3PGVA

Crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
264
structure length
259
Chain Sequence
YQVVASDLDGTLLSPDHFLTPYAKETLKLLTARGINFVFATGRHYIDVGQIRDNLGIRSYMITSNGARVHDSDGQQIFAHNLDRDIAADLFEIVRNDPKIVTNVYREDEWYMNRHRFFKEAVFNYKLYEPGELDPQGISKVFFTCEDHEHLLPLEQAMNARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKMLGYTLSDCIAFGDGMNDAEMLSMAGKGCIMANAHQRLKDLHPELEVIGSNADDAVPRYLRKLYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords haloacid dehalogenase-like hydrolase
publication title Crystal structure of a haloacid dehalogenase-like hydrolase (KPN_04322) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 2.39 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 80
structure length 259
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 3pgvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pgvA01
3HYCA 3WGVA 5AVSA 3ZX5A 1RMYA 3M1YA 4Y2QA 3L8EA 3ZWDA 2YFYA 5AIBA 5AI9A 1Y8AA 1SU4A 1TJ4A 1RLOA 2G06A 2ZBDA 2PKEA 1YMQA 2I33A 3L7YA 4HYTA 4DFDA 4JB3A 3NAMA 3N1UA 2I6XA 2B1QA 2IOHA 3NRJA 5AIAA 3L0YA 3VAYA 3RFUA 4ZEXA 5AM1A 1N9KA 4NV0A 2Q5EA 2WF8A 2I54A 3ZU6A 1O08A 1U02A 1Z5UA 3EPRA 4UM5A 5AICA 5AI0A 5AM5A 5ALQA 3WK8A 4Y2JA 5AM3A 1TJ5A 2JARA 3E8MA 3W5AA 2YBDA 2OYCA 3QX7A 4KNVA 3ESRA 3SMVA 2B8JA 4HGPA 4OD0A 1WR8A 3UMGA 1U2SA 3OCXA 2G09A 2GFHA 4J2TA 5AK3A 4NAVA 5ALZA 1QQ6A 3QUBA 4HAIA 3KOOA 4Y2TA 1Z4OA 4BX0A 4C4TA 1J8DA 5AKIA 3SKXA 3KC2A 4UMEA 2AH5A 2FI1A 2YMLA 3WGUA 5ALEA 2WF9A 1IWOA 4MUMA 3FPSA 4UMVA 5AM2A 1X42A 1ZD2P 5ALOA 1ZD3A 4FFDA 3N5KA 3PGLA 3QNMA 4KYTA 5ALSA 3MPOA 5AW8A 3PCTA 2B8EA 5AKJA 1S2OA 2FPRA 2HSZA 2P27A 4UATA 2R8YA 3QU2A 2BDUA 4G63A 1Q92A 1RLTA 3D6JA 1JUDA 5AVUA 1TJ3A 3WKAA 1KYTA 5AW7A 5AKEA 3OCYA 4EZEA 1Z4MA 4UMDA 1TA0A 2B1RA 3A1EA 1Z88A 2CFTA 3ZVMA 2G07A 4CF5A 4KNWA 3MMZA 4UU0A 4I9FA 1L8OA 1Z4IA 5ALDA 3SLRA 4FE3A 4BEWA 1RQLA 3QU9A 2PQ0A 3DV9A 1L7OA 3PGVA 1RKQA 3QGMA 3WK4A 2YJ3A 2HDOA 2CFRA 3MN1A 4YH1A 5AW6A 1J97A 4RETA 2GMWA 4EENA 2P11A 3L5KA 5AK5A 3QUTA 3ZVLA 4YCLA 1WVIA 2B30A 3AR7A 1K1EA 3AR2A 3W5DA 4F72A 2OA0A 2HCFA 2FPXA 4AP9A 2R8XA 2C8KA 1T5TA 2R8ZA 4UU1A 4XQ0A 4YIKA 2O2XA 3I1YA 5AM0A 3J7TA 1L6RA 4EX6A 2WHEA 3EF0A 2R8EA 4G9BA 1CQZA 1VJ5A 3ONNA 5AW4A 1SWVA 3SD7A 3WKCA 2OM6A 3U26A 1ZD4A 2WF5A 5AI4A 4ZEWA 2C9MA 5JJBA 2FEAA 1MH9A 3FGOA 3F9RA 1NNLA 3ZTWA 2YY6A 2HO4A 3NIWA 4CF3A 5ALGA 1RKUA 3QXGA 2C8LA 1Z4JA 3NUQA 4BNDB 3L8HA 5AW9A 2C4NA 3A3YA 2RAVA 1RLMA 3ZTYA 3QUCA 3WKEA 1N8NA 3FVVA 4H1WA 3I76A 1TE2A 3QUQA 4Y2RA 4BKMA 2AMYA 3WK5A 5AKZA 4BX3A 3B9BA 3W5BA 3ET5A 5AK6A 2YJ4A 2EARA 1Z4LA 5ALWA 4YCNA 4XPZA 4QJBA 4CNQA 5AHXA 3A1DA 3KDPA 3WK7A 4UAVA 3B9RA 5AKHA 5AKYA 1RKVA 1RMTA 4UARA 4MWOA 3M9LA 4IG4A 5AW0A 3NALA 5ALHA 3E84A 2G08A 2I7DA 2WM8A 1Q91A 5AVYA 3ZVNA 4PNHA 3GYGA 4C4RA 5AVRA 5AVZA 1U2TA 1T9ZA 3N28A 2EAUA 3IRUA 3I28A 3SHQA 2FUCA 3U7FB 3AR6A 4BX2A 2D2VA 2BY4A 2MU1A 1Z5GA 3UMCA 2AUTA 5T41A 5AI5A 3ED5A 1YJ5A 3ZWKA 2NYVA 1T5SA 2O9JA 4OFZA 4Y2SA 3OCUA 3AR3A 1L7MA 2HF2A 1WPGA 3ESQA 2ODAA 3OCWA 2JAWA 2ZBEA 2YMQA 1QQ7A 5A3SA 1XPJA 4DCCA 5ALJA 4HGNA 4UW9A 3KBBA 5AI6A 5AVTA 2FPUA 5AW1A 2YMMA 2ZBFA 2IOFA 3N8GA 5ALKA 3AR8A 3R4CA 3WKBA 1ZD5A 1YV9A 2G80A 1ZRMA 4KN8A 3U13A 5IT0A 3FPBA 2YN4A 2QYHA 1YS9A 1NRWA 3WK6A 2P9JA 4IFTA 4O8CA 3E81A 4NFLA 5AK4A 4EX7A 3KD3A 3RF6A 3S6JA 2JGAA 3QLEA 3CZ4A 2GHTA 1YDFA 4Y2XA 5AKGA 2FUEA 3U7HB 1QH9A 3DNPA 1RQNA 2BDEA 5ALMA 2ZBGA 4RESA 4F71A 2G1AA 3BA6A 1ZOLA 3IJ5A 5AESA 1VJRA 1Z4NA 2I34A 2JAUA 5AI8A 3U7EB 2WFAA 5AVVA 2GO7A 2HX1A 3BWVA 5AM4A 1FEZA 4Y2YA 3E58A 4KX3A 1ZRNA 3P96A 1RMQA 4NABA 1NF2A 3L0BA 3OTQA 3OCZA 1YNSA 2IA5A 4Y2VA 2HOQA 2HHLA 4L57A 5AVWA 2FPSA 2WF6A 5ALUA 3ET4A 4XE5A 2G0AA 2HF7A 2C88A 5A3QA 3W5CA 4EELA 4UMFA 2HI0A 4YIHA 2YJ6A 2NO5A 2X4DA 1L7PA 3EWIA 4OCZA 3R09A 2OBBA 5ALXA 5IT4A 3U7GA 4UASA 5ALPA 4BEVA 3OPXA 2ZXEA 4YGYA 3KZXA 5AW2A 1O03A 3L1UA 2WF7A 1EK2A 3QU5A 1QYIA 1RDFA 5IS2A 3IB6A 3AR4A 4DW8A 2FDRA 5FP0A 2HEGA 2Q4TA 1XVIA 3ZUPA 4EEKA 2B82A 3TLMA 4OHFA 3WK9A 5E0OA 2YMPA 3AR9A 3FZQA 3FM9A 4HGRA 4ZEVA 2ZOSA 5ALNA 3L0CA 2CN1A 1Z4PX 3ZX4A 4CF4A 1Z4KA 4YCMA 5AKKA 1RPZA 4C4SA 1RC8A 2QLTA 3EF1A 1LVHA 4NWIA 1Z4QA 4GIBA 1QQ5A 1ZS9A 2RARA 2B0CA 4I9GA 1SWWA 3NASA 5A3RA 3ZW7A 2VKQA 2RBKA 3B8EA 1EK1A 5ALFA 3SF0A 4HGOA 1L8LA 2FPWA 4AS2A 4UM7A 3AR5A 3PDWA 3UM9A 2EATA 4B6JA 4BYGA 4DWOA 2P69A 3SKYA 1AQ6A 1PW5A 3OCVA 1CR6A 5ALLA 2MSNA 1XP5A 1LTQA 2RB5A 5AKXA 5AKLA 1RRCA 3WKDA 5ALVA 2ZG6A 2Q4RA 1L7NA 4FYPA 4Y2PA 2AGVA 3NANA 2W43A 4L6AA 4BBJA 4CE6A 4L6CA 3CNHA 4J03A 1U7OA 3QYPA 3DAOA 3L8GA 5ALTA 3DDHA 2IOFK 4AS3A 2I55A 3I6BA 4UAUA 4E88A 4GXTA 3ZI4A 3N07A 3L8FA 5ALIA 2W4MA 4HGQA 1VFPA 4JDPA 3QU7A 5AW3A 2DQSA 3K1ZA 4KX5A 2CFSA 5ALRA 2YJ5A 3UMBA 5ALYA 3L1VA 3MC1A 3A1CA 5AW5A 1WZCA 5AVQA 4XOUA 4BNDA 3HLTA 5AVXA 1F5SA 1S8OA 2W11A 3QU4A 4Y3UA 3R9KA 2NO4A 4QQFA 4Y2UA 1ZJJA 2JAOA 1U7PA 2IYEA 3U19A 2GHQA 2PR7A
chains in the Genus database with same CATH superfamily
3F47A 4E5KA 2R0QC 2RSLA 4KAXA 4WN3A 1UT5A 3KZNA 3O21A 3WLFA 4UZFA 2R4UA 3G0GA 5EE1A 2BUCA 3L8EA 3ZCQA 5E6UB 4AJNA 3I5UA 3FAKA 4BN0A 1PJAA 2J0EA 2G17A 5LQJA 3VYVA 2XE6A 1KO5A 1LKZA 2YHUA 4HEA6 2HMSA 3JARB 5HHTA 1P5JA 4ANFA 2E5FA 3EG5A 1QYXA 4BMVA 5LSAA 3CSSA 2X8JA 1X7XA 3AIMA 2FFHA 4L72A 3RKSA 1GKUB 2JF0A 3E35A 4HYTA 5DYNA 3ZQ6A 5K6RA 3AKEA 5I7FA 2IPMA 1IY9A 1YBAA 3GRKA 5DXAA 1L7QA 4OP2A 1V8FA 3BXPA 3R7SA 4BKOA 1OKKA 4XVUA 5JC1A 1SOMA 5I7EA 4MEAA 4DC9A 1C3VA 4RK1A 4E0BA 4BECA 5I47A 1R5NA 2O3TA 3NJ4A 1GPJA 1M66A 4I5DA 2YRXA 4QDJA 2X9LA 3SYRA 1NZFA 1FMJA 2ZIGA 3DTYA 1ZIOA 2CLIB 4H3HB 2VT7A 4R3WA 1B8VA 1YRBA 4DIKA 1C81A 4CMHA 4HG2A 1SVSA 4UM5A 2F43B 1KK1A 1P18A 1Z5NA 2R47A 2R85A 1MAWA 2G5GX 2WHQA 3BCUA 1JG7A 3DXYA 3U1BA 1CUYA 3LBAA 1M0EA 1QBKC 2Q21A 2HEIA 5IJXA 1VMEA 3ZXYA 1NW9B 4QLBA 3S1SA 3D3NA 5ILOA 3HHEA 5AP9A 4CCYA 1P6QA 4J1TA 2NZ8A 4IGAA 4NCJA 4EI8A 4QT0A 1U6JA 1MO4A 2E6KA 4XEUA 2IU3A 4K9OA 2MWMA 2JI8A 4UQLA 1SKAA 2R4QA 4K05A 4NOMA 3CLHA 1ORRA 2PBRA 3FLBA 3OESA 4X63A 1NJFA 2A14A 1LDEA 1P5RA 1CR2A 4AB1A 1O2DA 3JD0A 4BAZA 5TS2A 3IIKA 2C2HA 1RXUA 2QTRA 4K5QA 2YOFA 3OY2A 3T5CA 1LJ8A 1XZQA 1AHIA 2PV7A 2VP4A 4HAIA 5I8ZA 3KOOA 4D44A 4EHJA 3BRWA 5IF9A 2WJ6A 4Q15A 1NA5A 3CKMA 3SKXA 3B89A 3U9LA 1AXRA 1VSTA 3WGUA 1J8YF 1EXMA 5AVOA 1IXRC 1BROA 1H2WA 1F4VA 1YS6A 1I0LA 3AF3A 4FMDF 4MUMA 4WK2B 5KINB 1NYQA 3KJIA 1FIUA 1HGXA 2G4CA 2R7KA 3AEUB 4ZZ2A 3PGLA 3VPSA 5A0VA 3IJPA 1KJNA 3GJ4A 3O1JC 3D3WB 3TO5A 4EA9A 1K2WA 4TN5A 3WMEA 2CNNA 3ZPXA 1CUUA 2P27A 2PX4A 3ZBPA 1BZYA 4FKMA 1Z39A 3N6VA 4FBGA 3UMMA 4MGIR 3PDCA 1XXLA 5GIOE 3KZVA 5K0NA 1SXJD 2ZSUA 3ICPA 1PG0A 2Q5OA 6PFKA 1DT5A 3JWHA 4MGHA 1RXIA 2I29A 2QA5A 1XQXA 4NPHA 3LIIA 3WOVA 5IBCA 2HF8A 4DAOA 5IT5A 3F96A 4IKOA 5ECDA 1WZUA 3CVVA 4R7ZA 1VXOA 2NO6A 2OZLA 2VL7A 3GBVA 3TLKA 4CIXA 3U17A 1GQRA 3SR0A 1H69A 1UXOA 2ZS9A 4LS3A 4ABTA 1QO0A 1AIPA 5AOBA 2E5LB 2H65A 3GELA 4K6KA 4GZMA 4BXOB 3IHLA 5F2NA 3P20A 1E7QA 3M4ZA 4II2A 3ICOA 5EG5A 4E5MA 4YRNA 2OP0A 2AC4A 2LIPA 3O94A 4HMQA 5ESXA 2O20A 1X70A 1GAXA 3KQNA 3W5JA 2WJYA 3TVYA 4QG3A 4BP1A 4FE3A 3EASA 3LOPA 1CIPA 5GM2A 1DIOB 1Q7CA 1MQAA 3H5WA 3SEFA 5L3QB 2VSXA 2Q6IA 3QITA 1S0UA 5DT9A 1EYZA 1TZCA 4IL5A 1FFXA 1TCUA 5IBQA 5JFGA 4B2LA 3U4MA 1U7HA 4HHEA 3D5TA 2FEOA 3N2NA 2ZITA 2NNWB 2QMEA 3KXIA 3Q85A 4NJEA 3DL7A 4LDAA 3OIUA 2AF4C 2WIAA 4FYYA 5E38A 4D4LA 5L3ZA 1HWYA 2P0YA 3KR9A 3LVFO 4D82A 2WRZA 2C3YA 4IDEA 1NXTA 2QE7D 1QGYA 3EDQA 4O4IA 3ROFA 4JENA 2ATEA 3ZXIA 1C8BA 2CMGA 1O96A 1DFHA 2XKKA 3ECCA 3KKEA 3MK31 4F72A 1ZD1A 1QE3A 2CNDA 3K16A 3FUVA 4HFRA 3WIDA 3FPGA 4RM2A 3L6EA 2OOSA 3MAJA 4FMBB 5J2TF 2O0MA 3BAZA 1QTQA 2Y1OA 2EBHX 3D8SA 3Q12A 3H1EA 1ZZGA 2XUQA 3D4IA 1E3EA 2ZWOA 3IO5A 2AEMA 2HMWA 1OHHD 3PNMA 1QG4A 4MUBA 1A8HA 2WYHA 4C78A 1C9NA 3AL0C 4B48A 2C3OA 4TLLB 4HUJA 4PPYA 2OBFA 4XKJA 3GP3A 3KWJA 1ACLA 2OKCA 1DQSA 2OSBA 4P7FA 4D81A 1KVUA 2VP0A 3QKSA 1VE7A 3I3SR 3HXOA 1RP1A 3C98A 1UPXA 4HKTA 2XJ9A 4O2RA 4RMHA 5IH3A 4DBZA 3OFNA 5KTYA 4W5TA 3DWGA 3QLUC 1BHQ1 4OHCA 2YXNA 4JP5A 1RXWA 5ALGA 2C8LA 1Z4JA 2HRDA 1X87A 1LY1A 1EWYA 3I72A 4TMKA 1HPLA 4RD6A 3PHCA 3HDYA 5F7JA 3A2NA 1KO1A 4LYDA 4QDOA 4R7TA 2DUJA 1C3JA 5HX7A 1NASA 1DJQA 3MUOA 4I1YA 3V8QA 2IXDA 3GQBA 4AD8A 4DM4A 1DBVO 4PGGA 1P3JA 4XX1A 4IHJF 1B26A 1N8NA 3B60A 1NP7A 3NKLA 5GZ1A 3D7MA 3ZVRA 1Q7GA 4D3FA 3K1YA 1PSDA 4MPDA 4ZV9A 3LVQE 5FEUA 2R4TA 1RZRA 2BOVA 4YRQA 3CIOA 3N0WA 2WW8A 4J7CA 4U2EA 4U7JA 4BX3A 1DRWA 2WMYA 4QVKA 4UHHA 2OV6A 4X3CA 3NEJA 5KHLB 3D8UA 3PRYA 2X8JB 1X7XB 2FSPA 3MWEA 1YZFA 3W1EA 3MTQA 4CM8A 3ZJVA 1Z0KA 4J4HA 3QVGA 3TD6A 1RWKA 1Q12A 4K2HA 1DFIA 4PX2A 3WK7A 5CG2A 2I3AA 1T8UA 2QGNA 4RSGA 3G7NA 3VNSA 1P2FA 4XJVA 3K73O 2P6PA 1P9WA 3BULA 3MTGA 2OZEA 3PQ4A 1FNDA 2GR9A 4ITRC 5T4BA 5ICSA 3L4KA 2B5WA 3I01A 3GCZA 1H1LA 4LYYA 2I7DA 2WM8A 2POQX 1W34A 3N76A 1V9CA 1Q91A 2ZTSA 4F4UA 2DGDA 1JAIA 1UOOA 2XCSB 2Z0MA 3U49A 3GGSA 4L08A 1UJ6A 5FPQA 2C04A 1T9ZA 1E9EA 3W2IA 2LXNA 1E69A 4CHTA 3ROMA 2W6PA 1PNTA 2C2OA 2I62A 3HJBA 3W06A 4IX9A 2FUCA 1DX4A 2HRRA 3AR6A 5DX8A 5EIBC 4ZYUA 5IVKA 4D4MA 3R7WA 2MTBA 3T1OA 4WKOA 5HILA 1SH7A 3PVZA 1T34A 3T8YA 1ZJ5A 2ARKA 1DBRA 3CT4A 3UXEA 2PTHA 3JQ7A 4Y98A 1UZMA 3PHBE 3SIPA 3TBKA 3CE9A 4FFPA 3WB9A 1BNCA 1RPTA 2NSYA 4OGGA 1EFRA 4LF6B 1RE1A 1F0PA 2XX3A 3AUSA 3EGOA 1GL6A 1L7MA 2J30A 1ZEJA 2XIJA 3INRA 5CD9A 4H59A 1EUDA 2GBPA 4XYGA 4MWZA 4IF4A 3UWMA 1BYIA 5CXSA 4OJTA 5HKOA 1Y4UA 3C6BA 3M6MD 1FDRA 1TZBA 5J43A 5DMHA 4PYNA 4QOJA 2CSXA 5KREA 1W5AA 4ZVRA 3KBBA 1R0ZA 5I51A 4N65A 1WTAA 5DYIA 3W8NA 4QUJA 2KSQA 3CY6A 4ZVUA 2FSVC 5H68A 3HVKA 3RTDA 4CI0B 1W47A 2IOFA 4Q24A 2GO1A 2H4YA 4TWAA 5MGBA 4DZTA 5B5SA 1G3IA 2WTNA 1YMVA 4EI9A 5LKAA 3EMVA 1R4AA 1UOPA 1VMKA 4I1VA 1LDMA 1SU7A 3EXEA 4EJ6A 1KOFA 3Q3GE 4LDZA 1GEGA 3UBMA 2C20A 3IJRA 3ZD8A 1G8HA 3TQCA 3AF2A 4QPJC 4M8IA 1OLOA 4EX7A 3S6JA 3KL4A 2IC5A 5H5JA 5KNBA 3DUWA 4GOJA 3ZS8A 3D2BA 2EF0A 4LBYA 2HU2A 2VHEA 1PZHA 2HK7A 2Z6UA 2OZLB 1OTHA 3PUHA 1T4BA 2K5UA 4CL8A 3TUZC 2XADA 4AY4A 4XFDA 4CTJA 3EJWA 1NXOA 5DHTA 2GXUA 4AUEA 3U7HB 2CXHA 4RU1A 4E51A 4QGFA 2XA2A 3VNBA 3FETA 4HO1X 3FNEA 1IEWA 4DV1B 2NQ2C 5HGXA 2H3HA 4IXDA 2TMGA 3LUAA 4M1OA 1K3UB 5FBRB 4JJKA 4WBNA 5EJ6A 1I80A 2J0VA 2PNFA 3DFIA 3U40A 3ZBTA 1OWPA 4R83A 5AI8A 1P6XA 2W2OA 2ZWPA 4ZCIA 4JUDX 3BIWA 1FFXB 1L3IA 4O3FA 1LZLA 2BGIA 5E6RA 1RRPA 2L82A 1FS5A 3E9ZA 3H5LA 4I9UA 5IZCA 1EGMB 1X86B 4BNZA 1DDGA 1NF2A 3OLCX 4NJEB 3OE5A 3WZ2A 4YUZA 3OTQA 2ID9A 5KVQA 2O19A 3ZK9A 3GNTA 4PGHA 1CZOA 2IX9A 3B53X 4C3VA 3A25A 3U61B 1X1CA 4EY4A 4QNMA 2EGHA 2C00A 5ES3A 1J8FA 2BI7A 4Y6OA 3AT1A 2YIJA 1O96B 1XZKA 2HNBA 4C89A 2P0AA 2KS6A 3KEOA 3ZY5A 3VVMA 4O29A 2FVYA 3OBBA 3ORRA 1O94D 3VNUA 4KCGA 4AN4A 4UTRA 3VISA 4K3UA 2EFDB 3IERA 1ODFA 1QOPB 2A0WA 4OCZA 4CWAA 1XZCA 1JB1A 2AG1A 2QRZA 2ZDQA 3NHAA 121PA 3RKUA 3C6YA 3VYUB 3W3AD 1B15A 2FW9A 3TDNA 4YRFA 3L02A 4NCIA 5AW2A 2NSDA 4HD8A 2OQ2A 1PR4A 4FDTA 3QYJA 4MDYA 4MS1A 3QE0A 3GLIA 2FG6C 2WA1A 1MX3A 3I6ZA 2IYWA 4GBMA 4E31A 1CZRA 1J6UA 2X7JA 3B3QA 4QREA 4XSVA 4AYXA 4D3XA 4EVIA 3P9KA 2OESA 2M6KA 5JDIA 1D1SA 2PWYA 2JL1A 2R1TA 4PO8A 4OXNA 3QKSB 5BQOA 4C6TA 4DCOA 1HL7A 3ILXA 4IXMA 3ZI7A 3TX6A 1K5GA 2BKVA 4Z6KA 3LKBA 1U28A 2VJYA 3ORYA 5A04A 3ZG6A 2FFQA 2OBXA 1TPYA 2R6GA 1L7XA 1NNUA 2YQ5A 4UM9D 4IDAA 1JU3A 4EZIA 3IEIA 3DHEA 1I0IA 1UOQA 3FM9A 2VYQA 3PC2A 4HF7A 2FRVA 5KEIA 5EUMA 3F5FA 3KALA 3CX3A 4Q9HA 2G72A 1X1QA 2H1WA 1Z0AA 2C9ZA 4IOKA 2VUSA 4QICA 5FRDA 3DOEA 3O3NB 4G0NA 5B37A 3GQBB 4FFBA 3UO8B 1UPFA 2FFJA 3LPNA 4M7RA 4QEDA 4QDZA 4TSFA 5IUNC 1JQKA 3OEWA 5TV2A 5JS6A 4IRUB 4DQLA 5M29A 1JW9B 1D0SA 2AN4A 3AHFA 4HWPA 4HEA1 4YBRA 3WLHA 5ERGB 2BE9A 3N8IA 2R8PA 5KB3A 4GPBA 4CTKA 3KRTA 5CVEA 3J7AC 3FSJX 4FN5A 3H8SA 4R1OA 3IQDB 4MAFA 4R68A 4TS4A 4D9EA 3L6OO 4II3A 4C4ZA 1I2AA 4C30A 3INTA 3PDWA 1R5JA 2PYIA 3UM9A 1E66A 4ZVTA 5FBWB 1KAEA 2BTQA 2C99A 3KTAA 1U0EA 4R3UC 4RZSA 4XFJA 3MWEB 4Z8XA 3TI9A 1G0OA 1SC9A 2C5LA 1LFAA 2FMUA 4J0IA 3FCUB 2J3EA 1MP0A 3QVGB 1YACA 3FNIA 5FUVA 2EVWX 3HACA 4M22A 1TAQA 3RLIA 4EJSC 1QIIA 1CJMA 2RC6A 4XI9A 5CGZA 5AKXA 2R6JA 3O83A 4LTNA 3LYLA 3LW7A 4KYVA 1WDWB 1L7NA 5GPBA 3SE7A 4HWOA 2O4CA 4DJFC 5EZYB 3ZWNA 1B74A 4C03A 4N54A 3TTWA 2UU9B 1J2RA 4KXYA 1H1LB 2GERA 2LTAA 3VYSB 2XMGA 3KAQA 4HQLA 1EPUA 1FUEA 2QSJA 2PMCA 3BXGA 3QWIA 1NP3A 4EB8A 5L3SA 2PZKA 4YB8A 4ZANA 1ZLXA 3VR5D 2QPLA 4RIFA 4RPGA 3PLAE 3SVLA 1UQUA 4KLNA 1SQFA 2Q3HA 2VWHA 1KI2A 3QFSA 2PMEA 2PLAA 2QMYA 3K6RA 2HZ7A 1M8KA 3L8FA 3EVTA 5DM60 3R7WB 4GI3A 4MV4A 4YCDA 1W52X 5FI0B 4ACBA 2DQSA 3DE1X 1JDTA 3OOEA 4OAOA 1BXZA 4MVJI 3JQ7B 3QNWA 3THWA 1Q0PA 2MSEB 1F3LA 2NZVG 2XB4A 2XYPA 3I04A 5EJIA 4AQ7A 3S7TA 5DWDA 4R69A 2AD1A 1ULTA 1ZJYA 3PNOA 2NQTA 2OG2A 2KHZA 4LOHA 5HFNA 2IL1A 3FTCA 4CW7A 1S8OA 4F2WA 5BYAA 1RI2A 5IXYA 4DSOA 1CZKA 3W7AA 5F98A 2NO4A 2PZEA 5DDIP 1QF6A 1F4LA 1PL0A 1BXGA 2CLHB 4TPKA 1U7PA 4N7RA 5HZGA 3E2IA 4PC7A 3M7IA 4BIIA 4RF5A 2P4UA 5AVSA 2HM7A 1HEUA 1N8SA 4NMXB 2X3UA 3I0MA 2YZ7A 1TM3E 4H6VA 1QB8A 5LQSA 5LNK6 1THTA 1RXYA 2DPGA 3L0PA 4HDNA 3UBTA 4YLEA 3M3PA 1CY1A 4GMDA 3A3NA 4U7DA 2J9YB 4BYMA 3K6KA 3L0ZA 3GFVA 1WMDA 3QOYA 1YI0A 3J81k 3WC4A 3ENQA 3G8YA 3EXEB 5LZ2A 3X1WA 1OXMA 4CYMA 2DCUA 1R88A 3AF0A 3UXMA 5D5HA 3GXOA 5JATA 2ZRIA 3N1UA 4I5IA 1YA8A 2JH9A 3Q5EA 1M1XB 1SOWA 1L2TA 1ZA1A 2XE7A 3IKJA 3IXMA 2J7PA 3L0YA 3N87A 4N0MA 5J2UA 4JXXA 4AY6A 4BLPA 3L7KA 4XM1A 1M6WA 3RG2A 1BX0A 4Y1GA 4ZK6A 1NPYA 3DB2A 4MVJA 1R9MA 3M0EA 4L28A 3L8ZA 3IP7A 2ST1A 1V16A 3E5MA 3N0XA 2UYGA 4G81A 1M1YA 1ZWLA 1E64A 1N5KA 2ORWA 1RRGA 5LZ9A 1XBTA 1T2VA 2IHBA 1AUQA 3O1HB 5EC8A 3SWWA 4KR6A 3VX3A 2J9GA 4DTCA 4WBNB 2QLLA 4CN9A 1U4OA 5K05A 1JH9A 1Z2DA 4ESHA 2IIBA 2A1UA 2VA9A 4FR2A 1FUYB 3PIIA 5I9IA 5E6RB 5M7EA 3QLVC 4YT8A 2FF5A 8OHMA 4HGPA 1IK6A 2CXPA 1WE2A 1U1DA 2GH1A 1FVHA 4OHRA 4WOCA 2F17A 4I2NA 2GFHA 3RRFA 3TR6A 3EN0A 1BA2A 1E9BA 1M0SA 1NIPA 4JQCA 4LX0A 2WKSA 4WZZA 1W48A 4RGQA 1YZQA 5JVDB 2ZJAA 3GUZA 3PDUA 1J8DA 1ULAA 2DBYA 3A0UA 1F17A 3EULA 2XTAA 1FMTA 3USCS 5HUJA 3P27A 3MCVA 3LUKA 2JEZA 3DBRA 4GLFA 5K0CA 1SKMA 5EZYF 5EKUA 2QS9A 1YQGA 1M74A 1QTIA 3LKZA 3PJEA 4EUSA 1EVZA 1D7AA 4PQEA 1MN6A 2F1RA 5G53C 4Z4QA 5EE9A 1MMFB 4UATA 1QCZA 1C8LA 1PEDA 3GLIB 4I8IA 4NZYA 4XWYA 3D6JA 3JQCA 3PHLA 1NKSA 4ZKDA 5CTJA 3T1HB 1UP6A 2I2CA 4B2IA 2EHJA 1DRUA 2V7VA 4G6ZA 1PQWA 3EXG1 3WQBA 4JMPA 1UM9A 3AUFA 4FWBA 3EGVA 4A82A 2SKDA 3HADA 3U4GA 2O1SA 2JFNA 2CFTA 1B6RA 4CLEA 4LPSA 1H6DA 4AVYA 4HQ0A 2WLTA 5H9VA 1NX6A 4F7WA 1RZ3A 2QNIA 3GIDA 5J63A 1NV8A 1Z6TA 1JFLA 2H16A 4FIDA 1Y81A 4FE7A 4B3DA 4FK8A 1RAAA 4FFBB 3BXEA 1VTKA 2QTHA 5DLEA 5THXA 4FGLA 4RORA 2E4ZA 2Q9UA 1QIMA 3ZHQA 2EW1A 2IYFA 4HNRA 2H54A 1T8RA 1AB5A 3HI6A 3LX8A 4G0YA 4MJ3A 3Q7QA 1PDWA 1YQXA 3PXBA 3TKAA 2RCYA 3UH0A 4Z5XA 4HDAA 3OIYA 1YE3A 1V37A 5FA8A 4FZRA 5FIUA 1Y6QA 4G56A 1Z3IX 2KYRA 1AO0A 1X74A 4EGAA 1H2YA 1SULA 3Q87B 3SE0A 2IYZA 4OLJA 3WK4A 5LZ7A 4XRGA 1F2VA 2BTQB 3KTAB 3A1VA 4FWIB 4HAOA 4TXJA 1O97C 3W2HA 2PX8A 1V48A 1JFSA 4HXGA 4KQ1A 1ILWA 1HM5A 3OJOA 1I6LA 1PGPA 2ZUUA 1HC7A 1LQ2A 2VDQB 5BQ3A 2XD4A 3AR2A 1CR1A 1SCUB 4B0OA 2ZVJA 4N5NA 2ZRBA 3TOCA 3HB9A 5A4JA 1I4TD 3DAYA 3VKHA 4W9MC 3DAFA 3GMTA 1ZXBA 2XVYA 1IN4A 1NQVA 3IDAA 4HYEA 2CXXA 4PIMA 3WGGA 2IVFA 4WVFA 2VP2A 5JNUA 3V97A 4OXKA 5EP4A 3VHRA 4CR7A 2IV2X 5L3SB 3P4XA 3WAGA 3ORHA 4ZTZB 3HZOA 4YONB 1DNPA 3ONNA 3ZKAA 1JE1A 1VCOA 1WY5A 2XZDA 4IOJA 4RO0A 1XPUA 1IB6A 4DV5B 1S2GA 2WICA 5HZHA 2JFFA 2MYPA 3CRMA 2YDYA 3K6JA 5C4IA 4N5HX 1ODLA 1OA1A 2C4MA 4RCZA 2A3NA 1E3DA 2AYXA 2JHCA 4P81A 1F1BA 1TK9A 3E9CA 5AH0A 3NHWA 2L19A 3JWEA 3CBQA 4KOEC 1G8KA 4M99A 1KJIA 1W4LA 1E3IA 1JIJA 3QQ5A 4P22A 3VR3D 1F14A 3THWB 1JEJA 2HO4A 4PLHA 5AHRA 1QHYA 3PXGA 5JALA 3V7WA 3AOGA 4PX5A 3FOCA 2RAUA 4JC8A 4UHCA 4ZARA 3HCCA 2OFXA 1P4RA 3OMXA 2JFXA 2WU4A 3EEOA 1Y9DA 1FVFA 2XUZA 4DV4B 1Z7BA 4XGQA 2OR3A 2Q6OA 4DIBA 1BXGB 1N6PA 3QUCA 2CVOA 4PG5A 1HH4A 5JVDF 3WKEA 2PT7A 2BMWA 2OVFA 3FVWA 5MDHA 4PHTA 1OBVA 2RBGA 1H6AA 3QUQA 2PMFA 3ZIUA 5EKSA 4Q00A 3MTDA 3RNLA 1F8XA 1ANKA 2RHRA 4HDNB 3UXHA 2JEYA 4L4UA 1WJGA 3K9HA 3WK5A 3C1OA 1BDIA 2AJBA 4MUXA 1CNFA 3WG9A 1U3FA 3A27A 3AVUA 1NVTA 2R7AA 1I5RA 3WB0A 4LK2A 4WNYA 1A7KA 3K96A 2CD7A 1DV1A 3NPMA 4GLOA 2AZ4A 4QJBA 3TL6A 3AU9A 2CJFA 3DCYA 4KI7A 2BKEA 1GGVA 2RHLA 3OU7A 4NL4H 1RI3A 4FYIA 4TN1A 5DHFA 4GOND 3F4BA 5J2UB 4AY2A 4P33A 1XZMA 4YP6A 4B44A 1FP7A 1IBRA 3RHFA 3WIBA 1NUHA 5AW0A 3TE7A 4AG5A 2BFDA 1VG1A 3DLBA 3JQFA 3SXPA 5BPHA 3AM1A 3CXUA 4V03A 5GJVC 5BQ5A 3H1TA 4G07A 2V9CA 4KNYA 3WSTA 2H7VA 3NOOA 4QOFA 3HA3A 1V16B 1XCGB 1IY2A 3CB2A 1PQ4A 1GAQA 3WRXC 4WKNA 2NYRA 5CDFA 2Q5FA 5AVZA 1M1YB 4BKRA 1Z6QA 5B1EA 3TF5A 2FLVA 5KNDD 3JRXA 2ZM5A 1SKQA 3RVRA 2NOAA 1TU4A 2WJ4A 1GPUA 4KR3A 5KTSA 2A1UB 4NESA 3CNOA 1C9MA 1Z5GA 2E49A 3Q7IA 3UMCA 1R6AA 4MDEA 3VTZA 1N6NA 4E5SA 2AUTA 2HB6A 1N1EA 2CB9A 3JXEA 4DUGD 4RPHA 4RK4A 5KOJA 1E2FA 2NN3C 2OYSA 1ZJ4A 3TVTA 1HLDA 4ZCQA 4U5XA 3RFTA 2GBGA 2Z8XA 3KHSA 3LQ4A 2IUSA 3AU8A 3QOFA 4MVJG 3KXDA 4DNXA 4P7BA 1DIHA 2DU8A 1K5PA 2PFKA 4K26A 3P2OA 2YZNA 3LUBA 5LOVB 3MB5A 3CMMA 3C3MA 1ELOA 4FILA 4BMZA 4QHTA 4DCCA 2PLWA 3PJDA 3TDKA 4D9NA 1W4BA 1WVMA 3SBDA 4KYUA 2CNOA 3HGTA 3WLNA 3DBRB 1MA0A 3H2JA 1Q16A 1J0DA 1HNZB 1K9SA 4QJ5A 4ZVLA 3SEAA 4GYKA 4E6PA 3ZCXA 3TL2A 4BLSA 4NEGA 4LY9A 2C98A 4PAMA 4RM3A 3UMRA 1MNAA 5K3FA 3VDXA 2VSQA 3UENA 4OBBA 2PMKA 4MW4A 1EUCA 2NAFA 1XMPA 4LC0A 1OVMA 5H16A 5HZKA 2Z6AA 4G65A 1NRWA 2IP2A 2VATA 3IO3A 4XDYA 4PAQA 1IONA 4FGJA 5JNSA 4F46A 1M2KA 5CFOA 4HDRA 1GJRA 1UM9B 1F2UA 1O0SA 2H4HA 4GX2A 4PVCA 1KOLA 1NOJA 1RC0A 2DAPA 4C2AA 5B55A 3SC4A 1LNQA 3UTDA 4OPMA 1J9ZA 1Z62A 2PQ6A 5BV1A 3AJEA 3CH6A 5BW6B 5JAUA 4ZK2A 4QOGA 4BNXA 2ZBUA 3AKZA 3PXCX 2ZYIA 4X6UA 1YZGA 2I1VB 1EVIA 3OQ6A 4LTDA 1GWNA 4X61A 5ENDA 2HHJA 3BFJA 4CT0A 3KQKA 1MJFA 1KSHA 4P2GA 1JMYA 3H1AA 4NBNA 2OECA 3H97A 1SZPA 5EINA 1XUOA 3AESA 2X6RA 2ZSJA 3FUWA 3GEGA 4IYRA 5AUOB 3G2MA 2ZUTA 1TM7E 2GEJA 3RK1A 3INGA 4QFBA 1IVNA 2D0OB 1FEZA 4NZNA 3PUWA 1USUA 3HV2A 4WK0B 2P3SA 3MWGA 5K3OA 4DDWA 4UNNA 1XIVA 1Z12A 2UZ3A 3QE3A 1TVCA 2X5NA 5CH5A 1CY7A 2PYZA 3L0BA 4W7IA 3EFOA 4XVHA 4F93B 3MTBA 4P9NA 2IA5A 3UA3A 1A95A 2ZI6A 4RD0A 4BP9A 1OWNA 3LU1A 4M21A 1F4PA 2W6JA 5EXTA 4GMHA 2W2PA 2B0JA 5E2BA 2WE7A 1B41A 2PQ2A 1ISHA 3CPJB 4HJRA 2BM9A 3EA0A 2JFOA 1TF2A 3OO0A 5DNEA 2IXEA 1M9NA 2C88A 2Y1DA 2RJ3A 1AK1A 4E30A 1TZ2A 3REFA 1WOYA 3K9NA 2UVDA 3EWIA 1PLJA 3C15C 3KKOA 3X1KA 4ETMA 5LWHA 3AY7A 4ZI3A 1K66A 2JFHA 4GGOA 2XF2A 2ZE7A 4GGPA 2CCKA 3ZY6A 4YV0A 4C0XA 3OOJA 2Y1LA 3ACBA 4NHEA 3OQIA 1G98A 1KO4A 4NBRA 1TEXA 4NNPA 4HT3B 5AK5A 3AKDA 3RGWS 1NN0A 1GGJA 1ML3A 1FDUA 1VLQA 2AX4A 2XNCA 1ZUIA 1IQRA 2PPLA 3QIAA 2GARA 4WA8A 4N1AA 1DC4A 1QK5A 4J0EA 5C4MA 2H1OA 1U7XA 4JJ7A 4QYTA 2Y27A 3WMRA 3K35A 2LBPA 5ENVA 1ULHA 4KUHA 5FP0A 4X6LA 4G4JA 3IGFA 5ANRB 1QAOA 1XFDA 2X2EA 4V2UA 5HIIA 1DOAA 3TLMA 4DABA 5BRNA 2XNJA 4BEBA 5FBZA 2C4WA 2W2NA 2O1EA 1NI3A 4AJEA 4D9CA 2YKGA 5E6SA 1SU8A 1E3TA 2OZVA 3ROTA 5ITVA 3IESA 4IMRA 5BSRA 4EDFA 2FYTA 1DCKA 2XXJA 1R15A 1TUIA 1K2VN 1U3TA 2FZWA 4YAFA 3NHMA 3DE3X 1VSQA 1R8YA 1P72A 2RJOA 3EAGA 1R6UA 3I1FA 3B8EA 3TOVA 3TXXA 1ONBA 2QZPA 3SM9A 3MWKA 2PRJA 1R0CA 4OM7A 5BSUA 5JD5A 2P3LA 4LSZA 3EPLA 4F56A 3DZCA 2WMDA 2AC7A 2FXIA 4CM6A 2A33A 2HQSA 5K2MA 3KB8A 2R751 1CUGA 1OLXA 3DH0A 3X3HA 4P54A 3NNSA 5KJFA 2C03A 2QR2A 3DXZA 4C4AA 2DBRA 1NMSA 1D0IA 1U2PA 2FOXA 2PWPA 5EJEA 1G66A 1SXQA 3OJFA 4YJ2F 5TQ2A 2RGGA 2Q62A 1I1HA 3D1JA 1XZHA 2QMOA 3FKJA 3OICA 1FA9A 3P0JA 1NN3A 2FFRA 221PA 4F92B 4G2TA 3BK1A 4M2LA 3HWRA 2BFDB 1N5LA 4BMOB 4WKBA 3ZHRA 1GPNA 5T67A 3OFJA 1GZSA 1S2DA 3QVVA 2D1TA 5KYNA 2JGEA 2OHVA 2GF2A 3AHEA 4DT1A 4PU0A 4RHCA 2ZSEA 2VIIA 1VLJA 4JUIA 5JS1A 3WIOA 1FBNA 4NCXA 4BFCA 1CR4A 3KZKA 4EK9A 1DQRA 2W2LD 3SC6A 1JEDA 3OIFA 4GQBA 2D62A 1F8FA 4XRRA 2ZE5A 4ABYA 4IQ0A 1VFPA 2HJWA 3B2NA 1RI4A 1KR2A 1GADO 2NT4A 4MI9A 1PT5A 2J07A 3BBLA 1X92A 3QBTA 4BKQA 2ISSD 1ADCA 1ZMBA 3JX9A 1CJUC 1ZNQO 5FPHA 2VEDA 2YOHA 4TTSA 1WD5A 3CEMA 4K9MA 4GYWA 1F5SA 1O54A 4H6XA 4DY6A 1JDJA 2V45A 2HWWA 4L74A 3RC8A 1RWMA 1V1JA 5K3DA 5BSKA 2Q4EA 5DOZA 1C4KA 4LOAA 2C0CA 3UF0A 3OCUA 3RPEA 4DPMA 3C7CB 1GCAA 4B87A 1D0VA 5BNIA 1OVGA 2PG3A 3G9ZA 4AO6A 5A71A 1A7AA 3VGJA 4BNMA 1IN6A 1ISIA 3P2JA 3EVNA 3M1YA 3E1SA 4GMXA 2C59A 4ML3A 5DGCA 5C0OE 1NQAO 3W9SA 3WLOA 1UKEA 1FRNA 1X80B 1H8ED 1DRJA 5AIBA 3PNLA 4RIIA 4K1LA 3WSVA 3WQHA 1P19A 1K3TA 1WMSA 5K3FB 1TJ4A 4B79A 4PONA 1JLRA 3LXMA 1ZAYA 4D26A 2X4GA 3BGIA 1JHAA 4IIYA 4HATA 4JYBA 4LOIA 1EUCB 2GZAA 4DR6B 3LJKA 5CIYA 2PKYX 3I61A 1UKYA 4O4LA 2QTVA 3GR6A 2VRNA 3TB4A 2GJSA 2OB1A 3D9QX 4YYEA 1HNWB 3FFAA 2QRVA 4MYHA 4Q1AA 4KO3S 3OHMA 3MM4A 5TQVA 2DYKA 3O3OB 3ASYA 4HDRB 2ZYAA 5AM1A 1F2UB 3R7LA 4KR7A 4HXEB 1TVKA 3AC0A 5HEKA 1NU6A 3ZQ4A 4W5OA 1PWXA 1XQWA 5E2AA 4V0ME 3HU1A 1SCQA 4KVZA 2F55A 2EFEB 2P9GA 3OBIA 5AM5A 1YU6A 3DEAA 1IZ9A 1FK8A 4H18A 2VHCA 4O2AA 4H7HA 3WGJA 1CUAA 3QVKA 3TNFA 4EA7A 4EVSA 1Z7EA 1JWLA 2JGNA 4JJGA 2DXIA 1SQ0A 1TXGA 521PA 3DP7A 1R5BA 3LYHA 2FK8A 2WDZA 1A5SB 3AESB 2I8AA 4FPXA 2IT1A 4AURA 1VHWA 5LP6C 4NMHA 2IX3A 2O8NA 3IPAA 4F85A 3T4EA 3OEHA 2ZIFA 1ZD9A 3CNBA 3SMVA 9GPBA 3AEXA 4DA9A 4PSCA 5K5EA 2QU8A 3JTEA 2G09A 4GO1A 3KVNA 1WUKS 2WFZA 3HYTA 3EFOB 1CWUA 1HNXB 3GVCA 5AHOA 3IAM1 1NPTO 4QFDA 3GRZA 1Y4ZA 3ZYZA 3RBAA 5KSWB 3EQZA 1IOLA 3ZCRA 1G2OA 4IQFA 1BVRA 4GUDA 2QI9C 5CNJA 3WLEA 2XA9A 3CISA 2I99A 3EDMA 1Y8RA 3IT3A 3KB6A 2K7ZA 4TTQA 3TFQA 5DM70 4YDHB 3D8TA 4GKAA 1XR3A 3I2YX 4F4DA 3CKLA 2I76A 1QBGA 2MR5A 2LR0A 3H5VA 4GI7A 4HFNA 5E1DA 5C1DA 1F48A 1ZWKA 1ZD2P 4LEIA 4BVBA 4FFDA 1E3MA 1FY2A 3A36A 3QNMA 4BAGA 3MTEA 1QXSA 3KIPA 5IG2A 4O33A 5DYYA 4RWZA 2CHGA 3OQIB 4FKBA 4Y67A 3OIVA 2KWIA 1N7GA 3JR7A 3GPIA 1V35A 2P30A 2D2XA 3DKIA 5EJ8A 2ALJA 1JVSA 2JAPA 4JYZA 4ZO8A 4PTYA 4DRXA 1XMQB 4Z7JA 2I7TA 2O07A 3KVVA 3LI2A 4P80A 1WW8A 5JZOA 3WDMA 2F2TA 2KMLA 2AKEA 1C1YA 3FVQA 5AJYA 3V42A 3NKFA 3O4JA 1T4CA 1XTBA 3H0KA 5JJKA 1RQRA 4R9UC 2I2BA 2OMEA 3RANA 3QFCA 3QMWA 3MQ2A 5EJFA 1HOTA 1LBIA 1HXHA 2P78A 1P4AA 4P0PB 3L7MA 4KXLA 4QLAA 4W8GA 3K2BA 3WZLA 5I7WA 4DR3B 3ZVMA 4OQMA 2FR0A 1KKUA 3NWPA 5E6SB 3U81A 1QQTA 2VTDA 4Z4FA 4ZVPA 2WE8A 4BQQA 3TZKA 1J06A 4J9VA 2QHXA 4Y6SA 5G3YA 1B93A 1ZISA 2GPSA 5J40A 5EQJB 2AK3A 1MLDA 1UBFA 5MN4A 3NFRA 1FS4A 3KOMA 1MENA 2FLKA 3F3KA 1K6IA 1J42A 1FTYA 1UPBA 2PEZA 3VNRA 1D04A 5JSFA 1O4VA 1DOHA 1TT5A 4G89A 2GETA 3GT0A 2BFPA 4V0QA 3AV0B 1NJ5A 1K27A 3S81A 1G7RA 1RYEA 1NLFA 3CG0A 2P9HA 1KFCB 2IWRA 3VR2A 1O9BA 1W49A 4UQPA 3OTOB 3TIIA 3WL6A 1DRKA 2M2IA 1J2JA 4A0GA 3DDNA 4LDRA 5EIXA 1W76A 2OHXA 3RW9A 5CB0A 1ZESA 3EY9A 2HDOA 3U16A 2RHCA 1HBJA 1OLXB 1DAFA 3C14C 1XQYA 1J97A 2W2MA 1FU4A 4FOOA 4RETA 5AW6A 4EHLA 4U1RA 3KUCA 2ECKA 4B74A 2V7EA 5TQ2B 2GTIA 3HU3A 3DLTA 2G71A 1ECCA 4RHTA 4N47A 2WT9A 2JFWA 5DJ5A 1Q44A 4RVOA 3MHPA 2P8SA 5AHWA 5NULA 4Y6RA 2VAPA 3RSCA 1ZY2A 2I6SA 5H82A 1GFSA 3NTUA 4BFVA 5JAZA 1H9BA 5TMEA 4BGDA 3JYQA 1V2GA 3H9GA 4DT1B 3RJMA 3UB4A 3AJDA 3CLSC 4QOSA 5KJEA 4IIXA 1OI4A 3V3KA 4ASUA 3PXEA 2YWFA 1GZ5A 5KNDH 1E6KA 1IVSA 2I1WA 1GG2A 3KOWA 4QC2A 4FS3A 1M7HA 2YY6A 3H1GA 3LY9A 1J0AA 4ZGBA 1MV8A 3H18A 3JRWA 4R6WA 3R7FA 3IL2A 4DR1B 4RJ2A 5TSDA 1BMQA 3COSA 2C1EA 4DPKA 1U0BB 2XNKA 2R3SA 2Q0SA 5EP1A 4ZU1X 3MGGA 1H93A 3QXGA 4IHAA 4WTOA 4Z9BA 5JR3A 2DOKA 2O3JA 3TM5A 4L9RA 3RODA 5CPBA 2ZTUA 2V4MA 3UEOA 3VMMA 1M0WA 2Y1CA 4PC3A 4IJQA 1WDKA 3IOBA 1VG8A 1V26A 1TM4E 4H1WA 2D7JA 4OAQA 4GPD1 4N8SA 5J23A 2QQFA 1IBLB 4JB2A 4WKGA 4YC7A 3UH1A 2NG1A 1EFPB 1ZM9A 2I7VA 3PTZA 2DB3A 4RYLA 1S3IA 5KUTA 3FNHA 1YVUA 3HJTA 4TYPA 5CXUA 5JUWA 3FSRA 2IGTA 2HA2A 5H59A 3ABQB 3Q40A 3Q98A 4E12A 1CJCA 1RZVA 1AKWA 3NR2A 4RZIA 3WYNA 2XMDA 3HUEA 4XPZA 1FYFA 1MD9A 5EQTA 4D97A 4HWRA 4O4LB 4LXHA 4O5AA 1H4SA 2XAAA 4CMBA 2QN1A 4GKBA 2CLEB 3HBAA 3T7JA 2C5FA 3U44A 1PVVA 4LNAA 3RVOA 2BT4A 4RX1A 5A3VA 4XYLA 1WMAA 1MX1A 4M4SA 1Z36A 2A88A 4J91A 1TVKB 1Z68A 4EMTA 1LC0A 3TIGA 3WNCA 3UWKA 1CETA 1HLPA 4GSYA 4MI6A 1ISJA 2DUMA 3NALA 4WZ6A 1W36D 4OMUA 2O2CA 1TTQB 5LC1A 2XCTB 2PFGA 3NGXA 4MEJA 2HH9A 1E5XA 1QX3A 4O2AB 2VWQA 4PNHA 3TJMA 4FC6A 4H7PA 4C4RA 2BP7B 2GOYA 2QUHA 2XQVA 3C6XA 3N28A 1NUSA 2AR7A 5JO9A 4M54A 5F12A 4WBXC 3SVZA 1M6NA 3AGQA 5EHZA 2Y05A 4UHJA 3SHQA 1U5AA 1AKYA 2G67A 2IF2A 1NXSA 2UYOA 3QPUA 1VZ3A 2JRCA 4DBVO 1A5TA 1P1CA 1F2TA 1WDTA 3GF4A 1DMSA 3BCHA 4YMGA 1PR3A 2VLBA 1WPQA 3VH4A 1GVNB 1ZM7A 4XJTA 3VZRA 1DEHA 1UBNA 1UT6A 1VL1A 2AE1A 2R7NA 2RJNA 1CVRA 1C9EA 2XOEA 4X9XA 5HE9A 1YJ5A 4MWDA 5KSPA 3T1QA 3UB3A 3ZWKA 2NYAA 4G8BA 2E37A 2O9JA 1QNFA 3PG5A 3UXYA 4B0PA 1L8XA 3NNDA 4Q3DA 4PW0A 2ECFA 2Z3WA 2PIDA 1EX7A 3ZWMA 1HSZA 1NBWB 3GEHA 1PSZA 4I6EA 5FOUA 4UOQA 2WP0A 4JZKA 3HCWA 4W1RA 4ENWA 3CA8A 5FLYA 3VNVA 1Y8RB 2P2SA 3Q6MA 5A3SA 2FFAA 3C1TA 3V7UA 2FH5B 2FV8A 3CSDA 5AI6A 2J48A 1FRVA 1JQ5A 1TM1E 4OL9A 4IOLA 3RFVA 4AYTA 3QA9A 1HSOA 3CU5A 3Q2KA 1Z73A 3E9NA 2M6RA 5FAXA 1R7RA 1V5FA 4BWGA 3T7DA 1A7JA 2QGZA 4PIPA 2WJIA 3BD7A 3CZAA 1RWWA 1ZRMA 3RU7A 2ZZNA 3P1JA 4GH5A 2DY1A 4WXMA 4D9HA 5LQRA 2D2FA 2QDKA 2OK8A 2WBLC 5DULA 4MQMA 2B36A 3DHWC 4DRXB 2GK4A 4A6EA 4J4TA 4A7PA 5AK4A 4B73A 2AB0A 4PZEA 1FMLA 4RPLA 5CEJA 4BMDA 5KTRA 4IILA 2CL6X 1T4CB 1VPWA 1Y0BA 1QDUA 2DHRA 1MB3A 2WOJA 3A4LA 4I6GA 4YRRA 1HQYE 1FU7A 1SCKA 4F0JA 1TCVA 1X8XA 5DXJA 3GIWA 1N34B 5TVKA 5J4YA 2ZIUB 4R1TA 5BWLA 1K98A 2VO1A 1RT9A 2QUIA 3OZCA 1UM8A 1PJZA 4R9VA 1TEHA 1BX1A 1K7SN 3AJ8A 4IIEA 4MRMB 5D7NA 2FPLA 2DTXA 2FUG6 4CLOA 4UBMA 4H1UA 4CI9A 2F6RA 3BA6A 1JFFB 3RM3A 4LG1A 4L0CA 4W6QA 4LSMA 1VI6A 2HSDA 1BJRE 2JASA 4Q5IA 4UCFA 4UUOA 3TQRA 3U3RA 4YRSA 2A9QA 2YWHA 4BO7A 5ISMA 1GTL1 1YFZA 2IELA 1TT5B 5HF6A 1GZHB 4AL4A 5DP2A 1HZZC 3Q7PA 1DJLA 1JHPA 4LPKA 3TZCA 3IT2A 1R0RE 2BW0A 1BHSA 3WLAA 4Y2YA 1OAOC 4F04A 4YMSA 3IH5A 5HJ5A 1AHHA 5F2EA 5FHRA 3CFYA 3NYRA 3IULA 3OFVA 2PMWB 3OMLA 1CDZA 3TFOA 4OBXA 1E98A 2VHZA 4F1WA 1PK7A 4RF2A 4PC2A 2WSIA 1SUFA 2F3QA 4K6CA 2O8DB 1E3QA 1YRWA 3RYFA 1AZTA 1ZIPA 2OAQ1 2JGLA 3ZUGA 4BTLA 3KUUA 1AVTA 4O4LF 3PGKA 4NAHA 4TKMA 1RCFA 4XE5A 1XTTA 3NONA 4GSKA 5BVHA 3C16C 3E2MA 4J29A 1MX5A 1XRPA 3HMKA 2HQOA 1WXEA 1Y34E 3RUFA 2QBYA 4CKBA 1ULUA 3CWCA 1NW4A 3S68A 1OKKD 3F7OA 3IB3A 4EKIA 2QTCA 2IYUA 4JDUA 1LSOA 2RBEA 4QQKA 4OSEA 3WMWA 4AG6A 1JJFA 3UUWA 5ECWA 1DL5A 1GP2A 1O03A 3I5XA 3KS9A 2AI1A 4Q9AA 1OILA 3L1UA 2QL5A 3MOIA 3K3PA 3O1LA 1QWSA 4NF2A 4O2AF 2EZUA 3DQQA 3IP6A 4XCXA 4ZVVA 4CN8A 4Y0NA 2GN4A 4F3CA 4R2IA 2QNBA 5JWRA 1MC8A 2VDPB 3UGTA 1DBSA 2ZBPA 1XQ6A 1Y63A 1LSUA 1VE5A 2PGJA 3GMDA 2JFGA 4FSHA 4GOXA 4W4TA 2EFYA 3LQYA 2IU0A 3SN6A 4S05A 3F46A 4JGIA 2YXEA 1JI3A 2WNIA 4JJZA 4KGXA 4QD3A 1KZHA 3DULA 3L8DA 1V2HE 3N2ZB 1NFQA 5LCXA 2Q2WA 2UYYA 2EJTA 5F3WB 4Y6GB 3NDRA 3EZ9A 2D8MA 4FYVA 4CNBA 4C0LA 5F5XA 2AFHB 5EQFA 2VAXA 1ZITA 5C3UA 1CY8A 1NE2A 2ATXA 1XJQA 3RCBA 5HJEA 2F9MA 1P2VA 3GC6A 1LVHA 4UNQA 1Z4QA 5JCOA 2P35A 3W6NA 2EZ8A 3LQ1A 7AT1A 2B0CA 2H0RA 4I9GA 5DXFA 4HPXB 4BN4A 2FW7A 4E03A 5JE8A 4J2OA 1NKTA 3EGXA 2J09A 4JI6B 3QFRA 3QXXA 1M6HA 2RI6A 2H2AA 3D6FA 3BRWD 1UK8A 2RH9B 3CNNA 1XRSB 4HQOA 3A7DA 2C4HA 3S55A 2YFQA 4OATA 1C4XA 1W1WA 2A9JA 2AK2A 1YB6A 2P8JA 3HNPA 2VZ8A 5DBGA 4US2R 5B3LA 4PLVA 5GQSA 3I30X 1WMFA 2A0XA 5SV2A 3IPCA 2X41A 2FR1A 1ECGA 2Q9CA 1REQB 2FWJA 1KH3A 1CE8A 4DLPA 4HVCA 5K0FA 1OPXA 3PR1A 2FSUA 4PE5B 4W1SA 4DEVA 3V7FA 4QPCA 1OGYA 3NYIA 1I7NA 3U44B 1QCDA 4YCBA 1Q22A 1ISFA 4RYDA 3MTAA 3NTVA 4XGNA 3ZQKA 1SB8A 2BZ1A 1M8PA 4MWCA 5KSOA 4J0JA 2E0IA 2HSWA 5DSZA 3GD5A 3QE2A 5DASA 3E3NA 1I5EA 1L4BA 5T57A 1C9DB 2IOFK 1D4AA 2C2XA 4HGZA 2DG2A 2YNMA 1BEUB 5F4BA 2Q3DA 4HQ6A 1X1EA 4OB7A 2ZUFA 2A78A 1N0WA 3IQFA 4MZDA 4QUKA 1VJ0A 1KY2A 5AQ1A 1QO0D 4KFSA 1SUIA 5FF9A 4YP5A 4F8JA 3T4PA 4G24A 1ZKMA 4KTTE 3HCBA 5F23A 2H4WA 3WRXA 1KJ8A 1F2TB 1LI5A 3F7NA 1Y82A 5GAJA 3W34A 1VOTA 4BV9A 1FMCA 3UWOA 1LCIA 1DWPA 7YASA 1I0ZA 2XQGA 2NIPA 1JFVA 2YJ5A 5TPZA 1NBMD 1J33A 5EE5B 3DAPA 4DIUA 4PSAA 5ICEA 2XUHA 4CL0A 1ZHOA 2VP9A 3LT4A 3P45A 3GLGE 2Z9DA 5DT2A 4HBGA 4BNTA 3SEQA 4NK4A 4E94A 2D54A 2PX6A 5KPDA 2VHYA 2IDMA 1E0KA 3BIJA 1A96A 4JL6A 2VFAA 3R7NA 4KH0A 1WNFA 2B6NA 4HDOB 1ID1A 1LU9A 4IRMA 5LQAA 2GZRA 1KJ9A 2PR7A 4U3JA 5FTWA 4AUKA 5GJBA 4Z9YA 4ISCA 5HM6A 3A1WA 2V0CA 1KMNA 5EWMA 4R3NA 2BBSA 4QYXA 2YFYA 4JT4A 2OVBA 4DKJA 2XMSA 4K0RA 4BC1A 1XKQA 4KMOA 4XUGB 2RAPA 4UEQA 3AG6A 1OFGA 1Y8AA 1RHJA 2ZSHA 4NHOA 3CF6R 3U5ZB 2G06A 3ZDXB 1A1SA 4CV3A 4JX9A 2UVPA 3OF5A 4TTAA 3FF4A 2GPAA 1UPAA 2ZSAA 4EPRA 4MGYR 5JFTA 2WWWA 4GZLA 1NHGA 5JNLA 1LQUA 5KVVA 3JQAA 5EJ2A 4ALMA 5CDUA 4TLCA 2OLEA 4R1MA 1F5NA 1NVFA 3UZUA 1T1SA 1H5QA 1GU1A 2ZRHA 3ZU6A 3IAS6 1CDDA 2JIZA 2QRLA 1ZK1A 2YZGA 2XUIA 3RUAA 3VPXA 1RPAA 2IODA 2MOKA 1SUPA 3OFND 4CLOB 1P31A 2J67A 3BERA 3BWEA 3CWZA 4P4UA 1G8PA 4E13A 1STOA 5TX7A 3T12A 4F38A 4PGFA 4XWKA 2IEGA 4N7JA 1I3OA 1VI2A 4KQKA 3GRFA 2ORYA 2ZJ3A 1I3MA 5CW2A 4ESVA 2N0SA 4FLMA 5K45A 2Z8ZA 1ZFNA 2A86A 2O2GA 3SJZA 3QVJA 4OBEA 1U0JA 4LWQA 1OAAA 2GI4A 3IEPA 4HN2A 4Q3BA 4R9RA 1U2SA 5MFPA 5E9JA 5IJ0A 1AA9A 4AKTA 3T6KA 1RZRD 5IASA 4IQ4A 5L4LA 3AIIA 1ESNA 5B7QA 5HOQA 3RYIA 3ZWXA 1MEJA 4R8MA 1RWNA 1FQWA 4J0FA 3LY8A 4FFMA 3RYFB 3ETJA 2C4TA 1A9PA 4K1XA 1L7RA 4FCVA 4ZOAA 1MXHA 4FDMA 3H11A 1G9XA 3IALA 4K9PA 4Q21A 4QPPA 4QYIA 3GGPA 4WLVA 5D87A 1QAMA 1WMEA 5GZ6A 2I6FA 4OY3A 1P74A 2QB5A 3LZCA 2QBYB 1QYVA 2PSHA 1XCBA 4LDPA 3TD2A 4CKBB 3BFKA 2CEAA 2WJWA 3QENA 1X1SA 3PF9A 2HRQA 4MB6A 1JF8A 3T5TA 3QXSA 5AKJA 3OQNA 2Y3IA 3EVGA 2E1PA 4IJWA 3I52A 4TKUA 4L0MA 4JLKA 5IT9A 2V5UA 1RVDA 4E46A 2JS7A 3WX0A 1SG0A 3RFCA 4BVGA 1AY0A 5BMVA 3A1TA 1TLTA 3LPDA 3PUVA 3QFTA 3HN7A 3LUCA 4R1SA 2WU0A 4KBGA 1FFYA 2YHAA 1Y9JA 1PJ8A 1WX1A 1X8KA 3C5WP 3QKTA 1H2HA 3QXHA 4RD3A 1IH8A 1GL3A 2Q29A 3I5YA 2GUGA 2BBWA 3ICWA 2AEEA 3LF1A 3EAFA 2YV1A 5DEIA 2F8SA 4G8CA 1KNQA 4XIJA 1XZPA 2DE0X 1BWSA 5E95A 3IHKA 3KKLA 4HQNA 3TMYA 3I4CA 4N6NA 3GWGA 4ZT2A 4ENRA 3AF5A 1XF9A 2ZUCA 5KSYA 3L6BA 1T4GA 4AF7A 4B4VA 1FXUA 2OCPA 1XALA 2WJGA 4R2WA 4EY7A 4OX9Y 3T06B 3LX6A 1A82A 1EFRD 4OHWA 4RKWA 1Z5OA 2HSJA 4OBWA 5ESRA 2I0FA 1M8GA 1OV4A 1DEAA 1U2GC 2FG7C 2XT0A 3VOAA 5IEBA 2V98A 3EGXB 5BURA 1AS3A 1ZKDA 1R12A 2FSIA 1I2BA 3BH7A 5CR9A 4GKJB 4RJIA 3T35A 1E6UA 4C3OB 1EHYA 5IM5A 3TZHA 2SBTA 4U00A 2H31A 1JV2B 1WD7A 3I92A 2OGTA 1B16A 4DCTA 4B6FA 1T25A 4FUTA 1UBHS 2XIQA 1UBMS 2C9BA 5IARA 2Q3EA 4BV3A 1CE8B 2WWGA 1X2EA 2YICA 1PNOA 1YK0A 4Z4GA 2OP1A 2IUYA 3L4JA 2A6PA 5K4AA 1LH0A 3IMKA 4A2QA 1LPOA 3H8JA 3H7IA 3QBDA 4L3VA 2PXHA 4RA9A 2OA0A 3KT8A 1DTSA 1XMVA 4RL4A 4G9EA 3I2FA 1XTJA 3CN7A 1P1JA 2PKQP 2ZRDA 1P91A 1PR0A 2R8ZA 3K4PA 1XJ5A 3DHVA 5I9LA 4IWYA 3CTPA 4BFUA 1TGVA 2WIGA 5KNBD 2FQQA 1XO1A 4QE3A 4LYHA 3T5DA 3LRXA 3EXIB 3NS7A 2PZJA 4TXHA 5JMTA 4MQEB 1TTPB 1IPHA 1S7CA 2H4JA 3UK7A 3ABSB 5JZVA 1VRCA 2A0FA 5LU8A 2MCFA 5LMCA 3HB0A 2PH7A 1QVWA 2JCYA 3H0CA 3KYBA 4PZPA 2UYQA 3DLIA 4ROSA 5AR1A 1QGOA 1EP1B 1D3AA 4D42A 4ENSA 1BRTA 3N8DA 1UANA 5BV0A 1Z5PA 2Q5JA 3IV6A 2QVYX 1J1ZA 3BCRA 4ALLA 1JGTA 2IEBA 3K1TA 4WY8A 1TTHA 1TF7A 3AZQA 3RS9A 3V3TA 4M6WA 1ZMRA 4PF1A 4GP9A 5E4TA 1ISPA 3DR3A 1WCIA 1Z7YA 2FEKA 3DTTA 4OHMA 2SNIE 5THKA 3ENWA 5ITZA 2HXSA 1AGXA 2RIRA 5KAMA 1EE1A 2EGGA 3O93A 4AK9A 4DLWA 2B21A 4M0FA 1ODKA 2HA7A 2Z83A 3IDOA 1EZ4A 4H7JA 3KSUA 4U3JB 2ZVPX 3SAJA 1PZGA 3SF8A 3H7AA 5JSQA 1BEZA 1XTQA 5EWMB 2W6ZA 1QYCA 1TAGA 3D64A 3H1FA 3TPCA 2I1LA 2D2EA 3UWPA 2AMYA 1E3JA 3CKKA 4R2HA 1POXA 1Y1QA 1QRUA 1DO2A 2IYYA 4KK3A 3IAUA 4DZRA 2Z1MA 1BE1A 1LK7A 2XSZA 1KIFA 3LPAA 3GNLA 3A9RA 2Y4OA 1FOEB 1V11A 2UVPB 3ZZ0A 5AXCA 5AHXA 4AJKA 2DR2A 4KN9S 2JNWA 4LMRA 5ILQA 1NW3A 5AKYA 5G40A 1QZXA 3JQAB 4Q02A 3ETCA 4AU1A 3RK0A 1NWCA 3O2SB 3LDGA 3HC7A 4ZAXA 5K8LA 2ZAGA 1K6XA 1LS6A 3GLHA 4RDXA 4FYHA 4EW2A 1BMTA 2FUG1 4RIHA 3IBYA 3U9TA 2VNSA 1WZIA 1QZUA 3FHLA 4Z0TA 4D7AA 5FWNA 1JEAA 3WWOA 4D3ZA 4G5RA 4OKNA 1Z8FA 1FLAA 1N2CA 5CRIA 4GM1A 3EB9A 4N9WA 3GUYA 3NVMB 2A4MA 1YQDA 3EMDA 2WY2D 3WLJA 4A0SA 4UJ3A 2BFMA 3DZHA 5DYWA 3TQQA 2JKZA 4PG4A 4WPGA 4OVKA 3WQRA 3F5MA 3E2PA 4EL5A 1JXMA 1Y5MA 3A7EA 3PUKA 3UAZA 1CPYA 1IULA 1R64A 3RH0A 3V6LA 4Q0MA 1KYWA 3O9MA 2W2QA 3QEMB 5EPEA 3OA2A 4CLDA 5AI5A 1JR3A 3K09A 1H0KA 3DDOA 1KL7A 3ETGA 3FPHA 3L7BA 2QPOA 5C5EA 5IVHA 2QZJA 3FUXA 3O7WA 5LP6A 1KEWA 3T0IA 3AR3A 4P3NA 1ECJA 1PP4A 2VCEA 4JB8A 3RYIB 2Q49A 2W6IA 4CKYA 1S8FA 2QL6A 3F5QA 4MULA 1DMRA 1B2RA 1Y3CE 4BNLA 2HLNA 1A4UA 4MV0A 2Z1NA 4B35A 4G41A 2O8FA 4QYIB 1U7DA 3H11B 1AB6A 4GI5A 4MCIA 1VL6A 3LFUA 3WLTA 5AVTA 2COKA 4UNPA 2BGKA 5FQOA 2ZE6A 3NIGB 3EIWA 1XYYA 3QZUA 1Y1TA 1TPZA 3QFFA 5I9NA 2XAUA 2LUOA 1QIDA 3E5NA 3VVCA 2PK3A 2IZ7A 2BI8A 1B14A 4RNCA 2A92A 4TKUB 4YJKA 4TTJA 1UIMA 3AG5A 1Z7GA 4QU8A 1O4WA 1R6VA 4DDKA 2ZI5A 4M8SA 5K8TA 3W4IA 4DV3B 3QW4B 5BMVB 1LDYA 3R8FA 4JC0A 1W9HA 4CEJA 2NGRA 3E81A 4NFLA 3UAWA 2BM8A 3KD3A 3UT6A 3IP8A 3TTXA 3VSCA 2FG5A 1SRQA 4BATA 3ANSA 4BX9A 2JAQA 3REGA 5LLDA 1J5XA 1CUVA 4HNGA 3GLIE 4RQTA 2VRCA 4OYHA 5AKGA 2R84A 3B36A 3RVQA 3TB6A 3HCNA 3FFWA 4PLFA 4CR8A 5DX1A 1FFSA 2XE8A 3R6WA 3O84A 1P2SA 4MCAA 2BN4A 1KIMA 2P5UA 1WEHA 2QOEA 2G1AA 1TRHA 2YV4A 4GRDA 4EHHA 1XTUA 4BRUA 4Z4EA 4OTZA 4MVWA 3C48A 4CF7A 2I34A 4MMZB 1WETA 4NYIR 2PGIA 3DB1A 2IW3A 3U7EB 3OU6A 1P7PA 4D6YA 1JHDA 1TW2A 1CTQA 1SVIA 4BPBA 2VBFA 2XVAA 3TTSA 2EXXA 3FUTA 3DOOA 1ZRNA 1AUVA 1YL6A 4MI1A 1NMEA 4B4WA 3UMJA 1SKYB 1KR5A 5B1SA 3JASA 1J8VA 3BJMA 3PQ8A 4AZ3A 3BN3A 2J59A 3N9IA 3DKRA 5PNTA 1FP4A 5ARDA 2ZYVX 1DJPA 1NZJA 2C4UA 1XWIA 4DNFA 1WHTA 5ALUA 1Y5IA 4QGAA 2ZB8A 5JPCA 3C6ZA 2FLWA 5IAAA 1U3DA 1CZUA 1CEXA 3AOEC 2ROQA 5DI3A 1KC3A 2DKOA 4C4PA 4N18A 4OFXA 2X23A 3RTEA 1AGYA 4YAKA 2J7PD 4DQUA 4P3XA 3Q5DA 3WLLA 2Q3BA 4N5DA 2IKSA 4Y30A 5CP8A 3PEEA 3CBGA 4MVJD 1KPIA 2IK8A 1X77A 3KQSA 1Z22A 1OF1A 1TUEA 5IVDA 1PU2A 4FEEA 3U3ZA 1KDOA 3IV9A 2RGAA 1INLA 1B0PA 1QTNA 1BS1A 4X44A 4EY6A 1XJWA 3G68A 1XVIA 4PZAA 1T8SA 2R86A 1N0HA 3ICEA 1VKNA 4LHVA 4CKWA 1GNLA 3TQSA 4M6WB 1W93A 3AR9A 3VH2A 3F6YA 1TVMA 2ERXA 5EPOA 2Y66A 2HBZA 4CQMA 1WCIB 5I01A 1UPCA 5ITZB 2JVKA 4OHXA 1ZOPA 2EX1A 2QQ0A 4NOLA 3I83A 3OPVA 4J8PA 3E48A 3UUFA 3D6VA 4EL0A 2JK1A 4CTOA 3VZPA 3JQEA 1V4BA 4WEOA 1SCDA 4WESA 1P61B 3P0HA 1YUNA 4V39A 2J0SA 2R6ZA 1KO8A 2FOLA 2YIMA 3SF8B 1SWWA 3V1LA 1AQJA 5EXEA 3HDTA 1NQWA 2X1LA 2J5XA 4X92A 1T8TA 4BO4A 5CCEA 3GFPA 4OYYA 4QAQA 1DB3A 4Z7OB 4UZSA 2VJAA 3M34A 4J6EA 4MCJA 4QBKA 4LCJA 1O0BA 3ZE9A 4PZUA 1Z29A 3E7WA 1ZU5A 3MW8A 4CMJA 3TZEA 4B6JA 1G5RA 3W0LB 3PYXA 5JW6A 4ZMSA 4DWOA 2AN1A 2JVJA 4Q9LA 1XF1A 2AZDA 1ZW1A 2GHRA 2P69A 3D6HA 3OKPA 3G5AA 1V11B 3RSSA 7ABPA 4RH1A 5JEDA 4ZI7F 4D8VA 1CEEA 3I4FA 2QRUA 3C3PA 2WMNB 4BO0A 1C14A 1V71A 5HIMA 5BMVF 4M83A 1LDGA 4KO4S 2QEQA 4DDTA 1U4NA 2W2TA 4YAJA 1DPFA 2AGVA 3HBLA 4K8RB 4RMIA 3GLHB 3NOVA 4QUDA 1FF9A 1RE0A 5HQJA 4KPUA 5IJWA 2J4FA 1FMFA 1M54A 3CF4A 5ALTA 6AT1A 3DDHA 3PNPA 2JFBA 4OXXA 3N0TA 4MIOA 4G5XA 3VA7A 3ENNA 4MUFA 4WCFA 3QV2A 1N2CB 3DDSA 4J16C 4JP1A 4ZI2A 3QWAA 1XDZA 4MVJE 1M5UA 4EB0A 1UWLA 1M1ZA 1PG2A 1Q19A 3CW2A 4E22A 1FXSA 1EI9A 1I4OA 5DTRA 4U2FA 2XB2A 2BZGA 1ZINA 1LPMA 2Q1XA 2HC9A 2ZRQA 1E59A 1HTWA 3QVTA 1GZ7A 3R5KA 4G5OA 4MB0A 4Y1EA 2RGRA 2RI1A 2WT8A 1IZYA 5JSZB 1OJLA 1T2FA 2JW5A 3JZFA 1DU4A 1H6CA 2GD6A 4UM8B 3WRVA 1L8AA 1XZ8A 2AS0A 2CW5A 5LP6B 2ZJ2A 1XD2A 3T15A 1GGHA 1E2PA 4EY3A 1YJAA 4YP1A 5DEOA 1N6OA 4HB4A 2C0QA 2WKWA 3A6PC 3FCYA 3LDHA 3F8WA 3R0QA 4KP7A 4R8LA 2O8FB 1DLJA 1KK3A 2VNHA 3KBOA 4MR9A 3KJFA 2UZ4A 4PSVA 3MNFA 2D1RA 4KGDA 2J4CA 3QG5A 4LCBA 1BCRA 2IBSA 2YZKA 3LP5A 4TRRA 4YJFA 1TCAA 4OAPA 1JS1X 4DSZA 3AX6A 3BE8A 1YZYA 2R00C 1K7CA 1OU4A 4J0KA 4HV4A 1GTSA 4OYLA 4NQRA 4EABA 1BWRA 4LECA 4V0KA 2PGAA 4W9NC 4CUZA 4KWHA 1L5GB 5EMHA 3BMNA 3ZS9A 1PKEA 2QRJA 4DFDA 3ILYA 3LDFA 3BSWA 4TV9A 4MRRA 3P9XA 3EEIA 1II9A 3UAGA 4AY3A 4LDNA 4EJ0A 2QY9A 2HQRA 5CEEA 3L0OA 3A05A 4EQZA 4FNMA 2L17A 9ATCA 3WGYA 2SICE 3CUWA 5H02A 4KPYA 1VXRA 4WLFA 2A5FA 1VHTA 2AI2A 3CXRA 1GYRA 2IEZA 3KQMA 4QDKA 4F3KA 2QD3A 3UV3A 1YR9A 1MDFA 3ZGVA 4LYAA 4HQRA 1U02A 2H9IA 2I4IA 2VC2B 4P8RA 4DM7A 4PM4A 4A03A 4X8LA 4F6RA 1KS9A 3N8KA 4RENA 3ZJTA 1QMPA 2V8OA 1G291 1W44A 2BJHA 1ND6A 2FTKE 2ZJ1A 1Y1KE 3MMXA 2Q0XA 3AJ9A 3NM4A 4GEGA 4QODA 4Y2JA 5TMDA 3IKTA 3CPSA 2JBHA 3HB4X 3ADDA 2QORA 3AW9A 4NFHA 2DRIA 2NV0A 4B2YA 1Q0HA 4JLMA 3HMQA 1L1RA 3N3AC 3QW2A 1GARA 1T29A 5CJ2A 3KJHA 4W82A 1HT1E 3MCAA 4NICA 4PYRA 3SGLA 4K28A 5C7OO 3DGFC 3BEOA 4TKZA 2QLNA 1JIVA 3HGQA 4FGZA 4A0QA 4PZLA 1XVLA 4QU9A 2Q46A 1HZZA 1DEKA 3OOYA 5JCJA 4BCDA 1M2NA 3JASB 2WAOA 1GQSA 3ES9A 4NAVA 5TJ9A 4AZ3B 1KTIA 2O2IA 3QVWA 3D8NA 3VYTB 4NNJA 1FP4B 2GSWA 4L3WA 3SC3A 1U98A 2PBLA 1EXVA 1M67A 2I7CA 3A37A 4M1YA 1Y3BE 1U63A 1YDGA 5CHYA 2ZU6A 4Y9DA 3ZDRA 4CIVA 1BE8A 4MO2A 1ZSNA 4YNBA 5BR4A 6CHYA 4R8VA 4R54A 2YR0A 2UAGA 3M8KA 5DI3B 3L7IA 1PHPA 2PA3A 4LTMA 3WA6A 3L6UA 3BBPA 4IJ6A 4POOA 4ZYXA 3QSYA 3MJHA 1P9LA 4R2JA 2EP8A 1S2OA 3U6BA 3UT5A 5K01A 1FYWA 4D9GA 2WYWA 2H7XA 1OI7A 1GRQA 1GKLA 4JBWA 1YH3A 5KNBH 5CT4A 5K0GA 3H4IA 1GKKA 3VYWA 2O8CA 2FZ4A 3VZQA 2RIPA 1KI6A 2EWVA 1Z83A 3JPWA 3ZEAA 1Y6GA 5AKEA 5ICMA 1LZKA 4J3JA 4KSCA 1Z4MA 2YL2A 3AEZA 3AVPA 3PL5A 4D4HA 1ENZA 1JIKA 3HYNA 4URZR 3RK4A 3O0TA 1Z88A 1GPWB 1O95C 1E2DA 3CF0A 3Q9UA 2ZRKA 3ZZMA 1KBZA 2VP6A 1TU3A 2UXBB 4AJ2A 4CF5A 1C4OA 2B8TA 3GJ6A 2B20A 1LNZA 1CK4A 3PQEA 4CQMB 4C7BA 5L9AA 1S89A 1HFWA 1NU8A 3COZA 1KBQA 3FPAA 3PWZA 4UU0A 4DTIA 5LP6F 2X15A 2YWCA 3SLRA 3ZU5A 1WBBA 1JPJA 3IQHX 4WESB 3GDOA 3HL4A 3LXUX 2YW2A 3MMNA 5EXSA 1E2JA 1YFKA 4G1UC 1R18A 4TM8A 2QR3A 5AHKA 2R6DA 3IOMA 2BFCA 5G0VA 1R8SA 2KPOA 1TADA 3H5OA 5FULA 1XHLA 4IGFA 1QU3A 2Z2IA 3CINA 4J4BA 3WR5A 1N92A 2W2XA 2OHHA 2QI9F 4PCAA 2NV6A 4RHFA 4H35A 2Y0BA 4N4AA 5CH3A 5E7JA 1C0LA 1LPPA 5EXXA 1A69A 4EMUA 4CJXA 1EZZA 2G4VA 1XRLA 5GTDA 3QGMA 3RT7A 3B1XA 1PZXA 4JWTA 4YX9A 2MMGA 3IXLA 3N3BC 2OAEA 3KCQA 5IN4A 2IZZA 1KWGA 1I94B 3FOAA 1L5RA 1YJQA 1C5KA 2RG7A 1PK9A 2Q6VA 3OOHA 4MUEA 1EJ0A 1WB5A 2RB4A 2ZIZA 4JI1B 4GE0A 4WCVA 3SJCA 3ZV4A 4CCWA 1XL1A 1EGHA 2WKRA 2V4UA 3F3YA 2O2DA 3ZV6A 2BYTA 2GD1O 5JG7A 2A1IA 1BD3A 3L4SO 2OKGA 3S2UA 4KPUB 1GNTA 1GL9B 1TNDA 3K0CC 3LO8A 5DV9A 2XUPA 4INJA 3M6IA 5FDFA 5JY6A 1PHRA 4CV0A 1UAAA 1FDSA 1HKHA 1CRLA 2P0EA 4WCFB 3UANA 1GGMA 3W6PA 1U0RA 4GXQA 1BC5A 3COWA 3JAWA 1OYYA 2IXAA 5FL3A 4CIDA 1H4QA 5F9HA 5BV7A 2PT9A 2B7CA 1K7XB 3MWLA 4AW9A 3SZLA 3O4IA 3BT7A 1XLTC 2PY6A 4GUAA 1QR2A 4P4SA 1KDYA 3WB1A 1D4FA 1X9IA 1K8ZB 3EQ8A 4J76A 2EG9A 1B76A 1J22A 1IC6A 3QF7A 3EH2A 3ADPA 1VE6A 3GO4A 4Y9RA 1UDAA 1C7ZA 2ADOA 5A05A 3EDCA 4AJ4A 3AWDA 3T52A 1TX4B 3M9WA 4WN9A 5B7NA 3GZTB 1TK2A 4JOQA 3BFVA 2CCJA 4LE0A 5CM8B 1N4AA 5IXSA 1PFQA 3CF4G 1KY3A 3QPVA 1E9CA 2CHQA 4M1EA 1U1FA 4WZAA 3WV4A 3WVNA 3D0OA 3RWBA 1YVEI 1QGUA 3K5WA 2FOIA 2E7ZA 5FHQA 2JG3A 5C46F 4MR9B 3FUCA 2I7XA 1PV1A 3IQXA 3WFIA 4N48A 1LDNA 1RWPA 2W6JD 1BCRB 2G1JA 3N74A 1IEQA 1SG6A 2H07A 2BUAA 2VDKB 3CUYA 2Z56A 3HRIA 1G7CA 1MKYA 3NWEA 4YJFB 5KQSA 3HK2A 4TYYA 4LQDA 3WWEA 4XIGS 2ZRGA 4I4LA 4LYFA 2IIQA 1ZU4A 5EEGA 2C31A 3ESYA 2XKBA 5I9TA 3ZLBA 1XC7A 3DBVO 1LTKA 3FB4A 2VT2A 4KRFA 1PYOA 4YRCA 4DM3A 3BS4A 3K31A 3BMNB 4HEQA 3CLTD 5ALWA 1YCDA 3A9UA 2JGDB 3NCTA 1XCPA 2IP4A 2QX6A 1OT5A 3C87A 1YS4A 4M1ZA 1TEVA 3A1DA 4MWSA 2VUTA 4TV9B 5FUYA 5HIKA 1QDEA 3A2KA 3RBZA 1JYFA 2ZDGA 1GFZA 1XAJA 4ZDWA 2FHPA 2HJVA 4U6QA 1V95A 4RFLA 4JJEA 3TLBA 2CFIA 5JBQA 3OF2A 5DTJA 1LB1B 4H4CA 1WPXA 2DFPA 2X0IA 2ZIXA 4ER6A 3P9YA 4E1VA 3VTAA 4B8WA 1ENOA 4NV3A 3RWMB 4QQRA 4C4YA 4F6RB 4Z0HO 2QTZA 3VDNB 2OSVA 2O8BB 3DPIA 3NYWA 3TTYA 4A0HA 1PBNA 4IFBA 4O4JF 4X93A 3WZMA 2XBLA 1QVZA 3H4VA 4KH1A 8MHTA 3AB7A 4Z1MA 2W98A 3C3WA 2D2VA 4JEHA 4QBIA 2GK3A 3E3AA 2H2DA 2Y4NA 4PZYA 1H3FA 2OBNA 5DN6A 3U3OA 2B94A 4DARA 3ED5A 1YJ8A 4Q37A 2NYVA 2D3TA 4HJXA 4Y2SA 4YWJA 4OJKA 2XXAA 4QQ8A 4TTPA 4LJ5A 4BBZA 3DF9A 3WTBA 2Z2KA 3E18A 4LJ7A 3ILHA 4HMOA 5I6DA 3GJTA 3ZHSA 2VA8A 3R1IA 4LF7B 1XZFA 3P2YA 1HE2A 1GLGA 4BNNA 1F7UA 1V8BA 1ICEA 3U3KA 3B7PA 4BJ1A 5BVGA 4RCVA 2VBGA 4TWRA 2V97A 5LBIA 2PSDA 3QVUA 4ZCMA 5H4GA 3OZAA 2PS9A 2J3DA 3H42B 4LJAA 5AW1A 3U5TA 2IYLD 2ZBFA 1KWKA 1PWHA 3FJOA 1D8AA 5IAGA 4M89A 4DHEA 1L3BA 4A16A 3L41A 4RTSA 1E3LA 1ID8A 1NM5C 3U13A 1CB0A 2JLAA 2QJWA 2YN4A 2YVLA 3DEHA 1FTSA 3KKPA 4F3RA 2CDCA 3L7DA 2JGRA 2AX3A 1OBFO 1ZOOA 4IDOA 4INAA 2A2ZA 1FSFA 1KI6B 3FH0A 4MVJH 4OP1A 5CLIA 4ZTUB 3DUFA 5CTAA 1NWHA 1DP4A 2A1TS 3GWZA 3T38A 3U39A 1YGPA 3OJLA 4CM5A 5K0BA 3ZJYA 2QYSA 2D06A 3OD5A 2ADFA 1JBEA 5BW5A 5CFNA 3E7PA 4YA6A 3HKEA 1VLLA 1FFWA 4M36A 3BREA 4MQ5A 1A2OA 4OFWA 4RGVA 4S0ZA 4BMCA 3RJTA 3P97A 4R5MA 5B6PA 4G4SO 5F3RA 1A98A 3C8DA 4FINA 2FSSA 3A4IA 1XGKA 3OPYA 3GLSA 4QBFA 3GUUA 2GVDC 3EBLA 1E5VA 3F8SA 1Q1AA 3BMCA 3LQRA 2H5JA 2ZE8A 3LY7A 1O8CA 5GGXA 4I4IA 4LF9B 1SZJG 3SBEA 2VTBA 2IVZA 1ECLA 4JIMA 3RU9A 3W2FA 4EDHA 5DNWA 3WQSB 3FCOA 1QKKA 2WUDA 3DM5A 2HD4A 2ESRA 5CT9A 5HFJA 1SVKA 2OB2A 3C3BA 1HR0B 1RBQA 3EZNA 2X9GA 1G17A 3PXAA 5BQPA 1LFDB 5C1PA 1D1TA 1KETA 2X9NA 3MT7A 4AP6A 2Z58A 5ELXA 5KMGA 4NE7A 1UKVY 1KEUA 5AVWA 2FPSA 1KKMA 4BVEA 3CMCO 1TMYA 3JD4A 4UUPA 4Q1VA 3HVIA 3TAHA 5EI5A 3WTCA 1NJ8A 1PG5A 4BVJA 1HL3A 3FLAA 2FR8C 5B1HA 5CFLA 1DFGA 2X4DA 1KZ6A 3GDHA 2XJ4A 2QAGA 5E7IA 2A0UA 1DZIA 2JLSA 3N2KA 2GDZA 5IT4A 4NONA 1J0BA 2ZWMA 5H3HA 1YB7A 4D2IA 4MHTA 1DC3A 4PPQA 1LXCA 5TNXA 4ZPJA 5AVJA 4QUGA 4BO9A 4HNHA 4EGCB 5C51B 3TFWA 4X3OA 3CR3C 4Q05A 2OXRA 1R0XA 3JAWB 5CCBA 1Z47A 4CG2A