3PGVA

Crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
259
Chain Sequence
b'YQVVASDLDGTLLSPDHFLTPYAKETLKLLTARGINFVFATGRHYIDVGQIRDNLGIRSYMITSNGARVHDSDGQQIFAHNLDRDIAADLFEIVRNDPKIVTNVYREDEWYMNRHRFFKEAVFNYKLYEPGELDPQGISKVFFTCEDHEHLLPLEQAMNARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKMLGYTLSDCIAFGDGMNDAEMLSMAGKGCIMANAHQRLKDLHPELEVIGSNADDAVPRYLRKLYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase (KPN_04322) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.39 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 80
structure length 259
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3pgvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pgvA01
2O2XA 4RESA 1Z4PX 3D6JA 4YIHA 4NV0A 3AR3A 1RQNA 1Q91A 2FUCA 2PR7A 5AK3A 5ALXA 3N1UA 4BEVA 1WPGA 3I76A 1RKUA 2FDRA 2IOFK 3BA6A 4G9BA 3AR2A 4GIBA 2EATA 3DNPA 3NAMA 2YMPA 3QLEA 1RMYA 4EX6A 3L8EA 1IWOA 5AKEA 2OM6A 3OCZA 1Z4OA 1EK2A 2JGAA 4YCNA 3ZX5A 1ZRMA 2HI0A 3HLTA 2ZBFA 1O08A 4UMEA 2ODAA 4UU1A 5AIAA 2G09A 4MWOA 2EARA 3ZVNA 4EENA 5AW6A 3L1UA 4C4SA 2Q4TA 3K1ZA 1YDFA 2WF8A 1SWWA 3ZUPA 1PW5A 1ZS9A 3PGVA 3OPXA 4BBJA 4F71A 4FYPA 3E81A 4QJBA 2CFRA 3KC2A 4I9GA 1L8LA 3WK8A 2HDOA 3ZI4A 5ALOA 3A1EA 4Y2PA 3L5KA 1Z4KA 4XPZA 1CQZA 3WKCA 1TJ4A 2BDUA 3WKDA 1JUDA 4BNDB 3SLRA 2PQ0A 2CFSA 3B8EA 3MPOA 2AH5A 1VJRA 1L7OA 2YJ6A 2YY6A 4Y2UA 1TJ5A 5AKGA 1NNLA 4NFLA 3SKYA 1L7PA 3PDWA 2IOFA 3MC1A 3AR8A 4KYTA 1T5SA 2VKQA 2D2VA 3ZWDA 4J2TA 3W5AA 4BKMA 3WKBA 3NUQA 4Y2XA 2GMWA 3NALA 4CF5A 2YJ4A 3EPRA 3SMVA 4KX3A 4QQFA 3CZ4A 3SF0A 3U7EB 3AR9A 2YJ5A 2W43A 4IFTA 3KBBA 5AICA 1RMTA 2P9JA 4EZEA 5AM2A 1RQLA 5AW8A 4UMDA 3R4CA 2HSZA 2ZBEA 3AR7A 1N9KA 1WZCA 5JJBA 2P69A 1TA0A 3E8MA 5AW2A 2Q4RA 3W5CA 2C4NA 3OCYA 3ZW7A 2JARA 1J8DA 2RBKA 2G08A 2HOQA 3ZX4A 4AP9A 2FUEA 2P11A 5AVSA 1L7MA 2MSNA 3P96A 2R8ZA 3KD3A 2HEGA 2MU1A 5E0OA 3S6JA 3L8HA 2ZBDA 3UMBA 4CE6A 5AI4A 3L0BA 1XVIA 3EF0A 1YMQA 3FPSA 4DWOA 5AVUA 2ZG6A 3L1VA 1U7OA 4KX5A 5IT4A 3EWIA 4AS2A 1VFPA 5AW9A 3CNHA 3UMCA 3VAYA 2B30A 3U7HB 4Y2RA 2G06A 5AM1A 4KN8A 5ALSA 2JAUA 1ZD5A 3I6BA 3QU4A 2C9MA 1L8OA 2YFYA 3J7TA 5AI8A 5AM5A 3MMZA 2JAWA 2NO4A 2B8JA 3ET5A 4UAVA 4L6AA 2FPRA 4AS3A 3KOOA 1Z4MA 2C88A 1S8OA 1ZD2P 3FPBA 5AVYA 3ESRA 5AESA 3QU2A 5ALRA 4XE5A 4FFDA 5ALKA 5AW5A 1YJ5A 2HHLA 2YJ3A 3L8GA 5ALIA 3FZQA 1WVIA 1X42A 4DCCA 3U7GA 5AVVA 5AKJA 4UATA 5A3RA 3QUBA 2AMYA 3IRUA 1TE2A 3BWVA 3WK9A 5ALPA 2I33A 5AKHA 2NO5A 4E88A 5AKKA 4HGOA 3OCXA 4Y2SA 5ALWA 5A3QA 2WHEA 1ZD3A 1RC8A 3EF1A 5AVQA 4CNQA 1MH9A 3NANA 5AM3A 2GHQA 4UMVA 4KNVA 5AVXA 5AKZA 3SD7A 2FI1A 4UM5A 4Y2QA 2WF9A 4I9FA 3WK5A 1U02A 2EAUA 3IB6A 3L8FA 2FEAA 4NWIA 1L7NA 3A1CA 5ALTA 3DDHA 2OYCA 3L0CA 4G63A 3WK4A 3TLMA 4O8CA 3QGMA 5ALFA 1EK1A 5AI0A 3B9RA 4DFDA 4HYTA 4CF3A 5T41A 2CFTA 3SKXA 4FE3A 3QUTA 3HYCA 4BNDA 2B1RA 4XOUA 4KNWA 3AR4A 2O9JA 2IA5A 2W11A 3A3YA 4PNHA 3L7YA 2B82A 2G07A 4Y2JA 1LVHA 1FEZA 3M9LA 4YGYA 2HCFA 1T9ZA 4Y3UA 3ZWKA 2R8XA 3ZVLA 2OA0A 1XPJA 1Y8AA 2HO4A 4L6CA 3PGLA 3ZTWA 3UMGA 3F9RA 3U13A 2B0CA 5IS2A 2R8EA 1YS9A 2WF7A 3FVVA 2ZXEA 4Y2YA 3ED5A 1RDFA 2YMLA 1J97A 5AI5A 4OCZA 3L0YA 5AK5A 2IOHA 4EX7A 5AW4A 5ALZA 1VJ5A 4NABA 1AQ6A 5AIBA 4ZEXA 1RPZA 2YBDA 1RLMA 2CN1A 2FPWA 3NIWA 1Q92A 5ALYA 3WKEA 1SU4A 5ALDA 2QYHA 2OBBA 4JDPA 2IYEA 2GHTA 1RLOA 4C4RA 4UMFA 1U2TA 4ZEWA 2QLTA 1TJ3A 4IG4A 2Q5EA 3KDPA 3R09A 5AKYA 4HGRA 3U19A 4J03A 4UARA 4RETA 4OHFA 4HGNA 3A1DA 1T5TA 1S2OA 2G80A 4YCMA 5AM0A 4OD0A 4BEWA 2BY4A 5ALHA 4OFZA 3N8GA 2HF2A 1YV9A 2GO7A 3E58A 4UASA 1KYTA 3QYPA 2R8YA 2HF7A 2ZOSA 1Z88A 3FM9A 4YCLA 1Z4NA 2B8EA 1WR8A 5IT0A 5AVTA 3WK6A 5AW3A 2FPXA 4HGPA 2DQSA 5ALUA 1NRWA 3MN1A 2G0AA 3B9BA 1K1EA 4H1WA 4EELA 3I28A 4XQ0A 5ALEA 5ALQA 3WK7A 2BDEA 4Y2TA 2RB5A 3SHQA 1U7PA 1XP5A 3ESQA 1QQ7A 5AVRA 1SWVA 2RAVA 2HX1A 3QNMA 4B6JA 1RLTA 5A3SA 2WF6A 4UW9A 3N5KA 3ZU6A 1Z5GA 4L57A 3E84A 2WFAA 3RFUA 3N07A 3M1YA 2YN4A 3ONNA 3QU5A 3ET4A 2YMMA 4BYGA 3W5BA 5AW7A 1QQ5A 3ZVMA 2AGVA 1RKQA 3W5DA 2P27A 5ALGA 4CF4A 2ZBGA 3QU7A 4YIKA 3WKAA 3U7FB 4JB3A 3DAOA 5ALJA 5AI6A 2GFHA 5AKIA 4EEKA 4NAVA 3WGUA 3QU9A 3GYGA 3OCWA 4BX0A 4ZEVA 1NF2A 1U2SA 5AK4A 5AKLA 2I6XA 3IJ5A 1ZOLA 1ZD4A 5AVWA 1Z4LA 2I34A 4MUMA 5FP0A 2W4MA 3QUQA 3ZTYA 1RKVA 3R9KA 1Z4QA 2I54A 1O03A 4GXTA 5AI9A 4YH1A 5ALNA 4HGQA 1ZJJA 1RMQA 4BX2A 2JAOA 3I1YA 2NYVA 3U26A 3OTQA 5AVZA 5AW0A 1CR6A 1L6RA 4UU0A 3QX7A 2I7DA 3NASA 2C8KA 3WGVA 2I55A 1LTQA 1Z4JA 5AHXA 2RARA 4Y2VA 1QH9A 1QQ6A 1YNSA 4BX3A 2FPSA 2C8LA 1F5SA 1Z4IA 3AR6A 3PCTA 1RRCA 4F72A 3RF6A 5AK6A 5ALMA 5AM4A 3NRJA 5AKXA 3OCVA 3QUCA 3QXGA 1ZRNA 2WF5A 2X4DA 2B1QA 3FGOA 4C4TA 1Z5UA 2FPUA 2YMQA 3OCUA 1N8NA 3KZXA 1QYIA 5ALLA 3AR5A 2WM8A 4UM7A 3UM9A 4UAUA 2PKEA 5AW1A 3N28A 5ALVA 2G1AA 4DW8A 3DV9A 4HAIA 2AUTA
chains in the Genus database with same CATH superfamily
2O2XA 4JLDA 1CEEA 1SJ9A 1R27A 4F5EA 1YJCA 1W9HA 2JVIA 1JMVA 2QR2A 4GBMA 4NV3A 3TOVA 1TCBA 2IU4A 4WSOA 2EQAA 2PR7A 4Q03A 4R2WA 1XIVA 5JD5A 3GJ3A 3M49A 1UFOA 5EXDA 1TAQA 2BGJA 1ONNA 3G02A 6GPBA 4ZQCB 3THXA 2P78A 4PRYA 1V7QA 4E5SA 8LDHA 2O59A 4HDRA 3TO5A 3DOUA 4JI5B 3UC9A 4H3VA 2OCYC 3DNPA 4PY2A 4BNYA 1HDEA 3QLEA 4O4IF 4JWTA 4OYLA 2IV3A 3MOIA 5AKEA 1QFSA 1LDYA 1G1MA 1KO1A 2OM6A 3A3KA 4GOOD 3UWMA 1TDJA 1XTBA 1L7RA 2BMEA 4ZJYA 2JGAA 1N8KA 3CTMA 4ZQGA 1A82A 1ZRMA 2YHBA 3TW8B 3CISA 4QVKA 5A3VA 3VOSA 3L77A 5EGSA 1NLZA 1M76A 1D7OA 2FPMA 4D25A 3I53A 3IUYA 5BSHA 1JKXA 3F9IA 3THYB 3KJEA 1SIUA 5K1ZA 5DPMA 4F4JA 4H60A 1P31A 2A9QA 1BO6A 3H16A 1G7TA 2OT3B 2CZGA 5K6AA 2XE7A 3WG9A 3ZWAA 2I2DA 5ECYA 3CE9A 2ZJ4A 1EHYA 4F1KA 1OX4B 3DMRA 4AI6A 4LTNA 2WILA 4R5HA 3CVJA 4D9IA 2C78A 3TMAA 3VTFA 4G25A 2QJOA 3QEMA 1CG6A 4X91A 3WA6A 5FTWA 4QJBA 3WGKA 3PZBA 2KLBA 3GGOA 3WHPA 4UEKA 3G0CA 4LV6A 3CWCA 3CC8A 3PVZA 3GFSA 1XFDA 1E79A 1NBMD 2JIBA 4S0XA 1W5BA 5FF9A 1T3GA 2QYSA 3IPRA 3DAFA 3WKCA 1MO4A 2UVDA 3NBKA 4JVMA 4IIYA 1JUDA 1L7VC 2QR3A 3KQMA 4G0XA 4R9UC 4FGZA 1Z17A 3GG9A 4LRXA 1CC1S 5HE8A 5A2GA 1RR6A 3F6BX 2QQGA 3DS8A 3KB2A 2IU0A 4K46A 3F74A 3SC4A 1FFSA 1OXXK 1PK7A 4YDRA 4F6CA 1DKLA 5DTEA 5BP7A 1J5XA 3EMBA 1L5KA 3F7MA 1G3RA 3FSRA 3GLFA 2GAFA 2ZJ2A 3JWGA 2ECFA 3JW8A 4UEWA 1TAUA 2IITA 4ZO4A 2Q5QA 4EA6A 2ZRFA 3PDWA 1W6RA 5G53C 5I47A 1GUBA 3B6KA 2XX3A 2XTAA 3MC1A 4LOJA 2D2VA 2YHIA 2GAAA 2RHGB 2Z5GA 3SF8B 5LYJB 3D6UA 1Z18A 2QRQA 3VUEA 1WPQA 2EV9A 1G2IA 4LHWA 1F3OA 2CVQA 3E6AA 2JD1A 3OLVA 5CFPA 1HQCA 2ZJAA 2YJ4A 3NALA 4MA0A 5JWOA 3MTGA 4C0KA 3LW8A 5DGDA 4ZV7A 5JZOA 1OFTA 3CZ4A 4LBZA 3SF0A 4BO5A 5CCBA 3DVAA 2KWIA 1OLXB 3HUFA 4ZOEA 1E9SA 2NUAB 2UYOA 3PL5A 1S1CA 4F8EA 1UZMA 1DV2A 3UW3A 4AJ2A 2HA3A 3HY6A 2X42A 4E1VA 1Y7LA 2CJYA 3JQFA 3SS7X 3R4CA 2WFLA 4QAJA 3FCUB 5AXAA 4ZHSA 5IH7A 1WZCA 5IU6A 4CGZA 3TRHA 1RIIA 5KPDA 1OAOA 2OFFA 2O7VA 4H59A 4BC1A 4XCQA 4ZOLA 2RHJA 2PWBA 3W7AA 3TCXB 4MWSA 3UCEA 1QDEA 4DJAA 2J4CA 3BSWA 1XK7A 2UU9B 3G5LA 2HF8A 3DMGA 1Z2NX 2HOQA 1BXGA 3ZX4A 3D0KA 3IVRA 1A2OA 5AVSA 1DT3A 5EL0A 1SCNE 1KQOA 2Z2ZA 3P96A 3WADA 2BDTA 1Q0QA 2XUOA 1I5EA 1KDPA 3AKYA 1Y80A 1OVGA 3E0QA 3HFSA 4ZT6A 5EY5B 3CX6A 2HMAA 2HU8A 3DTVA 2JI4A 4MQEB 4ENSA 4D74A 2Z58A 1EVKA 3L0ZA 3VVLA 2PUAA 2P9TA 2ZTVA 4RMNA 3VGJA 5HQTA 2X0JA 3B52X 2ZAYA 5ADUS 1VYTA 2J3JA 3AZOA 4UJ5A 2VJDA 2I71A 2Y93A 3JTMA 5G3ZA 3U6KA 1OKKD 1XXHE 3GZNA 1E32A 3OTOB 2IZ0A 4TKVB 1IOWA 1NFQA 3H11B 5FV7A 4QG3A 1CF4A 1HUQA 4X20B 1XD2B 5IYZF 1R6VA 4W5WA 5JEEA 4DWJA 3DE6X 1I24A 1LNSA 1J2UA 1H1LB 4KPGA 1VLZA 3HS3A 3CNHA 3OICA 2J3MA 4MMZB 4RVHA 4BASA 1GCOA 2ZYAA 4I1RA 4UXHA 4WVLA 2G06A 1ZJZA 3I01A 4TKUA 3O8LA 4REQB 4CL3A 4PZEA 2NVBA 1M2KA 1NM5C 2X8LA 1SCBA 1GZSA 1RWMA 2VOJA 2W71A 4JVNA 3MWGA 2X9NA 4P3KA 4PHHA 5AM5A 5EMHA 2EZTA 2PT5A 5HVNA 4MKXA 3TX2A 2FW9A 2H1CA 1L5HB 2FPRA 3T0GA 3EQ8A 1EFVA 4CM4A 3FLEA 4DZTA 5BYKA 2FR8C 1ZOPA 3GJ5A 2OXCA 4HH1A 4HWPA 2H48A 2W2KA 1DUVG 1EGHA 4FYWA 3WLPA 4HZUA 5KNCH 4K8RB 1XU7A 1OAAA 3CONA 3PPXA 4YXFA 3I64A 3L4SO 1GADO 2C1ZA 1JPVA 1VIDA 3NIGB 5CD1A 4PGHA 4L76A 3V1KA 3D4NA 4W1RA 6YASA 1SVLA 1JEQA 3OE7A 5E6UB 4QDKA 2VPQA 2Z4RA 2HEIA 3D4PA 4CT5A 3EY4A 3MMNA 4ENWA 4A5OA 4DXAA 1ISPA 3RODA 1G8MA 3QW2A 1A4XA 4WOBA 2AOUA 2E18A 4K9MA 4JEUA 1FU7A 4WK2B 5CHEA 3ROTA 3JX9A 3F2VA 3HDHA 1USIA 3MW8A 1H22A 3BWVA 5BNWA 5E9WA 1TJYA 2OCAA 2DQ4A 3K5IA 5LL6P 2YHSA 3O1HB 1WCYA 2O0MA 3CLVA 1FUKA 3H0EA 1PVVA 3TUZC 5F2NA 3TFOA 2XSZA 1PUJA 1Q12A 5A04A 2QMHA 4F3KA 1REQA 5CFNA 3B8HA 1GUAA 2J3EA 2QW8A 4F21A 3BFXA 5L9AA 4R6WA 2OAP1 4U2DA 4WAUA 3WB1A 4BECA 1Y7IA 4JT8A 1JHMA 4X63A 2C2BA 2X8WA 4UMVA 2AKEA 4UM5A 4L75A 3D5TA 1P2SA 3R7BA 3QH4A 3UNXA 3MGKA 2QAGC 2Z04A 5E9JA 4BGUA 3K96A 3J81A 3K9CA 1ENYA 1ZK3A 1DWQA 2CKDA 1V11A 4RJIA 3SX2A 2PYDA 4BV9A 1TT5B 2TMKA 1F4VA 1C9YA 2GSWA 4DV2B 2ZI3A 3Q2OA 3WK4A 2C42A 4NECA 2GJAA 2O5CA 5LIPA 2ARKA 5DE3A 2Z5VA 3GJQA 4PU0A 1DX6A 1W1UA 2IYOA 3RTBA 2C54A 3AF4A 4YUWA 2VTEA 1XVTA 1Y3FE 4X93A 1L3IA 1YE8A 2QS9A 2PU7A 4KDCA 4TT3A 2OXFA 5HG0A 1QFXA 5LBTA 4Q1EA 2O20A 5LA6A 3FWPA 3T9AA 3NLLA 2B1RA 4DIDA 4DDMA 1XEWX 1BIFA 4CQLB 4D3DA 5TY0A 1NBWB 1JT9A 3GDOA 5JANA 3JAMA 1W7AA 1YCFA 3UJNA 4F9FA 5F73A 4WINA 3ML1A 4NOLA 4X8LA 2APJA 1BS9A 5FYQA 2YYZA 4JJFA 1XQXA 3NWPA 4M0PA 1AKUA 2YV5A 4MWZA 5K4AA 4LFCB 4C04A 4DEXA 1F2VA 3HGMA 4JOCA 3VR3D 3IUMA 1XA3A 1V3VA 2C92A 3DWFA 3O4HA 4HPWA 1VZ3A 3U13A 3VKWA 5HWSA 2R2AA 1QIGA 1Z6AA 4G26A 3MD9A 2DFLA 3DE3X 1MU0A 4LDRA 3PTAA 1FVOA 2QX8A 3CNNA 2Q3FA 1FOEB 5JEDA 4GL2A 4MV8A 1YJAA 4AQ7A 1Z0UA 2H85A 4DWVA 1ZESA 5K05A 4F3TA 4GMKA 3TRFA 4NYIQ 4CM6A 3UENA 2VQFB 3OT1B 4AKTA 1SGWA 4WCFC 4EX7A 1ZO8A 4LIPD 5F78A 4M49A 5E1DA 2R6CA 1VSVA 2B2NA 2D62A 5LP6B 4UHBA 2WWYA 2JLCA 3P2EA 1TL7C 4PFQA 5CJJA 5EXSA 3RSLA 1P5ZB 5IUJC 3IV9A 3U44B 4OB7A 2YBDA 3TEMA 3ZYZA 3FTEA 5HX7A 1Z2PX 5BMVF 1Y9DA 3H1GA 5BV7A 3ZWXA 4JDPA 2IYEA 4EH1A 5ANRB 1C5KA 3TKAA 4HI0E 2IHTA 2R4UA 1TVKA 2WYVA 1PGQA 3OTHA 3FXAA 1P2GA 3P26A 4RF5A 2ZGVA 4PZDA 3RASA 4A6EA 1AD2A 2QLTA 4YV0A 3BL5A 1CX9B 3OZBA 2WSSA 1KI7A 3BXGA 4CTNA 4ZCIA 4QM7A 3W4KA 5IF9A 4J03A 1PBNA 2SECE 4CDGA 1RC0A 1YS7A 3ICOA 3A70A 4UHCA 4NZMA 1EFHA 4DR6B 2VP9A 1T5TA 4I3GA 4MGKR 4S24A 4B4DA 2ZSKA 3V8BA 4ZCTA 2Z09A 3FDXA 4XUGB 5JYDA 1E8NA 4NATA 2RGYA 5EJ5A 3GEBA 2BY4A 4YAGA 3H0KA 4XX0A 1VIYA 5DJ5A 3A6EA 4G1MB 5K3OA 2ONYA 3DMDA 1WPXA 1K92A 3KLPX 3KQOA 2XMBA 5FYDA 5DYYA 2HF7A 2VXYA 5CVJA 1Z4NA 3L6CA 1M7GA 3G6KA 2AUMA 2DE0X 3CCBA 3JARA 5AJUA 3GRUA 3M2PA 2ATEA 2Y1OA 4TL9A 3WK6A 2QTZA 1P2DA 4F3CA 1KSGA 4BVGA 5GONB 5A7HA 2RKWA 3K09A 2DFKB 2OLEA 1J9EA 3GFVA 1ZQ9A 3FWKA 5D2CA 2Y66A 3GLHB 1GZVA 3ZVKA 4F84A 2AQHA 4BOYA 5CW2A 3PPVA 2O8VA 2OOKA 2HV8A 2JEYA 4KI7A 4YTEA 4BN0A 5DYIA 2FEWB 3IAFA 3DVSX 3LSTA 2BF7A 1TYCA 4FPXA 2QENA 2Z2IA 2P6OA 2QVYX 2NQTA 3L05A 2WV9A 1T9BA 3H1TA 1Y8QB 4UNPA 4L51A 2WFAA 3WGTA 1ZGZA 3HL0A 4K2HA 4DNFA 2C3OA 3E3OA 4RTLA 2YMMA 3CU5A 1CP3A 1O2DA 4ZQEA 3W5BA 1IZZA 1H2EA 3F7TA 3H19A 1Q7CA 3VU9A 4RLQA 2XVXA 3BOSA 1H2RS 2GFQA 3EIOA 3ZVMA 1NQUA 4CLOB 1HRDA 1RRVA 1YVRA 2P5SA 3K05A 1ORHA 4GPEA 1S3FA 4NCNA 8GPBA 3ZXYA 5FAKA 2CK3D 3D8HA 3VNSA 1ARZA 3QIAA 1KYIA 1H6AA 2WDPA 1IWPB 2RHTA 4DG5A 1NAIA 1JYEA 4JC4A 3KVNA 3L6UA 1P8AA 5AKIA 4Z0PA 3I42A 1JIVA 5LMZA 1M6YA 1SG9A 3LSYA 3PK0A 3O8OA 1BROA 4FC6A 4QDZA 5JBQA 5FX2A 1F9AA 3WR5A 2JFYA 2O8BB 2ONZA 2VXCA 4PCUA 1QHGA 3DHNA 5AK4A 3CX3A 4O3FA 3TW4A 1V6AA 3GR6A 2YW2A 3VKUA 3AVUA 2NO1A 1KS9A 3KTFA 5DTJA 3H7AA 4IAOA 3FVRA 5LOVB 4GDFA 2A86A 2CHFA 3QMVA 4Q5IA 4QUDA 3RWMB 1OXTA 4KRGA 1ZCBA 3RC9A 3WQSB 1NW4A 2HT6A 5A1TA 4TV8B 3MQ4A 1AV7A 4NOKA 1SHLA 2G28A 1EZ1A 5T4FA 3RSZA 2FEPA 1IBCA 1MC1A 3DBIA 3IP9A 3MXOA 3VBCA 3VR6A 1R2QA 4IIVA 5K51A 4C7OA 4YDHB 4UM9D 1PU2A 3FUXA 1EH5A 2Q3DA 3KYJB 5I4BA 1MW9X 3U4AA 4B80A 4HDSA 4I2VA 3VR2A 1T9DA 4AN0A 1T9KA 1MIOA 5A6SA 4F86A 1DHTA 1UKYA 4BNJA 2M1XA 3GY0A 1GPUA 3BWDD 1MA0A 1Z37A 1EWTA 3FI0A 5FEUA 4KR2A 2O54A 2Z1NA 4KQXA 4ZI7F 3TIIA 2QOEA 4ZOCA 2K7ZA 3UV3A 5AOBA 3R4VA 4K0KB 2ZUBA 3EUEA 3AVYA 4CODB 4CKEB 3T54A 2FXIA 5D5PA 1YUBA 3OE1A 1OGJA 1P17A 1RXEA 3ABZA 3GCXA 1EVEA 1F0KA 1YQTA 1OFIA 1RBMA 3PCTA 4UQOA 4ABYA 1A2KC 3GLGB 1YVPA 1U0RA 3SQNA 3ZHTA 1L5VA 5ALMA 1XEXB 3QTTA 2FSUA 3AB7A 4JDUA 1GU7A 5G0SA 3EB9A 4R8MA 3ILYA 4M98A 5JFOA 2PWAA 4ZT3A 3VSEA 3W34A 3H65A 2E21A 4GD3Q 4EKYA 3S3TA 2EERA 2BFFA 1RZRA 2HBRA 1HEUA 2AF4C 2WI8A 3LECA 2XT0A 1QGDA 2PGDA 2X9GA 2G77B 4X3PA 5GTDA 1XR3A 3P2IA 4K88A 5HDQA 2R1ZA 3ADDA 1YRLA 4I5EA 3TG8A 3KEFA 5FOXA 3AW9A 5SYMA 1EQ2A 3T1QA 1C4OA 4QXQA 1HOTA 2VHCA 2CJXA 1Z7WA 2PLNA 2PLRA 4Z4HA 4UAUA 4FKBA 1XKXA 2O23A 3A3NA 1FJ2A 1FPMA 1RI1A 3PQFA 4H3SA 3C6ZA 3GW8A 4WLFA 2DX7A 2YQZA 1POWA 3O2JA 4OK6A 3BGVA 4ZHQF 4YQEA 4R1PA 1IHOA 1MNQA 1M1UA 2HT1A 2FZVA 1HTWA 4X8HA 1POXA 2PANA 3WY9A 2JGLA 3F5MA 4E5PA 5F1YA 1G0OA 3AESA 3OKFA 3VPBA 2V7BA 3Q6NA 2FW1A 5LDDC 2H2DA 2XLCA 3PIRA 4R1LA 4YUYA 1PJRA 3FN4A 5KWVA 1FP2A 1WW8A 1RMYA 1YS4A 4NYJQ 5LYYA 4MS3A 1A8IA 2CD7A 4CM3A 2YR0A 3B6IA 4UPDA 4PNPA 4YI3A 5B1SA 5CIQA 1Z75A 3KQYA 2J9RA 2WT9A 1YZNA 3VU1A 4F3YA 1AC5A 3QEKA 4B7AA 4Q1DA 4RE6A 4TL7A 2JCYA 3GZJA 2ZTMA 3Q8KA 1U9IC 4LNHA 3TJZA 4OHUA 2F1IA 1O9GA 3F90A 1V48A 3R74A 3DR3A 2H4YA 1Q1GA 3CRW1 4PC3A 2R66A 1ECPA 1IHPA 3TINA 2EKBA 3TSZA 3ZCXA 3K0CC 2Q3HA 1IZ8A 2XYVA 4XZ3A 3CZCA 2QQFA 4IWXA 5G3YA 2WAYA 1H2FA 2F9FA 4IMJB 1W52X 3NGLA 3GG2A 2V7XA 4JQYA 1ZHHA 3VTKA 3O0DA 4FOOA 1HA3A 3NDBB 5ELLA 3I5YA 3CKYA 1IXRC 2HIAA 3Q12A 4H7JA 3PUKA 1L8LA 4Z1OA 1Y3CE 4M1KA 3ZI4A 2CL6X 4QNMA 2TMDA 4F4FA 4G0WA 4JSRA 4XIJA 1DLIA 1PEKE 1OA0A 1Q7EA 1CZRA 3UMFA 3T15A 1K7YA 2QMEA 5CLHA 1DO0A 2DUWA 3KSBC 3W8EA 2X4GA 3LHIA 3MCTA 4AS1A 3NKFA 4WVFA 3TW0A 1W4RA 3ETLA 3FW1A 1NN1A 1BHO1 1UAGA 1CJBA 2YY7A 3HJNA 3OIUA 3F73A 1YS1X 3B8EA 1OX4A 1JAYA 3DEKA 3VZDA 2CCKA 1BQ4A 4Z2AA 2PCLA 2OXRA 2YJ6A 1LLDA 2PQ2A 2W00A 5L3RA 5B2FA 1C3VA 1FW8A 1HSZA 3GGPA 2B9VA 3KR0A 4ANFA 3U1BA 3OKPA 4Y6LA 1GGKA 1U11A 4BFVA 2PBFA 1GNVA 1I4WA 2X2FA 4AZ0B 2FPKA 4RL4A 4NFLA 1L4NA 3ABOB 1ISIA 5EG5A 2ZRPA 4E2FA 1L7PA 4DYHA 1DAKA 1G38A 2GLTA 1YHNA 2GPNA 3WSTA 1TJNA 1NXOA 1GEGA 1T5SA 1P0MA 3ZWDA 4ZI5A 1G3UA 2LCFA 2QN8A 4BQOA 3WKBA 2G83A 1GPMA 2O2EA 3W3AD 4N5IX 2JCSA 1E6MA 2YYSA 4EGSA 3ZLTA 4DM4A 1AKNA 5B4VA 4NBKA 3HDJA 1NXSA 3K35A 1PL0A 4DXHA 2YJGA 2ORED 3M4NA 2JLVA 1JFFB 3DDOA 5IDXA 2A7QA 1SHUX 5AICA 3KJIA 1WULS 3JQAD 4KFUA 3HEBA 1L7BA 4KIGA 1RZUA 1EQUA 3OC6A 1SG6A 1Z0IA 3PYXA 3Q72A 4GGPA 4ISBA 2ZYUX 4M6WB 1UJMA 3DNMA 1UM9B 3Q85A 4IRUB 2OBLA 1A9OA 1QIMA 3OUUA 5DVZA 3VFDA 2GVZC 2I67A 3MFYA 1QANA 1TGYA 5LYJA 4FDVA 1NPTO 2HHAA 1MV8A 3EQZA 4IFBA 1ZCAA 1F14A 1QVVA 2WYHA 2Q99A 3F1KA 2HO5A 1I7QB 5KWJA 5LZ9A 4QIHA 1QJ4A 1RADA 5CXXA 2DM6A 3QK7A 4M9SA 2IYQA 2C5BA 1OLXA 1GL3A 4G0UA 1M1ZA 1QTRA 2QDKA 2A1IA 4U7JA 1KZ1A 5F1PA 2AYYA 3ETCA 4O2AF 2YXDA 4FFRA 4A92A 3N0RA 1AK1A 3IP3A 3MA0A 3NFRA 3W5JA 5IXSA 4DNPA 3SCZA 3EZ2A 3N8KA 3TLCA 3WAKA 5I3ZA 5FBWB 3C6KA 2BFCA 4H7DA 2G9NA 4NQZA 1QIKA 3I01M 4EVSA 4I5IA 3QSYA 2ERXA 2FSVA 3R6LA 1QIHA 4QDUA 5ENZA 3LCCA 2NYRA 1EDEA 2ODTX 1I5RA 1DL5A 3IUJA 4GMFA 1OHHD 4IXMA 3QVMA 2YZKA 1AQNA 1T1EA 4NBSA 4ZVUA 3OCJA 3DV0A 1K08A 1E9RA 2DUMA 3TD6A 3X43A 2UYYA 3R8XA 5EJ4A 2VHVA 4F4IA 3ROKA 4YV2A 3V80A 3QG1A 1NZDA 2Q5IA 3I6BA 3GJRA 4EHLA 4IUCS 1B4DA 3ULKA 5BN1A 4LCEA 2OGUA 2BMVA 3E03A 2FK7A 5FUWA 2XUHA 1XQ6A 4EPYA 3IVCA 2NUTB 4KPFC 5HKAA 1E7QA 1CNEA 2GK3A 3T5TA 3DDNA 1B8PA 3CVWA 4Q7LA 1CUZA 1XD2A 3LOUA 2O19A 4MW4A 4KAXA 2Q46A 4WXRA 5DHTA 3TRDA 1SXQA 4V2UA 2EZ9A 3LOPA 5D6OA 1H1LA 1SCQA 1R50A 1A7KA 1U28C 4Q4LA 4QPNA 2V7GA 1FX1A 2P4SA 4PV7A 4TLLB 1BDMA 5IUNC 5HS6A 3ONFA 2R3SA 4UNNA 5EMNA 2HQRA 2P2SA 4MVJE 1BE0A 3PIIA 5HK8A 3I2GA 1J70A 1N6PA 3D4BA 4WMLA 2I8LA 4AJLA 5BWNA 5DO9A 2H9AA 1MDFA 3HV0A 4UATA 4XLLA 3R9XB 3DFMA 2EBHX 2D4AA 2AMYA 1IUPA 2CLFB 2O48X 2PWYA 3QP9A 1KAMA 2F3RA 3CEJA 4HB0A 4UAJA 3SVZA 1E0JA 1R0KA 3FKSD 1E66A 2WJ3A 1ONPA 4GH5A 1IQPA 5CUQA 2WHQA 3REQB 3S70A 3IAS1 3HWRA 2I33A 3EGDA 3THRA 4JI6B 4E14A 2OFPA 1AS0A 4TROA 4JA2A 2LGJA 2NVUB 2I3AA 1Y81A 3BIJA 4PE5B 1U2EA 2QRVB 2CV1A 1H2ZA 4HAOA 4D8XA 3G0BA 1SAYA 2GHQA 2B3DA 3PRYA 4LBYA 5IVKA 3SICE 5JTTA 5D3MB 1EINA 3B5EA 1I0IA 4FN4A 1E18A 3ACCA 3OY7A 4H1HA 4LZZA 4C43A 4OAPA 5I7VA 4KRFA 1DAOA 2EAUA 2GCPA 2ZE5A 1PZMA 3FRHA 2ID8A 4HG2A 4KN5A 2PXHA 2NZXA 3QE3A 1EUCB 5HGXA 2IYWA 3ONWA 1WSWA 3KFXA 1GTL1 2FF7A 4K6GA 4BHTA 1B1CA 1DG3A 3GJ0A 3OETA 4O8CA 1H6DA 3MCUA 3BWXA 1MF7A 1GFWA 2VRCA 3B9RA 4G5SA 3PHJA 4HOYA 4AMVA 5IZCA 4O2BA 3DOFA 4YV1A 1J90A 4GI2A 3E9YA 3C45A 1NX6A 4IRXA 1FDIA 4QQ8A 2UXCB 1XZJA 2XUPA 2QJFA 1D3AA 2DPYA 4IG9A 5K0CA 2C4HA 4WKCA 4MKRA 2DH6A 5FD8A 3Q2KA 1YF3A 4FZJA 1PBTA 3GP5A 2OXTA 3A3YA 1QXSA 3OO0A 1ZR4A 2FW7A 3F46A 1E0DA 1FYVA 1AM4D 1U5AA 1N2IA 4XVQA 4GYWA 3SYTA 3VOBA 4R0NA 5C1OA 1IXYA 1XZEA 1WKCA 4Z4GA 1NWCA 3PA8A 4LF6B 1QAQA 4UEQA 3ER6A 2DR2A 1BWRA 3KTAB 4GECA 1H2WA 3G0GA 3NJ4A 3OJOA 3DLTA 3QOXA 1JWBB 3CUSA 1JHRA 1MEOA 2O7NA 2QIPA 3D2AA 3F4BA 1RCTE 3KSRA 3QM1A 2JA2A 1KDOA 2H2FA 4HQ0A 2XY4A 4RA6A 4N18A 5I9TA 2WF7A 3D2CA 4U6QA 1UBKS 2VA8A 1JU9A 4Y2YA 5FFFA 3HEAA 4LFAB 4U2EA 1RAIA 4XDHA 3QMWA 5DCYA 3IV6A 5K4GA 3TSCA 3RAPR 3HVUA 3BK1A 3D4LA 3BX1A 1YUNA 5AK5A 5F7JA 4D0RA 1TQ2A 2Y9MB 4Y0VA 4ITVA 1AB5A 3OE5A 3D8NA 1A76A 1U0NA 1TCVA 3DP9A 4CWAA 1FVHA 1BHQ1 3CY6A 3K0FB 1LBEA 1GUDA 1AVTA 1XCOA 4BWGA 3IAEA 5F64A 2FR1A 2C5FA 2QVBA 3FCEA 1NE7A 4EYOA 1UMBA 3BL8A 2AFVA 1J0CA 1FBNA 1HFKA 1Q74A 3RFCA 3DZCA 5FBLB 4NBNA 1ADFA 4ZMRA 4PFJA 2X19A 4K9RA 5JQGA 2HLDD 4AO7A 3FHOA 2ID9A 4WEQA 2JGDB 3MWDB 4ZN6A 2WPDA 3OT1A 5F12A 3U49A 4EA7A 4ND6A 4KZPA 1M6WA 1KDRA 4PIVA 1I2BA 1S5PA 1CQJB 1E9VA 1EFPA 1GARA 1OPRA 2W48A 2A9JA 4OHFA 4L3WA 1IHYA 1M8FA 2L2QA 5LP6A 4HGNA 2C9OA 2EL9A 4GZ6A 3SN6A 1OBFO 2G8NA 3L7CA 5DI3A 3AB8A 4C14A 4JJKA 3CNQS 1TTHA 2YUTA 4YCMA 3U44A 2P67A 3KK0A 2A3RA 1UZAA 4Z7QB 3CH4B 3LGSA 4BLRA 3SR3A 4J29A 4WE3A 4X1OA 4TSKA 1ZL0A 2V8OA 3E58A 4HQKA 1DZ3A 3DONA 1O58A 1K7FB 1JDVA 3KYCB 5K3CA 4YCLA 1WUHS 5L4LA 1JHYA 3OLXA 5DGTA 3BMCB 4OPMA 1V6CA 3PQ3A 4HDKB 1E9AA 4GVLA 2ZUEA 1T4CA 1HE8B 4RZUA 3ENZA 4HGPA 1K5DA 5IVIA 3RNLA 4DPMA 3TCNA 1TKRA 3ABIA 1KGDA 3RUPA 4KO3S 3ZEAA 1XVUA 1N77A 2BBTA 4JLOA 5B53A 1N5LA 1VYHA 1O97D 4D82A 4JLMA 2XQVA 3SHQA 2F4VB 4QICA 1QM5A 4WK4B 3CIOA 4JI7B 1CR0A 1BWPA 1WDKA 2O2HA 4MRAA 3N2ZB 4UXIA 1E1NA 5A4MS 4D7AA 2XQGA 4KIWA 1ZSYA 4V0MA 4YRRA 3ZDQA 5JC8A 2IS2A 5KNLA 3CSUA 3FVWA 3RFUA 1QAMA 1FP4B 3LIPA 4O29A 1GA6A 4I4LA 3HB9A 3F1LA 1BG6A 2GK4A 1U1DA 3R3ZA 3S8EA 2J9GA 3FOEC 5AW7A 3ROXA 4FFSA 4KDRA 1ZSVA 1HO3A 4FYJA 4ZVKA 2G7MC 3T95A 2IH5A 3GLHA 4PZ0A 2CVFA 3OQPA 4WESB 2CEKA 2JC3A 4Y9DA 1IHXA 3NAZA 4HEQA 2IJGX 1W1IA 2A0KA 3N3BC 4N9QA 3QU7A 1N5IA 1N9GB 3WKAA 3K70D 4AL4A 4GI3A 3CWZA 2R8RA 1I7NA 3IHKA 5ALJA 1N75A 5AI6A 3W77A 3SIRA 4EEKA 1XCPA 4R0VA 1STOA 2W2NA 4YR7A 4ID9A 3WGUA 4NAHA 3RS5A 3WI7A 1Y8QA 3EGXB 2JANA 4IJQA 5K3BA 3D8RA 2BELA 4UTXA 1OB2A 1Y4SA 5DKFA 4WZBA 4NICA 1BJTA 3H9GA 3FYUC 4D4KA 1ZJ5A 3WLSA 5FI5A 3ED1A 4LF8B 2YJTD 3CEPB 4C1BA 5DZSA 4ALNA 1PSDA 3MVEA 4OQEA 4CLOA 2X8JB 2BHTA 1A9TA 3OF5A 5M34A 2I54A 2OHIA 1XKQA 1AZTA 3GRRA 5DW3A 4QRDA 1X1SA 1ZEJA 3ASUA 3V42A 1NNUA 5C8YB 2DBYA 5K8JB 4P7BA 3NTXA 4DV7B 1IG3A 3EC1A 3NRBA 2FUG1 1NR5A 1VXOA 1QR6A 3I6ZA 4CL8A 1BRTA 1JR3E 3EDYA 1KZYC 5GZ3A 3MD0A 1DEKA 2OPHA 1YU6A 1GNQA 3SOPA 1Z73A 2I3GA 1GTMA 3D6TB 1JQKA 3QMPA 2PGOA 5TSDA 4IHAA 1PR1A 3N7AA 1SHKA 2FOLA 4KJXA 5TVKA 1FC0A 5KOHB 4OI0A 3EIXA 2HM7A 3Q3IA 3WL6A 4Y98A 2CY0A 4PSCA 4DEYA 2Z6VA 3HCCA 3W7VA 2BKAA 5CLLA 1JRLA 5CDSA 1N2OA 1TM7E 3GVPA 4K1XA 4DQDA 4E22A 4RK7A 1AZSC 1HZZC 3RM3A 1IJKA 5AUNB 1X2BA 1Q0ZA 5CA0A 2DQKA 2JLSA 1QK3A 3B82A 2QG9A 3AIOA 3STVA 3ZV3A 3FROA 4W5TA 2VAWA 4TMYA 1B7GO 4QECA 5TC4A 2N3ZA 2GXQA 4YJFB 2NW6A 3RU9A 3VJLA 4YA6A 3ZI0A 1JSLA 3ASZA 3L43A 4EI7A 1J25A 3P20A 2Q28A 2CXNA 5I4CA 2XOXA 1JIXA 4QVGA 2QPOA 1O94D 2CKMA 5CURA 4DN6A 4EHNA 2CT8A 4DBLC 6PFKA 2BFPA 3FMVA 1ACMA 1IEWA 3T3NA 1D9XA 1DUIA 3ANLA 1NVEA 3HUDA 1RAFA 4UM7A 1ISRA 1BU8A 3WDLA 1WMBA 3HZOA 4GPIB 4XGNA 1FNSA 4LAFA 1IVNA 2A59A 2WM2A 1ESZA 5EWJA 4ZIRB 2G0NA 4HAIA 1XEXA 1OREA 1SY7A 2AJ8A 2O7RA 3HP1A 5B1YA 2V7QD 2VHWA 1X19A 3EIEA 2VZ9A 1XNJA 1YL7A 2VZLA 5K5EA 5KYXB 3PXEA 4IUDS 4MDHA 3U9SA 3LQKA 3WRXC 1ML3A 3D6VA 3KLNA 1YZ3A 1UKEA 2Y92A 3PZRA 4TQUS 2ZEJA 2GHRA 3LYAA 1FUUA 2QUZA 1ORTA 3Q3HA 2PG3A 3CFYA 3P52A 5EIXA 2W6IA 2WQZA 2EATA 1L5WA 2GYYA 2IXEA 3DW3X 1DFHA 3KUUA 3PD0A 5A2QA 4N0PA 3WLQA 3V7NA 3QOYA 3NHWA 3VZRA 3DBLA 1JGTA 4DF3A 1V6SA 1G5TA 1PFQA 2IE0A 1ZUHA 1NNSA 4WV3A 3SSNA 4BLPA 4KK4A 1OMOA 3C6QA 5GOTA 5K03A 4EHDA 2VT6A 1LRKA 2H0RA 1GOTA 2ZSFA 1EEHA 3DL2A 2MOKA 3DVRX 3G79A 4S1OA 1WQ4A 2J0VA 4DR7B 2IS6A 4Q21A 1YU9A 1VHTA 1F6BA 4I4TB 4IHJF 4AD8A 4MVXA 4OGGA 1QG6A 4XDGA 4RAOA 4C20A 2QL7A 4F5DA 2BSAA 4I81A 1TQ6A 3JQ7B 3HP4A 2FMHA 3HU5A 3TE6A 1B6SA 2WU8A 4MP6A 4CIWA 1R9JA 2A5JA 4W9MC 4QJIA 2BTOA 3IKJA 3B3JA 4ICIA 4AG6A 1JAIA 4TV9F 2GOYA 6NULA 1QORA 1CIJA 3EAFA 3JD2A 1FS6A 3H5NA 4J0EA 1UZUA 4QWMA 3ZWYA 1BHSA 3SQWA 4HDMA 2R87A 3OOEA 2HDOA 3H8WA 4PCAA 4GUAA 4CMIB 2H54A 5ALOA 4GLFA 3OQIB 2OAEA 4QEDA 4E5VA 2XA2A 3TDKA 3JALA 1TT7A 1H66A 3KOXA 1G66A 4EPTA 2W2MA 4YJ3A 1MB0A 2BDUA 2OD7A 4IJVA 2BM1A 2ZRLA 3M70A 5TQVA 4CMKA 3P8ZA 1V43A 4EEXA 2VNKA 2HMVA 2PU5A 2ZR7A 2O3TA 4RY0A 5A0VA 1YB6A 2CFSA 4H17A 4II3A 2AK3A 3IBTA 1CZOA 4M22A 4JBWA 1VHLA 4O59O 1VCMA 1VJRA 4TVBA 4K7JA 2FN9A 2JFFA 3W3AH 2RD2A 1ST3A 1TJ5A 2CFIA 4M0EA 2VHJA 4RKRA 4FS8A 4PAQA 5FI3A 2ZANA 4MLCA 4PPYA 1QPZA 3ROFA 4HDQB 3PXXA 1XCGB 2BR3A 1DP4A 3DE5X 3MTEA 4J1TA 5HM6A 1YJXA 2IYPA 3E7DA 4FE4A 3T5CA 3UJ6A 3G9UA 3VZBA 1XP8A 1F8FA 2IOFA 4JBXA 4MGHA 4ACBA 2OECA 3FYCA 1QIEA 3FYDA 1E99A 1OFVA 2PRSA 3ORSA 1XGKA 2ZXFA 4FEAA 4IGIA 5D51S 5H59A 4D46A 4Z1MD 5BOVA 3DOIA 1NQWA 4X1IB 1N6OA 3P9QA 4DQVA 1JBEA 1FU8A 2CXUA 5JRJA 2RC5A 1FVXA 3G17A 2XHEA 4RVOA 3WC4A 4JXZA 3SMVA 3DAPA 3HNRA 4GI7A 4U9UA 1E58A 2H2HA 2VDLB 1AV6A 3W9YA 1USGA 1XTJA 5HP4A 3C2QA 2DVMA 2QRZA 3O9ZA 3IPXA 1M83A 1N2EA 1T1SA 2C1EA 1K06A 4KUEA 2FFQA 1ORDA 1TRKA 4XTRA 3LCVB 2B61A 4HXGA 2AW5A 5G2OA 4AZ0A 4YRAA 1HE1C 1ZUNA 3SIPA 3U7JA 3Q9SA 3HHPA 2C95A 4FT4A 1K4MA 1ZN9A 1JZQA 3ZEIA 2ZSUA 4RL6A 1JR4A 1IUNA 2BEKA 2FMXA 2Q9BA 2QU8A 3ANYB 3BFPA 4G89A 2IF2A 4PIMA 4YAWA 1IOZA 1VMIA 4PRKA 4AJIA 1JL3A 3L4JA 1AUPA 5E3IA 4EO9A 1Z3CA 3CT4A 4YT5A 2JGIA 2GSDA 4EPXA 5J2UF 2WWRA 2QTWB 1ZLXA 2R8ZA 2I76A 3GIDA 3IIKA 4XWOA 3UJ9A 2QVLA 4TX1A 2R86A 1INLA 3S6JA 2BKUA 1E3SA 1JFFA 4GRIA 4AM8A 4BDTA 2GEUA 5C34B 4PZZA 5C37A 2AEFA 4JLBA 1KJJA 3OZXA 4U2KA 4W9NA 2I6QA 3JSXA 1B8OA 4NBUA 3RIGA 2ZIAA 4KXYA 4LY6A 3MTAA 1YZTA 2OLKA 1LPPA 2PUHA 1CS0B 5DW0A 5FI0B 4WA8A 3DCYA 3WRWA 2M9MA 2VATA 3T7IA 2RH9B 1W0KA 3W8FA 5HJEA 5B7NA 3FNRA 3G2NA 4F8JA 1ZFNA 2QN1A 3FG9A 3GDFA 1ZNYA 2V96A 3NR2A 5ALSA 1XHLA 2GN4A 3HVJA 4JX9A 1N0UA 1R0RE 2FN3A 4NU0A 4RANA 3SF8A 4KR0A 4UCQA 3PXCX 2NNWB 5AUQA 4WWHA 3VH2A 3W4JA 3A0UA 1APBA 1US8B 1N2CB 2WTUA 3G85A 1HYBA 3Q4GA 4IDOA 1OTYA 5M29A 1NV8A 1H2BA 4HS4A 5EEHA 3KOOA 3TFQA 3G2QA 3HG7A 1L7XA 4LWPA 4OBEA 2ZQYA 5EQTA 2B6NA 2I4OA 3E9MA 3OOHA 1ISHA 4AKIA 2DC1A 3BIWA 4P5DA 3M5DA 3QU2A 2ZJ6A 1P0PA 3RVNA 2XVMA 4DSZA 4XE5A 1BFUA 1GRRA 1J0AA 2WLSA 4BO1A 1C0PA 1QFJA 1LB1B 4QSHA 5DCUA 3R7FA 2GJ4A 1VHWA 1LQTA 4PGFA 4YRGA 1Z6TA 1R8XA 2F3QA 4KXVA 2VDMB 4P53A 3RH0A 4Z2YA 1BD4A 2IDJA 4MUAA 3PR1A 1HQDA 4BCCA 3EUFA 1W5TA 1P2TA 2ZKLA 5I7FA 2PZJA 1UBJS 2IP4A 3C7TA 2NUTA 1PWYE 1E8MA 3AJEA 3VJKA 4E1AA 1GRCA 1R9MA 2JS7A 4H3HB 1TADA 3PITA 1NMEA 3D8TA 1BC5A 3BWMA 1LRLA 1GGHA 4QU0A 3SJCA 8ABPA 3N70A 4EECA 4INAA 5BUSA 1O6GA 1JNYA 2DAPA 1W581 4N82A 3DBOB 4MGYR 2XCSB 3EF1A 2VTBB 1VKOA 1BEUB 1MB9A 2ZJBA 1Z7YA 1HPLA 4TXLA 5FULA 3SC6A 1LLUA 3NANA 4MVJP 1YQDA 1VE1A 4B9AA 3CCFA 2WF9A 3OF2A 4NBWA 1FRZA 1PNVA 4RBNA 1KH1A 5FBKA 1KO7A 3L8FA 2AR7A 2FLKA 4XD7A 4ZFNA 1TKAA 3A1CA 1WXHA 4FFOA 4G1CA 1TW3A 3JQ8B 3PHBE 5CK4A 4ZT5A 1GZDA 1U2ZA 3TW6A 2JEZA 3UJ7A 3F6RA 3W79A 3BRWD 3TWOA 3REQA 1JR3D 3TLMA 1CUDA 2PH5A 4XJVA 3BK2A 2WWIA 1K75A 5AI0A 3OJFA 2DETA 1P9NA 4BEJA 2OUKA 3MK31 4DJDC 1R15A 2NVUA 3HY4A 2JRLA 1Z7BA 2V6MA 4NP6A 4PLGA 4RY8A 1ABFA 3U9LA 4JT9A 4AU1A 1WA5A 2QRVA 2I1LA 2C29D 1R10A 1YCHA 2FKNA 1JWAB 1QGUB 1T3LA 1UJ4A 1ABEA 5DOZA 1W49A 5D3MA 3N3AC 3PF8A 4PQFA 3UOGA 4O2RA 4JOSA 1O97C 2CMHA 3WFZA 1NONA 4KRXA 1R1DA 4ZDJA 5ARDA 4LF7B 1YB1A 2OFOA 2P2LA 3D7MA 5F9MA 1EUCA 2IX9A 5E95A 3T9FA 3HB0A 1XQYA 3C3AA 3FUUA 1G6KA 2JAXA 3ZNQA 4RQUA 4YHBA 4FSDA 1XOIA 4KNYA 2UYQA 4LGVA 2UZIR 3WISA 1ZUD1 4EUHA 4WOCA 3OM0A 1KDVA 1SXJE 3EFEA 2E85A 2CWDA 4UHDA 2E0IA 3WNCA 1KEEB 5CAEA 1X7XB 2E4UA 4KYVA 1PX2A 3RT7A 2F43A 4JB8A 2YMLA 4JP8A 1D2CA 1Z08A 2LDXA 4OCZA 3UK6A 4I9UA 2WMYA 3HKDB 3OF3A 5IJ9B 1WAMA 3TQQA 4L5BA 1AA9A 5FWYB 4BRWA 4CDMA 1YZQA 4EJSB 1NYLA 2WG2A 5FI1B 1E0SA 2QRGA 1LPMA 2YZ2A 3P0JA 2EFEB 3UH0A 3W05A 5KWIA 5IAKA 3TYXA 4MPPA 1FSFA 2I7CA 2JNWA 3HA2A 3VPAA 4AY4A 4BMOB 4BO4A 5BV8A 3K70C 2JVJA 3KTOA 4ZO6A 3OPNA 1Q50A 4YQYA 1NMZA 2HJ9A 4ZOLF 2RG1A 5JECA 3UQYS 1FRQA 1U80A 1LSSA 2QZZA 2V7WA 2Z9DA 2EHDA 4YROA 1B2LA 4F60A 1UWCA 3DEJA 4M0KA 2GX6A 2C77A 4WZAE 2BBOA 4KQIA 2NU8A 2J9YB 1XL1A 4MK4A 3TR0A 3U7RA 2FZLA 5BVGA 2HSDA 1E9FA 1QGED 5KJCA 5L95A 2KM1A 2QPAA 3NONA 3ZWCA 5B1EA 4KO8A 2NUBA 5JD4A 1NP6A 2V9PA 3HNOA 1IHUA 4P9NA 2C9ZA 4HLDA 4NVRA 2GJSA 1Y7HA 3F97A 3OLZA 1N2ZA 3ES9A 3LPLA 3UTCA 2ZM5A 2ZJFA 2XGOA 3PVSA 2WSYB 4GBJA 2O0JA 2X22A 3QFFA 2RI0A 3STXA 3GFTA 3PHGA 3MERA 2HXSA 3DNFA 3OZFA 3HBNA 1GL7A 1PDVA 4NMLA 5DGIA 1O1YA 2FG6C 4IUBS 1GO2A 3V7FA 2ID4A 2RH8A 3RVPA 1PQWA 1TKCA 5HOQA 3UC5A 5AR1A 3U60B 2XCRB 1W25A 1ICIA 2RHDA 1FDVA 2DFVA 3O4VA 4C5CA 4EW6A 5DV9A 4P6VF 4BE4A 2AFHB 4Y1GA 3NI2A 2JGDA 3BB1A 1IQ0A 3SQLA 1FFWA 3TI7A 2B25A 4QYIB 4B40A 5EJ2A 1CQJA 3TE7A 1CETA 2O2YA 3ZV7A 1Y34E 121PA 4FEGA 1GFSA 4WKOA 4S1VA 5C4MA 5KPJA 1FSPA 2A30A 3AQIA 4E46A 4C76A 1XP5A 2D0DA 2Y77A 1QQ7A 3G9ZA 3EZNA 5A4FS 1F2UA 4M54A 2QN3A 4HT3B 3GQBA 4CN8A 5HCUA 4ID3A 3DQZA 3Q3GE 1V9LA 3FOFC 1ZA2A 4I2NA 3EA0A 3A1FA 1O4VA 3HA7A 1E1MA 3CJQA 4OL9A 3SZOA 5EJ9A 4BGIA 1ZZGA 2FN7A 3BMCA 3WMRA 1O94C 1U1GA 2Q2OA 4XJTA 3ZGXA 2IXDA 2Q4OA 2R85A 3CX8A 2WYOA 1YVUA 2X77A 4NG4A 4B3BA 4EG7A 2QRJA 4LQLA 2DY0A 3RGWS 4H77A 3CN7A 5TIIA 1CUXA 4ZTBA 4DR5B 1ZK1A 5K4HA 4ZXPA 1R3DA 3KKOA 4D8VA 2QVZX 4Q7EA 1VL5A 1NKVA 1ZW1A 5FADA 3C87A 4BNZA 4X5OA 2NZ8A 4FMBB 1A9YA 5EMJA 1FTGA 3Q0EA 1BYUA 1EXWA 1YZUA 1JX6A 3P19A 4J07A 4JXKA 4UBNA 1H5NA 3HA3A 3DFZA 4L3OA 4ZEVA 4FVTA 1PWXA 1FXSA 2R68A 1FP4A 1UBOS 2VHQA 1SOUA 3RS7A 2V65A 3A58B 5ITVA 3KPYA 3EOZA 4RPJA 1DAPA 4RTPA 1IY8A 2Q8NA 3DHVA 3I2FA 4RCZA 4Y9RA 3ZN2A 9MHTA 1NJ8A 1NJFA 2CNNA 2ZSDA 4G6ZA 4HGZA 2OBMA 4DA7A 4B6EA 4EY4A 1UP4A 3AW8A 1A1VA 1P4HA 1ILWA 4LK3A 1HWYA 5TF0A 2REOA 4EYGA 4Z53A 3T3OA 1PJBA 2IZ5A 1N9GA 3FKQA 3PNVA 2JAOA 4MW6A 3I1YA 2NYVA 1QV9A 3TRJA 2PIDA 3WJ7A 4RDXA 1HY3A 1VPTA 5B2EA 4TYNA 4LNAA 1JHZA 3OTQA 4J16A 4XWGA 1A27A 4B7XA 4C3UA 3G2HA 5D00A 3THWB 1B23P 1W6UA 4KFSA 4AYTA 4B75A 1WKVA 3R0IA 3W9SA 2ETVA 3ADKA 3IHLA 1ZMOA 2BGWA 3GPBA 3GT0A 5EFZA 3VC3A 5KSPA 1K3UB 1BMQA 3OWXA 2FZ4A 4HJRA 2B1IA 4ZC8A 4MAMA 4DTCA 1NJ6A 5BV1A 1OXKB 3PXUA 2VBGA 1GGMA 4XUEA 4C3OB 4YRMA 2J6IA 3TZEA 1ZVJA 5LA6F 3G9QA 3CR7A 3HNPA 3ZXSA 2RGXA 2IZZA 3M9WA 4YP1A 2PH1A 2DKNA 5FFNA 4DCUA 4D9JA 1GSHA 1F5NA 5SY4A 4KAFA 4DZRA 1UOQA 4XWTA 2RKOA 1YGPA 1Z0DA 1SVNA 4L9WA 1CYDA 1H2YA 1T3HA 2OUIA 4JJAA 5C8YA 1NY5A 3INRA 4RZ2A 5AJYA 3HDGA 4BNLA 3TQOA 1GTRA 5A06A 3R6GA 1XLVA 2C3MA 1QP8A 2YIMA 4N6OA 1C3LA 1XCLA 4OQYA 3TLAA 3NMUF 2XUQA 3AETB 1I1OA 1Z5PA 4ZDIA 4C4TA 2JFOA 2B8TA 2R7AA 4QODA 3P9KA 5GIOE 1E9EA 2N75A 2I78A 5HZKA 5EQJB 1WXIA 3U1VA 5KOHA 2HBQA 2X3UA 3FZYA 1GQOA 2JD2A 1JQ5A 1EHIA 2NM0A 4PLVA 1KJZA 3FCXA 2QUJA 3QBDA 2EGHA 2VH5R 4MR9B 4Q9LA 5IC4A 3FNQA 1P62B 2P1ZA 1YFJA 3TQSA 1XDDA 2V45A 3GFOA 3PRJA 1N7GA 3O4JA 3VR5A 4CCYB 1M1YB 1EHCA 1DG1G 2ZE8A 5COQA 2MSKA 5CBPB 1UBCA 3NOXA 5DRTA 2P62A 1G8GA 5JLAA 2COUA 5E6SB 3EH2A 3U3RA 1J33A 5JY1A 4MO9A 4RNCA 4YJFA 1DUSA 1E79D 3KR2A 4R2XA 4BWVA 5F9FA 4YN3A 3WRYC 4CFSA 1Y1TA 1O87A 2IEZA 3V46A 3ZOZA 3DKKA 2H4HA 2IHJA 3G68A 4GIBA 1M6VB 3B6JA 3VHLB 2I8AA 4B33A 4RU1A 4L50A 3G5MA 1DX4A 3ZLUA 2WIBA 2PJDA 3VO9A 4CT4B 3R7LA 1KPIA 3CWQA 3KO8A 2PY6A 4KBYA 1JW9B 4PN3A 1RJGA 2ZLBA 3HM9A 4B44A 2QYOA 5JO9A 5D01A 1RXSA 4N3AA 3CJTA 3FMPB 3NBUA 3SOZA 4DRYA 3LDFA 4ENQA 4COKA 3BM5A 5FWAA 3O4FA 4YK7A 4DA9A 3BIFA 1JZSA 1W0JD 1JI0A 1HKUA 2EJWA 2WNIA 5DEIA 3IBCA 1PJCA 2XXJA 5H02A 4Q3DA 4QGHA 3L1KA 1ADCA 2OG2A 2ZTLA 4IFIA 5H3HA 4D45A 5LZ7A 1Y8ZA 3V97A 5JDCA 2G7ZA 3EA4A 1C7JA 3R8CA 1KGSA 3ZU2A 1UDRA 3N6XA 1ZI8A 3GLQA 3IDAA 3QYFA 2HRCA 2JGEA 5DX1A 3DKPA 1ULAA 3EOBI 4OP1A 4C06A 5K3EA 3E81A 3BMNB 1A4RA 2YV1A 2P2NA 1DZIA 1MD9A 1U4SA 4AP6A 3KPUA 3EUWA 1QIJA 1OTXA 2Q9UA 4NDZA 3RIXA 3VUFA 4Y6RA 3X1KA 4Q82A 1XQWA 4YAFA 3M83A 1YE3A 3P2MA 5ARBA 1YVEI 3EIUA 2PKRA 4I4TA 1U9JA 4BFUA 2FEOA 3GUVA 1Q5PA 3ASYA 5ECWA 1QS0B 4BV2A 3GH1A 1N0VC 2ZAGA 5ICCA 3VZCA 3DGFC 1Z6XA 3PJGA 1VL6A 3PGMA 3SLRA 3HLKA 3ZDRA 1OJLA 3VGPA 2QW0X 1M1NA 2AH5A 5A02A 3ABRB 2AN1A 3CG0A 4A10A 3LV8A 3T7DA 2WUEA 3ICVA 3FHCB 1T1JA 3QPBA 2YY6A 4JOBA 4R0MA 4UD2A 5AKGA 3WIDA 1F8UA 3DTVD 4IICA 3BCSA 3FTDA 4UDOA 3TQHA 3BFKA 3RV4A 3HDTA 5JALA 1G7SA 1NNLA 5AJXA 2R6R1 4CMIA 1PYDA 3QHPA 3TPFA 1DQYA 3FJYA 3MAAC 3OMXA 4MB0A 1QYDA 4Q3AA 3OQIA 5LDGA 4AYWA 5AOVA 1JU3A 3FPLA 5CPBA 4MQ4A 3S55A 1P19A 1ZBQA 2Z9BA 1ODFA 3QKSA 5ER9A 1KEKA 3WLTA 3W5AA 5CEEA 4GQAA 1N5KA 1M2NA 2ODEA 2X1LA 3B20A 4KGDA 4NXMB 1NLFA 1SEPA 3GCGA 1EUDB 3TGLA 1L8AA 2O2SA 1M0WA 2NPFA 2Q7OE 1CRQA 3EDOA 3BYZA 3A7EA 4LXUA 4G5QA 4GKAA 2D3TA 2QX9A 1P1JA 3DDUA 4X84A 3PEFA 1DDGA 2XH8A 4H27A 3AT1A 4I4IA 5AW8A 4W7IA 3EBLA 4UMDA 1H8HA 1Z8NA 2OY0A 1KJWA 2WVJA 4P83A 3PC3A 3WAGA 3W2TA 2PE5A 3GLSA 4K9SA 1KEUA 1AIPA 2AFRA 1TA0A 4C2BA 2B78A 2BISA 3U37A 1GCIA 5JSYA 1IN8A 3TCKA 4C4PA 1W73A 3HXLA 3PE4A 5AW2A 3FDIA 3W5CA 2B98A 2CVPA 4BDSA 5KMGA 3ZW7A 4CFYA 4N3BA 4XB1A 3STUA 1Q0RA 2ZIXB 1KDZA 1BU5A 2ADFA 1K5PA 4R84A 4X1IA 1KMQA 5LZ4A 1J8FA 4RKYA 1PSZA 1KYZA 3KD3A 3OD5A 2Z56A 3SLGA 1JB9A 3H99A 3RT1A 4ZANA 4PSKA 2J5QA 1T3SA 4O4IB 1U6JA 2EZ4A 4D0GA 3NEAA 4K3VA 2VK8A 3UUGA 4TYYA 3OE7D 3ZE1B 2BN4A 4IGFA 4R4JA 5BR4A 3AM1A 3SAJA 4A8HA 2BKLA 5M04A 1IAVA 1USKA 4HGYA 4LJKA 1M8GA 1KFCB 3C14C 4JEMA 4NR0A 1SPBS 5JXGA 3DE4X 1RI2A 3BHIA 3FFTA 3KZKA 3QLUA 4H7KA 4LHEA 3I39X 1V1JA 3D02A 2DWQA 4N5DA 3I9NA 3ZE6A 3UEOA 5JFGA 4MDYA 5IBPA 4ECAA 1ZJWA 3ZD6A 5LN1A 4AJJA 4ITRC 2REQB 1FXWA 4PGAA 2XSZD 5EVCA 4FB5A 2Q8QA 2ON6A 1U90A 1EJ6A 1QIDA 1U3VA 2PUWA 2QLJA 10MHA 5AO9A 3FNHA 1ZX1A 5ICSA 3M5CA 2VHXA 1AGPA 4D02A 1EB8A 1M2OA 3GD7A 2ZQ5A 1IN7A 4LVNA 1UQUA 1L8OA 1U3CA 4B47A 3UMMA 4XEUA 5EKSA 3OOWA 1RACA 5H0IA 3UXYA 4G97A 3W6UA 1DC3A 1BS1A 3NVKI 1EE9A 2M6RA 1LPSA 3P9SA 3BD7A 3FLAA 2J0SA 1DEAA 5G41A 1V71A 4HHEA 2CYAA 4DADA 3R3UA 4S3MA 2V3VA 3OSZA 3ESRA 2OZLB 2B9EA 3OLWA 3UJBA 2WVHA 4TRNA 1ZY2A 4FFDA 1UIMA 4TKMA 1DQZA 3EXEB 3JQBA 5GJVC 1VGVA 1YJ5A 3UFBA 1E89A 4I99A 1B15A 3DPUA 3AZPA 4TT3D 3RSGA 1MT3A 3W6OA 1DC8A 5JCPA 3D6NB 1A95A 3EXHC 1J09A 1JMYA 3UK0A 1IRXA 5IN4A 4KE7A 4CUJA 5MN6A 5JJLA 1B6TA 2R62A 2OHOA 5HF8A 1W36D 1KRHA 4YP5A 4AJPA 1M34A 1TE2A 2QROA 1WOMA 3SBEA 4DCSA 1ZAYA 4I8XA 2BGLA 1MP0A 2VTVA 4V0NA 5EINA 5THXA 5JAHA 2OV1A 2J5BA 4QRIA 5AKHA 4EFKA 1MOPA 3M6MD 2BE7A 3DLPX 4YP7A 3MTDA 3P7MA 4IKOA 4A0HA 2XMQA 2P4EA 3QE9Y 2X58A 4W6ZA 1RCUA 1IPHA 1TA9A 1AUQA 3GI1A 2H1RA 4KH0A 4KO4S 1I7SB 1E4VA 2W6OA 3E8SA 4LXQA 4P84A 2ZIUB 1KZHA 3D8BA 4LSWA 4P2GA 2DSTA 2WYWA 2VEDA 3WWYA 3I5AA 5AM3A 5ENDA 4B45A 1NUSA 1H0SA 2CD9A 1LS6A 3RLFA 4Q1FA 4CQMD 5DNCA 1G291 4A26A 5JCOC 4HAZA 3OZRA 5DWQA 4Z9XA 1U02A 3R2JA 5EJAA 5KTKA 3UMYA 1DEOA 1L7NA 4ZTUB 1DXOA 1NOKA 3IGFA 4P33A 1NZJA 3JWEA 1PYGA 4MCJA 4YONB 2PRJA 3ZWWA 1QONA 2Q0SA 1EAMA 2QMYA 4LOHA 3O8CA 3A6DA 3HXMA 3CLUD 2AZTA 3UT5A 1JXOA 2XB8A 2YZ7A 3MCAA 3ZNNA 1HE5A 2PXXA 5FTMA 1GPKA 3CCCA 3VDMA 6AT1A 3DE0X 3ZY6A 2JG3A 4HSGA 1YXMA 4JUDX 2H51A 5CX1B 4TTJA 5KYGA 2G3YA 5E4YA 3QUTA 5B5SA 3Q7RA 2W2LA 1GDHA 2OVFA 5BOSA 1WU7A 3O8QB 5K0GA 3OQOA 1ZW6A 2NQ8A 2NT3A 1QU3A 2YZMA 1BS2A 1LLFA 3L6RA 3V8QA 2QRPA 5B7GA 4DQUA 4PLZA 4YP6A 1P73A 3M6XA 3SEAA 3AO0B 4M8LA 3I52A 2XMCA 4CEHB 1H85A 2UZ3A 5MFZA 4YRTA 1YULA 1VPVA 2XRZA 3U80A 1UPCA 5LLDA 1U0JA 2VPIA 1HF3A 2GPSA 3GH3A 3CPJB 5KJ1A 2AXEA 2VJMB 2X9QA 3A25A 3WHIA 2ZXEA 4CM9D 2C5AA 3LAWA 1T8PA 1I13A 1Q14A 3ENVA 5K3SA 2FJ0A 2RJOA 1DAEA 1E5XA 4M0FA 5FPKA 2AC2A 3MYRA 2X2PA 2QT1A 2XW6A 4B3DA 1RZVA 1BMFA 2YX1A 3PHLA 5K0LA 2VAPA 3QVJA 2AN3A 4ZCQA 4CCSA 2R0QC 1BYIA 4OFWA 1P8JA 3G0OA 3WV4A 4ZO7A 2PR2A 3WHKA 1XCMA 2FZ5A 2DKFA 3OIYA 4EOGA 1PVDA 2NQ2C 1HZJA 1EFRD 1GPAA 2VP5A 2G4CA 4ZVLA 4K8OA 4Y6QA 5IVDA 1H5UA 1RT9A 4AJEA 3SR4A 3BAFA 4EG1A 1E9DA 2OYSA 5LYJF 1KEEA 1X7XA 2WTMA 4ERXA 2RKBA 5D86A 3D59A 2Z3WA 3ZJYA 1AU9A 3WMGA 2Z98A 4ZEWA 3B1VA 4WKPA 1M0EA 4IG4A 2E1RA 2HMSA 3HKDA 3NVAA 4PEVA 2DUUA 3NDJA 4AURA 4EJSA 5FWYA 4HGRA 1OY1A 2IUFA 2DP4E 1YDMA 2QUIA 3FKJA 2AVDA 3I9V1 2XDQA 4BZXA 5EXTA 3A1DA 5G1OA 2PA0A 4LQDA 7GPBA 4WFIA 1R0WA 3PUHA 1D03A 1BA2A 3LDAA 2XUKA 2VYNA 1V8ZA 1N32B 5ALHA 3W8DA 1XNQB 2HQ1A 3M1IA 4WBXC 1E3JA 3QXSA 5BT9A 3RFVA 1W19A 3VNVA 1C8VB 1JS1X 1TA4A 2JCGA 3JASB 3OEHD 4XJXA 4YRCA 4QFDA 2FG7C 2FRDA 1F12A 1N25A 3IBGA 1WR8A 1PQPA 1V4VA 2GJ9A 4TWJA 4O5AA 4AMZA 2C2KA 5EA2A 4ALIA 4AY6A 3VMFA 2PKWA 2LE0A 3QA9A 4W8OA 3GLKA 3KZOA 3F5FA 4IDAA 3ERCA 1KZGB 1TFUA 2E4YA 1GRNA 2P0EA 2QD4A 2IHUA 1AGNA 3OZSA 5CH8A 3ZWOA 4L95C 1SCKA 3CH7A 5TQ0A 2Q8PA 4XQ0A 1Z9BA 4N5MA 4QBTA 4BN4A 3GFGA 2PX8A 2WVGA 5CGQB 4A82A 2ODBA 1FSSA 5BO5A 4OLAA 1A8HA 1JFVA 1JV2B 4YJGA 3WYFA 3WGQA 3ILVA 4F4CA 1TPYA 2WF6A 1N2SA 3UKOA 3N5KA 5EPUA 5KSZA 4H4DA 2Y76A 3PHHA 2IYUA 1UH5A 4K0RA 1P2VA 5ICGA 4AIIA 1SVWA 3HBLA 3TG2A 3S2IA 4FP9A 1UT6A 1HORA 1PD1A 1X0XA 2G6BA 2X5NA 2QTRA 3U3OA 5LMNB 1GT91 1QDLB 5E8RA 1SQ5A 1WF3A 2L69A 3I6YA 4P5PA 1B73A 4BBPA 1QQ5A 3GPIA 2JJ1A 3MGCA 3VR2D 3CVVA 2VDUE 4W5OA 1SA0A 1U0FA 4AECA 4G9EA 2HR1A 2HMTA 3JQGB 5F5LA 3ZUGA 4C87A 4N5LA 5F21A 5CD9A 1QLWA 5LZ2A 5K0FA 2QMUA 2WTNA 4WNIA 4JL8A 3R7SA 1KMNA 1THTA 1MQ9A 3HXOA 4L2IA 3IX7A 2X23A 2J45A 1X1DA 1ZGCA 3B6ZA 2B4YA 3H87A 1L5SA 4DPKA 3RYCA 4EEZA 3LXMA 2O3JA 3KS9A 4O8ZA 5L4NA 2TMYA 1GQ2A 3Q88A 4Q4HB 4M55A 1RZRD 1L1RA 1Z4LA 1MGPA 1LNZA 1NI4B 2I34A 2IYVA 2ZBRA 2ZJ0A 1O57A 2GHIA 4N7RA 4V3BA 4DS3A 3TEJA 2PEZA 5BURA 3U6BA 2JBAB 4Q66C 2JH3A 3AEQA 4PC7A 1TK9A 3PU6A 1ULTA 4CM8B 4FDTA 1R64A 2XAUA 3OJLA 1LSOA 1YIOA 5ALNA 4CKZA 2XBUA 1X3LA 1P9WA 1TB4A 4HNAB 1KJIA 4IOJA 5FR2A 3TN7A 4DCOA 5FDFA 4P7GA 1A8SA 1FQWA 5MHTA 3V1MA 2IPAB 1NMYA 4OYRA 3DZDA 4JITA 5FR1A 3ZU3A 4Q4JB 1MJFA 4ZA2A 1GTG1 2FN8A 3TNDA 1I7PA 2G9RA 3AKCA 3GA0A 1KI4A 1QH0A 2QZPA 3VSBA 2LIPA 4WEOA 3KJFA 4WN9B 5D1HA 3TPCA 2RGAA 3QX7A 4WW0A 3HB5X 4O2BF 4BQRA 4EFNA 5K7SA 4AROA 1PS0A 1JJIA 1U1IA 3M3HA 5EIAA 3UK7A 4UNRA 1U7UA 2B5VA 2ZB8A 3UY4A 4NYMQ 3HYLA 4TKLA 2Q7DA 1QH9A 3E9QA 3PWZA 1V9CA 2PH7A 1C7FA 1JSCA 4A4DA 3E9DA 4XWAA 4R1QA 1XF9A 3OTWA 4LVUA 2FPSA 1X2EA 5DLDA 1P7WA 1F1BA 3G1WA 4RHTA 4WIAA 3QY9A 2Z43A 3I30X 4F72A 1D2MA 1Q7RA 5KQLA 3AVXA 3NP7A 5FPPA 5CXUA 2R79A 2YFQA 4MCIA 4MW2A 1JF8A 2DPGA 1RBZA 2OCKA 1MDBA 4MYUA 3OH8A 1CY7A 2MYNA 3H9BA 1AURA 4YRPA 4OL0A 1FX0A 4LBWA 2FW6A 5TVGA 1EX9A 2DSNA 4C0WA 3W0LB 4B83A 5FBZA 1F48A 4YLGA 5JNLA 4J9VA 2C7OA 2JASA 1W2GA 2R7MA 3BBLA 3HVRA 5DNAA 5A3JA 4NE2A 4MYSA 2BCGY 5C32A 4Q18A 3DEHA 3EAGA 5CA1A 3QWAA 1NR1A 2PZAA 3W5SA 1JIIA 3ZIAD 1G98A 2GJ8A 3F49S 3HEMA 1CIVA 1XMIA 2PBZA 2PGXA 3VKFA 4DW8A 1SMKA 4OKNA 4R68A 1JDPA 1KJQA 2W2OA 2XYHA 2AUTA 2QRMA 2HWKA 3LDHA 4ARVA 2WNHA 1KYVA 1HT1E 3H04A 3GFQA 4YIHA 3RFXA 1GYQA 3NBZC 1SKUA 3FLBA 1PEDA 3IUQA 1GJRA 3AETA 5NULA 5ALXA 1OIVA 3ICPA 3W5UA 4B8ZA 4GP7A 1BX1A 1I2CA 4AICA 4IVPA 4B46A 1VCIA 3DBVO 3BB4A 3IAS6 4LW8A 5JQGF 1ULBA 3LO8A 1CZHA 3QNWA 3R24A 1RWOA 2Z57A 1K7CA 4KG7A 4GR4A 4KSBA 2DPLA 3DVQX 4DUYB 2DXIA 4RPIA 4O6VA 3RRFA 4EDHA 1P60A 4KQGA 4OQMA 4R40A 1XMQB 1RWVA 4CIXA 1D2AA 2ABWA 3KWJA 3OCZA 4FGWA 4FZVA 3V4SA 4AUKA 1VBKA 4F97A 2WC1A 5LP6F 1O8CA 1M1YA 3KXIA 4ZK6A 3IT3A 4BNFA 4CMJA 3QE0A 2HFJA 3TNFA 2H6EA 4NBTA 3GLHE 2W2VA 4NEGA 5CBPA 3BH7A 2XR1A 1EUYA 1JLLB 1ADBA 1C9NA 1XX6A 2DFNA 2ODAA 5E6SA 3IR6A 1H94A 2RHRA 4LN1A 2DULA 2V3WA 2Y71A 3DF7A 1WXXA 4QDXA 1E6UA 1ZSNA 3AG6A 2WB2A 1KPHA 5ILGA 5AW6A 1H3FA 2YHAA 1SR8A 5DDIP 1AS3A 3LYUA 2QEQA 4LJAA 3ZDBA 4WERA 1M6VA 4AG5A 2Y27A 5FPSA 4LECA 2NUPB 3OZGA 4HQNA 4EHKA 3L8ZA 4U9IS 3MIIA 4PGGA 1VBMA 4BX9A 1XYYA 4YNBA 1A96A 2H7YA 3FPFA 3K8OE 4KPUB 2HF9A 2J48A 5M7EA 3EVTA 4LJ5A 1ULUA 2YWGA 5IEBA 2BBWA 4MUJA 3A1EA 3OPQA 4P98A 2O6LA 3DCNA 3REGA 5B57C 4HFJA 3G59A 3S8YA 2QTHA 2PDAA 3AIMA 2GZ1A 3L1HA 1U4OA 1EESA 2CNWD 3NT4A 4B8WA 2D3WA 3DA8A 5LVAA 4K87A 2AMJA 3ZQJA 1BJRE 4OO3A 3ZHZA 5SYNA 3KRTA 4D57A 3J7AC 1A9XB 3LMKA 3GU3A 1C3JA 3U56A 1S2NA 1BX3A 1RJ9A 3ABQB 2HJSA 3HHEA 3KZNA 4QTZA 1M72A 3D0RA 3RC8A 4CIDA 4Y2UA 2X0FA 4IH4A 3ASVA 1SKAA 5DBHX 3WYAA 2E37A 2QQ5A 4LY3A 4K86A 4NCBA 1CRZA 1Y5RA 2CW5A 3BMNA 4EA8A 1C0KA 3CRRA 1M7BA 2A9PA 2V54A 5FWXB 4E12A 3KKPA 4AJHA 2OP1A 3GV0A 4UZEA 1EFDN 4C0JA 5BNZA 1WBBA 4Q01A 3P71T 3CNBA 5HKLA 5B7PA 1Z7GA 1FUEA 2C7PA 3F5QA 4MIEA 2JI6A 5F51A 3OA2A 2ZUCA 4PQEA 4JJZA 1QS0A 3CJRA 5LQNA 1VPDA 2R4TA 2YXEA 1DELA 1XG5A 4PAOA 5FJIA 5DHPA 3MQ2A 3ZDFA 1G20A 1TEHA 3AVOA 3KPWA 1OLUB 1SQ0A 3JATA 5TF4A 4B9EA 4DLWA 3WGIA 4G56A 5DIFA 2ONJA 1Q44A 4JA0A 4OXRA 3NYIA 2RG7A 1W88B 3EF3A 1JJAA 1B93A 4W5JA 5EZYB 3HVKA 1ZYUA 4QSMA 2ZBEA 1W36C 2VA9A 4ZHQB 3E4DA 1SKMA 2QV7A 4RSHA 3OT4A 4GKVA 1U2DA 5DK6A 1PR9A 2WHRA 2VPTA 3F6CA 3IEIA 4OATA 1PFUA 4PSDA 4L27A 3DEFA 4AX8A 3ZCSA 3LBNA 4YRFA 1YBFA 3C7AA 4XLTA 3GLGE 5BNTA 3O75A 2IHKA 5B1IA 4I14A 3N87A 2PX2A 4JXJA 4QOFA 3NFYA 1DO8A 3HN6A 5EKTA 4UCXA 1I4OA 4OJYA 4L8WB 3SE0A 4Z7JA 2VDKB 5LQDA 1UZLA 5DTMA 3BK7A 3EYAA 1TEXA 5E0OA 3RQIA 2YKGA 2BI8A 3ZCPA 1VJGA 2BE9A 4ETNA 5AJWA 3K1AA 1UZNA 2XUJA 3EJ6A 4MPJA 3CPHA 3MGAA 4KLZA 3K73O 1ZK2A 2GBLC 3CLHA 3D5QA 3IUSA 2CLHB 4OLHA 4N03A 2PFGA 4EITA 2A84A 1OBVA 2MINB 3E35A 2XE8A 4NCJA 4TV8F 5TPZA 1D2NA 4MV0A 3CLUC 4RA9B 4BCDA 4R2HA 1G0NA 3IYLW 2VP6A 3KM0A 5E3JA 3F5SA 3KQTA 4YUAA 1FLDA 1DIAA 3C3DA 5FO1A 3C5HA 2XNKA 3BJEA 2LRHA 5CA0F 2XQFA 3C39A 4JLPA 4NE9A 3I09A 1R16A 4LJLA 4HZIA 4WQMA 5AW9A 4B3SB 1SB8A 1E1QA 3IEPA 4W99A 3BE5A 7REQA 1PGNA 5AM1A 4KN8A 3T9BA 5TS3A 5LXTB 1R0YA 2Z6QA 2CHGA 3HKCB 4FC7A 4HQOA 3EXG2 3KQWA 3QBJA 4OIFA 2QRNA 3OE4A 5HPYB 4XPIA 4X3CA 4ALKA 1P7VA 4URWR 2JAWA 1IL0A 3FIJA 3EX7C 4CI0B 1W35A 2PRZA 3RAGA 1U1CA 4DLAA 1II9A 1G4UR 5CT4A 3PDIB 3TNYA 4BFZA 4HLQB 1KR5A 2ZVQX 3LY5A 4M0CA 1WF6A 3BIXA 1I4LD 4KR3A 5FHRA 5KHOC 2REQA 2HNBA 2C58A 2VRCD 2GBCA 4OMDA 4B4UA 2A3NA 4EHBA 2P3OA 2ZCUA 2BVNA 1QKIA 2XIJA 4A16A 1RQRA 4NDNE 4YPOA 3GJ8A 4XCVA 3VKHA 3W9BA 1EVIA 3S2YA 4G81A 4DCCA 4HY3A 2WMOB 5BWLA 1JLSA 3TZLA 1MC5A 1A9QA 4A6PA 3K09C 5TX7A 3V8PA 1CUAA 3UANA 1ANKA 3C3XA 2TECE 2GM3A 3BDVA 4I6GA 2QE7D 1G60A 3I9OA 2OQ2A 4Q9HA 1DC4A 5JMWA 3LC2O 2VUHB 4TS9A 2Z9CA 1L4HA 3DMFA 2VRBA 3LHSA 3MTJA 4I6JA 4MROA 3U40A 4ESOA 1Z68A 1OASA 3ZDYB 2YRFA 3I3SR 3KJZA 4X60A 3TVDA 5K20A 2CMFA 4MW0A 3UGJA 3WBJA 4DILA 3OCXA 4E2WA 5EJ6A 5LU8A 2OZLA 3CX4A 4GYYA 1CKEA 4J76A 2DQZA 2FFBA 3R44A 2VAVA 2FUG6 1O9HA 3CB2A 3EXEA 1U3GA 1ZNQO 4BC0A 2NWQA 3RKUA 2I4IA 4TXMA 4B6FA 1DG9A 3OPVA 4KNVA 4UM8B 3IE1A 4J0DA 1QU2A 5GAJA 3SG0A 3PT9A 4IQGA 3PVCA 5JMOA 3D6MA 1FFAA 1LJUA 2VBFA 1F0NA 4NL4H 5CEFA 3PJDA 2P6NA 3VVCA 1DJPA 4MCHA 1BZYA 1E6WA 1P3Y1 2E7ZA 2HCBA 2OB2A 1R0XA 3FUVA 4KQMA 4X71A 5ALTA 4BVEA 3EPLA 1MZVA 2H2AA 1WEKA 4BNWA 3LTNC 4JN6B 2D2XA 3CN9A 1XVAA 5ALFA 4POOA 2O3RA 4DCMA 5JSQA 3S2SA 4YY3B 2P5YA 4EKDA 4HYTA 3RV3A 4CFZA 2J7PA 4EO4A 1Q0LA 2CL5A 4PXYA 5K8LA 4X6LA 1AHHA 2V6JA 4YJ3F 1A9PA 5FOSA 3GMDA 3W1VA 4F46A 4MVJG 1Y1QA 4N12A 4YI5A 1HGXA 2O06A 4O2AB 3TOXA 1C1DB 1EQAA 4A27A 1H2XA 5E3HA 1F8YA 5PNTA 1QDUA 1X8LA 4I9HA 4TLAA 4F2PA 2RE8A 4BU1A 3G9TA 3JAKA 5HR5A 2WPDD 2R2GA 3T5AA 1V8PA 4OSOA 1LVHA 2IYXA 1T9ZA 1TF5A 4Y3UA 3ND5A 4V24A 4BJ6A 3OIFA 3UATA 1Y5MA 1E3WB 1PP4A 4RIHA 4H15A 2HBZA 2BGGA 3U4MA 2FE4A 1Y4ZA 3KT6A 2K5UA 1ZA1A 1SUEA 2AR0A 1S7GA 2UUPA 3LQ1A 1CJTC 2MSWA 1HC7A 3KYDA 4QOSA 1AN0A 5JD6A 2CLKB 3O8QA 1LPOA 3UAGA 4DJFC 5DNYB 3DBHA 2AXNA 2ZT7A 2C9BA 5AW4A 1Y1RA 2Q45A 2BJWA 5HKOA 3E82A 1NY6A 1VJ5A 2A4KA 3PQEA 4NYIR 4QGBA 4A8PA 4DM3A 2FP4B 2XD4A 4NABA 3V33A 3NHRA 4ZDKA 3KD2A 4RCVA 5K2MA 1G1AA 4FUQA 1AQJA 3EGVA 3BMOB 3GNLA 3JWPA 3UYLA 1L3BA 2VQ3A 4N4AA 4QC2A 1VJDA 5B3JA 4HO1X 2FFJA 1ZGJA 2EFHB 3OM1A 5IAAA 4Z4QA 2BJVA 1Q0TA 2A88A 4KREA 3WMFA 2W70A 4EKGA 4CTMA 1AMOA 2QYTA 4OOFA 3RU3A 2AEMA 1KO5A 4ZV4A 3EMDA 1KK1A 5KHAA 3U5ZB 1UKVY 3A4YA 4A7PA 2NO6A 1I33A 1W30A 2WZDA 3FZEA 3IE0A 1S8NA 3KEGA 4UARA 4R7GA 1BJKA 4UTRA 3ORQA 1CDOA 1ORWA 1PLKA 1X7YB 1XZKA 1Z82A 2NZ2A 2P1DA 2AN4A 3EOAI 5DBEX 1BSVA 2L0XA 1S2OA 5C81A 3TL3A 2C7QA 5GOZA 4OD0A 3AERB 3EXAA 3LYHA 3AU8A 4RXUA 3RABA 2SHKA 3FPCA 1DC7A 4V0SA 2I5PO 3RE1A 2CDNA 5BQ3A 3WLRA 1A50B 2YJZA 4IS3A 5F77A 3JAWB 2KE5A 3PX7A 2FDXA 2OEPA 4E2YA 1KYTA 3KVRA 3ZD7A 2CLMB 3IEUA 4HS9A 1RLJA 1CZNA 1Z0JA 1YZGA 4LTMA 4EI9A 4IEEA 4EJMA 1KA9H 2TMGA 3PT5A 5IT0A 5TPWB 4U00A 4HQFA