3PGRA

Asp348arg mutant of ecfadl
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
424
structure length
376
Chain Sequence
AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSFKDAYRIALGTTYYYDDNWTFRTGIAFRDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
total genus 110
structure length 376
sequence length 424
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pgrA00
3PGRA 2R4PA 2R88A 3BRZA 3DWOX 3DWNA 2R4LA 1T1LA 3BRYA 3PF1A 3PGUA 2R4OA 3BS0A 3PGSA 2R89A 1T16A 2R4NA 2R8AA
chains in the Genus database with same CATH superfamily
2YPVA 4RJXA 3AAEA 4FSPA 3JTYA 5DL7A 4BUMX 4C4VA 4E1TA 5JDPA 3DA4A 1ZHYA 2F1VA 3POXA 4AFKA 4JCHA 3VY8X 3A0HO 2W80C 3JCUO 4C69X 3PORA 2MHLA 3AAAA 2O4VA 3AA7A 2N2LA 3EMNX 4K3CA 1QJPA 4Z3TA 2R89A 4GCSA 1GFNA 2N2MA 3SYBA 2Y0HA 2Y0KA 3K19A 2IWWA 3AA7B 2ERVA 3LK2B 4FZMA 1YS5A 3AAAB 5ADXK 4AYID 2KXPB 2WJQA 3O0EA 4LSFA 5PRNA 3AA1B 3BS0A 3WI4A 4D64A 2GE4A 3PQUA 4FMSA 5DL6A 1OPFA 1IZNB 4F4BA 8PRNA 4G75A 2KC0A 1HXXA 1MM5A 2JMMA 2KDYA 2XTQA 3AAEB 3A0BO 4XNLA 5G26A 5ADXL 3SZDA 2LHFA 2F1TA 2W81C 4AYMC 2FGRA 3FYXA 2PRNA 5TISO 4RLBA 1S5LO 3AA0A 4O49A 3HW9A 2J1NA 1T1LA 3DZMA 2F1CX 5DL5A 2WJRA 2YNKA 2KZ7B 1PRNA 3HOLA 3PGRA 2R88A 3VZWX 4GHBA 5IYUA 3T0SA 3LK41 3QRCA 1E54A 2M06A 4N58A 4RLCA 2J4UP 3LK3B 2R8AA 1BT9A 2KZ7A 2Y0LA 5GTIO 4N75A 4AYNA 3RBHA 2LFUA 5D5DA 1H6S1 3DA3A 4O3YA 4CTDA 4RL9A 3SY9A 3SZVA 3UAQA 4PJ0O 1BXWA 2K4TA 4G76A 3UU2A 3T24A 3BRZA 2ZLDA 3DWOX 2ODJA 1Q9GA 3DWNA 4LSHA 4B61A 1PHOA 2XE2A 2X9KA 5E79O 2WVPA 2Y7SA 1THQA 1QJ8A 2AXTO 4O3XB 1GFOA 6PRNA 1HXUA 3LK42 1IZNA 4E1SA 2FGQX 3T20A 7PRNA 4FQEA 5EE2A 3VZTX 4D5UA 2XE1A 3PGSA 5KAFO 4FRXA 4KR8A 1BH3A 3POUA 5DL8A 3POQA 3NJTA 2XMXA 3SY7A 2XE5A 5G38A 4D65A 3LK3A 4C4VB 1HXTA 2X27X 3AA1A 1ZHZA 2OMFA 2XE3A 4O3WA 5FVNA 5T5FA 4LSIA 4O4XA 1QJ9A 4FZLA 1ZHXA 1ZHTA 5G39A 2XG6A 3WU2O 4C00A 4UB6O 5G3AA 2R4OA 3AA6B 4KRAA 5GTHO 1OSMA 2Y2XA 1T16A 2R4LA 2ZFGA 4PR7A 3VY9X 4AYEC 3HOEA 2R4PA 4FRTA 4GCQA 2IWVA 2QTKA 2KXPA 4GF4A 4PUXA 3HWBA 1Q9FA 4FT6A 3LK2A 4AZLA 3VZUX 5B5EO 1MM4A 4U9CA 3PQSA 1GFPA 2PORA 4AKMA 3AA6A 5H2FO 1GFQA 4AYDC 4RJWA 4QQ1A 4O3ZA 3GP6A 4GCPA 3VE2A 1G90A 1P4TA 2K0LA 3NSGA 3PF1A 3WI5A 2JQYA 4FZNA 4XNKA 5B66O 3TZGA 1MPFA 3VE1A 4KR4A 3G7GA 4O4UA 3QRAA 2MNHA 5KAIO 3PRNA 2R4NA 3A2SX 4JFBA 2XTRA 2M07A 1GFMA 1ZHWA 3C5OA 4AKRA 5AFUK 4UB8O 3KZIO 3SYSA 4IL6O 4FSOA 4N59A 4N74A 4FESA 4FUVA 3KVDD 5GV0A 4LSEA 1ORMA 4FOZA 4AKRB 5AFUL 4AUIA 3AA0B 3BRYA 3PGUA 3V8UA 4K3BA 3UPGA
chains in the Genus database with same CATH topology
3PGRA 2R4PA 2R88A 3BRZA 3DWOX 3DWNA 2R4LA 1T1LA 3BRYA 3PF1A 3PGUA 2R4OA 3BS0A 3PGSA 2R89A 1T16A 2R4NA 2R8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGR A;  2R4P A;  2R88 A;  3BRZ A;  3DWO X;  3DWN A;  2R4L A;  1T1L A;  3BRY A;  3PF1 A;  3PGU A;  2R4O A;  3BS0 A;  3PGS A;  2R89 A;  1T16 A;  2R4N A;  2R8A A; 
#chains in the Genus database with same CATH topology
 2YPV A;  4RJX A;  3AAE A;  4FSP A;  3JTY A;  5DL7 A;  4BUM X;  4C4V A;  4E1T A;  5JDP A;  3DA4 A;  1ZHY A;  2F1V A;  3POX A;  4AFK A;  4JCH A;  3VY8 X;  3A0H O;  2W80 C;  3JCU O;  4C69 X;  3POR A;  2MHL A;  3AAA A;  2O4V A;  3AA7 A;  2N2L A;  3EMN X;  4K3C A;  1QJP A;  4Z3T A;  2R89 A;  4GCS A;  1GFN A;  2N2M A;  3SYB A;  2Y0H A;  2Y0K A;  3K19 A;  2IWW A;  3AA7 B;  2ERV A;  3LK2 B;  4FZM A;  1YS5 A;  3AAA B;  5ADX K;  4AYI D;  2KXP B;  2WJQ A;  3O0E A;  4LSF A;  5PRN A;  3AA1 B;  3BS0 A;  3WI4 A;  4D64 A;  2GE4 A;  3PQU A;  4FMS A;  5DL6 A;  1OPF A;  1IZN B;  4F4B A;  8PRN A;  4G75 A;  2KC0 A;  1HXX A;  1MM5 A;  2JMM A;  2KDY A;  2XTQ A;  3AAE B;  3A0B O;  4XNL A;  5G26 A;  5ADX L;  3SZD A;  2LHF A;  2F1T A;  2W81 C;  4AYM C;  2FGR A;  3FYX A;  2PRN A;  5TIS O;  4RLB A;  1S5L O;  3AA0 A;  4O49 A;  3HW9 A;  2J1N A;  1T1L A;  3DZM A;  2F1C X;  5DL5 A;  2WJR A;  2YNK A;  2KZ7 B;  1PRN A;  3HOL A;  3PGR A;  2R88 A;  3VZW X;  4GHB A;  5IYU A;  3T0S A;  3LK4 1;  3QRC A;  1E54 A;  2M06 A;  4N58 A;  4RLC A;  2J4U P;  3LK3 B;  2R8A A;  1BT9 A;  2KZ7 A;  2Y0L A;  5GTI O;  4N75 A;  4AYN A;  3RBH A;  2LFU A;  5D5D A;  1H6S 1;  3DA3 A;  4O3Y A;  4CTD A;  4RL9 A;  3SY9 A;  3SZV A;  3UAQ A;  4PJ0 O;  1BXW A;  2K4T A;  4G76 A;  3UU2 A;  3T24 A;  3BRZ A;  2ZLD A;  3DWO X;  2ODJ A;  1Q9G A;  3DWN A;  4LSH A;  4B61 A;  1PHO A;  2XE2 A;  2X9K A;  5E79 O;  2WVP A;  2Y7S A;  1THQ A;  1QJ8 A;  2AXT O;  4O3X B;  1GFO A;  6PRN A;  1HXU A;  3LK4 2;  1IZN A;  4E1S A;  2FGQ X;  3T20 A;  7PRN A;  4FQE A;  5EE2 A;  3VZT X;  4D5U A;  2XE1 A;  3PGS A;  5KAF O;  4FRX A;  4KR8 A;  1BH3 A;  3POU A;  5DL8 A;  3POQ A;  3NJT A;  2XMX A;  3SY7 A;  2XE5 A;  5G38 A;  4D65 A;  3LK3 A;  4C4V B;  1HXT A;  2X27 X;  3AA1 A;  1ZHZ A;  2OMF A;  2XE3 A;  4O3W A;  5FVN A;  5T5F A;  4LSI A;  4O4X A;  1QJ9 A;  4FZL A;  1ZHX A;  1ZHT A;  5G39 A;  2XG6 A;  3WU2 O;  4C00 A;  4UB6 O;  5G3A A;  2R4O A;  3AA6 B;  4KRA A;  5GTH O;  1OSM A;  2Y2X A;  1T16 A;  2R4L A;  2ZFG A;  4PR7 A;  3VY9 X;  4AYE C;  3HOE A;  2R4P A;  4FRT A;  4GCQ A;  2IWV A;  2QTK A;  2KXP A;  4GF4 A;  4PUX A;  3HWB A;  1Q9F A;  4FT6 A;  3LK2 A;  4AZL A;  3VZU X;  5B5E O;  1MM4 A;  4U9C A;  3PQS A;  1GFP A;  2POR A;  4AKM A;  3AA6 A;  5H2F O;  1GFQ A;  4AYD C;  4RJW A;  4QQ1 A;  4O3Z A;  3GP6 A;  4GCP A;  3VE2 A;  1G90 A;  1P4T A;  2K0L A;  3NSG A;  3PF1 A;  3WI5 A;  2JQY A;  4FZN A;  4XNK A;  5B66 O;  3TZG A;  1MPF A;  3VE1 A;  4KR4 A;  3G7G A;  4O4U A;  3QRA A;  2MNH A;  5KAI O;  3PRN A;  2R4N A;  3A2S X;  4JFB A;  2XTR A;  2M07 A;  1GFM A;  1ZHW A;  3C5O A;  4AKR A;  5AFU K;  4UB8 O;  3KZI O;  3SYS A;  4IL6 O;  4FSO A;  4N59 A;  4N74 A;  4FES A;  4FUV A;  3KVD D;  5GV0 A;  4LSE A;  1ORM A;  4FOZ A;  4AKR B;  5AFU L;  4AUI A;  3AA0 B;  3BRY A;  3PGU A;  3V8U A;  4K3B A;  3UPG A; 
#chains in the Genus database with same CATH homology
 3PGR A;  2R4P A;  2R88 A;  3BRZ A;  3DWO X;  3DWN A;  2R4L A;  1T1L A;  3BRY A;  3PF1 A;  3PGU A;  2R4O A;  3BS0 A;  3PGS A;  2R89 A;  1T16 A;  2R4N A;  2R8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...