3PH0C

Crystal structure of the heteromolecular chaperone, asce-ascg, from the type iii secretion system in aeromonas hydrophila
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
MNVQLKKQLAELALAGTGHHCHQEAASIADWLAQEECMAECVTLIRLSSLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the heteromolecular chaperone, AscE-AscG, from the type III secretion system in Aeromonas hydrophila
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Chaperone
molecule keywords AscE
total genus 20
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.1040 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ph0C00
3PH0C 4E85A 4KVOA 4EBAA 4KVMA 4E6HA
chains in the Genus database with same CATH superfamily
2YHCA 3T5VA 2L6JA 3SFXA 3ZYMA 1RW2A 3QWWA 4U95D 2QFCA 2OCCE 3JQ1A 3TWQA 2F0YA 4LG6A 3BUAA 4WNDA 4N5QA 1N52A 4F53A 5KJLA 4LNUD 1TJFA 3G2TA 2KCLA 2WM9A 2L0IA 5EX0A 3NZSA 3QWPA 2GRMA 3ASNE 2WXNA 3D9MA 4U0ZA 4KBQA 3VLFA 2CG3A 2IFUA 1HX8A 2F8XK 4KXKB 3MKQA 5KJNA 1UG3A 2FO1E 1N0QA 4EBAG 5G04J 3V79K 3L54A 4I2ZA 4JA9A 2R17C 3Q5MA 4LCTA 2H6FA 4GCOA 2XGOA 2IEJA 2QZAA 3CVPA 5EX3A 2JEKA 1B89A 3UT8A 3TXNA 3MEKA 5AQ9A 2VGYA 1Y6IA 2EQXA 2WXIA 2EILE 4NQ0A 1YCSB 3C98A 3BU8A 5FQ7A 1YYHA 3QWVA 3FU0A 4CRWA 4CYMD 3KEAA 4JEUA 2CFUA 4CDRA 3PZ1A 3EHMA 2DCPA 1KPSB 4U8HA 4PH4B 2MYOA 3APCA 3UT7A 3ULEG 1YMPA 3FHEA 3FUIA 4GPMA 3RSEG 5G55A 4Q94A 4WUYA 3QK0A 1NFIE 2IONA 4GPKA 3FUFA 2PM6A 4CDNA 3QDNA 1EDUA 4J7WA 2AW6A 2XGMA 1TN6A 2GRLA 3IHYA 3QKYA 1UN8A 1S64A 2C0MA 4WAFA 5CMWA 5B1BE 5KJMA 1N9AA 1UOHA 5BV0A 5BPPA 3CSTA 4I6JA 2IQCA 4JXTA 2E0IA 5LFAA 4GA2A 2XGSA 1OY3D 1WAO1 3MZLB 3Q73A 2KC7A 4V3IA 3RU0A 2XRYA 5B3SE 2LO6A 3WXXA 4K03A 3U64A 1G3NB 4PUCA 4K5AB 4UWHA 3Q9NC 4DLQA 4C48B 2J09A 2V4HC 5HQ8A 3TJPA 3C3QA 4DI4A 1HE8A 3EUVA 3DWLG 1ZBPA 2ETAA 5EKQD 1IHGA 4U8YD 3AG4E 2WXJA 4E6HA 1IQUA 3BG1B 3S7DA 2IU1A 1PC2A 2OOEA 2ZGDA 5KBAA 4F1SA 4URKA 5T8IA 2UY1A 4YVOA 2P9NG 4G25A 4CT4A 2H6IA 1H2TC 3ML8A 3APDA 3O48A 2H6HA 3D9OA 2VSYA 2XS8A 4YDWA 4MS6A 4APOA 3G2WA 5FINA 4U0UA 3BG0B 3SFZA 1HO8A 1H19A 4HLLA 4XKBA 1E90A 2XPYA 1OCRE 4JL0A 3SBTB 5EILA 4CZ2D 3VTYA 3PZ3A 2E2EA 3U4TA 4FJYA 1K1AA 1VDYA 3BEEA 5CBOA 2KBXA 3ZEFA 4RG9A 4DPRA 4YDOA 3FUMA 1SW6A 2HE0A 3ESKA 1ELWA 4U07A 1EF1C 4DK5A 1NP7A 1N4RA 5HKPA 3Q79A 3FUDA 4CGVA 5KNHD 3CHMA 3JUIA 3B13A 1N4PA 3NZUA 1E8WA 3ABKE 2IOLA 3G2VA 3L22A 3SD5A 3JYSA 5ANRA 5FTPA 1LD7A 1K8KG 3PRZA 3CVXA 2JABA 3QNKA 2NXPA 5A7DB 4JC8A 3LY8A 2EIKE 1NL4A 2F8YA 5JHBA 1KZOA 3FUHA 4JA7A 5KJKA 5ENTD 5CBNA 4L2LA 5EDSA 3PZ4A 2XCBA 5D2MC 3HXBA 4HVBA 4UQXA 3CR3A 2AXUA 3MA5A 4FHKA 1W3BA 5D0QD 3WG7E 1HXIA 4A3TA 5CRVA 1X81A 1SVXA 3UI2A 3URZA 4FHJA 1BD8A 4B0ZA 2WXLA 4AEZC 1IQRA 3HXFA 3L13A 5AARA 1IXVA 5LX8A 2KZTB 1UN9A 5J90A 2XEHA 2J4DA 4N2SA 1DNPA 2WVIA 3DSVA 3PREA 3AAAC 4GMLA 2HO1A 4IN3B 1QYMA 1TNOA 3E37A 3UMVA 2XPIA 1A5EA 2NC9A 4TV3A 5BV1A 3MX3A 4ANUA 4XKCA 1N4SA 4HFGA 4KZCA 4RG6A 3PNTB 5JHAA 1LF8A 3DSXA 3RIBA 4AY6A 3NF1A 3ML9A 4UWKA 2V0PA 4ANXA 3DPDA 4J0UA 2ZISA 4BX8A 3GYZA 3AS5A 4Y6CA 3L08A 4MRUA 3SBSA 2LXLA 2KM4A 2P9LG 4I1AA 4GZ6A 1N0RA 3ABME 4ANVA 3Q9UC 5JJ7A 4RLYA 3OAWA 2V5FA 1NZNA 4XI9A 2RG8A 3SZ7A 3HDXA 5BUZA 2VQ2A 5EIDA 3UM2A 3IBEA 2IO2C 3CHQA 4AP2A 3SF4A 2XRZA 1FCHA 2HR2A 2WMOA 3CHSA 3JUEA 4GZCA 2KATA 3ZN3A 3HXEA 2DYSE 3EIQC 4EQFA 4GZDA 3CVUA 2IY0C 5G2NA 2AXVA 3UIOC 3JXJA 1OT8A 5FWQA 5CCLA 5AN8A 1TNYA 3I3NA 4EHMA 1LD8A 3HYMB 3MGBA 4QQIA 3AS4A 3I4GA 3TG4A 4G26A 4GTOA 1HS6A 1SZ9A 3IEGA 3SI5A 3EHRA 1D9SA 5LCWJ 2VJ8A 1Z3XA 4GTPA 5KWDA 1RZ4A 3FTWA 1O1TA 3LKUA 5ARGA 3CSFA 1MX4A 3FUEA 4TUUA 4GB9A 2X38A 2PZIA 3CK7A 2GGFA 4JPSA 3L6AA 4K0RA 4DLOA 4UI9K 3PH0C 2XEEA 2Q7FA 4B94A 4HRNA 4CT0A 3I5PA 1U3DA 3O4ZA 4HRLA 2LSUA 2R02A 3ZW3A 1QQEA 4AY5A 3TWTA 5JJTA 2GRPB 3V30A 3SO8A 3FEXA 4DX2A 1MX2A 3T5XA 3P2BA 3CVWA 5FIOA 2Y1LE 2EIME 2B0OE 4F6RD 2PQRA 3Q7FA 5FQ4A 2X3MA 3CQGB 1DCQA 1MYOA 3EU9A 3LVRE 2VGEA 4W9RA 4GZ5A 1MX6A 5CMYA 1SZAA 4BSXA 3TGOA 1L5JA 3ZYLA 3ZHEB 3AG3E 3ULYA 2YHEA 5E75A 4ILIA 3IKOB 3ZYQA 4GA1A 2IOSA 2XENA 3Q15A 3C5RA 3CQCB 1ZU2A 3B7UX 2CFZA 3NBNB 3ZYKA 4L2YA 5AJLA 2A5EA 3LPZA 3RJVA 3HXCA 3SY2A 1BI8B 3QJZA 2KXPC 2YNQA 4HQDA 3P1UA 3V2OA 4M7CA 3HHMA 3DEPA 4YNDA 1FVFA 3RO2A 2ETBA 3ZXSA 4L7TA 2XZTG 3TG5A 4FU3A 5FZRA 2VTBB 3FUJA 1AP7A 3B7BA 5E76A 2CHZA 4I1MA 1Z5SC 1Y8MA 1QNFA 4C0EA 2VGXA 3G2SA 4N5CA 4DRXE 4L9PA 5BW8C 1BPOA 3N71A 4YDYA 3ZNGA 3D9PA 2WQHA 4GYWA 3KAEA 1MZCA 3OXGA 2LAHA 1K1BA 5FZSA 1JUQA 2LUHA 2R03A 3CV0A 1TNUA 4PS8A 1WG0A 3Q75A 3CIAA 3CKCA 4I6GA 3FH5A 3ISMC 2OVFA 1XNFA 2V5QC 4F7AA 3ASOE 1N54A 3CLJA 3FTSA 5A6CA 4HOSA 3TWVA 3RRNB 3HVEA 4I43A 3SHFA 3E32A 1KT0A 3EIJA 3E34A 1NA3A 3FEYA 3AS8A 1U3CA 1DCEA 3CHRA 1IKND 4TXRA 3UX4A 3SFYA 2QY7A 1ZB1A 4U0SA 3K9IA 5DBKA 2QYUA 3EJNA 2MHKA 4XIFA 4XE0A 3ASDA 3SNXA 5AIJA 3DEOA 1KT1A 4DX6D 3FTXA 4BTAA 3J5QB 4NURA 2GW1A 4GMJA 3S7BA 5T4YA 3ZGQA 2QYJA 4ACKA 2Y69E 4JHRA 4Z68A 3PS6A 2FO7A 3ONKA 5ARFA 4B8CB 1PY1A 5ENSD 3Q7AA 2PL2A 5G04C 1HZ4A 2L0TB 2P9KG 3UINC 2ZIRA 2F37A 1TN7A 4OAUC 2CHWA 3TXMA 1OWOA 3ZU7B 3UIPC 2DIWA 3S2AA 5EN5D 5JMND 2Y4UA 1U2VG 1H2UA 2BKKB 4NIKA 3R7RA 5FQ6A 4G23A 4ME2A 4GYYA 4C0MA 5EIBE 2OV8A 4AOFA 3TAXA 3ZKJA 3ZXPA 1QBQA 2AWIA 3EHQA 4PDXA 4N3CA 3PZDA 4LSZE 4OYSA 2ZU6B 3RRMB 4HS2A 4OAVB 4NRHB 4M3OA 4HOTA 2J49A 3GZ1A 4O1PA 3PEVB 3TWRA 4GTSA 3MKQB 1QZ2A 2RFAA 5G05C 4B89A 3B7SA 3TL5A 4FC8A 3VLDA 4A1GA 2IO3C 3FU5A 4OVUA 3FY4A 3LY9A 2I1KA 3KS2A 4BEPA 1E96B 2MRIA 3EU5A 4G8LA 2H6GA 3UKRG 1JCQA 5A23A 1Z3YA 2XZDG 2M63A 1IHBA 3E4BA 2BF0X 2NYJA 1YA0A 3FWVA 4MKTA 1TN8A 3ASFA 3AG1E 4G8KA 4EZJA 3FULA 1N11A 2X6FA 3D9NA 1TYQG 3FTYA 2BEDA 3F6QA 3UTMA 3FP3A 3RO3A 3CVYA 3PUJA 3CVLA 5G05J 3FFLA 1IYGA 5LP0A 1UW4B 3MYVA 3S7FA 3ZFWA 3EHNA 4K5BA 4UI9J 1K3ZD 2RD0A 4I1OB 2AVPA 5ENQD 2LXMA 2WXQA 1HFAA 3RAUA 4ABNA 3UKUG 4BX9A 4U7EB 4KMOA 4RQIA 5KCMA 4WWPA 5ENRD 2A4ZA 2EIJE 3SGHA 4L1BA 1LTXA 2FI7A 3DBSA 2WXOA 5AQAA 1HG2A 1OUVA 3DPYA 1KZPA 1BLXB 3EDTB 1HU3A 1X5BA 1D8DA 3PEUB 3CVVA 4I2WA 2LAIA 3VTXA 4FA6A 3TWUA 4Y6WA 4EPZA 1JCRA 3CHOA 3VLEA 2NSZA 3FU3A 3Q47B 1NA0A 4O60A 3C3OA 3FDHA 3ZIMA 4EBAA 3C3RA 2WXFA 3W9FA 3UXGA 2J08A 3GZ2A 2B6CA 4GTQA 3W9GA 2Y4TA 3U66A 1ELRA 4MBGA 4H7YA 2LNIA 3ONLA 4AIFA 1MQSA 3B95A 1E8YA 3QARA 3LVQE 4GTMA 3Q49B 5EYLA 4EECA 1H2VC 1WDYA 4A63B 4BSZB 2KCKA 3MKRA 1HG5A 3AU4A 4X8QA 3C72A 4BFRA 4GAAA 5ITZF 2ETCA 1TJCA 3Q4AB 3UT4A 4EZKA 3ASGA 3RRUA 4DJAA 3KSLA 5H7PA 2P9UG 3RK6A 3D9LA 4K5CA 4B93B 5T3RA 2VSNA 1OCOE 5D66A 2WXKA 4D10C 4Q69A 4Q96A 1TNBA 2FULA 5FT9A 2ZGGA 5CECB 4U96D 5CCMA 1H6KA 3BQOA 4MLPA 4J8FA 3IHVA 5CHEE 1OXJA 1DC2A 4KVMA 1OWLA 3MCXA 4B8AA 2DZOA 4BTBA 4FADA 3MJWA 5AYWD 2J4BA 3GW4A 4XI0A 1OWMA 4GTTA 3Q78A 1A17A 4ZHBA 1O5MA 4KT6B 4G1TA 2RKKA 3LJ3A 4GTVA 4TXQA 2VGXB 4DX7D 2VSXE 3PNLB 2ONDA 5B1AE 2Y3AA 2I6HA 4ANWA 4ZFHA 2BKGA 4ILGA 5BT1A 2IF4A 4A1SA 3CVNA 4JHKA 1XGWA 4TXPA 4HI8A 3QOUA 2WXHA 2ILRA 1P5QA 5LOZA 3CHPA 3ENEA 4UWFA 1N95A 2QC9A 1N4QA 2GROB 3R9MA 2XHEA 4G24A 3HXDA 3KEZA 3FUKA 4LRZA 1E8XA 3PVLA 2CG2A 1FT2A 1E8ZA 3LJNA 5FJYA 4HBDA 2OEVA 1FPPA 4ACLA 4I9EA 4RVBA 2FF4A 3AG2E 3ULQA 3QAQA 4LNBA 4NACA 3TWSA 3D9KA 3L82A 3D9IA 4HB5A 4FULA 3FH7A 3NAWA 4J8EA 5CEDB 1HF8A 3NOCD 3JXIA 5AENA 4LERA 4FP7A 4OVVA 5JA4D 3T8KA 2GRNB 1BU9A 4CEMA 3KD7A 3MV3B 5FQ8A 5IY5E 2YQ8A 4YDEA 5HRYA 2P9SG 3UPVA 4BERA 4IULA 4BETA 3DSUA 2J9QA 5C1DA 5BXOA 1TR4A 2AXZA 4GMRA 3MV2B 4N3AA 4F3VA 2AJAA 2JLBA 3HIZA 5ENPD 3V31A 3U3WA 3CVQA 4N2QA 1SA5A 4WNGA 2P58C 2XEVA 1ELKA 1S63A 4IRUA 3CGHA 4DUIA 1V54E 4CGWA 4LEUA 3OXFA 4HXIA 4BWRA 5LCWC 3ASHA 3J5PA 5KNGA 4GCNA 3DRAA 3HVEB 2XPZA 4J8YA 3PE4A 2X6KA 4TRQA 4G2VA 3E30A 4I9CA 3DSWA 1OWNA 3UM1A 2BUGA 4U8VD 5M72A 1E7UA 3DXKG 4JHJA 2KCVA 3TWWA 4XZ4A 2RFMA 4KYOB 5FZQA 2BTDA 1TNZA 2L6BA 3LXUX 4N39A 3B7TA 2I2OA 3D9JA 3TWXA 5CERB 2DWZA 1N94A 4LUNU 4A3VA 2WQ7A 3GZSA 3ESLA 4HOUA 4O6FA 2P9IG 3CEQA 3ZRHA 2HM8A 3KSQA 1JWGA 4N3BA 2WMNA 2R2LA 5ENOD 3APFA 4C9BB 4WNEA 1UJKA 3OXLA 5CRUA 1UJJA 3FTVA 4BT9A 3UM0A 4ATGA 3UQ3A 2C2LA 2P9PG 4BESA 1V55E 4TUMA 5DIZA 5CEAA 1SQMA 2UWJG 4JW1A 2ZXWE 4JVSA 5ANLA 1S70B 3NQPA 3FUNA 4FJZA 2PNNA 1OCZE 4HI9A 4I6EA 3LS8A 4YVQC 2WXGA 4JZYA 4EZLA 3NOGD 3D3MA 2EINE 1FT1A 3SQVA 3PDNA 5HS0A 3JQ0A 4CDMA 2GRQB 3JCKC 5AQ7A 4LNGA 2X6IA 3E33A 4A55A 4J8SA 3PZ2A 4AXHA 3G2UA 4FLHA 2GRRB 1EPUA 3X2QE 3V2XA 3ZPJA 4XX5A 4WWOA 4WWNA 3ZVVA 2WQ6A 2VYIA 2V4LA 1NI1A 1OCCE 4KZ0A 2XQ0A 5AJDA 2A5UA 3L17A 3DSSA 4GZ3A 2OEWA 1TEZA 3DXMG 1OWPA 4XEIG 4HOQA 1PAQA 3L9TA 3S7JA 4DX1A 4J6IA 1GW6A 3CKBA 1AWCB 2FBNA 3RKVA 4APFA 3CK8A 1HH8A 4O1OA 2R05A 5AAOA 2UY1B 4KVOA 3L16A 2DZNA 3D9HA 5EYPF 3ZUVB 1JCSA 2DVWA 4I17A 1D8EA 4E85A 4FLBA 3FH8A 2XCCA 4UWGA 1MHQA 2Y0BG 2DYRE 4DI3A 3U9WA 4HORA 1S0PA 2WXPA 1MJ0A 4WNFA 2J07A 2C0LA 3LYAA 4GA0A 4L23A 2L9BA 5C2YA 4UUCA 3UUXA 2WXRA 2WXMA 2KZTA 1SA4A 4GU5A 3FTUA 2I9CA 3FU6A 4JD2G 4HRMB 4PS7A 1WY6A 5J08A 2J8SD 1KLXA 2YINA 3T8MA 2HYZA 3LEWA 3IV0A 3AJIA 4IYPA 3ABLE 2P2CP 3FTZA 5BXUA 2IJGX 3AU5A 3LY7A 5D0OD 2R5SA 1DVPA 3PUKA 1E7VA 3NB2A 4RSYA 4J8DA 1JWFA 4U04A 4GTRA 1JPLA 4QFVA 3DSTA 4AM9A 4F1PA 1EYHA 4H7XA 4ATZD 2CHXA 1O1RA 4R7LA 1BI7B 3HG0D 4UWLA 4AVXA 2OVBA 3QC1A 3UM3A 3QB2A 3I4RB 5BNWA 4UQYA 4HLEA 3ZHEA 5AQBA 2WPVA 2I1JA 4AV7A 4JEHA 2DBAA 4HNAD 4P29A 2LSVA 2VSOE 3HRAA 3B7RL 1WM5A 2XS1A 3IXEA 5ENNA 4ILHB 2PQNA 2WB2A 4CCAA 4G11A 1H6PA 3CK9A 1Z6TA 1H6OA 2PM7A 1INZA 3R7QA 2X6JA 2R59A 3LCAA 5JJ6A 3R9AB 4JB8P 4UQZA 2FEZA 1H0AA 3PE3A 4BT8A 4AJWA 4PS3A 5HI7A 2V8SE 2X6HA 4DX5D 4BY6A 3OTNA 4UI9C 2MOWA 1FVHA 1O1SA 3LDZA 3T9KA 2VTBA 4GYOA 4U63A 1Q2ZA
chains in the Genus database with same CATH topology
2RG8A 3SZ7A 2YHCA 3HDXA 5BUZA 3T5VA 4HOTA 2L6JA 2VQ2A 2J49A 3GZ1A 3HVEB 2XPZA 3PEVB 3ZYMA 3QWWA 3MKQB 1QZ2A 3IBEA 2QFCA 4AP2A 3CHQA 3PE4A 2X6KA 5G05C 4B89A 3SF4A 3B7SA 3TL5A 3JQ1A 4FC8A 2XRZA 1FCHA 2HR2A 2WMOA 3CHSA 4G2VA 4TRQA 3VLDA 4I9CA 4GZCA 1OWNA 2KATA 3ZN3A 4A1GA 2BUGA 3FU5A 4OVUA 3EIQC 4WNDA 1N52A 5M72A 3FY4A 3LY9A 4EQFA 4F53A 1E7UA 2I1KA 3KS2A 4GZDA 4JHJA 2KCVA 5KJLA 4XZ4A 1E96B 4KYOB 5FZQA 2BTDA 3CVUA 1TJFA 3G2TA 2MRIA 3LXUX 5G2NA 2KCLA 4N39A 3B7TA 2WM9A 2I2OA 3D9JA 2L0IA 2AXVA 5EX0A 4LUNU 4A3VA 2WQ7A 3NZSA 3GZSA 3QWPA 2GRMA 3ESLA 4HOUA 4O6FA 5A23A 2WXNA 3D9MA 3CEQA 4U0ZA 5FWQA 5CCLA 4KBQA 1Z3YA 3ZRHA 3VLFA 2CG3A 2HM8A 3I3NA 1JWGA 2IFUA 1HX8A 3HYMB 3MGBA 4KXKB 4N3BA 3MKQA 5KJNA 2M63A 2WMNA 3AS4A 3I4GA 1UG3A 3E4BA 3TG4A 2BF0X 4G26A 4EBAG 1YA0A 3APFA 5G04J 1HS6A 1SZ9A 3IEGA 3L54A 4I2ZA 3FWVA 4MKTA 4C9BB 3SI5A 4WNEA 4JA9A 1UJKA 2R17C 3ASFA 3OXLA 4EZJA 5LCWJ 2VJ8A 3FULA 1UJJA 1Z3XA 3Q5MA 3FTVA 4BT9A 4LCTA 4GCOA 2X6FA 4ATGA 2XGOA 3D9NA 3UQ3A 3FTYA 3CVPA 2C2LA 3FTWA 5EX3A 3LKUA 5ARGA 3FP3A 2JEKA 3CSFA 1B89A 3RO3A 3UT8A 3TXNA 3CVYA 3MEKA 3FUEA 3PUJA 4TUUA 3CVLA 4GB9A 5G05J 2X38A 3FFLA 2PZIA 3CK7A 2GGFA 2VGYA 1Y6IA 4JPSA 5DIZA 5LP0A 1IYGA 1UW4B 3L6AA 2EQXA 2WXIA 3MYVA 3S7FA 3ZFWA 4K0RA 4NQ0A 1SQMA 3EHNA 4DLOA 4UI9J 3C98A 2UWJG 4JW1A 4UI9K 3PH0C 5FQ7A 2RD0A 3QWVA 4I1OB 4JVSA 2AVPA 2Q7FA 5ANLA 4B94A 3I5PA 4CT0A 3FU0A 4CRWA 3NQPA 3FUNA 4FJZA 1U3DA 4JEUA 2CFUA 3O4ZA 4CDRA 2WXQA 1HFAA 2LSUA 4ABNA 3ZW3A 3EHMA 1QQEA 2DCPA 4U8HA 4BX9A 4KMOA 4AY5A 4I6EA 4PH4B 3UT7A 3APCA 3LS8A 5JJTA 5KCMA 3FHEA 4WWPA 4YVQC 3FUIA 2WXGA 5G55A 4Q94A 4WUYA 4JZYA 3QK0A 2A4ZA 3SGHA 4L1BA 3FEXA 2FI7A 2IONA 3DBSA 3T5XA 4EZLA 3P2BA 3FUFA 3D3MA 2WXOA 2PM6A 3CVWA 4GPKA 4CDNA 3QDNA 1EDUA 1HG2A 2AW6A 2XGMA 3IHYA 2GRLA 3QKYA 2PQRA 1OUVA 1UN8A 2C0MA 5FQ4A 4WAFA 5CMWA 3PDNA 3EDTB 5KJMA 3JQ0A 4CDMA 2X3MA 3CQGB 3JCKC 1HU3A 1X5BA 2X6IA 3LVRE 5BV0A 5BPPA 3PEUB 3CSTA 4GZ5A 4I2WA 4W9RA 3CVVA 4I6JA 2IQCA 2LAIA 4A55A 4J8SA 3VTXA 4JXTA 4FA6A 5CMYA 1SZAA 4BSXA 2E0IA 4Y6WA 4AXHA 3G2UA 5LFAA 3TGOA 4EPZA 1L5JA 4FLHA 4GA2A 2XGSA 3ZYLA 3ZHEB 2YHEA 3CHOA 1EPUA 3VLEA 1WAO1 2NSZA 3FU3A 5E75A 4ILIA 3IKOB 3ZPJA 4XX5A 3Q47B 4WWOA 3ZYQA 3MZLB 4GA1A 4WWNA 3ZVVA 2KC7A 2IOSA 4V3IA 2WQ6A 3RU0A 1NA0A 2VYIA 2XRYA 2LO6A 2V4LA 3Q15A 3WXXA 4K03A 4KZ0A 2XQ0A 3U64A 3CQCB 3FDHA 4PUCA 3ZIMA 4EBAA 1ZU2A 5AJDA 2WXFA 3B7UX 2J08A 2CFZA 4UWHA 3GZ2A 3ZYKA 2A5UA 4L2YA 3L17A 5AJLA 4DLQA 2J09A 5HQ8A 4GZ3A 3TJPA 4DI4A 3LPZA 3RJVA 1HE8A 1ZBPA 2Y4TA 3QJZA 5EKQD 3U66A 1OWPA 1ELRA 1TEZA 2YNQA 4HOQA 1PAQA 1IHGA 3P1UA 4H7YA 2LNIA 3ONLA 3S7JA 2WXJA 4AIFA 4E6HA 1MQSA 1IQUA 3BG1B 3S7DA 2IU1A 1PC2A 2OOEA 3HHMA 1E8YA 4J6IA 3QARA 3LVQE 4YNDA 1FVFA 3Q49B 1GW6A 3RO2A 3CKBA 4EECA 1H2VC 2FBNA 3ZXSA 3RKVA 4F1SA 4URKA 4APFA 3CK8A 2KCKA 3MKRA 5T8IA 1HG5A 1HH8A 3AU4A 4L7TA 4BFRA 2UY1A 4YVOA 4GAAA 3TG5A 4FU3A 1TJCA 3Q4AB 5FZRA 2VTBB 3FUJA 4G25A 2UY1B 4KVOA 4CT4A 3L16A 5E76A 3UT4A 1H2TC 4EZKA 3ML8A 3APDA 2CHZA 3ASGA 3O48A 4I1MA 4I17A 1Y8MA 3RRUA 1QNFA 4C0EA 2VGXA 3G2SA 3D9OA 2VSYA 4DJAA 4N5CA 4MS6A 4APOA 4E85A 3G2WA 3RK6A 3D9LA 4FLBA 5T3RA 2VSNA 4U0UA 5BW8C 3BG0B 3SFZA 1HO8A 1H19A 3FH8A 2WXKA 1BPOA 3N71A 4D10C 4Q69A 4Q96A 4XKBA 1E90A 2XPYA 3D9PA 2WQHA 4JL0A 2FULA 2XCCA 5FT9A 3SBTB 4GYWA 3KAEA 3OXGA 4UWGA 2LAHA 1MHQA 3VTYA 5CCMA 1H6KA 4MLPA 2E2EA 4J8FA 3IHVA 5FZSA 1JUQA 4FJYA 5CHEE 3U4TA 1VDYA 3BEEA 3CV0A 4KVMA 1OWLA 3MCXA 4PS8A 4DI3A 4B8AA 4BTBA 4FADA 3U9WA 3ZEFA 3CIAA 3CKCA 3MJWA 5AYWD 2J4BA 4I6GA 3FH5A 4HORA 1S0PA 2WXPA 4RG9A 4DPRA 2OVFA 3FUMA 3GW4A 1XNFA 3ESKA 4XI0A 1ELWA 4U07A 1EF1C 4DK5A 1OWMA 1NP7A 4F7AA 4WNFA 1N54A 3CLJA 3FTSA 3FUDA 4CGVA 5A6CA 4HOSA 3CHMA 1A17A 3JUIA 2J07A 3B13A 3NZUA 3RRNB 2C0LA 3LYAA 4GA0A 1E8WA 3HVEA 4L23A 4I43A 3SHFA 2L9BA 4KT6B 5C2YA 4G1TA 1KT0A 3LJ3A 3UUXA 2IOLA 3EIJA 2WXRA 3G2VA 1NA3A 3FEYA 2WXMA 2VGXB 3L22A 3AS8A 1U3CA 3SD5A 3JYSA 2VSXE 3PNLB 5ANRA 2KZTA 2ONDA 5FTPA 2Y3AA 2I6HA 4GU5A 4ANWA 3CHRA 3FTUA 4ILGA 3PRZA 5BT1A 3CVXA 2I9CA 2IF4A 3FU6A 3QNKA 4A1SA 3CVNA 2NXPA 4JHKA 4PS7A 1XGWA 1WY6A 3UX4A 5J08A 5A7DB 1KLXA 4JC8A 3LY8A 2QY7A 2YINA 4U0SA 3T8MA 5JHBA 3K9IA 2HYZA 5DBKA 3FUHA 3QOUA 2WXHA 3EJNA 4JA7A 3LEWA 2ILRA 3IV0A 5KJKA 2MHKA 4XIFA 1P5QA 4IYPA 4L2LA 4XE0A 3ASDA 5EDSA 3SNXA 3FTZA 5LOZA 2XCBA 5AIJA 3CHPA 2IJGX 3AU5A 3LY7A 4HVBA 3ENEA 4UWFA 1KT1A 4UQXA 3CR3A 5D0OD 2XHEA 4G24A 3FTXA 2R5SA 1DVPA 2AXUA 3PUKA 4BTAA 1E7VA 3KEZA 3MA5A 4FHKA 1W3BA 3FUKA 4LRZA 4RSYA 4J8DA 4NURA 1E8XA 1JWFA 2GW1A 2CG2A 3PVLA 4GMJA 4U04A 5D0QD 3S7BA 5T4YA 1JPLA 1HXIA 3ZGQA 4A3TA 4QFVA 4AM9A 1E8ZA 4ACKA 5FJYA 1EYHA 4H7XA 4JHRA 2CHXA 3PS6A 4ACLA 4I9EA 2FO7A 4R7LA 2FF4A 4RVBA 3ONKA 5ARFA 3URZA 4B8CB 4FHJA 4UWLA 4B0ZA 1PY1A 2WXLA 1IQRA 3ULQA 3L13A 4AEZC 4AVXA 3QAQA 2PL2A 5G04C 2OVBA 5LX8A 2KZTB 4NACA 3QC1A 3QB2A 1HZ4A 3D9KA 1UN9A 2L0TB 5J90A 3D9IA 3I4RB 5BNWA 4UQYA 4HLEA 3ZHEA 2J4DA 4FULA 3FH7A 4N2SA 2WPVA 4J8EA 1DNPA 2I1JA 2WVIA 4JEHA 4AV7A 2DBAA 2CHWA 1HF8A 3TXMA 3PREA 1OWOA 4GMLA 4P29A 2HO1A 5AENA 2LSVA 4IN3B 2VSOE 4LERA 2DIWA 3S2AA 4FP7A 3B7RL 4OVVA 3UMVA 2XPIA 2NC9A 1WM5A 4TV3A 5BV1A 3MX3A 5ENNA 4ILHB 2Y4UA 4ANUA 4CEMA 4XKCA 3KD7A 4HFGA 1H2UA 4KZCA 2PQNA 3MV3B 5FQ8A 2WB2A 4RG6A 2YQ8A 4CCAA 4G11A 3R7RA 3UPVA 5FQ6A 3PNTB 4G23A 5JHAA 4IULA 3CK9A 1LF8A 4ME2A 1Z6TA 4GYYA 2J9QA 5C1DA 2PM7A 4C0MA 1INZA 2AXZA 3R7QA 3RIBA 4AY6A 2OV8A 2X6JA 3MV2B 4AOFA 2R59A 3LCAA 3ML9A 3NF1A 4UWKA 5JJ6A 3R9AB 2V0PA 3TAXA 4N3AA 4F3VA 4ANXA 3DPDA 4J0UA 2AWIA 2FEZA 4UQZA 4BX8A 1H0AA 2JLBA 3GYZA 3AS5A 4Y6CA 3HIZA 3PE3A 3U3WA 4N2QA 3CVQA 3L08A 4BT8A 4WNGA 4MRUA 2P58C 4PDXA 3SBSA 4N3CA 4PS3A 2KM4A 2V8SE 5HI7A 4AJWA 2X6HA 4I1AA 2XEVA 1ELKA 4IRUA 4BY6A 3OTNA 3CGHA 4GZ6A 3PZDA 4UI9C 4ANVA 4CGWA 2MOWA 4LEUA 4OYSA 2ZU6B 3RRMB 1FVHA 4HS2A 5JJ7A 3LDZA 3OXFA 4HXIA 4BWRA 4NRHB 2VTBA 5LCWC 3OAWA 2V5FA 4GYOA 3ASHA 1NZNA 4M3OA 4U63A 4XI9A 4GCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PH0 C;  4E85 A;  4KVO A;  4EBA A;  4KVM A;  4E6H A; 
#chains in the Genus database with same CATH topology
 2YHC A;  3T5V A;  2L6J A;  3SFX A;  3ZYM A;  1RW2 A;  3QWW A;  4U95 D;  2QFC A;  2OCC E;  3JQ1 A;  3TWQ A;  2F0Y A;  4LG6 A;  3BUA A;  4WND A;  4N5Q A;  1N52 A;  4F53 A;  5KJL A;  4LNU D;  1TJF A;  3G2T A;  2KCL A;  2WM9 A;  2L0I A;  5EX0 A;  3NZS A;  3QWP A;  2GRM A;  3ASN E;  2WXN A;  3D9M A;  4U0Z A;  4KBQ A;  3VLF A;  2CG3 A;  2IFU A;  1HX8 A;  2F8X K;  4KXK B;  3MKQ A;  5KJN A;  1UG3 A;  2FO1 E;  1N0Q A;  4EBA G;  5G04 J;  3V79 K;  3L54 A;  4I2Z A;  4JA9 A;  2R17 C;  3Q5M A;  4LCT A;  2H6F A;  4GCO A;  2XGO A;  2IEJ A;  2QZA A;  3CVP A;  5EX3 A;  2JEK A;  1B89 A;  3UT8 A;  3TXN A;  3MEK A;  5AQ9 A;  2VGY A;  1Y6I A;  2EQX A;  2WXI A;  2EIL E;  4NQ0 A;  1YCS B;  3C98 A;  3BU8 A;  5FQ7 A;  1YYH A;  3QWV A;  3FU0 A;  4CRW A;  4CYM D;  3KEA A;  4JEU A;  2CFU A;  4CDR A;  3PZ1 A;  3EHM A;  2DCP A;  1KPS B;  4U8H A;  4PH4 B;  2MYO A;  3APC A;  3UT7 A;  3ULE G;  1YMP A;  3FHE A;  3FUI A;  4GPM A;  3RSE G;  5G55 A;  4Q94 A;  4WUY A;  3QK0 A;  1NFI E;  2ION A;  4GPK A;  3FUF A;  2PM6 A;  4CDN A;  3QDN A;  1EDU A;  4J7W A;  2AW6 A;  2XGM A;  1TN6 A;  2GRL A;  3IHY A;  3QKY A;  1UN8 A;  1S64 A;  2C0M A;  4WAF A;  5CMW A;  5B1B E;  5KJM A;  1N9A A;  1UOH A;  5BV0 A;  5BPP A;  3CST A;  4I6J A;  2IQC A;  4JXT A;  2E0I A;  5LFA A;  4GA2 A;  2XGS A;  1OY3 D;  1WAO 1;  3MZL B;  3Q73 A;  2KC7 A;  4V3I A;  3RU0 A;  2XRY A;  5B3S E;  2LO6 A;  3WXX A;  4K03 A;  3U64 A;  1G3N B;  4PUC A;  4K5A B;  4UWH A;  3Q9N C;  4DLQ A;  4C48 B;  2J09 A;  2V4H C;  5HQ8 A;  3TJP A;  3C3Q A;  4DI4 A;  1HE8 A;  3EUV A;  3DWL G;  1ZBP A;  2ETA A;  5EKQ D;  1IHG A;  4U8Y D;  3AG4 E;  2WXJ A;  4E6H A;  1IQU A;  3BG1 B;  3S7D A;  2IU1 A;  1PC2 A;  2OOE A;  2ZGD A;  5KBA A;  4F1S A;  4URK A;  5T8I A;  2UY1 A;  4YVO A;  2P9N G;  4G25 A;  4CT4 A;  2H6I A;  1H2T C;  3ML8 A;  3APD A;  3O48 A;  2H6H A;  3D9O A;  2VSY A;  2XS8 A;  4YDW A;  4MS6 A;  4APO A;  3G2W A;  5FIN A;  4U0U A;  3BG0 B;  3SFZ A;  1HO8 A;  1H19 A;  4HLL A;  4XKB A;  1E90 A;  2XPY A;  1OCR E;  4JL0 A;  3SBT B;  5EIL A;  4CZ2 D;  3VTY A;  3PZ3 A;  2E2E A;  3U4T A;  4FJY A;  1K1A A;  1VDY A;  3BEE A;  5CBO A;  2KBX A;  3ZEF A;  4RG9 A;  4DPR A;  4YDO A;  3FUM A;  1SW6 A;  2HE0 A;  3ESK A;  1ELW A;  4U07 A;  1EF1 C;  4DK5 A;  1NP7 A;  1N4R A;  5HKP A;  3Q79 A;  3FUD A;  4CGV A;  5KNH D;  3CHM A;  3JUI A;  3B13 A;  1N4P A;  3NZU A;  1E8W A;  3ABK E;  2IOL A;  3G2V A;  3L22 A;  3SD5 A;  3JYS A;  5ANR A;  5FTP A;  1LD7 A;  1K8K G;  3PRZ A;  3CVX A;  2JAB A;  3QNK A;  2NXP A;  5A7D B;  4JC8 A;  3LY8 A;  2EIK E;  1NL4 A;  2F8Y A;  5JHB A;  1KZO A;  3FUH A;  4JA7 A;  5KJK A;  5ENT D;  5CBN A;  4L2L A;  5EDS A;  3PZ4 A;  2XCB A;  5D2M C;  3HXB A;  4HVB A;  4UQX A;  3CR3 A;  2AXU A;  3MA5 A;  4FHK A;  1W3B A;  5D0Q D;  3WG7 E;  1HXI A;  4A3T A;  5CRV A;  1X81 A;  1SVX A;  3UI2 A;  3URZ A;  4FHJ A;  1BD8 A;  4B0Z A;  2WXL A;  4AEZ C;  1IQR A;  3HXF A;  3L13 A;  5AAR A;  1IXV A;  5LX8 A;  2KZT B;  1UN9 A;  5J90 A;  2XEH A;  2J4D A;  4N2S A;  1DNP A;  2WVI A;  3DSV A;  3PRE A;  3AAA C;  4GML A;  2HO1 A;  4IN3 B;  1QYM A;  1TNO A;  3E37 A;  3UMV A;  2XPI A;  1A5E A;  2NC9 A;  4TV3 A;  5BV1 A;  3MX3 A;  4ANU A;  4XKC A;  1N4S A;  4HFG A;  4KZC A;  4RG6 A;  3PNT B;  5JHA A;  1LF8 A;  3DSX A;  3RIB A;  4AY6 A;  3NF1 A;  3ML9 A;  4UWK A;  2V0P A;  4ANX A;  3DPD A;  4J0U A;  2ZIS A;  4BX8 A;  3GYZ A;  3AS5 A;  4Y6C A;  3L08 A;  4MRU A;  3SBS A;  2LXL A;  2KM4 A;  2P9L G;  4I1A A;  4GZ6 A;  1N0R A;  3ABM E;  4ANV A;  3Q9U C;  5JJ7 A;  4RLY A;  3OAW A;  2V5F A;  1NZN A;  4XI9 A;  2RG8 A;  3SZ7 A;  3HDX A;  5BUZ A;  2VQ2 A;  5EID A;  3UM2 A;  3IBE A;  2IO2 C;  3CHQ A;  4AP2 A;  3SF4 A;  2XRZ A;  1FCH A;  2HR2 A;  2WMO A;  3CHS A;  3JUE A;  4GZC A;  2KAT A;  3ZN3 A;  3HXE A;  2DYS E;  3EIQ C;  4EQF A;  4GZD A;  3CVU A;  2IY0 C;  5G2N A;  2AXV A;  3UIO C;  3JXJ A;  1OT8 A;  5FWQ A;  5CCL A;  5AN8 A;  1TNY A;  3I3N A;  4EHM A;  1LD8 A;  3HYM B;  3MGB A;  4QQI A;  3AS4 A;  3I4G A;  3TG4 A;  4G26 A;  4GTO A;  1HS6 A;  1SZ9 A;  3IEG A;  3SI5 A;  3EHR A;  1D9S A;  5LCW J;  2VJ8 A;  1Z3X A;  4GTP A;  5KWD A;  1RZ4 A;  3FTW A;  1O1T A;  3LKU A;  5ARG A;  3CSF A;  1MX4 A;  3FUE A;  4TUU A;  4GB9 A;  2X38 A;  2PZI A;  3CK7 A;  2GGF A;  4JPS A;  3L6A A;  4K0R A;  4DLO A;  4UI9 K;  3PH0 C;  2XEE A;  2Q7F A;  4B94 A;  4HRN A;  4CT0 A;  3I5P A;  1U3D A;  3O4Z A;  4HRL A;  2LSU A;  2R02 A;  3ZW3 A;  1QQE A;  4AY5 A;  3TWT A;  5JJT A;  2GRP B;  3V30 A;  3SO8 A;  3FEX A;  4DX2 A;  1MX2 A;  3T5X A;  3P2B A;  3CVW A;  5FIO A;  2Y1L E;  2EIM E;  2B0O E;  4F6R D;  2PQR A;  3Q7F A;  5FQ4 A;  2X3M A;  3CQG B;  1DCQ A;  1MYO A;  3EU9 A;  3LVR E;  2VGE A;  4W9R A;  4GZ5 A;  1MX6 A;  5CMY A;  1SZA A;  4BSX A;  3TGO A;  1L5J A;  3ZYL A;  3ZHE B;  3AG3 E;  3ULY A;  2YHE A;  5E75 A;  4ILI A;  3IKO B;  3ZYQ A;  4GA1 A;  2IOS A;  2XEN A;  3Q15 A;  3C5R A;  3CQC B;  1ZU2 A;  3B7U X;  2CFZ A;  3NBN B;  3ZYK A;  4L2Y A;  5AJL A;  2A5E A;  3LPZ A;  3RJV A;  3HXC A;  3SY2 A;  1BI8 B;  3QJZ A;  2KXP C;  2YNQ A;  4HQD A;  3P1U A;  3V2O A;  4M7C A;  3HHM A;  3DEP A;  4YND A;  1FVF A;  3RO2 A;  2ETB A;  3ZXS A;  4L7T A;  2XZT G;  3TG5 A;  4FU3 A;  5FZR A;  2VTB B;  3FUJ A;  1AP7 A;  3B7B A;  5E76 A;  2CHZ A;  4I1M A;  1Z5S C;  1Y8M A;  1QNF A;  4C0E A;  2VGX A;  3G2S A;  4N5C A;  4DRX E;  4L9P A;  5BW8 C;  1BPO A;  3N71 A;  4YDY A;  3ZNG A;  3D9P A;  2WQH A;  4GYW A;  3KAE A;  1MZC A;  3OXG A;  2LAH A;  1K1B A;  5FZS A;  1JUQ A;  2LUH A;  2R03 A;  3CV0 A;  1TNU A;  4PS8 A;  1WG0 A;  3Q75 A;  3CIA A;  3CKC A;  4I6G A;  3FH5 A;  3ISM C;  2OVF A;  1XNF A;  2V5Q C;  4F7A A;  3ASO E;  1N54 A;  3CLJ A;  3FTS A;  5A6C A;  4HOS A;  3TWV A;  3RRN B;  3HVE A;  4I43 A;  3SHF A;  3E32 A;  1KT0 A;  3EIJ A;  3E34 A;  1NA3 A;  3FEY A;  3AS8 A;  1U3C A;  1DCE A;  3CHR A;  1IKN D;  4TXR A;  3UX4 A;  3SFY A;  2QY7 A;  1ZB1 A;  4U0S A;  3K9I A;  5DBK A;  2QYU A;  3EJN A;  2MHK A;  4XIF A;  4XE0 A;  3ASD A;  3SNX A;  5AIJ A;  3DEO A;  1KT1 A;  4DX6 D;  3FTX A;  4BTA A;  3J5Q B;  4NUR A;  2GW1 A;  4GMJ A;  3S7B A;  5T4Y A;  3ZGQ A;  2QYJ A;  4ACK A;  2Y69 E;  4JHR A;  4Z68 A;  3PS6 A;  2FO7 A;  3ONK A;  5ARF A;  4B8C B;  1PY1 A;  5ENS D;  3Q7A A;  2PL2 A;  5G04 C;  1HZ4 A;  2L0T B;  2P9K G;  3UIN C;  2ZIR A;  2F37 A;  1TN7 A;  4OAU C;  2CHW A;  3TXM A;  1OWO A;  3ZU7 B;  3UIP C;  2DIW A;  3S2A A;  5EN5 D;  5JMN D;  2Y4U A;  1U2V G;  1H2U A;  2BKK B;  4NIK A;  3R7R A;  5FQ6 A;  4G23 A;  4ME2 A;  4GYY A;  4C0M A;  5EIB E;  2OV8 A;  4AOF A;  3TAX A;  3ZKJ A;  3ZXP A;  1QBQ A;  2AWI A;  3EHQ A;  4PDX A;  4N3C A;  3PZD A;  4LSZ E;  4OYS A;  2ZU6 B;  3RRM B;  4HS2 A;  4OAV B;  4NRH B;  4M3O A;  4HOT A;  2J49 A;  3GZ1 A;  4O1P A;  3PEV B;  3TWR A;  4GTS A;  3MKQ B;  1QZ2 A;  2RFA A;  5G05 C;  4B89 A;  3B7S A;  3TL5 A;  4FC8 A;  3VLD A;  4A1G A;  2IO3 C;  3FU5 A;  4OVU A;  3FY4 A;  3LY9 A;  2I1K A;  3KS2 A;  4BEP A;  1E96 B;  2MRI A;  3EU5 A;  4G8L A;  2H6G A;  3UKR G;  1JCQ A;  5A23 A;  1Z3Y A;  2XZD G;  2M63 A;  1IHB A;  3E4B A;  2BF0 X;  2NYJ A;  1YA0 A;  3FWV A;  4MKT A;  1TN8 A;  3ASF A;  3AG1 E;  4G8K A;  4EZJ A;  3FUL A;  1N11 A;  2X6F A;  3D9N A;  1TYQ G;  3FTY A;  2BED A;  3F6Q A;  3UTM A;  3FP3 A;  3RO3 A;  3CVY A;  3PUJ A;  3CVL A;  5G05 J;  3FFL A;  1IYG A;  5LP0 A;  1UW4 B;  3MYV A;  3S7F A;  3ZFW A;  3EHN A;  4K5B A;  4UI9 J;  1K3Z D;  2RD0 A;  4I1O B;  2AVP A;  5ENQ D;  2LXM A;  2WXQ A;  1HFA A;  3RAU A;  4ABN A;  3UKU G;  4BX9 A;  4U7E B;  4KMO A;  4RQI A;  5KCM A;  4WWP A;  5ENR D;  2A4Z A;  2EIJ E;  3SGH A;  4L1B A;  1LTX A;  2FI7 A;  3DBS A;  2WXO A;  5AQA A;  1HG2 A;  1OUV A;  3DPY A;  1KZP A;  1BLX B;  3EDT B;  1HU3 A;  1X5B A;  1D8D A;  3PEU B;  3CVV A;  4I2W A;  2LAI A;  3VTX A;  4FA6 A;  3TWU A;  4Y6W A;  4EPZ A;  1JCR A;  3CHO A;  3VLE A;  2NSZ A;  3FU3 A;  3Q47 B;  1NA0 A;  4O60 A;  3C3O A;  3FDH A;  3ZIM A;  4EBA A;  3C3R A;  2WXF A;  3W9F A;  3UXG A;  2J08 A;  3GZ2 A;  2B6C A;  4GTQ A;  3W9G A;  2Y4T A;  3U66 A;  1ELR A;  4MBG A;  4H7Y A;  2LNI A;  3ONL A;  4AIF A;  1MQS A;  3B95 A;  1E8Y A;  3QAR A;  3LVQ E;  4GTM A;  3Q49 B;  5EYL A;  4EEC A;  1H2V C;  1WDY A;  4A63 B;  4BSZ B;  2KCK A;  3MKR A;  1HG5 A;  3AU4 A;  4X8Q A;  3C72 A;  4BFR A;  4GAA A;  5ITZ F;  2ETC A;  1TJC A;  3Q4A B;  3UT4 A;  4EZK A;  3ASG A;  3RRU A;  4DJA A;  3KSL A;  5H7P A;  2P9U G;  3RK6 A;  3D9L A;  4K5C A;  4B93 B;  5T3R A;  2VSN A;  1OCO E;  5D66 A;  2WXK A;  4D10 C;  4Q69 A;  4Q96 A;  1TNB A;  2FUL A;  5FT9 A;  2ZGG A;  5CEC B;  4U96 D;  5CCM A;  1H6K A;  3BQO A;  4MLP A;  4J8F A;  3IHV A;  5CHE E;  1OXJ A;  1DC2 A;  4KVM A;  1OWL A;  3MCX A;  4B8A A;  2DZO A;  4BTB A;  4FAD A;  3MJW A;  5AYW D;  2J4B A;  3GW4 A;  4XI0 A;  1OWM A;  4GTT A;  3Q78 A;  1A17 A;  4ZHB A;  1O5M A;  4KT6 B;  4G1T A;  2RKK A;  3LJ3 A;  4GTV A;  4TXQ A;  2VGX B;  4DX7 D;  2VSX E;  3PNL B;  2OND A;  5B1A E;  2Y3A A;  2I6H A;  4ANW A;  4ZFH A;  2BKG A;  4ILG A;  5BT1 A;  2IF4 A;  4A1S A;  3CVN A;  4JHK A;  1XGW A;  4TXP A;  4HI8 A;  3QOU A;  2WXH A;  2ILR A;  1P5Q A;  5LOZ A;  3CHP A;  3ENE A;  4UWF A;  1N95 A;  2QC9 A;  1N4Q A;  2GRO B;  3R9M A;  2XHE A;  4G24 A;  3HXD A;  3KEZ A;  3FUK A;  4LRZ A;  1E8X A;  3PVL A;  2CG2 A;  1FT2 A;  1E8Z A;  3LJN A;  5FJY A;  4HBD A;  2OEV A;  1FPP A;  4ACL A;  4I9E A;  4RVB A;  2FF4 A;  3AG2 E;  3ULQ A;  3QAQ A;  4LNB A;  4NAC A;  3TWS A;  3D9K A;  3L82 A;  3D9I A;  4HB5 A;  4FUL A;  3FH7 A;  3NAW A;  4J8E A;  5CED B;  1HF8 A;  3NOC D;  3JXI A;  5AEN A;  4LER A;  4FP7 A;  4OVV A;  5JA4 D;  3T8K A;  2GRN B;  1BU9 A;  4CEM A;  3KD7 A;  3MV3 B;  5FQ8 A;  5IY5 E;  2YQ8 A;  4YDE A;  5HRY A;  2P9S G;  3UPV A;  4BER A;  4IUL A;  4BET A;  3DSU A;  2J9Q A;  5C1D A;  5BXO A;  1TR4 A;  2AXZ A;  4GMR A;  3MV2 B;  4N3A A;  4F3V A;  2AJA A;  2JLB A;  3HIZ A;  5ENP D;  3V31 A;  3U3W A;  3CVQ A;  4N2Q A;  1SA5 A;  4WNG A;  2P58 C;  2XEV A;  1ELK A;  1S63 A;  4IRU A;  3CGH A;  4DUI A;  1V54 E;  4CGW A;  4LEU A;  3OXF A;  4HXI A;  4BWR A;  5LCW C;  3ASH A;  3J5P A;  5KNG A;  4GCN A;  3DRA A;  3HVE B;  2XPZ A;  4J8Y A;  3PE4 A;  2X6K A;  4TRQ A;  4G2V A;  3E30 A;  4I9C A;  3DSW A;  1OWN A;  3UM1 A;  2BUG A;  4U8V D;  5M72 A;  1E7U A;  3DXK G;  4JHJ A;  2KCV A;  3TWW A;  4XZ4 A;  2RFM A;  4KYO B;  5FZQ A;  2BTD A;  1TNZ A;  2L6B A;  3LXU X;  4N39 A;  3B7T A;  2I2O A;  3D9J A;  3TWX A;  5CER B;  2DWZ A;  1N94 A;  4LUN U;  4A3V A;  2WQ7 A;  3GZS A;  3ESL A;  4HOU A;  4O6F A;  2P9I G;  3CEQ A;  3ZRH A;  2HM8 A;  3KSQ A;  1JWG A;  4N3B A;  2WMN A;  2R2L A;  5ENO D;  3APF A;  4C9B B;  4WNE A;  1UJK A;  3OXL A;  5CRU A;  1UJJ A;  3FTV A;  4BT9 A;  3UM0 A;  4ATG A;  3UQ3 A;  2C2L A;  2P9P G;  4BES A;  1V55 E;  4TUM A;  5DIZ A;  5CEA A;  1SQM A;  2UWJ G;  4JW1 A;  2ZXW E;  4JVS A;  5ANL A;  1S70 B;  3NQP A;  3FUN A;  4FJZ A;  2PNN A;  1OCZ E;  4HI9 A;  4I6E A;  3LS8 A;  4YVQ C;  2WXG A;  4JZY A;  4EZL A;  3NOG D;  3D3M A;  2EIN E;  1FT1 A;  3SQV A;  3PDN A;  5HS0 A;  3JQ0 A;  4CDM A;  2GRQ B;  3JCK C;  5AQ7 A;  4LNG A;  2X6I A;  3E33 A;  4A55 A;  4J8S A;  3PZ2 A;  4AXH A;  3G2U A;  4FLH A;  2GRR B;  1EPU A;  3X2Q E;  3V2X A;  3ZPJ A;  4XX5 A;  4WWO A;  4WWN A;  3ZVV A;  2WQ6 A;  2VYI A;  2V4L A;  1NI1 A;  1OCC E;  4KZ0 A;  2XQ0 A;  5AJD A;  2A5U A;  3L17 A;  3DSS A;  4GZ3 A;  2OEW A;  1TEZ A;  3DXM G;  1OWP A;  4XEI G;  4HOQ A;  1PAQ A;  3L9T A;  3S7J A;  4DX1 A;  4J6I A;  1GW6 A;  3CKB A;  1AWC B;  2FBN A;  3RKV A;  4APF A;  3CK8 A;  1HH8 A;  4O1O A;  2R05 A;  5AAO A;  2UY1 B;  4KVO A;  3L16 A;  2DZN A;  3D9H A;  5EYP F;  3ZUV B;  1JCS A;  2DVW A;  4I17 A;  1D8E A;  4E85 A;  4FLB A;  3FH8 A;  2XCC A;  4UWG A;  1MHQ A;  2Y0B G;  2DYR E;  4DI3 A;  3U9W A;  4HOR A;  1S0P A;  2WXP A;  1MJ0 A;  4WNF A;  2J07 A;  2C0L A;  3LYA A;  4GA0 A;  4L23 A;  2L9B A;  5C2Y A;  4UUC A;  3UUX A;  2WXR A;  2WXM A;  2KZT A;  1SA4 A;  4GU5 A;  3FTU A;  2I9C A;  3FU6 A;  4JD2 G;  4HRM B;  4PS7 A;  1WY6 A;  5J08 A;  2J8S D;  1KLX A;  2YIN A;  3T8M A;  2HYZ A;  3LEW A;  3IV0 A;  3AJI A;  4IYP A;  3ABL E;  2P2C P;  3FTZ A;  5BXU A;  2IJG X;  3AU5 A;  3LY7 A;  5D0O D;  2R5S A;  1DVP A;  3PUK A;  1E7V A;  3NB2 A;  4RSY A;  4J8D A;  1JWF A;  4U04 A;  4GTR A;  1JPL A;  4QFV A;  3DST A;  4AM9 A;  4F1P A;  1EYH A;  4H7X A;  4ATZ D;  2CHX A;  1O1R A;  4R7L A;  1BI7 B;  3HG0 D;  4UWL A;  4AVX A;  2OVB A;  3QC1 A;  3UM3 A;  3QB2 A;  3I4R B;  5BNW A;  4UQY A;  4HLE A;  3ZHE A;  5AQB A;  2WPV A;  2I1J A;  4AV7 A;  4JEH A;  2DBA A;  4HNA D;  4P29 A;  2LSV A;  2VSO E;  3HRA A;  3B7R L;  1WM5 A;  2XS1 A;  3IXE A;  5ENN A;  4ILH B;  2PQN A;  2WB2 A;  4CCA A;  4G11 A;  1H6P A;  3CK9 A;  1Z6T A;  1H6O A;  2PM7 A;  1INZ A;  3R7Q A;  2X6J A;  2R59 A;  3LCA A;  5JJ6 A;  3R9A B;  4JB8 P;  4UQZ A;  2FEZ A;  1H0A A;  3PE3 A;  4BT8 A;  4AJW A;  4PS3 A;  5HI7 A;  2V8S E;  2X6H A;  4DX5 D;  4BY6 A;  3OTN A;  4UI9 C;  2MOW A;  1FVH A;  1O1S A;  3LDZ A;  3T9K A;  2VTB A;  4GYO A;  4U63 A;  1Q2Z A; 
#chains in the Genus database with same CATH homology
 2RG8 A;  3SZ7 A;  2YHC A;  3HDX A;  5BUZ A;  3T5V A;  4HOT A;  2L6J A;  2VQ2 A;  2J49 A;  3GZ1 A;  3HVE B;  2XPZ A;  3PEV B;  3ZYM A;  3QWW A;  3MKQ B;  1QZ2 A;  3IBE A;  2QFC A;  4AP2 A;  3CHQ A;  3PE4 A;  2X6K A;  5G05 C;  4B89 A;  3SF4 A;  3B7S A;  3TL5 A;  3JQ1 A;  4FC8 A;  2XRZ A;  1FCH A;  2HR2 A;  2WMO A;  3CHS A;  4G2V A;  4TRQ A;  3VLD A;  4I9C A;  4GZC A;  1OWN A;  2KAT A;  3ZN3 A;  4A1G A;  2BUG A;  3FU5 A;  4OVU A;  3EIQ C;  4WND A;  1N52 A;  5M72 A;  3FY4 A;  3LY9 A;  4EQF A;  4F53 A;  1E7U A;  2I1K A;  3KS2 A;  4GZD A;  4JHJ A;  2KCV A;  5KJL A;  4XZ4 A;  1E96 B;  4KYO B;  5FZQ A;  2BTD A;  3CVU A;  1TJF A;  3G2T A;  2MRI A;  3LXU X;  5G2N A;  2KCL A;  4N39 A;  3B7T A;  2WM9 A;  2I2O A;  3D9J A;  2L0I A;  2AXV A;  5EX0 A;  4LUN U;  4A3V A;  2WQ7 A;  3NZS A;  3GZS A;  3QWP A;  2GRM A;  3ESL A;  4HOU A;  4O6F A;  5A23 A;  2WXN A;  3D9M A;  3CEQ A;  4U0Z A;  5FWQ A;  5CCL A;  4KBQ A;  1Z3Y A;  3ZRH A;  3VLF A;  2CG3 A;  2HM8 A;  3I3N A;  1JWG A;  2IFU A;  1HX8 A;  3HYM B;  3MGB A;  4KXK B;  4N3B A;  3MKQ A;  5KJN A;  2M63 A;  2WMN A;  3AS4 A;  3I4G A;  1UG3 A;  3E4B A;  3TG4 A;  2BF0 X;  4G26 A;  4EBA G;  1YA0 A;  3APF A;  5G04 J;  1HS6 A;  1SZ9 A;  3IEG A;  3L54 A;  4I2Z A;  3FWV A;  4MKT A;  4C9B B;  3SI5 A;  4WNE A;  4JA9 A;  1UJK A;  2R17 C;  3ASF A;  3OXL A;  4EZJ A;  5LCW J;  2VJ8 A;  3FUL A;  1UJJ A;  1Z3X A;  3Q5M A;  3FTV A;  4BT9 A;  4LCT A;  4GCO A;  2X6F A;  4ATG A;  2XGO A;  3D9N A;  3UQ3 A;  3FTY A;  3CVP A;  2C2L A;  3FTW A;  5EX3 A;  3LKU A;  5ARG A;  3FP3 A;  2JEK A;  3CSF A;  1B89 A;  3RO3 A;  3UT8 A;  3TXN A;  3CVY A;  3MEK A;  3FUE A;  3PUJ A;  4TUU A;  3CVL A;  4GB9 A;  5G05 J;  2X38 A;  3FFL A;  2PZI A;  3CK7 A;  2GGF A;  2VGY A;  1Y6I A;  4JPS A;  5DIZ A;  5LP0 A;  1IYG A;  1UW4 B;  3L6A A;  2EQX A;  2WXI A;  3MYV A;  3S7F A;  3ZFW A;  4K0R A;  4NQ0 A;  1SQM A;  3EHN A;  4DLO A;  4UI9 J;  3C98 A;  2UWJ G;  4JW1 A;  4UI9 K;  3PH0 C;  5FQ7 A;  2RD0 A;  3QWV A;  4I1O B;  4JVS A;  2AVP A;  2Q7F A;  5ANL A;  4B94 A;  3I5P A;  4CT0 A;  3FU0 A;  4CRW A;  3NQP A;  3FUN A;  4FJZ A;  1U3D A;  4JEU A;  2CFU A;  3O4Z A;  4CDR A;  2WXQ A;  1HFA A;  2LSU A;  4ABN A;  3ZW3 A;  3EHM A;  1QQE A;  2DCP A;  4U8H A;  4BX9 A;  4KMO A;  4AY5 A;  4I6E A;  4PH4 B;  3UT7 A;  3APC A;  3LS8 A;  5JJT A;  5KCM A;  3FHE A;  4WWP A;  4YVQ C;  3FUI A;  2WXG A;  5G55 A;  4Q94 A;  4WUY A;  4JZY A;  3QK0 A;  2A4Z A;  3SGH A;  4L1B A;  3FEX A;  2FI7 A;  2ION A;  3DBS A;  3T5X A;  4EZL A;  3P2B A;  3FUF A;  3D3M A;  2WXO A;  2PM6 A;  3CVW A;  4GPK A;  4CDN A;  3QDN A;  1EDU A;  1HG2 A;  2AW6 A;  2XGM A;  3IHY A;  2GRL A;  3QKY A;  2PQR A;  1OUV A;  1UN8 A;  2C0M A;  5FQ4 A;  4WAF A;  5CMW A;  3PDN A;  3EDT B;  5KJM A;  3JQ0 A;  4CDM A;  2X3M A;  3CQG B;  3JCK C;  1HU3 A;  1X5B A;  2X6I A;  3LVR E;  5BV0 A;  5BPP A;  3PEU B;  3CST A;  4GZ5 A;  4I2W A;  4W9R A;  3CVV A;  4I6J A;  2IQC A;  2LAI A;  4A55 A;  4J8S A;  3VTX A;  4JXT A;  4FA6 A;  5CMY A;  1SZA A;  4BSX A;  2E0I A;  4Y6W A;  4AXH A;  3G2U A;  5LFA A;  3TGO A;  4EPZ A;  1L5J A;  4FLH A;  4GA2 A;  2XGS A;  3ZYL A;  3ZHE B;  2YHE A;  3CHO A;  1EPU A;  3VLE A;  1WAO 1;  2NSZ A;  3FU3 A;  5E75 A;  4ILI A;  3IKO B;  3ZPJ A;  4XX5 A;  3Q47 B;  4WWO A;  3ZYQ A;  3MZL B;  4GA1 A;  4WWN A;  3ZVV A;  2KC7 A;  2IOS A;  4V3I A;  2WQ6 A;  3RU0 A;  1NA0 A;  2VYI A;  2XRY A;  2LO6 A;  2V4L A;  3Q15 A;  3WXX A;  4K03 A;  4KZ0 A;  2XQ0 A;  3U64 A;  3CQC B;  3FDH A;  4PUC A;  3ZIM A;  4EBA A;  1ZU2 A;  5AJD A;  2WXF A;  3B7U X;  2J08 A;  2CFZ A;  4UWH A;  3GZ2 A;  3ZYK A;  2A5U A;  4L2Y A;  3L17 A;  5AJL A;  4DLQ A;  2J09 A;  5HQ8 A;  4GZ3 A;  3TJP A;  4DI4 A;  3LPZ A;  3RJV A;  1HE8 A;  1ZBP A;  2Y4T A;  3QJZ A;  5EKQ D;  3U66 A;  1OWP A;  1ELR A;  1TEZ A;  2YNQ A;  4HOQ A;  1PAQ A;  1IHG A;  3P1U A;  4H7Y A;  2LNI A;  3ONL A;  3S7J A;  2WXJ A;  4AIF A;  4E6H A;  1MQS A;  1IQU A;  3BG1 B;  3S7D A;  2IU1 A;  1PC2 A;  2OOE A;  3HHM A;  1E8Y A;  4J6I A;  3QAR A;  3LVQ E;  4YND A;  1FVF A;  3Q49 B;  1GW6 A;  3RO2 A;  3CKB A;  4EEC A;  1H2V C;  2FBN A;  3ZXS A;  3RKV A;  4F1S A;  4URK A;  4APF A;  3CK8 A;  2KCK A;  3MKR A;  5T8I A;  1HG5 A;  1HH8 A;  3AU4 A;  4L7T A;  4BFR A;  2UY1 A;  4YVO A;  4GAA A;  3TG5 A;  4FU3 A;  1TJC A;  3Q4A B;  5FZR A;  2VTB B;  3FUJ A;  4G25 A;  2UY1 B;  4KVO A;  4CT4 A;  3L16 A;  5E76 A;  3UT4 A;  1H2T C;  4EZK A;  3ML8 A;  3APD A;  2CHZ A;  3ASG A;  3O48 A;  4I1M A;  4I17 A;  1Y8M A;  3RRU A;  1QNF A;  4C0E A;  2VGX A;  3G2S A;  3D9O A;  2VSY A;  4DJA A;  4N5C A;  4MS6 A;  4APO A;  4E85 A;  3G2W A;  3RK6 A;  3D9L A;  4FLB A;  5T3R A;  2VSN A;  4U0U A;  5BW8 C;  3BG0 B;  3SFZ A;  1HO8 A;  1H19 A;  3FH8 A;  2WXK A;  1BPO A;  3N71 A;  4D10 C;  4Q69 A;  4Q96 A;  4XKB A;  1E90 A;  2XPY A;  3D9P A;  2WQH A;  4JL0 A;  2FUL A;  2XCC A;  5FT9 A;  3SBT B;  4GYW A;  3KAE A;  3OXG A;  4UWG A;  2LAH A;  1MHQ A;  3VTY A;  5CCM A;  1H6K A;  4MLP A;  2E2E A;  4J8F A;  3IHV A;  5FZS A;  1JUQ A;  4FJY A;  5CHE E;  3U4T A;  1VDY A;  3BEE A;  3CV0 A;  4KVM A;  1OWL A;  3MCX A;  4PS8 A;  4DI3 A;  4B8A A;  4BTB A;  4FAD A;  3U9W A;  3ZEF A;  3CIA A;  3CKC A;  3MJW A;  5AYW D;  2J4B A;  4I6G A;  3FH5 A;  4HOR A;  1S0P A;  2WXP A;  4RG9 A;  4DPR A;  2OVF A;  3FUM A;  3GW4 A;  1XNF A;  3ESK A;  4XI0 A;  1ELW A;  4U07 A;  1EF1 C;  4DK5 A;  1OWM A;  1NP7 A;  4F7A A;  4WNF A;  1N54 A;  3CLJ A;  3FTS A;  3FUD A;  4CGV A;  5A6C A;  4HOS A;  3CHM A;  1A17 A;  3JUI A;  2J07 A;  3B13 A;  3NZU A;  3RRN B;  2C0L A;  3LYA A;  4GA0 A;  1E8W A;  3HVE A;  4L23 A;  4I43 A;  3SHF A;  2L9B A;  4KT6 B;  5C2Y A;  4G1T A;  1KT0 A;  3LJ3 A;  3UUX A;  2IOL A;  3EIJ A;  2WXR A;  3G2V A;  1NA3 A;  3FEY A;  2WXM A;  2VGX B;  3L22 A;  3AS8 A;  1U3C A;  3SD5 A;  3JYS A;  2VSX E;  3PNL B;  5ANR A;  2KZT A;  2OND A;  5FTP A;  2Y3A A;  2I6H A;  4GU5 A;  4ANW A;  3CHR A;  3FTU A;  4ILG A;  3PRZ A;  5BT1 A;  3CVX A;  2I9C A;  2IF4 A;  3FU6 A;  3QNK A;  4A1S A;  3CVN A;  2NXP A;  4JHK A;  4PS7 A;  1XGW A;  1WY6 A;  3UX4 A;  5J08 A;  5A7D B;  1KLX A;  4JC8 A;  3LY8 A;  2QY7 A;  2YIN A;  4U0S A;  3T8M A;  5JHB A;  3K9I A;  2HYZ A;  5DBK A;  3FUH A;  3QOU A;  2WXH A;  3EJN A;  4JA7 A;  3LEW A;  2ILR A;  3IV0 A;  5KJK A;  2MHK A;  4XIF A;  1P5Q A;  4IYP A;  4L2L A;  4XE0 A;  3ASD A;  5EDS A;  3SNX A;  3FTZ A;  5LOZ A;  2XCB A;  5AIJ A;  3CHP A;  2IJG X;  3AU5 A;  3LY7 A;  4HVB A;  3ENE A;  4UWF A;  1KT1 A;  4UQX A;  3CR3 A;  5D0O D;  2XHE A;  4G24 A;  3FTX A;  2R5S A;  1DVP A;  2AXU A;  3PUK A;  4BTA A;  1E7V A;  3KEZ A;  3MA5 A;  4FHK A;  1W3B A;  3FUK A;  4LRZ A;  4RSY A;  4J8D A;  4NUR A;  1E8X A;  1JWF A;  2GW1 A;  2CG2 A;  3PVL A;  4GMJ A;  4U04 A;  5D0Q D;  3S7B A;  5T4Y A;  1JPL A;  1HXI A;  3ZGQ A;  4A3T A;  4QFV A;  4AM9 A;  1E8Z A;  4ACK A;  5FJY A;  1EYH A;  4H7X A;  4JHR A;  2CHX A;  3PS6 A;  4ACL A;  4I9E A;  2FO7 A;  4R7L A;  2FF4 A;  4RVB A;  3ONK A;  5ARF A;  3URZ A;  4B8C B;  4FHJ A;  4UWL A;  4B0Z A;  1PY1 A;  2WXL A;  1IQR A;  3ULQ A;  3L13 A;  4AEZ C;  4AVX A;  3QAQ A;  2PL2 A;  5G04 C;  2OVB A;  5LX8 A;  2KZT B;  4NAC A;  3QC1 A;  3QB2 A;  1HZ4 A;  3D9K A;  1UN9 A;  2L0T B;  5J90 A;  3D9I A;  3I4R B;  5BNW A;  4UQY A;  4HLE A;  3ZHE A;  2J4D A;  4FUL A;  3FH7 A;  4N2S A;  2WPV A;  4J8E A;  1DNP A;  2I1J A;  2WVI A;  4JEH A;  4AV7 A;  2DBA A;  2CHW A;  1HF8 A;  3TXM A;  3PRE A;  1OWO A;  4GML A;  4P29 A;  2HO1 A;  5AEN A;  2LSV A;  4IN3 B;  2VSO E;  4LER A;  2DIW A;  3S2A A;  4FP7 A;  3B7R L;  4OVV A;  3UMV A;  2XPI A;  2NC9 A;  1WM5 A;  4TV3 A;  5BV1 A;  3MX3 A;  5ENN A;  4ILH B;  2Y4U A;  4ANU A;  4CEM A;  4XKC A;  3KD7 A;  4HFG A;  1H2U A;  4KZC A;  2PQN A;  3MV3 B;  5FQ8 A;  2WB2 A;  4RG6 A;  2YQ8 A;  4CCA A;  4G11 A;  3R7R A;  3UPV A;  5FQ6 A;  3PNT B;  4G23 A;  5JHA A;  4IUL A;  3CK9 A;  1LF8 A;  4ME2 A;  1Z6T A;  4GYY A;  2J9Q A;  5C1D A;  2PM7 A;  4C0M A;  1INZ A;  2AXZ A;  3R7Q A;  3RIB A;  4AY6 A;  2OV8 A;  2X6J A;  3MV2 B;  4AOF A;  2R59 A;  3LCA A;  3ML9 A;  3NF1 A;  4UWK A;  5JJ6 A;  3R9A B;  2V0P A;  3TAX A;  4N3A A;  4F3V A;  4ANX A;  3DPD A;  4J0U A;  2AWI A;  2FEZ A;  4UQZ A;  4BX8 A;  1H0A A;  2JLB A;  3GYZ A;  3AS5 A;  4Y6C A;  3HIZ A;  3PE3 A;  3U3W A;  4N2Q A;  3CVQ A;  3L08 A;  4BT8 A;  4WNG A;  4MRU A;  2P58 C;  4PDX A;  3SBS A;  4N3C A;  4PS3 A;  2KM4 A;  2V8S E;  5HI7 A;  4AJW A;  2X6H A;  4I1A A;  2XEV A;  1ELK A;  4IRU A;  4BY6 A;  3OTN A;  3CGH A;  4GZ6 A;  3PZD A;  4UI9 C;  4ANV A;  4CGW A;  2MOW A;  4LEU A;  4OYS A;  2ZU6 B;  3RRM B;  1FVH A;  4HS2 A;  5JJ7 A;  3LDZ A;  3OXF A;  4HXI A;  4BWR A;  4NRH B;  2VTB A;  5LCW C;  3OAW A;  2V5F A;  4GYO A;  3ASH A;  1NZN A;  4M3O A;  4U63 A;  4XI9 A;  4GCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...