3PGXA

Crystal structure of a putative carveol dehydrogenase from mycobacterium paratuberculosis bound to nicotinamide adenine dinucleotide
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
270
structure length
270
Chain Sequence
GSLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASVTYAPASPEDLDETARLVEDQGRKALTRVLDVRDDAALRELVADGMEQFGRLDVVVANAGVLSWGRVWELTDEQWDTVIGVNLTGTWRTLRATVPAMIEAGNGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTNTLAIELGEYGIRVNSIHPYSVETPMIEPEAMMEIFARHPSFVHSFPPMPVQPNGFMTADEVADVVAWLAGDGSGTLTGTQIPVDKGALKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
molecule keywords carveol dehydrogenase
total genus 102
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pgxA00
1TI7A 3M6IA 3DFUA 1NVMB 4D7AA 3I52A 4EEZA 1B2LA 4E5MA 4YACA 3FF4A 2W2LD 3L4BC 4TVBA 4EJMA 1A72A 4DREA 1GUYA 1RM3A 1JTVA 4RPGA 7MDHA 3P7MA 2X0IA 4QTZA 4E5KA 3GGGA 3DTYA 3PDJA 4ZVVA 1DAOA 2A92A 3I9OA 4JCOA 5KJ6A 4NR0A 4PG5A 1UXGA 1T24A 1F14A 1CWUA 2IODA 1N5DA 1YB4A 4H3VA 3CZRA 1B16A 2AEFA 1KEVA 2O50A 4D43A 5EESA 1E7YA 1DO8A 4CR6A 2VYNA 2JHFA 2C0CA 2D3TA 3WGQA 4ALJA 1JKJA 5L9AA 4RVHA 5G0TA 5FI5A 4DBZA 5LDHA 2Y0DA 1U4OA 2NACA 4IDBA 3BZUA 4J2HA 1LQUA 4R1UA 5LCXA 3KYCA 4RZIA 3EGOA 2IEBA 4I5GA 1VJTA 1ZSVA 2IXAA 4JBGA 2X4GA 1GYQA 1JAXA 1GQQA 1HE3A 1GL3A 2WEKA 3WR5A 1QP8A 1NFFA 3DOJA 3E5RA 1YOVA 2HMWA 3OJLA 2ZK7A 4TRRA 2Q2WA 4MP8A 2HDHA 1DPGA 1R4MA 3P19A 4MPDA 3D5TA 1ZK4A 3PRJA 1I2BA 1DIGA 2GRAA 1FF9A 2C54A 4MIEA 2X86A 4NIMA 5EN4A 2EHDA 3WGGA 1R15A 3A06A 3P5SA 4A5OA 2YUTA 3TL3A 4CMCA 4DC1A 5IZCA 3F46A 1U7HA 1UZMA 1V3UA 4IS2A 4CMKA 3KLMX 4K26A 1KBZA 4YT4A 4EW6A 4NK4A 5L7TA 1HDGO 5CDSA 2J6IA 3U62A 4B8ZA 2J3IA 4WJZA 3S2GA 1TT7A 4KOAA 1UZLA 3BMNB 2Y0EA 2I6TA 3LVFO 3PZRA 1OAAA 2JFGA 1VRWA 1VE9A 2IZZA 4FGSA 1BVRA 3UOGA 4F3YA 5JCJD 1KVRA 1P1HA 3D64A 4EUEA 4L4SA 4XD2A 3OM9A 5CPFA 3L9WA 3GZNB 4IIVA 3DZHA 4XX0A 1EVZA 1KEPA 5IDYA 4L0QA 3RASA 4AICA 5CG2A 1PJQA 2DTDA 2FWMX 1M2WA 2D5AA 4RF2A 2QIOA 4WLUA 3PFFA 4NBUA 1LDEA 3M1LA 1BTOA 1K3TA 1MG5A 1I5RA 2X22A 1D3AA 2DKNA 4CPDA 4R9RA 4BIIA 3C1TA 2G5CA 3PLNA 3KB6A 4N54A 3RJ5A 2PGLA 3OHSX 1VJ1A 4R4JA 5LC1A 2VHZA 3VKVA 2YV3A 2Q4EA 1FDUA 1XKQA 5L51A 4BGUA 4CMHA 5I9LA 3Q2KA 1DBVO 2QZZA 3CE6A 4WLFA 3EDMA 3T4XA 2CY0A 1JWAB 4TRJA 3RD5A 3B1FA 3ZWYA 3PJEA 1I01A 3AY7A 3JV7A 1FXSA 4IM7A 4N18A 5IZCC 1KC1A 2YQ5A 3KYCB 3PTZA 1PJTA 3ZWCA 2X1HA 3ZHZA 4D41A 1Q2XA 3DQPA 3GK3A 3NJ4A 5DDIP 3GQVA 5L45A 4NJMB 4WCFA 2CFCA 2YDXA 5HRUA 3ETDA 3Q3CA 5MDHA 2Z1MA 4H16A 3FPLA 3PQDA 4LRTB 1PWXA 5DNAA 2VWPA 2PNFA 5H81A 5F5NA 3WFIA 2J3HA 3GUYA 2AW5A 3NX4A 3V8BA 3NDJA 5BNTA 3WWZA 3WLEA 1KEUA 2X5OA 3GR6A 4RZHA 4ID9A 4CM9A 1E7SA 1PGQA 2B0JA 1X1EA 1GYPA 1YL7A 2X58A 4UEJA 3QWBA 4K28A 3IS3A 4G81A 2Q3EA 3EK2A 1UUFA 1AXEA 2UVDA 5TGDA 2FMUA 1HKUA 3EHEA 4OOEA 4XQGA 3ZI0A 2ZB4A 3BA1A 2CVZA 2BGKA 1EE2A 2IE0A 5A3VA 1WDKA 3AI2A 5IZ4A 5ENVA 4XGKA 4Z9YA 1WZEA 3OJOA 2BFMA 4B4UA 1GADO 2GZ2A 1E7WA 4RCVA 2RBEA 3GA0A 3BTOA 2VHXA 2A94A 2BFAA 3RFVA 4CLOB 4DBVO 5B12A 5JFOA 2W4QA 3QRWA 5DP2A 1GCUA 1NXQA 4FOSA 4EBFA 5IXSA 2QW8A 2PD4A 5DCWA 1GEGA 1UJMA 4IGFA 4RORA 3UN1A 4CR7A 1XR3A 3TFQA 2Y0CA 4BNNA 1BHSA 1AHHA 1EK6A 2ZTVA 3QWIA 3QP9A 1NPTO 2E4AA 2DTEA 3TZCA 4S3MA 1LA2A 4WPGA 4BNKA 3PHHA 3VVBA 3PYXA 1YKFA 3RUIA 3WNVA 4J6FA 1ISMA 3B20A 4XYBA 2YV1A 5F5LA 2O7QA 1IOLA 3QQPA 1F8FA 4Z3DA 1IZ0A 2PGJA 4FS3A 3P2OA 5HM8A 3EZYA 4YYZA 5B4VA 2NVWA 2BF7A 3N74A 1M6HA 3FD8A 1ZVMA 1U3WA 3JD0A 1GUZA 3R3JA 4BO5A 1UXHA 4Y67A 2DPGA 3H5NA 4Z0HO 1N92A 3B6ZA 3RU9A 4CLHA 4BKPA 3WLFA 5L95A 4BO1A 4J1QA 5A9SA 3W8EA 3D3EA 1PL8A 2P5YA 4M89A 1HYEA 1QV6A 3T4EA 3TZQA 3OSUA 2XXBA 1E7QA 1H6DA 2J5KA 3VVCA 3ZWNA 5CHEA 2GZ1A 5EQFA 1KERA 3U4DA 4C7JA 1T2EA 3H3FA 5ILGA 1NHGA 3KSDO 1I2ZA 3HFSA 1N8KA 3DBHA 2PY6A 3QA9A 1YBMA 3GMDA 2C59A 4MVJG 2E37A 4B3IA 3PQEA 4PLVA 4CUKA 1XYGA 4IIUA 4W6ZA 3AM5A 1V3TA 4U6QA 2NU7A 2VWQA 4PRLA 1GZ4A 5CDYA 1B7GO 4E3ZA 5TQVA 1F0YA 2DBZA 1QRRA 1X7HA 2JAHA 1O5IA 2I5PO 3QVWA 4L4RA 1HSOA 2VRBA 4ALNA 3JD1A 1Z75A 3JQ8A 1RKXA 4R41A 4PG8A 1XU9A 3ROQA 3KO8A 2NV6A 4Q3EA 1D1TA 4WOJA 4BQPA 2C2XA 4FJ2A 3JQFC 3A14A 3IDSA 2VN8A 4GGPA 5HWSA 1BXGB 5EQDA 4R54A 3RBVA 3GVCA 3K8ZA 2NSDA 3JQCA 4G5HA 4MKXA 4DLLA 1F12A 3O9ZA 5KNLA 2OFPA 2IRWA 2V65A 1CETA 3FNHA 2V6MA 4B7XA 4NK5A 4IY1A 3U3XA 1S6YA 2VZ9A 1DC5A 2FR0A 2JAPA 4NNJA 1A7KA 1XCBA 4E2XA 1V0JA 3HSKA 4BO0A 4JIGA 4WE3A 4RQUA 4NQZA 3ZNPA 5CAEA 3RC1A 2YY7A 4BO7A 3R6DA 4DLBA 1Y9EA 1LQTA 1U2GA 5A04A 2FPPA 1SB9A 3PWSA 2NTJA 4BO8A 1T1RA 3QE3A 4XRRA 3EUWA 3CINA 5JS6A 2UDPA 3GDGA 3RBZA 3EZLA 3UICA 4HFNA 4R51A 5U1PA 3MWEB 2QHXA 2HJRA 1CYDA 3TF5A 1NBOA 5DT9A 4PLPA 4MVJP 3LC7O 4GSKA 3LU1A 4TSKA 4J2OA 1ZK2A 3E48A 5A03A 5A5EA 3I3OA 3V1YA 4TRNA 3Q2IA 1B8UA 1E3IA 3L6DA 4R1TA 2ZYGA 2I65A 2YJZA 3KEOA 2V6FA 5JLAA 8ADHA 2Y67A 1I30A 1IB6A 3JYOA 3FR8A 4H7PA 3FRJA 1KIFA 2FHSA 3DR3A 4DPMA 1A4IA 4QT0A 3DAPA 3ZV5A 2CNBA 1N1GA 1T2FA 2F1KA 3ADOA 3WS7A 1ZZEA 4KP7A 4XWYA 4FN4A 1HDYA 3WQSB 3INGA 4CMEC 4UUOA 1DFGA 1ENYA 3O4RA 3OA2A 1O6ZA 4J43A 4PG6A 1A5ZA 3EC7A 2VTEA 3RROA 2FN7A 4EI2A 5KJCA 3IQDB 4GMGA 4GI2A 4OQZA 3I5MA 1PJ4A 2NU6A 1Z7EA 2DAPA 5DCUA 3ZV6A 2C5EA 4I9NA 1ADBA 2WD7B 4CLXA 5A06A 1OC4A 1WWKA 3K92A 1LXCA 4RQTA 1U8XX 4FC7A 2OMEA 5GZ3A 5FWNA 4UVHA 4EUFA 1HZJA 1HT0A 1I8TA 3GRPA 1VSVA 1GV1A 1GAEO 3QLJA 2P91A 2O2YA 2O3UA 3WDSA 4YXFA 3DBVO 2C7GA 4IQ0A 4DGSA 1U5AA 3BTVA 4YJGB 4ZD6A 5G4KB 5BT9A 3TSCA 3QVXA 2EXXA 3AU8A 3OBBA 3ROKA 5ICMA 1LDMA 2YHUA 3M2PA 3A1NA 3PYMA 3PXXA 2VQ3A 3IP1A 1OFGA 1V3VA 3L9XA 4EEXA 1P3DA 4QO8A 1O0SA 4J7CA 4Z9XA 1ZJYA 2H6EA 1DC3A 3E8XA 4QFDA 3WGOA 1BSVA 3AWDA 3H65A 3Q0EA 3AM4A 4NH4A 4BGIA 1R66A 2BGLA 4HADA 2JL1A 3DL2A 4Z6KA 3DDNA 2EP7A 4Q3NA 1MC4A 4R5MA 2Z95A 3WGHA 2JCXA 4EGFA 3VH2A 3EMKA 1K6XA 4GWKA 2H9IA 3GLQA 1Y8QB 1P1IA 1AUPA 2I76A 3ANNA 3F5SA 3KETA 3PIDA 5BSGA 4GGOA 4IJWA 3WFJA 4BOYA 4DMMA 1XLTA 3CTMA 2P9GA 4E12A 3DMTA 5DOZA 1ISIA 3ASVA 1UDBA 3X2FA 1E1KA 2FSSA 3ZNNA 4DQVA 2GZ3A 3HB4X 4LISA 1HLDA 3E18A 2FZEA 2Y1EA 1YQXA 1SOVA 1LBEA 1P31A 4G65A 1V35A 3I9KA 3HQ4O 4RPKA 3KYDA 4B3JA 3W4IA 1MXHA 3AOEC 4WLNA 3RKUA 5FFFA 6LDHA 3VPSA 4Q3DA 4I9UA 3G17A 4J3FA 2WTBA 4U0JA 1P1JA 2UYYA 4BMNA 1YDWA 2BMAA 1NHWA 4MKRA 1MA0A 4KTVE 5G0WA 4CMJA 3AK4A 3F47A 4PVDA 3JD2A 3QY9A 3DBLB 4CV1A 1U5CA 4BNHA 3JQ6A 2UUPA 5F1OA 2PKQO 1JKFA 1E5QA 3S2FA 3TJRA 2O3SA 1SBYA 2HAEA 3L6OO 4Y98A 4E2YA 4YT2A 1E6WA 3NUGA 3ZN2A 4D44A 2ZTUA 3GNTA 1Y8QA 9LDTA 3ZNOA 4MVJH 2GR9A 1RWBA 3VH3A 2IZ0A 3W4JA 1KVQA 1QLJA 3PZBA 4UEKA 5AXBA 1SB8A 5DZSA 2EEZA 4WOKA 4AJJA 3TOZA 4YAKA 4XZ3A 4L9RA 3PIIA 1PL7A 2VHYA 3GEGA 3E03A 1EEHA 3VDQA 4YB8A 2Q45A 4JP2A 3ZNQA 2NVBA 2VHVA 1UDCA 1Z73A 1L7EA 3AY3A 1HDRA 2X7HA 4CMIA 1V8BA 3IUPA 4PFJA 1W73A 1H93A 2D8AA 3GAFA 4CV3A 3QV1A 3QIVA 1LEHA 1ZK3A 5T6BA 4RPJA 3RVDA 3PK0A 4UUPA 3C1AA 4R9SA 1S7CA 2NLOA 4JP3A 2AG5A 3ONFA 3GZNA 4ZHSA 1EUDA 1VKNA 3PPIA 3B1KA 1JWBB 4YCAA 5J23A 2PH3A 1SEPA 2X9NA 3UXYA 5G4LA 2A35A 5JDCC 1N9GB 1X14A 5K9ZA 3UHAA 3DZFA 5HTOA 3DZBA 2PZMA 1FDVA 3K31A 3ZDFA 2RHRA 4CM9D 3RQSA 4FJ1A 3BMOA 1OBFO 3OF2A 1E3WA 4NJOA 4D3DA 3PEFA 3DAGA 3EYWA 2VTDA 3RUHA 4DVJA 2GDZA 3CSDA 2QQ5A 1AE1A 3JQEA 4CMAA 1QYWA 3WIEA 1HE5A 3HDHA 5AXDA 4CR8A 3FI9A 4ZQFA 4D0SA 4L8VA 4PRKA 1BVUA 3PJFA 1P45A 4AJ1A 1ZUD1 1I2CA 3QHAA 1RM5A 2GSDA 3DB2A 1ZO8A 3GRKA 2QG4A 3K6JA 4D46A 3K2EA 3DBRA 4PLZA 3VTFA 3K5PA 1AN9A 3HJAA 2GGSA 1ZEMA 2BI7A 1NAIA 1CIVA 1A7AA 3C85A 5IN4A 4ZQBA 2O2SA 2R00C 1DJNA 3LQFA 2D1YA 1T2CA 3U49A 3OECA 4RDIA 4NBTA 3S2IA 3PFWO 4JX8A 4BNIA 3X2EA 1N9GA 2Y05A 3NTOA 3GFGA 2AEMA 4L73A 3KXDA 3COSA 1SMKA 1SAYA 1YL6A 2GN9A 1MP0A 4MVJD 4AG3A 2J3KA 4WLOA 3DZKA 3I6QA 1ZKMA 3NJ8A 2Q99A 3H2ZA 4BVAA 1JN0A 2J5RA 3HZZA 3ST7A 5JDCA 1K2WA 3ANLA 3I9NA 3RUAA 2OGUA 5CDTA 4RVFA 2VT3A 2GCGA 4XKJA 2XXJA 4WNIA 4J90A 3ZGYA 4IPTA 1A4UA 3PGJA 5C3MA 2H63A 4FFOA 8LDHA 3ABIA 1XEAA 1GYRA 3UCXA 2JFHA 1I0ZA 3FBTA 4CQMA 2LDXA 3ZZNA 2AG8A 1TEHA 3KTDA 4CMIB 2Q1TA 1FMCA 4IINA 1DOHA 4JJGA 5L3ZA 5JAMA 1WAMA 1EZ4A 5CDGA 2GN6A 4BNJA 3PQFA 2C5AA 4INAA 4B8WA 3G1UA 5H82A 4J0FA 4RDHA 4YJFB 1YL5A 2EWMA 1P1RA 5B1YA 2DFVA 2VZ8A 5EPOA 5F21A 1KY4A 2QRLA 4UUMA 3GUCA 3MJVA 2EGGA 1IL0A 4Q39A 5CEFA 2NQ8A 3AUAA 1U1IA 3RKRA 4IDDA 4J4TA 3EW7A 1DIAA 3FTPA 1C1XB 1NNUA 3WX0A 1WMBA 3VZRA 1VL6A 2BKAA 3WSWA 1EQUA 5H83A 2GUGA 3H2SA 1DEHA 4RF4A 4BV9A 1IE3A 3INRA 4HFJA 4XR4A 5JPIA 3FCOA 3TPCA 4YJGA 1C1DA 3LDHA 1BXKA 4RO0A 2BLLA 2Q2QA 1QORA 5I8ZA 1EDOA 2SCUA 3FNGA 1BGVA 3HUDA 5KWEA 2YHIA 3JQ9C 3R0IA 1XQ1A 5KVQA 5THKA 4Y9DA 4M49A 3W6UA 4X54A 5ENDA 4DMLA 1ISFA 1HDOA 1T1SA 3SBOA 4G2NA 3WG9A 3H5RA 2NUAA 2FSVA 3LSYA 5ER9A 5L4LA 5T57A 3H9JA 1D7OA 4GX0A 1TT5B 5L4NA 2HU2A 1KEWA 4ND3A 1PZGA 4B79A 5F1PA 3WYBA 3JD3A 3AUSA 2OP0A 3A9WA 3R3SA 2CD9A 1XSEA 1GY8A 2CVOA 1NWHA 1HYGA 1KVUA 3DBLA 3GPIA 1JA9A 3LZ6A 2CF5A 4R5HA 3RWBA 4BO9A 5KVCA 1CJCA 3ZH2A 1DRUA 5I7FA 1MLDA 3KSZO 2EERA 2HLPA 3AY6A 2NNLD 4WEQA 4FFNA 4YA6A 1VM6A 4OQYA 1PX0A 2HRZA 3JQAA 3JQBC 1EBUA 2CMDA 4IUYA 4L4XA 4QXMA 4BUCA 1UXIA 3VPHA 3V2GA 4CM5A 4WECA 2B4RO 2GN8A 3G49A 3KZVA 5G0UA 5COAA 3E1KA 3NTRA 3LT2A 4QECA 5L53A 1E1NA 5I8WA 4GWGA 5AXAA 3PWZA 4TRMA 3ENKA 2VRCD 4BV8A 1XWFA 5CEJA 1E92A 2VZ0A 4J7XA 1GTMA 1ZIDA 4TMFA 1DLIA 1Z82A 2AXQA 3ITDA 2C82A 1SC6A 3GC6A 4CM4A 5IG2A 3QVTA 5KTKA 3UCEA 4DIOA 1ZFNA 4UVIA 5LDGA 4RLHA 3TDKA 2Q1SA 1EQ2A 3G1TA 2IZ1A 4RF3A 1C0PA 2QRKA 1ADFA 1PJ3A 2AA3A 4BNVA 4PLHA 3BIOA 3C7AA 4GSLA 4M87A 3K9QO 1SOWA 1Z45A 3O26A 1ULSA 3WWYA 3DWFA 3HN2A 4J1SA 4PLWA 3BMCB 4LCEA 2Q1UA 1LC0A 3AUTA 5JO9A 1U3VA 2WJPA 3SJ7A 2W2KA 3ZWVA 2EG9A 1FDWA 2WYVA 1D4FA 3ITKA 3OJEA 2VYND 1F8GA 4OJNA 4J1TA 3VZSA 1GFSA 1GQ2A 1MC5A 1R4NA 4HXYA 4PZEA 4WGGA 1NASA 1ZSNA 4RPLA 2E48A 4CLEA 4OOFA 2JD2A 2NQTA 4PG7A 4HNHA 1X15A 1RJWA 1UXKA 1PJSA 3GVHA 2RCYA 1XA0A 1PGNA 2ZCVA 3SLKA 4DWVA 2FRDA 3DEYX 4NDNE 2YHIB 2Y99A 4OXKA 3EVNA 1LTHR 3JQBA 3TFOA 2DUUA 1B14A 2ZB8A 4FFMA 5A02A 4OM8A 5AYVA 4ALKA 4RVDA 5DBGA 2HK7A 3NDIA 4AJIA 1KVSA 1YB5A 1YH3A 4BQRA 3W6ZA 1TVEA 2NVUA 3AOEA 3K2BA 3VC7A 3R1IA 1D8AA 4CM8A 5ITVA 3GEMA 1HL3A 2HRBA 3JQFA 1EVJA 3DAFA 4S1VA 3H8VA 2AE2A 5JNLA 1ZXBA 4XB1A 4BS9A 5A9TA 1J49A 1ZK1A 2HK9A 3DMTC 3MCVA 2O3QA 3KM0A 1R0SA 4BNZA 5IAAA 1ONOA 5JMPA 3SC4A 1DAPA 2I9PA 2Y1DA 1DC4A 5K6AC 4GH5A 4XQ9A 1IHXA 4RF5A 4XJSA 2QX7A 4YJFA 3RUFA 3V1UA 3ETEA 3ZHYA 1VL0A 1PZEA 1HZZA 4IDGA 1GUFA 4EUHA 4P8RA 4CUJA 1I33A 3IKTA 4LN1A 1DDOA 4FD3A 4GLLA 4WASA 4YAIA 5JSFA 1C0KA 1M76A 1LLUA 2DVMA 2QYSA 4R3WA 3BMNA 1ENPA 3KSUA 4OSOA 4CM4B 1MB4A 1MUUA 1LRLA 1WLYA 4KUEA 1YBVA 4DYDA 3RBXA 1YS4A 2RIRA 2NM0A 1DLJA 1YE3A 2IEDA 4E2WA 4LMPA 5TX7A 1ML3A 4AJNA 2WMDA 4RPHA 3FHLA 4P22A 1I36A 4YR9A 1JW9B 4YVFA 1CDOA 2WD8A 4B7CA 2XOXA 4E31A 5AVOA 1GZ3A 3QVOA 1BXZA 4I5FA 4BNTA 2FPGA 4YAEA 3WJ7A 5JC8A 4HWKA 3TN7A 2PGDA 3MTGA 4FDAA 5JDIA 2UAGA 3WYCA 3GNQA 3NT5A 3EY4A 3ZHXA 1GZ6A 1YJ8A 4FBGA 2Z1NA 4LVUA 1VJ0A 4JLWA 4QUKA 3VDRA 3BHIA 3WIDA 2AQKA 3IJPA 4BNXA 4A73A 2AMFA 4ND4A 1EBFA 4CLOA 3RIHA 5IXYA 4IXWA 1UR5A 2JD0A 5BSEA 4HFRA 3KEQA 1A27A 1Q0LA 3H9QA 3OP4A 3O8QB 2I99A 1QYCA 2PLAA 2BRUA 2C29D 2PZJA 2CZCA 1ZMTA 3PWKA 2I66A 4M8SA 5EERA 2X5JO 4U8GA 5I9MA 4PLGA 1C1DB 3WGIA 1QG6A 2PFGA 2FZWA 5ER6A 5T5QA 1Y8RA 2BFOA 4OL9A 3MJTA 4I5DA 3F4LA 1JVBA 1LNQA 2Y68A 2PTGA 3F1KA 1ARZA 3LT4A 2P9EA 2OP1A 3JQ8B 4BKUA 1J5PA 3TWOA 1ID1A 3BXXA 2JD1A 3Q11A 4YRAA 2XPCA 3VZPA 2BHLA 4YBZA 4BNMA 1EVYA 5L7WA 3I23A 4ITUA 3ZWAA 2EW2A 1O8CA 5JY6A 4XGIA 2JFFA 3CH6A 4OKIA 4FOOA 1EVIA 4W9NC 1J4AA 4TZKA 4Q9NA 3D4NA 2ZQZA 3DMYA 5DP1A 2BD0A 4LGVA 3Q1LA 2F00A 3OJ0A 4N7RA 4A26A 3FWZA 4TROA 1IHYA 3DBHB 4PLTA 3SJUA 4B4WA 4K6FA 4CMGA 4EZBA 3EVTA 3NRCA 1I3LA 4J7UA 4OH1A 5GY7A 1I3MA 1RM0A 4IZIA 5JCJA 4Y6PA 3UUWA 5IN5A 2B4QA 1PGOA 4JXKA 4BO3A 1DRVA 4IDAA 4IMRA 4BMVA 3PGXA 3DZJA 5AQ1A 1A9ZA 2ZJ1A 1E3JA 3Q9NA 3RFXA 3AU9A 2O3RA 3JQGA 3BYZA 2GASA 5JAZA 5F3RA 2BELA 4GVLA 2DPHA 4I5EA 4E5YA 2CDCA 4JBHA 2VUTA 1TXGA 2BFPA 1LU9A 5K0ZA 4JK3A 5JW6A 3BTUA 3KYDB 1PZFA 1ULUA 4IBOA 4E2ZA 1A71A 3HDYA 4GL4A 1MV8A 4MOWA 3ZWWA 5B4TA 1YRLA 4GX5A 4O1MA 1UZNA 3KVOA 4HX5A 4DTIA 3LLSA 4D42A 1EFLA 3HFGA 1W6UA 2DLDA 1NQTA 4A03A 4BHTA 2J5QA 2W2KB 4AJLA 5GZ1A 1JAYA 3C24A 4OAQA 3LT1A 4A10A 2X0JA 2JJYA 3OIFA 1HSZA 1LDYA 1DIHA 2OXIA 4J1NA 1VPDA 3E9QA 1RYEA 1TT5A 3DBRB 4LSMA 2AQIA 2EIHA 3H6KA 1FK8A 3WICA 1ADGA 3NYWA 4FJ0A 2GNAA 2CDBA 5IDQA 3N58A 3C7CB 3HWRA 1I32A 2GD1O 4BMSA 1FDSA 3CKYA 3ZU4A 1CQIA 2I3AA 3V2UA 2PD6A 2Y66A 4WK6A 5JYEA 4E21A 5AOVA 1DB3A 4N5LA 1X13A 2R2GA 4RV9A 2Q46A 1K6IA 4UAGA 4DA9A 2EJWA 2H1SA 2RHCA 4YRBA 4Y8VA 1D1SA 3ADPA 3ZCXA 1P0CA 4IJUA 1PS8A 4M54A 4Z3KA 1H2BA 4E0BA 1JU9A 1VC2A 1Q0QA 4CM6A 4W7IA 1NR1A 4GAEA 1MXFA 4ALMA 3NEPX 4F6CA 1PQPA 2B4TO 5A4DA 4ALLA 1EFKA 3VKUA 3PDUA 2Q49A 3W8DA 4ZU3A 4YPOA 3DHYA 2AHRA 3L6EA 1U28A 1DSSG 1G0NA 1IY8A 1HE4A 2O3JA 2POQX 1EE9A 4OMUA 3I9MA 3CZMA 4NPCA 1SO8A 5KCZA 3LYLA 2B35A 4R69A 2X23A 3WXBA 2WM3A 3I4CA 2A4KA 4YAJA 2OHXA 2DU8A 2YYYA 5KKCA 1PS9A 3JYNA 4JGBA 1G1AA 4FGWA 4PLCA 5JO0A 3GN1A 2PR2A 3GT0A 1WNTA 4W7HA 2EKPA 3S8MA 5C7IO 3ZU2A 4OXNA 4NI5A 4RVUA 2GPTA 1MFZA 4E4YA 4KMSA 1O9BA 3PJGA 3P2YA 1H94A 1KYQA 1ZW1A 2G82A 3E82A 4GQAA 4R16A 5KOIA 3JQAD 4R3NA 4Y6SA 3L77A 4B3HA 4HP8A 4BKQA 3CIFA 7ADHA 5U9CA 3E9NA 5ADHA 4NG5A 3VPGA 2IXBA 4C4OA 5KVSA 3QW2A 1HDZA 4E5NA 4H15A 3JQDA 3AW9A 3RUEA 1BRMA 1Q7CA 3W8FA 1ENOA 2DTXA 2ZTLA 3GVIA 2OOSA 1X0XA 4QEDA 1PU2A 3CXRA 2Q4BA 4A2CA 1BW9A 1LSOA 1TA4A 1QV7A 1SPXA 4LW8A 4ND2A 5T8KC 1JDJA 3RUCA 1R4MB 1XHLA 4FFRA 4CM1A 1KC3A 4L74A 5A9RA 1R12A 4ZICA 3FPCA 4K9DA 4MVJF 3D5QA 5GZ6A 4EYEA 1R37A 3OIGA 3A28A 4NZ9A 3RI3A 1NTOA 3H5AA 2B5VA 3BHMA 4W82A 4NBRA 1C14A 3U4IA 3ROPA 4KZPA 5KJEA 5JMWA 1ZNQO 3MTJA 5EMHA 2GERA 1XELA 3F5QA 3DHNA 3ZHBA 4EDFA 3KYBA 3GFBA 5U4QA 5JBIA 2VOJA 1E7MA 4U5QA 1NM5A 4HY3A 2DQ4A 1BG6A 1H6CA 4BO2A 4GX2A 4QX6A 1LDNA 1ORRA 1Y1PA 2GN4A 4K1LA 3EAGA 2CUKA 5DN9A 3GN2A 2YW9A 5BSFA 4J9VA 1LX6A 2E49A 4F46A 1DHTA 5COBA 2ZB3A 3AOGA 3ONDA 1E6UA 1X0VA 4XDYA 1E6EA 4IGEA 4P4LA 2X0NA 5KIAA 1SCUA 4E6PA 1LRJA 3I6IA 3NGLA 3CEAA 4WUVA 5ICSA 4XYEA 3VTZA 1DIRA 1YGYA 3DOOA 3PHJA 1P44A 4MP6A 3WQQA 4YAGA 4CQMD 2C2YA 2EGHA 4RJTA 4ZQEA 1K89A 3ZU5A 2VT2A 3MJEA 4XRGA 4HUJA 4I9HA 2YFQA 3DXFA 6ADHA 4CV2A 1YB1A 3NT4A 1YVEI 4OSPA 2QYTA 4AVYA 2CDAA 1ZCJA 2O3TA 2P4QA 1Q7GA 2WDZA 3RC2A 3CUKA 1E3EA 4BKOA 3VAZA 2TMDA 1FJHA 1HWYA 4NU6A 3WGTA 1YQGA 5CP8A 4JJFA 3GEDA 3LK7A 4MVJI 3GY0A 4EJ6A 1M66A 2ZTMA 3ZWBA 3GH3A 1KS9A 4XDZA 4ZJUA 4CV0A 5ITWA 3V2HA 2ZQYA 2FY8A 4NU5A 1TLTA 1B3RA 1JVSA 1Y8RB 5L7YA 2W90A 3PI7A 3QWFA 3DONA 3GG2A 4Z9FA 3D4OA 4MDHA 1NX6A 4W99A 3UVEA 2VHWA 1P1FA 3FSRA 4NFSA 3HG7A 4MO2A 2OZPA 4KQWA 5CPBA 1C0IA 4WNCA 3JQ9A 4OKNA 2OORA 5JE8A 4JROA 3GZ4A 1ONNA 1LLDA 3KV3O 5C7LO 1HRDA 4IZHA 3QJ5A 1EK5A 2B36A 2VWHA 3OICA 5CEEA 1OC2A 2G0TA 3W4KA 3OEYA 2D59A 4XA8A 2JHGA 1UXJA 4J4HA 4ESOA 4E13A 5JDIC 4UULA 4BO4A 3D7LA 3AJRA 4Q3CA 3UH1A 2B37A 1Q0HA 3SC6A 3W1VA 5EIOA 4YRDA 2ZATA 1PR3A 2PH5A 4BKRA 2X6TA 4AJPA 1O94A 5L40A 2VYVD 3NDRA 1LI4A 1PWZA 2DFDA 1I3KA 5JAQA 1H6AA 3SEFA 3VHRA 4DQUA 4O63O 3PHIA 4CLDA 4EJ0A 2PKQP 5GMOA 4DRYA 3PYLA 5G2OA 5BR7A 1Z7BA 4DLAA 2WYWA 3FR7A 4TWRA 4ZQHA 3GG9A 3ONEA 1XQ6A 3S1LA 3AFMA 4ZRNA 1UAGA 2C20A 1CF2O 4OIMA 1MGOA 4AJEA 1JLLA 4IS3A 2ZYDA 4JNKA 4UUNA 4D0RA 4PG4A 1P74A 2EP5A 2YFHA 3ZWXA 2CVQA 1T4BA 3AUUA 3C8MA 4BNFA 4Z0TA 1K5HA 2TMGA 4I1IA 2AE1A 3GPDG 1HDXA 3KBOA 4NMHA 1PSDA 4PZCA 1BDBA 3GAZA 3NTQA 5L4SA 1I3NA 3JQAB 1ZMOA 4FR5A 2ZYAA 1W4ZA 1PIWA 1W0CA 4IQ8A 3GMSA 4GX1A 3I9LA 4DYVA 1E3WB 1NR7A 4R68A 4NFHA 4YTEA 1RYDA 4LSWA 1MX3A 3OETA 3ZU3A 3AM3A 3VPXA 3FWNA 4YT5A 2EW8A 1ZJZA 1E7RA 3ETGA 1V6AA 2VWGA 3SLGA 3WGYA 4PLYA 4AJHA 3L4BA 3HE3A 3OQ6A 3UW3A 1WPQA 3JYPA 1YQDA 1W8DA 1PQWA 1IULA 1X7DA 5IF3A 2OL4A 4I08A 4AJOA 2VYVA 2Y1OA 9LDBA 4XCVA 1GEEA 1YO6A 1HDCA 1PJBA 2O7SA 2NTNA 4PN3A 5HA5A 1E3LA 3GHHA 1T2AA 5DBIA 3SXPA 5JCXA 3GDOA 1IPFA 4NBWA 5JXWA 3O38A 1P0FA 2EKLA 3KHUA 1H6BA 4B4VA 3LLVA 4F45A 3UKOA 1M6WA 3WQRA 5BSHA 4QO7A 1NPYA 1VSUA 3F3SA 3MJCA 3MJSA 2Q1WA 2Z5LA 2PA3A 5C5IA 1SZJG 2QRJA 2RAFA 4FQ8A 1NQOA 4YWJA 5TNXA 4IQGA 4O0LA 4LRSB 1ONPA 1V9LA 1IPEA 1CEQA 1E3SA 2P9CA 3DHEA 3OFSA 3VZQA 3DZIA 4MVJM 4ZQGA 5FF9A 2FPIA 1X7GA 5CDUA 3WSVA 4E30A 1YJQA 2VOEA 2O4CA 3K96A 4IMPA 2E6UX 2PZKA 1ZBQA 2JCVA 5BQFA 4J9UE 1Q1NA 2B5WA 3WMXA 4ZA2A 2D2IA 4E33A 4O5OA 1RPNA 1WXDA 3DFZA 3BMCA 1G0OA 2HMVA 1B15A 3KLPX 1KOLA 3ZW9A 2NU9A 4JQCA 1NWCA 2I67A 1HLPA 4DL9A 3GF4A 5G4KA 1RM4A 3DO5A 1QYVA 2X9GA 5I7VA 1R6DA 5F1KA 2Q50A 3K73O 1JQBA 1R4NB 4W4TA 5BNFA 4DIBA 4GVXA 1U3UA 1E5LA 1KVTA 4L75A 4RL6A 3ZWPA 3QWHA 4U6SA 1LRKA 3TZ6A 5TIIA 1WDMA 3Q6IA 1BWSA 4UEOA 1YWGO 1B8PA 1OI7A 4FFPA 4FSHA 4KUHA 4KWHA 3TQHA 1GV0A 1GU7A 4ILKA 2NU8A 4HKTA 1QKIA 4D79A 4XQCA 1KETA 1NQAO 4OGWA 5DULA 4N5MA 3E5MA 1DFHA 1YOVB 3GVXA 4MJLA 4WKGA 3U9LA 2BGMA 3UAGA 2X5KO 2GYYA 4CM3A 4FCCA 5BNIA 1NPDA 1XDWA 2JCYA 1QSGA 1GCOA 2Y1GA 4XGNA 4R1SA 3JSAA 1DFIA 3G3EA 5DBFA 3RSHA 2BH9A 2VCYA 4KQXA 3U0BA 3WBBA 5TC4A 2EKQA 2VNSA 5KJFA 1ZH8A 1LUAA 1T2DA 3FN4A 3WYEA 5G0SA 5TT0A 3MOIA 3K30A 4HFMA 3C3XA 2IYOA 3H9EO 4BNGA 4F6LA 5I7SA 2G1UA 3WTBA 1Y5MA 1UP6A 3SVTA 1PGPA 3D3WB 4KWIA 3QWAA 4LMRA 4P4NA 1R16A 1LJ8A 1NAHA 4OXYA 4WEOA 5KKAA 1I10A 3C1OA 1AGNA 1DJQA 3ZV4A 4L76A 2R6JA 4B4OA 4M86A 1J6UA 1NVTA 2FR1A 3U09A 1C0LA 1U8FO 4UVEA 3U4HA 1AHIA 5CG1A 5FI3A 3LC1O 4ZN6A 3JYQA 4HNGA 5A1TA 2HMSA 1EUZA 5JYDA 3H3JA 4Y6RA 5ILOA 1Y9AA 2X9VA 2HQ1A 2RH8A 3V1TC 1PQUA 2FP4A 2HK8A 1WMAA 1Y5RA 4JJIA 3NKLA 5T67A 3LF2A 3IMFA 2P68A 4D3SA 1SNYA 3HB5X 4QFCA 4ROSA 5DCYA 4ZRMA 1F06A 5HBRA 2Y1FA 1NQ5A 2C7VA 3IC5A 3C7DB 5C37A 1N7HA 1LC3A 1M75A 3PVZA 5HS6A 4W9NA 2GLXA 2PD3A 2PV7A 4MKZA 2ET6A 3H9UA 2BI8A 2YDYA 3SX2A 4WLVA 3D1LA 1BXGA 3S55A 2PWZA 4Q3AA 4C7KA 1LLCA 4AJKA 1H2HA 1T26A 3ULKA 4BGEA 1ZEJA 2EJVA 2JKVA 3WBFA 3OH8A 4P38A 4TVOA 4JN6B 3WTCA 1WW8A 2ZB7A 1QLHA 1B26A 1Z74A 1F17A 1H9AA 1NYTA 4BNLA 1PZHA 1ISGA 5IDXA 4GKBA 1NFQA 1Z6ZA 1ISJA 4EITA 1NFRA 4E5PA 4BO6A 1GD1O 4LVCA 2AQHA 2VRCA 2WD7A 1UP4A 3HADA 5B37A 2GO1A 2C07A 3LF1A 1CRWG 1SEVA 1T25A 3O8QA 2XAAA 2LDBA 1G6KA 3GNSA 3TOXA 3QVSA 1UAYA 3CMCO 3O03A 2P5UA 3LT0A 5K6AA 1XG5A 3RJ9A 3MZ0A 4PVCA 2DBRA 2O23A 2ZJ0A 2V7PA 4B7UA 3PLRA 3I9JA 3ROMA 3JYLA 4M1QA 4CL3A 4TKMA 1R0KA 1B0AA 1M67A 3RUDA 2AQ8A 1EUCA 4XJTA 3U4CA 1AXGA 4CQMB 2NTVA 3DZGA 1ZK0A 3KOUA 1UP7A 4YT8A 3AI1A 4XIJA 1U2DA 1GPDG 1BDMA 2G17A 5IJZA 3FTNA 4K6CA 3IL2A 4FW8A 1TB4A 3WOHA 3WB9A 3TL2A 3IP3A 4CMBA 4MVJE 2VNAA 4O59O 4IDEA 1XU7A 3E9MA 1U4SA 5JAIA 2Y93A 1WVGA 5TS3A 3ORFA 3TRIA 1E1LA 2HCTA 5G0VA 3WGZA 3A4VA 2ZIZA 4OYRA 5B4UA 1QYDA 1Y81A 3JQ7A 1N7GA 4CQLB 2DT5A 4U7WA 5TSDA 4AJ4A 2I3GA 3HN7A 4CLRB 3HNPA 5I9NA 1HF3A 1LSUA 2YV2A 3NAQA 2HUNA 1ADCA 3T7CA 1CQJA 3E6AA 1YONA 2W8ZA 4IJVA 3UCFA 5FEUA 1PJLA 4J4BA 1U7TA 1Y7TA 2AEJA 4YJHA 2J8ZA 4MINA 3NV9A 1L1FA 2HO5A 1QMGA 3MEQA 5DF1A 2G76A 3UGKA 4ALIA 5IFLA 3U5TA 3GGPA 2FR8A 3NGXA 1K0UA 3MJ4A 3ON5A 4YDRA 4DQXA 2NVUB 2Q2VA 3UF0A 2WE7A 2ZKLA 2R00A 3PHGA 2OBNA 1C3VA 4KDFA 4J49A 1X1TA 2NWQA 3INTA 4IJKA 3BHJA 3BTSA 1VKOA 1HE2A 1PL6A 5FYDA 4HBGA 3GOHA 1DC6A 4PZDA 1VL8A 1YBAA 5EL0A 1MFPA 1UH5A 4UREA 5I7EA 4WCFC 3I4FA 3H7AA 3JQ7B 5TJ9A 4MP3A 1DHRA 2HSDA 3WMWA 3GHYA 2UV8A 4ND1A 4E32A 1GPJA 2YQ4A 3V5NA 3OA0A 1P1KA 1NP3A 4XB2A 3VH1A 3DC2A 2E82A 3HHPA 4CM7A 1U9JA 3RC7A 1HYHA 2Y1CA 4CUZA 1P77A 1ZXLA 2GF2A 4CL8A 4RLSA 3AI3A 3HDQA 5TT1A 5JY1A 5A5FA 1Q7BA 2PKRA 4RVGA 5DOVA 1WP4A 3JD4A 4PIVA 1JKIA 1HXHA 1E1MA 4NFYA 4ZGWA 3KRTA 4WCDA 3TZKA 5TLSA 4GPD1 4A0SA 4MVJA 2B83A 3H9GA 3NT2A 3TNLA 3IAHA 1N1EA 4AL4A 1PS0A 1O89A 4OHUA 4DPLA 4WLEA 1B3BA 3KUXA 1A9YA 5THQA 4CMEA 2DC1A 2EF1A 2IDZA 1B8VA 2X8LA 4FPXA 4RVSA 5TRTA 1BW9B 3PHLA 1LSSA 3B70A 4U0KA 3D0OA 1PEDA 3L0DA 1GR0A 4XEHA 3IOYA 2W2LA 2ILTA 4BNWA 3CMMA 2HKIA 3IUSA 3B1JA 3RC9A 1H5QA 1H0KA 2A9FA 2CF6A 2O4UX 4YQZA 1HETA 3OMLA 4FB5A 4GLOA 5KJ1A 4XQEA 4HV4A 4KUGA 1UDAA 4IDCA 3ZWMA 4R1NA 2O48X 3FNFA 4II2A 3VOSA 4DUPA 3L4SO 3F4BA 1WDLA 2X0RA 5TJHA 1IYZA 3DOCA 5COQA 4A7PA 5HS4A 1KY5A 1O95A 2B69A 3F1LA 3BMOB 3M2TA 2D0IA 2PZLA 3OQ1A 1GDHA 1LSJA 4J0EA 3GDFA 2RH4A 1OZAA 3LC2O 1PJ2A 4R01A 4PLFA 4DIFA 5MGBA 4DXHA 2IYPA 1EDZA 3DTTA 3F6YA 3M1AA 5C7OO 3L07A 2FOIA 1DXYA 4YEDA 3ICCA 4BNYA 3BMQA 5JC1A 1OMOA 3ENNA 2P4HX 4CM8B 1PJCA 3GGOA 4I8XA 1ENZA 4XIYA 2UUOA 1VI2A 4NHEA 1E0DA 2YZ7A 1YXMA 2EV9A 4TKLA 3ZWOA 3MOGA 3IIEA 3N7UA 4Q3BA 1R0LA 4NBVA 5KVVA 4ONEA 1OOEA 3RFTA 4BB5A 4CQLA 4AJ2A 1BMDA 3RU7A 3I83A 4YJDA 2QZ9A 4RGBA 5EINA 2DBQA 2HMUA 4M55A 3D3WA 1DRWA 1ZSYA 3WJAA 5IDWA 1H9BA 1YDEA 4NJMA 4WCFB 4KTTE 4O6VA 3PJDA 4OO3A 3ZW8A 3Q9UA 4BB6A 4XR9A 2V6GA 4D3FA 1LDGA 3BMQB 4DC0A 1DIBA 4YQYA 3G0OA 1C1XA 3VH4A 3WNQA 1XIVA 3D4PA 3FNEA 4PCVA 3QSGA 3STHA 3RAJA 4AFNA 3CPSA 3ASUA 2CSUA 3F9IA 4CLRA 4FC6A 1N2SA 1PGJA 4CJXA 3JTMA 3HDJA 4Z0PA 3RCBA 4P4GA 3OQBA 4XYGA 4II3A 1ISHA 4TZTA 1U3TA 1K6JA 1WZIA 2OBYA 2XF8A 4J91A 3MWDB 4GKVA 1T4DA 3JCZA 2DUWA 1IZ9A 1P33A 2OUIA 2WYUA 1MG0A 2D5CA 5A9SB 2ZCUA 3OEWA 4PGFA 2WE8A 4IDFA 1FDTA 2P2SA 1VLLA 1E77A 2WWRA 3BAZA 4IXTA 4MIOA 1J0XO 2VUUA 3ICPA 4QQRA 3ANMA 4GMFA 1PTJA 4FFLA 3G79A 2WSBA 4LK3A 2OO5A 3FBGA 1PR9A 5T64A 4D45A 3I1JA 4J16A 3VPFA 4N5NA 3UFXA 5AXCA 4GBJA 3OIDA 1HTBA 4MIYA 5CFZA 4BL5A 3JQGB 4DPKA 2V6BA 3ZV3A 1LLQA 5A3JA 3T7EA 2H5LA 4JBIA 1XGKA 2HJSA 4ND5A 4KDEA 1QR6A 3AFNA 1NVGA 1Y6JA 1QYXA 1I24A 4FIZA 2PK3A 2VUSA 3PP8A 4XYLA 1HEUA 1IUKA 3TZHA 3IKVA 4BNUA 2DM6A 4UVGA 1QXSA 1L7DA 3H4VA 4BGVA 4YJHB 2DBVO 1EMDA 4URFA 2HMTA 5T8KA 5A05A 3IJRA 1CERA 3OJFA 1GQYA 5TF4A 1LDBA 2D4AA 3GVPA 1P9LA 5ES3A 5EJ2A 4TQGA 4XYMA 2NADA 2W98A 4CODB 4QSMA 4LCJA 4UVDA 4A27A 3S2EA 2J3JA
chains in the Genus database with same CATH superfamily
4X90A 1TI7A 1GVNB 3M6IA 4C5AA 3RS0A 1NLUA 1IDN1 1A8UA 1T9HA 2E0IA 3I52A 2F1OA 1V11A 3SQOA 1SRQA 3RU3A 4E5MA 2JGDB 4M9UA 3NOOA 4R7ZA 1YR6A 3H75A 5K05A 1GUYA 1JR6A 1VECA 1JTVA 2IUEA 7MDHA 4MLZA 4P7BA 5DLYA 2X0IA 3RVRA 5EFOA 1T5IA 4G0ZA 4KAAA 4ZVVA 5FPQA 2RGEA 3EQ2A 2PL5A 3WYFA 1G5RA 1B4DA 4NR0A 3VNUA 3C74A 3D31A 1MAAA 1OUMA 1N5DA 4G1FA 2O1WA 4MUMA 3CZRA 5BN5B 1WQ4A 3O0TA 4BZWA 1KEVA 3VPAA 1F51E 2AFIA 1NDHA 2WOOA 2HREA 2GPWA 5EESA 3LFHA 1RMTA 3P32A 1D6SA 2GDJA 4A4DA 1WHSB 3WRXC 1NBEA 4QARA 2ZIAA 3WRWA 3ZTYA 4F85A 2CBZA 2W8BA 2J67A 2OHHA 3Q2OA 1FTSA 4NY1A 4X91A 5L9AA 5LDHA 2Y0DA 4IDBA 1QCCA 4OHWA 3BUSA 4C4PA 2K2QB 1MO4A 3M6UA 3QENA 1GFWA 2AX3A 4HRVA 3NHRA 3UB2A 3VR6H 1P8AA 4PSVA 4D25A 2D2FA 4CN9A 1N77A 3W3AD 4DG5A 1TYCA 2FN4A 4UE6A 3RGGA 5HNKA 1JAXA 1NATA 4FLMA 5ERXA 4P86A 1DP4A 3DEKA 1RRPA 5JOQA 3D6VA 3OJLA 2ZK7A 4KRXA 2IOQA 4YMLA 3OPYI 2XE8A 3P19A 1TK2A 2G5TA 1E2DA 1XA4A 5DRYA 4RC9A 1P4SA 1BDIA 2RGNC 1KMHB 1R9NA 4PFSA 4DCNA 2A9OA 1DIGA 2GRAA 2HQOA 5AOBA 5REQB 3VPCA 4TQ9A 4ZO9A 2WJGA 4MIEA 4FOTA 5EMMA 3OFJA 5DHQA 1NRIA 1QVAA 1XCJA 3WGGA 1R15A 3P5SA 4NE2A 2YUTA 2WJYA 1BQ4A 3DUFA 3BPSA 5IZCA 1U5BB 2YCBA 3BH6A 3F46A 4GHWA 2QMZA 4IWYA 1RHJA 3FOFC 3WYDA 4M9CA 1UZMA 5FUXA 3K0KA 3TSAA 4ZOLA 1TYBE 3GJTA 3ZGZA 4QWMA 1UJNA 2PJRA 4JYAB 4P4SB 4YT4A 4JLDA 5EA2A 1C3OB 2IEZA 1IXZA 2IXDA 2J6IA 3O4GA 2DWCA 2IYZA 2UZ0A 3U62A 2J3IA 4PPGA 4BFZA 3W5DA 3K9FC 3BMNB 5EJAA 1SXJB 3UG7A 4F4UA 3BWEA 5JXJA 4WHMA 5HGXA 2YJ3A 1VE9A 1Z4QA 4FGSA 3UOGA 5JCJD 2J9FB 1T1EA 5CB4A 4GRDA 3OM9A 4LJ8A 5K3BA 3H1GA 1J0BA 1SJ9A 4WMLA 4L8LA 1EVZA 2DE0X 2H54A 3IULA 3L04A 2O2DA 4X6YA 2ONJA 3RASA 3O75A 1UM8A 3UA3A 3FLBA 5I7UA 2W6QA 5CT6A 1M2WA 2D5AA 2GPSA 1P6UA 3FZEA 3JWHA 4JD5A 5IARA 4JELA 4P6VF 4FLFA 4IWNA 1LDEA 1FNDA 3QU7A 3M1LA 4TTIA 4NAHA 1I5RA 3UV3A 4CPDA 2E87A 1UBNA 2UYHA 2JKYA 3WK8A 1SCAA 2HA2A 2AZXA 3KB6A 4QYTA 1J39A 1I13A 2E7ZA 3GGSA 4N54A 3ITNA 4EKEA 2VHZA 2FPKA 1JEDA 3JWJA 3EC2A 1KKLA 3FNIA 4JZKA 3SHFA 2YV3A 2Q4EA 4KB5A 4QU0A 3VKVA 2QMUA 2XUPA 3WI7A 4BGUA 2GD2A 4MGKR 1QAOA 1RD4A 3NIGB 5KX5F 1DKLA 3M5CA 3UPDA 1T8WA 2WZDA 4P2BA 1UBTS 2QZZA 3CE6A 3LWZA 5BWBA 2WQ7A 4TYQA 1GRQA 3GQBA 1GQOA 3GYGA 4RS3A 1NXOA 3TD9A 4MROA 2GZSA 1JWAB 4Z4EA 2D1TA 1GTVA 2JIOA 1Q6ZA 1NLYA 3KZKA 3S2ZA 2WHYA 4MWTA 3FRIA 3PJEA 3VXKA 3ZWYA 5B1EA 2N46A 3SR0A 4G0UA 4GRIA 4QDUA 5J59A 4DIEA 2MT9A 4ODIA 5TXGA 3OCJA 3O5AA 4IM7A 3SSOA 4A92A 5IZCC 3U44B 1KC1A 1CUFA 1KOFA 1R0XA 2VS1A 3HUEA 3KYCB 4LNHA 5DLDA 4GUAA 2FOLA 4LDPA 3EZXA 1E6MA 1NNI1 2BW0A 3PTZA 4M6WB 1PJTA 1QFZA 2BGJA 2II6A 2B78A 3RODA 1QVZA 3ZHZA 3F8SA 5B58C 1Q2XA 7AT1A 1TQ8A 5FO1A 1XBTA 1Z5PA 1SPBS 4W1PA 3BM5A 2FG6C 2QTZA 3RF6A 2CE2X 1M1YA 2BEJA 3GQVA 1TAQA 4BQIA 2VF4X 4WCFA 4GBMA 2CFCA 2YDXA 1OH8A 4XX0B 5MDHA 2JLXA 2K6GA 2H5JA 2A0WA 4GWLA 1PWXA 5DNAA 4QEZA 3EPHA 4TYYA 1H1LA 2PNFA 5F5NA 3T1VA 4TM7A 4O2AA 3A4LA 2B7BA 1VGVA 5CVEA 2AW5A 4J16C 1U8CB 1BWRA 4MMXB 3V8BA 3FWKA 5BNTA 5BVGB 1JHXA 5LUAA 2BISA 2WHXA 3OUTA 3FGNA 2CFRA 3EWAA 3VHXB 2VTBA 3QF7A 5IEBA 1ZUIA 1NW5A 1W4LA 1E7SA 1H1LB 2B0JA 2PBLA 3ZHRA 2I1QA 3D8HA 5J58A 1YL7A 2PX3A 3OHPA 3V7FA 2AMVA 1Z4KA 2IH5A 4P3YA 3QWBA 2VPIA 2QI9F 1QB8A 1EFPA 4M8NE 4CN8A 4AROA 1AO3A 3IA7A 3GJ8A 1UJ5A 2ZB4A 4GQIA 1F48A 2CVZA 2LZ0A 2P30A 3D54D 1W25A 3A27A 2IE0A 1TQHA 1QH9A 2QTLA 2EDCA 1DAHA 2NO1A 5IZ4A 5ENVA 4XGKA 2GF9A 3T38A 1AIPA 4DWOA 1WUHS 5EJEA 4WBNA 3W5VA 3UWKA 2J9FA 2POCA 4KQMA 4K9PA 4O2AF 3DV0A 1RQ7A 1E7WA 3WIBA 2RBEA 2A94A 3ZDAA 3RFVA 1KFEB 5H9WA 4JBNA 4QC2A 5ALYA 3M3PA 4RK7A 4X1KB 4J3NA 5B12A 5DP2A 2FOXA 2EBUA 4MUYA 4W8HA 2JLBA 1SM4A 2QW8A 3DTVD 3LBYA 1J0DA 3M9WA 4UBLA 4BYGA 2AD5A 3NAMA 3PNYA 4RORA 4KWEA 4WRRA 5BN1A 1SK8A 1ILEA 1KXZA 1U04A 2BE7A 4QU5A 4LK2A 4M0KA 1AHHA 2GKOA 3QWIA 1NPTO 2E4AA 4V0SA 1M34E 4OGFA 3QA3E 1SGWA 2I2XB 4WPGA 1C1HA 4BNKA 1Y3AA 5JRJA 1CUGA 1O5OA 2GM5A 3DBOB 1H8HD 4FYKA 3TTYA 3VVBA 1YKFA 5EJ5A 3U37A 3WNVA 2GN2A 4J6FA 5ALEA 4NBSA 5EMNA 2ODQA 1ESZA 5F5LA 3C6ZA 3PX3A 2A6PA 2O7QA 4G0XA 1MJFA 1TUGA 2F2TA 2H16A 1SURA 3ESRA 1IZ0A 4UASA 2I6XA 4Y0NA 1XL0A 1Y37A 2B0CA 4G9GA 4ASUD 3ZDYB 2BHSA 5CBPA 2WIBA 2I7TA 4M46A 5CXUA 1KEKA 5DSXA 1OU0A 4C14A 3JD0A 1FTGA 3CR3C 3WRXA 1N92A 3RU9A 2JLWA 2ASEA 2CXPA 5L95A 2ZUSA 3IOMA 4H77A 5CFPA 2FMKA 3O4JA 3ROTA 2P5YA 1U9CA 1CTQA 4B2PA 4C5CA 1RMQA 3ESZA 2IZ7A 1QV6A 1TX4B 2JF0A 4CF5A 5CAEB 2A5YB 3HZRA 4WESB 1TM1E 4UJ3A 2XT0A 1E1CB 2EHJA 2J5KA 4UD6A 5CHEA 5EQFA 2RJNA 1FTNA 2XVYA 1RLMA 3CRNA 3U4DA 3HP1A 1T2EA 3H3FA 5ILGA 1DWUA 1T4GA 1IBRA 1S2LA 2EW1A 2WP8J 3DBHA 2V1XA 5GP1A 5BV1A 3AP1A 3QSYA 1MJ5A 2RGAA 3KZOA 4DCPA 5BRAA 4B3IA 3OZFA 4JKYA 1WQ3A 2HQSA 4YP6A 1SR8A 2XGMA 3OEHA 1U3CA 3FJYA 4U6QA 2E4UA 2XUHA 4FNMA 1YNSA 1UKCA 2FEXA 1C4OA 4B3FX 4IL5A 1H65A 2CNLA 4L15A 2HYIC 2IU6A 2XI4A 4LJLA 2DBZA 2QD5A 2JAHA 4F2GA 3H18A 2HH9A 4REQB 4QFBA 5E9JA 3WMEA 4DMRA 1LPBB 4QHTA 2CV1A 1OIWA 1L5YA 2X1VA 1Z75A 2C03A 1Z07A 4R41A 3T4UA 2G4VA 3ROQA 4BFVA 4MS3B 2F9MA 3UC9A 3T41A 1CR0A 4IJQA 3RG8A 3TM4A 4EA6A 2GBGA 3A4YA 3G8BA 4V0ME 2HFJA 2ZKIA 1HEYA 4TYMA 2VQFB 3GFVA 5HWSA 5C1BA 5DT2A 1KPGA 1V9SA 2H08A 4QUJA 4FHZA 5EQDA 3RBVA 4X8LA 3LBNA 3RG2A 4G5HA 4DLLA 4P3XA 4C0XA 5SY4A 5LVAA 5L3SB 4LEIA 2OFPA 2ZULA 2ZBUA 4CETA 2JFUA 2H48A 2BFNA 1FBNA 3CB2A 4DT1A 1SVOA 3TW8B 1A9RA 4M83A 3HO1A 2JAPA 4NNJA 1XCBA 5AJZA 2V5AA 4ZV4A 3FPAA 1V0JA 4Q48A 4IX1A 3U3MA 3TG8A 1IHUA 3T7IA 4WE3A 2G1AA 4BP9A 3ZNPA 3RC1A 2YY7A 3H5LA 4BO7A 5JZBA 4QPCA 4DLBA 1Y9EA 4Y3UA 2FKNA 2FPPA 3AI7A 3NLLA 1A8SA 1H2XA 1KPIA 2RHMA 1C2YA 3BGVA 3I3SR 1J70A 1G8AA 4IHAA 4EW2A 1GPBA 2QUZA 4ZK2A 5KSYA 1G20B 3QE3A 2BM0A 3EUWA 2PXHA 4COOA 4BVGA 4ZAGA 4II7A 1O95D 1Y5NA 4RJJA 4PS0A 5H1YA 4EGCB 4HFNA 2NU8B 1PZMA 3T7SA 3GW8A 1M7HA 3IPLA 4XM0A 5D51S 3U3KA 3EEYA 2DOKA 1GGVA 3O2JA 4EF4A 1F4LA 4WVFA 1FNSA 1M1ZA 1X80A 1ZK2A 3HR4A 3I30X 1RRMA 3V1YA 3P0HA 2EFJA 1E3IA 3L6DA 1E9SA 1YDGA 2R3SA 4ZEXA 2PZBA 2ZYGA 3LW8A 4AWXA 4UZSA 1N5IA 4EMTA 2VXOA 3SSAA 4EGQA 1LBIA 3UA4A 4HOYA 2ANCA 1I30A 2AWOA 3DNPA 1QS0B 2V1UA 1PNRA 2W42A 1KIFA 4AQDA 2ZIGA 1NKVA 2ZSJA 4J07A 4Y1RA 3UHPA 5JH7B 1N1GA 1X87A 4M38A 2H00A 4DZRA 1ZCZA 2VZLA 1ZZEA 1AKTA 1SQSA 2AZDA 4MDFA 1G55A 1MJGM 2XXAB 2E5WA 4WKNA 2ZTSA 2XZOA 1A50B 4GLJA 3INGA 4G4SP 1ENYA 3IO3A 3OA2A 3T3MB 2G9RA 3TIVA 2DP4E 3VU0A 1VLJA 3EC7A 1N4DA 3RC3A 4EI2A 2A1IA 1UJ4A 2CVFA 5IBCA 4NWIA 1NV8A 3QH4A 3L06A 1X7XB 2DFNA 1J2UA 3UKJA 4AYXA 4LJSA 1R1DA 5JNUA 1GKUB 3IV6A 3GEHA 2NU6A 4C6TB 2B1QA 1RE0A 1ZBDA 5DCUA 3UFXB 1KYWA 2LCFA 5I7HA 2WD7B 1W5BA 2FUEA 4FMPA 1Q11A 5DNWA 1XD2A 1D0SA 3GA7A 1Y3IA 1SC9A 5EWLA 2DX7A 3OAAD 4G1EB 2QAGC 2BKUA 5GZ3A 4Z0NA 4N41A 2MU1A 4AKHA 3CCCA 3GRFA 1KI6A 1HZJA 4A8JA 3R7DA 4C7XA 2IYQA 2WA2A 1S3SA 3G2HA 2SKCA 1GNVA 3QLJA 4D82A 3MBKA 1PKXA 1M2HA 3WDSA 1A04A 4E94A 3HFRA 3K6RA 4X1OA 5IXJA 2C7GA 2WAMA 1T5TA 4YFYA 3RTGA 4AY6A 3KOXA 4ZD6A 5B3JA 4RKEA 2XKBA 2B34A 4OMDA 4QL3A 5BT9A 1Z62A 3Q1KA 3WWOA 5MGNA 2RBGA 3DP9A 4P92A 2EXXA 3OBBA 4DGQA 3QVJA 4Y6LA 5K8CA 2FQQA 3FPJA 1SCQA 3A1NA 2IPMA 2OILA 4EB3A 5H4GA 3N87A 3PXXA 4X97A 2A1UB 2O59A 4XJXA 3TRDA 2G36A 3M1YA 3O31A 4HSEA 4QO8A 1AMUA 4HL6A 1O0SA 2FZ5A 1QX3A 4Z4QA 4UC0A 3WGOA 4EENA 1BSVA 3AKDA 2ONYA 2NOAA 2BSQA 3AM4A 2DUMA 5EQTA 4BGIA 1MGPA 1WMEA 1O6FA 1YZGA 2WAYA 2X4LA 3KKNA 1OZHA 2YHBA 4BQEA 1QE5A 2BKEA 3DM9B 3WQHA 1SQ5A 2WSIA 2Z95A 3FE2A 2IC5A 3ESYA 3IALA 3DAHA 1ZN9A 2IZ5A 4IV8A 3M6VA 2BOVA 1PEYA 1P1IA 3KT6A 3ANNA 2VSNA 2XQFA 5CB4B 1DAIA 4EUKA 1EFRA 4MEJA 3WFJA 3IXQA 4LDNA 3RYHB 1T5BA 4UM7A 2R8PA 3TLEA 1PEKE 4RENA 1U1GA 3B9PA 1QIJA 3ETCA 3GLUA 4ISBA 5D3ZA 5DOZA 1ZXXA 4MPJA 1UDBA 5I7AA 3V4VB 2R97A 1LNZA 3HB4X 4ITRC 4FU0A 2BUAA 3TRFA 4CEJA 5I4CA 1FBTA 2ZJOA 3E61A 4IVPA 1SOVA 1DBIA 1LBEA 2YJTD 4A8HA 2FW0A 1XCPA 4P7FA 4RPKA 5C4IA 2PLNA 3DCIA 2ZUBA 1UBUS 2JJQA 5BSMA 3TQQA 4WFIA 1MXHA 1DUVG 2VF7A 3AOEC 5FFFA 3SDSA 4DVGA 2PH1A 3PPXA 4D9IA 4B5KA 4ZCRA 4I9UA 4UMFA 3JX9A 3LRXA 3HCRA 4U0JA 4OAOA 1REQA 1P1JA 2UYYA 3HWWA 2BMAA 3UAOA 5D3MB 3RRJA 5M5BA 4HNAA 3LKVA 2GSWA 4RXMA 5G0WA 1G8JA 3OQJA 5SY6A 3LT5A 1O96B 4YP1A 1X2BA 5EPUA 5ISMA 2XRMA 3IOBA 4JLUA 5ICGA 1OLXA 3GEBA 4RGQA 4QYIB 3WKAA 1U8UA 1N5JA 1T43A 2Z9BA 1U5CA 3EGWA 4JI3B 2X5XA 4AXBA 3D2CA 3ZD7A 1ZOPA 3B6KA 3UW1A 4TZ0A 4D8YA 1KJQA 5IT5A 4N47A 5LIPA 3D6TB 2UU9B 1CR2A 1JKFA 5A4FS 4KN9S 2YS7A 5HE9A 1MB3A 2UXDB 4E2YA 3ZY6A 1N3YA 4YT2A 1E6WA 5CMLA 4B31A 2JIRA 5DX8A 5DN6A 1LVUA 3GT4A 1ID8A 9LDTA 4DR2B 4BQFA 5BV0A 1QOQB 2L17A 3CX7A 1NLFA 2GPJA 2IZ0A 2MINA 1KVQA 2H11A 3SIWA 4NCAA 2O8EB 1NC3A 2D5IA 4C0SA 2WF7A 3ZCSA 5D1NA 5AXBA 5E0KB 3T8YA 4D6XA 4F8JA 4NZOA 3N2KA 4YMWA 1SB8A 1EM8A 1L4NA 2EEZA 3KXKA 1Z4PX 4L9RA 1BYIA 4MQMA 1ZOSA 4JA2A 2R5FA 4EB0A 3GP8A 1Y6ZA 4KQJA 2YN0A 2NTYC 3VNAA 1BMQA 1XPUA 2I29A 2HWKA 3AY3A 5DHAA 1Y7IA 5FV4A 4CMIA 1K1EA 5LP1A 3UK7A 4PFJA 1W73A 3GYBA 1H93A 3K9BA 2OFOA 1A9PA 1SKBA 3KD2A 1WETA 1GRCA 4L2IB 4CV3A 1S3IA 1VYHA 5BXQC 2JFXA 2KE5A 1A97A 4MULA 3T5CA 2JZCA 3BXZA 4MKGA 4KNVA 2HU8A 5EHGA 1KE2A 4RPJA 5C8DA 1PG5A 4RLFA 4N1AA 4N9QA 5EVCA 3L7NA 1WLSA 5JSHA 2JA2A 4G8JA 4OV6B 4K9LA 4JP3A 2BR4A 2AG5A 3DMHA 3RT7A 4ECEA 5A2QA 3ONFA 2HNKA 3GZNA 5BQXA 1Z4NA 2XUGA 2P35A 3HYLA 4HPXB 4UD2A 1TIPA 3CWCA 5A3QA 2JFQA 1T9GR 3B1KA 3HC7A 4RCZA 3R5KA 3IO5A 1WUYA 3O21A 4K86A 4YCAA 1SEPA 1CR1A 3UM9A 4B3DA 4MHTA 4GSYA 3I5UA 3UXYA 2C7BA 5I7WA 1N9GB 3D5EA 5K9ZA 5KTYA 3HKBB 5CIQA 3CC8A 3K31A 3QUCA 4TS4A 3TLZA 2GCOA 1Q3HA 2A0XA 2VDWA 3U3OA 2A1TS 1XTJA 2BDEA 4X8HA 5K8UA 2YWHA 1NUTA 2DPLA 1SUSA 5TPWB 3UAWA 1PYOA 2PV0A 3DD1A 4BFUA 5I3ZA 1OBFO 1QZZA 2XH8A 3CS3A 3AR7A 2FRVA 4MDEA 4D3DA 4KR0A 1THTA 1R50A 1NSFA 3L0SA 1JEAA 3DAGA 3RUHA 4C04A 5CD9A 1L6RA 5BO5A 4BBPA 4DVJA 3EJWA 5IYZB 2X76A 2NUBA 1AE1A 2H1LA 2WC1A 3JQEA 4CKWB 2YNMA 5B7PA 1JPVA 3KAQA 5EHNA 5CT8A 3CNEA 5THXA 1DAKA 4ZQFA 1GNQA 1P45A 3JVDA 1KMHA 2IGTA 1Z0ZA 3QFTA 5D8DA 3NR2A 4ID3A 1II9A 3RF7A 1RKUA 2GSDA 3I8SA 4LYJA 2BI4A 2CLMB 4OXRA 1WP9A 4L9WA 2NZWA 4CG0A 3GL9A 3K2EA 2RGBA 3H16A 2RHDA 3P9NA 1UKVY 3K5PA 3MM4A 2IYRA 4PLZA 5TMPA 1V1MB 1AN9A 1DRJA 1WCV1 3CH5A 3E7WA 3FUUA 1SHLA 3FWYA 3KWFA 4D4IA 1RMYA 3HJAA 2CL5A 1ZIXA 4R1PA 2BZGA 3TL6A 1LBSA 2QXUA 2OBFA 3C85A 3V8RA 4EHHA 3W2HA 2O2SA 2R00C 4FE7A 3TG2A 1DJNA 3AB7A 4FUQA 1T8PA 5T6MA 4R0NA 4CKEB 1XAJA 2R2AA 2WTMA 4JX8A 1JT9A 5CR9A 1UQTA 3RDPA 1N9GA 2FG7C 3ECCA 3A9RA 3IVAA 3MJRA 3KXDA 3U4AA 3COSA 4LTMA 2DR2A 5BWMA 1XZEA 4DA4A 1YL6A 2QRNA 3L3BA 3IH5A 4O29A 4AG3A 4OXQA 3DZKA 3NJ8A 2Q99A 3EQZA 4HDSB 3FSGA 3MOSA 1N8SA 3TMKA 4D26A 3GCZA 2DY0A 1V95A 3DMDA 1HYBA 2ANBA 4OPMA 1VA4A 2AN5A 2ATXA 2H7CA 3U0VA 2AXEA 3UAYA 4XKJA 3SPXA 3EXHC 3ZGYA 1A4UA 4M2LA 2WVJA 3S99A 3X1ZA 3I2KA 3QEMB 1JR2A 4YCLA 1TEXA 1YU6A 3Q8KA 4LZZA 1RKVA 4CQMA 3PHBE 5DCLA 3LOQA 4IHQA 4RYDA 3OLWA 3FROA 3KTDA 3K5WA 1HY3A 1RIFA 2Q1TA 3OX2A 5BN3A 1S7GA 2OCGA 5EUMA 4JJGA 2P1ZA 5L3ZA 2E4WA 2Q1YA 3ME5A 3B7PA 2Q3MA 5CDGA 3B9BA 1UQRA 2OFWA 3AYXB 4AKSA 2Y4OA 2M32A 4FMDF 4B8WA 4E03A 2F1RA 2SECE 1TA9A 4J0FA 4FONA 1ORHA 4RDHA 2EWMA 7ABPA 2DFVA 1E5TA 4WZ6A 2I55A 2V8OA 4QLOA 4YDSA 3V80A 2QRLA 2ZUTA 3ZWKA 3LP6A 2YS6A 3BF8A 4UUMA 5AK0A 1GNTA 3CPJB 3F7MA 3IBGA 3MJVA 1IL0A 2NQ8A 3IE0A 4D6YA 4JP1A 5BW8A 1U0FA 1U1IA 1WHSA 3JVIA 5IDVA 3PRHA 5EKTA 4QE3A 4BMYA 1ETUA 1YSCA 2B8WA 4ZANA 1TO1E 5JC8A 3UKDA 4GRAA 4CYMA 3V4PB 1JQ5A 1RXUA 3U13A 2WUGA 3WX0A 4LJ6A 3VZRA 1VL6A 2HHAA 1JPNA 2Y9PB 3G2PA 1DDGA 1ZRSA 2GUGA 3H2SA 3IYLW 4AZVA 1DEHA 1F0KA 2YTZA 3O3NB 4B45A 2OCBA 4CIDA 4BV9A 4EJSC 1KNXA 3INRA 4HZUA 4XR4A 4EKNB 4ITVA 4X95A 4F4IA 4YJGA 1C1DA 3JRNA 4KE6A 4XWTA 1D6MA 4RO0A 3FKSA 3B3AA 1IAVA 3FDZB 2Q2QA 3DPUA 4YJ2B 5I8ZA 1KZ9A 1E94E 1QDEA 2WFZA 2ODWA 1NDUA 3JQ9C 2YVKA 3A3PA 1Q57A 1RQRA 2FVXA 5KVQA 5THKA 2ZSAA 2NUPB 4M9SA 1XZGA 3N53A 2ZZMA 1T1SA 1HDOA 1UBHS 4G2NA 2LUOA 1OH7A 3QI7A 3HLTA 1R0YA 5L4LA 2JAWA 3VJRA 1A98A 3TR0A 3G5TA 1KEWA 2QVLA 4XIGS 2YR0A 4FYIA 2VYFA 3A9WA 3UIEA 2CD9A 1PUXA 2QSUA 1PV1A 3K53A 5FP0A 4QBIA 4JY7A 1ZL0A 3GPIA 5LWQA 3UQZA 3AB8A 3LZ6A 2CF5A 1NJGA 1JB9A 5KVCA 5FUMA 1RHQA 1DRUA 1RI5A 3G8CA 5I7FA 1TK9A 2IX9A 5CJPA 2HLPA 5AT1A 3AY6A 2IE8A 4A0FA 1R5NA 2NNLD 4FFNA 1DKQA 2HK6A 4YA6A 2H9AA 1VKJA 4LY0A 4MI6A 2KLHA 2HRZA 2W22A 3JQBC 5EIAA 2C5HA 2CMDA 3M82A 2ZLBA 5IEJA 2HR1A 4F9GA 2GN8A 5EIBD 3SMQA 4LF7B 4PSAA 5HZKA 3HKCB 3RSSA 2JFPA 4MV5A 1A2KC 4BLOA 1E79D 3I32A 4FIDA 4PYJA 5I8WA 4GWGA 3PWZA 3HJRA 4TRMA 2V7BA 3BJZA 3NM5A 2F67A 1XWFA 1X7YB 2O2JA 5DK4A 4BV8A 5L8VA 3SM3A 4TMFA 1Z82A 2AXQA 1XVUA 2BHNA 2C82A 2IZ6A 3ITDA 3QTBA 1GGJA 3LCVB 2WP0A 1X92A 3QVTA 4IIBA 3UCEA 2ZT5A 2B8NA 4EG1A 2UVQA 5LDGA 3ZQKA 2H0AA 3C5WP 2VKTA 1EQ2A 1NN5A 2IDKA 2IZ1A 2W6CX 4GOKA 4H6WA 5AVYA 2QRKA 2XNKA 4ZI2A 3QPDA 5BPHA 4JT2A 4FE3A 5JQWA 5FULA 1MTOA 2J9ZB 3BIOA 4RUKA 5G1PA 1U8YA 2PGOA 3KWJA 1GKKA 1W0KA 4DTCA 4UTRA 4NNOA 4ARZA 4BVLA 1RPJA 1ULSA 4ZZIA 3TLCA 2QTRA 1GSAA 4J1SA 3BMCB 5K0CA 1CFZA 4M53A 4R3UC 5FUVA 4CCYA 1GPLA 3ER9A 1HZZC 4Q7EA 2XNDA 2EG9A 5KSWB 2J4CA 5EWJB 3OTGA 3CVJA 3ITKA 4PY2A 3FH0A 5LA6B 2QNIA 5JFGA 4ZYLA 5JWOA 1G66A 1U6JA 4W5RA 4HQ0A 3HM9A 1EGMB 1E20A 1T36B 2X2FA 1A5TA 3QLVC 2QY6A 2IF0A 2I78A 3AR5A 1GFSA 1YK0A 1Z6PA 2QU8A 1R4NA 1XLVA 4MQ6A 4HXYA 2ZE6A 4RS4A 4WGGA 4ZTBA 3N0WA 5I47A 2QTMA 2FNAA 2D4HA 4CLEA 2CBGA 4OH7A 2VYCA 4OOFA 5LR6A 4IV0A 4PG7A 2A2ZA 4HNHA 3ZCUA 5I45A 2F8MA 1GU0A 1AB5A 3FNBA 2BM9A 3AQ4A 3SLKA 2OB2A 3ORYA 3GLHE 4P33A 2H92A 5LXTA 3TSZA 3BXEA 4RK1A 1SUWA 1YA8A 1LTHR 3EVNA 3JQBA 1UK7A 1U2QA 4PGAA 3TFOA 1NBME 3IURA 2ZVJA 4OM8A 5AYVA 2D1SA 3UMBA 1OAKA 3G13A 3AGQA 3DDHA 1MQAA 3NDIA 2WA1A 1KVSA 4AJIA 3E7DA 1TVEA 1F9AA 4ZAXA 4TM8A 3D8SA 3N2KB 1KJWA 4MEBA 3R7BA 3K2BA 4AG6A 1EVEA 2CNOA 3HJUA 3GUZA 1D8AA 2GVZC 4TL7A 3TX2A 1QQBA 1NBMA 2W43A 1PD1A 2F8TA 1Y9ZA 2HRBA 4GMKA 3IAUA 3AHEA 1EVJA 3EEBA 1YQTA 3IBSA 3W5BA 1CX9B 1CZHA 4TTAA 4XB1A 1KQGA 4JEMA 3QPCA 1QGED 3THYB 1ZK1A 1C8KA 1K7FB 1KIMA 1Z2CA 3DMTC 3MCVA 3ONNA 2XQVA 1BXRA 3L4EA 4LJ9A 4PR3A 1NN3A 1ZNXA 3RTCA 5E1DA 3W78A 4YP7A 4TT3A 1NI4B 2HRQA 1WY5A 3KYJB 4DLSA 1XMJA 4F93B 2Q41A 3M4ZA 4CT5A 1GTL1 1RJFA 5HQTA 1B23P 3TGPA 5EIXA 3I1FA 2QD4A 1LK5A 2UVPB 2XHZA 4HH1A 2JHAA 2FWPA 4P8RA 4CUJA 3SCZA 3IKTA 4LN1A 1RXSA 4FD3A 1M76A 1LLUA 4MS4B 1CZUA 1O8BA 5DIZA 1MUUA 1WLYA 2PAAA 2DH5A 1IXKA 3OOEA 5CURA 1YS4A 1POWA 2R6FA 2VFAA 2RIRA 1IUNA 1DLJA 2LVBA 3EGVA 2G06A 3JPWA 5GOTA 1E3MA 1P7ZA 4YS6A 2D06A 4RBNA 2J1LA 3MIZA 1F1JA 5TX7A 3A3OA 2QDXA 3FZGA 4RPHA 3MWFA 4B2IA 5ENZA 1I36A 3T1OA 1JW9B 2Q6VA 2H2FA 2Z6VA 3CWQA 1VP9A 2OORC 4YVFA 4A1OA 4CIXA 5BOSB 1V8PA 1D2HA 5FFNA 2LRHA 1R9JA 1Z0IA 3VYTB 2XOXA 1XJQA 5SYNA 4E31A 1GZ3A 2ZS9A 3BD7A 4I5FA 4TV9B 3I9FA 3LY9A 3I53A 4REMA 1LV8A 2PGDA 2X0DA 1J8VA 4HNQA 2VJDA 2VR1A 3A05A 4PW0A 3TEMA 1CJUC 4NYJQ 2DG2A 3NT5A 3UMCA 4HEQA 1GZ6A 3YASA 2I87A 4A91A 5I5EA 3EVBA 1D2GA 1VJ0A 4JLWA 3I6MA 4KVFA 5H02A 2XY4A 2MSCB 1GSIA 3LO5A 4NMXB 1FP2A 3EXG1 1ES9A 3EOAI 3IJPA 2JBAA 4WWHA 3ZBPA 5KOJB 5E95A 2AMFA 1EBFA 1L3IA 3LTEA 4N3AA 2RE8A 2VJQA 1E4EB 4GYJA 5IANA 1UC9A 4DUGA 3RT9A 3E23A 1MEOA 4LA4A 3CF4G 1Y8AA 2C4HA 3CY6A 3RRYA 2BEKA 2Q7OE 3KEQA 1IB0A 1BEZA 821PA 1DQPA 3LYUA 3TW8A 3VZCA 4DZTA 3U4QB 4FFDA 4J75A 5LQRA 3AERB 1LPSA 3DAOA 5CVJA 1ZITA 1Q95A 2HPZA 1QPBA 2X5JO 2ZIVB 3GP3A 4GC5A 4WBSA 5I9MA 3VPDA 4HZIA 1QG6A 3N59A 4OB7A 4W7SA 2PVPA 2PFGA 4B6EA 5LOVF 4ZTZB 1GP2A 4GOMD 2P9JA 3IDQA 5ER6A 4K5QA 5T5QA 2BFOA 4OL9A 3AL3A 4GI3A 4I5DA 3MT7A 3U16A 1JVBA 3AL2A 4XGRA 4UEWA 3COWA 2VDMB 5JCPA 2PTGA 2FZCA 1UMBB 3K2IA 5TPZA 4BKUA 3VBCA 1J5PA 1Z4LA 3D59A 1DKPA 2AG1A 3RIYA 2H17A 3MRXA 2JD1A 3RV3A 1KP3A 3UNXA 5LQDA 3KJIA 3W9SA 3SM9A 3V1NA 4BCCA 4M76B 2ZRJA 4DHEA 1AA9A 1U9IA 1ZJ6A 3SJAA 3RVPA 3AO0B 1I1QB 3BB4A 2BL4A 4LI3X 4CI0B 4O5AA 3W5UA 1UMDA 4F2HA 1JHZA 3O74A 4OKIA 3IUYA 2XE4A 2GD0A 5FOUA 1C80A 4QFMA 4W9NC 1SBZA 4KXXA 4TZKA 3KUKA 4P31A 1K8ZB 3S1AA 1J8FA 5DP1A 2NXEA 1MDFA 3Q1LA 4C0BA 4F5WA 1DOZA 3VSBA 4A26A 3FWZA 4A6EA 4B4WA 2IQ5A 1CJTC 4EZBA 4L9SA 3VZDA 1JAZA 3NRCA 1I3LA 2WVAA 4K9NA 4B3BA 1I3MA 2ACEA 2AOWA 1E3QA 5CGQB 5E9WA 1VYTA 5IN5A 4B0PA 1ZY2A 1GCAA 1DX4A 1PGOA 2B4QA 3IT0A 1FDIA 4ML3A 4ZALA 2G83A 1DRVA 1CVRA 5FTNA 4YUXA 5K03A 4RCYA 3MWLA 1TJNA 4BMVA 2PKWA 2XB6A 3DV0B 4UDXX 2GBFA 3PGXA 1KI7A 3ETHA 3BZBA 3W8RA 2P62A 2ZR0A 1A9ZA 1Q3TA 1UBLS 2DFLA 3Q9NA 3D6HA 4PPYA 4CF7A 1I2DA 1WTAA 3RSOA 3JQGA 1RTKA 3EVZA 2B4YA 2REOA 5JAZA 1DAFA 2BELA 1JXQA 3T4PA 1WKVA 3V3KA 4JBHA 4B4KA 4UTNA 2VUTA 2DCUA 1LU9A 1FFXA 3IEXA 4FHEA 5FR1A 3SX4A 4ZC8A 1IG0A 1NI3A 2FPSA 4DLXA 4PYNA 2JFZA 3KYDB 1R0CA 4F56A 1A82A 1QIDA 4KE8A 1SHJA 1DMRA 3ZD9A 5LYJB 3AX6A 1A71A 1YOBA 3MS7A 4GIBA 1A88A 2HQRA 1LWOA 2GYUA 1U6KA 1G4UR 5B4TA 1YRLA 2XB9A 4KXNA 2YJNA 1EP9A 3KVOA 2GQ0A 4CL0A 3EA4A 2IHTA 3AILA 1NQTA 1BFKA 1M5UA 4ESVA 3ZK8A 5GZ1A 5IPFA 1RYNA 3I9V1 3OPVA 4UHJA 4Y2YA 5J4VA 1BZYA 1LPNA 4IG4A 3LG2A 3WGMA 1U2DC 1XRRA 3VJLA 3KSAC 3OIFA 2XYPA 4IQ4A 3FYDA 2OXIA 1WS6A 1QLWA 1VPDA 2Y1LA 2XTZA 1TT5A 3DBRB 4IFTA 4LSMA 4MCAA 1B2RA 1GKLA 2AQIA 2EIHA 1D1QA 3LW7A 1DDIA 4ZEWA 3WICA 1ADGA 4DN6A 3GI1A 2HC9A 1I32A 1R3UA 4TMKA 4TV8F 1FDSA 3ZJVA 1W36B 2B2NA 1MB9A 4JV5B 1PWHA 4WK6A 4HH3C 3OSZA 5DHPA 4AZ0B 5CA0B 1QHGA 5AOVA 1DB3A 3KT3A 1X13A 2FUG1 4A16A 2EL7A 3PS9A 3U17A 2C77A 4EHFA 4OHVA 1XMPA 3IVMA 5CA1B 4AQYB 1JR3A 2P8SA 1VHTA 3T5GA 3ZCXA 1FVFA 1IM8A 4HHEA 8AT1A 2OLJA 1J7KA 1XC7A 3DNFA 3K4HA 4Y6GB 4M54A 4Z3KA 4E0BA 1JU9A 1K2VN 3ADKA 1CQZA 3I09A 3WMFA 3V1LA 4BQOA 4CM6A 2RGRA 4UAUA 1MZPA 4W7IA 4ZAZA 1XQXA 1FFWA 1UBEA 2GB4A 3JWIA 3NEPX 3HR7A 1PQPA 3SICE 3W8DA 3WLMA 3KKEA 1ZRMA 4DV1B 3L1JA 4IIDA 2AHRA 3N8HA 4ZYXA 3EEOA 1W36C 2AGVA 3KZXA 3O7MA 3QF4B 1IY8A 1N2CA 2GCEA 2O3JA 4R9VA 2POQX 3T7RA 1EE9A 4OMUA 3I5XA 1CR6A 5CDFA 4NPHA 1M0SA 4XSVA 4R69A 4I3HA 2LTAA 2WM3A 3PX2A 3I4CA 4F0JA 3MB8A 1KWGA 4KOEC 3H0EA 2OHXA 4IFIA 3FXAA 4WESA 4FTWA 5EWJA 5DNUA 2BGTA 3G23A 3I6YA 3GT0A 5LQUA 1WNTA 2YVUA 3EXFB 4LYHA 4LBWA 4R7TA 4D57A 3E9ZA 2BTEA 1GAWA 2H1CA 3UY4A 2A8YA 4NI5A 4PCUA 3ZU2A 5FJJA 2C4VA 2O7VA 2IYTA 3B52X 4E4YA 1KTIA 3PJGA 3ORQA 1PT9A 4LX8A 1ZW1A 1QH1A 2G82A 3E82A 3TQIA 2V3VA 5CLJA 4ND7A 3FA2A 1T3SA 2XSZD 3JQAD 3R40A 1EGHA 2Q5QA 4Y6SA 5GGXA 3ASZA 4XDHA 2VP2A 4BKQA 4E46A 2HDNB 3E9NA 1SA0B 2YICA 5ALVA 4WV3A 1LFAA 5CU7A 5ADHA 2Q3LA 3VPGA 5G41A 2QEQA 4HDCA 4MLCA 4Q37A 5IABA 5FIUA 3QW2A 4FZ5A 4URWR 3TNDA 3QTLA 1B1AA 3JQDA 2E18A 4EGAA 1VYUA 1UKBA 1J1IA 1BRMA 1YZQA 3W8FA 3KZ1E 2G0AA 1YE5A 2WUWE 3H5IA 3EPKA 2YZNA 2ZTLA 4CIBA 5KQRA 4F1WA 1EFCA 5AVTA 4X20A 1PU2A 4BQNA 1KZ4A 1SUIA 1V5IA 3CXRA 4L7QA 4NS1A 5KPDA 4LW8A 1DUIA 2AUMA 4ND2A 5H16A 1M2KA 2I1LA 3KZCA 4YMVA 3PX7A 1KQPA 1R4MB 2B30A 2JVKA 2R66A 4ER7A 3SQDA 1R12A 3H04A 4DYHA 2WIDA 2O0MA 3W06A 2QL9A 1PWEA 4PAWA 3RT1A 1VHLA 4HQ6A 3FGOA 4HWPA 3RI3A 5K6TA 3BHMA 3VNSA 1UFQA 2PJUA 4HO1X 4KZPA 1QCZA 2GBLC 3SK0A 1L1QA 5KJEA 3FAZA 5JMWA 3ZXUB 3L8GA 2HCJB 3MTJA 1RBMA 5EMHA 5ELXA 3DHNA 5U4QA 5I4IA 2O8FA 4UARA 3C3AA 1E7MA 1XDGA 1GHTA 4Z7NB 3UAZA 1NM5A 4HY3A 3G2QA 2FHPA 5JI3E 1NTRA 4ZCTA 3R6LA 2AFIB 3A70A 3OZGA 2VQEB 4Q05A 1JLLB 3D0KA 3EAGA 3L8FA 2VTBB 5AWFC 3JVUA 3G2NA 4RGVA 4J9VA 1X1AA 4FFBB 5JJLA 4UKDA 4BJ1A 5LQNA 1OGJA 1LX6A 2A5DA 2E49A 3DCJA 4PYRA 3OTIA 4QBFA 3SNHA 2IF2A 4NS4A 4F46A 1CF4A 1YE8A 1JXAA 1Y1TA 1L8LA 2ZJ3A 3DVLA 3NV7A 3OVMA 3WHKA 4F8YA 2RGXA 5FL7D 4B73A 2ZB3A 3HK2A 4KSCA 1L4HA 4U1RA 3FM9A 3MTDA 5EUBA 1YB7A 3ZWQA 3H13A 1UADA 3M1IA 2HBYA 3K70C