3PH0C

Crystal structure of the heteromolecular chaperone, asce-ascg, from the type iii secretion system in aeromonas hydrophila
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
MNVQLKKQLAELALAGTGHHCHQEAASIADWLAQEECMAECVTLIRLSSLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the heteromolecular chaperone, AscE-AscG, from the type III secretion system in Aeromonas hydrophila
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Chaperone
molecule keywords AscE
total genus 20
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.1040 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ph0C00
4EBAA 4E6HA 4KVOA 4KVMA 4E85A 3PH0C
chains in the Genus database with same CATH superfamily
4M7CA 3ZXPA 2P9LG 1N4RA 3PZ2A 3ZEFA 1TN6A 3AS5A 5CECB 4JB8P 4DX6D 4C0MA 5D0OD 2QYUA 2WXIA 3X2QE 1D8EA 1JUQA 4AY5A 5H7PA 4L9PA 1JPLA 1ELWA 3WXXA 3S7DA 3QWVA 2VGEA 4XI9A 3O48A 1OCOE 4GYYA 2P9UG 5FQ6A 4F7AA 3TWVA 2AXZA 3FWVA 3FEYA 3Q47B 4ILHB 3ZRHA 3HVEA 3IHYA 1QQEA 4BTAA 4LCTA 4Z68A 2JLBA 4J6IA 2XCCA 1UJJA 3GZ2A 3G2WA 4NRHB 3SFYA 2RFMA 4HOSA 4GB9A 1DCQA 5AARA 3JCKC 4XZ4A 2C2LA 3U4TA 5ENQD 3ASHA 3CVVA 2OV8A 3URZA 3EIQC 1Z5SC 4J8DA 4XKCA 2V5QC 5AQ7A 2OEVA 4RSYA 3RJVA 2A5EA 2PQNA 2DYRE 5EN5D 3DPDA 2BUGA 4KT6B 4UWFA 4F1SA 3FU5A 4CDRA 1B89A 4FLHA 3ULQA 3OXLA 3UKUG 3UPVA 2BKKB 3JYSA 1MZCA 1WG0A 2CFZA 4N2QA 4F3VA 4YDWA 4EZLA 3NF1A 4GTTA 1ZB1A 2KZTB 3ZXSA 3ZGQA 3HHMA 4ILGA 3MCXA 4A63B 1N4SA 1IYGA 3MX3A 3RRNB 3TWQA 4GTVA 2RD0A 2X6JA 3CIAA 2P9NG 2WQ6A 5C2YA 3G2TA 5T3RA 1AWCB 2GRPB 4UWLA 4GTMA 4I2ZA 4HI8A 1OUVA 3R7QA 3RO2A 1EPUA 2GRQB 3ASOE 3ZHEB 3UI2A 4HI9A 4ZHBA 4JVSA 1BI8B 4G24A 1E8XA 1SZAA 4G8LA 3R9AB 3ZUVB 2XRYA 4G23A 4F1PA 1TNBA 1JCSA 1TJCA 3LJ3A 4HOUA 3ZIMA 5ENSD 4RG9A 4FHKA 1N52A 2LAHA 2WXLA 3APFA 2WXOA 1WDYA 3UT7A 1E8WA 2QZAA 3ML8A 1S0PA 1W3BA 1HU3A 5KJNA 3DSVA 4J8EA 4U0UA 4WUYA 5FINA 4QQIA 3ZYKA 3U64A 1KZPA 3C5RA 3ABKE 4DX5D 3UQ3A 2IF4A 4NQ0A 3FEXA 4G26A 3T8MA 3FU3A 3TWTA 5LP0A 3UIPC 4HLEA 1OXJA 2LAIA 4BWRA 1NA3A 4AXHA 2KZTA 2DYSE 3QC1A 4FU3A 4A3VA 2C0LA 3HXFA 3DXMG 3AJIA 3S7BA 5B1BE 1H2UA 1RW2A 5ENTD 3RRMB 2F0YA 4CZ2D 4ABNA 3ASDA 1A17A 1HG2A 4U0ZA 4APFA 4K5AB 3CHQA 4B0ZA 3TG4A 4L7TA 4U95D 4CGVA 4U8HA 5KJMA 1O1RA 1DCEA 3NB2A 1QNFA 2GW1A 5KWDA 2IO3C 2IQCA 3WG7E 4MS6A 1QZ2A 2CHWA 3JQ1A 3TWUA 1HZ4A 3V2XA 3NBNB 3Q78A 2LNIA 4ANVA 3UTMA 3APCA 4JEHA 5KBAA 3FTYA 4J8YA 2MYOA 4O1PA 3CHMA 3CHOA 4RQIA 5D2MC 4PS7A 3GYZA 3QNKA 4Y6CA 1TNZA 4YDYA 2PL2A 4B8CB 5AJDA 3PZ4A 1UN8A 1PC2A 5A6CA 3DEPA 2WPVA 3UM3A 1FT2A 2DCPA 4R7LA 4LUNU 1KT1A 5EDSA 4N3AA 1N4QA 5G04C 4LG6A 3EJNA 2VGXB 3DSSA 3LKUA 3IEGA 1ZU2A 3ASGA 4B94A 2Y4UA 4DI4A 4CT0A 2GRRB 4HVBA 4UWHA 2DVWA 3ZYLA 3S7FA 4OAUC 4JHJA 5DIZA 3ZFWA 4JL0A 2A4ZA 4WAFA 4FC8A 1OCCE 3QDNA 4JHRA 3SHFA 3QB2A 2R03A 3MA5A 4HOQA 3NZSA 2V8SE 3D9KA 4DI3A 1WAO1 3P2BA 3CVLA 4X8QA 3R7RA 2KCLA 3FU6A 3HXDA 1XNFA 1MX6A 5CCMA 3Q79A 3CVYA 2DIWA 2WXQA 2WXFA 4AY6A 2IO2C 2VTBA 4CDNA 3PE3A 3CSTA 3PZ3A 3TWSA 3Q7FA 2P9IG 5BPPA 4ZFHA 3Q7AA 2XS8A 1UW4B 5BV1A 1O5MA 3EIJA 3B7SA 2GGFA 4HLLA 1Z3XA 2ETAA 3RK6A 3SY2A 1MX4A 1Q2ZA 4E85A 1HG5A 4OVUA 2PZIA 2R2LA 2KXPC 3LJNA 3HVEB 4FJYA 2GRMA 4XX5A 3ZW3A 2R59A 2L9BA 5ENOD 5BXUA 3W9FA 1OCZE 3CVWA 2ETCA 3FUHA 3DWLG 2FF4A 3FY4A 3SQVA 4GA1A 4G8KA 1SZ9A 3AG4E 4BT8A 1K1AA 3UMVA 3MYVA 4KVMA 4OYSA 5EKQD 3L08A 3ML9A 3SO8A 5FT9A 2AXVA 4QFVA 2CFUA 4NIKA 4GMLA 3DBSA 3ASFA 2NXPA 4D10C 2ZIRA 3EHQA 3C3QA 5T8IA 3S7JA 1FCHA 3FTUA 5LFAA 4TUMA 2ZGDA 3MGBA 3MKQB 1OT8A 5HQ8A 4EQFA 1NP7A 2I1JA 4UQYA 3D3MA 3PNLB 4XKBA 3MV3B 4Q69A 4AVXA 4EPZA 2VTBB 5CEDB 1YA0A 4AIFA 4YDEA 3TJPA 2OVBA 1MQSA 2KCVA 1JCQA 5CMWA 5DBKA 5G04J 5ENNA 2EQXA 1SA5A 3L16A 4WNDA 3UM0A 1Z6TA 3FUIA 5AQBA 4IRUA 3EHRA 5LX8A 3DRAA 5BT1A 1EDUA 3T8KA 4F6RD 4DK5A 3AU5A 1Z3YA 1N94A 3MEKA 3DSXA 1D8DA 3LDZA 4HRNA 3V79K 4IULA 1TNYA 5A23A 1BI7B 3TXMA 2FULA 3LPZA 5ARFA 5JJ6A 4I1MA 3SZ7A 3EU5A 2XQ0A 4GTPA 4ATZD 1OWMA 4BSXA 3JUEA 4I6JA 3ENEA 3QWWA 4J8FA 3B7UX 5FQ4A 2PNNA 3IHVA 3RRUA 4JZYA 3L54A 2X6HA 3BU8A 5HI7A 3RU0A 2H6IA 2Y3AA 4FJZA 3Q5MA 4GAAA 4OVVA 2UY1B 4U8VD 2AXUA 3QARA 3ZYQA 3TAXA 5BNWA 2J4BA 1QBQA 3ZU7B 4K03A 3LXUX 5HRYA 3R9MA 2X38A 1OWLA 2MRIA 4ANUA 3AAAC 2J09A 4GA0A 2FEZA 2I1KA 4JW1A 2EILE 5CMYA 2L0TB 3UM1A 2A5UA 5JA4D 3V30A 3MJWA 3ABME 4UQXA 3CHRA 1HFAA 4HRMB 3L6AA 3ISMC 1N0RA 4AV7A 2YNQA 5EYPF 1XGWA 1KT0A 2CHZA 2RG8A 4GMRA 2P9PG 4A55A 4I6GA 3CQCB 3E37A 5KJLA 4JC8A 3JXIA 1GW6A 3ASNE 2XCBA 2DZNA 2UY1A 3L13A 2X6IA 3U9WA 4CDMA 4EZKA 3O4ZA 3EUVA 1KLXA 4U04A 4B8AA 3E30A 3BUAA 1A5EA 1X81A 1H0AA 1HF8A 3B95A 4RG6A 3AG1E 3KD7A 3ONLA 4Q96A 1SW6A 3E4BA 2VGXA 2QYJA 4EBAA 3D9HA 4UQZA 4WNFA 3L82A 3FFLA 3DSWA 5JJ7A 4JA9A 2OCCE 3Q49B 3UXGA 1TN8A 4K5CA 3EDTB 4DPRA 3CQGB 1N9AA 4KYOB 2ZXWE 4TRQA 1BPOA 2LXMA 3I5PA 5ANRA 3KEAA 4I1AA 1ELKA 3W9GA 2CG2A 5ENRD 4U8YD 1E8ZA 3B13A 4MRUA 5EIBE 3L9TA 5JHBA 3B7TA 3E33A 3RO3A 3PNTB 2HM8A 3HXEA 4PS3A 2XEEA 1LD8A 1MJ0A 2XPYA 2WM9A 4YVOA 3HIZA 2EIME 4KVOA 3QK0A 1X5BA 4K5BA 3FH8A 3UX4A 2XENA 4N5QA 2MHKA 3JXJA 2XPIA 4P29A 3TL5A 1IQRA 5CBOA 2ZGGA 4KZCA 4NURA 1HO8A 4XIFA 4GTRA 5FZQA 3FTXA 1IKND 3TWWA 1UG3A 2HE0A 2L6JA 3RSEG 5BUZA 1HE8A 2ETBA 3LCAA 4DX1A 2OEWA 4CCAA 3PEVB 2OOEA 5ITZF 3FUKA 1IHGA 2Y0BG 5D0QD 2C0MA 2IFUA 5G2NA 2QY7A 4ILIA 2VQ2A 1WY6A 2VYIA 1IQUA 4GYOA 4I9CA 1NZNA 2IJGX 3D9JA 3JQ0A 4BERA 1H19A 3AS8A 4CT4A 2IY0C 5FWQA 3Q15A 1U2VG 3FTVA 3CVQA 5CEAA 1MYOA 4HRLA 3CVXA 4I2WA 3DPYA 3E34A 3BEEA 2FBNA 2JEKA 1IXVA 2WXNA 1JCRA 4APOA 4PUCA 1VDYA 1LTXA 4J0UA 4GZ3A 5J90A 3CHPA 2F37A 4GYWA 4WWNA 3CVPA 4JXTA 5A7DB 4U07A 3PS6A 4AM9A 5E76A 3OAWA 3FUNA 3ZNGA 2FO7A 5CRVA 2DBAA 3FUMA 3CVNA 3ZKJA 2E0IA 4YVQC 4J7WA 3OXFA 5JMND 4U96D 5BW8C 2X6FA 4G25A 2I2OA 3PEUB 4H7XA 3HXBA 5FIOA 2WXGA 4Y6WA 4DX7D 2X6KA 2WVIA 3LY8A 4IN3B 4FHJA 2FO1E 3S2AA 2WXRA 1MX2A 3CK9A 4J8SA 4ACLA 1TEZA 4RLYA 1O1TA 2WB2A 5AJLA 5AQAA 4H7YA 2VGYA 3C72A 4CRWA 2MOWA 3FU0A 2PQRA 2V5FA 3CK8A 4GU5A 4BX8A 5CCLA 1E96B 2E2EA 2R02A 1K8KG 1DNPA 2BKGA 1LD7A 4B93B 5KCMA 4GTQA 2AJAA 3FDHA 2DZOA 4EZJA 4N2SA 4BTBA 3CR3A 2Y69E 5EIDA 5G55A 3FP3A 2VSNA 3SFXA 5CRUA 2H6FA 1TNOA 3VLDA 1L5JA 3Q4AB 2IEJA 3SGHA 2AVPA 5ARGA 4DUIA 3D9OA 2IU1A 2B6CA 3KEZA 4URKA 1S70B 3SI5A 3C3OA 5CBNA 3QWPA 2EIJE 2VSYA 3ESKA 3Q9UC 3CKCA 4FULA 4HB5A 4HFGA 4W9RA 2GROB 3PUJA 4EECA 3QAQA 3NZUA 1SA4A 3HRAA 4LNGA 3FUEA 3CLJA 1NA0A 2YHCA 4HXIA 1FVFA 4GPMA 3Q73A 3ONKA 3B7RL 3FHEA 1E7UA 2J07A 3HYMB 2X3MA 4GCNA 5JHAA 2NYJA 4FLBA 2CHXA 2XZTG 3LY9A 3PREA 3GZSA 3QOUA 3OTNA 4V3IA 1HS6A 4HBDA 5B1AE 4E6HA 1TJFA 2YHEA 3SBTB 2VJ8A 4BEPA 2WXJA 1ZBPA 1IHBA 5LCWJ 4O1OA 1WM5A 2JABA 3PUKA 3APDA 3TG5A 2KCKA 1ELRA 5ENPD 3U3WA 2XZDG 1FPPA 2F8YA 4NACA 2NC9A 4F53A 1LF8A 3K9IA 2L0IA 4PS8A 1OCRE 1RZ4A 4DRXE 4UI9K 1OY3D 1E90A 5G05C 3VTYA 2XGOA 3EHNA 4JD2G 5JJTA 4U7EB 5E75A 2P2CP 3FTSA 3AG3E 4JHKA 4JEUA 1P5QA 5AIJA 4HQDA 5AYWD 3BG0B 2AW6A 4BX9A 3VLEA 3FULA 4HS2A 3NOGD 1N11A 3QJZA 3EU9A 4ACKA 3ZVVA 4PDXA 1H2TC 1PAQA 2HR2A 2V0PA 2KBXA 3CK7A 3SF4A 3Q9NC 3I4GA 4UUCA 3FTWA 3TGOA 4LNBA 1KPSB 2WQ7A 4MLPA 1HH8A 1UJKA 3E32A 4KBQA 5KNGA 4DLQA 1YCSB 5C1DA 3QKYA 2H6GA 4AJWA 4OAVB 4I1OB 4HORA 3AG2E 5T4YA 3D9MA 3UT8A 2J9QA 1OWPA 2QC9A 1HX8A 4I6EA 2KC7A 4KXKB 3BQOA 1HXIA 3FH7A 2PM6A 1H6OA 4TV3A 4YDOA 2XHEA 1BU9A 2Y1LE 1U3CA 2LO6A 5FZSA 3F6QA 3D9IA 1SQMA 4DJAA 1JWGA 5EX0A 3TXNA 1Y8MA 2YQ8A 5B3SE 1E8YA 5KJKA 4A1GA 4GTOA 4WNEA 3D9NA 1EF1C 5ANLA 4LEUA 5EX3A 4FADA 4GPKA 2AWIA 2KM4A 4I9EA 3V2OA 3MZLB 5EYLA 3D9PA 3TWRA 3V31A 3UM2A 2LSUA 4FP7A 4WWPA 4AEZC 3CHSA 2R5SA 1S63A 1YYHA 4GCOA 3FUDA 4UI9J 4G11A 3VTXA 3I4RB 3FH5A 1OWOA 3PE4A 1TR4A 2RKKA 4GZCA 3G2VA 4TUUA 3CGHA 4BT9A 2FI7A 4UI9C 4ANWA 3KS2A 4GZDA 3NOCD 3CEQA 2B0OE 5CERB 4JPSA 2V4LA 2I6HA 1QYMA 2P9KG 4ANXA 4L1BA 2J49A 3P1UA 4MKTA 3PZDA 5D66A 2YINA 3NAWA 1KZOA 3T9KA 1S64A 3AS4A 2P9SG 3G2UA 2PM7A 2WMNA 2NSZA 2J8SD 4N3BA 3ZN3A 3L17A 2M63A 4IYPA 1V55E 2F8XK 1TNUA 3GZ1A 4HNAD 3SNXA 2XGSA 3MV2B 2XRZA 4N5CA 4DX2A 4TXRA 2RFAA 3T5VA 2OVFA 3TWXA 5LOZA 3LS8A 1N0QA 4CGWA 2CG3A 1TN7A 5FQ8A 3PZ1A 4I43A 2P58C 4JA7A 3DSTA 3LVQE 4O6FA 4RVBA 2WMOA 3UIOC 4I17A 1N95A 4K0RA 4LSZE 3ABLE 4GA2A 3U66A 1G3NB 3RIBA 3RKVA 3NQPA 4WNGA 3B7BA 1TYQG 2EINE 4GZ6A 2ILRA 2LSVA 3LY7A 5EILA 2I9CA 4AOFA 4U0SA 5FJYA 2XEHA 4ATGA 1OWNA 3FUFA 2XGMA 2BEDA 4L2LA 1K3ZD 4UWKA 3CVUA 4BESA 2Q7FA 2V4HC 4LERA 3HDXA 2BTDA 2ZU6B 2WQHA 1K1BA 4TXPA 3FUJA 3C98A 2IOLA 3VLFA 5BV0A 3RAUA 4C0EA 2QFCA 5BXOA 4BFRA 1O1SA 3LYAA 3T5XA 3ESLA 3HXCA 4Q94A 1E7VA 2WXMA 3KSQA 3ULEG 3DEOA 4PH4B 3JUIA 2BF0X 1DC2A 2LUHA 3SD5A 3AU4A 5M72A 2J08A 3UINC 4AP2A 4N39A 1D9SA 2WXHA 5LCWC 2HO1A 3SFZA 4XE0A 2VSXE 4KMOA 4N3CA 1EYHA 2XPZA 4HOTA 5KNHD 4U63A 5AQ9A 2WXPA 3IXEA 2XEVA 3DXKG 4LRZA 1NI1A 2GRLA 3G2SA 2KATA 4MBGA 5AAOA 3KSLA 1PY1A 1FVHA 1BD8A 5CHEE 3IV0A 2UWJG 1INZA 3L22A 1N54A 4C48B 1YMPA 3ZPJA 1Y6IA 1UOHA 1V54E 5HKPA 1FT1A 4L23A 5IY5E 2L6BA 3MKQA 3EHMA 5AENA 2R17C 2IONA 5FQ7A 4BETA 4EBAG 5G05J 3BG1B 5HS0A 4YNDA 4A1SA 4GMJA 4WWOA 4CYMD 2ONDA 3CSFA 3CKBA 2H6HA 5AN8A 5FZRA 3PDNA 3HG0D 2GRNB 1JWFA 3SBSA 1NL4A 3PRZA 1UN9A 4BY6A 3C3RA 2LXLA 4ME2A 4B89A 3ULYA 3IKOB 4G2VA 1N4PA 3IBEA 3ZHEA 3PVLA 4XEIG 5FTPA 3J5QB 2DWZA 1U3DA 3DSUA 3OXGA 4G1TA 3CV0A 3UT4A 4EHMA 3UKRG 4A3TA 4TXQA 2ZISA 4O60A 3KAEA 2WXKA 1BLXB 3LEWA 3MKRA 2HYZA 4GZ5A 1NFIE 2EIKE 1H6PA 3FTZA 2IOSA 3N71A 4LNUD 3UUXA 1H6KA 4L2YA 4XI0A 3GW4A 2R05A 3Q75A 4DLOA 4CEMA 1MHQA 3ZYMA 4UWGA 1DVPA 2Y4TA 4KZ0A 2VSOE 4GTSA 3I3NA 1AP7A 5J08A 1SVXA 2J4DA 3D9LA 3PH0C 2XS1A 3LVRE 3J5PA 4M3OA 4BSZB 1H2VC 4C9BB 4FA6A
chains in the Genus database with same CATH topology
5D0QD 3MZLB 2C0MA 3ZEFA 2IFUA 3AS5A 4E85A 3D9PA 1HG5A 2QY7A 4OVUA 5G2NA 4ILIA 2PZIA 4C0MA 5D0OD 2VQ2A 2WXIA 2LSUA 3HVEB 1JUQA 4AY5A 4FP7A 4FJYA 2GRMA 4WWPA 4XX5A 3ZW3A 2R59A 1WY6A 2VYIA 1IQUA 2L9BA 4AEZC 3CHSA 2R5SA 4GYOA 1JPLA 3CVWA 1ELWA 4GCOA 3WXXA 3FUDA 3FUHA 4I9CA 4UI9J 1NZNA 3QWVA 2IJGX 3S7DA 4G11A 2FF4A 3D9JA 3VTXA 3JQ0A 3I4RB 3FH5A 4XI9A 1OWOA 3FY4A 3O48A 3PE4A 4GYYA 4GA1A 1SZ9A 5FQ6A 1H19A 4F7AA 4GZCA 3G2VA 4BT8A 3AS8A 3CGHA 4TUUA 2FI7A 3UMVA 4BT9A 4CT4A 2AXZA 4UI9C 4ANWA 3MYVA 3FWVA 3FEYA 4KVMA 3Q47B 3KS2A 4GZDA 4OYSA 3Q15A 3L08A 3ML9A 5EKQD 3FTVA 5FWQA 3CEQA 3CVQA 5FT9A 2AXVA 4QFVA 2CFUA 3CVXA 4ILHB 4I2WA 2V4LA 2I6HA 4JPSA 3ZRHA 4GMLA 4ANXA 4L1BA 3DBSA 3ASFA 3HVEA 2NXPA 4D10C 2J49A 3P1UA 4MKTA 3PZDA 3IHYA 2YINA 5T8IA 3S7JA 3BEEA 1QQEA 2FBNA 2JEKA 4BTAA 4LCTA 1FCHA 2JLBA 2WXNA 3FTUA 5LFAA 4J6IA 2XCCA 4APOA 3MGBA 1UJJA 4PUCA 3GZ2A 3G2WA 1VDYA 3MKQB 4J0UA 3AS4A 4GZ3A 4NRHB 5J90A 3CHPA 4EQFA 1NP7A 5HQ8A 4HOSA 3G2UA 2PM7A 4GB9A 2WMNA 4GYWA 2NSZA 2I1JA 3JCKC 4XZ4A 4UQYA 2C2LA 4N3BA 3CVPA 3D3MA 4WWNA 4JXTA 3U4TA 3ZN3A 5A7DB 3L17A 2M63A 3PNLB 4IYPA 4U07A 3PS6A 3MV3B 4XKBA 4AM9A 3ASHA 5E76A 3OAWA 2OV8A 3URZA 4Q69A 3EIQC 3CVVA 3FUNA 2FO7A 4J8DA 3GZ1A 4XKCA 3SNXA 2XGSA 2DBAA 4AVXA 3FUMA 4RSYA 3RJVA 4EPZA 3CVNA 2VTBB 1YA0A 2E0IA 3MV2B 4YVQC 2PQNA 3OXFA 4AIFA 2XRZA 4N5CA 3DPDA 3TJPA 2OVBA 5BW8C 2BUGA 2X6FA 4G25A 1MQSA 2KCVA 4KT6B 3T5VA 4UWFA 4F1SA 3FU5A 2OVFA 2I2OA 3PEUB 4CDRA 1B89A 4FLHA 4H7XA 3ULQA 5LOZA 3OXLA 5CMWA 5DBKA 3LS8A 3UPVA 4CGWA 2WXGA 5G04J 4Y6WA 2CG3A 2X6KA 5ENNA 2WVIA 3JYSA 3LY8A 5FQ8A 4IN3B 4FHJA 2CFZA 2EQXA 4N2QA 4I43A 4F3VA 3S2AA 2WXRA 3L16A 2P58C 3CK9A 4J8SA 4WNDA 4ACLA 3NF1A 4JA7A 3LVQE 4EZLA 4O6FA 2KZTB 1TEZA 1Z6TA 3FUIA 4RVBA 3ZXSA 2WMOA 3ZGQA 4I17A 4K0RA 3HHMA 2WB2A 4GA2A 5AJLA 3U66A 4ILGA 3MCXA 4IRUA 5LX8A 3RIBA 3RKVA 4H7YA 5BT1A 2VGYA 1EDUA 3NQPA 4WNGA 4CRWA 1IYGA 4DK5A 3AU5A 4GZ6A 1Z3YA 2MOWA 2ILRA 3MEKA 3FU0A 2LSVA 2PQRA 2V5FA 3MX3A 3CK8A 4GU5A 3LDZA 3LY7A 3RRNB 4BX8A 5CCLA 2RD0A 1E96B 2I9CA 2X6JA 4AOFA 2E2EA 4IULA 4U0SA 1DNPA 3CIAA 5A23A 5FJYA 2WQ6A 5C2YA 4ATGA 3G2TA 2FULA 5KCMA 3TXMA 3LPZA 5T3RA 5ARFA 5JJ6A 4I1MA 3SZ7A 1OWNA 4UWLA 2XQ0A 3FUFA 4I2ZA 2XGMA 3FDHA 4L2LA 1OUVA 3R7QA 4EZJA 3RO2A 4UWKA 1EPUA 1OWMA 3CVUA 4N2SA 4BTBA 2Q7FA 3CR3A 4LERA 3HDXA 3ZHEB 2BTDA 2ZU6B 4BSXA 2WQHA 5G55A 4JVSA 4I6JA 3FUJA 4G24A 3C98A 3ENEA 3QWWA 1E8XA 2IOLA 4J8FA 1SZAA 3FP3A 2VSNA 3VLFA 5BV0A 3R9AB 3B7UX 2XRYA 5FQ4A 4G23A 3VLDA 3IHVA 3RRUA 1L5JA 3Q4AB 4JZYA 4C0EA 3L54A 2QFCA 2X6HA 1TJCA 3LJ3A 4HOUA 3SGHA 4BFRA 2AVPA 3ZIMA 5HI7A 5ARGA 3RU0A 4RG9A 3D9OA 2Y3AA 3LYAA 4FHKA 1N52A 2IU1A 2LAHA 4FJZA 2WXLA 3ESLA 3T5XA 3KEZA 3Q5MA 3APFA 2WXOA 4Q94A 4URKA 3SI5A 1E7VA 4GAAA 4OVVA 2WXMA 3UT7A 1E8WA 3ML8A 2UY1B 1S0PA 3QWPA 2AXUA 1W3BA 1HU3A 4PH4B 2VSYA 5KJNA 3QARA 3JUIA 4J8EA 4U0UA 3ESKA 2BF0X 4WUYA 3SD5A 3ZYKA 3AU4A 3U64A 5M72A 3CKCA 4FULA 3ZYQA 4HFGA 4W9RA 3TAXA 2J08A 3PUJA 3UQ3A 5BNWA 4AP2A 2IF4A 4NQ0A 2J4BA 4N39A 3FEXA 2WXHA 5LCWC 4G26A 3T8MA 3FU3A 2HO1A 3QAQA 3NZUA 3SFZA 4EECA 4K03A 4XE0A 3LXUX 5LP0A 2VSXE 4KMOA 2X38A 4HLEA 1OWLA 2LAIA 4N3CA 2MRIA 3FUEA 1EYHA 4ANUA 4BWRA 3CLJA 2XPZA 1NA3A 1NA0A 4AXHA 2KZTA 4HOTA 2J09A 2YHCA 2FEZA 4GA0A 4HXIA 2I1KA 4JW1A 3QC1A 4FU3A 4U63A 1FVFA 2L0TB 5CMYA 4A3VA 2A5UA 2C0LA 2WXPA 3S7BA 1H2UA 3ONKA 3B7RL 3RRMB 2XEVA 3MJWA 4ABNA 4UQXA 3CHRA 3ASDA 1E7UA 3FHEA 1HFAA 1A17A 1HG2A 2J07A 4U0ZA 3HYMB 4APFA 2X3MA 4LRZA 3CHQA 4GCNA 3L6AA 4B0ZA 3TG4A 5JHAA 4L7TA 4AV7A 4CGVA 4FLBA 2CHXA 2GRLA 2YNQA 3LY9A 3PREA 3G2SA 3GZSA 3QOUA 4U8HA 5KJMA 1QNFA 3OTNA 1HS6A 1XGWA 1KT0A 2CHZA 2GW1A 4V3IA 2KATA 2RG8A 2IQCA 4E6HA 1TJFA 2YHEA 3SBTB 2VJ8A 1PY1A 2WXJA 1ZBPA 4MS6A 1FVHA 1QZ2A 2CHWA 3JQ1A 4A55A 1HZ4A 5CHEE 3IV0A 2UWJG 4I6GA 2LNIA 3CQCB 5LCWJ 1INZA 3L22A 1N54A 4ANVA 5KJLA 4JC8A 1WM5A 3PUKA 3APDA 3TG5A 3APCA 2KCKA 1ELRA 1GW6A 2XCBA 3ZPJA 2UY1A 4JEHA 3FTYA 3U3WA 3L13A 1Y6IA 4NACA 2X6IA 2NC9A 3U9WA 3CHMA 4L23A 3CHOA 4CDMA 1LF8A 3K9IA 4F53A 4EZKA 3MKQA 3EHMA 3GYZA 3QNKA 4PS7A 3O4ZA 4Y6CA 2L0IA 5AENA 2R17C 2IONA 5FQ7A 4EBAG 1KLXA 2PL2A 4PS8A 4B8CB 5AJDA 4U04A 5G05J 4B8AA 4UI9K 1E90A 1UN8A 3BG1B 5G05C 1PC2A 3VTYA 5A6CA 4YNDA 2WPVA 4A1SA 4GMJA 2XGOA 3EHNA 5JJTA 4WWOA 5E75A 2DCPA 1H0AA 4R7LA 3FTSA 4LUNU 1HF8A 1KT1A 2ONDA 5EDSA 3KD7A 4JHKA 3ONLA 3CSFA 1P5QA 4JEUA 4Q96A 4N3AA 4RG6A 5AYWD 5AIJA 3CKBA 3BG0B 2AW6A 5FZRA 4BX9A 3E4BA 2VGXA 3PDNA 5G04C 3VLEA 3FULA 4EBAA 4HS2A 3EJNA 4UQZA 4WNFA 2VGXB 1JWFA 3LKUA 3FFLA 3QJZA 3SBSA 3IEGA 4ACKA 3PRZA 3ZVVA 5JJ7A 1ZU2A 3ASGA 4PDXA 1H2TC 4JA9A 1PAQA 1UN9A 2HR2A 4B94A 2V0PA 3CK7A 3SF4A 2Y4UA 3Q49B 4DI4A 4CT0A 4BY6A 3EDTB 3I4GA 4ME2A 4B89A 4DPRA 4HVBA 3CQGB 4UWHA 3IKOB 4KYOB 3FTWA 4G2VA 3ZYLA 3TGOA 4TRQA 1BPOA 3IBEA 3ZHEA 3PVLA 3S7FA 5FTPA 4JHJA 5DIZA 2WQ7A 3I5PA 4MLPA 3ZFWA 5ANRA 1HH8A 4JL0A 1UJKA 2A4ZA 4KBQA 4I1AA 1ELKA 1U3DA 3OXGA 4WAFA 4FC8A 4DLQA 3QDNA 4JHRA 2CG2A 3SHFA 4G1TA 3CV0A 3QB2A 3MA5A 4HOQA 3NZSA 3UT4A 1E8ZA 3B13A 5C1DA 3QKYA 4MRUA 5JHBA 3B7TA 2V8SE 4A3TA 3RO3A 3PNTB 3D9KA 4AJWA 4DI3A 1WAO1 2HM8A 4PS3A 3KAEA 4I1OB 4HORA 3P2BA 2WXKA 5T4YA 3CVLA 3D9MA 3UT8A 2J9QA 3LEWA 1OWPA 3MKRA 3R7RA 1HX8A 2HYZA 2KCLA 4I6EA 2KC7A 3FU6A 2XPYA 2WM9A 4GZ5A 4YVOA 3HIZA 4KXKB 1XNFA 4KVOA 1HXIA 1X5BA 3FH7A 3QK0A 2PM6A 3FTZA 2IOSA 3N71A 5CCMA 3FH8A 3UX4A 3CVYA 4TV3A 2DIWA 2WXQA 3UUXA 1H6KA 2WXFA 2MHKA 4L2YA 2XHEA 4XI0A 4AY6A 2XPIA 3GW4A 4P29A 4DLOA 1U3CA 3TL5A 2LO6A 4CEMA 1IQRA 5FZSA 2VTBA 3D9IA 4CDNA 1SQMA 1MHQA 4KZCA 4DJAA 3PE3A 4NURA 4UWGA 1DVPA 1HO8A 3CSTA 3ZYMA 2Y4TA 4XIFA 4KZ0A 5FZQA 1JWGA 3FTXA 2VSOE 1UG3A 3I3NA 5BPPA 5J08A 5EX0A 2L6JA 3TXNA 1Y8MA 2YQ8A 1E8YA 5KJKA 5BUZA 2J4DA 4A1GA 3D9LA 4WNEA 1HE8A 3LCAA 3D9NA 1EF1C 3PH0C 5ANLA 4LEUA 3LVRE 4CCAA 1UW4B 5BV1A 3EIJA 5EX3A 3B7SA 3PEVB 2GGFA 2OOEA 4M3OA 1Z3XA 3RK6A 4FA6A 4FADA 3FUKA 4GPKA 1IHGA 1H2VC 4C9BB 2AWIA 2KM4A 4I9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBA A;  4E6H A;  4KVO A;  4KVM A;  4E85 A;  3PH0 C; 
#chains in the Genus database with same CATH topology
 4M7C A;  3ZXP A;  2P9L G;  1N4R A;  3PZ2 A;  3ZEF A;  1TN6 A;  3AS5 A;  5CEC B;  4JB8 P;  4DX6 D;  4C0M A;  5D0O D;  2QYU A;  2WXI A;  3X2Q E;  1D8E A;  1JUQ A;  4AY5 A;  5H7P A;  4L9P A;  1JPL A;  1ELW A;  3WXX A;  3S7D A;  3QWV A;  2VGE A;  4XI9 A;  3O48 A;  1OCO E;  4GYY A;  2P9U G;  5FQ6 A;  4F7A A;  3TWV A;  2AXZ A;  3FWV A;  3FEY A;  3Q47 B;  4ILH B;  3ZRH A;  3HVE A;  3IHY A;  1QQE A;  4BTA A;  4LCT A;  4Z68 A;  2JLB A;  4J6I A;  2XCC A;  1UJJ A;  3GZ2 A;  3G2W A;  4NRH B;  3SFY A;  2RFM A;  4HOS A;  4GB9 A;  1DCQ A;  5AAR A;  3JCK C;  4XZ4 A;  2C2L A;  3U4T A;  5ENQ D;  3ASH A;  3CVV A;  2OV8 A;  3URZ A;  3EIQ C;  1Z5S C;  4J8D A;  4XKC A;  2V5Q C;  5AQ7 A;  2OEV A;  4RSY A;  3RJV A;  2A5E A;  2PQN A;  2DYR E;  5EN5 D;  3DPD A;  2BUG A;  4KT6 B;  4UWF A;  4F1S A;  3FU5 A;  4CDR A;  1B89 A;  4FLH A;  3ULQ A;  3OXL A;  3UKU G;  3UPV A;  2BKK B;  3JYS A;  1MZC A;  1WG0 A;  2CFZ A;  4N2Q A;  4F3V A;  4YDW A;  4EZL A;  3NF1 A;  4GTT A;  1ZB1 A;  2KZT B;  3ZXS A;  3ZGQ A;  3HHM A;  4ILG A;  3MCX A;  4A63 B;  1N4S A;  1IYG A;  3MX3 A;  3RRN B;  3TWQ A;  4GTV A;  2RD0 A;  2X6J A;  3CIA A;  2P9N G;  2WQ6 A;  5C2Y A;  3G2T A;  5T3R A;  1AWC B;  2GRP B;  4UWL A;  4GTM A;  4I2Z A;  4HI8 A;  1OUV A;  3R7Q A;  3RO2 A;  1EPU A;  2GRQ B;  3ASO E;  3ZHE B;  3UI2 A;  4HI9 A;  4ZHB A;  4JVS A;  1BI8 B;  4G24 A;  1E8X A;  1SZA A;  4G8L A;  3R9A B;  3ZUV B;  2XRY A;  4G23 A;  4F1P A;  1TNB A;  1JCS A;  1TJC A;  3LJ3 A;  4HOU A;  3ZIM A;  5ENS D;  4RG9 A;  4FHK A;  1N52 A;  2LAH A;  2WXL A;  3APF A;  2WXO A;  1WDY A;  3UT7 A;  1E8W A;  2QZA A;  3ML8 A;  1S0P A;  1W3B A;  1HU3 A;  5KJN A;  3DSV A;  4J8E A;  4U0U A;  4WUY A;  5FIN A;  4QQI A;  3ZYK A;  3U64 A;  1KZP A;  3C5R A;  3ABK E;  4DX5 D;  3UQ3 A;  2IF4 A;  4NQ0 A;  3FEX A;  4G26 A;  3T8M A;  3FU3 A;  3TWT A;  5LP0 A;  3UIP C;  4HLE A;  1OXJ A;  2LAI A;  4BWR A;  1NA3 A;  4AXH A;  2KZT A;  2DYS E;  3QC1 A;  4FU3 A;  4A3V A;  2C0L A;  3HXF A;  3DXM G;  3AJI A;  3S7B A;  5B1B E;  1H2U A;  1RW2 A;  5ENT D;  3RRM B;  2F0Y A;  4CZ2 D;  4ABN A;  3ASD A;  1A17 A;  1HG2 A;  4U0Z A;  4APF A;  4K5A B;  3CHQ A;  4B0Z A;  3TG4 A;  4L7T A;  4U95 D;  4CGV A;  4U8H A;  5KJM A;  1O1R A;  1DCE A;  3NB2 A;  1QNF A;  2GW1 A;  5KWD A;  2IO3 C;  2IQC A;  3WG7 E;  4MS6 A;  1QZ2 A;  2CHW A;  3JQ1 A;  3TWU A;  1HZ4 A;  3V2X A;  3NBN B;  3Q78 A;  2LNI A;  4ANV A;  3UTM A;  3APC A;  4JEH A;  5KBA A;  3FTY A;  4J8Y A;  2MYO A;  4O1P A;  3CHM A;  3CHO A;  4RQI A;  5D2M C;  4PS7 A;  3GYZ A;  3QNK A;  4Y6C A;  1TNZ A;  4YDY A;  2PL2 A;  4B8C B;  5AJD A;  3PZ4 A;  1UN8 A;  1PC2 A;  5A6C A;  3DEP A;  2WPV A;  3UM3 A;  1FT2 A;  2DCP A;  4R7L A;  4LUN U;  1KT1 A;  5EDS A;  4N3A A;  1N4Q A;  5G04 C;  4LG6 A;  3EJN A;  2VGX B;  3DSS A;  3LKU A;  3IEG A;  1ZU2 A;  3ASG A;  4B94 A;  2Y4U A;  4DI4 A;  4CT0 A;  2GRR B;  4HVB A;  4UWH A;  2DVW A;  3ZYL A;  3S7F A;  4OAU C;  4JHJ A;  5DIZ A;  3ZFW A;  4JL0 A;  2A4Z A;  4WAF A;  4FC8 A;  1OCC E;  3QDN A;  4JHR A;  3SHF A;  3QB2 A;  2R03 A;  3MA5 A;  4HOQ A;  3NZS A;  2V8S E;  3D9K A;  4DI3 A;  1WAO 1;  3P2B A;  3CVL A;  4X8Q A;  3R7R A;  2KCL A;  3FU6 A;  3HXD A;  1XNF A;  1MX6 A;  5CCM A;  3Q79 A;  3CVY A;  2DIW A;  2WXQ A;  2WXF A;  4AY6 A;  2IO2 C;  2VTB A;  4CDN A;  3PE3 A;  3CST A;  3PZ3 A;  3TWS A;  3Q7F A;  2P9I G;  5BPP A;  4ZFH A;  3Q7A A;  2XS8 A;  1UW4 B;  5BV1 A;  1O5M A;  3EIJ A;  3B7S A;  2GGF A;  4HLL A;  1Z3X A;  2ETA A;  3RK6 A;  3SY2 A;  1MX4 A;  1Q2Z A;  4E85 A;  1HG5 A;  4OVU A;  2PZI A;  2R2L A;  2KXP C;  3LJN A;  3HVE B;  4FJY A;  2GRM A;  4XX5 A;  3ZW3 A;  2R59 A;  2L9B A;  5ENO D;  5BXU A;  3W9F A;  1OCZ E;  3CVW A;  2ETC A;  3FUH A;  3DWL G;  2FF4 A;  3FY4 A;  3SQV A;  4GA1 A;  4G8K A;  1SZ9 A;  3AG4 E;  4BT8 A;  1K1A A;  3UMV A;  3MYV A;  4KVM A;  4OYS A;  5EKQ D;  3L08 A;  3ML9 A;  3SO8 A;  5FT9 A;  2AXV A;  4QFV A;  2CFU A;  4NIK A;  4GML A;  3DBS A;  3ASF A;  2NXP A;  4D10 C;  2ZIR A;  3EHQ A;  3C3Q A;  5T8I A;  3S7J A;  1FCH A;  3FTU A;  5LFA A;  4TUM A;  2ZGD A;  3MGB A;  3MKQ B;  1OT8 A;  5HQ8 A;  4EQF A;  1NP7 A;  2I1J A;  4UQY A;  3D3M A;  3PNL B;  4XKB A;  3MV3 B;  4Q69 A;  4AVX A;  4EPZ A;  2VTB B;  5CED B;  1YA0 A;  4AIF A;  4YDE A;  3TJP A;  2OVB A;  1MQS A;  2KCV A;  1JCQ A;  5CMW A;  5DBK A;  5G04 J;  5ENN A;  2EQX A;  1SA5 A;  3L16 A;  4WND A;  3UM0 A;  1Z6T A;  3FUI A;  5AQB A;  4IRU A;  3EHR A;  5LX8 A;  3DRA A;  5BT1 A;  1EDU A;  3T8K A;  4F6R D;  4DK5 A;  3AU5 A;  1Z3Y A;  1N94 A;  3MEK A;  3DSX A;  1D8D A;  3LDZ A;  4HRN A;  3V79 K;  4IUL A;  1TNY A;  5A23 A;  1BI7 B;  3TXM A;  2FUL A;  3LPZ A;  5ARF A;  5JJ6 A;  4I1M A;  3SZ7 A;  3EU5 A;  2XQ0 A;  4GTP A;  4ATZ D;  1OWM A;  4BSX A;  3JUE A;  4I6J A;  3ENE A;  3QWW A;  4J8F A;  3B7U X;  5FQ4 A;  2PNN A;  3IHV A;  3RRU A;  4JZY A;  3L54 A;  2X6H A;  3BU8 A;  5HI7 A;  3RU0 A;  2H6I A;  2Y3A A;  4FJZ A;  3Q5M A;  4GAA A;  4OVV A;  2UY1 B;  4U8V D;  2AXU A;  3QAR A;  3ZYQ A;  3TAX A;  5BNW A;  2J4B A;  1QBQ A;  3ZU7 B;  4K03 A;  3LXU X;  5HRY A;  3R9M A;  2X38 A;  1OWL A;  2MRI A;  4ANU A;  3AAA C;  2J09 A;  4GA0 A;  2FEZ A;  2I1K A;  4JW1 A;  2EIL E;  5CMY A;  2L0T B;  3UM1 A;  2A5U A;  5JA4 D;  3V30 A;  3MJW A;  3ABM E;  4UQX A;  3CHR A;  1HFA A;  4HRM B;  3L6A A;  3ISM C;  1N0R A;  4AV7 A;  2YNQ A;  5EYP F;  1XGW A;  1KT0 A;  2CHZ A;  2RG8 A;  4GMR A;  2P9P G;  4A55 A;  4I6G A;  3CQC B;  3E37 A;  5KJL A;  4JC8 A;  3JXI A;  1GW6 A;  3ASN E;  2XCB A;  2DZN A;  2UY1 A;  3L13 A;  2X6I A;  3U9W A;  4CDM A;  4EZK A;  3O4Z A;  3EUV A;  1KLX A;  4U04 A;  4B8A A;  3E30 A;  3BUA A;  1A5E A;  1X81 A;  1H0A A;  1HF8 A;  3B95 A;  4RG6 A;  3AG1 E;  3KD7 A;  3ONL A;  4Q96 A;  1SW6 A;  3E4B A;  2VGX A;  2QYJ A;  4EBA A;  3D9H A;  4UQZ A;  4WNF A;  3L82 A;  3FFL A;  3DSW A;  5JJ7 A;  4JA9 A;  2OCC E;  3Q49 B;  3UXG A;  1TN8 A;  4K5C A;  3EDT B;  4DPR A;  3CQG B;  1N9A A;  4KYO B;  2ZXW E;  4TRQ A;  1BPO A;  2LXM A;  3I5P A;  5ANR A;  3KEA A;  4I1A A;  1ELK A;  3W9G A;  2CG2 A;  5ENR D;  4U8Y D;  1E8Z A;  3B13 A;  4MRU A;  5EIB E;  3L9T A;  5JHB A;  3B7T A;  3E33 A;  3RO3 A;  3PNT B;  2HM8 A;  3HXE A;  4PS3 A;  2XEE A;  1LD8 A;  1MJ0 A;  2XPY A;  2WM9 A;  4YVO A;  3HIZ A;  2EIM E;  4KVO A;  3QK0 A;  1X5B A;  4K5B A;  3FH8 A;  3UX4 A;  2XEN A;  4N5Q A;  2MHK A;  3JXJ A;  2XPI A;  4P29 A;  3TL5 A;  1IQR A;  5CBO A;  2ZGG A;  4KZC A;  4NUR A;  1HO8 A;  4XIF A;  4GTR A;  5FZQ A;  3FTX A;  1IKN D;  3TWW A;  1UG3 A;  2HE0 A;  2L6J A;  3RSE G;  5BUZ A;  1HE8 A;  2ETB A;  3LCA A;  4DX1 A;  2OEW A;  4CCA A;  3PEV B;  2OOE A;  5ITZ F;  3FUK A;  1IHG A;  2Y0B G;  5D0Q D;  2C0M A;  2IFU A;  5G2N A;  2QY7 A;  4ILI A;  2VQ2 A;  1WY6 A;  2VYI A;  1IQU A;  4GYO A;  4I9C A;  1NZN A;  2IJG X;  3D9J A;  3JQ0 A;  4BER A;  1H19 A;  3AS8 A;  4CT4 A;  2IY0 C;  5FWQ A;  3Q15 A;  1U2V G;  3FTV A;  3CVQ A;  5CEA A;  1MYO A;  4HRL A;  3CVX A;  4I2W A;  3DPY A;  3E34 A;  3BEE A;  2FBN A;  2JEK A;  1IXV A;  2WXN A;  1JCR A;  4APO A;  4PUC A;  1VDY A;  1LTX A;  4J0U A;  4GZ3 A;  5J90 A;  3CHP A;  2F37 A;  4GYW A;  4WWN A;  3CVP A;  4JXT A;  5A7D B;  4U07 A;  3PS6 A;  4AM9 A;  5E76 A;  3OAW A;  3FUN A;  3ZNG A;  2FO7 A;  5CRV A;  2DBA A;  3FUM A;  3CVN A;  3ZKJ A;  2E0I A;  4YVQ C;  4J7W A;  3OXF A;  5JMN D;  4U96 D;  5BW8 C;  2X6F A;  4G25 A;  2I2O A;  3PEU B;  4H7X A;  3HXB A;  5FIO A;  2WXG A;  4Y6W A;  4DX7 D;  2X6K A;  2WVI A;  3LY8 A;  4IN3 B;  4FHJ A;  2FO1 E;  3S2A A;  2WXR A;  1MX2 A;  3CK9 A;  4J8S A;  4ACL A;  1TEZ A;  4RLY A;  1O1T A;  2WB2 A;  5AJL A;  5AQA A;  4H7Y A;  2VGY A;  3C72 A;  4CRW A;  2MOW A;  3FU0 A;  2PQR A;  2V5F A;  3CK8 A;  4GU5 A;  4BX8 A;  5CCL A;  1E96 B;  2E2E A;  2R02 A;  1K8K G;  1DNP A;  2BKG A;  1LD7 A;  4B93 B;  5KCM A;  4GTQ A;  2AJA A;  3FDH A;  2DZO A;  4EZJ A;  4N2S A;  4BTB A;  3CR3 A;  2Y69 E;  5EID A;  5G55 A;  3FP3 A;  2VSN A;  3SFX A;  5CRU A;  2H6F A;  1TNO A;  3VLD A;  1L5J A;  3Q4A B;  2IEJ A;  3SGH A;  2AVP A;  5ARG A;  4DUI A;  3D9O A;  2IU1 A;  2B6C A;  3KEZ A;  4URK A;  1S70 B;  3SI5 A;  3C3O A;  5CBN A;  3QWP A;  2EIJ E;  2VSY A;  3ESK A;  3Q9U C;  3CKC A;  4FUL A;  4HB5 A;  4HFG A;  4W9R A;  2GRO B;  3PUJ A;  4EEC A;  3QAQ A;  3NZU A;  1SA4 A;  3HRA A;  4LNG A;  3FUE A;  3CLJ A;  1NA0 A;  2YHC A;  4HXI A;  1FVF A;  4GPM A;  3Q73 A;  3ONK A;  3B7R L;  3FHE A;  1E7U A;  2J07 A;  3HYM B;  2X3M A;  4GCN A;  5JHA A;  2NYJ A;  4FLB A;  2CHX A;  2XZT G;  3LY9 A;  3PRE A;  3GZS A;  3QOU A;  3OTN A;  4V3I A;  1HS6 A;  4HBD A;  5B1A E;  4E6H A;  1TJF A;  2YHE A;  3SBT B;  2VJ8 A;  4BEP A;  2WXJ A;  1ZBP A;  1IHB A;  5LCW J;  4O1O A;  1WM5 A;  2JAB A;  3PUK A;  3APD A;  3TG5 A;  2KCK A;  1ELR A;  5ENP D;  3U3W A;  2XZD G;  1FPP A;  2F8Y A;  4NAC A;  2NC9 A;  4F53 A;  1LF8 A;  3K9I A;  2L0I A;  4PS8 A;  1OCR E;  1RZ4 A;  4DRX E;  4UI9 K;  1OY3 D;  1E90 A;  5G05 C;  3VTY A;  2XGO A;  3EHN A;  4JD2 G;  5JJT A;  4U7E B;  5E75 A;  2P2C P;  3FTS A;  3AG3 E;  4JHK A;  4JEU A;  1P5Q A;  5AIJ A;  4HQD A;  5AYW D;  3BG0 B;  2AW6 A;  4BX9 A;  3VLE A;  3FUL A;  4HS2 A;  3NOG D;  1N11 A;  3QJZ A;  3EU9 A;  4ACK A;  3ZVV A;  4PDX A;  1H2T C;  1PAQ A;  2HR2 A;  2V0P A;  2KBX A;  3CK7 A;  3SF4 A;  3Q9N C;  3I4G A;  4UUC A;  3FTW A;  3TGO A;  4LNB A;  1KPS B;  2WQ7 A;  4MLP A;  1HH8 A;  1UJK A;  3E32 A;  4KBQ A;  5KNG A;  4DLQ A;  1YCS B;  5C1D A;  3QKY A;  2H6G A;  4AJW A;  4OAV B;  4I1O B;  4HOR A;  3AG2 E;  5T4Y A;  3D9M A;  3UT8 A;  2J9Q A;  1OWP A;  2QC9 A;  1HX8 A;  4I6E A;  2KC7 A;  4KXK B;  3BQO A;  1HXI A;  3FH7 A;  2PM6 A;  1H6O A;  4TV3 A;  4YDO A;  2XHE A;  1BU9 A;  2Y1L E;  1U3C A;  2LO6 A;  5FZS A;  3F6Q A;  3D9I A;  1SQM A;  4DJA A;  1JWG A;  5EX0 A;  3TXN A;  1Y8M A;  2YQ8 A;  5B3S E;  1E8Y A;  5KJK A;  4A1G A;  4GTO A;  4WNE A;  3D9N A;  1EF1 C;  5ANL A;  4LEU A;  5EX3 A;  4FAD A;  4GPK A;  2AWI A;  2KM4 A;  4I9E A;  3V2O A;  3MZL B;  5EYL A;  3D9P A;  3TWR A;  3V31 A;  3UM2 A;  2LSU A;  4FP7 A;  4WWP A;  4AEZ C;  3CHS A;  2R5S A;  1S63 A;  1YYH A;  4GCO A;  3FUD A;  4UI9 J;  4G11 A;  3VTX A;  3I4R B;  3FH5 A;  1OWO A;  3PE4 A;  1TR4 A;  2RKK A;  4GZC A;  3G2V A;  4TUU A;  3CGH A;  4BT9 A;  2FI7 A;  4UI9 C;  4ANW A;  3KS2 A;  4GZD A;  3NOC D;  3CEQ A;  2B0O E;  5CER B;  4JPS A;  2V4L A;  2I6H A;  1QYM A;  2P9K G;  4ANX A;  4L1B A;  2J49 A;  3P1U A;  4MKT A;  3PZD A;  5D66 A;  2YIN A;  3NAW A;  1KZO A;  3T9K A;  1S64 A;  3AS4 A;  2P9S G;  3G2U A;  2PM7 A;  2WMN A;  2NSZ A;  2J8S D;  4N3B A;  3ZN3 A;  3L17 A;  2M63 A;  4IYP A;  1V55 E;  2F8X K;  1TNU A;  3GZ1 A;  4HNA D;  3SNX A;  2XGS A;  3MV2 B;  2XRZ A;  4N5C A;  4DX2 A;  4TXR A;  2RFA A;  3T5V A;  2OVF A;  3TWX A;  5LOZ A;  3LS8 A;  1N0Q A;  4CGW A;  2CG3 A;  1TN7 A;  5FQ8 A;  3PZ1 A;  4I43 A;  2P58 C;  4JA7 A;  3DST A;  3LVQ E;  4O6F A;  4RVB A;  2WMO A;  3UIO C;  4I17 A;  1N95 A;  4K0R A;  4LSZ E;  3ABL E;  4GA2 A;  3U66 A;  1G3N B;  3RIB A;  3RKV A;  3NQP A;  4WNG A;  3B7B A;  1TYQ G;  2EIN E;  4GZ6 A;  2ILR A;  2LSV A;  3LY7 A;  5EIL A;  2I9C A;  4AOF A;  4U0S A;  5FJY A;  2XEH A;  4ATG A;  1OWN A;  3FUF A;  2XGM A;  2BED A;  4L2L A;  1K3Z D;  4UWK A;  3CVU A;  4BES A;  2Q7F A;  2V4H C;  4LER A;  3HDX A;  2BTD A;  2ZU6 B;  2WQH A;  1K1B A;  4TXP A;  3FUJ A;  3C98 A;  2IOL A;  3VLF A;  5BV0 A;  3RAU A;  4C0E A;  2QFC A;  5BXO A;  4BFR A;  1O1S A;  3LYA A;  3T5X A;  3ESL A;  3HXC A;  4Q94 A;  1E7V A;  2WXM A;  3KSQ A;  3ULE G;  3DEO A;  4PH4 B;  3JUI A;  2BF0 X;  1DC2 A;  2LUH A;  3SD5 A;  3AU4 A;  5M72 A;  2J08 A;  3UIN C;  4AP2 A;  4N39 A;  1D9S A;  2WXH A;  5LCW C;  2HO1 A;  3SFZ A;  4XE0 A;  2VSX E;  4KMO A;  4N3C A;  1EYH A;  2XPZ A;  4HOT A;  5KNH D;  4U63 A;  5AQ9 A;  2WXP A;  3IXE A;  2XEV A;  3DXK G;  4LRZ A;  1NI1 A;  2GRL A;  3G2S A;  2KAT A;  4MBG A;  5AAO A;  3KSL A;  1PY1 A;  1FVH A;  1BD8 A;  5CHE E;  3IV0 A;  2UWJ G;  1INZ A;  3L22 A;  1N54 A;  4C48 B;  1YMP A;  3ZPJ A;  1Y6I A;  1UOH A;  1V54 E;  5HKP A;  1FT1 A;  4L23 A;  5IY5 E;  2L6B A;  3MKQ A;  3EHM A;  5AEN A;  2R17 C;  2ION A;  5FQ7 A;  4BET A;  4EBA G;  5G05 J;  3BG1 B;  5HS0 A;  4YND A;  4A1S A;  4GMJ A;  4WWO A;  4CYM D;  2OND A;  3CSF A;  3CKB A;  2H6H A;  5AN8 A;  5FZR A;  3PDN A;  3HG0 D;  2GRN B;  1JWF A;  3SBS A;  1NL4 A;  3PRZ A;  1UN9 A;  4BY6 A;  3C3R A;  2LXL A;  4ME2 A;  4B89 A;  3ULY A;  3IKO B;  4G2V A;  1N4P A;  3IBE A;  3ZHE A;  3PVL A;  4XEI G;  5FTP A;  3J5Q B;  2DWZ A;  1U3D A;  3DSU A;  3OXG A;  4G1T A;  3CV0 A;  3UT4 A;  4EHM A;  3UKR G;  4A3T A;  4TXQ A;  2ZIS A;  4O60 A;  3KAE A;  2WXK A;  1BLX B;  3LEW A;  3MKR A;  2HYZ A;  4GZ5 A;  1NFI E;  2EIK E;  1H6P A;  3FTZ A;  2IOS A;  3N71 A;  4LNU D;  3UUX A;  1H6K A;  4L2Y A;  4XI0 A;  3GW4 A;  2R05 A;  3Q75 A;  4DLO A;  4CEM A;  1MHQ A;  3ZYM A;  4UWG A;  1DVP A;  2Y4T A;  4KZ0 A;  2VSO E;  4GTS A;  3I3N A;  1AP7 A;  5J08 A;  1SVX A;  2J4D A;  3D9L A;  3PH0 C;  2XS1 A;  3LVR E;  3J5P A;  4M3O A;  4BSZ B;  1H2V C;  4C9B B;  4FA6 A; 
#chains in the Genus database with same CATH homology
 5D0Q D;  3MZL B;  2C0M A;  3ZEF A;  2IFU A;  3AS5 A;  4E85 A;  3D9P A;  1HG5 A;  2QY7 A;  4OVU A;  5G2N A;  4ILI A;  2PZI A;  4C0M A;  5D0O D;  2VQ2 A;  2WXI A;  2LSU A;  3HVE B;  1JUQ A;  4AY5 A;  4FP7 A;  4FJY A;  2GRM A;  4WWP A;  4XX5 A;  3ZW3 A;  2R59 A;  1WY6 A;  2VYI A;  1IQU A;  2L9B A;  4AEZ C;  3CHS A;  2R5S A;  4GYO A;  1JPL A;  3CVW A;  1ELW A;  4GCO A;  3WXX A;  3FUD A;  3FUH A;  4I9C A;  4UI9 J;  1NZN A;  3QWV A;  2IJG X;  3S7D A;  4G11 A;  2FF4 A;  3D9J A;  3VTX A;  3JQ0 A;  3I4R B;  3FH5 A;  4XI9 A;  1OWO A;  3FY4 A;  3O48 A;  3PE4 A;  4GYY A;  4GA1 A;  1SZ9 A;  5FQ6 A;  1H19 A;  4F7A A;  4GZC A;  3G2V A;  4BT8 A;  3AS8 A;  3CGH A;  4TUU A;  2FI7 A;  3UMV A;  4BT9 A;  4CT4 A;  2AXZ A;  4UI9 C;  4ANW A;  3MYV A;  3FWV A;  3FEY A;  4KVM A;  3Q47 B;  3KS2 A;  4GZD A;  4OYS A;  3Q15 A;  3L08 A;  3ML9 A;  5EKQ D;  3FTV A;  5FWQ A;  3CEQ A;  3CVQ A;  5FT9 A;  2AXV A;  4QFV A;  2CFU A;  3CVX A;  4ILH B;  4I2W A;  2V4L A;  2I6H A;  4JPS A;  3ZRH A;  4GML A;  4ANX A;  4L1B A;  3DBS A;  3ASF A;  3HVE A;  2NXP A;  4D10 C;  2J49 A;  3P1U A;  4MKT A;  3PZD A;  3IHY A;  2YIN A;  5T8I A;  3S7J A;  3BEE A;  1QQE A;  2FBN A;  2JEK A;  4BTA A;  4LCT A;  1FCH A;  2JLB A;  2WXN A;  3FTU A;  5LFA A;  4J6I A;  2XCC A;  4APO A;  3MGB A;  1UJJ A;  4PUC A;  3GZ2 A;  3G2W A;  1VDY A;  3MKQ B;  4J0U A;  3AS4 A;  4GZ3 A;  4NRH B;  5J90 A;  3CHP A;  4EQF A;  1NP7 A;  5HQ8 A;  4HOS A;  3G2U A;  2PM7 A;  4GB9 A;  2WMN A;  4GYW A;  2NSZ A;  2I1J A;  3JCK C;  4XZ4 A;  4UQY A;  2C2L A;  4N3B A;  3CVP A;  3D3M A;  4WWN A;  4JXT A;  3U4T A;  3ZN3 A;  5A7D B;  3L17 A;  2M63 A;  3PNL B;  4IYP A;  4U07 A;  3PS6 A;  3MV3 B;  4XKB A;  4AM9 A;  3ASH A;  5E76 A;  3OAW A;  2OV8 A;  3URZ A;  4Q69 A;  3EIQ C;  3CVV A;  3FUN A;  2FO7 A;  4J8D A;  3GZ1 A;  4XKC A;  3SNX A;  2XGS A;  2DBA A;  4AVX A;  3FUM A;  4RSY A;  3RJV A;  4EPZ A;  3CVN A;  2VTB B;  1YA0 A;  2E0I A;  3MV2 B;  4YVQ C;  2PQN A;  3OXF A;  4AIF A;  2XRZ A;  4N5C A;  3DPD A;  3TJP A;  2OVB A;  5BW8 C;  2BUG A;  2X6F A;  4G25 A;  1MQS A;  2KCV A;  4KT6 B;  3T5V A;  4UWF A;  4F1S A;  3FU5 A;  2OVF A;  2I2O A;  3PEU B;  4CDR A;  1B89 A;  4FLH A;  4H7X A;  3ULQ A;  5LOZ A;  3OXL A;  5CMW A;  5DBK A;  3LS8 A;  3UPV A;  4CGW A;  2WXG A;  5G04 J;  4Y6W A;  2CG3 A;  2X6K A;  5ENN A;  2WVI A;  3JYS A;  3LY8 A;  5FQ8 A;  4IN3 B;  4FHJ A;  2CFZ A;  2EQX A;  4N2Q A;  4I43 A;  4F3V A;  3S2A A;  2WXR A;  3L16 A;  2P58 C;  3CK9 A;  4J8S A;  4WND A;  4ACL A;  3NF1 A;  4JA7 A;  3LVQ E;  4EZL A;  4O6F A;  2KZT B;  1TEZ A;  1Z6T A;  3FUI A;  4RVB A;  3ZXS A;  2WMO A;  3ZGQ A;  4I17 A;  4K0R A;  3HHM A;  2WB2 A;  4GA2 A;  5AJL A;  3U66 A;  4ILG A;  3MCX A;  4IRU A;  5LX8 A;  3RIB A;  3RKV A;  4H7Y A;  5BT1 A;  2VGY A;  1EDU A;  3NQP A;  4WNG A;  4CRW A;  1IYG A;  4DK5 A;  3AU5 A;  4GZ6 A;  1Z3Y A;  2MOW A;  2ILR A;  3MEK A;  3FU0 A;  2LSV A;  2PQR A;  2V5F A;  3MX3 A;  3CK8 A;  4GU5 A;  3LDZ A;  3LY7 A;  3RRN B;  4BX8 A;  5CCL A;  2RD0 A;  1E96 B;  2I9C A;  2X6J A;  4AOF A;  2E2E A;  4IUL A;  4U0S A;  1DNP A;  3CIA A;  5A23 A;  5FJY A;  2WQ6 A;  5C2Y A;  4ATG A;  3G2T A;  2FUL A;  5KCM A;  3TXM A;  3LPZ A;  5T3R A;  5ARF A;  5JJ6 A;  4I1M A;  3SZ7 A;  1OWN A;  4UWL A;  2XQ0 A;  3FUF A;  4I2Z A;  2XGM A;  3FDH A;  4L2L A;  1OUV A;  3R7Q A;  4EZJ A;  3RO2 A;  4UWK A;  1EPU A;  1OWM A;  3CVU A;  4N2S A;  4BTB A;  2Q7F A;  3CR3 A;  4LER A;  3HDX A;  3ZHE B;  2BTD A;  2ZU6 B;  4BSX A;  2WQH A;  5G55 A;  4JVS A;  4I6J A;  3FUJ A;  4G24 A;  3C98 A;  3ENE A;  3QWW A;  1E8X A;  2IOL A;  4J8F A;  1SZA A;  3FP3 A;  2VSN A;  3VLF A;  5BV0 A;  3R9A B;  3B7U X;  2XRY A;  5FQ4 A;  4G23 A;  3VLD A;  3IHV A;  3RRU A;  1L5J A;  3Q4A B;  4JZY A;  4C0E A;  3L54 A;  2QFC A;  2X6H A;  1TJC A;  3LJ3 A;  4HOU A;  3SGH A;  4BFR A;  2AVP A;  3ZIM A;  5HI7 A;  5ARG A;  3RU0 A;  4RG9 A;  3D9O A;  2Y3A A;  3LYA A;  4FHK A;  1N52 A;  2IU1 A;  2LAH A;  4FJZ A;  2WXL A;  3ESL A;  3T5X A;  3KEZ A;  3Q5M A;  3APF A;  2WXO A;  4Q94 A;  4URK A;  3SI5 A;  1E7V A;  4GAA A;  4OVV A;  2WXM A;  3UT7 A;  1E8W A;  3ML8 A;  2UY1 B;  1S0P A;  3QWP A;  2AXU A;  1W3B A;  1HU3 A;  4PH4 B;  2VSY A;  5KJN A;  3QAR A;  3JUI A;  4J8E A;  4U0U A;  3ESK A;  2BF0 X;  4WUY A;  3SD5 A;  3ZYK A;  3AU4 A;  3U64 A;  5M72 A;  3CKC A;  4FUL A;  3ZYQ A;  4HFG A;  4W9R A;  3TAX A;  2J08 A;  3PUJ A;  3UQ3 A;  5BNW A;  4AP2 A;  2IF4 A;  4NQ0 A;  2J4B A;  4N39 A;  3FEX A;  2WXH A;  5LCW C;  4G26 A;  3T8M A;  3FU3 A;  2HO1 A;  3QAQ A;  3NZU A;  3SFZ A;  4EEC A;  4K03 A;  4XE0 A;  3LXU X;  5LP0 A;  2VSX E;  4KMO A;  2X38 A;  4HLE A;  1OWL A;  2LAI A;  4N3C A;  2MRI A;  3FUE A;  1EYH A;  4ANU A;  4BWR A;  3CLJ A;  2XPZ A;  1NA3 A;  1NA0 A;  4AXH A;  2KZT A;  4HOT A;  2J09 A;  2YHC A;  2FEZ A;  4GA0 A;  4HXI A;  2I1K A;  4JW1 A;  3QC1 A;  4FU3 A;  4U63 A;  1FVF A;  2L0T B;  5CMY A;  4A3V A;  2A5U A;  2C0L A;  2WXP A;  3S7B A;  1H2U A;  3ONK A;  3B7R L;  3RRM B;  2XEV A;  3MJW A;  4ABN A;  4UQX A;  3CHR A;  3ASD A;  1E7U A;  3FHE A;  1HFA A;  1A17 A;  1HG2 A;  2J07 A;  4U0Z A;  3HYM B;  4APF A;  2X3M A;  4LRZ A;  3CHQ A;  4GCN A;  3L6A A;  4B0Z A;  3TG4 A;  5JHA A;  4L7T A;  4AV7 A;  4CGV A;  4FLB A;  2CHX A;  2GRL A;  2YNQ A;  3LY9 A;  3PRE A;  3G2S A;  3GZS A;  3QOU A;  4U8H A;  5KJM A;  1QNF A;  3OTN A;  1HS6 A;  1XGW A;  1KT0 A;  2CHZ A;  2GW1 A;  4V3I A;  2KAT A;  2RG8 A;  2IQC A;  4E6H A;  1TJF A;  2YHE A;  3SBT B;  2VJ8 A;  1PY1 A;  2WXJ A;  1ZBP A;  4MS6 A;  1FVH A;  1QZ2 A;  2CHW A;  3JQ1 A;  4A55 A;  1HZ4 A;  5CHE E;  3IV0 A;  2UWJ G;  4I6G A;  2LNI A;  3CQC B;  5LCW J;  1INZ A;  3L22 A;  1N54 A;  4ANV A;  5KJL A;  4JC8 A;  1WM5 A;  3PUK A;  3APD A;  3TG5 A;  3APC A;  2KCK A;  1ELR A;  1GW6 A;  2XCB A;  3ZPJ A;  2UY1 A;  4JEH A;  3FTY A;  3U3W A;  3L13 A;  1Y6I A;  4NAC A;  2X6I A;  2NC9 A;  3U9W A;  3CHM A;  4L23 A;  3CHO A;  4CDM A;  1LF8 A;  3K9I A;  4F53 A;  4EZK A;  3MKQ A;  3EHM A;  3GYZ A;  3QNK A;  4PS7 A;  3O4Z A;  4Y6C A;  2L0I A;  5AEN A;  2R17 C;  2ION A;  5FQ7 A;  4EBA G;  1KLX A;  2PL2 A;  4PS8 A;  4B8C B;  5AJD A;  4U04 A;  5G05 J;  4B8A A;  4UI9 K;  1E90 A;  1UN8 A;  3BG1 B;  5G05 C;  1PC2 A;  3VTY A;  5A6C A;  4YND A;  2WPV A;  4A1S A;  4GMJ A;  2XGO A;  3EHN A;  5JJT A;  4WWO A;  5E75 A;  2DCP A;  1H0A A;  4R7L A;  3FTS A;  4LUN U;  1HF8 A;  1KT1 A;  2OND A;  5EDS A;  3KD7 A;  4JHK A;  3ONL A;  3CSF A;  1P5Q A;  4JEU A;  4Q96 A;  4N3A A;  4RG6 A;  5AYW D;  5AIJ A;  3CKB A;  3BG0 B;  2AW6 A;  5FZR A;  4BX9 A;  3E4B A;  2VGX A;  3PDN A;  5G04 C;  3VLE A;  3FUL A;  4EBA A;  4HS2 A;  3EJN A;  4UQZ A;  4WNF A;  2VGX B;  1JWF A;  3LKU A;  3FFL A;  3QJZ A;  3SBS A;  3IEG A;  4ACK A;  3PRZ A;  3ZVV A;  5JJ7 A;  1ZU2 A;  3ASG A;  4PDX A;  1H2T C;  4JA9 A;  1PAQ A;  1UN9 A;  2HR2 A;  4B94 A;  2V0P A;  3CK7 A;  3SF4 A;  2Y4U A;  3Q49 B;  4DI4 A;  4CT0 A;  4BY6 A;  3EDT B;  3I4G A;  4ME2 A;  4B89 A;  4DPR A;  4HVB A;  3CQG B;  4UWH A;  3IKO B;  4KYO B;  3FTW A;  4G2V A;  3ZYL A;  3TGO A;  4TRQ A;  1BPO A;  3IBE A;  3ZHE A;  3PVL A;  3S7F A;  5FTP A;  4JHJ A;  5DIZ A;  2WQ7 A;  3I5P A;  4MLP A;  3ZFW A;  5ANR A;  1HH8 A;  4JL0 A;  1UJK A;  2A4Z A;  4KBQ A;  4I1A A;  1ELK A;  1U3D A;  3OXG A;  4WAF A;  4FC8 A;  4DLQ A;  3QDN A;  4JHR A;  2CG2 A;  3SHF A;  4G1T A;  3CV0 A;  3QB2 A;  3MA5 A;  4HOQ A;  3NZS A;  3UT4 A;  1E8Z A;  3B13 A;  5C1D A;  3QKY A;  4MRU A;  5JHB A;  3B7T A;  2V8S E;  4A3T A;  3RO3 A;  3PNT B;  3D9K A;  4AJW A;  4DI3 A;  1WAO 1;  2HM8 A;  4PS3 A;  3KAE A;  4I1O B;  4HOR A;  3P2B A;  2WXK A;  5T4Y A;  3CVL A;  3D9M A;  3UT8 A;  2J9Q A;  3LEW A;  1OWP A;  3MKR A;  3R7R A;  1HX8 A;  2HYZ A;  2KCL A;  4I6E A;  2KC7 A;  3FU6 A;  2XPY A;  2WM9 A;  4GZ5 A;  4YVO A;  3HIZ A;  4KXK B;  1XNF A;  4KVO A;  1HXI A;  1X5B A;  3FH7 A;  3QK0 A;  2PM6 A;  3FTZ A;  2IOS A;  3N71 A;  5CCM A;  3FH8 A;  3UX4 A;  3CVY A;  4TV3 A;  2DIW A;  2WXQ A;  3UUX A;  1H6K A;  2WXF A;  2MHK A;  4L2Y A;  2XHE A;  4XI0 A;  4AY6 A;  2XPI A;  3GW4 A;  4P29 A;  4DLO A;  1U3C A;  3TL5 A;  2LO6 A;  4CEM A;  1IQR A;  5FZS A;  2VTB A;  3D9I A;  4CDN A;  1SQM A;  1MHQ A;  4KZC A;  4DJA A;  3PE3 A;  4NUR A;  4UWG A;  1DVP A;  1HO8 A;  3CST A;  3ZYM A;  2Y4T A;  4XIF A;  4KZ0 A;  5FZQ A;  1JWG A;  3FTX A;  2VSO E;  1UG3 A;  3I3N A;  5BPP A;  5J08 A;  5EX0 A;  2L6J A;  3TXN A;  1Y8M A;  2YQ8 A;  1E8Y A;  5KJK A;  5BUZ A;  2J4D A;  4A1G A;  3D9L A;  4WNE A;  1HE8 A;  3LCA A;  3D9N A;  1EF1 C;  3PH0 C;  5ANL A;  4LEU A;  3LVR E;  4CCA A;  1UW4 B;  5BV1 A;  3EIJ A;  5EX3 A;  3B7S A;  3PEV B;  2GGF A;  2OOE A;  4M3O A;  1Z3X A;  3RK6 A;  4FA6 A;  4FAD A;  3FUK A;  4GPK A;  1IHG A;  1H2V C;  4C9B B;  2AWI A;  2KM4 A;  4I9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...