;  4N9F 4;  1P0R A;  2CKH B;  4XC2 A;  3S2A A;  1V2Y A;  1G6J A;  1S3S G;  4A3P A;  1WJ4 A;  4OVU A;  3KYD D;  1WZ3 A;  2DAF A;  4DHZ E;  2AEH A;  3VFK A;  2PE9 A;  4KZC A;  3X0W A;  2C7H A;  2ZPY A;  3WAP A;  3JSV A;  2L3Z A;  3HM6 X;  3AU5 A;  2FIF A;  4FHK A;  3EFU A;  3UIO B;  2WYQ A;  4DDG D;  3QQ8 B;  3VDZ A;  1UGM A;  2D3G A;  2KFJ A;  1M94 A;  2LD9 A;  3B08 A;  4FJY A;  2D11 A;  1KLV A;  3RCZ A;  4E71 A;  1SE9 A;  4URK A;  3U30 A;  2KWU B;  3Q3F A;  4RMA A;  2ZPN A;  3DBR I;  4OVV A;  2GMI C;  2CHW A;  2DZK A;  2XK5 B;  1QZE A;  3L13 A;  1WE6 A;  2HD5 B;  4WJQ A;  2MLB A;  1LFD A;  5E6N A;  2WX0 A;  3GZN I;  3GOE A;  4WJP A;  5JHB A;  4NY0 A;  1WGG A;  4GDL A;  1ZKH A;  3PHW B;  3PTF C;  3M3J A;  2G4S A;  3NS8 A;  4DDI D;  3MJW A;  2CHX A;  2HJ8 A;  2RD0 A;  2K1F A;  4DHZ B;  2K6Q A;  2JRI B;  4K7S A;  2LVQ A;  3RT3 B;  1YD8 U;  4I6N B;  2JRH A;  2LI5 A;  3PSE B;  2KNB A;  2JVC A;  4J6I A;  2OJR A;  4IG7 B;  5CHV C;  5IAA C;  3H9D A;  4JL9 A;  3QK0 A;  5CHW A;  4ANU A;  2KN5 A;  3EC8 A;  2IZV B;  3R3M A;  3M95 A;  5D94 A;  4GDL B;  3ZNG C;  3V61 A;  3T9L A;  2M17 A;  4K1R B;  4BBN F;  1EF5 A;  1OGW A;  4XX5 A;  2KJ6 A;  3ZRF A;  2IO1 B;  2KWC A;  2N7E A;  2M0X A;  3NOB A;  4FA6 A;  3RYT A;  4EEW A;  1WGD A;  1V5T A;  1WX9 A;  2ZEQ A;  4E3C A;  2UWQ A;  2CS4 A;  3R7R A;  4MJS B;  2JT4 B;  5DCN A;  3KUD B;  3VTW A;  4EZK A;  3WIM A;  1GC7 A;  3A9K A;  4IW0 A;  1T0Y A;  2DX5 B;  3AI5 A;  4PS3 A;  2N1W A;  4JIO U;  2GBM A;  4HPM B;  1SIF A;  5BO4 B;  2JZZ A;  4HJK A;  4EZL A;  2LXC A;  5CTR C;  2MA9 B;  5JH5 C;  2G3Q B;  4ZRK A;  5G2N A;  4IC7 B;  3UIP B;  1I42 A;  4FJV B;  4NNJ B;  3ZLZ A;  2DZM A;  3UQB A;  3KVF B;  2MRP A;  2O2V B;  1WE7 A;  3A9K B;  2HTH A;  3KYC D;  1V6E A;  4HLE A;  1UBI A;  4G50 A;  4WJN A;  3QA8 A;  1ISN A;  5C1Z A;  2KDI A;  2KFK A;  4HWI B;  2ZCC A;  2BWE S;  2LGX A;  3QAQ A;  4M8M A;  5L95 C;  2J0J A;  2GBN A;  4GB9 A;  3VUX A;  4CHK A;  4GN1 A;  3ZKJ C;  4TKN A;  2CR5 A;  4KVG B;  2BYE A;  4EFO A;  3NHE B;  1JRU A;  2PEA A;  3DVG Y;  3JW0 X;  3M62 B;  2PPH A;  1WXA A;  3V62 A;  2EKE C;  1WR1 A;  1VD2 A;  4FHJ A;  3AXC A;  1L2N A;  3K9O B;  2AWT A;  4W9F A;  3PPA A;  3L10 B;  4WWP A;  2Z59 B;  4W9J A;  4B9K A;  3Q3J A;  3SDL C;  1ZGU B;  1U4A A;  5GMV A;  4MGZ E;  3R66 C;  5KHQ A;  3JVZ X;  3DVN V;  1RFA A;  1UEL A;  3EEC A;  3KUC B;  4HPL B;  4CO7 A;  4TQ1 A;  2O6V B;  4FBJ B;  4FAD A;  4IM3 A;  2KJR A;  3A9J A;  3WAO A;  4X57 B;  1E8W A;  3IBE A;  4GSW A;  1OEY J;  3QX1 A;  4BOZ B;  3IHP C;  2MX2 A;  1SGH A;  3APF A;  4LDT D;  3JSV B;  4MH0 E;  2IO0 B;  3A1Q A;  2MQJ A;  1EO6 A;  1P1A A;  1WMH B;  4HDO A;  3RUI B;  4NAW B;  1J0G A;  4G11 A;  2O6V A;  3ZO5 B;  1C3T A;  2ZZP B;  5D6J B;  1EF1 A;  3ZRC A;  2G4D B;  3QCA A;  1OEY A;  4G0N B;  1RRB A;  2BGF A;  2KZR A;  2R2Q A;  2ZCB A;  2LGY A;  2IYD B;  4GIV A;  4LJO B;  2VRR B;  1WIA A;  1LXD A;  1GNU A;  1WGR A;  3SU8 X;  2KD0 A;  4W9D A;  3V6C B;  3W1Y A;  1WJ6 A;  4GOC A;  1EUV B;  4FN2 A;  1PQS A;  3HM3 A;  1R4N I;  3K9P B;  4I6P A;  4KIK A;  4A3O A;  1RLF A;  2J7Q B;  2KLG A;  1KOT A;  2K8H A;  3HIZ A;  2DYO A;  3PS6 A;  1GC6 A;  2K39 A;  2DZI A;  4DWF A;  4AJW A;  1YX5 B;  1ZW7 A;  3H6N A;  4NJ6 A;  2BKF A;  1XT9 B;  2ZJD A;  2N9E B;  1Z5S B;  2WDT B;  3LJ3 A;  4LCD E;  2KAN A;  2KDB A;  3TBL D;  4HDQ A;  3U7D A;  5TR5 A;  3CST A;  5FR6 A;  1LQB A;  2XK5 A;  3AUL A;  3N30 A;  4ZRJ A;  3ML9 A;  1TZ1 A;  3BY4 B;  4AOF A;  3PRP B;  4P7I A;  2JUO A;  5JHA A;  4AP4 C;  1E7V A;  1V86 A;  1WM2 A;  2ASQ A;  5J2R A;  2V1Y A;  3PLV A;  3DVG X;  5D2M B;  3KUZ A;  1WR6 E;  2L8J A;  3ZW3 A;  3VXW A;  4W9G A;  2EMT A;  1XQQ A;  4ZDV A;  1WJU A;  2I1J A;  5KHO A;  4AJY B;  1E90 A;  2YLM A;  2D2Q A;  3WAL A;  4B95 A;  1H4R A;  1MG8 A;  1TBE A;  1KM7 A;  2MCN B;  4MEL A;  3OLM D;  3V6E B;  2FCS A;  1WYW B;  2KX3 A;  1J8C A;  3L17 A;  4KDI C;  3OAW A;  2L00 B;  2K25 A;  2JY6 A;  2D10 A;  3H7P B;  4BKG A;  3DPD A;  2MBE A;  1TTN A;  3L0W B;  4GDK A;  2KTR B;  1E8Y A;  2DEN B;  4RM8 A;  3ZNH B;  2OOB B;  2BYV E;  5HKH A;  3PVL A;  3ECI A;  4WWN A;  1AAR A;  4EKU A;  2GBK A;  4BKT A;  3PRE A;  3NY5 A;  2FAZ A;  4JLC A;  2G45 B;  4ANW A;  1NBF C;  2N4F A;  3TCA A;  5LXI B;  2WX1 A;  5J18 A;  2M8S A;  4G3X B;  2J0M A;  3DBS A;  4K7U A;  4DXA B;  2C7M B;  2RGF A;  3I3T B;  3DBL I;  2EMS A;  2JWZ A;  1WM3 A;  4GMV A;  4MGY E;  3PV1 A;  3PZD A;  4ZRI A;  2N9P C;  1GJZ A;  1L7Y A;  2RSU A;  2Z0D B;  2C5L C;  3APC A;  4KDL B;  4AUQ C;  3VUY A;  4F1S A;  4JQW C;  1GUA B;  3U8Z A;  2NVU I;  3T8M A;  3ZIM A;  3ZNZ B;  1FXT B;  2LXA A;  2ZVN A;  3ZVV A;  2FCQ A;  3VUW A;  3P2B A;  3A9J B;  1WF9 A;  1J19 A;  1V80 A;  2KDE B;  4I6L B;  3UF8 A;  2L76 A;  2KFK B;  2KK8 A;  4MSQ B;  2MBB B;  3H7S A;  3QIJ A;  4II3 B;  2IBI B;  4FJZ A;  2NCN A;  4NQL B;  1E8Z A;  5D7G A;  1V5O A;  2M1M A;  2CHZ A;  4NQK E;  1LM8 B;  2BWF A;  4WQO B;  1KJT A;  1V9J A;  2D07 B;  4NAW A;  2N7D A;  4WAA A;  2REX A;  1WGH A;  2MBH A;  3L0X B;  2JPH A;  3ML8 A;  3QJZ A;  3QC8 B;  1IYF A;  2GOW A;  4NPN A;  5CHF A;  1IP9 A;  4WJO A;  1V81 A;  4IWP A;  5LXH A;  2O6V D;  3HHM A;  2BF8 B;  1RAX A;  2FNJ B;  2JXX A;  2K8C A;  1UH6 A;  2KJH B;  2MSE D;  1YJ1 A;  2LRU A;  2NBU A;  5AZF A;  3V60 A;  4BKS A;  2IY1 B;  3N3K B;  5EDS A;  2GBJ A;  3UIN B;  2KLC A;  2WWZ A;  4TQ0 A;  4BOS C;  1GG3 A;  3DQV A;  1WJN A;  2LGD A;  1P3Q U;  4JGH B;  4A20 A;  1OQY A;  5E6O A;  3VHT C;  3QHT A;  3RZW C;  3W1S A;  1BT0 A;  1Z2M A;  2IO2 B;  3B1L X;  3WAM A;  3VQI A;  4E74 A;  4AWJ A;  4IM2 A;  2MW5 A;  1V49 A;  1Q0W B;  3A1Q B;  1NI2 A;  4CYE A;  2JF5 A;  2MP2 B;  1A5R A;  1C1Y B;  2LUE A;  3OJ4 B;  2N1V A;  3VH3 B;  3N32 A;  3IVF A;  1UBQ A;  4LDT B;  2V4L A;  4M0W B;  3LDZ E;  1S1Q B;  3JYU A;  4XZ4 A;  3C0R B;  4W9C A;  2RR9 A;  3HK0 A;  4IWO A;  5G55 A;  3APD A;  2DHZ A;  2FID A;  3VVW B;  2LAS A;  2NPT A;  3AU4 A;  1WFY A;  4PS7 A;  2KMA A;  2ZNV C;  4F7Z A;  4IM0 A;  3PLU A;  1P98 A;  3UQA A;  5L83 A;  2ZVO A;  1Q5W B;  3OJ3 A;  3PGE A;  4HK2 A;  4W9I A;  3ZDM C;  1Y8R C;  3DBH I;  2AYO B;  4PS8 A;  2B3A A;  4W9L A;  4B6W A;  4II2 B;  2KWV B;  2M4N A;  2FCM A;  4FUL A;  2YVC A;  4MJS A;  4ANV A;  2L7R A;  2Y5B B;  3A4R A;  2LJ5 A;  2NPT B;  4GU2 A;  5DPT A;  2DYB A;  3CF6 E;  3DVN U;  3UGB B;  1WXS A;  2KTR A;  3KW5 B;  3ZDT A;  2KHW B;  4EUT A;  4KZ0 A;  2IY0 B;  2L05 A;  4HXD A;  4KSL C;  2KC1 A;  1IPG A;  4EOY A;  2FCN A;  1H8C A;  3QWZ B;  2NR2 A;  4BFR A;  3DOW A;  2BKR B;  2PE6 B;  2RPQ A;  4PYU A;  1F9J A;  2O2V A;  2CU1 A;  2L0F A;  3O65 B;  4ICU A;  4ICV A;  4MSM B;  3L54 A;  3TL5 A;  1YX6 B;  2A5U A;  3L16 A;  3CSF A;  1XD3 B;  2K6D B;  2KXJ A;  2K8B A;  3TJP A;  4M8N A;  4YL8 A;  1WY8 A;  3B0A A;  2BYF A;  4GGQ A;  3RD2 A;  1HE8 A;  4KIK B;  5C23 A;  2KQS A;  5JZE B;  1UZX B;  1CMX B;  3H7P A;  2FUH B;  2LVP A;  1WZ0 A;  3TMP B;  2NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...