3PGFA

Crystal structure of maltose bound mbp with a conformationally specific synthetic antigen binder (sab)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
367
structure length
358
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric control of ligand-binding affinity using engineered conformation-specific effector proteins.
pubmed doi rcsb
molecule keywords Maltose-binding periplasmic protein
source organism Escherichia coli
molecule tags Maltodextrin binding protein/de novo protein
total genus 122
structure length 358
sequence length 367
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pgfA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pgfA01
2GH9A 1Y3PA 1N84A 1FTLA 3VDFA 3S9EA 4GXAA 4OYVA 2XXTA 2YJPA 2I4CA 1Z7NE 3QUFA 3IOVA 3SEYA 3RPWA 4TOZA 3T22A 1MM7A 4I8CA 3IO6A 4HCWA 1I6AA 3FUZA 1ANFA 1D3KA 2F78A 1M5FA 3MVZA 2AL4A 1QVSA 5K2YA 4PFYA 4AB5A 4WXJA 3MPKA 4P0IA 3C4MA 1B4ZA 2RF1A 2I48A 5KZTA 2OZZA 3EPEA 1FTKA 2PBWA 1WVJA 4QSDA 3W9WA 1VFDA 3FXQA 1P1QA 4YMBA 4R6HA 1UQWA 4LZ5A 3IK6B 1IIWA 2M8CA 1QULA 3O97A 5B70A 2FYIA 4MFIA 3B6QA 2DE4A 4JSDA 3IB2A 2PX1A 3VXCA 3MAMA 3EF7A 4YB5A 3MVYA 2DWHA 3TCHA 1EH3A 1LAHE 3I5OA 3U8QA 2Q2AA 4OESA 1GVCA 5AA4B 1OIBA 4G8NA 4GD5A 4JSOA 3O28A 1Z7ME 3N6UA 1US5A 2Y7PA 2AYSA 2XD3A 1LB8A 1SW5A 1US4A 3FATA 1MQGA 4E0WA 3MC2A 3DP4A 4DCXA 3VXBA 5H8FB 1XS5A 4G77A 2ZYNA 4KR5A 1A40A 2DP8A 1MY3A 2XXUA 1DMBA 1YPNA 2V3TA 1TFDA 3DM0A 2QMXA 4ZEKA 3O29A 1MY2A 3JYRA 3TELA 1NH7A 4GF8A 2Q2CA 2XX8A 1B7HA 3IOUA 4R72A 1AH5A 1QJMA 3UORA 2D21A 2F5XA 1R6ZA 3UGWA 3K02A 1RYXA 5AA2B 5ICTA 5FHNA 3HHFA 1LLSA 2PT1A 1UIUA 2B65A 3FZVA 1Q1KA 4JWXA 3MW0A 3E4RA 3G3IA 4EXKA 4OFJA 3T9XB 2VD2A 1JVYA 3GZGA 2QMWA 3RT6B 1I6QA 5JTYB 3FV1A 3UIFA 3M8UA 4YKIA 4RNSA 4I1DA 1FQBA 1B51A 3PMVA 1A8FA 2F7CA 1SBPA 3QIMA 1QUIA 5EYFA 3N5LA 3BBRA 1HSLA 3TQLA 4KHZE 4LP2B 4F3PA 3M3FA 1PB9A 3U92A 1P1OA 3RQTA 1MY1A 2F36A 5AA2A 2HEUA 4R73A 1XVYA 1MG1A 3DP8A 4PFUA 4H8JA 1QUJA 5AA1A 3E13X 5H8NB 2ANJA 3G3GA 5L9SA 5DEXB 2DQVA 3V5AA 3S9NC 1N0TA 2O68A 2HAVA 2HQ0A 1OLCA 4NWCA 3RLFE 4R6YA 4R75A 3CI8A 4RK9A 3S4UA 5JTYA 3KJTA 1H76A 4N13A 3GXAA 3OMBA 1IXCA 3OOAA 5IKBA 1S9TA 1BIYA 3IJOB 4OMBA 4P0GA 3EHSA 5ELVA 3TPAA 1P99A 5J1DA 1R9QA 4ELPA 3KN8A 1ATGA 2XX7A 2LAOA 4NF6A 5CMKA 3SDFA 2Z23A 3HN0A 3KJ7A 1MXVA 1R1NA 3H6VA 2G29A 2HAUA 3KZGA 3SKPA 3PPQA 3TZAA 4IGRA 4XTCQ 3TTNA 5TPAB 5L8DA 2YLNA 2GRVA 5H8NA 4KYDA 3K1MA 5DEXA 3W9VA 1PEBA 3G3HA 2Q8JA 1OQHA 1O64A 1MXUA 1IXGA 4F18A 3PPPA 5EHSA 2I0CA 4LA9A 4OEVA 1QKBA 4IO4A 2R6GE 4XKPA 2NUVA 4IO7A 4KYSA 1P1WA 4BLAA 3PGFA 3PPNA 1OVBA 4ELRA 3TUSA 2I49A 2Z8FA 2P0SA 4KCDA 1LGBC 3R26A 2ABHA 1B9JA 4RXLA 4YB6A 3D4CA 4KCCA 4EQ7A 1SI1A 1USYH 1P1UA 3TDJA 1A55A 5DYHA 4G2ZA 2Y84A 1M5BA 3AXFA 5TPAA 5H8QA 4EDPA 3CIJA 4GL0A 2F6PA 2H4IA 4C0RA 2XXWA 4U1ZA 1FQAA 3VLUA 4U2RA 1AMFA 3LSFB 2QL3A 4OZ9A 3H6WA 1ZIUA 1B46A 4GXSB 5ICQA 2D3IA 4QFLA 4MF3A 3PPOA 2XX9A 5JEIA 1N3XA 2HCAA 1UIVA 3ONMA 3PD8A 4Z7EA 3FASA 3G7WA 1UTBB 4KFQA 4ZZEA 1LCFA 2XXHA 2I3WA 2FNCA 1FQDA 5CMMA 2V93A 2RKMA 2DE2A 1M5DA 2VD3A 3I6VA 3HCQA 2X7PA 3QSLA 4BDRA 3T96B 3JV9A 1VFEA 1PBPA 3IOTA 1D9YA 2ESNA 3VVDA 1ZLQA 2RC7A 2VOZA 3CSGA 3U72A 1MXWA 4X1BA 1B0LA 1B5HA 1MY0A 1YTVA 4FECA 2O6AA 3VE1B 3KFMA 4ELQA 2ZMBA 4FEBA 1SVXB 3KN3A 1TWYA 3L6GA 4IB2A 3B6TA 4U23A 1NMUA 3VLVA 2QJEA 4QHQA 3FXRA 1UTBA 5I58A 4ZS9A 1FTOA 3CSBA 3D4GA 4R9GA 4WEDA 3ZKKA 3V8XB 4H1XA 2OWSA 4NE4A 5I59B 1OLAA 1MH3A 2PYYA 4RA1A 4XKNA 1SW1A 1EZPA 5ITPA 2DVZA 1B3HA 4LQ5A 2PMSA 2ZYKA 3U93A 3N94A 3MVWA 3SEUA 2H98A 3HHGA 2O1LA 1URGA 3KG2A 3MP1A 3TFLA 2F35A 3LSLA 1VR5A 1NNTA 1B2HA 1PC3A 1D4NA 3T9UA 3HV1A 3TQWA 2DWJA 3W15C 3FXUA 4KQPA 3K6UA 3K00A 3ODBA 4KD5A 3TEPA 3CVGA 2I3VA 4RJZA 1GGGA 4F2OA 3GBBA 4KPTA 1IQ7A 4IY6A 5AA3A 1TFAA 1Y3NA 5I59A 5CI5A 4KYEA 4R9FA 1OMPA 3MZ1A 2Z8EA 1B3FA 1B40A 1B58A 4O3BA 4OWDA 4F3SA 2PT2A 3PUYE 3PMWA 4NTLA 2XXRA 3RNNA 3QK6A 1N3WA 3A3UA 3H06B 3CG3A 4F3GA 4GLIA 1B5JA 2O51A 5FHOA 3OEMA 3CRBA 4IO3A 1MQDA 4GOTA 3GBAA 1BKAA 1Y4CA 4YKJA 2FA7A 1B0HA 3BFUA 2F8DA 3M3LA 4F2QA 4FATA 4Q30B 1B1HA 3MUQA 1DPPA 1DOTA 3R7XA 4YB7A 5I2KB 1LFHA 4U4SA 2Q88A 3O66A 2I4BA 1Q35A 4ESXA 3IOWA 1WODA 2D5WA 2DXRA 5BUUA 2QS2A 1PB8A 4NEDA 2Y7RA 4DXBA 3OD7A 3IORA 1QUKA 3FVKA 1BTJA 3OO9A 3SEWA 3PPRA 3FVNA 1DSNA 4ND9A 4ZZAA 5L9OA 4L17A 3H03A 4Q0CA 2ONSA 3ILTB 4UA8A 2H9BA 4FORA 4ZDMA 4LZ8A 1B6HA 2ALUA 1CE2A 4KI0E 4TLMB 1H3DA 2F7AA 3R6UA 3PUWE 3H3GA 2RC9A 4HS7A 3UN6A 4ZEBA 5I2KA 3OXNA 3KBRA 3O9PA 3K1NA 1Y4TA 2UVHA 4N6PA 5I2NA 2UVIA 1WDNA 1IITA 2XHDA 2XXYA 3THIA 4F19A 3PD9A 1S7YA 3V89B 3SEXA 1VSOA 3TKDA 3SESA 2E0SA 3MBPA 4U21A 4IGTA 5ITOA 3PUZE 2DS9A 4LUBA 2GFEA 3TTKA 3IAZA 3A3CA 1BLFA 4DIGA 1B3GA 1PB7A 4NF6B 3WAEA 3V83A 1ZBMA 3OO7A 2G93A 4NWDA 1B3EA 3QYTA 2DOJA 3IB0A 4U22A 2Q9TA 1DPEA 1MXZA 3E9XA 2VP1A 1RKMA 3UK4A 4QSCA 5HPQA 2ZNTA 4OVJA 3O6HA 4YICA 4PETA 2O69A 1IZ1A 4LVQA 4ELOA 1AOVA 3ZS6A 4ESWA 2A5TB 2REGA 5JK4A 4YMAA 3PUXE 4OQOA 1MXYA 2R71A 2UVGA 3Q25A 5DVFA 3MWBA 4DE8A 3Q28A 5KDTA 2O7IA 4RPOA 1NNFA 3MZ9A 5H8QB 5IAIA 5F7VA 1LBCA 4JXIA 3L6HA 3K6XA 1LFIA 1H45A 4JWYA 2B3BA 2XXVA 3MZBA 1YAEA 1ELJA 2ZNUA 3P7IA 4MLVA 4QRZA 1USYE 2A5TA 3LC8A 2XXPA 1PBQA 5F1QA 1MQHA 4POWA 4G4PA 1I6BA 2RCBA 4NF5A 1MQJA 1XOCA 1FW0A 4ZECA 3QXMA 4MBPA 3FV2A 2Z8DA 2KLFA 1H44A 4X1DA 4F31B 2H25A 1LB9A 2OCUA 3U94A 1FQFA 3KGCA 4F1YA 4GWOA 5HM4B 1CB6A 2I6EA 2Q89A 3LSXA 2HZLA 4JBZA 1FTJA 1TT1A 3RGYA 2VGQA 4DXCA 5FTIA 3RTWB 3A09A 5I57B 2B3FA 1IUDA 3UP9A 4EF1A 4XXUA 1A99A 1FTMA 1FQEA 4FE8A 1L5TA 3PMXA 1SW4A 3KSJA 1EZ9A 3Q26A 4FAJA 5I58B 5A5XA 3RY3A 1F9BA 2OJTA 3C32A 4NF4B 3T93B 4HW8A 3LUYA 3M3KA 3LSWA 5TP9B 5K2XA 2H99A 3BKIB 2IA4A 1JNFA 5CMBA 4OHNA 3S9LC 4I9DA 2DYXA 3O2AA 4AQ4A 2W7YA 1M5EA 1FQCA 1GR2A 2O1MA 3DP6A 4X9TA 3IJXB 4OTEA 3IO4A 2F7BA 3SETA 1URSA 1B3LA 4U4XA 4K3FA 1A7LA 5I57A 3TAJA 2PVUA 4DDDA 1MY4A 3HO7A 4C1TA 3SERA 4RK2A 3ILUB 1MXXA 3EHTA 5M2VA 1FCKA 3MQ9A 3K4UA 2QPQA 4LZ7A 1MDQA 2NOOA 2QRYA 5FHMA 3CFLA 5I56B 1N04A 1B5IA 2X26A 5LOMA 2Y7IA 4OXVA 2RC8A 1HSJA 4M4GA 5ISUA 3O6GA 2NVUB 4NF4A 3TCGA 1B7ZA 1N7XA 5TP9A 4EF2A 1N7WA 3K1PA 2HZKA 1JQFA 3TTRA 1LCTA 3CFXA 2RCAA 2F6GA 3OSQA 4E0XA 4G68B 2I58A 4MH5A 3N6TA 3HSTA 3DELB 4QFPA 4ECFA 4ISUA 4XKRA 3H7MA 3C36A 3IB1A 4U1OA 2DWAA 3LR1A 2HFBA 1B52A 3VVEA 3FGSA 1B7UA 3JZJA 1EU8A 4BDOA 5I56A 2F34A 2UXAA 2IEEA 4H67A 3ZKLA 4H5GA 2E1SA 1QW0A 4G8MA 5KCJB 3C31A 4YKPA 2DSFA 4O3AA 4PP0A 3K2DA 4OEUA 3FD3A 3G3FA 3C35A 4MLQA 2QS3A 5B7DA 1N76A 1A54A 3PU5A 2ZXTA 2X7QA 3S2VA 4G68A 1IXIA 3SEVA 3I3VA 4UACA 1SYIA 5L9MA 4RY1A 3FVGA 5AA2D 3TTLA 4H6DA 4QF9A 1LAGE 1LFGA 4GL8A 2F97A 5DT6A 2VHAA 2P1SA 4ONYA 2OBGA 4F1VA 1MM6A 3OO8A 1POY1 1SYHA 4YKKA 5KCJA 2P2AA 3VVFA 5FTHA 4WKMA 4ZE8A 4JWOA 4OENA 1NFTA 2Z22A 4IO5A 1P1NA 1JETA 3KN7A 1JW4A 3CG1A 2V3QA 2DXYA 3ZSFA 1IXHA 3G3JA 1Y20A 3K6VA 3IX1A 4JB7A 5H8HB 4OERA 1Y9UA 4DXUA 4GRKA 1SQYA 2DE3A 4BDNA 5I2NB 2GHBA 1SW2A 3OO6A 1JW1A 2QS4A 3FJGA 4WEPA 1MPBA 4GFRA 1EZOA 4ZE9A 3B7DA 3GLBA 1VE4A 2QS1A 3HPIA 4IO6A 1T0KA 1ZU0A 4HTGA 1Y1ZA 1KWHA 3KSXA 4R2FA 4Q8RA 1JVXA 2BJJX 3MVXA 3E3KA 1LBBA 4X48A 1LAFE 1B4HA 5AA4A 1MPCA 3QUJA 4NMYA 2CMOA 4F3BA 5H8HA 4G68C 4G8HA 5DTBA 2YPNA 2ONRA 1B05A 2UYEA 4YU0A 5H8FA 2HXWA 3S9MC 1NNPA 3OELA 4AB6A 4RPNA 2O7UA 1JEVA 5CRYA 4PFTA 5CBRA 4PE5B 4QFOA 2XD2A 3C9HA 3MP8A 3KEIA 4H0WA 3USDA 2ZYOA 4R74A 4C1UA 4F22A 5KDTB 1B1XA 1NL5A 1NNKA 4M1VA 2V84A 1ZJLA 5H8SA 1XVXA 2I0BA 1LAXA 2AL5A 4ZEFA 4DLDA 3PUVE 3T9HB 2ONKE 4QFKA 1AL3A 2ZYMA 1O7TA 2UYFA 3EHUA 3K6WA 3MPLA 3O6IA 5BWJA 3VV5A 4NF5B 1HSEA 4BDMA 1B32A 4PFWA 3FIRA 4F39A 4PQJA 4O3CA 5AE4A 4OFLA 1MH4A 3RTFB 2DVCA 5I84A 1ZKBA 1JEUA 1MPDA 2RINA 3VLWA 1SI0A 1R9LA 3EQ1A 1II5A 5DVIA 1D9VA 4ZEIA 3DLNA 3CFZA 2XXXA 3T66A 2QSXA 3KOSA 4H5FA 5CC2A 3MP6A 1UTHB 2V3UA 2DWIA 3OENA 2XXIA 4POXA 4EQ9A 1POTA 4THIA 4GQOA 2THIA 4IY5A 4TLLB 5CBSA 5CMCA 3VFJA 3N26A 3PV0E 4FEDA 4QSEA 3T9VA 2Y7KA 1AIVA 3F11A 1BP5A 1J1NA 3IL1B 1H43A 3ECRA 1SD3A 3TMGA 4EXLA 3TTMA 4DCYA 2R9JA 4LQ2A 5A5XB 4XIGQ 1PDAA 1S50A 2OWTA 1LSTA 3H6TA 2NXOA 1ZTYA 2A5SA 1OVTA 2NWJA 1OQGA 1QKAA 2WKYA 3OSRA 1MDP1 3C34A 4GIZA 5DVJA 3U1OA 4P11A 1UTHA 5CM6A 4YAHX 4RYAA 3TCFA 1GTKA 1NKXA 3MJNA 2UVJA 2V25A 1MRPA 1O63A 3WAFA 3TODA 4BDQA 3RT8A 3H6UA 3RN8A 2XXQA 3G3KA 4FJPA 4R2BA 1M5CA 4FIMA 4F1UA 1Y1MA 2REJA 1DTGA 4H8IA 1NH8A 4JDFA 3FJ7A 4EUOA 4Z0IA 4TQUQ 1ZMGA 4NF8B 4N07A 4OETA 1RYOA 5TU0A 2CZLA 4R6KA 4ZEDA 4QFNA 3LBSA 3KOTA 3QAXA 1MQIA 2OLBA 3B6WA 1XC1A 1MS7A 4Q5TA 2GHAA 3TYHA 2H5YA 2AIXA 3UA8A 4I62A 3C33A 4YZZA 1URDA 3BFTA 2O84X 3CR9A 3FVOA 4XKQA 4DZ1A 3Q29A 3Q27A 4OFOA 3OEKA 3IR1A 3K01A 2OK2A 1A8EA 4EQBA 4F29A 1Y3QA 1GV8A 1IEJA 1YCJA 3RUMA 4LATA 4NF8A 1I69A 1DTZA 1JW5A 2Y7WA 4LONB 1XHYA 4GVOA 4IO2A 5HBCA 4HCYA 5EHMA 4BDLA 3EN3A 1XT8A 1SDXA 2ZNSA 3H4ZA 3K0VA 3FJMA 4H65A 1TXFA
chains in the Genus database with same CATH superfamily
2GH9A 1Y3PA 1N84A 1FTLA 3VDFA 3S9EA 4GXAA 4OYVA 2XXTA 2YJPA 2I4CA 1Z7NE 3CHGA 3QUFA 5IM2A 3IOVA 3SEYA 3RPWA 4TOZA 3E78A 3T22A 1MM7A 4I8CA 3IO6A 4HCWA 1I6AA 3FUZA 2F3DA 5EYGA 1ANFA 1D3KA 2F78A 1M5FA 3MVZA 4PAFA 2Q8MA 3BIGA 2AL4A 1QVSA 5K2YA 4PFYA 4AB5A 4WXJA 3MPKA 1NUZA 4P0IA 3C4MA 4PFRA 1B4ZA 2RF1A 2I48A 5KZTA 2OZZA 3EPEA 1FTKA 5I7IA 2PBWA 4GBWA 1WVJA 4QSDA 3W9WA 1VFDA 3FXQA 1P1QA 4YMBA 4R6HA 1UQWA 4LZ5A 3IK6B 1IIWA 2M8CA 1QULA 3O97A 5B70A 2FYIA 4OA4A 4MFIA 3BIHA 3B6QA 4XF5A 2DE4A 4PBHA 4JSDA 3IB2A 2PX1A 3VXCA 2FIEA 3MAMA 3EF7A 4MAGA 4N17A 4YB5A 3MVYA 2DWHA 4N8YA 3TCHA 1EH3A 1LAHE 3I5OA 3U8QA 2Q2AA 4OESA 1GVCA 5AA4B 1OIBA 2QVVA 4G8NA 4GD5A 4JSOA 3O28A 1Z7ME 3N6UA 1US5A 2Y7PA 2AYSA 2XD3A 1LB8A 3IFCA 1SW5A 1US4A 3FATA 1MQGA 4E0WA 3MC2A 2KQZA 3DP4A 2XWOA 4DCXA 3VXBA 5H8FB 1XS5A 4KXPA 1K9ZA 4G77A 2ZYNA 4KR5A 4MNIA 1A40A 2DP8A 1MY3A 3ROJA 2XXUA 4GWWA 1DMBA 4JVDA 1YPNA 2V3TA 1FBHA 1TFDA 3DM0A 3E79A 2QMXA 4ZEKA 3O29A 1MY2A 3JYRA 3TELA 1NH7A 4GF8A 2Q2CA 2XX8A 1B7HA 3IOUA 4R72A 1AH5A 1QJMA 3UORA 5I5PA 2D21A 2F5XA 1D9QA 1R6ZA 4GWUA 3UGWA 4IR8A 3K02A 2B4LA 1RYXA 5AA2B 5ICTA 5FHNA 5IZZA 3HHFA 1LLSA 2PT1A 1UIUA 2B65A 4G61A 2B4MA 3FZVA 1Q1KA 4JWXA 1FPDA 3MW0A 3E4RA 3G3IA 4AS5A 4HE2A 4EXKA 4OFJA 3T9XB 2VD2A 1JVYA 3GZGA 2QMWA 1FBFA 3RT6B 1CNQA 1I6QA 5JTYB 3FV1A 3UIFA 3M8UA 4YKIA 4RNSA 4I1DA 1FQBA 1B51A 3PMVA 1A8FA 2F7CA 2FHYA 1SBPA 3QIMA 1QUIA 5EYFA 3N5LA 1KA0A 3BBRA 1HSLA 3TQLA 4KHZE 4LP2B 1NUWA 4F3PA 3M3FA 1PB9A 3U92A 1P1OA 3RQTA 1DCUA 2BJIA 1MY1A 1G0HA 2F36A 5AA2A 2HEUA 4R73A 1XVYA 1MG1A 3DP8A 4PFUA 4H8JA 1QUJA 5AA1A 3U65A 3E13X 5H8NB 2ANJA 3G3GA 5L9SA 5DEXB 1SPIA 2DQVA 3V5AA 3S9NC 1N0TA 2O68A 4P47A 2HAVA 2HQ0A 1OLCA 4NWCA 3RLFE 4R6YA 4R75A 3CI8A 4RK9A 3S4UA 5JTYA 3KJTA 4PE3A 1H76A 4N13A 3GXAA 3OMBA 1IXCA 3OOAA 5IKBA 1S9TA 1BIYA 3IJOB 4OMBA 4P0GA 3EHSA 5ELVA 3TPAA 1P99A 5J1DA 1R9QA 4ELPA 3KN8A 3IFAA 1ATGA 2XX7A 2LAOA 4NF6A 5CMKA 3SDFA 2Z23A 3HN0A 3KJ7A 1MXVA 1R1NA 3H6VA 2G29A 2HAUA 3KZGA 3SKPA 3PPQA 3TZAA 4IGRA 4XTCQ 3TTNA 5TPAB 5L8DA 2YLNA 2GRVA 5H8NA 4KYDA 3K1MA 5DEXA 3W9VA 1PEBA 3G3HA 2Q8JA 1OQHA 1O64A 1MXUA 1IXGA 4F18A 3PPPA 5EHSA 2I0CA 4LA9A 2Y5KA 4OEVA 1QKBA 4IO4A 2R6GE 4XKPA 2NUVA 4IO7A 2HXRA 4KYSA 4P56A 1P1WA 4BLAA 3PGFA 3PPNA 1OVBA 4ELRA 3TUSA 2I49A 2Z8FA 2P0SA 4KCDA 1LGBC 3R26A 2ABHA 1B9JA 4RXLA 4YB6A 3D4CA 4KCCA 2XXKA 4EQ7A 1SI1A 1QGXA 1USYH 1P1UA 3TDJA 1A55A 5DYHA 4G2ZA 2Y84A 1M5BA 3AXFA 5TPAA 4LN5A 5H8QA 4EDPA 3CIJA 4GL0A 4JVIA 2F6PA 1FJ6A 2H4IA 2VPOA 1Q9DA 4C0RA 2XXWA 4U1ZA 1FQAA 4OVSA 3VLUA 4NX1A 4U2RA 1AMFA 1DBZA 3LSFB 5EQ9A 2QL3A 4OZ9A 4NHBA 3H6WA 1ZIUA 1B46A 4GXSB 5ICQA 2D3IA 4QFLA 4MF3A 3PPOA 2XX9A 5JEIA 1FPFA 1N3XA 2HCAA 1UIVA 3ONMA 3PD8A 4Z7EA 3FASA 3G7WA 1UTBB 4NQ8A 3FXBA 4KFQA 4ZZEA 1LCFA 2XXHA 3RPLB 2I3WA 2FNCA 5IZ3B 1FQDA 3QMFA 5CMMA 2V93A 2RKMA 2DE2A 1M5DA 2VD3A 3I6VA 3HCQA 2X7PA 3KC0A 3QSLA 5LDZA 1KA1A 4BDRA 3T96B 3JV9A 1AWBA 3MYUA 1VFEA 1PBPA 3IOTA 1D9YA 2ESNA 3VVDA 1ZLQA 2RC7A 2VOZA 3CSGA 3U72A 1MXWA 4X1BA 1B0LA 1LEVA 1B5HA 1MY0A 1YTVA 1NV1A 4FECA 1FRPA 2O6AA 3VE1B 3KFMA 4ELQA 2ZMBA 4FEBA 1SVXB 3KN3A 1TWYA 3L6GA 4IB2A 3B6TA 4U23A 1NMUA 3VLVA 2QJEA 4QHQA 3FXRA 1UTBA 5I58A 4ZS9A 1FTOA 3CSBA 3D4GA 4R9GA 4WEDA 5IZ3A 1RDZA 1YXIA 3ZKKA 3V8XB 2QFLA 4H1XA 2OWSA 4NE4A 5I59B 1OLAA 1MH3A 2PYYA 4RA1A 4XKNA 2WBBA 1SW1A 1EZPA 4DI4B 5ITPA 2DVZA 1B3HA 4LQ5A 2PMSA 1FPLA 2Y5LA 2ZYKA 3U93A 3N94A 3MVWA 3SEUA 2H98A 3HHGA 2O1LA 4NN3A 1URGA 3KG2A 3MP1A 3TFLA 2F35A 3LSLA 1VR5A 1NNTA 5ESYA 1B2HA 1PC3A 1D4NA 3T9UA 3HV1A 3TQWA 2DWJA 3W15C 2WYPA 3FXUA 4KQPA 1LBXA 3K6UA 3K00A 3ODBA 1BK4A 4KD5A 3TEPA 3CVGA 2I3VA 4RJZA 1GGGA 4F2OA 3GBBA 4PBQA 4KPTA 1IQ7A 4IY6A 5AA3A 2R8TA 1TFAA 1Y3NA 5I59A 5CI5A 4KYEA 4R9FA 1OMPA 3MZ1A 2Z8EA 1B3FA 1B40A 1B58A 4O3BA 4OWDA 4F3SA 2PT2A 2WEFA 2FIXA 3PUYE 3PMWA 4NTLA 2XXRA 3RNNA 2ZZVA 3QK6A 4NG7A 1N3WA 4H46A 3A3UA 4PFBA 3H06B 5F24A 3CG3A 1K9YA 1IMCA 4F3GA 4GLIA 4MX6A 1B5JA 1FBDA 2O51A 5FHOA 3OEMA 2XWVA 3CRBA 4IO3A 1MQDA 4P1LA 4GOTA 2PFYA 3GBAA 1NUXA 3HFUA 1BKAA 4N6DA 1RDYA 1Y4CA 1IMAA 4YKJA 2FA7A 1DK4A 1B0HA 3BFUA 2F8DA 3M3LA 4F2QA 4FATA 5EQAA 4Q30B 1B1HA 3MUQA 1DPPA 1DOTA 3R7XA 4YB7A 5I2KB 1LFHA 1EYJA 4U4SA 2Q88A 3O66A 2I4BA 1Q35A 4ESXA 3IOWA 1WODA 2D5WA 2DXRA 5BUUA 2QS2A 1PB8A 4NEDA 2Y7RA 4DXBA 3OD7A 4I3EA 3IORA 1QUKA 4OVRA 3FVKA 1BTJA 3OO9A 3SEWA 3PPRA 3FVNA 1DSNA 4ND9A 4ZZAA 5L9OA 4L17A 3H03A 4Q0CA 2ONSA 3ILTB 2ZZWA 4UA8A 2WYKA 2H9BA 4FORA 4ZDMA 4LZ8A 1B6HA 2ALUA 1CE2A 4KI0E 4TLMB 1H3DA 2F7AA 2QVUA 3R6UA 3PUWE 3H3GA 2XWIA 2RC9A 4HS7A 3UN6A 4ZEBA 5I2KA 3OXNA 2CZHA 1IMFA 3KBRA 3O9PA 3K1NA 1Y4TA 2UVHA 2FVZA 4N6PA 5I2NA 2UVIA 1WDNA 1IITA 2XHDA 2XXYA 3THIA 4F19A 3PD9A 1S7YA 1NUYA 3V89B 3SEXA 1VSOA 3TKDA 3SESA 2E0SA 3MBPA 4U21A 4IGTA 5ITOA 4MNPA 3PUZE 2DS9A 2VT5A 4LUBA 4P9KA 2GFEA 4XEQA 3TTKA 3IAZA 3A3CA 4HE0A 1BLFA 4DIGA 1B3GA 1PB7A 4NF6B 3WAEA 3V83A 3PTYA 1ZBMA 1VDWA 4PGPA 3OO7A 2G93A 4N4UA 2WX9A 4NWDA 4HXVA 5ET7A 1B3EA 3QYTA 2CZIA 2DOJA 3IB0A 4U22A 2Q9TA 1DPEA 1MXZA 3E9XA 2VP1A 1RKMA 4OVPA 3UK4A 4QSCA 5HPQA 2ZNTA 1FBGA 4OVJA 3O6HA 4YICA 4PETA 2O69A 3NOHA 1IZ1A 4LVQA 4ELOA 4GWYA 1AOVA 1FPEA 3ZS6A 4ESWA 2A5TB 2REGA 5JK4A 4YMAA 1YYZA 3PUXE 4OQOA 1NV7A 1MXYA 2R71A 2UVGA 3Q25A 5DVFA 1NV4A 3MWBA 2XA5A 4DE8A 5IZ1A 4XFEA 3Q28A 5KDTA 2O7IA 4RPOA 1NNFA 3MZ9A 5H8QB 5IAIA 5F7VA 1LBCA 4JXIA 1NV3A 3L6HA 1INPA 1FTAA 3K6XA 1LFIA 1H45A 4MHFA 4JWYA 4X04A 2B3BA 2XXVA 3MZBA 1YAEA 1ELJA 2ZNUA 3P7IA 4MLVA 4QRZA 1USYE 2A5TA 3LC8A 2XXPA 1PBQA 4O7IA 5F1QA 1MQHA 3T1BA 4POWA 4G4PA 1I6BA 2RCBA 4NF5A 4GX4A 1MQJA 4PAIA 1XOCA 1FW0A 4ZECA 3QXMA 4MBPA 3FV2A 2Z8DA 2KLFA 1H44A 4NAPA 2P3VA 4X1DA 4F31B 2H25A 1LB9A 2OCUA 3U94A 1RDXA 1FQFA 2WBDA 3KGCA 4F1YA 4GWOA 3FBPA 5HM4B 1FSAA 1CB6A 2I6EA 2Q89A 3LSXA 2HZLA 4JBZA 2KR0A 1FTJA 1TT1A 3RGYA 2VGQA 4P8BA 4PF8A 5FTIA 4DXCA 3RTWB 3A09A 4JVCA 5I57B 2B3FA 1IUDA 2V4CA 3UP9A 2XWKA 4EF1A 4XXUA 1A99A 5J16A 1FTMA 4MNCA 1FQEA 4FE8A 1L5TA 3PMXA 1SW4A 3KSJA 1EZ9A 3Q26A 4FAJA 5I58B 3ISPA 5A5XA 3RY3A 1F9BA 2OJTA 3C32A 4NF4B 3T93B 4HW8A 3LUYA 4NGUA 3M3KA 2HHMA 3LSWA 5TP9B 5K2XA 2H99A 3BKIB 2IA4A 1JNFA 5CMBA 4OHNA 3S9LC 1IMBA 4I9DA 2DYXA 3O2AA 4AQ4A 2W7YA 1M5EA 1FQCA 1GR2A 2O1MA 3DP6A 4X9TA 3IJXB 4OTEA 3IO4A 2F7BA 3SETA 1URSA 2CEXA 1B3LA 4U4XA 4K3FA 1A7LA 5I57A 3TAJA 2PVUA 4DDDA 1MY4A 3HO7A 4C1TA 3SERA 4RK2A 3ILUB 1MXXA 3EHTA 5M2VA 1FCKA 3MQ9A 3K4UA 2QPQA 4LZ7A 1MDQA 2NOOA 2QRYA 5FHMA 5EQ8A 3CFLA 5I56B 2OX3A 1N04A 5EYHA 1B5IA 2X26A 5LOMA 2Y7IA 4OXVA 2RC8A 1HSJA 4M4GA 5ISUA 3O6GA 2NVUB 4NF4A 3TCGA 3LUZA 1B7ZA 1N7XA 5TP9A 4EF2A 3B8BA 1N7WA 1FBEA 3K1PA 2HZKA 4O94A 1JQFA 3TTRA 1LCTA 3CFXA 2RCAA 2F6GA 3OSQA 4E0XA 5ET5A 1FPKA 4G68B 2I58A 4MH5A 3N6TA 3HSTA 3DELB 4QFPA 4PGNA 4ISUA 4XKRA 4ECFA 3H7MA 3C36A 3IB1A 4U1OA 2DWAA 5ET8A 3LR1A 2HFBA 1B52A 3VVEA 3FGSA 1B7UA 3JZJA 1NI9A 1EU8A 4BDOA 5I56A 2F34A 2UXAA 2IEEA 4H67A 3ZKLA 1IMEA 4H5GA 2E1SA 5FBPA 1QW0A 4G8MA 5KCJB 1KZ8A 1LBYA 3C31A 1EYKA 4YKPA 2DSFA 4O3AA 4PP0A 3K2DA 4OEUA 3FD3A 3G3FA 3C35A 4MLQA 2QS3A 5B7DA 4PTKA 1N76A 2HPGA 1A54A 3PU5A 2ZXTA 2X7QA 3S2VA 4G68A 1IXIA 3SEVA 3I3VA 4UACA 1SYIA 5L9MA 4RY1A 3FVGA 5AA2D 3TTLA 4H6DA 4QF9A 1LAGE 1LFGA 5LTCA 4PAKA 4GL8A 4PC9A 2F97A 5DT6A 2VHAA 2P1SA 4ONYA 2OBGA 4F1VA 1MM6A 3OO8A 1POY1 1SYHA 4YKKA 5KCJA 4DI3D 2P2AA 3VVFA 5FTHA 4WKMA 4ZE8A 4JWOA 4OENA 1NFTA 2Z22A 4IO5A 4N8GA 1P1NA 1JETA 3KN7A 1JW4A 3CG1A 4GWXA 2V3QA 4MJOA 2DXYA 2FBPA 3ZSFA 1IXHA 1G0IA 3G3JA 1Y20A 3K6VA 3IX1A 4JB7A 5H8HB 4OERA 1Y9UA 3B50A 4AS4A 4DXUA 4OVQA 4GRKA 1SQYA 2DE3A 4BDNA 5I2NB 2GHBA 1SW2A 3OO6A 1JW1A 2QS4A 3FJGA 4WEPA 1MPBA 4GFRA 1EZOA 4N15A 4ZE9A 3B7DA 2PFZA 3GLBA 1VE4A 2QS1A 3HPIA 4IO6A 1T0KA 1ZU0A 4HTGA 4QXDA 3MSTA 1Y1ZA 1KWHA 3KSXA 4R2FA 4Q8RA 1JVXA 2BJJX 4QBAA 3MVXA 2L5VA 3E3KA 1NV5A 1LBBA 4X48A 1LAFE 1B4HA 5AA4A 1MPCA 1EYIA 3QUJA 4NMYA 2CMOA 1FBPA 4F3BA 5H8HA 4G68C 4G8HA 4GWSA 4MMPA 5DTBA 4O7MA 2YPNA 2ONRA 1B05A 2UYEA 4YU0A 5H8FA 2HXWA 3S9MC 1NNPA 3OELA 4AB6A 4O8MA 4RPNA 2O7UA 1JEVA 5CRYA 4PFTA 2QVRA 5CBRA 4PE5B 4QFOA 4P1EA 2XD2A 3C9HA 3MP8A 3KEIA 4H0WA 2F3BA 3USDA 2GQ1A 2ZYOA 1FBCA 1XI6A 4X8RA 3EKIA 4R74A 4C1UA 4F22A 5KDTB 1B1XA 1NL5A 1NNKA 4M1VA 2ZZXA 2V84A 1ZJLA 5H8SA 1XVXA 2I0BA 4PDHA 1LAXA 2AL5A 4ZEFA 4DLDA 3PUVE 3T9HB 4PFIA 4GBVA 2ONKE 4QFKA 1AL3A 1NV0A 2ZYMA 4I40A 2OWZA 1O7TA 2UYFA 3EHUA 3K6WA 3MPLA 1LBZA 3O6IA 5BWJA 3VV5A 4NF5B 1HSEA 4N6KA 4BDMA 4PFWA 1B32A 1NV2A 3FIRA 4F39A 4PQJA 4O3CA 5AE4A 3T0JA 5A5LA 4OFLA 4GX3A 1MH4A 3D1RA 3RTFB 2DVCA 4I3YA 5I84A 1ZKBA 1JEUA 4UABA 1MPDA 2DDKA 2RINA 4GWZA 3VLWA 1SI0A 1R9LA 3EQ1A 1II5A 5DVIA 1D9VA 4ZEIA 3DLNA 3CFZA 2XXXA 3T66A 2QSXA 3KOSA 4H5FA 1FPJA 5CC2A 3MP6A 1UTHB 2V3UA 3KC1A 2DWIA 4MEVA 3OENA 4MCOA 2XXIA 4POXA 4EQ9A 1POTA 1IMDA 4THIA 4H45A 4GQOA 1JP4A 2THIA 4IY5A 4PF6A 4P3LA 4TLLB 5CBSA 5CMCA 2VPNA 3SZPA 3VFJA 3N26A 3PV0E 4FEDA 4QSEA 3T9VA 2Y7KA 2CZKA 1AIVA 3F11A 1BP5A 1J1NA 3IL1B 1H43A 3ECRA 2P3NA 1SD3A 4N81A 3TMGA 4EXLA 1FPGA 3TTMA 4DCYA 2R9JA 4LQ2A 4GX6A 5A5XB 4XIGQ 1PDAA 3A29A 1S50A 2OWTA 1LSTA 3H6TA 2NXOA 1ZTYA 2A5SA 1OVTA 2NWJA 4MIJA 1OQGA 1QKAA 2WKYA 3OSRA 1MDP1 3C34A 4GIZA 5DVJA 5IGAA 3U1OA 4P11A 1UTHA 5CM6A 4HE1A 4YAHX 4RYAA 3TCFA 1GTKA 1NKXA 3MJNA 2UVJA 2V25A 1MRPA 3KBZA 1O63A 5DW8A 3WAFA 3TODA 4BDQA 3RT8A 3H6UA 3RN8A 4NF0A 2XXQA 3G3KA 4FJPA 4R2BA 1M5CA 4FIMA 2CEYA 1FJ9A 4F1UA 2Q74A 1Y1MA 2REJA 1DTGA 4H8IA 1NH8A 4JDFA 3FJ7A 4EUOA 4Z0IA 4TQUQ 1ZMGA 4NF8B 4N07A 4OETA 1RYOA 5TU0A 2CZLA 4PDDA 4R6KA 4ZEDA 4QFNA 3LBSA 1FPIA 3KOTA 3QAXA 1LBVA 1FPBA 1MQIA 2OLBA 2MKZA 3B6WA 1XC1A 1MS7A 4Q5TA 4N91A 2GHAA 3TYHA 2H5YA 2AIXA 3UA8A 4I62A 3C33A 1LBWA 4YZZA 1URDA 3BFTA 2O84X 3CR9A 3FVOA 4XKQA 4DZ1A 3LV0A 3Q29A 3Q27A 4OFOA 3OEKA 3GYYA 3IR1A 2PCRA 3K01A 2OK2A 1A8EA 4EQBA 4OVTA 4F29A 1YZ0A 1Y3QA 1GV8A 1IEJA 1YCJA 3RUMA 4LATA 4NF8A 1I69A 1DTZA 1JW5A 5T3JA 4FBPA 2Y7WA 5I3SA 4LONB 1XHYA 5EQ7A 4GVOA 4IO2A 5HBCA 4HCYA 1NV6A 5EHMA 3RPLA 4OANA 4BDLA 3RYDA 3EN3A 1XT8A 5ET6A 1SDXA 2ZNSA 2JJKA 3H4ZA 4PCDA 3K0VA 3FJMA 4H65A 1TXFA
chains in the Genus database with same CATH topology
2GH9A 1Y3PA 1N84A 1FTLA 3VDFA 3S9EA 4GXAA 4OYVA 2XXTA 2YJPA 2I4CA 1Z7NE 3QUFA 3IOVA 3SEYA 3RPWA 4TOZA 3T22A 1MM7A 4I8CA 3IO6A 4HCWA 1I6AA 3FUZA 1ANFA 1D3KA 2F78A 1M5FA 3MVZA 2AL4A 1QVSA 5K2YA 4PFYA 4AB5A 4WXJA 3MPKA 4P0IA 3C4MA 1B4ZA 2RF1A 2I48A 5KZTA 2OZZA 3EPEA 1FTKA 2PBWA 1WVJA 4QSDA 3W9WA 1VFDA 3FXQA 1P1QA 4YMBA 4R6HA 1UQWA 4LZ5A 3IK6B 1IIWA 2M8CA 1QULA 3O97A 5B70A 2FYIA 4MFIA 3B6QA 2DE4A 4JSDA 3IB2A 2PX1A 3VXCA 3MAMA 3EF7A 4YB5A 3MVYA 2DWHA 3TCHA 1EH3A 1LAHE 3I5OA 3U8QA 2Q2AA 4OESA 1GVCA 5AA4B 1OIBA 4G8NA 4GD5A 4JSOA 3O28A 1Z7ME 3N6UA 1US5A 2Y7PA 2AYSA 2XD3A 1LB8A 1SW5A 1US4A 3FATA 1MQGA 4E0WA 3MC2A 3DP4A 4DCXA 3VXBA 5H8FB 1XS5A 4G77A 2ZYNA 4KR5A 1A40A 2DP8A 1MY3A 2XXUA 1DMBA 1YPNA 2V3TA 1TFDA 3DM0A 2QMXA 4ZEKA 3O29A 1MY2A 3JYRA 3TELA 1NH7A 4GF8A 2Q2CA 2XX8A 1B7HA 3IOUA 4R72A 1AH5A 1QJMA 3UORA 2D21A 2F5XA 1R6ZA 3UGWA 3K02A 1RYXA 5AA2B 5ICTA 5FHNA 3HHFA 1LLSA 2PT1A 1UIUA 2B65A 3FZVA 1Q1KA 4JWXA 3MW0A 3E4RA 3G3IA 4EXKA 4OFJA 3T9XB 2VD2A 1JVYA 3GZGA 2QMWA 3RT6B 1I6QA 5JTYB 3FV1A 3UIFA 3M8UA 4YKIA 4RNSA 4I1DA 1FQBA 1B51A 3PMVA 1A8FA 2F7CA 1SBPA 3QIMA 1QUIA 5EYFA 3N5LA 3BBRA 1HSLA 3TQLA 4KHZE 4LP2B 4F3PA 3M3FA 1PB9A 3U92A 1P1OA 3RQTA 1MY1A 2F36A 5AA2A 2HEUA 4R73A 1XVYA 1MG1A 3DP8A 4PFUA 4H8JA 1QUJA 5AA1A 3E13X 5H8NB 2ANJA 3G3GA 5L9SA 5DEXB 2DQVA 3V5AA 3S9NC 1N0TA 2O68A 2HAVA 2HQ0A 1OLCA 4NWCA 3RLFE 4R6YA 4R75A 3CI8A 4RK9A 3S4UA 5JTYA 3KJTA 1H76A 4N13A 3GXAA 3OMBA 1IXCA 3OOAA 5IKBA 1S9TA 1BIYA 3IJOB 4OMBA 4P0GA 3EHSA 5ELVA 3TPAA 1P99A 5J1DA 1R9QA 4ELPA 3KN8A 1ATGA 2XX7A 2LAOA 4NF6A 5CMKA 3SDFA 2Z23A 3HN0A 3KJ7A 1MXVA 1R1NA 3H6VA 2G29A 2HAUA 3KZGA 3SKPA 3PPQA 3TZAA 4IGRA 4XTCQ 3TTNA 5TPAB 5L8DA 2YLNA 2GRVA 5H8NA 4KYDA 3K1MA 5DEXA 3W9VA 1PEBA 3G3HA 2Q8JA 1OQHA 1O64A 1MXUA 1IXGA 4F18A 3PPPA 5EHSA 2I0CA 4LA9A 4OEVA 1QKBA 4IO4A 2R6GE 4XKPA 2NUVA 4IO7A 4KYSA 1P1WA 4BLAA 3PGFA 3PPNA 1OVBA 4ELRA 3TUSA 2I49A 2Z8FA 2P0SA 4KCDA 1LGBC 3R26A 2ABHA 1B9JA 4RXLA 4YB6A 3D4CA 4KCCA 4EQ7A 1SI1A 1USYH 1P1UA 3TDJA 1A55A 5DYHA 4G2ZA 2Y84A 1M5BA 3AXFA 5TPAA 5H8QA 4EDPA 3CIJA 4GL0A 2F6PA 2H4IA 4C0RA 2XXWA 4U1ZA 1FQAA 3VLUA 4U2RA 1AMFA 3LSFB 2QL3A 4OZ9A 3H6WA 1ZIUA 1B46A 4GXSB 5ICQA 2D3IA 4QFLA 4MF3A 3PPOA 2XX9A 5JEIA 1N3XA 2HCAA 1UIVA 3ONMA 3PD8A 4Z7EA 3FASA 3G7WA 1UTBB 4KFQA 4ZZEA 1LCFA 2XXHA 2I3WA 2FNCA 1FQDA 5CMMA 2V93A 2RKMA 2DE2A 1M5DA 2VD3A 3I6VA 3HCQA 2X7PA 3QSLA 4BDRA 3T96B 3JV9A 1VFEA 1PBPA 3IOTA 1D9YA 2ESNA 3VVDA 1ZLQA 2RC7A 2VOZA 3CSGA 3U72A 1MXWA 4X1BA 1B0LA 1B5HA 1MY0A 1YTVA 4FECA 2O6AA 3VE1B 3KFMA 4ELQA 2ZMBA 4FEBA 1SVXB 3KN3A 1TWYA 3L6GA 4IB2A 3B6TA 4U23A 1NMUA 3VLVA 2QJEA 4QHQA 3FXRA 1UTBA 5I58A 4ZS9A 1FTOA 3CSBA 3D4GA 4R9GA 4WEDA 3ZKKA 3V8XB 4H1XA 2OWSA 4NE4A 5I59B 1OLAA 1MH3A 2PYYA 4RA1A 4XKNA 1SW1A 1EZPA 5ITPA 2DVZA 1B3HA 4LQ5A 2PMSA 2ZYKA 3U93A 3N94A 3MVWA 3SEUA 2H98A 3HHGA 2O1LA 1URGA 3KG2A 3MP1A 3TFLA 2F35A 3LSLA 1VR5A 1NNTA 1B2HA 1PC3A 1D4NA 3T9UA 3HV1A 3TQWA 2DWJA 3W15C 3FXUA 4KQPA 3K6UA 3K00A 3ODBA 4KD5A 3TEPA 3CVGA 2I3VA 4RJZA 1GGGA 4F2OA 3GBBA 4KPTA 1IQ7A 4IY6A 5AA3A 1TFAA 1Y3NA 5I59A 5CI5A 4KYEA 4R9FA 1OMPA 3MZ1A 2Z8EA 1B3FA 1B40A 1B58A 4O3BA 4OWDA 4F3SA 2PT2A 3PUYE 3PMWA 4NTLA 2XXRA 3RNNA 3QK6A 1N3WA 3A3UA 3H06B 3CG3A 4F3GA 4GLIA 1B5JA 2O51A 5FHOA 3OEMA 3CRBA 4IO3A 1MQDA 4GOTA 3GBAA 1BKAA 1Y4CA 4YKJA 2FA7A 1B0HA 3BFUA 2F8DA 3M3LA 4F2QA 4FATA 4Q30B 1B1HA 3MUQA 1DPPA 1DOTA 3R7XA 4YB7A 5I2KB 1LFHA 4U4SA 2Q88A 3O66A 2I4BA 1Q35A 4ESXA 3IOWA 1WODA 2D5WA 2DXRA 5BUUA 2QS2A 1PB8A 4NEDA 2Y7RA 4DXBA 3OD7A 3IORA 1QUKA 3FVKA 1BTJA 3OO9A 3SEWA 3PPRA 3FVNA 1DSNA 4ND9A 4ZZAA 5L9OA 4L17A 3H03A 4Q0CA 2ONSA 3ILTB 4UA8A 2H9BA 4FORA 4ZDMA 4LZ8A 1B6HA 2ALUA 1CE2A 4KI0E 4TLMB 1H3DA 2F7AA 3R6UA 3PUWE 3H3GA 2RC9A 4HS7A 3UN6A 4ZEBA 5I2KA 3OXNA 3KBRA 3O9PA 3K1NA 1Y4TA 2UVHA 4N6PA 5I2NA 2UVIA 1WDNA 1IITA 2XHDA 2XXYA 3THIA 4F19A 3PD9A 1S7YA 3V89B 3SEXA 1VSOA 3TKDA 3SESA 2E0SA 3MBPA 4U21A 4IGTA 5ITOA 3PUZE 2DS9A 4LUBA 2GFEA 3TTKA 3IAZA 3A3CA 1BLFA 4DIGA 1B3GA 1PB7A 4NF6B 3WAEA 3V83A 1ZBMA 3OO7A 2G93A 4NWDA 1B3EA 3QYTA 2DOJA 3IB0A 4U22A 2Q9TA 1DPEA 1MXZA 3E9XA 2VP1A 1RKMA 3UK4A 4QSCA 5HPQA 2ZNTA 4OVJA 3O6HA 4YICA 4PETA 2O69A 1IZ1A 4LVQA 4ELOA 1AOVA 3ZS6A 4ESWA 2A5TB 2REGA 5JK4A 4YMAA 3PUXE 4OQOA 1MXYA 2R71A 2UVGA 3Q25A 5DVFA 3MWBA 4DE8A 3Q28A 5KDTA 2O7IA 4RPOA 1NNFA 3MZ9A 5H8QB 5IAIA 5F7VA 1LBCA 4JXIA 3L6HA 3K6XA 1LFIA 1H45A 4JWYA 2B3BA 2XXVA 3MZBA 1YAEA 1ELJA 2ZNUA 3P7IA 4MLVA 4QRZA 1USYE 2A5TA 3LC8A 2XXPA 1PBQA 5F1QA 1MQHA 4POWA 4G4PA 1I6BA 2RCBA 4NF5A 1MQJA 1XOCA 1FW0A 4ZECA 3QXMA 4MBPA 3FV2A 2Z8DA 2KLFA 1H44A 4X1DA 4F31B 2H25A 1LB9A 2OCUA 3U94A 1FQFA 3KGCA 4F1YA 4GWOA 5HM4B 1CB6A 2I6EA 2Q89A 3LSXA 2HZLA 4JBZA 1FTJA 1TT1A 3RGYA 2VGQA 4DXCA 5FTIA 3RTWB 3A09A 5I57B 2B3FA 1IUDA 3UP9A 4EF1A 4XXUA 1A99A 1FTMA 1FQEA 4FE8A 1L5TA 3PMXA 1SW4A 3KSJA 1EZ9A 3Q26A 4FAJA 5I58B 5A5XA 3RY3A 1F9BA 2OJTA 3C32A 4NF4B 3T93B 4HW8A 3LUYA 3M3KA 3LSWA 5TP9B 5K2XA 2H99A 3BKIB 2IA4A 1JNFA 5CMBA 4OHNA 3S9LC 4I9DA 2DYXA 3O2AA 4AQ4A 2W7YA 1M5EA 1FQCA 1GR2A 2O1MA 3DP6A 4X9TA 3IJXB 4OTEA 3IO4A 2F7BA 3SETA 1URSA 1B3LA 4U4XA 4K3FA 1A7LA 5I57A 3TAJA 2PVUA 4DDDA 1MY4A 3HO7A 4C1TA 3SERA 4RK2A 3ILUB 1MXXA 3EHTA 5M2VA 1FCKA 3MQ9A 3K4UA 2QPQA 4LZ7A 1MDQA 2NOOA 2QRYA 5FHMA 3CFLA 5I56B 1N04A 1B5IA 2X26A 5LOMA 2Y7IA 4OXVA 2RC8A 1HSJA 4M4GA 5ISUA 3O6GA 2NVUB 4NF4A 3TCGA 1B7ZA 1N7XA 5TP9A 4EF2A 1N7WA 3K1PA 2HZKA 1JQFA 3TTRA 1LCTA 3CFXA 2RCAA 2F6GA 3OSQA 4E0XA 4G68B 2I58A 4MH5A 3N6TA 3HSTA 3DELB 4QFPA 4ECFA 4ISUA 4XKRA 3H7MA 3C36A 3IB1A 4U1OA 2DWAA 3LR1A 2HFBA 1B52A 3VVEA 3FGSA 1B7UA 3JZJA 1EU8A 4BDOA 5I56A 2F34A 2UXAA 2IEEA 4H67A 3ZKLA 4H5GA 2E1SA 1QW0A 4G8MA 5KCJB 3C31A 4YKPA 2DSFA 4O3AA 4PP0A 3K2DA 4OEUA 3FD3A 3G3FA 3C35A 4MLQA 2QS3A 5B7DA 1N76A 1A54A 3PU5A 2ZXTA 2X7QA 3S2VA 4G68A 1IXIA 3SEVA 3I3VA 4UACA 1SYIA 5L9MA 4RY1A 3FVGA 5AA2D 3TTLA 4H6DA 4QF9A 1LAGE 1LFGA 4GL8A 2F97A 5DT6A 2VHAA 2P1SA 4ONYA 2OBGA 4F1VA 1MM6A 3OO8A 1POY1 1SYHA 4YKKA 5KCJA 2P2AA 3VVFA 5FTHA 4WKMA 4ZE8A 4JWOA 4OENA 1NFTA 2Z22A 4IO5A 1P1NA 1JETA 3KN7A 1JW4A 3CG1A 2V3QA 2DXYA 3ZSFA 1IXHA 3G3JA 1Y20A 3K6VA 3IX1A 4JB7A 5H8HB 4OERA 1Y9UA 4DXUA 4GRKA 1SQYA 2DE3A 4BDNA 5I2NB 2GHBA 1SW2A 3OO6A 1JW1A 2QS4A 3FJGA 4WEPA 1MPBA 4GFRA 1EZOA 4ZE9A 3B7DA 3GLBA 1VE4A 2QS1A 3HPIA 4IO6A 1T0KA 1ZU0A 4HTGA 1Y1ZA 1KWHA 3KSXA 4R2FA 4Q8RA 1JVXA 2BJJX 3MVXA 3E3KA 1LBBA 4X48A 1LAFE 1B4HA 5AA4A 1MPCA 3QUJA 4NMYA 2CMOA 4F3BA 5H8HA 4G68C 4G8HA 5DTBA 2YPNA 2ONRA 1B05A 2UYEA 4YU0A 5H8FA 2HXWA 3S9MC 1NNPA 3OELA 4AB6A 4RPNA 2O7UA 1JEVA 5CRYA 4PFTA 5CBRA 4PE5B 4QFOA 2XD2A 3C9HA 3MP8A 3KEIA 4H0WA 3USDA 2ZYOA 4R74A 4C1UA 4F22A 5KDTB 1B1XA 1NL5A 1NNKA 4M1VA 2V84A 1ZJLA 5H8SA 1XVXA 2I0BA 1LAXA 2AL5A 4ZEFA 4DLDA 3PUVE 3T9HB 2ONKE 4QFKA 1AL3A 2ZYMA 1O7TA 2UYFA 3EHUA 3K6WA 3MPLA 3O6IA 5BWJA 3VV5A 4NF5B 1HSEA 4BDMA 1B32A 4PFWA 3FIRA 4F39A 4PQJA 4O3CA 5AE4A 4OFLA 1MH4A 3RTFB 2DVCA 5I84A 1ZKBA 1JEUA 1MPDA 2RINA 3VLWA 1SI0A 1R9LA 3EQ1A 1II5A 5DVIA 1D9VA 4ZEIA 3DLNA 3CFZA 2XXXA 3T66A 2QSXA 3KOSA 4H5FA 5CC2A 3MP6A 1UTHB 2V3UA 2DWIA 3OENA 2XXIA 4POXA 4EQ9A 1POTA 4THIA 4GQOA 2THIA 4IY5A 4TLLB 5CBSA 5CMCA 3VFJA 3N26A 3PV0E 4FEDA 4QSEA 3T9VA 2Y7KA 1AIVA 3F11A 1BP5A 1J1NA 3IL1B 1H43A 3ECRA 1SD3A 3TMGA 4EXLA 3TTMA 4DCYA 2R9JA 4LQ2A 5A5XB 4XIGQ 1PDAA 1S50A 2OWTA 1LSTA 3H6TA 2NXOA 1ZTYA 2A5SA 1OVTA 2NWJA 1OQGA 1QKAA 2WKYA 3OSRA 1MDP1 3C34A 4GIZA 5DVJA 3U1OA 4P11A 1UTHA 5CM6A 4YAHX 4RYAA 3TCFA 1GTKA 1NKXA 3MJNA 2UVJA 2V25A 1MRPA 1O63A 3WAFA 3TODA 4BDQA 3RT8A 3H6UA 3RN8A 2XXQA 3G3KA 4FJPA 4R2BA 1M5CA 4FIMA 4F1UA 1Y1MA 2REJA 1DTGA 4H8IA 1NH8A 4JDFA 3FJ7A 4EUOA 4Z0IA 4TQUQ 1ZMGA 4NF8B 4N07A 4OETA 1RYOA 5TU0A 2CZLA 4R6KA 4ZEDA 4QFNA 3LBSA 3KOTA 3QAXA 1MQIA 2OLBA 3B6WA 1XC1A 1MS7A 4Q5TA 2GHAA 3TYHA 2H5YA 2AIXA 3UA8A 4I62A 3C33A 4YZZA 1URDA 3BFTA 2O84X 3CR9A 3FVOA 4XKQA 4DZ1A 3Q29A 3Q27A 4OFOA 3OEKA 3IR1A 3K01A 2OK2A 1A8EA 4EQBA 4F29A 1Y3QA 1GV8A 1IEJA 1YCJA 3RUMA 4LATA 4NF8A 1I69A 1DTZA 1JW5A 2Y7WA 4LONB 1XHYA 4GVOA 4IO2A 5HBCA 4HCYA 5EHMA 4BDLA 3EN3A 1XT8A 1SDXA 2ZNSA 3H4ZA 3K0VA 3FJMA 4H65A 1TXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH9 A;  1Y3P A;  1N84 A;  1FTL A;  3VDF A;  3S9E A;  4GXA A;  4OYV A;  2XXT A;  2YJP A;  2I4C A;  1Z7N E;  3QUF A;  3IOV A;  3SEY A;  3RPW A;  4TOZ A;  3T22 A;  1MM7 A;  4I8C A;  3IO6 A;  4HCW A;  1I6A A;  3FUZ A;  1ANF A;  1D3K A;  2F78 A;  1M5F A;  3MVZ A;  2AL4 A;  1QVS A;  5K2Y A;  4PFY A;  4AB5 A;  4WXJ A;  3MPK A;  4P0I A;  3C4M A;  1B4Z A;  2RF1 A;  2I48 A;  5KZT A;  2OZZ A;  3EPE A;  1FTK A;  2PBW A;  1WVJ A;  4QSD A;  3W9W A;  1VFD A;  3FXQ A;  1P1Q A;  4YMB A;  4R6H A;  1UQW A;  4LZ5 A;  3IK6 B;  1IIW A;  2M8C A;  1QUL A;  3O97 A;  5B70 A;  2FYI A;  4MFI A;  3B6Q A;  2DE4 A;  4JSD A;  3IB2 A;  2PX1 A;  3VXC A;  3MAM A;  3EF7 A;  4YB5 A;  3MVY A;  2DWH A;  3TCH A;  1EH3 A;  1LAH E;  3I5O A;  3U8Q A;  2Q2A A;  4OES A;  1GVC A;  5AA4 B;  1OIB A;  4G8N A;  4GD5 A;  4JSO A;  3O28 A;  1Z7M E;  3N6U A;  1US5 A;  2Y7P A;  2AYS A;  2XD3 A;  1LB8 A;  1SW5 A;  1US4 A;  3FAT A;  1MQG A;  4E0W A;  3MC2 A;  3DP4 A;  4DCX A;  3VXB A;  5H8F B;  1XS5 A;  4G77 A;  2ZYN A;  4KR5 A;  1A40 A;  2DP8 A;  1MY3 A;  2XXU A;  1DMB A;  1YPN A;  2V3T A;  1TFD A;  3DM0 A;  2QMX A;  4ZEK A;  3O29 A;  1MY2 A;  3JYR A;  3TEL A;  1NH7 A;  4GF8 A;  2Q2C A;  2XX8 A;  1B7H A;  3IOU A;  4R72 A;  1AH5 A;  1QJM A;  3UOR A;  2D21 A;  2F5X A;  1R6Z A;  3UGW A;  3K02 A;  1RYX A;  5AA2 B;  5ICT A;  5FHN A;  3HHF A;  1LLS A;  2PT1 A;  1UIU A;  2B65 A;  3FZV A;  1Q1K A;  4JWX A;  3MW0 A;  3E4R A;  3G3I A;  4EXK A;  4OFJ A;  3T9X B;  2VD2 A;  1JVY A;  3GZG A;  2QMW A;  3RT6 B;  1I6Q A;  5JTY B;  3FV1 A;  3UIF A;  3M8U A;  4YKI A;  4RNS A;  4I1D A;  1FQB A;  1B51 A;  3PMV A;  1A8F A;  2F7C A;  1SBP A;  3QIM A;  1QUI A;  5EYF A;  3N5L A;  3BBR A;  1HSL A;  3TQL A;  4KHZ E;  4LP2 B;  4F3P A;  3M3F A;  1PB9 A;  3U92 A;  1P1O A;  3RQT A;  1MY1 A;  2F36 A;  5AA2 A;  2HEU A;  4R73 A;  1XVY A;  1MG1 A;  3DP8 A;  4PFU A;  4H8J A;  1QUJ A;  5AA1 A;  3E13 X;  5H8N B;  2ANJ A;  3G3G A;  5L9S A;  5DEX B;  2DQV A;  3V5A A;  3S9N C;  1N0T A;  2O68 A;  2HAV A;  2HQ0 A;  1OLC A;  4NWC A;  3RLF E;  4R6Y A;  4R75 A;  3CI8 A;  4RK9 A;  3S4U A;  5JTY A;  3KJT A;  1H76 A;  4N13 A;  3GXA A;  3OMB A;  1IXC A;  3OOA A;  5IKB A;  1S9T A;  1BIY A;  3IJO B;  4OMB A;  4P0G A;  3EHS A;  5ELV A;  3TPA A;  1P99 A;  5J1D A;  1R9Q A;  4ELP A;  3KN8 A;  1ATG A;  2XX7 A;  2LAO A;  4NF6 A;  5CMK A;  3SDF A;  2Z23 A;  3HN0 A;  3KJ7 A;  1MXV A;  1R1N A;  3H6V A;  2G29 A;  2HAU A;  3KZG A;  3SKP A;  3PPQ A;  3TZA A;  4IGR A;  4XTC Q;  3TTN A;  5TPA B;  5L8D A;  2YLN A;  2GRV A;  5H8N A;  4KYD A;  3K1M A;  5DEX A;  3W9V A;  1PEB A;  3G3H A;  2Q8J A;  1OQH A;  1O64 A;  1MXU A;  1IXG A;  4F18 A;  3PPP A;  5EHS A;  2I0C A;  4LA9 A;  4OEV A;  1QKB A;  4IO4 A;  2R6G E;  4XKP A;  2NUV A;  4IO7 A;  4KYS A;  1P1W A;  4BLA A;  3PGF A;  3PPN A;  1OVB A;  4ELR A;  3TUS A;  2I49 A;  2Z8F A;  2P0S A;  4KCD A;  1LGB C;  3R26 A;  2ABH A;  1B9J A;  4RXL A;  4YB6 A;  3D4C A;  4KCC A;  4EQ7 A;  1SI1 A;  1USY H;  1P1U A;  3TDJ A;  1A55 A;  5DYH A;  4G2Z A;  2Y84 A;  1M5B A;  3AXF A;  5TPA A;  5H8Q A;  4EDP A;  3CIJ A;  4GL0 A;  2F6P A;  2H4I A;  4C0R A;  2XXW A;  4U1Z A;  1FQA A;  3VLU A;  4U2R A;  1AMF A;  3LSF B;  2QL3 A;  4OZ9 A;  3H6W A;  1ZIU A;  1B46 A;  4GXS B;  5ICQ A;  2D3I A;  4QFL A;  4MF3 A;  3PPO A;  2XX9 A;  5JEI A;  1N3X A;  2HCA A;  1UIV A;  3ONM A;  3PD8 A;  4Z7E A;  3FAS A;  3G7W A;  1UTB B;  4KFQ A;  4ZZE A;  1LCF A;  2XXH A;  2I3W A;  2FNC A;  1FQD A;  5CMM A;  2V93 A;  2RKM A;  2DE2 A;  1M5D A;  2VD3 A;  3I6V A;  3HCQ A;  2X7P A;  3QSL A;  4BDR A;  3T96 B;  3JV9 A;  1VFE A;  1PBP A;  3IOT A;  1D9Y A;  2ESN A;  3VVD A;  1ZLQ A;  2RC7 A;  2VOZ A;  3CSG A;  3U72 A;  1MXW A;  4X1B A;  1B0L A;  1B5H A;  1MY0 A;  1YTV A;  4FEC A;  2O6A A;  3VE1 B;  3KFM A;  4ELQ A;  2ZMB A;  4FEB A;  1SVX B;  3KN3 A;  1TWY A;  3L6G A;  4IB2 A;  3B6T A;  4U23 A;  1NMU A;  3VLV A;  2QJE A;  4QHQ A;  3FXR A;  1UTB A;  5I58 A;  4ZS9 A;  1FTO A;  3CSB A;  3D4G A;  4R9G A;  4WED A;  3ZKK A;  3V8X B;  4H1X A;  2OWS A;  4NE4 A;  5I59 B;  1OLA A;  1MH3 A;  2PYY A;  4RA1 A;  4XKN A;  1SW1 A;  1EZP A;  5ITP A;  2DVZ A;  1B3H A;  4LQ5 A;  2PMS A;  2ZYK A;  3U93 A;  3N94 A;  3MVW A;  3SEU A;  2H98 A;  3HHG A;  2O1L A;  1URG A;  3KG2 A;  3MP1 A;  3TFL A;  2F35 A;  3LSL A;  1VR5 A;  1NNT A;  1B2H A;  1PC3 A;  1D4N A;  3T9U A;  3HV1 A;  3TQW A;  2DWJ A;  3W15 C;  3FXU A;  4KQP A;  3K6U A;  3K00 A;  3ODB A;  4KD5 A;  3TEP A;  3CVG A;  2I3V A;  4RJZ A;  1GGG A;  4F2O A;  3GBB A;  4KPT A;  1IQ7 A;  4IY6 A;  5AA3 A;  1TFA A;  1Y3N A;  5I59 A;  5CI5 A;  4KYE A;  4R9F A;  1OMP A;  3MZ1 A;  2Z8E A;  1B3F A;  1B40 A;  1B58 A;  4O3B A;  4OWD A;  4F3S A;  2PT2 A;  3PUY E;  3PMW A;  4NTL A;  2XXR A;  3RNN A;  3QK6 A;  1N3W A;  3A3U A;  3H06 B;  3CG3 A;  4F3G A;  4GLI A;  1B5J A;  2O51 A;  5FHO A;  3OEM A;  3CRB A;  4IO3 A;  1MQD A;  4GOT A;  3GBA A;  1BKA A;  1Y4C A;  4YKJ A;  2FA7 A;  1B0H A;  3BFU A;  2F8D A;  3M3L A;  4F2Q A;  4FAT A;  4Q30 B;  1B1H A;  3MUQ A;  1DPP A;  1DOT A;  3R7X A;  4YB7 A;  5I2K B;  1LFH A;  4U4S A;  2Q88 A;  3O66 A;  2I4B A;  1Q35 A;  4ESX A;  3IOW A;  1WOD A;  2D5W A;  2DXR A;  5BUU A;  2QS2 A;  1PB8 A;  4NED A;  2Y7R A;  4DXB A;  3OD7 A;  3IOR A;  1QUK A;  3FVK A;  1BTJ A;  3OO9 A;  3SEW A;  3PPR A;  3FVN A;  1DSN A;  4ND9 A;  4ZZA A;  5L9O A;  4L17 A;  3H03 A;  4Q0C A;  2ONS A;  3ILT B;  4UA8 A;  2H9B A;  4FOR A;  4ZDM A;  4LZ8 A;  1B6H A;  2ALU A;  1CE2 A;  4KI0 E;  4TLM B;  1H3D A;  2F7A A;  3R6U A;  3PUW E;  3H3G A;  2RC9 A;  4HS7 A;  3UN6 A;  4ZEB A;  5I2K A;  3OXN A;  3KBR A;  3O9P A;  3K1N A;  1Y4T A;  2UVH A;  4N6P A;  5I2N A;  2UVI A;  1WDN A;  1IIT A;  2XHD A;  2XXY A;  3THI A;  4F19 A;  3PD9 A;  1S7Y A;  3V89 B;  3SEX A;  1VSO A;  3TKD A;  3SES A;  2E0S A;  3MBP A;  4U21 A;  4IGT A;  5ITO A;  3PUZ E;  2DS9 A;  4LUB A;  2GFE A;  3TTK A;  3IAZ A;  3A3C A;  1BLF A;  4DIG A;  1B3G A;  1PB7 A;  4NF6 B;  3WAE A;  3V83 A;  1ZBM A;  3OO7 A;  2G93 A;  4NWD A;  1B3E A;  3QYT A;  2DOJ A;  3IB0 A;  4U22 A;  2Q9T A;  1DPE A;  1MXZ A;  3E9X A;  2VP1 A;  1RKM A;  3UK4 A;  4QSC A;  5HPQ A;  2ZNT A;  4OVJ A;  3O6H A;  4YIC A;  4PET A;  2O69 A;  1IZ1 A;  4LVQ A;  4ELO A;  1AOV A;  3ZS6 A;  4ESW A;  2A5T B;  2REG A;  5JK4 A;  4YMA A;  3PUX E;  4OQO A;  1MXY A;  2R71 A;  2UVG A;  3Q25 A;  5DVF A;  3MWB A;  4DE8 A;  3Q28 A;  5KDT A;  2O7I A;  4RPO A;  1NNF A;  3MZ9 A;  5H8Q B;  5IAI A;  5F7V A;  1LBC A;  4JXI A;  3L6H A;  3K6X A;  1LFI A;  1H45 A;  4JWY A;  2B3B A;  2XXV A;  3MZB A;  1YAE A;  1ELJ A;  2ZNU A;  3P7I A;  4MLV A;  4QRZ A;  1USY E;  2A5T A;  3LC8 A;  2XXP A;  1PBQ A;  5F1Q A;  1MQH A;  4POW A;  4G4P A;  1I6B A;  2RCB A;  4NF5 A;  1MQJ A;  1XOC A;  1FW0 A;  4ZEC A;  3QXM A;  4MBP A;  3FV2 A;  2Z8D A;  2KLF A;  1H44 A;  4X1D A;  4F31 B;  2H25 A;  1LB9 A;  2OCU A;  3U94 A;  1FQF A;  3KGC A;  4F1Y A;  4GWO A;  5HM4 B;  1CB6 A;  2I6E A;  2Q89 A;  3LSX A;  2HZL A;  4JBZ A;  1FTJ A;  1TT1 A;  3RGY A;  2VGQ A;  4DXC A;  5FTI A;  3RTW B;  3A09 A;  5I57 B;  2B3F A;  1IUD A;  3UP9 A;  4EF1 A;  4XXU A;  1A99 A;  1FTM A;  1FQE A;  4FE8 A;  1L5T A;  3PMX A;  1SW4 A;  3KSJ A;  1EZ9 A;  3Q26 A;  4FAJ A;  5I58 B;  5A5X A;  3RY3 A;  1F9B A;  2OJT A;  3C32 A;  4NF4 B;  3T93 B;  4HW8 A;  3LUY A;  3M3K A;  3LSW A;  5TP9 B;  5K2X A;  2H99 A;  3BKI B;  2IA4 A;  1JNF A;  5CMB A;  4OHN A;  3S9L C;  4I9D A;  2DYX A;  3O2A A;  4AQ4 A;  2W7Y A;  1M5E A;  1FQC A;  1GR2 A;  2O1M A;  3DP6 A;  4X9T A;  3IJX B;  4OTE A;  3IO4 A;  2F7B A;  3SET A;  1URS A;  1B3L A;  4U4X A;  4K3F A;  1A7L A;  5I57 A;  3TAJ A;  2PVU A;  4DDD A;  1MY4 A;  3HO7 A;  4C1T A;  3SER A;  4RK2 A;  3ILU B;  1MXX A;  3EHT A;  5M2V A;  1FCK A;  3MQ9 A;  3K4U A;  2QPQ A;  4LZ7 A;  1MDQ A;  2NOO A;  2QRY A;  5FHM A;  3CFL A;  5I56 B;  1N04 A;  1B5I A;  2X26 A;  5LOM A;  2Y7I A;  4OXV A;  2RC8 A;  1HSJ A;  4M4G A;  5ISU A;  3O6G A;  2NVU B;  4NF4 A;  3TCG A;  1B7Z A;  1N7X A;  5TP9 A;  4EF2 A;  1N7W A;  3K1P A;  2HZK A;  1JQF A;  3TTR A;  1LCT A;  3CFX A;  2RCA A;  2F6G A;  3OSQ A;  4E0X A;  4G68 B;  2I58 A;  4MH5 A;  3N6T A;  3HST A;  3DEL B;  4QFP A;  4ECF A;  4ISU A;  4XKR A;  3H7M A;  3C36 A;  3IB1 A;  4U1O A;  2DWA A;  3LR1 A;  2HFB A;  1B52 A;  3VVE A;  3FGS A;  1B7U A;  3JZJ A;  1EU8 A;  4BDO A;  5I56 A;  2F34 A;  2UXA A;  2IEE A;  4H67 A;  3ZKL A;  4H5G A;  2E1S A;  1QW0 A;  4G8M A;  5KCJ B;  3C31 A;  4YKP A;  2DSF A;  4O3A A;  4PP0 A;  3K2D A;  4OEU A;  3FD3 A;  3G3F A;  3C35 A;  4MLQ A;  2QS3 A;  5B7D A;  1N76 A;  1A54 A;  3PU5 A;  2ZXT A;  2X7Q A;  3S2V A;  4G68 A;  1IXI A;  3SEV A;  3I3V A;  4UAC A;  1SYI A;  5L9M A;  4RY1 A;  3FVG A;  5AA2 D;  3TTL A;  4H6D A;  4QF9 A;  1LAG E;  1LFG A;  4GL8 A;  2F97 A;  5DT6 A;  2VHA A;  2P1S A;  4ONY A;  2OBG A;  4F1V A;  1MM6 A;  3OO8 A;  1POY 1;  1SYH A;  4YKK A;  5KCJ A;  2P2A A;  3VVF A;  5FTH A;  4WKM A;  4ZE8 A;  4JWO A;  4OEN A;  1NFT A;  2Z22 A;  4IO5 A;  1P1N A;  1JET A;  3KN7 A;  1JW4 A;  3CG1 A;  2V3Q A;  2DXY A;  3ZSF A;  1IXH A;  3G3J A;  1Y20 A;  3K6V A;  3IX1 A;  4JB7 A;  5H8H B;  4OER A;  1Y9U A;  4DXU A;  4GRK A;  1SQY A;  2DE3 A;  4BDN A;  5I2N B;  2GHB A;  1SW2 A;  3OO6 A;  1JW1 A;  2QS4 A;  3FJG A;  4WEP A;  1MPB A;  4GFR A;  1EZO A;  4ZE9 A;  3B7D A;  3GLB A;  1VE4 A;  2QS1 A;  3HPI A;  4IO6 A;  1T0K A;  1ZU0 A;  4HTG A;  1Y1Z A;  1KWH A;  3KSX A;  4R2F A;  4Q8R A;  1JVX A;  2BJJ X;  3MVX A;  3E3K A;  1LBB A;  4X48 A;  1LAF E;  1B4H A;  5AA4 A;  1MPC A;  3QUJ A;  4NMY A;  2CMO A;  4F3B A;  5H8H A;  4G68 C;  4G8H A;  5DTB A;  2YPN A;  2ONR A;  1B05 A;  2UYE A;  4YU0 A;  5H8F A;  2HXW A;  3S9M C;  1NNP A;  3OEL A;  4AB6 A;  4RPN A;  2O7U A;  1JEV A;  5CRY A;  4PFT A;  5CBR A;  4PE5 B;  4QFO A;  2XD2 A;  3C9H A;  3MP8 A;  3KEI A;  4H0W A;  3USD A;  2ZYO A;  4R74 A;  4C1U A;  4F22 A;  5KDT B;  1B1X A;  1NL5 A;  1NNK A;  4M1V A;  2V84 A;  1ZJL A;  5H8S A;  1XVX A;  2I0B A;  1LAX A;  2AL5 A;  4ZEF A;  4DLD A;  3PUV E;  3T9H B;  2ONK E;  4QFK A;  1AL3 A;  2ZYM A;  1O7T A;  2UYF A;  3EHU A;  3K6W A;  3MPL A;  3O6I A;  5BWJ A;  3VV5 A;  4NF5 B;  1HSE A;  4BDM A;  1B32 A;  4PFW A;  3FIR A;  4F39 A;  4PQJ A;  4O3C A;  5AE4 A;  4OFL A;  1MH4 A;  3RTF B;  2DVC A;  5I84 A;  1ZKB A;  1JEU A;  1MPD A;  2RIN A;  3VLW A;  1SI0 A;  1R9L A;  3EQ1 A;  1II5 A;  5DVI A;  1D9V A;  4ZEI A;  3DLN A;  3CFZ A;  2XXX A;  3T66 A;  2QSX A;  3KOS A;  4H5F A;  5CC2 A;  3MP6 A;  1UTH B;  2V3U A;  2DWI A;  3OEN A;  2XXI A;  4POX A;  4EQ9 A;  1POT A;  4THI A;  4GQO A;  2THI A;  4IY5 A;  4TLL B;  5CBS A;  5CMC A;  3VFJ A;  3N26 A;  3PV0 E;  4FED A;  4QSE A;  3T9V A;  2Y7K A;  1AIV A;  3F11 A;  1BP5 A;  1J1N A;  3IL1 B;  1H43 A;  3ECR A;  1SD3 A;  3TMG A;  4EXL A;  3TTM A;  4DCY A;  2R9J A;  4LQ2 A;  5A5X B;  4XIG Q;  1PDA A;  1S50 A;  2OWT A;  1LST A;  3H6T A;  2NXO A;  1ZTY A;  2A5S A;  1OVT A;  2NWJ A;  1OQG A;  1QKA A;  2WKY A;  3OSR A;  1MDP 1;  3C34 A;  4GIZ A;  5DVJ A;  3U1O A;  4P11 A;  1UTH A;  5CM6 A;  4YAH X;  4RYA A;  3TCF A;  1GTK A;  1NKX A;  3MJN A;  2UVJ A;  2V25 A;  1MRP A;  1O63 A;  3WAF A;  3TOD A;  4BDQ A;  3RT8 A;  3H6U A;  3RN8 A;  2XXQ A;  3G3K A;  4FJP A;  4R2B A;  1M5C A;  4FIM A;  4F1U A;  1Y1M A;  2REJ A;  1DTG A;  4H8I A;  1NH8 A;  4JDF A;  3FJ7 A;  4EUO A;  4Z0I A;  4TQU Q;  1ZMG A;  4NF8 B;  4N07 A;  4OET A;  1RYO A;  5TU0 A;  2CZL A;  4R6K A;  4ZED A;  4QFN A;  3LBS A;  3KOT A;  3QAX A;  1MQI A;  2OLB A;  3B6W A;  1XC1 A;  1MS7 A;  4Q5T A;  2GHA A;  3TYH A;  2H5Y A;  2AIX A;  3UA8 A;  4I62 A;  3C33 A;  4YZZ A;  1URD A;  3BFT A;  2O84 X;  3CR9 A;  3FVO A;  4XKQ A;  4DZ1 A;  3Q29 A;  3Q27 A;  4OFO A;  3OEK A;  3IR1 A;  3K01 A;  2OK2 A;  1A8E A;  4EQB A;  4F29 A;  1Y3Q A;  1GV8 A;  1IEJ A;  1YCJ A;  3RUM A;  4LAT A;  4NF8 A;  1I69 A;  1DTZ A;  1JW5 A;  2Y7W A;  4LON B;  1XHY A;  4GVO A;  4IO2 A;  5HBC A;  4HCY A;  5EHM A;  4BDL A;  3EN3 A;  1XT8 A;  1SDX A;  2ZNS A;  3H4Z A;  3K0V A;  3FJM A;  4H65 A;  1TXF A; 
#chains in the Genus database with same CATH topology
 2GH9 A;  1Y3P A;  1N84 A;  1FTL A;  3VDF A;  3S9E A;  4GXA A;  4OYV A;  2XXT A;  2YJP A;  2I4C A;  1Z7N E;  3CHG A;  3QUF A;  5IM2 A;  3IOV A;  3SEY A;  3RPW A;  4TOZ A;  3E78 A;  3T22 A;  1MM7 A;  4I8C A;  3IO6 A;  4HCW A;  1I6A A;  3FUZ A;  2F3D A;  5EYG A;  1ANF A;  1D3K A;  2F78 A;  1M5F A;  3MVZ A;  4PAF A;  2Q8M A;  3BIG A;  2AL4 A;  1QVS A;  5K2Y A;  4PFY A;  4AB5 A;  4WXJ A;  3MPK A;  1NUZ A;  4P0I A;  3C4M A;  4PFR A;  1B4Z A;  2RF1 A;  2I48 A;  5KZT A;  2OZZ A;  3EPE A;  1FTK A;  5I7I A;  2PBW A;  4GBW A;  1WVJ A;  4QSD A;  3W9W A;  1VFD A;  3FXQ A;  1P1Q A;  4YMB A;  4R6H A;  1UQW A;  4LZ5 A;  3IK6 B;  1IIW A;  2M8C A;  1QUL A;  3O97 A;  5B70 A;  2FYI A;  4OA4 A;  4MFI A;  3BIH A;  3B6Q A;  4XF5 A;  2DE4 A;  4PBH A;  4JSD A;  3IB2 A;  2PX1 A;  3VXC A;  2FIE A;  3MAM A;  3EF7 A;  4MAG A;  4N17 A;  4YB5 A;  3MVY A;  2DWH A;  4N8Y A;  3TCH A;  1EH3 A;  1LAH E;  3I5O A;  3U8Q A;  2Q2A A;  4OES A;  1GVC A;  5AA4 B;  1OIB A;  2QVV A;  4G8N A;  4GD5 A;  4JSO A;  3O28 A;  1Z7M E;  3N6U A;  1US5 A;  2Y7P A;  2AYS A;  2XD3 A;  1LB8 A;  3IFC A;  1SW5 A;  1US4 A;  3FAT A;  1MQG A;  4E0W A;  3MC2 A;  2KQZ A;  3DP4 A;  2XWO A;  4DCX A;  3VXB A;  5H8F B;  1XS5 A;  4KXP A;  1K9Z A;  4G77 A;  2ZYN A;  4KR5 A;  4MNI A;  1A40 A;  2DP8 A;  1MY3 A;  3ROJ A;  2XXU A;  4GWW A;  1DMB A;  4JVD A;  1YPN A;  2V3T A;  1FBH A;  1TFD A;  3DM0 A;  3E79 A;  2QMX A;  4ZEK A;  3O29 A;  1MY2 A;  3JYR A;  3TEL A;  1NH7 A;  4GF8 A;  2Q2C A;  2XX8 A;  1B7H A;  3IOU A;  4R72 A;  1AH5 A;  1QJM A;  3UOR A;  5I5P A;  2D21 A;  2F5X A;  1D9Q A;  1R6Z A;  4GWU A;  3UGW A;  4IR8 A;  3K02 A;  2B4L A;  1RYX A;  5AA2 B;  5ICT A;  5FHN A;  5IZZ A;  3HHF A;  1LLS A;  2PT1 A;  1UIU A;  2B65 A;  4G61 A;  2B4M A;  3FZV A;  1Q1K A;  4JWX A;  1FPD A;  3MW0 A;  3E4R A;  3G3I A;  4AS5 A;  4HE2 A;  4EXK A;  4OFJ A;  3T9X B;  2VD2 A;  1JVY A;  3GZG A;  2QMW A;  1FBF A;  3RT6 B;  1CNQ A;  1I6Q A;  5JTY B;  3FV1 A;  3UIF A;  3M8U A;  4YKI A;  4RNS A;  4I1D A;  1FQB A;  1B51 A;  3PMV A;  1A8F A;  2F7C A;  2FHY A;  1SBP A;  3QIM A;  1QUI A;  5EYF A;  3N5L A;  1KA0 A;  3BBR A;  1HSL A;  3TQL A;  4KHZ E;  4LP2 B;  1NUW A;  4F3P A;  3M3F A;  1PB9 A;  3U92 A;  1P1O A;  3RQT A;  1DCU A;  2BJI A;  1MY1 A;  1G0H A;  2F36 A;  5AA2 A;  2HEU A;  4R73 A;  1XVY A;  1MG1 A;  3DP8 A;  4PFU A;  4H8J A;  1QUJ A;  5AA1 A;  3U65 A;  3E13 X;  5H8N B;  2ANJ A;  3G3G A;  5L9S A;  5DEX B;  1SPI A;  2DQV A;  3V5A A;  3S9N C;  1N0T A;  2O68 A;  4P47 A;  2HAV A;  2HQ0 A;  1OLC A;  4NWC A;  3RLF E;  4R6Y A;  4R75 A;  3CI8 A;  4RK9 A;  3S4U A;  5JTY A;  3KJT A;  4PE3 A;  1H76 A;  4N13 A;  3GXA A;  3OMB A;  1IXC A;  3OOA A;  5IKB A;  1S9T A;  1BIY A;  3IJO B;  4OMB A;  4P0G A;  3EHS A;  5ELV A;  3TPA A;  1P99 A;  5J1D A;  1R9Q A;  4ELP A;  3KN8 A;  3IFA A;  1ATG A;  2XX7 A;  2LAO A;  4NF6 A;  5CMK A;  3SDF A;  2Z23 A;  3HN0 A;  3KJ7 A;  1MXV A;  1R1N A;  3H6V A;  2G29 A;  2HAU A;  3KZG A;  3SKP A;  3PPQ A;  3TZA A;  4IGR A;  4XTC Q;  3TTN A;  5TPA B;  5L8D A;  2YLN A;  2GRV A;  5H8N A;  4KYD A;  3K1M A;  5DEX A;  3W9V A;  1PEB A;  3G3H A;  2Q8J A;  1OQH A;  1O64 A;  1MXU A;  1IXG A;  4F18 A;  3PPP A;  5EHS A;  2I0C A;  4LA9 A;  2Y5K A;  4OEV A;  1QKB A;  4IO4 A;  2R6G E;  4XKP A;  2NUV A;  4IO7 A;  2HXR A;  4KYS A;  4P56 A;  1P1W A;  4BLA A;  3PGF A;  3PPN A;  1OVB A;  4ELR A;  3TUS A;  2I49 A;  2Z8F A;  2P0S A;  4KCD A;  1LGB C;  3R26 A;  2ABH A;  1B9J A;  4RXL A;  4YB6 A;  3D4C A;  4KCC A;  2XXK A;  4EQ7 A;  1SI1 A;  1QGX A;  1USY H;  1P1U A;  3TDJ A;  1A55 A;  5DYH A;  4G2Z A;  2Y84 A;  1M5B A;  3AXF A;  5TPA A;  4LN5 A;  5H8Q A;  4EDP A;  3CIJ A;  4GL0 A;  4JVI A;  2F6P A;  1FJ6 A;  2H4I A;  2VPO A;  1Q9D A;  4C0R A;  2XXW A;  4U1Z A;  1FQA A;  4OVS A;  3VLU A;  4NX1 A;  4U2R A;  1AMF A;  1DBZ A;  3LSF B;  5EQ9 A;  2QL3 A;  4OZ9 A;  4NHB A;  3H6W A;  1ZIU A;  1B46 A;  4GXS B;  5ICQ A;  2D3I A;  4QFL A;  4MF3 A;  3PPO A;  2XX9 A;  5JEI A;  1FPF A;  1N3X A;  2HCA A;  1UIV A;  3ONM A;  3PD8 A;  4Z7E A;  3FAS A;  3G7W A;  1UTB B;  4NQ8 A;  3FXB A;  4KFQ A;  4ZZE A;  1LCF A;  2XXH A;  3RPL B;  2I3W A;  2FNC A;  5IZ3 B;  1FQD A;  3QMF A;  5CMM A;  2V93 A;  2RKM A;  2DE2 A;  1M5D A;  2VD3 A;  3I6V A;  3HCQ A;  2X7P A;  3KC0 A;  3QSL A;  5LDZ A;  1KA1 A;  4BDR A;  3T96 B;  3JV9 A;  1AWB A;  3MYU A;  1VFE A;  1PBP A;  3IOT A;  1D9Y A;  2ESN A;  3VVD A;  1ZLQ A;  2RC7 A;  2VOZ A;  3CSG A;  3U72 A;  1MXW A;  4X1B A;  1B0L A;  1LEV A;  1B5H A;  1MY0 A;  1YTV A;  1NV1 A;  4FEC A;  1FRP A;  2O6A A;  3VE1 B;  3KFM A;  4ELQ A;  2ZMB A;  4FEB A;  1SVX B;  3KN3 A;  1TWY A;  3L6G A;  4IB2 A;  3B6T A;  4U23 A;  1NMU A;  3VLV A;  2QJE A;  4QHQ A;  3FXR A;  1UTB A;  5I58 A;  4ZS9 A;  1FTO A;  3CSB A;  3D4G A;  4R9G A;  4WED A;  5IZ3 A;  1RDZ A;  1YXI A;  3ZKK A;  3V8X B;  2QFL A;  4H1X A;  2OWS A;  4NE4 A;  5I59 B;  1OLA A;  1MH3 A;  2PYY A;  4RA1 A;  4XKN A;  2WBB A;  1SW1 A;  1EZP A;  4DI4 B;  5ITP A;  2DVZ A;  1B3H A;  4LQ5 A;  2PMS A;  1FPL A;  2Y5L A;  2ZYK A;  3U93 A;  3N94 A;  3MVW A;  3SEU A;  2H98 A;  3HHG A;  2O1L A;  4NN3 A;  1URG A;  3KG2 A;  3MP1 A;  3TFL A;  2F35 A;  3LSL A;  1VR5 A;  1NNT A;  5ESY A;  1B2H A;  1PC3 A;  1D4N A;  3T9U A;  3HV1 A;  3TQW A;  2DWJ A;  3W15 C;  2WYP A;  3FXU A;  4KQP A;  1LBX A;  3K6U A;  3K00 A;  3ODB A;  1BK4 A;  4KD5 A;  3TEP A;  3CVG A;  2I3V A;  4RJZ A;  1GGG A;  4F2O A;  3GBB A;  4PBQ A;  4KPT A;  1IQ7 A;  4IY6 A;  5AA3 A;  2R8T A;  1TFA A;  1Y3N A;  5I59 A;  5CI5 A;  4KYE A;  4R9F A;  1OMP A;  3MZ1 A;  2Z8E A;  1B3F A;  1B40 A;  1B58 A;  4O3B A;  4OWD A;  4F3S A;  2PT2 A;  2WEF A;  2FIX A;  3PUY E;  3PMW A;  4NTL A;  2XXR A;  3RNN A;  2ZZV A;  3QK6 A;  4NG7 A;  1N3W A;  4H46 A;  3A3U A;  4PFB A;  3H06 B;  5F24 A;  3CG3 A;  1K9Y A;  1IMC A;  4F3G A;  4GLI A;  4MX6 A;  1B5J A;  1FBD A;  2O51 A;  5FHO A;  3OEM A;  2XWV A;  3CRB A;  4IO3 A;  1MQD A;  4P1L A;  4GOT A;  2PFY A;  3GBA A;  1NUX A;  3HFU A;  1BKA A;  4N6D A;  1RDY A;  1Y4C A;  1IMA A;  4YKJ A;  2FA7 A;  1DK4 A;  1B0H A;  3BFU A;  2F8D A;  3M3L A;  4F2Q A;  4FAT A;  5EQA A;  4Q30 B;  1B1H A;  3MUQ A;  1DPP A;  1DOT A;  3R7X A;  4YB7 A;  5I2K B;  1LFH A;  1EYJ A;  4U4S A;  2Q88 A;  3O66 A;  2I4B A;  1Q35 A;  4ESX A;  3IOW A;  1WOD A;  2D5W A;  2DXR A;  5BUU A;  2QS2 A;  1PB8 A;  4NED A;  2Y7R A;  4DXB A;  3OD7 A;  4I3E A;  3IOR A;  1QUK A;  4OVR A;  3FVK A;  1BTJ A;  3OO9 A;  3SEW A;  3PPR A;  3FVN A;  1DSN A;  4ND9 A;  4ZZA A;  5L9O A;  4L17 A;  3H03 A;  4Q0C A;  2ONS A;  3ILT B;  2ZZW A;  4UA8 A;  2WYK A;  2H9B A;  4FOR A;  4ZDM A;  4LZ8 A;  1B6H A;  2ALU A;  1CE2 A;  4KI0 E;  4TLM B;  1H3D A;  2F7A A;  2QVU A;  3R6U A;  3PUW E;  3H3G A;  2XWI A;  2RC9 A;  4HS7 A;  3UN6 A;  4ZEB A;  5I2K A;  3OXN A;  2CZH A;  1IMF A;  3KBR A;  3O9P A;  3K1N A;  1Y4T A;  2UVH A;  2FVZ A;  4N6P A;  5I2N A;  2UVI A;  1WDN A;  1IIT A;  2XHD A;  2XXY A;  3THI A;  4F19 A;  3PD9 A;  1S7Y A;  1NUY A;  3V89 B;  3SEX A;  1VSO A;  3TKD A;  3SES A;  2E0S A;  3MBP A;  4U21 A;  4IGT A;  5ITO A;  4MNP A;  3PUZ E;  2DS9 A;  2VT5 A;  4LUB A;  4P9K A;  2GFE A;  4XEQ A;  3TTK A;  3IAZ A;  3A3C A;  4HE0 A;  1BLF A;  4DIG A;  1B3G A;  1PB7 A;  4NF6 B;  3WAE A;  3V83 A;  3PTY A;  1ZBM A;  1VDW A;  4PGP A;  3OO7 A;  2G93 A;  4N4U A;  2WX9 A;  4NWD A;  4HXV A;  5ET7 A;  1B3E A;  3QYT A;  2CZI A;  2DOJ A;  3IB0 A;  4U22 A;  2Q9T A;  1DPE A;  1MXZ A;  3E9X A;  2VP1 A;  1RKM A;  4OVP A;  3UK4 A;  4QSC A;  5HPQ A;  2ZNT A;  1FBG A;  4OVJ A;  3O6H A;  4YIC A;  4PET A;  2O69 A;  3NOH A;  1IZ1 A;  4LVQ A;  4ELO A;  4GWY A;  1AOV A;  1FPE A;  3ZS6 A;  4ESW A;  2A5T B;  2REG A;  5JK4 A;  4YMA A;  1YYZ A;  3PUX E;  4OQO A;  1NV7 A;  1MXY A;  2R71 A;  2UVG A;  3Q25 A;  5DVF A;  1NV4 A;  3MWB A;  2XA5 A;  4DE8 A;  5IZ1 A;  4XFE A;  3Q28 A;  5KDT A;  2O7I A;  4RPO A;  1NNF A;  3MZ9 A;  5H8Q B;  5IAI A;  5F7V A;  1LBC A;  4JXI A;  1NV3 A;  3L6H A;  1INP A;  1FTA A;  3K6X A;  1LFI A;  1H45 A;  4MHF A;  4JWY A;  4X04 A;  2B3B A;  2XXV A;  3MZB A;  1YAE A;  1ELJ A;  2ZNU A;  3P7I A;  4MLV A;  4QRZ A;  1USY E;  2A5T A;  3LC8 A;  2XXP A;  1PBQ A;  4O7I A;  5F1Q A;  1MQH A;  3T1B A;  4POW A;  4G4P A;  1I6B A;  2RCB A;  4NF5 A;  4GX4 A;  1MQJ A;  4PAI A;  1XOC A;  1FW0 A;  4ZEC A;  3QXM A;  4MBP A;  3FV2 A;  2Z8D A;  2KLF A;  1H44 A;  4NAP A;  2P3V A;  4X1D A;  4F31 B;  2H25 A;  1LB9 A;  2OCU A;  3U94 A;  1RDX A;  1FQF A;  2WBD A;  3KGC A;  4F1Y A;  4GWO A;  3FBP A;  5HM4 B;  1FSA A;  1CB6 A;  2I6E A;  2Q89 A;  3LSX A;  2HZL A;  4JBZ A;  2KR0 A;  1FTJ A;  1TT1 A;  3RGY A;  2VGQ A;  4P8B A;  4PF8 A;  5FTI A;  4DXC A;  3RTW B;  3A09 A;  4JVC A;  5I57 B;  2B3F A;  1IUD A;  2V4C A;  3UP9 A;  2XWK A;  4EF1 A;  4XXU A;  1A99 A;  5J16 A;  1FTM A;  4MNC A;  1FQE A;  4FE8 A;  1L5T A;  3PMX A;  1SW4 A;  3KSJ A;  1EZ9 A;  3Q26 A;  4FAJ A;  5I58 B;  3ISP A;  5A5X A;  3RY3 A;  1F9B A;  2OJT A;  3C32 A;  4NF4 B;  3T93 B;  4HW8 A;  3LUY A;  4NGU A;  3M3K A;  2HHM A;  3LSW A;  5TP9 B;  5K2X A;  2H99 A;  3BKI B;  2IA4 A;  1JNF A;  5CMB A;  4OHN A;  3S9L C;  1IMB A;  4I9D A;  2DYX A;  3O2A A;  4AQ4 A;  2W7Y A;  1M5E A;  1FQC A;  1GR2 A;  2O1M A;  3DP6 A;  4X9T A;  3IJX B;  4OTE A;  3IO4 A;  2F7B A;  3SET A;  1URS A;  2CEX A;  1B3L A;  4U4X A;  4K3F A;  1A7L A;  5I57 A;  3TAJ A;  2PVU A;  4DDD A;  1MY4 A;  3HO7 A;  4C1T A;  3SER A;  4RK2 A;  3ILU B;  1MXX A;  3EHT A;  5M2V A;  1FCK A;  3MQ9 A;  3K4U A;  2QPQ A;  4LZ7 A;  1MDQ A;  2NOO A;  2QRY A;  5FHM A;  5EQ8 A;  3CFL A;  5I56 B;  2OX3 A;  1N04 A;  5EYH A;  1B5I A;  2X26 A;  5LOM A;  2Y7I A;  4OXV A;  2RC8 A;  1HSJ A;  4M4G A;  5ISU A;  3O6G A;  2NVU B;  4NF4 A;  3TCG A;  3LUZ A;  1B7Z A;  1N7X A;  5TP9 A;  4EF2 A;  3B8B A;  1N7W A;  1FBE A;  3K1P A;  2HZK A;  4O94 A;  1JQF A;  3TTR A;  1LCT A;  3CFX A;  2RCA A;  2F6G A;  3OSQ A;  4E0X A;  5ET5 A;  1FPK A;  4G68 B;  2I58 A;  4MH5 A;  3N6T A;  3HST A;  3DEL B;  4QFP A;  4PGN A;  4ISU A;  4XKR A;  4ECF A;  3H7M A;  3C36 A;  3IB1 A;  4U1O A;  2DWA A;  5ET8 A;  3LR1 A;  2HFB A;  1B52 A;  3VVE A;  3FGS A;  1B7U A;  3JZJ A;  1NI9 A;  1EU8 A;  4BDO A;  5I56 A;  2F34 A;  2UXA A;  2IEE A;  4H67 A;  3ZKL A;  1IME A;  4H5G A;  2E1S A;  5FBP A;  1QW0 A;  4G8M A;  5KCJ B;  1KZ8 A;  1LBY A;  3C31 A;  1EYK A;  4YKP A;  2DSF A;  4O3A A;  4PP0 A;  3K2D A;  4OEU A;  3FD3 A;  3G3F A;  3C35 A;  4MLQ A;  2QS3 A;  5B7D A;  4PTK A;  1N76 A;  2HPG A;  1A54 A;  3PU5 A;  2ZXT A;  2X7Q A;  3S2V A;  4G68 A;  1IXI A;  3SEV A;  3I3V A;  4UAC A;  1SYI A;  5L9M A;  4RY1 A;  3FVG A;  5AA2 D;  3TTL A;  4H6D A;  4QF9 A;  1LAG E;  1LFG A;  5LTC A;  4PAK A;  4GL8 A;  4PC9 A;  2F97 A;  5DT6 A;  2VHA A;  2P1S A;  4ONY A;  2OBG A;  4F1V A;  1MM6 A;  3OO8 A;  1POY 1;  1SYH A;  4YKK A;  5KCJ A;  4DI3 D;  2P2A A;  3VVF A;  5FTH A;  4WKM A;  4ZE8 A;  4JWO A;  4OEN A;  1NFT A;  2Z22 A;  4IO5 A;  4N8G A;  1P1N A;  1JET A;  3KN7 A;  1JW4 A;  3CG1 A;  4GWX A;  2V3Q A;  4MJO A;  2DXY A;  2FBP A;  3ZSF A;  1IXH A;  1G0I A;  3G3J A;  1Y20 A;  3K6V A;  3IX1 A;  4JB7 A;  5H8H B;  4OER A;  1Y9U A;  3B50 A;  4AS4 A;  4DXU A;  4OVQ A;  4GRK A;  1SQY A;  2DE3 A;  4BDN A;  5I2N B;  2GHB A;  1SW2 A;  3OO6 A;  1JW1 A;  2QS4 A;  3FJG A;  4WEP A;  1MPB A;  4GFR A;  1EZO A;  4N15 A;  4ZE9 A;  3B7D A;  2PFZ A;  3GLB A;  1VE4 A;  2QS1 A;  3HPI A;  4IO6 A;  1T0K A;  1ZU0 A;  4HTG A;  4QXD A;  3MST A;  1Y1Z A;  1KWH A;  3KSX A;  4R2F A;  4Q8R A;  1JVX A;  2BJJ X;  4QBA A;  3MVX A;  2L5V A;  3E3K A;  1NV5 A;  1LBB A;  4X48 A;  1LAF E;  1B4H A;  5AA4 A;  1MPC A;  1EYI A;  3QUJ A;  4NMY A;  2CMO A;  1FBP A;  4F3B A;  5H8H A;  4G68 C;  4G8H A;  4GWS A;  4MMP A;  5DTB A;  4O7M A;  2YPN A;  2ONR A;  1B05 A;  2UYE A;  4YU0 A;  5H8F A;  2HXW A;  3S9M C;  1NNP A;  3OEL A;  4AB6 A;  4O8M A;  4RPN A;  2O7U A;  1JEV A;  5CRY A;  4PFT A;  2QVR A;  5CBR A;  4PE5 B;  4QFO A;  4P1E A;  2XD2 A;  3C9H A;  3MP8 A;  3KEI A;  4H0W A;  2F3B A;  3USD A;  2GQ1 A;  2ZYO A;  1FBC A;  1XI6 A;  4X8R A;  3EKI A;  4R74 A;  4C1U A;  4F22 A;  5KDT B;  1B1X A;  1NL5 A;  1NNK A;  4M1V A;  2ZZX A;  2V84 A;  1ZJL A;  5H8S A;  1XVX A;  2I0B A;  4PDH A;  1LAX A;  2AL5 A;  4ZEF A;  4DLD A;  3PUV E;  3T9H B;  4PFI A;  4GBV A;  2ONK E;  4QFK A;  1AL3 A;  1NV0 A;  2ZYM A;  4I40 A;  2OWZ A;  1O7T A;  2UYF A;  3EHU A;  3K6W A;  3MPL A;  1LBZ A;  3O6I A;  5BWJ A;  3VV5 A;  4NF5 B;  1HSE A;  4N6K A;  4BDM A;  4PFW A;  1B32 A;  1NV2 A;  3FIR A;  4F39 A;  4PQJ A;  4O3C A;  5AE4 A;  3T0J A;  5A5L A;  4OFL A;  4GX3 A;  1MH4 A;  3D1R A;  3RTF B;  2DVC A;  4I3Y A;  5I84 A;  1ZKB A;  1JEU A;  4UAB A;  1MPD A;  2DDK A;  2RIN A;  4GWZ A;  3VLW A;  1SI0 A;  1R9L A;  3EQ1 A;  1II5 A;  5DVI A;  1D9V A;  4ZEI A;  3DLN A;  3CFZ A;  2XXX A;  3T66 A;  2QSX A;  3KOS A;  4H5F A;  1FPJ A;  5CC2 A;  3MP6 A;  1UTH B;  2V3U A;  3KC1 A;  2DWI A;  4MEV A;  3OEN A;  4MCO A;  2XXI A;  4POX A;  4EQ9 A;  1POT A;  1IMD A;  4THI A;  4H45 A;  4GQO A;  1JP4 A;  2THI A;  4IY5 A;  4PF6 A;  4P3L A;  4TLL B;  5CBS A;  5CMC A;  2VPN A;  3SZP A;  3VFJ A;  3N26 A;  3PV0 E;  4FED A;  4QSE A;  3T9V A;  2Y7K A;  2CZK A;  1AIV A;  3F11 A;  1BP5 A;  1J1N A;  3IL1 B;  1H43 A;  3ECR A;  2P3N A;  1SD3 A;  4N81 A;  3TMG A;  4EXL A;  1FPG A;  3TTM A;  4DCY A;  2R9J A;  4LQ2 A;  4GX6 A;  5A5X B;  4XIG Q;  1PDA A;  3A29 A;  1S50 A;  2OWT A;  1LST A;  3H6T A;  2NXO A;  1ZTY A;  2A5S A;  1OVT A;  2NWJ A;  4MIJ A;  1OQG A;  1QKA A;  2WKY A;  3OSR A;  1MDP 1;  3C34 A;  4GIZ A;  5DVJ A;  5IGA A;  3U1O A;  4P11 A;  1UTH A;  5CM6 A;  4HE1 A;  4YAH X;  4RYA A;  3TCF A;  1GTK A;  1NKX A;  3MJN A;  2UVJ A;  2V25 A;  1MRP A;  3KBZ A;  1O63 A;  5DW8 A;  3WAF A;  3TOD A;  4BDQ A;  3RT8 A;  3H6U A;  3RN8 A;  4NF0 A;  2XXQ A;  3G3K A;  4FJP A;  4R2B A;  1M5C A;  4FIM A;  2CEY A;  1FJ9 A;  4F1U A;  2Q74 A;  1Y1M A;  2REJ A;  1DTG A;  4H8I A;  1NH8 A;  4JDF A;  3FJ7 A;  4EUO A;  4Z0I A;  4TQU Q;  1ZMG A;  4NF8 B;  4N07 A;  4OET A;  1RYO A;  5TU0 A;  2CZL A;  4PDD A;  4R6K A;  4ZED A;  4QFN A;  3LBS A;  1FPI A;  3KOT A;  3QAX A;  1LBV A;  1FPB A;  1MQI A;  2OLB A;  2MKZ A;  3B6W A;  1XC1 A;  1MS7 A;  4Q5T A;  4N91 A;  2GHA A;  3TYH A;  2H5Y A;  2AIX A;  3UA8 A;  4I62 A;  3C33 A;  1LBW A;  4YZZ A;  1URD A;  3BFT A;  2O84 X;  3CR9 A;  3FVO A;  4XKQ A;  4DZ1 A;  3LV0 A;  3Q29 A;  3Q27 A;  4OFO A;  3OEK A;  3GYY A;  3IR1 A;  2PCR A;  3K01 A;  2OK2 A;  1A8E A;  4EQB A;  4OVT A;  4F29 A;  1YZ0 A;  1Y3Q A;  1GV8 A;  1IEJ A;  1YCJ A;  3RUM A;  4LAT A;  4NF8 A;  1I69 A;  1DTZ A;  1JW5 A;  5T3J A;  4FBP A;  2Y7W A;  5I3S A;  4LON B;  1XHY A;  5EQ7 A;  4GVO A;  4IO2 A;  5HBC A;  4HCY A;  1NV6 A;  5EHM A;  3RPL A;  4OAN A;  4BDL A;  3RYD A;  3EN3 A;  1XT8 A;  5ET6 A;  1SDX A;  2ZNS A;  2JJK A;  3H4Z A;  4PCD A;  3K0V A;  3FJM A;  4H65 A;  1TXF A; 
#chains in the Genus database with same CATH homology
 2GH9 A;  1Y3P A;  1N84 A;  1FTL A;  3VDF A;  3S9E A;  4GXA A;  4OYV A;  2XXT A;  2YJP A;  2I4C A;  1Z7N E;  3QUF A;  3IOV A;  3SEY A;  3RPW A;  4TOZ A;  3T22 A;  1MM7 A;  4I8C A;  3IO6 A;  4HCW A;  1I6A A;  3FUZ A;  1ANF A;  1D3K A;  2F78 A;  1M5F A;  3MVZ A;  2AL4 A;  1QVS A;  5K2Y A;  4PFY A;  4AB5 A;  4WXJ A;  3MPK A;  4P0I A;  3C4M A;  1B4Z A;  2RF1 A;  2I48 A;  5KZT A;  2OZZ A;  3EPE A;  1FTK A;  2PBW A;  1WVJ A;  4QSD A;  3W9W A;  1VFD A;  3FXQ A;  1P1Q A;  4YMB A;  4R6H A;  1UQW A;  4LZ5 A;  3IK6 B;  1IIW A;  2M8C A;  1QUL A;  3O97 A;  5B70 A;  2FYI A;  4MFI A;  3B6Q A;  2DE4 A;  4JSD A;  3IB2 A;  2PX1 A;  3VXC A;  3MAM A;  3EF7 A;  4YB5 A;  3MVY A;  2DWH A;  3TCH A;  1EH3 A;  1LAH E;  3I5O A;  3U8Q A;  2Q2A A;  4OES A;  1GVC A;  5AA4 B;  1OIB A;  4G8N A;  4GD5 A;  4JSO A;  3O28 A;  1Z7M E;  3N6U A;  1US5 A;  2Y7P A;  2AYS A;  2XD3 A;  1LB8 A;  1SW5 A;  1US4 A;  3FAT A;  1MQG A;  4E0W A;  3MC2 A;  3DP4 A;  4DCX A;  3VXB A;  5H8F B;  1XS5 A;  4G77 A;  2ZYN A;  4KR5 A;  1A40 A;  2DP8 A;  1MY3 A;  2XXU A;  1DMB A;  1YPN A;  2V3T A;  1TFD A;  3DM0 A;  2QMX A;  4ZEK A;  3O29 A;  1MY2 A;  3JYR A;  3TEL A;  1NH7 A;  4GF8 A;  2Q2C A;  2XX8 A;  1B7H A;  3IOU A;  4R72 A;  1AH5 A;  1QJM A;  3UOR A;  2D21 A;  2F5X A;  1R6Z A;  3UGW A;  3K02 A;  1RYX A;  5AA2 B;  5ICT A;  5FHN A;  3HHF A;  1LLS A;  2PT1 A;  1UIU A;  2B65 A;  3FZV A;  1Q1K A;  4JWX A;  3MW0 A;  3E4R A;  3G3I A;  4EXK A;  4OFJ A;  3T9X B;  2VD2 A;  1JVY A;  3GZG A;  2QMW A;  3RT6 B;  1I6Q A;  5JTY B;  3FV1 A;  3UIF A;  3M8U A;  4YKI A;  4RNS A;  4I1D A;  1FQB A;  1B51 A;  3PMV A;  1A8F A;  2F7C A;  1SBP A;  3QIM A;  1QUI A;  5EYF A;  3N5L A;  3BBR A;  1HSL A;  3TQL A;  4KHZ E;  4LP2 B;  4F3P A;  3M3F A;  1PB9 A;  3U92 A;  1P1O A;  3RQT A;  1MY1 A;  2F36 A;  5AA2 A;  2HEU A;  4R73 A;  1XVY A;  1MG1 A;  3DP8 A;  4PFU A;  4H8J A;  1QUJ A;  5AA1 A;  3E13 X;  5H8N B;  2ANJ A;  3G3G A;  5L9S A;  5DEX B;  2DQV A;  3V5A A;  3S9N C;  1N0T A;  2O68 A;  2HAV A;  2HQ0 A;  1OLC A;  4NWC A;  3RLF E;  4R6Y A;  4R75 A;  3CI8 A;  4RK9 A;  3S4U A;  5JTY A;  3KJT A;  1H76 A;  4N13 A;  3GXA A;  3OMB A;  1IXC A;  3OOA A;  5IKB A;  1S9T A;  1BIY A;  3IJO B;  4OMB A;  4P0G A;  3EHS A;  5ELV A;  3TPA A;  1P99 A;  5J1D A;  1R9Q A;  4ELP A;  3KN8 A;  1ATG A;  2XX7 A;  2LAO A;  4NF6 A;  5CMK A;  3SDF A;  2Z23 A;  3HN0 A;  3KJ7 A;  1MXV A;  1R1N A;  3H6V A;  2G29 A;  2HAU A;  3KZG A;  3SKP A;  3PPQ A;  3TZA A;  4IGR A;  4XTC Q;  3TTN A;  5TPA B;  5L8D A;  2YLN A;  2GRV A;  5H8N A;  4KYD A;  3K1M A;  5DEX A;  3W9V A;  1PEB A;  3G3H A;  2Q8J A;  1OQH A;  1O64 A;  1MXU A;  1IXG A;  4F18 A;  3PPP A;  5EHS A;  2I0C A;  4LA9 A;  4OEV A;  1QKB A;  4IO4 A;  2R6G E;  4XKP A;  2NUV A;  4IO7 A;  4KYS A;  1P1W A;  4BLA A;  3PGF A;  3PPN A;  1OVB A;  4ELR A;  3TUS A;  2I49 A;  2Z8F A;  2P0S A;  4KCD A;  1LGB C;  3R26 A;  2ABH A;  1B9J A;  4RXL A;  4YB6 A;  3D4C A;  4KCC A;  4EQ7 A;  1SI1 A;  1USY H;  1P1U A;  3TDJ A;  1A55 A;  5DYH A;  4G2Z A;  2Y84 A;  1M5B A;  3AXF A;  5TPA A;  5H8Q A;  4EDP A;  3CIJ A;  4GL0 A;  2F6P A;  2H4I A;  4C0R A;  2XXW A;  4U1Z A;  1FQA A;  3VLU A;  4U2R A;  1AMF A;  3LSF B;  2QL3 A;  4OZ9 A;  3H6W A;  1ZIU A;  1B46 A;  4GXS B;  5ICQ A;  2D3I A;  4QFL A;  4MF3 A;  3PPO A;  2XX9 A;  5JEI A;  1N3X A;  2HCA A;  1UIV A;  3ONM A;  3PD8 A;  4Z7E A;  3FAS A;  3G7W A;  1UTB B;  4KFQ A;  4ZZE A;  1LCF A;  2XXH A;  2I3W A;  2FNC A;  1FQD A;  5CMM A;  2V93 A;  2RKM A;  2DE2 A;  1M5D A;  2VD3 A;  3I6V A;  3HCQ A;  2X7P A;  3QSL A;  4BDR A;  3T96 B;  3JV9 A;  1VFE A;  1PBP A;  3IOT A;  1D9Y A;  2ESN A;  3VVD A;  1ZLQ A;  2RC7 A;  2VOZ A;  3CSG A;  3U72 A;  1MXW A;  4X1B A;  1B0L A;  1B5H A;  1MY0 A;  1YTV A;  4FEC A;  2O6A A;  3VE1 B;  3KFM A;  4ELQ A;  2ZMB A;  4FEB A;  1SVX B;  3KN3 A;  1TWY A;  3L6G A;  4IB2 A;  3B6T A;  4U23 A;  1NMU A;  3VLV A;  2QJE A;  4QHQ A;  3FXR A;  1UTB A;  5I58 A;  4ZS9 A;  1FTO A;  3CSB A;  3D4G A;  4R9G A;  4WED A;  3ZKK A;  3V8X B;  4H1X A;  2OWS A;  4NE4 A;  5I59 B;  1OLA A;  1MH3 A;  2PYY A;  4RA1 A;  4XKN A;  1SW1 A;  1EZP A;  5ITP A;  2DVZ A;  1B3H A;  4LQ5 A;  2PMS A;  2ZYK A;  3U93 A;  3N94 A;  3MVW A;  3SEU A;  2H98 A;  3HHG A;  2O1L A;  1URG A;  3KG2 A;  3MP1 A;  3TFL A;  2F35 A;  3LSL A;  1VR5 A;  1NNT A;  1B2H A;  1PC3 A;  1D4N A;  3T9U A;  3HV1 A;  3TQW A;  2DWJ A;  3W15 C;  3FXU A;  4KQP A;  3K6U A;  3K00 A;  3ODB A;  4KD5 A;  3TEP A;  3CVG A;  2I3V A;  4RJZ A;  1GGG A;  4F2O A;  3GBB A;  4KPT A;  1IQ7 A;  4IY6 A;  5AA3 A;  1TFA A;  1Y3N A;  5I59 A;  5CI5 A;  4KYE A;  4R9F A;  1OMP A;  3MZ1 A;  2Z8E A;  1B3F A;  1B40 A;  1B58 A;  4O3B A;  4OWD A;  4F3S A;  2PT2 A;  3PUY E;  3PMW A;  4NTL A;  2XXR A;  3RNN A;  3QK6 A;  1N3W A;  3A3U A;  3H06 B;  3CG3 A;  4F3G A;  4GLI A;  1B5J A;  2O51 A;  5FHO A;  3OEM A;  3CRB A;  4IO3 A;  1MQD A;  4GOT A;  3GBA A;  1BKA A;  1Y4C A;  4YKJ A;  2FA7 A;  1B0H A;  3BFU A;  2F8D A;  3M3L A;  4F2Q A;  4FAT A;  4Q30 B;  1B1H A;  3MUQ A;  1DPP A;  1DOT A;  3R7X A;  4YB7 A;  5I2K B;  1LFH A;  4U4S A;  2Q88 A;  3O66 A;  2I4B A;  1Q35 A;  4ESX A;  3IOW A;  1WOD A;  2D5W A;  2DXR A;  5BUU A;  2QS2 A;  1PB8 A;  4NED A;  2Y7R A;  4DXB A;  3OD7 A;  3IOR A;  1QUK A;  3FVK A;  1BTJ A;  3OO9 A;  3SEW A;  3PPR A;  3FVN A;  1DSN A;  4ND9 A;  4ZZA A;  5L9O A;  4L17 A;  3H03 A;  4Q0C A;  2ONS A;  3ILT B;  4UA8 A;  2H9B A;  4FOR A;  4ZDM A;  4LZ8 A;  1B6H A;  2ALU A;  1CE2 A;  4KI0 E;  4TLM B;  1H3D A;  2F7A A;  3R6U A;  3PUW E;  3H3G A;  2RC9 A;  4HS7 A;  3UN6 A;  4ZEB A;  5I2K A;  3OXN A;  3KBR A;  3O9P A;  3K1N A;  1Y4T A;  2UVH A;  4N6P A;  5I2N A;  2UVI A;  1WDN A;  1IIT A;  2XHD A;  2XXY A;  3THI A;  4F19 A;  3PD9 A;  1S7Y A;  3V89 B;  3SEX A;  1VSO A;  3TKD A;  3SES A;  2E0S A;  3MBP A;  4U21 A;  4IGT A;  5ITO A;  3PUZ E;  2DS9 A;  4LUB A;  2GFE A;  3TTK A;  3IAZ A;  3A3C A;  1BLF A;  4DIG A;  1B3G A;  1PB7 A;  4NF6 B;  3WAE A;  3V83 A;  1ZBM A;  3OO7 A;  2G93 A;  4NWD A;  1B3E A;  3QYT A;  2DOJ A;  3IB0 A;  4U22 A;  2Q9T A;  1DPE A;  1MXZ A;  3E9X A;  2VP1 A;  1RKM A;  3UK4 A;  4QSC A;  5HPQ A;  2ZNT A;  4OVJ A;  3O6H A;  4YIC A;  4PET A;  2O69 A;  1IZ1 A;  4LVQ A;  4ELO A;  1AOV A;  3ZS6 A;  4ESW A;  2A5T B;  2REG A;  5JK4 A;  4YMA A;  3PUX E;  4OQO A;  1MXY A;  2R71 A;  2UVG A;  3Q25 A;  5DVF A;  3MWB A;  4DE8 A;  3Q28 A;  5KDT A;  2O7I A;  4RPO A;  1NNF A;  3MZ9 A;  5H8Q B;  5IAI A;  5F7V A;  1LBC A;  4JXI A;  3L6H A;  3K6X A;  1LFI A;  1H45 A;  4JWY A;  2B3B A;  2XXV A;  3MZB A;  1YAE A;  1ELJ A;  2ZNU A;  3P7I A;  4MLV A;  4QRZ A;  1USY E;  2A5T A;  3LC8 A;  2XXP A;  1PBQ A;  5F1Q A;  1MQH A;  4POW A;  4G4P A;  1I6B A;  2RCB A;  4NF5 A;  1MQJ A;  1XOC A;  1FW0 A;  4ZEC A;  3QXM A;  4MBP A;  3FV2 A;  2Z8D A;  2KLF A;  1H44 A;  4X1D A;  4F31 B;  2H25 A;  1LB9 A;  2OCU A;  3U94 A;  1FQF A;  3KGC A;  4F1Y A;  4GWO A;  5HM4 B;  1CB6 A;  2I6E A;  2Q89 A;  3LSX A;  2HZL A;  4JBZ A;  1FTJ A;  1TT1 A;  3RGY A;  2VGQ A;  4DXC A;  5FTI A;  3RTW B;  3A09 A;  5I57 B;  2B3F A;  1IUD A;  3UP9 A;  4EF1 A;  4XXU A;  1A99 A;  1FTM A;  1FQE A;  4FE8 A;  1L5T A;  3PMX A;  1SW4 A;  3KSJ A;  1EZ9 A;  3Q26 A;  4FAJ A;  5I58 B;  5A5X A;  3RY3 A;  1F9B A;  2OJT A;  3C32 A;  4NF4 B;  3T93 B;  4HW8 A;  3LUY A;  3M3K A;  3LSW A;  5TP9 B;  5K2X A;  2H99 A;  3BKI B;  2IA4 A;  1JNF A;  5CMB A;  4OHN A;  3S9L C;  4I9D A;  2DYX A;  3O2A A;  4AQ4 A;  2W7Y A;  1M5E A;  1FQC A;  1GR2 A;  2O1M A;  3DP6 A;  4X9T A;  3IJX B;  4OTE A;  3IO4 A;  2F7B A;  3SET A;  1URS A;  1B3L A;  4U4X A;  4K3F A;  1A7L A;  5I57 A;  3TAJ A;  2PVU A;  4DDD A;  1MY4 A;  3HO7 A;  4C1T A;  3SER A;  4RK2 A;  3ILU B;  1MXX A;  3EHT A;  5M2V A;  1FCK A;  3MQ9 A;  3K4U A;  2QPQ A;  4LZ7 A;  1MDQ A;  2NOO A;  2QRY A;  5FHM A;  3CFL A;  5I56 B;  1N04 A;  1B5I A;  2X26 A;  5LOM A;  2Y7I A;  4OXV A;  2RC8 A;  1HSJ A;  4M4G A;  5ISU A;  3O6G A;  2NVU B;  4NF4 A;  3TCG A;  1B7Z A;  1N7X A;  5TP9 A;  4EF2 A;  1N7W A;  3K1P A;  2HZK A;  1JQF A;  3TTR A;  1LCT A;  3CFX A;  2RCA A;  2F6G A;  3OSQ A;  4E0X A;  4G68 B;  2I58 A;  4MH5 A;  3N6T A;  3HST A;  3DEL B;  4QFP A;  4ECF A;  4ISU A;  4XKR A;  3H7M A;  3C36 A;  3IB1 A;  4U1O A;  2DWA A;  3LR1 A;  2HFB A;  1B52 A;  3VVE A;  3FGS A;  1B7U A;  3JZJ A;  1EU8 A;  4BDO A;  5I56 A;  2F34 A;  2UXA A;  2IEE A;  4H67 A;  3ZKL A;  4H5G A;  2E1S A;  1QW0 A;  4G8M A;  5KCJ B;  3C31 A;  4YKP A;  2DSF A;  4O3A A;  4PP0 A;  3K2D A;  4OEU A;  3FD3 A;  3G3F A;  3C35 A;  4MLQ A;  2QS3 A;  5B7D A;  1N76 A;  1A54 A;  3PU5 A;  2ZXT A;  2X7Q A;  3S2V A;  4G68 A;  1IXI A;  3SEV A;  3I3V A;  4UAC A;  1SYI A;  5L9M A;  4RY1 A;  3FVG A;  5AA2 D;  3TTL A;  4H6D A;  4QF9 A;  1LAG E;  1LFG A;  4GL8 A;  2F97 A;  5DT6 A;  2VHA A;  2P1S A;  4ONY A;  2OBG A;  4F1V A;  1MM6 A;  3OO8 A;  1POY 1;  1SYH A;  4YKK A;  5KCJ A;  2P2A A;  3VVF A;  5FTH A;  4WKM A;  4ZE8 A;  4JWO A;  4OEN A;  1NFT A;  2Z22 A;  4IO5 A;  1P1N A;  1JET A;  3KN7 A;  1JW4 A;  3CG1 A;  2V3Q A;  2DXY A;  3ZSF A;  1IXH A;  3G3J A;  1Y20 A;  3K6V A;  3IX1 A;  4JB7 A;  5H8H B;  4OER A;  1Y9U A;  4DXU A;  4GRK A;  1SQY A;  2DE3 A;  4BDN A;  5I2N B;  2GHB A;  1SW2 A;  3OO6 A;  1JW1 A;  2QS4 A;  3FJG A;  4WEP A;  1MPB A;  4GFR A;  1EZO A;  4ZE9 A;  3B7D A;  3GLB A;  1VE4 A;  2QS1 A;  3HPI A;  4IO6 A;  1T0K A;  1ZU0 A;  4HTG A;  1Y1Z A;  1KWH A;  3KSX A;  4R2F A;  4Q8R A;  1JVX A;  2BJJ X;  3MVX A;  3E3K A;  1LBB A;  4X48 A;  1LAF E;  1B4H A;  5AA4 A;  1MPC A;  3QUJ A;  4NMY A;  2CMO A;  4F3B A;  5H8H A;  4G68 C;  4G8H A;  5DTB A;  2YPN A;  2ONR A;  1B05 A;  2UYE A;  4YU0 A;  5H8F A;  2HXW A;  3S9M C;  1NNP A;  3OEL A;  4AB6 A;  4RPN A;  2O7U A;  1JEV A;  5CRY A;  4PFT A;  5CBR A;  4PE5 B;  4QFO A;  2XD2 A;  3C9H A;  3MP8 A;  3KEI A;  4H0W A;  3USD A;  2ZYO A;  4R74 A;  4C1U A;  4F22 A;  5KDT B;  1B1X A;  1NL5 A;  1NNK A;  4M1V A;  2V84 A;  1ZJL A;  5H8S A;  1XVX A;  2I0B A;  1LAX A;  2AL5 A;  4ZEF A;  4DLD A;  3PUV E;  3T9H B;  2ONK E;  4QFK A;  1AL3 A;  2ZYM A;  1O7T A;  2UYF A;  3EHU A;  3K6W A;  3MPL A;  3O6I A;  5BWJ A;  3VV5 A;  4NF5 B;  1HSE A;  4BDM A;  1B32 A;  4PFW A;  3FIR A;  4F39 A;  4PQJ A;  4O3C A;  5AE4 A;  4OFL A;  1MH4 A;  3RTF B;  2DVC A;  5I84 A;  1ZKB A;  1JEU A;  1MPD A;  2RIN A;  3VLW A;  1SI0 A;  1R9L A;  3EQ1 A;  1II5 A;  5DVI A;  1D9V A;  4ZEI A;  3DLN A;  3CFZ A;  2XXX A;  3T66 A;  2QSX A;  3KOS A;  4H5F A;  5CC2 A;  3MP6 A;  1UTH B;  2V3U A;  2DWI A;  3OEN A;  2XXI A;  4POX A;  4EQ9 A;  1POT A;  4THI A;  4GQO A;  2THI A;  4IY5 A;  4TLL B;  5CBS A;  5CMC A;  3VFJ A;  3N26 A;  3PV0 E;  4FED A;  4QSE A;  3T9V A;  2Y7K A;  1AIV A;  3F11 A;  1BP5 A;  1J1N A;  3IL1 B;  1H43 A;  3ECR A;  1SD3 A;  3TMG A;  4EXL A;  3TTM A;  4DCY A;  2R9J A;  4LQ2 A;  5A5X B;  4XIG Q;  1PDA A;  1S50 A;  2OWT A;  1LST A;  3H6T A;  2NXO A;  1ZTY A;  2A5S A;  1OVT A;  2NWJ A;  1OQG A;  1QKA A;  2WKY A;  3OSR A;  1MDP 1;  3C34 A;  4GIZ A;  5DVJ A;  3U1O A;  4P11 A;  1UTH A;  5CM6 A;  4YAH X;  4RYA A;  3TCF A;  1GTK A;  1NKX A;  3MJN A;  2UVJ A;  2V25 A;  1MRP A;  1O63 A;  3WAF A;  3TOD A;  4BDQ A;  3RT8 A;  3H6U A;  3RN8 A;  2XXQ A;  3G3K A;  4FJP A;  4R2B A;  1M5C A;  4FIM A;  4F1U A;  1Y1M A;  2REJ A;  1DTG A;  4H8I A;  1NH8 A;  4JDF A;  3FJ7 A;  4EUO A;  4Z0I A;  4TQU Q;  1ZMG A;  4NF8 B;  4N07 A;  4OET A;  1RYO A;  5TU0 A;  2CZL A;  4R6K A;  4ZED A;  4QFN A;  3LBS A;  3KOT A;  3QAX A;  1MQI A;  2OLB A;  3B6W A;  1XC1 A;  1MS7 A;  4Q5T A;  2GHA A;  3TYH A;  2H5Y A;  2AIX A;  3UA8 A;  4I62 A;  3C33 A;  4YZZ A;  1URD A;  3BFT A;  2O84 X;  3CR9 A;  3FVO A;  4XKQ A;  4DZ1 A;  3Q29 A;  3Q27 A;  4OFO A;  3OEK A;  3IR1 A;  3K01 A;  2OK2 A;  1A8E A;  4EQB A;  4F29 A;  1Y3Q A;  1GV8 A;  1IEJ A;  1YCJ A;  3RUM A;  4LAT A;  4NF8 A;  1I69 A;  1DTZ A;  1JW5 A;  2Y7W A;  4LON B;  1XHY A;  4GVO A;  4IO2 A;  5HBC A;  4HCY A;  5EHM A;  4BDL A;  3EN3 A;  1XT8 A;  1SDX A;  2ZNS A;  3H4Z A;  3K0V A;  3FJM A;  4H65 A;  1TXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...