3PGEA

Structure of sumoylated pcna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
173
structure length
172
Chain Sequence
KPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-modified proliferating cell nuclear antigen
publication title Crystal Structure of SUMO-Modified Proliferating Cell Nuclear Antigen.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 28
structure length 172
sequence length 173
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3pgeA01
3.10.150.20 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III; Chain A, domain 2 3pgeA02
3CSFA 2C60A 2CS4A 2L0TA 4WJNA 1IYFA 3GZNI 3O65B 4BBNF 2LRUA 4EKUA 3VUWA 2KFKB 3ZVVA 3QCAA 2KTRB 2KK8A 5AEKB 1WI0A 3VUXA 2CHXA 3ZNZB 2CKHB 4HPMB 4RMAA 4WJQA 5CTRC 3Q3JA 4HCPB 2KOXA 4ZDVA 4IW0A 2ZPNA 3DBHI 2BWFA 3VH3B 5LXIB 3AU5A 4IWQA 4WAAA 5E6OA 3P2BA 1UGMA 3U8ZA 3RUIB 4HK2A 4M8NA 2K1FA 4G50A 2AL3A 2BF8B 3ZW3A 1F9JA 4HCNB 4EEWA 4A20A 4NNJB 3QAQA 3PGEA 4FN2A 4P7IA 3UQAA 1Q0WB 4EOYA 2KXJA 1Y8RC 2L0FA 4HWIB 4FJYA 3V6CB 1XT9B 2RSUA 2KLCA 2KDEB 4G11A 4HDOA 5AZGA 2NPTA 4HDQA 2LZ6A 2OOBB 3W1SA 4E74A 4J6IA 2DHZA 2KQ7A 3K9PB 3A1QA 1OEYJ 2LVPA 2Z59B 3RZFA 3PV1A 3T9LA 4IG7B 1D3ZA 3PREA 4CYEA 1FXTB 2MBQA 2FCQA 4W9LA 4MGKE 1OEYA 2LVQA 3JW0X 3WANA 3LDZE 3PVLA 4FJVB 3VDZA 1L2NA 2QHOA 1R4MI 5J2RA 5JHBA 3UINB 2IO3B 3ZKJC 2FCSA 2N1WA 4MH0E 3VAWA 4ZRIA 2BGFA 2M1MA 3PLUA 4WWOA 1WJUA 3H7PA 4LDTD 5L95C 1EF5A 4JLCA 2WDTB 1WMHA 4LJPB 4MELA 3EFUA 3ZO5B 3V62A 1WGDA 2MP2B 1GNUA 3VQIA 4AJWA 2KC1A 4KVGB 2NCNA 4A3PA 4K81A 4WJOA 3Q3FA 3ALBA 2Y5BB 1NBFC 3ZTCA 2KNBA 2CHWA 2WX1A 5LXHA 2HD5B 2DAJA 2XEWA 4ZYNA 3RCZA 2YLMA 3L54A 2IY0B 4HXDA 4K1RB 4PS8A 4G3XB 2BKRB 1ZKHA 2O6VD 2HE7A 4KDIC 2GBJA 3RD2A 4K7SA 3HHMA 3KUZA 4I6LB 3ZNID 1YX6B 3TIXA 4DXAB 3V61A 2XK5B 2C7NB 2ZZPB 2IO2B 2C7HA 1GG3A 2DZMA 3ML8A 3B1LX 3PPAA 4II2B 3ZRCA 3D32A 1WR6E 2D2QA 5DPSA 1IPGA 3R3MA 4IWPA 1OGWA 1WIAA 3HIZA 2IYDB 4ANXA 1V5TA 2KFKA 3KUDB 2KTRA 2L76A 2NS5A 2N1VA 2BYVE 4GDKB 4ZRJA 3R7QA 3WALA 3WA0A 3X0WA 2FIDA 2ZVNA 2B3AA 1RRBA 1E8WA 3N32A 1GC6A 3VTUA 2LJ5A 4BKSA 1WX9A 3R7RA 1E90A 3HK0A 4XZ4A 4ANUA 3PS6A 5D7GA 3M63B 5C1ZA 1E5WA 3ZIMA 4B95A 1WFYA 5DPWA 2ZCBA 3L16A 3DVNV 3ZLZA 3RYTA 5AZFA 2UWQA 3ML9A 4NAWB 1JRUA 1WXMA 2RPQA 3DBRI 3TL5A 4F7ZA 1Q1OA 2KN5A 3IFWB 5IA7A 2NBWB 2MBEA 2K8CA 2C7MB 1LQBA 3PHWB 2KDFB 2KD0A 3A9JB 4I6PA 4AWJA 3ZRFA 2L7RA 3ECIA 2KQSA 4DDID 1WF9A 2PEAA 3QA8A 2D3GA 2I1KA 2KC2A 2LASA 1XQQA 2KX0A 1P3QU 5DCNA 1KJTA 3NHEB 3H7SA 4W9JA 4TV3A 3ZUNA 3H9DA 4MEMA 1RFAA 3OJ4B 4B6WA 2GBRA 3VXWA 4FBJB 3QIJA 4M0WB 2V3SA 3A4RA 4AP4C 4DHZB 1UD7A 4BVUC 2G3QB 2JRIB 1UBIA 3PRPB 1K8RB 1C1YB 2CU1A 1CMXB 1E8XA 3QC8B 2MA9B 4ANWA 5FR6A 2MP2A 1ZGUB 1S1QB 2NBVB 4XX5A 4IWOA 1WXSA 4M8MA 3NZUA 2O2VA 4F1SA 1M94A 4W9KA 1I42A 5KHOA 1LM8B 4CO7A 4WQOB 3WIMA 4IUMB 3PRMB 3KYDD 1OQYA 1V2YA 1V6EA 4NY0A 1E8YA 1V49A 4W9HA 1WZ0A 2BWES 2MX2A 4ICUA 4WJPA 3A9KB 3LJ3A 2ZJDA 3I3TB 3CMMB 1IP9A 1ZW7A 3AI5A 4N9F4 5L83A 1V9JA 3PHXB 4GIVA 4FJZA 5CHVC 2N7DA 3W1SC 5HKHA 1EF1A 2XK5A 4IC7B 3SD5A 3L13A 1WE7A 2K25A 2KDIA 4FULA 4GU2A 3L0XB 3T8MA 1TTNA 2CHZA 1R4NI 2KANA 2MBOA 1RLFA 2ZCCA 2R2QA 1WXVA 3EHVA 3RULA 3KYCD 4MGZE 4W9EA 4GDLA 4EZKA 2K39A 2YVCA 3A4SC 4JGHB 2XBBC 1AARA 2O6VA 1S3SG 4GDKA 2NR2A 4K7WA 2PJHA 2N9EB 4IM3A 3TCAA 3H1UA 2JF5A 2KO3A 2PPHA 1BT0A 2BYEA 1VCBA 2V1YA 5BO4B 2JZ3B 2DYBA 3PT2B 2KHWB 2KJ6A 2KJHB 2G45B 4TUUA 3SU8X 3PLVA 3S2AA 2MCNB 3L10B 2KWCA 3UIPB 3H6NA 3ONSA 2AL6A 2ZEQA 1KM7A 2N4FA 3V60A 3QARA 4GGQA 4NAWA 2MBBB 2DENB 2FIFA 2FNJB 3DVGX 2Z0EB 5JHAA 2KVRA 4IM2A 3JVZX 3V6EB 5G55A 4A3OA 5KHQA 2M4NA 4E3CA 3IVFA 4W9GA 2MWSB 1H8CA 1GJZA 1TZ1A 5G2NA 5JZEB 3DCGA 1WR1A 1WX8A 1Z5SB 3M95A 3NY5A 3OJ3A 2D11A 3CSTA 3NS8A 5TR5A 4BOZB 2L3ZA 4HJKA 2JRHA 3MTNB 1WRDB 3APDA 4OVUA 2K8HA 3WAOA 4GN1A 3DPDA 4ICVA 5E6NA 2KJRA 2JZZA 5D2MB 4AJYB 1YJ1A 2PE6B 2LXAA 4F8CB 1P98A 3JSVB 1H4RA 4MGYE 4NQLB 1U4AA 2FUHB 2N9XA 2C5LC 1EUVB 4I6NB 3NOBA 5GMVA 4KSLC 1C3TA 1WMHB 2LUEA 3ZTDA 4EUTA 2N9PC 3IBEA 4KV2A 3IHPC 1UH6A 5CX3A 2DX5B 1WX7A 3KH0A 1V86A 2LGXA 2MSED 3HM6X 2ASQA 2OJRA 3SHQA 1WYWB 2EKEC 3A9KA 3BINA 1WJ6A 1SE9A 2WX0A 3ZNHB 1UBQA 2LWPA 1P9DU 2ZVOA 3ZDMC 4CHKA 4HPLB 4BOSC 4PYUA 4AOFA 5C23A 3QQ8B 4MJSB 2J7QB 4URKA 2AYOB 2N7EA 4JIOU 1A5RA 3UF8A 2RD0A 3AU4A 1P0RA 1WGRA 4FA6A 4XC2A 3VTVA 2FCNA 3SDLC 4E71A 2EMSA 2LGYA 1GUAB 2KKCA 3NZSA 5LLIA 4ASWC 5CHFA 4K7UA 5CHWA 2IZVB 3GOEA 3N3KB 4W9IA 1WGYA 5AZHA 1J8CA 2IBIB 1VD2A 4KIKB 3U30A 5IAAC 2KWUB 2Z0DB 2D07B 4OVVA 2A5UA 4TKNA 2HJ8A 2LGDA 2ZNVC 3KW5B 1I35A 2W9NA 3DDCB 1EO6A 3WAPA 3UGBB 1TBEA 5E6PA 2WYQA 2JY6A 3VVWB 2AWTA 4TQ1A 2V4LA 3L0WB 1RAXA 2DYOA 3B08A 3OAWA 4DK5A 1E8ZA 3DOWA 1SGHA 2BPSA 4W9FA 1YX5B 1KOTA 3AULA 2R2OA 2D10A 2G4SA 3TJPA 2L05A 3QWZB 2DZJA 5D94A 3DBLI 5J18A 3DVGY 1NDDA 3VFKA 3PZDA 2LVOA 2M0XA 1TGZB 2NBUA 3U7DA 4PYZA 3KVFB 2FAZA 1WGHA 3APCA 3K9OB 1X1MA 1J0GA 3ZDTA 4GXBA 1WJ4A 3APFA 4W9CA 4JQWC 1WJNA 1WE6A 4LJOB 2RR9A 3KUCB 2KLGA 3EC8A 4PS7A 3QHTA 2J0KA 2BKFA 3ENEA 2JT4B 1YQBA 3L08A 3QK0A 1WGGA 4G0NB 1KLVA 1V5OA 1SIFA 2WWZA 2L00B 2AEHA 2K6QA 5DPRA 4DDGD 2MLBA 4NPNA 1UZXB 3CF6E 2GOWA 4PS3A 2JVCA 2GBMA 3JSVA 1WH3A 3B0AA 3W1YA 2KX3A 4BFRA 4ZRKA 4DHJD 1G6JA 1E7VA 2ZNVB 4RM9A 4KSKC 2IY1B 1YD8U 2MW5A 4II3B 3VUYA 1V81A 2K8BA 4AUQC 2JWZA 4W9DA 3QX1A 2CR5A 3DQVA 2EMTA 1NI2A 4RM8A 2UYZB 1WXAA 1UELA 2KZRA 3VH4B 2L8JA 1L7YA 3AXCA 3ZNGC 3JYUA 4HLEA 4NQKE 2G4DB 2KTFA 3PSEB 3WAMA 2HTHA 2O2VB 1J19A 1WY8A 1Q5WB 2KMAA 3QJZA 2DZKA 4BKTA 3A9JA 1LFDA 5J17A 3PTFC 1OTRB 2NPTB 2KWVB 4HVBA 2GBKA 5JH5C 4FADA 3TMPB 4DHJB 4X57B 2FCMA 3MHSD 2M17A 1T0YA 3A1QB 4LDTB 2GMIC 4ANVA 2J0JA 3MJWA 4FHKA 2JXXA 2M8SA 4IM0A 2MBHA 4MJSA 4TQ0A 4FHJA 3EECA 4NJ6A 1P1AA 4DHZE 1V80A 4KDLB 2MRPA 3R66C 5EDSA 2C9WB 2KMCA 4GOCA 4NJ7A 2IO1B 4KZ0A 2REXA 3HM3A 2LI5A 2IO0B 1HE8A 3A33B 4BBNC 1MG8A 2DZIA 2JUOA 4GMVA 3IG3A 4MSQB 2A4ZA 1ISNA 2I1JA 4MDKE 1GC7A 3UQBA 4JL9A 4KIKA 4LCDE 4GDLB 1E7UA 4KZCA 3H7PB 3L17A 5DPTA 2O6VB 2PE9A 2K6DB 3OLMD 2KFJA 3PRZA 4YL8A 4FLHA 4EFOA 4GSWA 3VHTC 4WWPA 4BKGA 2MQJA 3BY4B 1QZEA 2NVUI 2BYFA 1YIWA 4EZJA 2DAFA 4EZLA 3DVNU 2ZPYA 2LXCA 3TBLD 4DWFA 4DBGA 2LD9A 2RGFA 3VTWA 3X23A 1LXDA 1WM3A 2J0MA 3N30A 4B9KA 4GB9A 4MM3A 3M62B 3M3JA 4MGIE 4MSMB 1PQSA 2DYMA 2KDBA 3DBSA 4WWNA 3RT3B 5D6JB 3UIOB 1WM2A 3C0RB 2VRRB 2GBNA 1XD3B 4BKSD 3RZWC 2LRWA 1Z2MA 2JPHA 1WZ3A
chains in the Genus database with same CATH superfamily
1F1HA 3O65B 3VUWA 2KTRB 2KK8A 1P7EA 4WJQA 4RMAA 3F1VA 2ZW0A 2ZPNA 3DBHI 2BWFA 5LXIB 1Y56A 1UGMA 3U8ZA 4YXDB 4HK2A 1FMAD 1TS3A 3ZW3A 3UQAA 3AE7B 4MT5A 1JWAD 4FJYA 1STEA 5AZGA 2KDEB 4HDOA 2J53A 2OOBB 3W1SA 4ARCA 1FO4A 3HRDD 3PV1A 3T9LA 4IG7B 1SJED 1YN3A 2FCQA 2I2YA 4MGKE 2LVQA 4MJRA 3WANA 3PVLA 1KF6B 1R4MI 2IO3B 3PZ8A 4OVFA 2WHIA 2M1MA 4WWOA 5L95C 3Q4JA 1RYJA 4YWGG 4MELA 1GNUA 4AJWA 1PFDA 2NCNA 3RNFC 3ALBA 3NG0A 3NVZA 2DAJA 2POLA 5I4DA 1C78A 4HXDA 2O6VD 3D1FA 4KDIC 3KUZA 2W54A 4L1BA 5TSSA 2WS3B 2XK5B 2WU5B 2C7HA 2DZMA 2D3AA 2CU3A 3B1LX 3ML8A 3Q14C 3ZRCA 2D2QA 3RNAC 3ZXRA 1IPGA 3E56A 3R3MA 2BBCA 2AX5A 2KFKA 4RFBA 3KUDB 3O13A 2L76A 2NS5A 4ZRJA 1HEZE 1BXTA 2FIDA 2B3AA 4D2KA 3AEGB 1E8WA 1D4BA 3N32A 2Y3AA 2VH1A 2KAJA 1QILA 4A90A 1XEEA 3R7RA 1E90A 4XZ4A 3AE5B 1ZP0B 3Q8AA 3V3XA 3ZIMA 5AZFA 2UWQA 4TR8A 3ML9A 1UF0A 1JRUA 1TIFA 3Q3MC 2RPQA 4F7ZA 2DNFA 2KN5A 1VPKA 2K8CA 2C7MB 1LQBA 1I4QA 5BMIA 1PYWD 1WF9A 4C7YA 2KC2A 2WU2B 1XQQA 1SJHD 1KJTA 3NHEB 4W9JA 3H9DA 1RFAA 4B6WA 2GBRA 2V3SA 1E10A 2G3QB 2CU1A 2QJLA 2W3SA 2PIAA 2MP2A 2O2VA 4F1SA 1QOFA 4CO7A 1ACCA 4WQOB 3PRMB 4NY0A 1E8YA 1V49A 1SBBB 5AUIA 2BYTA 4ICUA 3N1XC 4JWSC 3A9KB 2ZJDA 2DWQA 2VZKB 3PHXB 4GIVA 5HKHA 5CHVC 1IUEA 3IT4B 4IC7B 2GB1A 2W3RA 4P6VF 1CK1A 2K25A 4FULA 4GU2A 3T8MA 1YQ4B 2CHZA 2ZCCA 1WXVA 3OWEB 3A4SC 2X8XX 1AARA 2O6VA 2XBBC 1I4GA 1S3SG 3BVZA 3TCAA 1BT0A 1VCBA 5BO4B 3PT2B 2MHJA 4TUUA 3PLVA 3MHZA 2KWCA 4HPPA 3Q8FA 2FNJB 2WXGA 4IM2A 3CIRB 3AE3B 3LB8C 4W9GA 1F0ZA 4K3OA 3DCGA 3NY5A 3M95A 4OVHA 3OJ3A 3D1GA 2JRHA 2WXLA 1SXTA 3APDA 4OVUA 4S0RA 3WAOA 4AJYB 2KJRA 5D2MB 1D5ZC 1YJ1A 2LXAA 1PGXA 3NJTA 3JSVB 1H4RA 3KWVA 2NTSA 1EUVB 1N63A 2INDC 3ZTDA 1PDXA 2N9PC 3DWMA 5FR3A 3IHPC 2BT6A 3ZYYX 1UH6A 1WX7A 3HM6X 2MSED 2ASQA 2RMMA 3U4EG 4HEA1 1T0RC 2WX0A 2ZVOA 4CHKA 4AOFA 5C23A 3R8BA 3Q69A 2WXJA 4JIOU 5BYRA 2RD0A 3AU4A 2KMMA 1P0RA 4FA6A 2FCNA 2ON8A 3GZNB 4N95A 2RPVA 1MHHE 2KKCA 5CHFA 2AQ3B 1WWTA 3GOEA 4MJPA 3U30A 1MJDA 1ZXHA 4RF1A 2LGDA 3KW5B 3UGBB 3L0WB 3SFDB 4K74A 2DYOA 1SE4A 1N62A 3AE9B 3BIID 3AULA 2Q5WD 1HTQA 3TJPA 2L05A 4ARIA 5H92C 3DBLI 4QAYA 4YSXB 1TGZB 3KVFB 1TS4A 3Q3NC 3K9OB 3ZDTA 1WJNA 2RR9A 1HXYD 3QHTA 1ZUD2 2JT4B 1YQBA 1ZDVA 5AUKA 1I4HA 4G0NB 4YSYB 4DQOC 1JCKB 1UZXB 1L4DB 3W1YA 4ZOHC 1B9RA 4DHJD 4LK0M 1N5WA 4RM9A 4KSKC 3AECB 3R2TA 1TY0A 3VUYA 1CZPA 2LMCA 3DQVA 3PGEB 4M01A 4RM8A 1UELA 3AXCA 4NQKE 2G4DB 1NYQA 3P4RB 2O2VB 4IDIA 3RB9A 2KMAA 3QJZA 3A9JA 3AE4B 1HZ6A 1OTRB 4HVBA 2GBKA 1VDVA 4X57B 2M17A 2M56B 2PMVA 4N9AA 2J0JA 4FHKA 4MJSA 3VRAB 1TY2A 1V80A 4OVGA 2QILA 4WWMA 1JQJA 3HM3A 1ROEA 2IO0B 1HE8A 1MG8A 2JUOA 1JQLA 2A4ZA 4JL9A 1E7UA 4KZCA 2OHFA 3H7PB 3L17A 2O6VB 2XNAC 5FRQA 1QOBA 2KFJA 3P63A 4YL8A 4FLHA 4GSWA 1F2RC 1ENFA 2BYFA 4EZJA 3DVNU 2LXCA 4DWFA 1FRRA 1WM3A 4ZRPA 4B9KA 3AE8B 4MM3A 2G9HD 2INNE 4EE2A 3UI3A 3V05A 1PQSA 2KDBA 3DBSA 4RGTA 5D6JB 3UIOB 1L0XB 4BKSD 2LRWA 2MBBB 2JPHA 2BB6A 4WQMA 2L0TA 3GZNI 3ZVVA 3BYTB 5AEKB 1FEHA 1WI0A 3ZNZB 4HPMB 4RCOA 3AU5A 4IWQA 3RUIB 3NUHB 2RDBC 1F9JA 1FD6A 4A6QA 4A20A 4P7IA 3FILA 5EE9A 1NENB 2RSUA 2KLCA 4G11A 1VZ8A 5IP4D 4J6IA 3P4SB 2KQ7A 1R4MB 2HJ1A 4S17A 3TEWA 3A1QA 2LVPA 1R4NB 3RZFA 1D3ZA 3NRZA 1UNNA 4BAXA 4CYEA 1FXTB 5HFYA 1NI3A 3LDZE 2IPKD 5J2RA 5JHBA 3UINB 2BGFA 4LDTD 1ET6A 4JLCA 2JXTA 1V8CA 3ZO5B 3MC0B 3Q3FA 1JRPA 2D3CA 1NBFC 3ZTCA 2JYTA 3RCZA 2Y5CA 4K3QA 1ZKHA 2HE7A 3RD2A 1MMIA 4DXAB 1JW9D 3BWUD 2WXKA 2C7NB 2ZZPB 5AGUA 5JXVA 2Y5PA 1ZDXA 1T0QC 1WR6E 3L4PA 4IWPA 1OGWA 1WIAA 3HIZA 4KKIA 2QDFA 2IYDB 3DWGC 3RMKC 4ANXA 1V5TA 3R2IA 4GDKB 1CQVA 3Q8EA 2ZVNA 1ESFA 3HVDA 3EUB2 3EFCA 3AN1A 4BKSA 2BS3B 2LHDA 2KWDA 1IGCA 3PS6A 1T5XD 1PGAA 3M63B 3NVYA 3W5UB 1E5WA 4B95A 5DPWA 3L16A 3DVNV 5D3IB 4OVZA 3RYTA 2MH7A 4KGRA 3TL5A 1VZ6A 4FXCA 3RNGC 3N20C 3A9JB 5LNK1 3N9YC 3B9JA 3ECIA 2KQSA 4DDID 4N99A 2PEAA 2I1KA 2INPE 3LXFA 4TSZA 2L1AA 1AW7A 4S3IA 3ZUNA 3NZ3A 3OJ4B 4M0WB 3A4RA 4AP4C 1N6ZA 4BVUC 1UWMA 4DHZB 2WXOA 1UBIA 4HKQA 1SB3C 4XGAB 1E8XA 3QC8B 5FR6A 4WURA 1ZGUB 1E9MA 3AE1B 1QOAA 4W9KA 1LM8B 1L4ZB 3WIMA 1V2YA 1UNSA 4W9HA 1WZ0A 2WXPA 3LJ3A 4XE0A 1ZW7A 3AI5A 4FJZA 1EF1A 2QC8A 1WE7A 2KDIA 1TTNA 2GRIA 1R4NI 3RULA 4RH6A 3AEEB 4W9EA 4EZKA 2K39A 4JGHB 1WGKA 2LJIA 1K50A 2PJHA 1B1ZA 2IGDA 2NTTA 2BYEA 2IGGA 2YEPB 2KJHB 2G45B 3SU8X 3S2AA 3I9V1 2MCNB 3AEAB 2D3BA 1D5MC 1F52A 3V60A 2X38A 4NAWA 3EGRA 2ICIA 2WQYB 3FILB 1XLNA 1C76A 1ZPSA 2M4NA 2KDMA 2RDGA 3IVFA 2MWSB 3MP9A 4MH8A 1JMLA 1WR1A 4NZLB 2K5PA 3DHHC 3BK1A 4BOZB 2XN9C 4DXFA 2IGHA 3DPDA 5E6NA 4ZRQA 2PE6B 2AQ2B 1TKEA 1E7PB 1QLBB 5GMVA 4I6NB 3PZ7A 1C3TA 3Q6BA 2LUEA 4EUTA 3IBEA 1MG4A 1BMLC 2OJRA 3SHQA 4K3PA 1WJ6A 1SE9A 1ZOYB 1UBQA 3ZDMC 1P9DU 4HPLB 1FRDA 3VRBB 2J7QB 2AYOB 2N7EA 1A5RA 3I57A 1WGRA 3VTVA 4E71A 2EMSA 4TRTA 1GB1A 1GUAB 1SE3A 4B0EA 1WGYA 2PVOD 1J8CA 3FAHA 2KWUB 2D07B 2ZNVC 1MFWA 5BYQA 1DOIA 1TBEA 5E6PA 3DBLB 3VVWB 1J7BA 4DK5A 1E8ZA 4HROA 1SGHA 4W9FA 2G4SA 2HDEA 3QWZB 5D94A 4BZAA 3DVGY 2K22A 3U7ZA 2M0XA 3U7DA 4PNWA 1WGHA 4L2YA 3APCA 3ABVB 1RM6C 1C77A 1WJ4A 3APFA 3Q8CA 3QK0A 1WGGA 1C4AA 1SIFA 4PNUA 2AEHA 1MHXA 4NPNA 4PS3A 2JVCA 1WH3A 5FKAC 3ZJTA 1SF0A 2JZPA 2K9XA 4US8A 3TEZA 4USAA 4AUQC 2JWZA 1YQ3B 2QSDA 3DHIC 3ZJUA 2EMTA 1VRAB 3B2FA 1IBXA 2KZRA 3RPFC 3VH4B 1IGDA 3ZNGC 1K53A 4HLEA 3WAMA 2DZKA 4OW0A 4N58A 3ZJVA 4WIPA 2KWVB 3BZDB 5JH5C 4FADA 4MACA 3MHSD 1EWYC 3IT6B 4LDTB 4ANVA 2KT7A 4FHJA 1P1AA 4DHZE 1UUPA 1MPEA 5EE0A 2OJWA 3IXSA 4KZ0A 1T6BX 3BVGA 3A33B 4BBNC 2DZIA 4UDUC 2N7JA 4GMVA 2I1JA 3UQBA 1GC7A 4KIKA 3OLMD 3PRZA 4EFOA 3VHTC 3E9SA 3PO0A 3AH7A 3BY4B 1QZEA 4TMAB 1XCTL 4EZLA 3TBLD 3DBRB 2LD9A 2RGFA 3VTWA 2DLBA 4P16A 3N30A 2EELA 4JE3B 4MSMB 4NAMA 4IOIE 3U2SC 2LFIA 3RT3B 4WWNA 3GS2A 2VRRB 3C19A 1XD3B 3W5VB 5C3JB 4CQNA 1WZ3A 3BVMA 3CSFA 2LUMA 1JWBD 2C60A 4WJNA 1N60A 1YJIA 4BBNF 2QEJC 1QQRA 2KFKB 2CHXA 3Q3JA 4ZDVA 2MJEA 3P2BA 3L10A 4M8NA 4G50A 2BF8B 4HKZE 4HCNB 2WXNA 1I4PA 3QAQA 1YN4A 1FCLA 2L0FA 2WXQA 4HRSA 1EU3A 2N9KA 4HWIB 3V6CB 4N6EB 2NPTA 3NVVA 2LZ6A 4E74A 3K9PB 1T0SC 4LNIA 2Z59B 1JWSD 2MBQA 3AB5A 4W9LA 1FNVA 3VDZA 2QHOA 2AQ1B 2FCSA 4MH0E 4ZRIA 4RNAA 2KYWA 4LNFA 2E3TA 2LGIA 4GLSC 1WMHA 3EFUA 3V62A 1WGDA 2MP2B 3KQ4A 3SEBA 1WRIA 3VQIA 2KC1A 4KVGB 4A3PA 2EKIA 4K81A 4WJOA 2Y5BB 1KTKA 1KH0A 2CHWA 2KNBA 4C80A 5BMHA 5LXHA 2K3UA 2XEWA 2YLMA 2MEKA 3L54A 3CWIA 2BB5A 2GBJA 1F77A 1YOVB 2FE8A 4I6LB 2V0GA 3ZNID 4TR7A 1YX6B 3TIXA 1FFUA 5HG2A 3FC4A 2IO2B 2QIEB 3KLSX 3PPAA 3WCQA 3D32A 1L0YB 1HA5A 1XO3A 2AWAA 2KTRA 2N1VA 3WA0A 4YTPB 3TUOA 1BUIC 1RRBA 5H8YE 2BTEA 1GC6A 4RGOS 3VTUA 2LJ5A 2E6XA 4ANUA 1V1PA 2ZCBA 1EWCA 3ZLZA 4K3RA 1WXMA 1IBXB 3DBRI 5MPOA 2WXHA 1Q1OA 5D3DA 5G5HA 5IA7A 2NBWB 2MBEA 4K3CA 3PHWB 1P7FA 2KDFB 3Q4KA 1JQ4A 4AWJA 2JSVX 2L7RA 2LASA 5DCNA 3HVZA 1L6VA 5FK9C 1MVKA 4TV3A 4MEMA 1YNTE 3B2GA 4R3DA 4FBJB 4REZA 1FCCC 1K8RB 1CMXB 1PGBA 1N5XA 2MA9B 4ANWA 2NBVB 1S1QB 1WXSA 1L5PA 1UGJA 3P16A 1HQRD 1M94A 1HZ5A 1I42A 5KHOA 1TJEA 2BQQA 1KLUD 4IUMB 4XYCA 4PK1A 5AH2A 1VJKA 3L0XA 1ZXIA 4DXGA 1NVID 3CMMB 1IP9A 4N9F4 1V9JA 2JWUA 2N7DA 3W1SC 4YTNB 2XK5A 4LNNA 1T3QA 3P1MA 3SD5A 3L13A 4IW0A 2KANA 2MBOA 3P42A 1RLFA 2KQ4X 4GDLA 2YVCA 2J4XA 1OQQA 2NR2A 2AVTA 4IM3A 2N9EB 3H1UA 4JWUC 2PPHA 2V1YA 3RNBC 1AWDA 2JZ3B 2KHWB 2KJ6A 2Z8LA 3L10B 2TSSA 4LNKA 3H6NA 5C2TB 3ONSA 1OFFA 3HUIA 2ZEQA 2N4FA 4Q2JA 2WGSA 1XLOA 1TT5B 4A55A 3DVGX 2Z0EB 1SEBD 2KVRA 1XXGA 3JVZX 3V6EB 4A3OA 4K3BA 4E3CA 2KVZA 1GJZA 1TZ1A 5G2NA 5JZEB 2K0PA 1TS5A 1WX8A 3CSTA 2L32A 1WRDB 2WDVB 2LGSA 2JZZA 3BYYB 1L0VB 3RFZB 1JALA 1D5XC 3MJ5A 3T0PA 4NQLB 2FUHB 2N9XA 1XLPA 2C5LC 4M02A 2W55A 3NOBA 1CJEA 4A9AA 4KSLC 1WMHB 2J52A 1J7CA 2XURA 1SIJA 1V86A 2LGXA 4J3OD 1TYGB 1WYWB 2DBYA 2EKEC 2JX5A 1FNWA 3A9KA 3BINA 2IDYA 3ZNHB 2V9HA 2V4IB 4BOSC 5BYSA 1GOZA 2SAKA 4MJSB 1GB4A 2RDHA 4XC2A 3SDLC 1V1OA 2V3PA 1Q10A 1GAQB 1WYGA 4ASWC 4K7UA 2D5GA 5CHWA 2IZVB 3N3KB 3I63C 2H88B 4TKNA 4OVVA 2HJ8A 3DDCB 1EO6A 3WAPA 4OHJA 2JY6A 5IN7A 3OAWA 3EA6A 1TZOA 2BPSA 4KGTA 1YX5B 3C8YA 1VLBA 2R2OA 1V1PB 4C4VA 4WH4A 5IOIA 2DZJA 5J18A 3VFKA 2WXMA 3PZDA 4KKJA 4MM3B 1EU4A 3Q4LA 1DGJA 1TS2A 1J0GA 3N1ZC 1FFVA 4ZHOA 4LJOB 2KLGA 3EC8A 1N61A 4PS7A 3IAS1 1KLVA 2ACZB 4OZAA 1V5OA 3OG5A 2L00B 3AMZA 4DDGD 3CF6E 2GOWA 3JSVA 2GBMA 3B0AA 4BFRA 2KX3A 4OZBA 1E0ZA 1G6JA 1C79A 3Q2AC 2MW5A 2WXIA 2K8BA 4N59A 3QX1A 2CR5A 4W9DA 1NI2A 2H89B 3NS1A 5IO9A 2UYZB 3JYUA 1J19A 1WY8A 1LO5D 2KN4A 5J17A 1V97A 3PTFC 5AH4A 4ITKA 1I4XA 3TMPB 4DHJB 2FCMA 3TEXA 3A1QB 3L0XB 2GMIC 3MJWA 5EE1A 2JXXA 4IM0A 3Q3OC 2MBHA 1FXAA 4NJ6A 3KWLA 4KX6B 4ZYSA 4KDLB 2MRPA 3R66C 4GOCA 2KMCA 5FVEA 4YSZB 2IO1B 1FXIA 2BS4B 2LI5A 2FUG1 3AE6B 3IG3A 4MSQB 1AN8A 1ISNA 4MDKE 4XWTA 4GDLB 4N94A 5DPTA 3P4QB 3GP7A 3QSBA 4WWPA 2MQJA 3L0WA 2NVUI 2ZPYA 4KGSA 4DBGA 2JQRB 2J0MA 3M3JA 2N0SB 1I4RA 4MGIE 4M00A 2WDRB 1WM2A 3C0RB 2GBNA 3RZWC 3LYYA 4LNOA 3AEFB 2CS4A 1IYFA 2LRUA 4EKUA 1MI0A 3QCAA 1ZE3D 5AGVA 3VUXA 4PT5A 2CKHB 1QOGA 5CTRC 4HCPB 2KOXA 5E6JA 3VH3B 4WAAA 5E6OA 2M19A 1JWUD 2K1FA 4XDDA 2AL3A 3RI7C 4EEWA 4NNJB 3PGEA 4FN2A 1Q0WB 4EOYA 4US9A 2KXJA 1Y8RC 1DYQA 4LLGM 4HJGE 2WXRA 1XT9B 4C7ZA 2MJ3A 1VZ7A 4HDQA 4N96A 2QCZA 2DHZA 1OEYJ 3PREA 2CJOA 1C4CA 3AV8A 3D1EA 2PKOA 2WLBA 3BK2A 1OEYA 3JW0X 4FJVB 1L2NA 2WNMA 1D6EC 3ZKJC 2N1WA 3MFGA 4K3MA 3VAWA 2WDQB 3PLUA 1WJUA 3H7PA 1EF5A 2WDTB 4LJPB 4N97A 4NJCA 4WAFA 2WX1A 2PTLA 2HD5B 4ZYNA 4JPSA 2IY0B 4K1RB 4PS8A 4G3XB 2BKRB 4K7SA 3HHMA 4AS1A 4C4VB 1L6UA 1K51A 2WXFA 3V61A 2BW2A 2NMQA 5G5GA 4AQ7A 1GG3A 3W2DA 4II2B 3ETRA 5DPSA 3RNEC 3DHGC 3R7QA 3WALA 2BYVE 1HTOA 1TKYA 1ET9A 3X0WA 2L52A 3N1YC 3SR6A 1WX9A 1E6EB 1YJJA 3HK0A 2OEDA 5HI1A 5D7GA 5C1ZA 1WFYA 4NAWB 2ZW1A 1VR9A 3IFWB 2M0AA 2KD0A 4I6PA 4N98A 3ZRFA 3QA8A 2D3GA 1A70A 5T8IA 1KFYB 2KX0A 1P3QU 5HHDG 4YTMB 3H7SA 2MJDA 4RKIA 3AEBB 4RGNA 1LGRA 3VXWA 3QIJA 1FPYA 1UD7A 2JRIB 3PRPB 1C1YB 3ZXVA 1FIQA 2KACA 4XX5A 4IWOA 4M8MA 3NZUA 1EM7A 3QSBB 4ACFA 3T3OA 1XF5L 1OQYA 3KYDD 1V6EA 1F2RI 1OK7A 2BWES 2MX2A 4WJPA 3I3TB 5L83A 4ZHPA 4O1NA 2INCC 2BS2B 1FNUA 2JU6X 1GPXA 3EHVA 2R2QA 3KYCD 4MGZE 1DOXA 1JWMD 4GDKA 1C9FA 1XCQL 3SFEB 4K7WA 2BVCA 2JF5A 2KO3A 2YEPF 2FBWB 3U52E 1SSNA 2DYBA 4P1BC 4P1CC 2J42A 4K3KA 4K3SA 4H2AA 3UIPB 2AL6A 1KM7A 1QKZA 3QARA 4GGQA 2DENB 2FIFA 5JHAA 4RGMA 5G55A 5KHQA 3W9CB 1H8CA 2IJ0A 1QF6A 1Z5SB 2D11A 1XLQA 3NS8A 2B76B 5TR5A 2L3ZA 4HJKA 3MTNB 5EE3A 2K8HA 5BMGA 2W82A 4GN1A 3MC8A 3TEYA 4ICVA 4M0WA 1KRHA 4F8CB 4XDCA 1P98A 1NYRA 1RWSA 4TR6A 4L23A 1M4VA 4MGYE 1U4AA 2PW9A 3T3NA 3P4PB 1OQRA 4KV2A 3AEDB 1AYFA 5CX3A 2DX5B 3KH0A 3ZGZA 3GE3C 2LWPA 3URYA 4PYUA 3QQ8B 4URKA 3FKYA 3J9CA 2PVGC 3UF8A 1FM0D 3TSSA 4RF0A 2LGYA 4B0MA 3NZSA 5LLIA 2LHEA 2VZKD 4W9IA 3DBHB 3AE2B 5AZHA 2PLPA 2IBIB 1VD2A 4KIKB 5IAAC 2Z0DB 2A5UA 2R61A 3Q8BA 4C00A 1I35A 2W9NA 2WYQA 2AWTA 4TQ1A 2V4LA 1RAXA 3B08A 3DOWA 3PWEA 1YN5A 1SE2A 4IKGA 1KOTA 2D10A 1I7HA 1NDDA 2WP9B 2LVOA 3VR9B 2CJNA 1TKGA 2NBUA 4PYZA 2FAZA 1X1MA 4GXBA 4W9CA 4JQWC 1WE6A 2GI9A 3KUCB 4YT0B 2JYEA 2J0KA 2BKFA 1KLGD 2N9LA 3ENEA 2UU7A 3L08A 3NVWA 2WWZA 4JX1C 5DPRA 2K6QA 4MJQA 2MLBA 1UWXA 2GLSA 4K3LA 3GE8C 1DOYA 4ZRKA 1NEKB 3RNCC 3VR8B 1RFKA 1E7VA 2VH2A 2ZNVB 2IY1B 1YD8U 4II3B 1V81A 1JROA 3IAM1 1WXAA 2L8JA 1L7YA 2V3NA 3I5JC 4XWWA 3BEPA 1PUTA 2KTFA 3PSEB 2HTHA 4OZCA 1Q5WB 2SEBD 4BKTA 1LFDA 2NPTB 1T0YA 3MC9A 1WXQA 2M8SA 4TQ0A 3EECA 4PNVA 2I38A 5EDSA 2C9WB 4NJ7A 5IKCM 2REXA 2L83A 3AM9A 5GXGB 4C56C 1C4PA 2HTME 3RN9C 4LCDE 4A8XC 2QMTA 2PE9A 2K6DB 1WSPA 4LTUA 3GB1A 4BKGA 1K52A 1R7SA 1J7AA 1YIWA 1QT9A 4TSSA 2DAFA 3H8HA 1YMHE 3X23A 1LXDA 2G1EA 4GB9A 3ZQ4A 3M62B 2ONQA 2LEKA 2DYMA 1Z2MA
chains in the Genus database with same CATH topology
3CSFA 2C60A 2CS4A 2L0TA 4WJNA 1IYFA 3GZNI 3O65B 4BBNF 2LRUA 4EKUA 3VUWA 2KFKB 3ZVVA 3QCAA 2KTRB 2KK8A 5AEKB 1WI0A 3VUXA 2CHXA 3ZNZB 2CKHB 4HPMB 4RMAA 4WJQA 5CTRC 3Q3JA 4HCPB 2KOXA 4ZDVA 4IW0A 2ZPNA 3DBHI 2BWFA 3VH3B 5LXIB 3AU5A 4IWQA 4WAAA 5E6OA 3P2BA 1UGMA 3U8ZA 3RUIB 4HK2A 4M8NA 2K1FA 4G50A 2AL3A 2BF8B 3ZW3A 1F9JA 4HCNB 4EEWA 4A20A 4NNJB 3QAQA 3PGEA 4FN2A 4P7IA 3UQAA 1Q0WB 4EOYA 2KXJA 1Y8RC 2L0FA 4HWIB 4FJYA 3V6CB 1XT9B 2RSUA 2KLCA 2KDEB 4G11A 4HDOA 5AZGA 2NPTA 4HDQA 2LZ6A 2OOBB 3W1SA 4E74A 4J6IA 2DHZA 2KQ7A 3K9PB 3A1QA 1OEYJ 2LVPA 2Z59B 3RZFA 3PV1A 3T9LA 4IG7B 1D3ZA 3PREA 4CYEA 1FXTB 2MBQA 2FCQA 4W9LA 4MGKE 1OEYA 2LVQA 3JW0X 3WANA 3LDZE 3PVLA 4FJVB 3VDZA 1L2NA 2QHOA 1R4MI 5J2RA 5JHBA 3UINB 2IO3B 3ZKJC 2FCSA 2N1WA 4MH0E 3VAWA 4ZRIA 2BGFA 2M1MA 3PLUA 4WWOA 1WJUA 3H7PA 4LDTD 5L95C 1EF5A 4JLCA 2WDTB 1WMHA 4LJPB 4MELA 3EFUA 3ZO5B 3V62A 1WGDA 2MP2B 1GNUA 3VQIA 4AJWA 2KC1A 4KVGB 2NCNA 4A3PA 4K81A 4WJOA 3Q3FA 3ALBA 2Y5BB 1NBFC 3ZTCA 2KNBA 2CHWA 2WX1A 5LXHA 2HD5B 2DAJA 2XEWA 4ZYNA 3RCZA 2YLMA 3L54A 2IY0B 4HXDA 4K1RB 4PS8A 4G3XB 2BKRB 1ZKHA 2O6VD 2HE7A 4KDIC 2GBJA 3RD2A 4K7SA 3HHMA 3KUZA 4I6LB 3ZNID 1YX6B 3TIXA 4DXAB 3V61A 2XK5B 2C7NB 2ZZPB 2IO2B 2C7HA 1GG3A 2DZMA 3ML8A 3B1LX 3PPAA 4II2B 3ZRCA 3D32A 1WR6E 2D2QA 5DPSA 1IPGA 3R3MA 4IWPA 1OGWA 1WIAA 3HIZA 2IYDB 4ANXA 1V5TA 2KFKA 3KUDB 2KTRA 2L76A 2NS5A 2N1VA 2BYVE 4GDKB 4ZRJA 3R7QA 3WALA 3WA0A 3X0WA 2FIDA 2ZVNA 2B3AA 1RRBA 1E8WA 3N32A 1GC6A 3VTUA 2LJ5A 4BKSA 1WX9A 3R7RA 1E90A 3HK0A 4XZ4A 4ANUA 3PS6A 5D7GA 3M63B 5C1ZA 1E5WA 3ZIMA 4B95A 1WFYA 5DPWA 2ZCBA 3L16A 3DVNV 3ZLZA 3RYTA 5AZFA 2UWQA 3ML9A 4NAWB 1JRUA 1WXMA 2RPQA 3DBRI 3TL5A 4F7ZA 1Q1OA 2KN5A 3IFWB 5IA7A 2NBWB 2MBEA 2K8CA 2C7MB 1LQBA 3PHWB 2KDFB 2KD0A 3A9JB 4I6PA 4AWJA 3ZRFA 2L7RA 3ECIA 2KQSA 4DDID 1WF9A 2PEAA 3QA8A 2D3GA 2I1KA 2KC2A 2LASA 1XQQA 2KX0A 1P3QU 5DCNA 1KJTA 3NHEB 3H7SA 4W9JA 4TV3A 3ZUNA 3H9DA 4MEMA 1RFAA 3OJ4B 4B6WA 2GBRA 3VXWA 4FBJB 3QIJA 4M0WB 2V3SA 3A4RA 4AP4C 4DHZB 1UD7A 4BVUC 2G3QB 2JRIB 1UBIA 3PRPB 1K8RB 1C1YB 2CU1A 1CMXB 1E8XA 3QC8B 2MA9B 4ANWA 5FR6A 2MP2A 1ZGUB 1S1QB 2NBVB 4XX5A 4IWOA 1WXSA 4M8MA 3NZUA 2O2VA 4F1SA 1M94A 4W9KA 1I42A 5KHOA 1LM8B 4CO7A 4WQOB 3WIMA 4IUMB 3PRMB 3KYDD 1OQYA 1V2YA 1V6EA 4NY0A 1E8YA 1V49A 4W9HA 1WZ0A 2BWES 2MX2A 4ICUA 4WJPA 3A9KB 3LJ3A 2ZJDA 3I3TB 3CMMB 1IP9A 1ZW7A 3AI5A 4N9F4 5L83A 1V9JA 3PHXB 4GIVA 4FJZA 5CHVC 2N7DA 3W1SC 5HKHA 1EF1A 2XK5A 4IC7B 3SD5A 3L13A 1WE7A 2K25A 2KDIA 4FULA 4GU2A 3L0XB 3T8MA 1TTNA 2CHZA 1R4NI 2KANA 2MBOA 1RLFA 2ZCCA 2R2QA 1WXVA 3EHVA 3RULA 3KYCD 4MGZE 4W9EA 4GDLA 4EZKA 2K39A 2YVCA 3A4SC 4JGHB 2XBBC 1AARA 2O6VA 1S3SG 4GDKA 2NR2A 4K7WA 2PJHA 2N9EB 4IM3A 3TCAA 3H1UA 2JF5A 2KO3A 2PPHA 1BT0A 2BYEA 1VCBA 2V1YA 5BO4B 2JZ3B 2DYBA 3PT2B 2KHWB 2KJ6A 2KJHB 2G45B 4TUUA 3SU8X 3PLVA 3S2AA 2MCNB 3L10B 2KWCA 3UIPB 3H6NA 3ONSA 2AL6A 2ZEQA 1KM7A 2N4FA 3V60A 3QARA 4GGQA 4NAWA 2MBBB 2DENB 2FIFA 2FNJB 3DVGX 2Z0EB 5JHAA 2KVRA 4IM2A 3JVZX 3V6EB 5G55A 4A3OA 5KHQA 2M4NA 4E3CA 3IVFA 4W9GA 2MWSB 1H8CA 1GJZA 1TZ1A 5G2NA 5JZEB 3DCGA 1WR1A 1WX8A 1Z5SB 3M95A 3NY5A 3OJ3A 2D11A 3CSTA 3NS8A 5TR5A 4BOZB 2L3ZA 4HJKA 2JRHA 3MTNB 1WRDB 3APDA 4OVUA 2K8HA 3WAOA 4GN1A 3DPDA 4ICVA 5E6NA 2KJRA 2JZZA 5D2MB 4AJYB 1YJ1A 2PE6B 2LXAA 4F8CB 1P98A 3JSVB 1H4RA 4MGYE 4NQLB 1U4AA 2FUHB 2N9XA 2C5LC 1EUVB 4I6NB 3NOBA 5GMVA 4KSLC 1C3TA 1WMHB 2LUEA 3ZTDA 4EUTA 2N9PC 3IBEA 4KV2A 3IHPC 1UH6A 5CX3A 2DX5B 1WX7A 3KH0A 1V86A 2LGXA 2MSED 3HM6X 2ASQA 2OJRA 3SHQA 1WYWB 2EKEC 3A9KA 3BINA 1WJ6A 1SE9A 2WX0A 3ZNHB 1UBQA 2LWPA 1P9DU 2ZVOA 3ZDMC 4CHKA 4HPLB 4BOSC 4PYUA 4AOFA 5C23A 3QQ8B 4MJSB 2J7QB 4URKA 2AYOB 2N7EA 4JIOU 1A5RA 3UF8A 2RD0A 3AU4A 1P0RA 1WGRA 4FA6A 4XC2A 3VTVA 2FCNA 3SDLC 4E71A 2EMSA 2LGYA 1GUAB 2KKCA 3NZSA 5LLIA 4ASWC 5CHFA 4K7UA 5CHWA 2IZVB 3GOEA 3N3KB 4W9IA 1WGYA 5AZHA 1J8CA 2IBIB 1VD2A 4KIKB 3U30A 5IAAC 2KWUB 2Z0DB 2D07B 4OVVA 2A5UA 4TKNA 2HJ8A 2LGDA 2ZNVC 3KW5B 1I35A 2W9NA 3DDCB 1EO6A 3WAPA 3UGBB 1TBEA 5E6PA 2WYQA 2JY6A 3VVWB 2AWTA 4TQ1A 2V4LA 3L0WB 1RAXA 2DYOA 3B08A 3OAWA 4DK5A 1E8ZA 3DOWA 1SGHA 2BPSA 4W9FA 1YX5B 1KOTA 3AULA 2R2OA 2D10A 2G4SA 3TJPA 2L05A 3QWZB 2DZJA 5D94A 3DBLI 5J18A 3DVGY 1NDDA 3VFKA 3PZDA 2LVOA 2M0XA 1TGZB 2NBUA 3U7DA 4PYZA 3KVFB 2FAZA 1WGHA 3APCA 3K9OB 1X1MA 1J0GA 3ZDTA 4GXBA 1WJ4A 3APFA 4W9CA 4JQWC 1WJNA 1WE6A 4LJOB 2RR9A 3KUCB 2KLGA 3EC8A 4PS7A 3QHTA 2J0KA 2BKFA 3ENEA 2JT4B 1YQBA 3L08A 3QK0A 1WGGA 4G0NB 1KLVA 1V5OA 1SIFA 2WWZA 2L00B 2AEHA 2K6QA 5DPRA 4DDGD 2MLBA 4NPNA 1UZXB 3CF6E 2GOWA 4PS3A 2JVCA 2GBMA 3JSVA 1WH3A 3B0AA 3W1YA 2KX3A 4BFRA 4ZRKA 4DHJD 1G6JA 1E7VA 2ZNVB 4RM9A 4KSKC 2IY1B 1YD8U 2MW5A 4II3B 3VUYA 1V81A 2K8BA 4AUQC 2JWZA 4W9DA 3QX1A 2CR5A 3DQVA 2EMTA 1NI2A 4RM8A 2UYZB 1WXAA 1UELA 2KZRA 3VH4B 2L8JA 1L7YA 3AXCA 3ZNGC 3JYUA 4HLEA 4NQKE 2G4DB 2KTFA 3PSEB 3WAMA 2HTHA 2O2VB 1J19A 1WY8A 1Q5WB 2KMAA 3QJZA 2DZKA 4BKTA 3A9JA 1LFDA 5J17A 3PTFC 1OTRB 2NPTB 2KWVB 4HVBA 2GBKA 5JH5C 4FADA 3TMPB 4DHJB 4X57B 2FCMA 3MHSD 2M17A 1T0YA 3A1QB 4LDTB 2GMIC 4ANVA 2J0JA 3MJWA 4FHKA 2JXXA 2M8SA 4IM0A 2MBHA 4MJSA 4TQ0A 4FHJA 3EECA 4NJ6A 1P1AA 4DHZE 1V80A 4KDLB 2MRPA 3R66C 5EDSA 2C9WB 2KMCA 4GOCA 4NJ7A 2IO1B 4KZ0A 2REXA 3HM3A 2LI5A 2IO0B 1HE8A 3A33B 4BBNC 1MG8A 2DZIA 2JUOA 4GMVA 3IG3A 4MSQB 2A4ZA 1ISNA 2I1JA 4MDKE 1GC7A 3UQBA 4JL9A 4KIKA 4LCDE 4GDLB 1E7UA 4KZCA 3H7PB 3L17A 5DPTA 2O6VB 2PE9A 2K6DB 3OLMD 2KFJA 3PRZA 4YL8A 4FLHA 4EFOA 4GSWA 3VHTC 4WWPA 4BKGA 2MQJA 3BY4B 1QZEA 2NVUI 2BYFA 1YIWA 4EZJA 2DAFA 4EZLA 3DVNU 2ZPYA 2LXCA 3TBLD 4DWFA 4DBGA 2LD9A 2RGFA 3VTWA 3X23A 1LXDA 1WM3A 2J0MA 3N30A 4B9KA 4GB9A 4MM3A 3M62B 3M3JA 4MGIE 4MSMB 1PQSA 2DYMA 2KDBA 3DBSA 4WWNA 3RT3B 5D6JB 3UIOB 1WM2A 3C0RB 2VRRB 2GBNA 1XD3B 4BKSD 3RZWC 2LRWA 1Z2MA 2JPHA 1WZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSF A;  2C60 A;  2CS4 A;  2L0T A;  4WJN A;  1IYF A;  3GZN I;  3O65 B;  4BBN F;  2LRU A;  4EKU A;  3VUW A;  2KFK B;  3ZVV A;  3QCA A;  2KTR B;  2KK8 A;  5AEK B;  1WI0 A;  3VUX A;  2CHX A;  3ZNZ B;  2CKH B;  4HPM B;  4RMA A;  4WJQ A;  5CTR C;  3Q3J A;  4HCP B;  2KOX A;  4ZDV A;  4IW0 A;  2ZPN A;  3DBH I;  2BWF A;  3VH3 B;  5LXI B;  3AU5 A;  4IWQ A;  4WAA A;  5E6O A;  3P2B A;  1UGM A;  3U8Z A;  3RUI B;  4HK2 A;  4M8N A;  2K1F A;  4G50 A;  2AL3 A;  2BF8 B;  3ZW3 A;  1F9J A;  4HCN B;  4EEW A;  4A20 A;  4NNJ B;  3QAQ A;  3PGE A;  4FN2 A;  4P7I A;  3UQA A;  1Q0W B;  4EOY A;  2KXJ A;  1Y8R C;  2L0F A;  4HWI B;  4FJY A;  3V6C B;  1XT9 B;  2RSU A;  2KLC A;  2KDE B;  4G11 A;  4HDO A;  5AZG A;  2NPT A;  4HDQ A;  2LZ6 A;  2OOB B;  3W1S A;  4E74 A;  4J6I A;  2DHZ A;  2KQ7 A;  3K9P B;  3A1Q A;  1OEY J;  2LVP A;  2Z59 B;  3RZF A;  3PV1 A;  3T9L A;  4IG7 B;  1D3Z A;  3PRE A;  4CYE A;  1FXT B;  2MBQ A;  2FCQ A;  4W9L A;  4MGK E;  1OEY A;  2LVQ A;  3JW0 X;  3WAN A;  3LDZ E;  3PVL A;  4FJV B;  3VDZ A;  1L2N A;  2QHO A;  1R4M I;  5J2R A;  5JHB A;  3UIN B;  2IO3 B;  3ZKJ C;  2FCS A;  2N1W A;  4MH0 E;  3VAW A;  4ZRI A;  2BGF A;  2M1M A;  3PLU A;  4WWO A;  1WJU A;  3H7P A;  4LDT D;  5L95 C;  1EF5 A;  4JLC A;  2WDT B;  1WMH A;  4LJP B;  4MEL A;  3EFU A;  3ZO5 B;  3V62 A;  1WGD A;  2MP2 B;  1GNU A;  3VQI A;  4AJW A;  2KC1 A;  4KVG B;  2NCN A;  4A3P A;  4K81 A;  4WJO A;  3Q3F A;  3ALB A;  2Y5B B;  1NBF C;  3ZTC A;  2KNB A;  2CHW A;  2WX1 A;  5LXH A;  2HD5 B;  2DAJ A;  2XEW A;  4ZYN A;  3RCZ A;  2YLM A;  3L54 A;  2IY0 B;  4HXD A;  4K1R B;  4PS8 A;  4G3X B;  2BKR B;  1ZKH A;  2O6V D;  2HE7 A;  4KDI C;  2GBJ A;  3RD2 A;  4K7S A;  3HHM A;  3KUZ A;  4I6L B;  3ZNI D;  1YX6 B;  3TIX A;  4DXA B;  3V61 A;  2XK5 B;  2C7N B;  2ZZP B;  2IO2 B;  2C7H A;  1GG3 A;  2DZM A;  3ML8 A;  3B1L X;  3PPA A;  4II2 B;  3ZRC A;  3D32 A;  1WR6 E;  2D2Q A;  5DPS A;  1IPG A;  3R3M A;  4IWP A;  1OGW A;  1WIA A;  3HIZ A;  2IYD B;  4ANX A;  1V5T A;  2KFK A;  3KUD B;  2KTR A;  2L76 A;  2NS5 A;  2N1V A;  2BYV E;  4GDK B;  4ZRJ A;  3R7Q A;  3WAL A;  3WA0 A;  3X0W A;  2FID A;  2ZVN A;  2B3A A;  1RRB A;  1E8W A;  3N32 A;  1GC6 A;  3VTU A;  2LJ5 A;  4BKS A;  1WX9 A;  3R7R A;  1E90 A;  3HK0 A;  4XZ4 A;  4ANU A;  3PS6 A;  5D7G A;  3M63 B;  5C1Z A;  1E5W A;  3ZIM A;  4B95 A;  1WFY A;  5DPW A;  2ZCB A;  3L16 A;  3DVN V;  3ZLZ A;  3RYT A;  5AZF A;  2UWQ A;  3ML9 A;  4NAW B;  1JRU A;  1WXM A;  2RPQ A;  3DBR I;  3TL5 A;  4F7Z A;  1Q1O A;  2KN5 A;  3IFW B;  5IA7 A;  2NBW B;  2MBE A;  2K8C A;  2C7M B;  1LQB A;  3PHW B;  2KDF B;  2KD0 A;  3A9J B;  4I6P A;  4AWJ A;  3ZRF A;  2L7R A;  3ECI A;  2KQS A;  4DDI D;  1WF9 A;  2PEA A;  3QA8 A;  2D3G A;  2I1K A;  2KC2 A;  2LAS A;  1XQQ A;  2KX0 A;  1P3Q U;  5DCN A;  1KJT A;  3NHE B;  3H7S A;  4W9J A;  4TV3 A;  3ZUN A;  3H9D A;  4MEM A;  1RFA A;  3OJ4 B;  4B6W A;  2GBR A;  3VXW A;  4FBJ B;  3QIJ A;  4M0W B;  2V3S A;  3A4R A;  4AP4 C;  4DHZ B;  1UD7 A;  4BVU C;  2G3Q B;  2JRI B;  1UBI A;  3PRP B;  1K8R B;  1C1Y B;  2CU1 A;  1CMX B;  1E8X A;  3QC8 B;  2MA9 B;  4ANW A;  5FR6 A;  2MP2 A;  1ZGU B;  1S1Q B;  2NBV B;  4XX5 A;  4IWO A;  1WXS A;  4M8M A;  3NZU A;  2O2V A;  4F1S A;  1M94 A;  4W9K A;  1I42 A;  5KHO A;  1LM8 B;  4CO7 A;  4WQO B;  3WIM A;  4IUM B;  3PRM B;  3KYD D;  1OQY A;  1V2Y A;  1V6E A;  4NY0 A;  1E8Y A;  1V49 A;  4W9H A;  1WZ0 A;  2BWE S;  2MX2 A;  4ICU A;  4WJP A;  3A9K B;  3LJ3 A;  2ZJD A;  3I3T B;  3CMM B;  1IP9 A;  1ZW7 A;  3AI5 A;  4N9F 4;  5L83 A;  1V9J A;  3PHX B;  4GIV A;  4FJZ A;  5CHV C;  2N7D A;  3W1S C;  5HKH A;  1EF1 A;  2XK5 A;  4IC7 B;  3SD5 A;  3L13 A;  1WE7 A;  2K25 A;  2KDI A;  4FUL A;  4GU2 A;  3L0X B;  3T8M A;  1TTN A;  2CHZ A;  1R4N I;  2KAN A;  2MBO A;  1RLF A;  2ZCC A;  2R2Q A;  1WXV A;  3EHV A;  3RUL A;  3KYC D;  4MGZ E;  4W9E A;  4GDL A;  4EZK A;  2K39 A;  2YVC A;  3A4S C;  4JGH B;  2XBB C;  1AAR A;  2O6V A;  1S3S G;  4GDK A;  2NR2 A;  4K7W A;  2PJH A;  2N9E B;  4IM3 A;  3TCA A;  3H1U A;  2JF5 A;  2KO3 A;  2PPH A;  1BT0 A;  2BYE A;  1VCB A;  2V1Y A;  5BO4 B;  2JZ3 B;  2DYB A;  3PT2 B;  2KHW B;  2KJ6 A;  2KJH B;  2G45 B;  4TUU A;  3SU8 X;  3PLV A;  3S2A A;  2MCN B;  3L10 B;  2KWC A;  3UIP B;  3H6N A;  3ONS A;  2AL6 A;  2ZEQ A;  1KM7 A;  2N4F A;  3V60 A;  3QAR A;  4GGQ A;  4NAW A;  2MBB B;  2DEN B;  2FIF A;  2FNJ B;  3DVG X;  2Z0E B;  5JHA A;  2KVR A;  4IM2 A;  3JVZ X;  3V6E B;  5G55 A;  4A3O A;  5KHQ A;  2M4N A;  4E3C A;  3IVF A;  4W9G A;  2MWS B;  1H8C A;  1GJZ A;  1TZ1 A;  5G2N A;  5JZE B;  3DCG A;  1WR1 A;  1WX8 A;  1Z5S B;  3M95 A;  3NY5 A;  3OJ3 A;  2D11 A;  3CST A;  3NS8 A;  5TR5 A;  4BOZ B;  2L3Z A;  4HJK A;  2JRH A;  3MTN B;  1WRD B;  3APD A;  4OVU A;  2K8H A;  3WAO A;  4GN1 A;  3DPD A;  4ICV A;  5E6N A;  2KJR A;  2JZZ A;  5D2M B;  4AJY B;  1YJ1 A;  2PE6 B;  2LXA A;  4F8C B;  1P98 A;  3JSV B;  1H4R A;  4MGY E;  4NQL B;  1U4A A;  2FUH B;  2N9X A;  2C5L C;  1EUV B;  4I6N B;  3NOB A;  5GMV A;  4KSL C;  1C3T A;  1WMH B;  2LUE A;  3ZTD A;  4EUT A;  2N9P C;  3IBE A;  4KV2 A;  3IHP C;  1UH6 A;  5CX3 A;  2DX5 B;  1WX7 A;  3KH0 A;  1V86 A;  2LGX A;  2MSE D;  3HM6 X;  2ASQ A;  2OJR A;  3SHQ A;  1WYW B;  2EKE C;  3A9K A;  3BIN A;  1WJ6 A;  1SE9 A;  2WX0 A;  3ZNH B;  1UBQ A;  2LWP A;  1P9D U;  2ZVO A;  3ZDM C;  4CHK A;  4HPL B;  4BOS C;  4PYU A;  4AOF A;  5C23 A;  3QQ8 B;  4MJS B;  2J7Q B;  4URK A;  2AYO B;  2N7E A;  4JIO U;  1A5R A;  3UF8 A;  2RD0 A;  3AU4 A;  1P0R A;  1WGR A;  4FA6 A;  4XC2 A;  3VTV A;  2FCN A;  3SDL C;  4E71 A;  2EMS A;  2LGY A;  1GUA B;  2KKC A;  3NZS A;  5LLI A;  4ASW C;  5CHF A;  4K7U A;  5CHW A;  2IZV B;  3GOE A;  3N3K B;  4W9I A;  1WGY A;  5AZH A;  1J8C A;  2IBI B;  1VD2 A;  4KIK B;  3U30 A;  5IAA C;  2KWU B;  2Z0D B;  2D07 B;  4OVV A;  2A5U A;  4TKN A;  2HJ8 A;  2LGD A;  2ZNV C;  3KW5 B;  1I35 A;  2W9N A;  3DDC B;  1EO6 A;  3WAP A;  3UGB B;  1TBE A;  5E6P A;  2WYQ A;  2JY6 A;  3VVW B;  2AWT A;  4TQ1 A;  2V4L A;  3L0W B;  1RAX A;  2DYO A;  3B08 A;  3OAW A;  4DK5 A;  1E8Z A;  3DOW A;  1SGH A;  2BPS A;  4W9F A;  1YX5 B;  1KOT A;  3AUL A;  2R2O A;  2D10 A;  2G4S A;  3TJP A;  2L05 A;  3QWZ B;  2DZJ A;  5D94 A;  3DBL I;  5J18 A;  3DVG Y;  1NDD A;  3VFK A;  3PZD A;  2LVO A;  2M0X A;  1TGZ B;  2NBU A;  3U7D A;  4PYZ A;  3KVF B;  2FAZ A;  1WGH A;  3APC A;  3K9O B;  1X1M A;  1J0G A;  3ZDT A;  4GXB A;  1WJ4 A;  3APF A;  4W9C A;  4JQW C;  1WJN A;  1WE6 A;  4LJO B;  2RR9 A;  3KUC B;  2KLG A;  3EC8 A;  4PS7 A;  3QHT A;  2J0K A;  2BKF A;  3ENE A;  2JT4 B;  1YQB A;  3L08 A;  3QK0 A;  1WGG A;  4G0N B;  1KLV A;  1V5O A;  1SIF A;  2WWZ A;  2L00 B;  2AEH A;  2K6Q A;  5DPR A;  4DDG D;  2MLB A;  4NPN A;  1UZX B;  3CF6 E;  2GOW A;  4PS3 A;  2JVC A;  2GBM A;  3JSV A;  1WH3 A;  3B0A A;  3W1Y A;  2KX3 A;  4BFR A;  4ZRK A;  4DHJ D;  1G6J A;  1E7V A;  2ZNV B;  4RM9 A;  4KSK C;  2IY1 B;  1YD8 U;  2MW5 A;  4II3 B;  3VUY A;  1V81 A;  2K8B A;  4AUQ C;  2JWZ A;  4W9D A;  3QX1 A;  2CR5 A;  3DQV A;  2EMT A;  1NI2 A;  4RM8 A;  2UYZ B;  1WXA A;  1UEL A;  2KZR A;  3VH4 B;  2L8J A;  1L7Y A;  3AXC A;  3ZNG C;  3JYU A;  4HLE A;  4NQK E;  2G4D B;  2KTF A;  3PSE B;  3WAM A;  2HTH A;  2O2V B;  1J19 A;  1WY8 A;  1Q5W B;  2KMA A;  3QJZ A;  2DZK A;  4BKT A;  3A9J A;  1LFD A;  5J17 A;  3PTF C;  1OTR B;  2NPT B;  2KWV B;  4HVB A;  2GBK A;  5JH5 C;  4FAD A;  3TMP B;  4DHJ B;  4X57 B;  2FCM A;  3MHS D;  2M17 A;  1T0Y A;  3A1Q B;  4LDT B;  2GMI C;  4ANV A;  2J0J A;  3MJW A;  4FHK A;  2JXX A;  2M8S A;  4IM0 A;  2MBH A;  4MJS A;  4TQ0 A;  4FHJ A;  3EEC A;  4NJ6 A;  1P1A A;  4DHZ E;  1V80 A;  4KDL B;  2MRP A;  3R66 C;  5EDS A;  2C9W B;  2KMC A;  4GOC A;  4NJ7 A;  2IO1 B;  4KZ0 A;  2REX A;  3HM3 A;  2LI5 A;  2IO0 B;  1HE8 A;  3A33 B;  4BBN C;  1MG8 A;  2DZI A;  2JUO A;  4GMV A;  3IG3 A;  4MSQ B;  2A4Z A;  1ISN A;  2I1J A;  4MDK E;  1GC7 A;  3UQB A;  4JL9 A;  4KIK A;  4LCD E;  4GDL B;  1E7U A;  4KZC A;  3H7P B;  3L17 A;  5DPT A;  2O6V B;  2PE9 A;  2K6D B;  3OLM D;  2KFJ A;  3PRZ A;  4YL8 A;  4FLH A;  4EFO A;  4GSW A;  3VHT C;  4WWP A;  4BKG A;  2MQJ A;  3BY4 B;  1QZE A;  2NVU I;  2BYF A;  1YIW A;  4EZJ A;  2DAF A;  4EZL A;  3DVN U;  2ZPY A;  2LXC A;  3TBL D;  4DWF A;  4DBG A;  2LD9 A;  2RGF A;  3VTW A;  3X23 A;  1LXD A;  1WM3 A;  2J0M A;  3N30 A;  4B9K A;  4GB9 A;  4MM3 A;  3M62 B;  3M3J A;  4MGI E;  4MSM B;  1PQS A;  2DYM A;  2KDB A;  3DBS A;  4WWN A;  3RT3 B;  5D6J B;  3UIO B;  1WM2 A;  3C0R B;  2VRR B;  2GBN A;  1XD3 B;  4BKS D;  3RZW C;  2LRW A;  1Z2M A;  2JPH A;  1WZ3 A; 
#chains in the Genus database with same CATH topology
 1F1H A;  3O65 B;  3VUW A;  2KTR B;  2KK8 A;  1P7E A;  4WJQ A;  4RMA A;  3F1V A;  2ZW0 A;  2ZPN A;  3DBH I;  2BWF A;  5LXI B;  1Y56 A;  1UGM A;  3U8Z A;  4YXD B;  4HK2 A;  1FMA D;  1TS3 A;  3ZW3 A;  3UQA A;  3AE7 B;  4MT5 A;  1JWA D;  4FJY A;  1STE A;  5AZG A;  2KDE B;  4HDO A;  2J53 A;  2OOB B;  3W1S A;  4ARC A;  1FO4 A;  3HRD D;  3PV1 A;  3T9L A;  4IG7 B;  1SJE D;  1YN3 A;  2FCQ A;  2I2Y A;  4MGK E;  2LVQ A;  4MJR A;  3WAN A;  3PVL A;  1KF6 B;  1R4M I;  2IO3 B;  3PZ8 A;  4OVF A;  2WHI A;  2M1M A;  4WWO A;  5L95 C;  3Q4J A;  1RYJ A;  4YWG G;  4MEL A;  1GNU A;  4AJW A;  1PFD A;  2NCN A;  3RNF C;  3ALB A;  3NG0 A;  3NVZ A;  2DAJ A;  2POL A;  5I4D A;  1C78 A;  4HXD A;  2O6V D;  3D1F A;  4KDI C;  3KUZ A;  2W54 A;  4L1B A;  5TSS A;  2WS3 B;  2XK5 B;  2WU5 B;  2C7H A;  2DZM A;  2D3A A;  2CU3 A;  3B1L X;  3ML8 A;  3Q14 C;  3ZRC A;  2D2Q A;  3RNA C;  3ZXR A;  1IPG A;  3E56 A;  3R3M A;  2BBC A;  2AX5 A;  2KFK A;  4RFB A;  3KUD B;  3O13 A;  2L76 A;  2NS5 A;  4ZRJ A;  1HEZ E;  1BXT A;  2FID A;  2B3A A;  4D2K A;  3AEG B;  1E8W A;  1D4B A;  3N32 A;  2Y3A A;  2VH1 A;  2KAJ A;  1QIL A;  4A90 A;  1XEE A;  3R7R A;  1E90 A;  4XZ4 A;  3AE5 B;  1ZP0 B;  3Q8A A;  3V3X A;  3ZIM A;  5AZF A;  2UWQ A;  4TR8 A;  3ML9 A;  1UF0 A;  1JRU A;  1TIF A;  3Q3M C;  2RPQ A;  4F7Z A;  2DNF A;  2KN5 A;  1VPK A;  2K8C A;  2C7M B;  1LQB A;  1I4Q A;  5BMI A;  1PYW D;  1WF9 A;  4C7Y A;  2KC2 A;  2WU2 B;  1XQQ A;  1SJH D;  1KJT A;  3NHE B;  4W9J A;  3H9D A;  1RFA A;  4B6W A;  2GBR A;  2V3S A;  1E10 A;  2G3Q B;  2CU1 A;  2QJL A;  2W3S A;  2PIA A;  2MP2 A;  2O2V A;  4F1S A;  1QOF A;  4CO7 A;  1ACC A;  4WQO B;  3PRM B;  4NY0 A;  1E8Y A;  1V49 A;  1SBB B;  5AUI A;  2BYT A;  4ICU A;  3N1X C;  4JWS C;  3A9K B;  2ZJD A;  2DWQ A;  2VZK B;  3PHX B;  4GIV A;  5HKH A;  5CHV C;  1IUE A;  3IT4 B;  4IC7 B;  2GB1 A;  2W3R A;  4P6V F;  1CK1 A;  2K25 A;  4FUL A;  4GU2 A;  3T8M A;  1YQ4 B;  2CHZ A;  2ZCC A;  1WXV A;  3OWE B;  3A4S C;  2X8X X;  1AAR A;  2O6V A;  2XBB C;  1I4G A;  1S3S G;  3BVZ A;  3TCA A;  1BT0 A;  1VCB A;  5BO4 B;  3PT2 B;  2MHJ A;  4TUU A;  3PLV A;  3MHZ A;  2KWC A;  4HPP A;  3Q8F A;  2FNJ B;  2WXG A;  4IM2 A;  3CIR B;  3AE3 B;  3LB8 C;  4W9G A;  1F0Z A;  4K3O A;  3DCG A;  3NY5 A;  3M95 A;  4OVH A;  3OJ3 A;  3D1G A;  2JRH A;  2WXL A;  1SXT A;  3APD A;  4OVU A;  4S0R A;  3WAO A;  4AJY B;  2KJR A;  5D2M B;  1D5Z C;  1YJ1 A;  2LXA A;  1PGX A;  3NJT A;  3JSV B;  1H4R A;  3KWV A;  2NTS A;  1EUV B;  1N63 A;  2IND C;  3ZTD A;  1PDX A;  2N9P C;  3DWM A;  5FR3 A;  3IHP C;  2BT6 A;  3ZYY X;  1UH6 A;  1WX7 A;  3HM6 X;  2MSE D;  2ASQ A;  2RMM A;  3U4E G;  4HEA 1;  1T0R C;  2WX0 A;  2ZVO A;  4CHK A;  4AOF A;  5C23 A;  3R8B A;  3Q69 A;  2WXJ A;  4JIO U;  5BYR A;  2RD0 A;  3AU4 A;  2KMM A;  1P0R A;  4FA6 A;  2FCN A;  2ON8 A;  3GZN B;  4N95 A;  2RPV A;  1MHH E;  2KKC A;  5CHF A;  2AQ3 B;  1WWT A;  3GOE A;  4MJP A;  3U30 A;  1MJD A;  1ZXH A;  4RF1 A;  2LGD A;  3KW5 B;  3UGB B;  3L0W B;  3SFD B;  4K74 A;  2DYO A;  1SE4 A;  1N62 A;  3AE9 B;  3BII D;  3AUL A;  2Q5W D;  1HTQ A;  3TJP A;  2L05 A;  4ARI A;  5H92 C;  3DBL I;  4QAY A;  4YSX B;  1TGZ B;  3KVF B;  1TS4 A;  3Q3N C;  3K9O B;  3ZDT A;  1WJN A;  2RR9 A;  1HXY D;  3QHT A;  1ZUD 2;  2JT4 B;  1YQB A;  1ZDV A;  5AUK A;  1I4H A;  4G0N B;  4YSY B;  4DQO C;  1JCK B;  1UZX B;  1L4D B;  3W1Y A;  4ZOH C;  1B9R A;  4DHJ D;  4LK0 M;  1N5W A;  4RM9 A;  4KSK C;  3AEC B;  3R2T A;  1TY0 A;  3VUY A;  1CZP A;  2LMC A;  3DQV A;  3PGE B;  4M01 A;  4RM8 A;  1UEL A;  3AXC A;  4NQK E;  2G4D B;  1NYQ A;  3P4R B;  2O2V B;  4IDI A;  3RB9 A;  2KMA A;  3QJZ A;  3A9J A;  3AE4 B;  1HZ6 A;  1OTR B;  4HVB A;  2GBK A;  1VDV A;  4X57 B;  2M17 A;  2M56 B;  2PMV A;  4N9A A;  2J0J A;  4FHK A;  4MJS A;  3VRA B;  1TY2 A;  1V80 A;  4OVG A;  2QIL A;  4WWM A;  1JQJ A;  3HM3 A;  1ROE A;  2IO0 B;  1HE8 A;  1MG8 A;  2JUO A;  1JQL A;  2A4Z A;  4JL9 A;  1E7U A;  4KZC A;  2OHF A;  3H7P B;  3L17 A;  2O6V B;  2XNA C;  5FRQ A;  1QOB A;  2KFJ A;  3P63 A;  4YL8 A;  4FLH A;  4GSW A;  1F2R C;  1ENF A;  2BYF A;  4EZJ A;  3DVN U;  2LXC A;  4DWF A;  1FRR A;  1WM3 A;  4ZRP A;  4B9K A;  3AE8 B;  4MM3 A;  2G9H D;  2INN E;  4EE2 A;  3UI3 A;  3V05 A;  1PQS A;  2KDB A;  3DBS A;  4RGT A;  5D6J B;  3UIO B;  1L0X B;  4BKS D;  2LRW A;  2MBB B;  2JPH A;  2BB6 A;  4WQM A;  2L0T A;  3GZN I;  3ZVV A;  3BYT B;  5AEK B;  1FEH A;  1WI0 A;  3ZNZ B;  4HPM B;  4RCO A;  3AU5 A;  4IWQ A;  3RUI B;  3NUH B;  2RDB C;  1F9J A;  1FD6 A;  4A6Q A;  4A20 A;  4P7I A;  3FIL A;  5EE9 A;  1NEN B;  2RSU A;  2KLC A;  4G11 A;  1VZ8 A;  5IP4 D;  4J6I A;  3P4S B;  2KQ7 A;  1R4M B;  2HJ1 A;  4S17 A;  3TEW A;  3A1Q A;  2LVP A;  1R4N B;  3RZF A;  1D3Z A;  3NRZ A;  1UNN A;  4BAX A;  4CYE A;  1FXT B;  5HFY A;  1NI3 A;  3LDZ E;  2IPK D;  5J2R A;  5JHB A;  3UIN B;  2BGF A;  4LDT D;  1ET6 A;  4JLC A;  2JXT A;  1V8C A;  3ZO5 B;  3MC0 B;  3Q3F A;  1JRP A;  2D3C A;  1NBF C;  3ZTC A;  2JYT A;  3RCZ A;  2Y5C A;  4K3Q A;  1ZKH A;  2HE7 A;  3RD2 A;  1MMI A;  4DXA B;  1JW9 D;  3BWU D;  2WXK A;  2C7N B;  2ZZP B;  5AGU A;  5JXV A;  2Y5P A;  1ZDX A;  1T0Q C;  1WR6 E;  3L4P A;  4IWP A;  1OGW A;  1WIA A;  3HIZ A;  4KKI A;  2QDF A;  2IYD B;  3DWG C;  3RMK C;  4ANX A;  1V5T A;  3R2I A;  4GDK B;  1CQV A;  3Q8E A;  2ZVN A;  1ESF A;  3HVD A;  3EUB 2;  3EFC A;  3AN1 A;  4BKS A;  2BS3 B;  2LHD A;  2KWD A;  1IGC A;  3PS6 A;  1T5X D;  1PGA A;  3M63 B;  3NVY A;  3W5U B;  1E5W A;  4B95 A;  5DPW A;  3L16 A;  3DVN V;  5D3I B;  4OVZ A;  3RYT A;  2MH7 A;  4KGR A;  3TL5 A;  1VZ6 A;  4FXC A;  3RNG C;  3N20 C;  3A9J B;  5LNK 1;  3N9Y C;  3B9J A;  3ECI A;  2KQS A;  4DDI D;  4N99 A;  2PEA A;  2I1K A;  2INP E;  3LXF A;  4TSZ A;  2L1A A;  1AW7 A;  4S3I A;  3ZUN A;  3NZ3 A;  3OJ4 B;  4M0W B;  3A4R A;  4AP4 C;  1N6Z A;  4BVU C;  1UWM A;  4DHZ B;  2WXO A;  1UBI A;  4HKQ A;  1SB3 C;  4XGA B;  1E8X A;  3QC8 B;  5FR6 A;  4WUR A;  1ZGU B;  1E9M A;  3AE1 B;  1QOA A;  4W9K A;  1LM8 B;  1L4Z B;  3WIM A;  1V2Y A;  1UNS A;  4W9H A;  1WZ0 A;  2WXP A;  3LJ3 A;  4XE0 A;  1ZW7 A;  3AI5 A;  4FJZ A;  1EF1 A;  2QC8 A;  1WE7 A;  2KDI A;  1TTN A;  2GRI A;  1R4N I;  3RUL A;  4RH6 A;  3AEE B;  4W9E A;  4EZK A;  2K39 A;  4JGH B;  1WGK A;  2LJI A;  1K50 A;  2PJH A;  1B1Z A;  2IGD A;  2NTT A;  2BYE A;  2IGG A;  2YEP B;  2KJH B;  2G45 B;  3SU8 X;  3S2A A;  3I9V 1;  2MCN B;  3AEA B;  2D3B A;  1D5M C;  1F52 A;  3V60 A;  2X38 A;  4NAW A;  3EGR A;  2ICI A;  2WQY B;  3FIL B;  1XLN A;  1C76 A;  1ZPS A;  2M4N A;  2KDM A;  2RDG A;  3IVF A;  2MWS B;  3MP9 A;  4MH8 A;  1JML A;  1WR1 A;  4NZL B;  2K5P A;  3DHH C;  3BK1 A;  4BOZ B;  2XN9 C;  4DXF A;  2IGH A;  3DPD A;  5E6N A;  4ZRQ A;  2PE6 B;  2AQ2 B;  1TKE A;  1E7P B;  1QLB B;  5GMV A;  4I6N B;  3PZ7 A;  1C3T A;  3Q6B A;  2LUE A;  4EUT A;  3IBE A;  1MG4 A;  1BML C;  2OJR A;  3SHQ A;  4K3P A;  1WJ6 A;  1SE9 A;  1ZOY B;  1UBQ A;  3ZDM C;  1P9D U;  4HPL B;  1FRD A;  3VRB B;  2J7Q B;  2AYO B;  2N7E A;  1A5R A;  3I57 A;  1WGR A;  3VTV A;  4E71 A;  2EMS A;  4TRT A;  1GB1 A;  1GUA B;  1SE3 A;  4B0E A;  1WGY A;  2PVO D;  1J8C A;  3FAH A;  2KWU B;  2D07 B;  2ZNV C;  1MFW A;  5BYQ A;  1DOI A;  1TBE A;  5E6P A;  3DBL B;  3VVW B;  1J7B A;  4DK5 A;  1E8Z A;  4HRO A;  1SGH A;  4W9F A;  2G4S A;  2HDE A;  3QWZ B;  5D94 A;  4BZA A;  3DVG Y;  2K22 A;  3U7Z A;  2M0X A;  3U7D A;  4PNW A;  1WGH A;  4L2Y A;  3APC A;  3ABV B;  1RM6 C;  1C77 A;  1WJ4 A;  3APF A;  3Q8C A;  3QK0 A;  1WGG A;  1C4A A;  1SIF A;  4PNU A;  2AEH A;  1MHX A;  4NPN A;  4PS3 A;  2JVC A;  1WH3 A;  5FKA C;  3ZJT A;  1SF0 A;  2JZP A;  2K9X A;  4US8 A;  3TEZ A;  4USA A;  4AUQ C;  2JWZ A;  1YQ3 B;  2QSD A;  3DHI C;  3ZJU A;  2EMT A;  1VRA B;  3B2F A;  1IBX A;  2KZR A;  3RPF C;  3VH4 B;  1IGD A;  3ZNG C;  1K53 A;  4HLE A;  3WAM A;  2DZK A;  4OW0 A;  4N58 A;  3ZJV A;  4WIP A;  2KWV B;  3BZD B;  5JH5 C;  4FAD A;  4MAC A;  3MHS D;  1EWY C;  3IT6 B;  4LDT B;  4ANV A;  2KT7 A;  4FHJ A;  1P1A A;  4DHZ E;  1UUP A;  1MPE A;  5EE0 A;  2OJW A;  3IXS A;  4KZ0 A;  1T6B X;  3BVG A;  3A33 B;  4BBN C;  2DZI A;  4UDU C;  2N7J A;  4GMV A;  2I1J A;  3UQB A;  1GC7 A;  4KIK A;  3OLM D;  3PRZ A;  4EFO A;  3VHT C;  3E9S A;  3PO0 A;  3AH7 A;  3BY4 B;  1QZE A;  4TMA B;  1XCT L;  4EZL A;  3TBL D;  3DBR B;  2LD9 A;  2RGF A;  3VTW A;  2DLB A;  4P16 A;  3N30 A;  2EEL A;  4JE3 B;  4MSM B;  4NAM A;  4IOI E;  3U2S C;  2LFI A;  3RT3 B;  4WWN A;  3GS2 A;  2VRR B;  3C19 A;  1XD3 B;  3W5V B;  5C3J B;  4CQN A;  1WZ3 A;  3BVM A;  3CSF A;  2LUM A;  1JWB D;  2C60 A;  4WJN A;  1N60 A;  1YJI A;  4BBN F;  2QEJ C;  1QQR A;  2KFK B;  2CHX A;  3Q3J A;  4ZDV A;  2MJE A;  3P2B A;  3L10 A;  4M8N A;  4G50 A;  2BF8 B;  4HKZ E;  4HCN B;  2WXN A;  1I4P A;  3QAQ A;  1YN4 A;  1FCL A;  2L0F A;  2WXQ A;  4HRS A;  1EU3 A;  2N9K A;  4HWI B;  3V6C B;  4N6E B;  2NPT A;  3NVV A;  2LZ6 A;  4E74 A;  3K9P B;  1T0S C;  4LNI A;  2Z59 B;  1JWS D;  2MBQ A;  3AB5 A;  4W9L A;  1FNV A;  3VDZ A;  2QHO A;  2AQ1 B;  2FCS A;  4MH0 E;  4ZRI A;  4RNA A;  2KYW A;  4LNF A;  2E3T A;  2LGI A;  4GLS C;  1WMH A;  3EFU A;  3V62 A;  1WGD A;  2MP2 B;  3KQ4 A;  3SEB A;  1WRI A;  3VQI A;  2KC1 A;  4KVG B;  4A3P A;  2EKI A;  4K81 A;  4WJO A;  2Y5B B;  1KTK A;  1KH0 A;  2CHW A;  2KNB A;  4C80 A;  5BMH A;  5LXH A;  2K3U A;  2XEW A;  2YLM A;  2MEK A;  3L54 A;  3CWI A;  2BB5 A;  2GBJ A;  1F77 A;  1YOV B;  2FE8 A;  4I6L B;  2V0G A;  3ZNI D;  4TR7 A;  1YX6 B;  3TIX A;  1FFU A;  5HG2 A;  3FC4 A;  2IO2 B;  2QIE B;  3KLS X;  3PPA A;  3WCQ A;  3D32 A;  1L0Y B;  1HA5 A;  1XO3 A;  2AWA A;  2KTR A;  2N1V A;  3WA0 A;  4YTP B;  3TUO A;  1BUI C;  1RRB A;  5H8Y E;  2BTE A;  1GC6 A;  4RGO S;  3VTU A;  2LJ5 A;  2E6X A;  4ANU A;  1V1P A;  2ZCB A;  1EWC A;  3ZLZ A;  4K3R A;  1WXM A;  1IBX B;  3DBR I;  5MPO A;  2WXH A;  1Q1O A;  5D3D A;  5G5H A;  5IA7 A;  2NBW B;  2MBE A;  4K3C A;  3PHW B;  1P7F A;  2KDF B;  3Q4K A;  1JQ4 A;  4AWJ A;  2JSV X;  2L7R A;  2LAS A;  5DCN A;  3HVZ A;  1L6V A;  5FK9 C;  1MVK A;  4TV3 A;  4MEM A;  1YNT E;  3B2G A;  4R3D A;  4FBJ B;  4REZ A;  1FCC C;  1K8R B;  1CMX B;  1PGB A;  1N5X A;  2MA9 B;  4ANW A;  2NBV B;  1S1Q B;  1WXS A;  1L5P A;  1UGJ A;  3P16 A;  1HQR D;  1M94 A;  1HZ5 A;  1I42 A;  5KHO A;  1TJE A;  2BQQ A;  1KLU D;  4IUM B;  4XYC A;  4PK1 A;  5AH2 A;  1VJK A;  3L0X A;  1ZXI A;  4DXG A;  1NVI D;  3CMM B;  1IP9 A;  4N9F 4;  1V9J A;  2JWU A;  2N7D A;  3W1S C;  4YTN B;  2XK5 A;  4LNN A;  1T3Q A;  3P1M A;  3SD5 A;  3L13 A;  4IW0 A;  2KAN A;  2MBO A;  3P42 A;  1RLF A;  2KQ4 X;  4GDL A;  2YVC A;  2J4X A;  1OQQ A;  2NR2 A;  2AVT A;  4IM3 A;  2N9E B;  3H1U A;  4JWU C;  2PPH A;  2V1Y A;  3RNB C;  1AWD A;  2JZ3 B;  2KHW B;  2KJ6 A;  2Z8L A;  3L10 B;  2TSS A;  4LNK A;  3H6N A;  5C2T B;  3ONS A;  1OFF A;  3HUI A;  2ZEQ A;  2N4F A;  4Q2J A;  2WGS A;  1XLO A;  1TT5 B;  4A55 A;  3DVG X;  2Z0E B;  1SEB D;  2KVR A;  1XXG A;  3JVZ X;  3V6E B;  4A3O A;  4K3B A;  4E3C A;  2KVZ A;  1GJZ A;  1TZ1 A;  5G2N A;  5JZE B;  2K0P A;  1TS5 A;  1WX8 A;  3CST A;  2L32 A;  1WRD B;  2WDV B;  2LGS A;  2JZZ A;  3BYY B;  1L0V B;  3RFZ B;  1JAL A;  1D5X C;  3MJ5 A;  3T0P A;  4NQL B;  2FUH B;  2N9X A;  1XLP A;  2C5L C;  4M02 A;  2W55 A;  3NOB A;  1CJE A;  4A9A A;  4KSL C;  1WMH B;  2J52 A;  1J7C A;  2XUR A;  1SIJ A;  1V86 A;  2LGX A;  4J3O D;  1TYG B;  1WYW B;  2DBY A;  2EKE C;  2JX5 A;  1FNW A;  3A9K A;  3BIN A;  2IDY A;  3ZNH B;  2V9H A;  2V4I B;  4BOS C;  5BYS A;  1GOZ A;  2SAK A;  4MJS B;  1GB4 A;  2RDH A;  4XC2 A;  3SDL C;  1V1O A;  2V3P A;  1Q10 A;  1GAQ B;  1WYG A;  4ASW C;  4K7U A;  2D5G A;  5CHW A;  2IZV B;  3N3K B;  3I63 C;  2H88 B;  4TKN A;  4OVV A;  2HJ8 A;  3DDC B;  1EO6 A;  3WAP A;  4OHJ A;  2JY6 A;  5IN7 A;  3OAW A;  3EA6 A;  1TZO A;  2BPS A;  4KGT A;  1YX5 B;  3C8Y A;  1VLB A;  2R2O A;  1V1P B;  4C4V A;  4WH4 A;  5IOI A;  2DZJ A;  5J18 A;  3VFK A;  2WXM A;  3PZD A;  4KKJ A;  4MM3 B;  1EU4 A;  3Q4L A;  1DGJ A;  1TS2 A;  1J0G A;  3N1Z C;  1FFV A;  4ZHO A;  4LJO B;  2KLG A;  3EC8 A;  1N61 A;  4PS7 A;  3IAS 1;  1KLV A;  2ACZ B;  4OZA A;  1V5O A;  3OG5 A;  2L00 B;  3AMZ A;  4DDG D;  3CF6 E;  2GOW A;  3JSV A;  2GBM A;  3B0A A;  4BFR A;  2KX3 A;  4OZB A;  1E0Z A;  1G6J A;  1C79 A;  3Q2A C;  2MW5 A;  2WXI A;  2K8B A;  4N59 A;  3QX1 A;  2CR5 A;  4W9D A;  1NI2 A;  2H89 B;  3NS1 A;  5IO9 A;  2UYZ B;  3JYU A;  1J19 A;  1WY8 A;  1LO5 D;  2KN4 A;  5J17 A;  1V97 A;  3PTF C;  5AH4 A;  4ITK A;  1I4X A;  3TMP B;  4DHJ B;  2FCM A;  3TEX A;  3A1Q B;  3L0X B;  2GMI C;  3MJW A;  5EE1 A;  2JXX A;  4IM0 A;  3Q3O C;  2MBH A;  1FXA A;  4NJ6 A;  3KWL A;  4KX6 B;  4ZYS A;  4KDL B;  2MRP A;  3R66 C;  4GOC A;  2KMC A;  5FVE A;  4YSZ B;  2IO1 B;  1FXI A;  2BS4 B;  2LI5 A;  2FUG 1;  3AE6 B;  3IG3 A;  4MSQ B;  1AN8 A;  1ISN A;  4MDK E;  4XWT A;  4GDL B;  4N94 A;  5DPT A;  3P4Q B;  3GP7 A;  3QSB A;  4WWP A;  2MQJ A;  3L0W A;  2NVU I;  2ZPY A;  4KGS A;  4DBG A;  2JQR B;  2J0M A;  3M3J A;  2N0S B;  1I4R A;  4MGI E;  4M00 A;  2WDR B;  1WM2 A;  3C0R B;  2GBN A;  3RZW C;  3LYY A;  4LNO A;  3AEF B;  2CS4 A;  1IYF A;  2LRU A;  4EKU A;  1MI0 A;  3QCA A;  1ZE3 D;  5AGV A;  3VUX A;  4PT5 A;  2CKH B;  1QOG A;  5CTR C;  4HCP B;  2KOX A;  5E6J A;  3VH3 B;  4WAA A;  5E6O A;  2M19 A;  1JWU D;  2K1F A;  4XDD A;  2AL3 A;  3RI7 C;  4EEW A;  4NNJ B;  3PGE A;  4FN2 A;  1Q0W B;  4EOY A;  4US9 A;  2KXJ A;  1Y8R C;  1DYQ A;  4LLG M;  4HJG E;  2WXR A;  1XT9 B;  4C7Z A;  2MJ3 A;  1VZ7 A;  4HDQ A;  4N96 A;  2QCZ A;  2DHZ A;  1OEY J;  3PRE A;  2CJO A;  1C4C A;  3AV8 A;  3D1E A;  2PKO A;  2WLB A;  3BK2 A;  1OEY A;  3JW0 X;  4FJV B;  1L2N A;  2WNM A;  1D6E C;  3ZKJ C;  2N1W A;  3MFG A;  4K3M A;  3VAW A;  2WDQ B;  3PLU A;  1WJU A;  3H7P A;  1EF5 A;  2WDT B;  4LJP B;  4N97 A;  4NJC A;  4WAF A;  2WX1 A;  2PTL A;  2HD5 B;  4ZYN A;  4JPS A;  2IY0 B;  4K1R B;  4PS8 A;  4G3X B;  2BKR B;  4K7S A;  3HHM A;  4AS1 A;  4C4V B;  1L6U A;  1K51 A;  2WXF A;  3V61 A;  2BW2 A;  2NMQ A;  5G5G A;  4AQ7 A;  1GG3 A;  3W2D A;  4II2 B;  3ETR A;  5DPS A;  3RNE C;  3DHG C;  3R7Q A;  3WAL A;  2BYV E;  1HTO A;  1TKY A;  1ET9 A;  3X0W A;  2L52 A;  3N1Y C;  3SR6 A;  1WX9 A;  1E6E B;  1YJJ A;  3HK0 A;  2OED A;  5HI1 A;  5D7G A;  5C1Z A;  1WFY A;  4NAW B;  2ZW1 A;  1VR9 A;  3IFW B;  2M0A A;  2KD0 A;  4I6P A;  4N98 A;  3ZRF A;  3QA8 A;  2D3G A;  1A70 A;  5T8I A;  1KFY B;  2KX0 A;  1P3Q U;  5HHD G;  4YTM B;  3H7S A;  2MJD A;  4RKI A;  3AEB B;  4RGN A;  1LGR A;  3VXW A;  3QIJ A;  1FPY A;  1UD7 A;  2JRI B;  3PRP B;  1C1Y B;  3ZXV A;  1FIQ A;  2KAC A;  4XX5 A;  4IWO A;  4M8M A;  3NZU A;  1EM7 A;  3QSB B;  4ACF A;  3T3O A;  1XF5 L;  1OQY A;  3KYD D;  1V6E A;  1F2R I;  1OK7 A;  2BWE S;  2MX2 A;  4WJP A;  3I3T B;  5L83 A;  4ZHP A;  4O1N A;  2INC C;  2BS2 B;  1FNU A;  2JU6 X;  1GPX A;  3EHV A;  2R2Q A;  3KYC D;  4MGZ E;  1DOX A;  1JWM D;  4GDK A;  1C9F A;  1XCQ L;  3SFE B;  4K7W A;  2BVC A;  2JF5 A;  2KO3 A;  2YEP F;  2FBW B;  3U52 E;  1SSN A;  2DYB A;  4P1B C;  4P1C C;  2J42 A;  4K3K A;  4K3S A;  4H2A A;  3UIP B;  2AL6 A;  1KM7 A;  1QKZ A;  3QAR A;  4GGQ A;  2DEN B;  2FIF A;  5JHA A;  4RGM A;  5G55 A;  5KHQ A;  3W9C B;  1H8C A;  2IJ0 A;  1QF6 A;  1Z5S B;  2D11 A;  1XLQ A;  3NS8 A;  2B76 B;  5TR5 A;  2L3Z A;  4HJK A;  3MTN B;  5EE3 A;  2K8H A;  5BMG A;  2W82 A;  4GN1 A;  3MC8 A;  3TEY A;  4ICV A;  4M0W A;  1KRH A;  4F8C B;  4XDC A;  1P98 A;  1NYR A;  1RWS A;  4TR6 A;  4L23 A;  1M4V A;  4MGY E;  1U4A A;  2PW9 A;  3T3N A;  3P4P B;  1OQR A;  4KV2 A;  3AED B;  1AYF A;  5CX3 A;  2DX5 B;  3KH0 A;  3ZGZ A;  3GE3 C;  2LWP A;  3URY A;  4PYU A;  3QQ8 B;  4URK A;  3FKY A;  3J9C A;  2PVG C;  3UF8 A;  1FM0 D;  3TSS A;  4RF0 A;  2LGY A;  4B0M A;  3NZS A;  5LLI A;  2LHE A;  2VZK D;  4W9I A;  3DBH B;  3AE2 B;  5AZH A;  2PLP A;  2IBI B;  1VD2 A;  4KIK B;  5IAA C;  2Z0D B;  2A5U A;  2R61 A;  3Q8B A;  4C00 A;  1I35 A;  2W9N A;  2WYQ A;  2AWT A;  4TQ1 A;  2V4L A;  1RAX A;  3B08 A;  3DOW A;  3PWE A;  1YN5 A;  1SE2 A;  4IKG A;  1KOT A;  2D10 A;  1I7H A;  1NDD A;  2WP9 B;  2LVO A;  3VR9 B;  2CJN A;  1TKG A;  2NBU A;  4PYZ A;  2FAZ A;  1X1M A;  4GXB A;  4W9C A;  4JQW C;  1WE6 A;  2GI9 A;  3KUC B;  4YT0 B;  2JYE A;  2J0K A;  2BKF A;  1KLG D;  2N9L A;  3ENE A;  2UU7 A;  3L08 A;  3NVW A;  2WWZ A;  4JX1 C;  5DPR A;  2K6Q A;  4MJQ A;  2MLB A;  1UWX A;  2GLS A;  4K3L A;  3GE8 C;  1DOY A;  4ZRK A;  1NEK B;  3RNC C;  3VR8 B;  1RFK A;  1E7V A;  2VH2 A;  2ZNV B;  2IY1 B;  1YD8 U;  4II3 B;  1V81 A;  1JRO A;  3IAM 1;  1WXA A;  2L8J A;  1L7Y A;  2V3N A;  3I5J C;  4XWW A;  3BEP A;  1PUT A;  2KTF A;  3PSE B;  2HTH A;  4OZC A;  1Q5W B;  2SEB D;  4BKT A;  1LFD A;  2NPT B;  1T0Y A;  3MC9 A;  1WXQ A;  2M8S A;  4TQ0 A;  3EEC A;  4PNV A;  2I38 A;  5EDS A;  2C9W B;  4NJ7 A;  5IKC M;  2REX A;  2L83 A;  3AM9 A;  5GXG B;  4C56 C;  1C4P A;  2HTM E;  3RN9 C;  4LCD E;  4A8X C;  2QMT A;  2PE9 A;  2K6D B;  1WSP A;  4LTU A;  3GB1 A;  4BKG A;  1K52 A;  1R7S A;  1J7A A;  1YIW A;  1QT9 A;  4TSS A;  2DAF A;  3H8H A;  1YMH E;  3X23 A;  1LXD A;  2G1E A;  4GB9 A;  3ZQ4 A;  3M62 B;  2ONQ A;  2LEK A;  2DYM A;  1Z2M A; 
#chains in the Genus database with same CATH homology
 3CSF A;  2C60 A;  2CS4 A;  2L0T A;  4WJN A;  1IYF A;  3GZN I;  3O65 B;  4BBN F;  2LRU A;  4EKU A;  3VUW A;  2KFK B;  3ZVV A;  3QCA A;  2KTR B;  2KK8 A;  5AEK B;  1WI0 A;  3VUX A;  2CHX A;  3ZNZ B;  2CKH B;  4HPM B;  4RMA A;  4WJQ A;  5CTR C;  3Q3J A;  4HCP B;  2KOX A;  4ZDV A;  4IW0 A;  2ZPN A;  3DBH I;  2BWF A;  3VH3 B;  5LXI B;  3AU5 A;  4IWQ A;  4WAA A;  5E6O A;  3P2B A;  1UGM A;  3U8Z A;  3RUI B;  4HK2 A;  4M8N A;  2K1F A;  4G50 A;  2AL3 A;  2BF8 B;  3ZW3 A;  1F9J A;  4HCN B;  4EEW A;  4A20 A;  4NNJ B;  3QAQ A;  3PGE A;  4FN2 A;  4P7I A;  3UQA A;  1Q0W B;  4EOY A;  2KXJ A;  1Y8R C;  2L0F A;  4HWI B;  4FJY A;  3V6C B;  1XT9 B;  2RSU A;  2KLC A;  2KDE B;  4G11 A;  4HDO A;  5AZG A;  2NPT A;  4HDQ A;  2LZ6 A;  2OOB B;  3W1S A;  4E74 A;  4J6I A;  2DHZ A;  2KQ7 A;  3K9P B;  3A1Q A;  1OEY J;  2LVP A;  2Z59 B;  3RZF A;  3PV1 A;  3T9L A;  4IG7 B;  1D3Z A;  3PRE A;  4CYE A;  1FXT B;  2MBQ A;  2FCQ A;  4W9L A;  4MGK E;  1OEY A;  2LVQ A;  3JW0 X;  3WAN A;  3LDZ E;  3PVL A;  4FJV B;  3VDZ A;  1L2N A;  2QHO A;  1R4M I;  5J2R A;  5JHB A;  3UIN B;  2IO3 B;  3ZKJ C;  2FCS A;  2N1W A;  4MH0 E;  3VAW A;  4ZRI A;  2BGF A;  2M1M A;  3PLU A;  4WWO A;  1WJU A;  3H7P A;  4LDT D;  5L95 C;  1EF5 A;  4JLC A;  2WDT B;  1WMH A;  4LJP B;  4MEL A;  3EFU A;  3ZO5 B;  3V62 A;  1WGD A;  2MP2 B;  1GNU A;  3VQI A;  4AJW A;  2KC1 A;  4KVG B;  2NCN A;  4A3P A;  4K81 A;  4WJO A;  3Q3F A;  3ALB A;  2Y5B B;  1NBF C;  3ZTC A;  2KNB A;  2CHW A;  2WX1 A;  5LXH A;  2HD5 B;  2DAJ A;  2XEW A;  4ZYN A;  3RCZ A;  2YLM A;  3L54 A;  2IY0 B;  4HXD A;  4K1R B;  4PS8 A;  4G3X B;  2BKR B;  1ZKH A;  2O6V D;  2HE7 A;  4KDI C;  2GBJ A;  3RD2 A;  4K7S A;  3HHM A;  3KUZ A;  4I6L B;  3ZNI D;  1YX6 B;  3TIX A;  4DXA B;  3V61 A;  2XK5 B;  2C7N B;  2ZZP B;  2IO2 B;  2C7H A;  1GG3 A;  2DZM A;  3ML8 A;  3B1L X;  3PPA A;  4II2 B;  3ZRC A;  3D32 A;  1WR6 E;  2D2Q A;  5DPS A;  1IPG A;  3R3M A;  4IWP A;  1OGW A;  1WIA A;  3HIZ A;  2IYD B;  4ANX A;  1V5T A;  2KFK A;  3KUD B;  2KTR A;  2L76 A;  2NS5 A;  2N1V A;  2BYV E;  4GDK B;  4ZRJ A;  3R7Q A;  3WAL A;  3WA0 A;  3X0W A;  2FID A;  2ZVN A;  2B3A A;  1RRB A;  1E8W A;  3N32 A;  1GC6 A;  3VTU A;  2LJ5 A;  4BKS A;  1WX9 A;  3R7R A;  1E90 A;  3HK0 A;  4XZ4 A;  4ANU A;  3PS6 A;  5D7G A;  3M63 B;  5C1Z A;  1E5W A;  3ZIM A;  4B95 A;  1WFY A;  5DPW A;  2ZCB A;  3L16 A;  3DVN V;  3ZLZ A;  3RYT A;  5AZF A;  2UWQ A;  3ML9 A;  4NAW B;  1JRU A;  1WXM A;  2RPQ A;  3DBR I;  3TL5 A;  4F7Z A;  1Q1O A;  2KN5 A;  3IFW B;  5IA7 A;  2NBW B;  2MBE A;  2K8C A;  2C7M B;  1LQB A;  3PHW B;  2KDF B;  2KD0 A;  3A9J B;  4I6P A;  4AWJ A;  3ZRF A;  2L7R A;  3ECI A;  2KQS A;  4DDI D;  1WF9 A;  2PEA A;  3QA8 A;  2D3G A;  2I1K A;  2KC2 A;  2LAS A;  1XQQ A;  2KX0 A;  1P3Q U;  5DCN A;  1KJT A;  3NHE B;  3H7S A;  4W9J A;  4TV3 A;  3ZUN A;  3H9D A;  4MEM A;  1RFA A;  3OJ4 B;  4B6W A;  2GBR A;  3VXW A;  4FBJ B;  3QIJ A;  4M0W B;  2V3S A;  3A4R A;  4AP4 C;  4DHZ B;  1UD7 A;  4BVU C;  2G3Q B;  2JRI B;  1UBI A;  3PRP B;  1K8R B;  1C1Y B;  2CU1 A;  1CMX B;  1E8X A;  3QC8 B;  2MA9 B;  4ANW A;  5FR6 A;  2MP2 A;  1ZGU B;  1S1Q B;  2NBV B;  4XX5 A;  4IWO A;  1WXS A;  4M8M A;  3NZU A;  2O2V A;  4F1S A;  1M94 A;  4W9K A;  1I42 A;  5KHO A;  1LM8 B;  4CO7 A;  4WQO B;  3WIM A;  4IUM B;  3PRM B;  3KYD D;  1OQY A;  1V2Y A;  1V6E A;  4NY0 A;  1E8Y A;  1V49 A;  4W9H A;  1WZ0 A;  2BWE S;  2MX2 A;  4ICU A;  4WJP A;  3A9K B;  3LJ3 A;  2ZJD A;  3I3T B;  3CMM B;  1IP9 A;  1ZW7 A;  3AI5 A;  4N9F 4;  5L83 A;  1V9J A;  3PHX B;  4GIV A;  4FJZ A;  5CHV C;  2N7D A;  3W1S C;  5HKH A;  1EF1 A;  2XK5 A;  4IC7 B;  3SD5 A;  3L13 A;  1WE7 A;  2K25 A;  2KDI A;  4FUL A;  4GU2 A;  3L0X B;  3T8M A;  1TTN A;  2CHZ A;  1R4N I;  2KAN A;  2MBO A;  1RLF A;  2ZCC A;  2R2Q A;  1WXV A;  3EHV A;  3RUL A;  3KYC D;  4MGZ E;  4W9E A;  4GDL A;  4EZK A;  2K39 A;  2YVC A;  3A4S C;  4JGH B;  2XBB C;  1AAR A;  2O6V A;  1S3S G;  4GDK A;  2NR2 A;  4K7W A;  2PJH A;  2N9E B;  4IM3 A;  3TCA A;  3H1U A;  2JF5 A;  2KO3 A;  2PPH A;  1BT0 A;  2BYE A;  1VCB A;  2V1Y A;  5BO4 B;  2JZ3 B;  2DYB A;  3PT2 B;  2KHW B;  2KJ6 A;  2KJH B;  2G45 B;  4TUU A;  3SU8 X;  3PLV A;  3S2A A;  2MCN B;  3L10 B;  2KWC A;  3UIP B;  3H6N A;  3ONS A;  2AL6 A;  2ZEQ A;  1KM7 A;  2N4F A;  3V60 A;  3QAR A;  4GGQ A;  4NAW A;  2MBB B;  2DEN B;  2FIF A;  2FNJ B;  3DVG X;  2Z0E B;  5JHA A;  2KVR A;  4IM2 A;  3JVZ X;  3V6E B;  5G55 A;  4A3O A;  5KHQ A;  2M4N A;  4E3C A;  3IVF A;  4W9G A;  2MWS B;  1H8C A;  1GJZ A;  1TZ1 A;  5G2N A;  5JZE B;  3DCG A;  1WR1 A;  1WX8 A;  1Z5S B;  3M95 A;  3NY5 A;  3OJ3 A;  2D11 A;  3CST A;  3NS8 A;  5TR5 A;  4BOZ B;  2L3Z A;  4HJK A;  2JRH A;  3MTN B;  1WRD B;  3APD A;  4OVU A;  2K8H A;  3WAO A;  4GN1 A;  3DPD A;  4ICV A;  5E6N A;  2KJR A;  2JZZ A;  5D2M B;  4AJY B;  1YJ1 A;  2PE6 B;  2LXA A;  4F8C B;  1P98 A;  3JSV B;  1H4R A;  4MGY E;  4NQL B;  1U4A A;  2FUH B;  2N9X A;  2C5L C;  1EUV B;  4I6N B;  3NOB A;  5GMV A;  4KSL C;  1C3T A;  1WMH B;  2LUE A;  3ZTD A;  4EUT A;  2N9P C;  3IBE A;  4KV2 A;  3IHP C;  1UH6 A;  5CX3 A;  2DX5 B;  1WX7 A;  3KH0 A;  1V86 A;  2LGX A;  2MSE D;  3HM6 X;  2ASQ A;  2OJR A;  3SHQ A;  1WYW B;  2EKE C;  3A9K A;  3BIN A;  1WJ6 A;  1SE9 A;  2WX0 A;  3ZNH B;  1UBQ A;  2LWP A;  1P9D U;  2ZVO A;  3ZDM C;  4CHK A;  4HPL B;  4BOS C;  4PYU A;  4AOF A;  5C23 A;  3QQ8 B;  4MJS B;  2J7Q B;  4URK A;  2AYO B;  2N7E A;  4JIO U;  1A5R A;  3UF8 A;  2RD0 A;  3AU4 A;  1P0R A;  1WGR A;  4FA6 A;  4XC2 A;  3VTV A;  2FCN A;  3SDL C;  4E71 A;  2EMS A;  2LGY A;  1GUA B;  2KKC A;  3NZS A;  5LLI A;  4ASW C;  5CHF A;  4K7U A;  5CHW A;  2IZV B;  3GOE A;  3N3K B;  4W9I A;  1WGY A;  5AZH A;  1J8C A;  2IBI B;  1VD2 A;  4KIK B;  3U30 A;  5IAA C;  2KWU B;  2Z0D B;  2D07 B;  4OVV A;  2A5U A;  4TKN A;  2HJ8 A;  2LGD A;  2ZNV C;  3KW5 B;  1I35 A;  2W9N A;  3DDC B;  1EO6 A;  3WAP A;  3UGB B;  1TBE A;  5E6P A;  2WYQ A;  2JY6 A;  3VVW B;  2AWT A;  4TQ1 A;  2V4L A;  3L0W B;  1RAX A;  2DYO A;  3B08 A;  3OAW A;  4DK5 A;  1E8Z A;  3DOW A;  1SGH A;  2BPS A;  4W9F A;  1YX5 B;  1KOT A;  3AUL A;  2R2O A;  2D10 A;  2G4S A;  3TJP A;  2L05 A;  3QWZ B;  2DZJ A;  5D94 A;  3DBL I;  5J18 A;  3DVG Y;  1NDD A;  3VFK A;  3PZD A;  2LVO A;  2M0X A;  1TGZ B;  2NBU A;  3U7D A;  4PYZ A;  3KVF B;  2FAZ A;  1WGH A;  3APC A;  3K9O B;  1X1M A;  1J0G A;  3ZDT A;  4GXB A;  1WJ4 A;  3APF A;  4W9C A;  4JQW C;  1WJN A;  1WE6 A;  4LJO B;  2RR9 A;  3KUC B;  2KLG A;  3EC8 A;  4PS7 A;  3QHT A;  2J0K A;  2BKF A;  3ENE A;  2JT4 B;  1YQB A;  3L08 A;  3QK0 A;  1WGG A;  4G0N B;  1KLV A;  1V5O A;  1SIF A;  2WWZ A;  2L00 B;  2AEH A;  2K6Q A;  5DPR A;  4DDG D;  2MLB A;  4NPN A;  1UZX B;  3CF6 E;  2GOW A;  4PS3 A;  2JVC A;  2GBM A;  3JSV A;  1WH3 A;  3B0A A;  3W1Y A;  2KX3 A;  4BFR A;  4ZRK A;  4DHJ D;  1G6J A;  1E7V A;  2ZNV B;  4RM9 A;  4KSK C;  2IY1 B;  1YD8 U;  2MW5 A;  4II3 B;  3VUY A;  1V81 A;  2K8B A;  4AUQ C;  2JWZ A;  4W9D A;  3QX1 A;  2CR5 A;  3DQV A;  2EMT A;  1NI2 A;  4RM8 A;  2UYZ B;  1WXA A;  1UEL A;  2KZR A;  3VH4 B;  2L8J A;  1L7Y A;  3AXC A;  3ZNG C;  3JYU A;  4HLE A;  4NQK E;  2G4D B;  2KTF A;  3PSE B;  3WAM A;  2HTH A;  2O2V B;  1J19 A;  1WY8 A;  1Q5W B;  2KMA A;  3QJZ A;  2DZK A;  4BKT A;  3A9J A;  1LFD A;  5J17 A;  3PTF C;  1OTR B;  2NPT B;  2KWV B;  4HVB A;  2GBK A;  5JH5 C;  4FAD A;  3TMP B;  4DHJ B;  4X57 B;  2FCM A;  3MHS D;  2M17 A;  1T0Y A;  3A1Q B;  4LDT B;  2GMI C;  4ANV A;  2J0J A;  3MJW A;  4FHK A;  2JXX A;  2M8S A;  4IM0 A;  2MBH A;  4MJS A;  4TQ0 A;  4FHJ A;  3EEC A;  4NJ6 A;  1P1A A;  4DHZ E;  1V80 A;  4KDL B;  2MRP A;  3R66 C;  5EDS A;  2C9W B;  2KMC A;  4GOC A;  4NJ7 A;  2IO1 B;  4KZ0 A;  2REX A;  3HM3 A;  2LI5 A;  2IO0 B;  1HE8 A;  3A33 B;  4BBN C;  1MG8 A;  2DZI A;  2JUO A;  4GMV A;  3IG3 A;  4MSQ B;  2A4Z A;  1ISN A;  2I1J A;  4MDK E;  1GC7 A;  3UQB A;  4JL9 A;  4KIK A;  4LCD E;  4GDL B;  1E7U A;  4KZC A;  3H7P B;  3L17 A;  5DPT A;  2O6V B;  2PE9 A;  2K6D B;  3OLM D;  2KFJ A;  3PRZ A;  4YL8 A;  4FLH A;  4EFO A;  4GSW A;  3VHT C;  4WWP A;  4BKG A;  2MQJ A;  3BY4 B;  1QZE A;  2NVU I;  2BYF A;  1YIW A;  4EZJ A;  2DAF A;  4EZL A;  3DVN U;  2ZPY A;  2LXC A;  3TBL D;  4DWF A;  4DBG A;  2LD9 A;  2RGF A;  3VTW A;  3X23 A;  1LXD A;  1WM3 A;  2J0M A;  3N30 A;  4B9K A;  4GB9 A;  4MM3 A;  3M62 B;  3M3J A;  4MGI E;  4MSM B;  1PQS A;  2DYM A;  2KDB A;  3DBS A;  4WWN A;  3RT3 B;  5D6J B;  3UIO B;  1WM2 A;  3C0R B;  2VRR B;  2GBN A;  1XD3 B;  4BKS D;  3RZW C;  2LRW A;  1Z2M A;  2JPH A;  1WZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...