3PH0C

Crystal structure of the heteromolecular chaperone, asce-ascg, from the type iii secretion system in aeromonas hydrophila
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
MNVQLKKQLAELALAGTGHHCHQEAASIADWLAQEECMAECVTLIRLSSLMNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AscE
publication title Crystal structure of the heteromolecular chaperone, AscE-AscG, from the type III secretion system in Aeromonas hydrophila
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Chaperone
total genus 20
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.1040 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ph0C00
4E6HA 4E85A 4KVMA 3PH0C 4KVOA 4EBAA
chains in the Genus database with same CATH superfamily
4AVXA 1FT2A 2NYJA 3UIOC 4GTTA 5ENTD 3T5XA 2OOEA 2ILRA 3UM2A 4UWFA 1BI8B 4ANWA 3QKYA 4OVVA 3CVPA 4RG6A 3RO2A 5M72A 3ZHEA 1OWPA 3ONLA 3OXGA 2AW6A 2IOSA 2MRIA 3P2BA 2BEDA 3FDHA 4CDNA 5ENSD 4HOUA 2IY0C 2PQNA 1KLXA 3TL5A 5BXUA 2XRZA 2I1KA 4GTQA 3PH0C 5E75A 3PS6A 2Y69E 1PAQA 2XGOA 3TWWA 1NZNA 2WXJA 3UM1A 3CLJA 2NC9A 4G8LA 5FZRA 4ANXA 2IJGX 1TNYA 5ENQD 5DBKA 3HHMA 5CMYA 3E32A 1ELKA 1JCQA 2V8SE 3CVQA 2LO6A 3NF1A 3EHRA 4L2YA 5CRVA 5ENRD 3UT4A 2AWIA 4HVBA 4GU5A 2X3MA 3DPYA 1E7VA 2PNNA 3LS8A 3DSWA 3NAWA 1W3BA 4DUIA 3Q47B 3G2TA 3PNLB 1HFAA 2HE0A 3UXGA 3HVEA 2BTDA 4GZ5A 1OCOE 3C3QA 1OCCE 4HS2A 4KZCA 2WXRA 1D8DA 3SI5A 1Q2ZA 5EDSA 2LNIA 3JYSA 4G26A 1A5EA 1SA5A 3W9FA 4CT4A 4JA7A 5KJKA 1H6KA 1OCRE 2E2EA 3LJ3A 4J8YA 4E6HA 3QOUA 4EHMA 2DYSE 4L1BA 3G2WA 4UWKA 2DCPA 3Q5MA 1H19A 1Z6TA 3NBNB 5G04C 1V55E 4BWRA 1WDYA 4I6JA 5G2NA 1UN9A 2R5SA 2J49A 3PREA 5J08A 4AY6A 1KZPA 2DWZA 3B95A 1H2UA 4DK5A 3C3OA 4XKCA 2X6KA 1ZB1A 4TXQA 2Y3AA 3C72A 4A55A 2GROB 1U3DA 5AN8A 3Q79A 3FFLA 5EYLA 5EIBE 3LCAA 3CV0A 2WXNA 4N2SA 3NOGD 1E8XA 4J8DA 3CGHA 3FH5A 2YHEA 1DVPA 2L0IA 1UOHA 4ABNA 2H6IA 3HXBA 3LY8A 2VJ8A 3AG1E 2CG3A 3ASNE 3RRNB 5ANRA 3TWVA 3ZXSA 1UJJA 1MX6A 2XEEA 4MRUA 4DI3A 3DSSA 4A3TA 5CEDB 1OWOA 3P1UA 4HOQA 3FTZA 3VLEA 4CGVA 5FIOA 1HF8A 3W9GA 2IONA 2XEVA 3ZRHA 3U66A 2CFZA 2XRYA 3FP3A 2AJAA 3FUKA 3NZSA 3HXCA 1LF8A 2I1JA 2VGXB 2EQXA 3DXMG 1K8KG 3AS4A 4JW1A 3FUDA 1Z3XA 5HRYA 3G2VA 1TNBA 3MKRA 3FUJA 4N3AA 1SA4A 2RG8A 1WY6A 4HRLA 3ESLA 3DSUA 3EHNA 3R7QA 1JCRA 3FH8A 3FU0A 1O5MA 4XE0A 1HU3A 2IQCA 3IBEA 3VTYA 1IQUA 3DXKG 2V5FA 4C48B 3OAWA 4V3IA 4XZ4A 4N5QA 5CECB 4I9EA 2H6FA 2R03A 3MYVA 3X2QE 2QY7A 5JJTA 2YINA 4U95D 3CQGB 3E34A 4CZ2D 4FLBA 4ATZD 5KJLA 2EIKE 3CHSA 5JA4D 4HI9A 4PS3A 1OWNA 5KNHD 4EQFA 3LEWA 3MKQB 4C0MA 2RKKA 4O1PA 3DWLG 3SHFA 3UKUG 1YA0A 1HG2A 4HXIA 2IF4A 1K1AA 3J5PA 5FINA 1PY1A 3BUAA 3FTWA 2FULA 5CHEE 2XQ0A 3U64A 1SW6A 5FQ6A 3V30A 2OEVA 5FQ4A 5C2YA 3RSEG 1OY3D 2XZDG 3L82A 1ZU2A 1TJFA 3V79K 3PZDA 4HRNA 1Y6IA 4M3OA 4J8EA 2P9PG 4GMJA 4OAUC 3PEUB 3OTNA 2LUHA 4ANVA 1KZOA 4APFA 3DSTA 5BV1A 4RVBA 1D8EA 3D9KA 3V2OA 2XZTG 1Z5SC 1WM5A 2I9CA 3FU6A 3C3RA 2Y1LE 2Y4TA 1HO8A 1G3NB 5BV0A 3UUXA 3AJIA 1OXJA 1HX8A 4F3VA 4TUMA 1YYHA 1L5JA 4CGWA 2VYIA 4LNBA 1QZ2A 4G23A 1N9AA 4U96D 1EDUA 5EILA 3JUEA 3KS2A 3ZYMA 1BU9A 5JHAA 3ZU7B 2WMNA 3CEQA 4I9CA 2VSYA 3RJVA 3SQVA 2WXMA 1N11A 1TR4A 2L6JA 3MZLB 4WNFA 4JXTA 3F6QA 4FHJA 2OEWA 3KD7A 1P5QA 2B6CA 1JWGA 2KXPC 4QQIA 3RRMB 2J4BA 4JB8P 4BT8A 2VGEA 2ETAA 4JZYA 3CVLA 3QC1A 3BU8A 3CSFA 4ACKA 4L7TA 2R2LA 5ITZF 4C9BB 1SQMA 2PQRA 3LDZA 5DIZA 4K5AB 3FTVA 2L0TB 3BG1B 1JPLA 3L54A 4ILHB 2ZGDA 2GRPB 3QJZA 1NI1A 3ESKA 1TEZA 4GZDA 4JPSA 3I5PA 3KSLA 4R7LA 4QFVA 3EU9A 3KEAA 2F0YA 4M7CA 3C98A 4WUYA 5BXOA 2GRRB 4JHKA 4CEMA 4PS7A 4JD2G 4GA0A 2VGYA 2FI7A 3LJNA 4TRQA 2HR2A 4KT6B 4A3VA 4GCNA 4PH4B 1K1BA 4OVUA 3HDXA 2FBNA 3WXXA 4J6IA 3CVYA 4ACLA 2LAHA 4AP2A 5AIJA 1IKND 3D9NA 3PEVB 3HXEA 1BLXB 2PM7A 3JQ0A 2V4LA 2GRNB 2UY1B 3DSVA 2P2CP 2Q7FA 4Q69A 3ZXPA 3D9JA 2EINE 1NA0A 4KYOB 1N0RA 3S7JA 3TXMA 3UTMA 2NXPA 3L22A 3SD5A 4AOFA 4B0ZA 3ASOE 3CR3A 2V4HC 4K0RA 1E8YA 3QK0A 4P29A 4GA2A 5CMWA 1N52A 1H6OA 3FTUA 4DI4A 3PNTB 2VSOE 1MZCA 4GTVA 2DIWA 3LYAA 4KBQA 3JXIA 4KMOA 2LAIA 3Q49B 3BEEA 5EKQD 3U4TA 3CHMA 2WB2A 3Q7FA 2ZISA 4DRXE 1EF1C 3APFA 4K5BA 4APOA 2ETCA 3D9HA 4GTSA 4GZ6A 2IFUA 3B7SA 1TYQG 3SBTB 3APCA 4RQIA 5LFAA 2H6GA 2L9BA 1JCSA 1TN7A 4DPRA 1O1TA 2ETBA 5G05J 2XHEA 3GZ2A 5AQ9A 4I2WA 1UG3A 4MBGA 3EIJA 3KAEA 2GRMA 2DZOA 4NURA 1HS6A 2AVPA 3QARA 2X6FA 4GYYA 4J7WA 1GW6A 1XNFA 4A63B 2R59A 4BESA 5KWDA 2KBXA 4I43A 4I1OB 3IHVA 3E33A 1IHGA 1S0PA 1ELRA 2WXPA 5CCLA 1MQSA 4I17A 4GYOA 2KM4A 2WXOA 5IY5E 3APDA 3ZN3A 3ZEFA 4K03A 3LKUA 4OYSA 4CDMA 4G24A 3TWUA 3FUNA 1LTXA 2XENA 3GZ1A 4UQXA 5BUZA 3QAQA 2YQ8A 4U8VD 3ZNGA 5FZQA 1KT0A 3LY7A 3D9IA 3MV2B 1QQEA 2WPVA 2KATA 4Q96A 2PL2A 4U7EB 4GZ3A 3QNKA 3AG2E 3FHEA 5D2MC 2VGXA 4FP7A 1TJCA 2AXVA 5ARGA 4RG9A 5BNWA 3ZYKA 4O60A 1E8WA 3NQPA 4O1OA 4WNDA 3Q15A 5AQBA 4LNUD 4ATGA 4U8HA 3D3MA 5H7PA 1ELWA 2HM8A 1N94A 3QB2A 2VTBB 4XX5A 2X6HA 5D0OD 1N54A 4GTRA 4OAVB 3PZ2A 4U63A 4GTPA 3PUKA 4NACA 4H7YA 3RO3A 4LERA 4IRUA 4B8AA 2WQ7A 4JC8A 3UT8A 1S64A 5G05C 3TWTA 5AAOA 3ASGA 2MOWA 4EECA 4WNGA 5JJ7A 2L6BA 4EBAG 5HQ8A 3SF4A 1N4RA 4HLLA 5FZSA 1HZ4A 3UIPC 4UUCA 5EIDA 4AXHA 2WM9A 4FC8A 1QNFA 4BX9A 4DX7D 1QBQA 1Y8MA 4XIFA 3PZ3A 3DSXA 4L2LA 1RW2A 3ZPJA 5KBAA 4GAAA 5FQ7A 2GGFA 2EIME 2KZTA 5A23A 4CCAA 3LVRE 4HOTA 2KCVA 3IHYA 3V2XA 3ISMC 3FY4A 3G2SA 3CVWA 1O1SA 3DRAA 2XEHA 3QWPA 3KEZA 3L08A 2GW1A 3FUEA 1H2TC 3D9PA 2LXLA 2XPZA 4ME2A 3RU0A 3ZIMA 2WXGA 4H7XA 4YDWA 3CVUA 5KJMA 4B93B 4CYMD 2IU1A 2JLBA 4Y6WA 2J9QA 1S63A 3NOCD 4IULA 2X38A 3RAUA 1LD8A 3L6AA 4BY6A 2C2LA 3PUJA 3EDTB 4BERA 4B94A 2CHXA 3ULYA 3UT7A 3SNXA 4WWOA 3UI2A 1N4QA 5B1AE 5AQAA 3R7RA 1HH8A 4DX6D 3LY9A 4XKBA 3FWVA 2RD0A 4ZFHA 2V5QC 4YDOA 2NSZA 3D9LA 3JCKC 2VSXE 4N3CA 3TGOA 2P9KG 2XPIA 4LRZA 1O1RA 4FHKA 3ZVVA 3ZFWA 4Z68A 4WNEA 3CK9A 2PM6A 1H2VC 1NFIE 4BSZB 2VQ2A 3LPZA 3FUFA 3AG3E 5LX8A 3GYZA 5ENNA 3AS8A 3ABME 2WVIA 3CHQA 5C1DA 5T4YA 4GMRA 3Q9NC 5CBOA 4RLYA 4EZLA 4HI8A 1QYMA 3BG0B 1H6PA 4AV7A 1JUQA 1X5BA 4UI9K 3TG5A 1TNUA 4BFRA 2J08A 3CVXA 1SZ9A 2J4DA 5AYWD 3DPDA 3L9TA 3FU3A 4U8YD 4LNGA 1OCZE 3T8KA 4NQ0A 4G8KA 1BD8A 3VLFA 2P9NG 2XCBA 4O6FA 5CEAA 2CG2A 2XPYA 5CBNA 5BPPA 3DBSA 3MJWA 1UW4B 3TG4A 4L9PA 4JHJA 4XEIG 1S70B 2QC9A 3LVQE 4U04A 4I1AA 3TWRA 4URKA 2ZU6B 3IKOB 1N0QA 3CIAA 4N5CA 3E37A 1U3CA 3S7BA 4FLHA 2A4ZA 1IHBA 1DC2A 1UJKA 5EX0A 4J8FA 5HI7A 5ENPD 4B89A 1N95A 4CDRA 2PZIA 3Q7AA 3FU5A 3FTYA 4EZKA 3UQ3A 4L23A 4GCOA 2GRLA 4DX5D 2C0LA 2LSUA 1HE8A 2WXIA 4XI9A 2F37A 2HYZA 3CVNA 3T8MA 2KCLA 3IXEA 3TAXA 4J0UA 3TWQA 5E76A 3BQOA 5KCMA 2DVWA 2EIJE 3CKBA 4LUNU 3VLDA 5CCMA 3URZA 2X6JA 2WXHA 1SVXA 4EBAA 2V0PA 4FULA 3ULEG 3PVLA 4IN3B 3Q73A 3MA5A 4KVMA 3ABLE 4I2ZA 4YDYA 1SZAA 4PS8A 1FVHA 5HKPA 5G04J 3QDNA 4MKTA 2AXUA 1WG0A 2QFCA 4U0UA 2OV8A 3EJNA 4AJWA 4E85A 3IEGA 1MYOA 4KVOA 3TWSA 2Y0BG 5AQ7A 4Y6CA 2BUGA 1K3ZD 3OXFA 4AY5A 4UI9J 1E7UA 3PDNA 1NL4A 3G2UA 4YDEA 5FT9A 5B3SE 5KJNA 3T5VA 4N2QA 3HRAA 2MHKA 4I6GA 2LXMA 3R9AB 4GPMA 2HO1A 1E8ZA 5EX3A 3HYMB 3FEXA 3FUMA 2X6IA 3OXLA 3FULA 2DYRE 4BSXA 4F1PA 3DEOA 4I1MA 4BX8A 3SO8A 4FJZA 4G1TA 2A5EA 1TN6A 3B7RL 1VDYA 2XS8A 3LXUX 4EZJA 5LP0A 1OUVA 3U3WA 3PRZA 4XI0A 3K9IA 3HXFA 2LSVA 1V54E 1DCQA 4J8SA 5T3RA 4BETA 3NB2A 1U2VG 5CERB 1NA3A 2P9SG 4FU3A 4WAFA 3ZHEB 2ZGGA 3CKCA 3CVVA 5AARA 3QWVA 5FWQA 5FQ8A 3ML9A 3AU5A 4UQZA 3I4GA 4AM9A 1TNZA 3HG0D 4JA9A 3GW4A 2WXFA 3I4RB 4ANUA 4X8QA 3CK8A 4CRWA 5A7DB 3E4BA 3ENEA 4ILGA 5AJDA 4GTOA 4U07A 4W9RA 4G25A 2ZXWE 4G2VA 4K5CA 2WXLA 1A17A 2Y4UA 5FJYA 4BTAA 4JL0A 2WXKA 3MGBA 4MLPA 3RIBA 5FTPA 1UN8A 3TXNA 4ILIA 2VTBA 2F8XK 2IO3C 2J07A 1OWLA 3SBSA 2ONDA 3UX4A 3V31A 3HVEB 5ARFA 3ZYQA 1KPSB 3CHRA 1DNPA 1H0AA 3CHOA 4YVQC 3UM3A 4UI9C 1E90A 2UWJG 4TXPA 3PZ4A 2R05A 4MS6A 4Q94A 2CHZA 3AG4E 3SGHA 5JHBA 1N4PA 2MYOA 4FA6A 4GB9A 3Q75A 1LD7A 2JEKA 3EU5A 4A1GA 4YVOA 2AXZA 1YCSB 4LEUA 1MJ0A 4DJAA 4BTBA 4FJYA 3SFYA 3ZGQA 1B89A 4HBDA 5B1BE 3B7TA 1AP7A 1XGWA 4YNDA 1KT1A 3SY2A 1IQRA 2VSNA 3JQ1A 1FPPA 2P58C 4CT0A 3RK6A 4IYPA 3UM0A 3MKQA 4N3BA 1EYHA 4HQDA 2FO1E 2H6HA 4HOSA 5LCWJ 2F8YA 1HG5A 3TWXA 1YMPA 4FADA 1MHQA 4HFGA 4F1SA 1NP7A 4G11A 2WQ6A 3ZYLA 4TXRA 4GTMA 5HS0A 1BI7B 2I2OA 4GPKA 1ZBPA 5ANLA 3S7FA 3MV3B 1MX4A 3Q78A 3FEYA 4JEHA 4HNAD 1BPOA 2J09A 2XS1A 3O4ZA 3B7UX 3ULQA 1JWFA 2R17C 2IEJA 2OVFA 4PUCA 4UQYA 3FUHA 1INZA 3UINC 2C0MA 3MEKA 5T8IA 4DLQA 1N4SA 4JHRA 3N71A 3FH7A 3HIZA 4HORA 1OT8A 5JMND 5J90A 4HRMB 2FEZA 2XGSA 3L16A 4DLOA 3B7BA 2I6HA 3ASDA 2A5UA 5ENOD 2RFAA 1D9SA 2OVBA 1OWMA 2WXQA 4C0EA 2CFUA 4GYWA 4LG6A 3ASHA 3S7DA 3NZUA 3UMVA 4LSZE 3R9MA 2YHCA 4BEPA 2BKGA 4B8CB 1E96B 2WMOA 2P9LG 2KZTB 4U0SA 5BT1A 3CSTA 3RKVA 1MX2A 4BT9A 2DBAA 5LOZA 2YNQA 3ONKA 4F53A 3I3NA 3AAAC 4HLEA 1FT1A 3JXJA 4NIKA 2CHWA 3SFXA 1Z3YA 3AS5A 3ASFA 2P9UG 2QZAA 3O48A 1TN8A 3EUVA 3UPVA 4N39A 1PC2A 4KXKB 5JJ6A 3WG7E 2P9IG 1HXIA 1WAO1 1AWCB 2QYJA 3J5QB 3Q9UC 4F6RD 3UKRG 2WQHA 2E0IA 2FO7A 4EPZA 2IOLA 2ZIRA 3T9KA 1TNOA 5AENA 2FF4A 2OCCE 2IO2C 4TUUA 3GZSA 4GZCA 5A6CA 2BF0X 5LCWC 2XGMA 3L17A 3IV0A 4WWPA 1EPUA 3DEPA 4JEUA 3D9MA 3JUIA 3CQCB 2JABA 4ZHBA 3ZUVB 3VTXA 3D9OA 3FUIA 4I6EA 5CRUA 1FCHA 5AJLA 2XCCA 4WWNA 3Q4AB 3ZKJA 1RZ4A 3TJPA 2QYUA 2GRQB 4DX2A 3SZ7A 3PZ1A 4HB5A 2UY1A 3CK7A 3U9WA 2KC7A 3EIQC 4A1SA 4GA1A 5G55A 4JVSA 4F7AA 2M63A 2J8SD 4D10C 2KCKA 3PE4A 3SFZA 3RRUA 3C5RA 3EHQA 4U0ZA 5BW8C 3EHMA 4UWGA 3L13A 3B13A 3FTSA 3S2AA 1FVFA 3FTXA 3KSQA 5KNGA 3ABKE 3MX3A 5EN5D 3ML8A 4DX1A 4AEZC 5D0QD 4GMLA 2RFMA 2R02A 3HXDA 3MCXA 1IXVA 4AIFA 2DZNA 4LCTA 3PE3A 5D66A 1DCEA 4UWHA 3E30A 4RSYA 1X81A 5EYPF 3ZW3A 4UWLA 3CHPA 1IYGA 4KZ0A 4PDXA 3AU4A 2BKKB 4NRHB 2EILE 3QWWA 4TV3A 2B0OE
chains in the Genus database with same CATH topology
4L2LA 3ZPJA 4JL0A 4AVXA 2WXKA 4BTAA 3MGBA 2L6JA 4GAAA 3MZLB 4MLPA 5FQ7A 4WNFA 3RIBA 4JXTA 4FHJA 3T5XA 2OOEA 5FTPA 1UN8A 2ILRA 3KD7A 4UWFA 3TXNA 1P5QA 4ILIA 1JWGA 2VTBA 2GGFA 4ANWA 2KZTA 3QKYA 3RRMB 2J4BA 4OVVA 5A23A 3CVPA 2J07A 1OWLA 4RG6A 3RO2A 4BT8A 3SBSA 4CCAA 5M72A 3LVRE 3ZHEA 4HOTA 2KCVA 3IHYA 1OWPA 4JZYA 3CVLA 3ONLA 3CSFA 3OXGA 3QC1A 2AW6A 2IOSA 3G2SA 3FY4A 4L7TA 4ACKA 3CVWA 2MRIA 3P2BA 2ONDA 3FDHA 3UX4A 4CDNA 3QWPA 4HOUA 3KEZA 2PQNA 1KLXA 3L08A 2GW1A 3TL5A 3HVEB 5ARFA 4C9BB 3FUEA 1SQMA 1H2TC 2PQRA 3D9PA 2XRZA 2I1KA 3ZYQA 2XPZA 4ME2A 3CHRA 3RU0A 3LDZA 1DNPA 5DIZA 3ZIMA 2WXGA 4H7XA 1H0AA 3CHOA 4YVQC 3PH0C 3CVUA 3FTVA 5E75A 2L0TB 3BG1B 1JPLA 4UI9C 3L54A 3PS6A 5KJMA 4ILHB 1E90A 2IU1A 2UWJG 1PAQA 3QJZA 2JLBA 2XGOA 3ESKA 2J9QA 4Y6WA 1TEZA 4IULA 1NZNA 4MS6A 4GZDA 2X38A 4JPSA 3I5PA 2WXJA 4Q94A 3CLJA 4R7LA 2CHZA 3L6AA 4BY6A 4QFVA 2C2LA 3PUJA 3EDTB 2NC9A 5FZRA 4B94A 4ANXA 2CHXA 2IJGX 3UT7A 3SGHA 3SNXA 5JHBA 4WWOA 5DBKA 3R7RA 3HHMA 3C98A 5CMYA 4FA6A 1HH8A 1ELKA 4GB9A 3LY9A 2V8SE 4XKBA 2JEKA 4A1GA 4WUYA 3CVQA 2AXZA 4YVOA 3FWVA 2RD0A 4JHKA 4CEMA 2NSZA 4LEUA 3D9LA 2LO6A 4PS7A 3NF1A 3JCKC 2VSXE 4GA0A 4FJYA 4L2YA 4BTBA 4DJAA 2VGYA 4N3CA 3UT4A 3ZGQA 1B89A 3TGOA 2AWIA 4HVBA 2FI7A 2XPIA 4GU5A 2X3MA 4TRQA 4LRZA 3B7TA 1E7VA 2HR2A 1XGWA 4FHKA 3ZVVA 3ZFWA 4KT6B 4YNDA 1KT1A 3LS8A 4A3VA 1W3BA 1IQRA 2VSNA 4GCNA 3JQ1A 3Q47B 3G2TA 4PH4B 2P58C 4CT0A 4OVUA 3HDXA 4IYPA 3RK6A 3PNLB 1HFAA 3MKQA 4WNEA 2FBNA 3WXXA 4N3BA 1EYHA 3HVEA 5LCWJ 4HOSA 2BTDA 3CK9A 4J6IA 4GZ5A 2PM6A 1H2VC 3CVYA 1HG5A 4ACLA 2LAHA 4FADA 4AP2A 5AIJA 2VQ2A 3D9NA 3LPZA 3PEVB 1MHQA 3FUFA 4HS2A 4KZCA 4HFGA 2WXRA 2PM7A 3GYZA 5LX8A 3JQ0A 2V4LA 3SI5A 4F1SA 2UY1B 5ENNA 5EDSA 1NP7A 2LNIA 3JYSA 3AS8A 4G11A 2WQ6A 4G26A 2Q7FA 3ZYLA 4Q69A 2WVIA 3D9JA 4CT4A 1NA0A 3CHQA 4KYOB 3S7JA 3TXMA 2NXPA 4JA7A 5C1DA 3L22A 5T4YA 3SD5A 5KJKA 1H6KA 2I2OA 4GPKA 2E2EA 3LJ3A 4AOFA 4EZLA 4B0ZA 1ZBPA 4E6HA 3QOUA 5ANLA 3BG0B 3S7FA 3CR3A 3MV3B 4AV7A 4L1BA 4K0RA 3G2WA 1E8YA 3QK0A 4UWKA 1JUQA 3FEYA 4P29A 1X5BA 4UI9K 3TG5A 2DCPA 4JEHA 4BFRA 3Q5MA 4GA2A 5CMWA 1N52A 2J08A 1H19A 1Z6TA 3FTUA 3CVXA 5G04C 1SZ9A 1BPOA 2J4DA 4BWRA 4DI4A 3PNTB 2J09A 3DPDA 5AYWD 3FU3A 4I6JA 5G2NA 2VSOE 3O4ZA 3B7UX 4NQ0A 1UN9A 1JWFA 3ULQA 2R17C 2R5SA 2OVFA 2DIWA 4PUCA 4UQYA 3FUHA 3LYAA 3VLFA 1INZA 2J49A 2XCBA 2C0MA 3PREA 4KBQA 4O6FA 5J08A 3MEKA 4AY6A 5T8IA 4DLQA 4KMOA 1H2UA 4JHRA 4XKCA 4DK5A 2X6KA 3FH7A 2LAIA 2CG2A 2Y3AA 2XPYA 3N71A 3BEEA 3Q49B 5EKQD 3U4TA 3DBSA 4A55A 1U3DA 3HIZA 5BPPA 4HORA 3CHMA 3MJWA 1UW4B 3FFLA 3TG4A 5J90A 2WB2A 1EF1C 4JHJA 3LCAA 3CV0A 2FEZA 2XGSA 3L16A 3APFA 2WXNA 4N2SA 4U04A 3LVQE 4DLOA 4APOA 4I1AA 2I6HA 3ASDA 1E8XA 4J8DA 2A5UA 4URKA 2ZU6B 4GZ6A 2IFUA 3B7SA 3CGHA 3FH5A 3IKOB 2OVBA 3CIAA 1OWMA 4N5CA 2WXQA 4C0EA 3SBTB 2YHEA 3APCA 1DVPA 1U3CA 2L0IA 2CFUA 4FLHA 2A4ZA 3S7BA 4GYWA 5LFAA 1UJKA 2L9BA 4ABNA 5EX0A 4J8FA 3ASHA 4DPRA 5HI7A 5G05J 3S7DA 2XHEA 3GZ2A 3NZUA 3UMVA 3LY8A 1UG3A 2VJ8A 4I2WA 4B89A 3EIJA 2YHCA 3KAEA 4CDRA 2PZIA 3FU5A 2CG3A 3FTYA 2GRMA 3RRNB 4EZKA 4NURA 3UQ3A 5ANRA 4L23A 1HS6A 2AVPA 4GCOA 2GRLA 3ZXSA 1UJJA 2C0LA 4B8CB 1E96B 2LSUA 2WMOA 3QARA 1HE8A 2WXIA 4MRUA 2X6FA 4XI9A 2HYZA 3CVNA 3T8MA 4DI3A 2KZTB 2KCLA 4GYYA 4A3TA 1OWOA 3P1UA 4HOQA 3FTZA 4U0SA 3TAXA 3VLEA 4CGVA 5BT1A 1GW6A 3CSTA 1XNFA 4J0UA 1HF8A 5E76A 5KCMA 3RKVA 2IONA 2R59A 2XEVA 3ZRHA 3CKBA 4LUNU 3VLDA 5CCMA 3U66A 2CFZA 3URZA 2XRYA 3FP3A 2X6JA 4BT9A 2WXHA 2DBAA 3FUKA 3NZSA 5LOZA 4EBAA 2YNQA 2V0PA 4FULA 1LF8A 4I43A 4I1OB 2I1JA 2VGXB 3ONKA 2EQXA 4F53A 3IHVA 3I3NA 1IHGA 4HLEA 1S0PA 3PVLA 4IN3B 3AS4A 3MA5A 4JW1A 1ELRA 2WXPA 4KVMA 2CHWA 3FUDA 5CCLA 1MQSA 1Z3XA 1Z3YA 4I17A 3AS5A 3ASFA 4GYOA 4I2ZA 3G2VA 1SZAA 2KM4A 2WXOA 3MKRA 3O48A 3FUJA 4N3AA 4PS8A 1FVHA 5G04J 3UPVA 3APDA 3QDNA 3ZN3A 2RG8A 4N39A 3ZEFA 4MKTA 1PC2A 4K03A 4KXKB 5JJ6A 2AXUA 3LKUA 1WY6A 4OYSA 2QFCA 4G24A 4CDMA 4U0UA 1HXIA 3ESLA 3EHNA 3R7QA 1WAO1 2OV8A 3EJNA 4AJWA 4E85A 3FH8A 3FU0A 3IEGA 4XE0A 2WQHA 2E0IA 3FUNA 4KVOA 2FO7A 1HU3A 4EPZA 2IOLA 2IQCA 3IBEA 3VTYA 1IQUA 4Y6CA 3GZ1A 2BUGA 4UQXA 3OXFA 5AENA 5BUZA 3QAQA 2FF4A 4AY5A 4TUUA 2V5FA 2YQ8A 4UI9J 3GZSA 4GZCA 3OAWA 5A6CA 1E7UA 2BF0X 4V3IA 4XZ4A 5LCWC 3PDNA 5FT9A 3G2UA 3T5VA 5KJNA 5FZQA 4N2QA 1KT0A 4I9EA 2XGMA 3LY7A 3D9IA 3L17A 3IV0A 3MV2B 3MYVA 2MHKA 1QQEA 2QY7A 2WPVA 5JJTA 2KATA 4I6GA 2YINA 4Q96A 4WWPA 1EPUA 2PL2A 3CQGB 3R9AB 4FLBA 4GZ3A 4JEUA 3D9MA 3JUIA 3QNKA 2HO1A 3CQCB 1E8ZA 5EX3A 5KJLA 3CHSA 3HYMB 3VTXA 3FEXA 3D9OA 3FUIA 4I6EA 3FUMA 4PS3A 1OWNA 3FHEA 4EQFA 2X6IA 1FCHA 3LEWA 3OXLA 5AJLA 2XCCA 3MKQB 4WWNA 3FULA 4C0MA 3SHFA 2VGXA 4BSXA 4FP7A 1TJCA 4I1MA 3Q4AB 1YA0A 1HG2A 3TJPA 4HXIA 4BX8A 3SZ7A 2AXVA 2IF4A 5ARGA 4FJZA 4RG9A 2UY1A 5BNWA 3CK7A 4G1TA 3U9WA 2KC7A 3ZYKA 3EIQC 4A1SA 1PY1A 3B7RL 4GA1A 3FTWA 1E8WA 2FULA 5G55A 4JVSA 3NQPA 5CHEE 1VDYA 2XQ0A 4WNDA 3U64A 4F7AA 2M63A 3Q15A 5FQ6A 3LXUX 4EZJA 5LP0A 4D10C 1OUVA 2KCKA 3PE4A 3PRZA 3SFZA 3RRUA 4ATGA 3U3WA 4XI0A 3K9IA 5FQ4A 5C2YA 2LSVA 4U8HA 3D3MA 5BW8C 4U0ZA 3EHMA 1ELWA 2HM8A 4J8SA 4UWGA 1ZU2A 5T3RA 3L13A 1TJFA 3QB2A 3PZDA 3B13A 1Y6IA 4M3OA 2VTBB 4XX5A 4J8EA 3FTSA 2X6HA 3S2AA 4GMJA 1NA3A 5D0OD 1N54A 3PEUB 1FVFA 3FTXA 3OTNA 4ANVA 4FU3A 4WAFA 3ZHEB 4APFA 5BV1A 3MX3A 3ML8A 4U63A 3CKCA 4RVBA 3CVVA 3D9KA 3QWVA 4GMLA 5D0QD 3PUKA 5FWQA 4AEZC 5FQ8A 4NACA 3ML9A 3MCXA 1WM5A 2I9CA 3AU5A 3FU6A 4H7YA 2Y4TA 3RO3A 4LERA 4AIFA 4UQZA 1HO8A 4IRUA 4B8AA 3I4GA 4AM9A 2WQ7A 5BV0A 4JC8A 3UUXA 3UT8A 4LCTA 1HX8A 5G05C 4F3VA 4JA9A 3PE3A 3ASGA 1L5JA 3GW4A 4CGWA 2WXFA 3I4RB 2VYIA 2MOWA 1QZ2A 4ANUA 4EECA 4G23A 4WNGA 4UWHA 5JJ7A 4EBAG 3CK8A 5HQ8A 1EDUA 4CRWA 3SF4A 5A7DB 4RSYA 3E4BA 3ENEA 3KS2A 3ZYMA 4ILGA 5AJDA 5FZSA 5JHAA 3ZW3A 4U07A 1HZ4A 3CHPA 4UWLA 2WMNA 3CEQA 4G25A 4W9RA 1IYGA 4KZ0A 4PDXA 4G2VA 3AU4A 4I9CA 2VSYA 3RJVA 4AXHA 2WXLA 1A17A 2WM9A 4FC8A 3QWWA 4NRHB 4TV3A 1QNFA 4BX9A 2WXMA 2Y4UA 1Y8MA 5FJYA 4XIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6H A;  4E85 A;  4KVM A;  3PH0 C;  4KVO A;  4EBA A; 
#chains in the Genus database with same CATH topology
 4AVX A;  1FT2 A;  2NYJ A;  3UIO C;  4GTT A;  5ENT D;  3T5X A;  2OOE A;  2ILR A;  3UM2 A;  4UWF A;  1BI8 B;  4ANW A;  3QKY A;  4OVV A;  3CVP A;  4RG6 A;  3RO2 A;  5M72 A;  3ZHE A;  1OWP A;  3ONL A;  3OXG A;  2AW6 A;  2IOS A;  2MRI A;  3P2B A;  2BED A;  3FDH A;  4CDN A;  5ENS D;  4HOU A;  2IY0 C;  2PQN A;  1KLX A;  3TL5 A;  5BXU A;  2XRZ A;  2I1K A;  4GTQ A;  3PH0 C;  5E75 A;  3PS6 A;  2Y69 E;  1PAQ A;  2XGO A;  3TWW A;  1NZN A;  2WXJ A;  3UM1 A;  3CLJ A;  2NC9 A;  4G8L A;  5FZR A;  4ANX A;  2IJG X;  1TNY A;  5ENQ D;  5DBK A;  3HHM A;  5CMY A;  3E32 A;  1ELK A;  1JCQ A;  2V8S E;  3CVQ A;  2LO6 A;  3NF1 A;  3EHR A;  4L2Y A;  5CRV A;  5ENR D;  3UT4 A;  2AWI A;  4HVB A;  4GU5 A;  2X3M A;  3DPY A;  1E7V A;  2PNN A;  3LS8 A;  3DSW A;  3NAW A;  1W3B A;  4DUI A;  3Q47 B;  3G2T A;  3PNL B;  1HFA A;  2HE0 A;  3UXG A;  3HVE A;  2BTD A;  4GZ5 A;  1OCO E;  3C3Q A;  1OCC E;  4HS2 A;  4KZC A;  2WXR A;  1D8D A;  3SI5 A;  1Q2Z A;  5EDS A;  2LNI A;  3JYS A;  4G26 A;  1A5E A;  1SA5 A;  3W9F A;  4CT4 A;  4JA7 A;  5KJK A;  1H6K A;  1OCR E;  2E2E A;  3LJ3 A;  4J8Y A;  4E6H A;  3QOU A;  4EHM A;  2DYS E;  4L1B A;  3G2W A;  4UWK A;  2DCP A;  3Q5M A;  1H19 A;  1Z6T A;  3NBN B;  5G04 C;  1V55 E;  4BWR A;  1WDY A;  4I6J A;  5G2N A;  1UN9 A;  2R5S A;  2J49 A;  3PRE A;  5J08 A;  4AY6 A;  1KZP A;  2DWZ A;  3B95 A;  1H2U A;  4DK5 A;  3C3O A;  4XKC A;  2X6K A;  1ZB1 A;  4TXQ A;  2Y3A A;  3C72 A;  4A55 A;  2GRO B;  1U3D A;  5AN8 A;  3Q79 A;  3FFL A;  5EYL A;  5EIB E;  3LCA A;  3CV0 A;  2WXN A;  4N2S A;  3NOG D;  1E8X A;  4J8D A;  3CGH A;  3FH5 A;  2YHE A;  1DVP A;  2L0I A;  1UOH A;  4ABN A;  2H6I A;  3HXB A;  3LY8 A;  2VJ8 A;  3AG1 E;  2CG3 A;  3ASN E;  3RRN B;  5ANR A;  3TWV A;  3ZXS A;  1UJJ A;  1MX6 A;  2XEE A;  4MRU A;  4DI3 A;  3DSS A;  4A3T A;  5CED B;  1OWO A;  3P1U A;  4HOQ A;  3FTZ A;  3VLE A;  4CGV A;  5FIO A;  1HF8 A;  3W9G A;  2ION A;  2XEV A;  3ZRH A;  3U66 A;  2CFZ A;  2XRY A;  3FP3 A;  2AJA A;  3FUK A;  3NZS A;  3HXC A;  1LF8 A;  2I1J A;  2VGX B;  2EQX A;  3DXM G;  1K8K G;  3AS4 A;  4JW1 A;  3FUD A;  1Z3X A;  5HRY A;  3G2V A;  1TNB A;  3MKR A;  3FUJ A;  4N3A A;  1SA4 A;  2RG8 A;  1WY6 A;  4HRL A;  3ESL A;  3DSU A;  3EHN A;  3R7Q A;  1JCR A;  3FH8 A;  3FU0 A;  1O5M A;  4XE0 A;  1HU3 A;  2IQC A;  3IBE A;  3VTY A;  1IQU A;  3DXK G;  2V5F A;  4C48 B;  3OAW A;  4V3I A;  4XZ4 A;  4N5Q A;  5CEC B;  4I9E A;  2H6F A;  2R03 A;  3MYV A;  3X2Q E;  2QY7 A;  5JJT A;  2YIN A;  4U95 D;  3CQG B;  3E34 A;  4CZ2 D;  4FLB A;  4ATZ D;  5KJL A;  2EIK E;  3CHS A;  5JA4 D;  4HI9 A;  4PS3 A;  1OWN A;  5KNH D;  4EQF A;  3LEW A;  3MKQ B;  4C0M A;  2RKK A;  4O1P A;  3DWL G;  3SHF A;  3UKU G;  1YA0 A;  1HG2 A;  4HXI A;  2IF4 A;  1K1A A;  3J5P A;  5FIN A;  1PY1 A;  3BUA A;  3FTW A;  2FUL A;  5CHE E;  2XQ0 A;  3U64 A;  1SW6 A;  5FQ6 A;  3V30 A;  2OEV A;  5FQ4 A;  5C2Y A;  3RSE G;  1OY3 D;  2XZD G;  3L82 A;  1ZU2 A;  1TJF A;  3V79 K;  3PZD A;  4HRN A;  1Y6I A;  4M3O A;  4J8E A;  2P9P G;  4GMJ A;  4OAU C;  3PEU B;  3OTN A;  2LUH A;  4ANV A;  1KZO A;  4APF A;  3DST A;  5BV1 A;  4RVB A;  1D8E A;  3D9K A;  3V2O A;  2XZT G;  1Z5S C;  1WM5 A;  2I9C A;  3FU6 A;  3C3R A;  2Y1L E;  2Y4T A;  1HO8 A;  1G3N B;  5BV0 A;  3UUX A;  3AJI A;  1OXJ A;  1HX8 A;  4F3V A;  4TUM A;  1YYH A;  1L5J A;  4CGW A;  2VYI A;  4LNB A;  1QZ2 A;  4G23 A;  1N9A A;  4U96 D;  1EDU A;  5EIL A;  3JUE A;  3KS2 A;  3ZYM A;  1BU9 A;  5JHA A;  3ZU7 B;  2WMN A;  3CEQ A;  4I9C A;  2VSY A;  3RJV A;  3SQV A;  2WXM A;  1N11 A;  1TR4 A;  2L6J A;  3MZL B;  4WNF A;  4JXT A;  3F6Q A;  4FHJ A;  2OEW A;  3KD7 A;  1P5Q A;  2B6C A;  1JWG A;  2KXP C;  4QQI A;  3RRM B;  2J4B A;  4JB8 P;  4BT8 A;  2VGE A;  2ETA A;  4JZY A;  3CVL A;  3QC1 A;  3BU8 A;  3CSF A;  4ACK A;  4L7T A;  2R2L A;  5ITZ F;  4C9B B;  1SQM A;  2PQR A;  3LDZ A;  5DIZ A;  4K5A B;  3FTV A;  2L0T B;  3BG1 B;  1JPL A;  3L54 A;  4ILH B;  2ZGD A;  2GRP B;  3QJZ A;  1NI1 A;  3ESK A;  1TEZ A;  4GZD A;  4JPS A;  3I5P A;  3KSL A;  4R7L A;  4QFV A;  3EU9 A;  3KEA A;  2F0Y A;  4M7C A;  3C98 A;  4WUY A;  5BXO A;  2GRR B;  4JHK A;  4CEM A;  4PS7 A;  4JD2 G;  4GA0 A;  2VGY A;  2FI7 A;  3LJN A;  4TRQ A;  2HR2 A;  4KT6 B;  4A3V A;  4GCN A;  4PH4 B;  1K1B A;  4OVU A;  3HDX A;  2FBN A;  3WXX A;  4J6I A;  3CVY A;  4ACL A;  2LAH A;  4AP2 A;  5AIJ A;  1IKN D;  3D9N A;  3PEV B;  3HXE A;  1BLX B;  2PM7 A;  3JQ0 A;  2V4L A;  2GRN B;  2UY1 B;  3DSV A;  2P2C P;  2Q7F A;  4Q69 A;  3ZXP A;  3D9J A;  2EIN E;  1NA0 A;  4KYO B;  1N0R A;  3S7J A;  3TXM A;  3UTM A;  2NXP A;  3L22 A;  3SD5 A;  4AOF A;  4B0Z A;  3ASO E;  3CR3 A;  2V4H C;  4K0R A;  1E8Y A;  3QK0 A;  4P29 A;  4GA2 A;  5CMW A;  1N52 A;  1H6O A;  3FTU A;  4DI4 A;  3PNT B;  2VSO E;  1MZC A;  4GTV A;  2DIW A;  3LYA A;  4KBQ A;  3JXI A;  4KMO A;  2LAI A;  3Q49 B;  3BEE A;  5EKQ D;  3U4T A;  3CHM A;  2WB2 A;  3Q7F A;  2ZIS A;  4DRX E;  1EF1 C;  3APF A;  4K5B A;  4APO A;  2ETC A;  3D9H A;  4GTS A;  4GZ6 A;  2IFU A;  3B7S A;  1TYQ G;  3SBT B;  3APC A;  4RQI A;  5LFA A;  2H6G A;  2L9B A;  1JCS A;  1TN7 A;  4DPR A;  1O1T A;  2ETB A;  5G05 J;  2XHE A;  3GZ2 A;  5AQ9 A;  4I2W A;  1UG3 A;  4MBG A;  3EIJ A;  3KAE A;  2GRM A;  2DZO A;  4NUR A;  1HS6 A;  2AVP A;  3QAR A;  2X6F A;  4GYY A;  4J7W A;  1GW6 A;  1XNF A;  4A63 B;  2R59 A;  4BES A;  5KWD A;  2KBX A;  4I43 A;  4I1O B;  3IHV A;  3E33 A;  1IHG A;  1S0P A;  1ELR A;  2WXP A;  5CCL A;  1MQS A;  4I17 A;  4GYO A;  2KM4 A;  2WXO A;  5IY5 E;  3APD A;  3ZN3 A;  3ZEF A;  4K03 A;  3LKU A;  4OYS A;  4CDM A;  4G24 A;  3TWU A;  3FUN A;  1LTX A;  2XEN A;  3GZ1 A;  4UQX A;  5BUZ A;  3QAQ A;  2YQ8 A;  4U8V D;  3ZNG A;  5FZQ A;  1KT0 A;  3LY7 A;  3D9I A;  3MV2 B;  1QQE A;  2WPV A;  2KAT A;  4Q96 A;  2PL2 A;  4U7E B;  4GZ3 A;  3QNK A;  3AG2 E;  3FHE A;  5D2M C;  2VGX A;  4FP7 A;  1TJC A;  2AXV A;  5ARG A;  4RG9 A;  5BNW A;  3ZYK A;  4O60 A;  1E8W A;  3NQP A;  4O1O A;  4WND A;  3Q15 A;  5AQB A;  4LNU D;  4ATG A;  4U8H A;  3D3M A;  5H7P A;  1ELW A;  2HM8 A;  1N94 A;  3QB2 A;  2VTB B;  4XX5 A;  2X6H A;  5D0O D;  1N54 A;  4GTR A;  4OAV B;  3PZ2 A;  4U63 A;  4GTP A;  3PUK A;  4NAC A;  4H7Y A;  3RO3 A;  4LER A;  4IRU A;  4B8A A;  2WQ7 A;  4JC8 A;  3UT8 A;  1S64 A;  5G05 C;  3TWT A;  5AAO A;  3ASG A;  2MOW A;  4EEC A;  4WNG A;  5JJ7 A;  2L6B A;  4EBA G;  5HQ8 A;  3SF4 A;  1N4R A;  4HLL A;  5FZS A;  1HZ4 A;  3UIP C;  4UUC A;  5EID A;  4AXH A;  2WM9 A;  4FC8 A;  1QNF A;  4BX9 A;  4DX7 D;  1QBQ A;  1Y8M A;  4XIF A;  3PZ3 A;  3DSX A;  4L2L A;  1RW2 A;  3ZPJ A;  5KBA A;  4GAA A;  5FQ7 A;  2GGF A;  2EIM E;  2KZT A;  5A23 A;  4CCA A;  3LVR E;  4HOT A;  2KCV A;  3IHY A;  3V2X A;  3ISM C;  3FY4 A;  3G2S A;  3CVW A;  1O1S A;  3DRA A;  2XEH A;  3QWP A;  3KEZ A;  3L08 A;  2GW1 A;  3FUE A;  1H2T C;  3D9P A;  2LXL A;  2XPZ A;  4ME2 A;  3RU0 A;  3ZIM A;  2WXG A;  4H7X A;  4YDW A;  3CVU A;  5KJM A;  4B93 B;  4CYM D;  2IU1 A;  2JLB A;  4Y6W A;  2J9Q A;  1S63 A;  3NOC D;  4IUL A;  2X38 A;  3RAU A;  1LD8 A;  3L6A A;  4BY6 A;  2C2L A;  3PUJ A;  3EDT B;  4BER A;  4B94 A;  2CHX A;  3ULY A;  3UT7 A;  3SNX A;  4WWO A;  3UI2 A;  1N4Q A;  5B1A E;  5AQA A;  3R7R A;  1HH8 A;  4DX6 D;  3LY9 A;  4XKB A;  3FWV A;  2RD0 A;  4ZFH A;  2V5Q C;  4YDO A;  2NSZ A;  3D9L A;  3JCK C;  2VSX E;  4N3C A;  3TGO A;  2P9K G;  2XPI A;  4LRZ A;  1O1R A;  4FHK A;  3ZVV A;  3ZFW A;  4Z68 A;  4WNE A;  3CK9 A;  2PM6 A;  1H2V C;  1NFI E;  4BSZ B;  2VQ2 A;  3LPZ A;  3FUF A;  3AG3 E;  5LX8 A;  3GYZ A;  5ENN A;  3AS8 A;  3ABM E;  2WVI A;  3CHQ A;  5C1D A;  5T4Y A;  4GMR A;  3Q9N C;  5CBO A;  4RLY A;  4EZL A;  4HI8 A;  1QYM A;  3BG0 B;  1H6P A;  4AV7 A;  1JUQ A;  1X5B A;  4UI9 K;  3TG5 A;  1TNU A;  4BFR A;  2J08 A;  3CVX A;  1SZ9 A;  2J4D A;  5AYW D;  3DPD A;  3L9T A;  3FU3 A;  4U8Y D;  4LNG A;  1OCZ E;  3T8K A;  4NQ0 A;  4G8K A;  1BD8 A;  3VLF A;  2P9N G;  2XCB A;  4O6F A;  5CEA A;  2CG2 A;  2XPY A;  5CBN A;  5BPP A;  3DBS A;  3MJW A;  1UW4 B;  3TG4 A;  4L9P A;  4JHJ A;  4XEI G;  1S70 B;  2QC9 A;  3LVQ E;  4U04 A;  4I1A A;  3TWR A;  4URK A;  2ZU6 B;  3IKO B;  1N0Q A;  3CIA A;  4N5C A;  3E37 A;  1U3C A;  3S7B A;  4FLH A;  2A4Z A;  1IHB A;  1DC2 A;  1UJK A;  5EX0 A;  4J8F A;  5HI7 A;  5ENP D;  4B89 A;  1N95 A;  4CDR A;  2PZI A;  3Q7A A;  3FU5 A;  3FTY A;  4EZK A;  3UQ3 A;  4L23 A;  4GCO A;  2GRL A;  4DX5 D;  2C0L A;  2LSU A;  1HE8 A;  2WXI A;  4XI9 A;  2F37 A;  2HYZ A;  3CVN A;  3T8M A;  2KCL A;  3IXE A;  3TAX A;  4J0U A;  3TWQ A;  5E76 A;  3BQO A;  5KCM A;  2DVW A;  2EIJ E;  3CKB A;  4LUN U;  3VLD A;  5CCM A;  3URZ A;  2X6J A;  2WXH A;  1SVX A;  4EBA A;  2V0P A;  4FUL A;  3ULE G;  3PVL A;  4IN3 B;  3Q73 A;  3MA5 A;  4KVM A;  3ABL E;  4I2Z A;  4YDY A;  1SZA A;  4PS8 A;  1FVH A;  5HKP A;  5G04 J;  3QDN A;  4MKT A;  2AXU A;  1WG0 A;  2QFC A;  4U0U A;  2OV8 A;  3EJN A;  4AJW A;  4E85 A;  3IEG A;  1MYO A;  4KVO A;  3TWS A;  2Y0B G;  5AQ7 A;  4Y6C A;  2BUG A;  1K3Z D;  3OXF A;  4AY5 A;  4UI9 J;  1E7U A;  3PDN A;  1NL4 A;  3G2U A;  4YDE A;  5FT9 A;  5B3S E;  5KJN A;  3T5V A;  4N2Q A;  3HRA A;  2MHK A;  4I6G A;  2LXM A;  3R9A B;  4GPM A;  2HO1 A;  1E8Z A;  5EX3 A;  3HYM B;  3FEX A;  3FUM A;  2X6I A;  3OXL A;  3FUL A;  2DYR E;  4BSX A;  4F1P A;  3DEO A;  4I1M A;  4BX8 A;  3SO8 A;  4FJZ A;  4G1T A;  2A5E A;  1TN6 A;  3B7R L;  1VDY A;  2XS8 A;  3LXU X;  4EZJ A;  5LP0 A;  1OUV A;  3U3W A;  3PRZ A;  4XI0 A;  3K9I A;  3HXF A;  2LSV A;  1V54 E;  1DCQ A;  4J8S A;  5T3R A;  4BET A;  3NB2 A;  1U2V G;  5CER B;  1NA3 A;  2P9S G;  4FU3 A;  4WAF A;  3ZHE B;  2ZGG A;  3CKC A;  3CVV A;  5AAR A;  3QWV A;  5FWQ A;  5FQ8 A;  3ML9 A;  3AU5 A;  4UQZ A;  3I4G A;  4AM9 A;  1TNZ A;  3HG0 D;  4JA9 A;  3GW4 A;  2WXF A;  3I4R B;  4ANU A;  4X8Q A;  3CK8 A;  4CRW A;  5A7D B;  3E4B A;  3ENE A;  4ILG A;  5AJD A;  4GTO A;  4U07 A;  4W9R A;  4G25 A;  2ZXW E;  4G2V A;  4K5C A;  2WXL A;  1A17 A;  2Y4U A;  5FJY A;  4BTA A;  4JL0 A;  2WXK A;  3MGB A;  4MLP A;  3RIB A;  5FTP A;  1UN8 A;  3TXN A;  4ILI A;  2VTB A;  2F8X K;  2IO3 C;  2J07 A;  1OWL A;  3SBS A;  2OND A;  3UX4 A;  3V31 A;  3HVE B;  5ARF A;  3ZYQ A;  1KPS B;  3CHR A;  1DNP A;  1H0A A;  3CHO A;  4YVQ C;  3UM3 A;  4UI9 C;  1E90 A;  2UWJ G;  4TXP A;  3PZ4 A;  2R05 A;  4MS6 A;  4Q94 A;  2CHZ A;  3AG4 E;  3SGH A;  5JHB A;  1N4P A;  2MYO A;  4FA6 A;  4GB9 A;  3Q75 A;  1LD7 A;  2JEK A;  3EU5 A;  4A1G A;  4YVO A;  2AXZ A;  1YCS B;  4LEU A;  1MJ0 A;  4DJA A;  4BTB A;  4FJY A;  3SFY A;  3ZGQ A;  1B89 A;  4HBD A;  5B1B E;  3B7T A;  1AP7 A;  1XGW A;  4YND A;  1KT1 A;  3SY2 A;  1IQR A;  2VSN A;  3JQ1 A;  1FPP A;  2P58 C;  4CT0 A;  3RK6 A;  4IYP A;  3UM0 A;  3MKQ A;  4N3B A;  1EYH A;  4HQD A;  2FO1 E;  2H6H A;  4HOS A;  5LCW J;  2F8Y A;  1HG5 A;  3TWX A;  1YMP A;  4FAD A;  1MHQ A;  4HFG A;  4F1S A;  1NP7 A;  4G11 A;  2WQ6 A;  3ZYL A;  4TXR A;  4GTM A;  5HS0 A;  1BI7 B;  2I2O A;  4GPK A;  1ZBP A;  5ANL A;  3S7F A;  3MV3 B;  1MX4 A;  3Q78 A;  3FEY A;  4JEH A;  4HNA D;  1BPO A;  2J09 A;  2XS1 A;  3O4Z A;  3B7U X;  3ULQ A;  1JWF A;  2R17 C;  2IEJ A;  2OVF A;  4PUC A;  4UQY A;  3FUH A;  1INZ A;  3UIN C;  2C0M A;  3MEK A;  5T8I A;  4DLQ A;  1N4S A;  4JHR A;  3N71 A;  3FH7 A;  3HIZ A;  4HOR A;  1OT8 A;  5JMN D;  5J90 A;  4HRM B;  2FEZ A;  2XGS A;  3L16 A;  4DLO A;  3B7B A;  2I6H A;  3ASD A;  2A5U A;  5ENO D;  2RFA A;  1D9S A;  2OVB A;  1OWM A;  2WXQ A;  4C0E A;  2CFU A;  4GYW A;  4LG6 A;  3ASH A;  3S7D A;  3NZU A;  3UMV A;  4LSZ E;  3R9M A;  2YHC A;  4BEP A;  2BKG A;  4B8C B;  1E96 B;  2WMO A;  2P9L G;  2KZT B;  4U0S A;  5BT1 A;  3CST A;  3RKV A;  1MX2 A;  4BT9 A;  2DBA A;  5LOZ A;  2YNQ A;  3ONK A;  4F53 A;  3I3N A;  3AAA C;  4HLE A;  1FT1 A;  3JXJ A;  4NIK A;  2CHW A;  3SFX A;  1Z3Y A;  3AS5 A;  3ASF A;  2P9U G;  2QZA A;  3O48 A;  1TN8 A;  3EUV A;  3UPV A;  4N39 A;  1PC2 A;  4KXK B;  5JJ6 A;  3WG7 E;  2P9I G;  1HXI A;  1WAO 1;  1AWC B;  2QYJ A;  3J5Q B;  3Q9U C;  4F6R D;  3UKR G;  2WQH A;  2E0I A;  2FO7 A;  4EPZ A;  2IOL A;  2ZIR A;  3T9K A;  1TNO A;  5AEN A;  2FF4 A;  2OCC E;  2IO2 C;  4TUU A;  3GZS A;  4GZC A;  5A6C A;  2BF0 X;  5LCW C;  2XGM A;  3L17 A;  3IV0 A;  4WWP A;  1EPU A;  3DEP A;  4JEU A;  3D9M A;  3JUI A;  3CQC B;  2JAB A;  4ZHB A;  3ZUV B;  3VTX A;  3D9O A;  3FUI A;  4I6E A;  5CRU A;  1FCH A;  5AJL A;  2XCC A;  4WWN A;  3Q4A B;  3ZKJ A;  1RZ4 A;  3TJP A;  2QYU A;  2GRQ B;  4DX2 A;  3SZ7 A;  3PZ1 A;  4HB5 A;  2UY1 A;  3CK7 A;  3U9W A;  2KC7 A;  3EIQ C;  4A1S A;  4GA1 A;  5G55 A;  4JVS A;  4F7A A;  2M63 A;  2J8S D;  4D10 C;  2KCK A;  3PE4 A;  3SFZ A;  3RRU A;  3C5R A;  3EHQ A;  4U0Z A;  5BW8 C;  3EHM A;  4UWG A;  3L13 A;  3B13 A;  3FTS A;  3S2A A;  1FVF A;  3FTX A;  3KSQ A;  5KNG A;  3ABK E;  3MX3 A;  5EN5 D;  3ML8 A;  4DX1 A;  4AEZ C;  5D0Q D;  4GML A;  2RFM A;  2R02 A;  3HXD A;  3MCX A;  1IXV A;  4AIF A;  2DZN A;  4LCT A;  3PE3 A;  5D66 A;  1DCE A;  4UWH A;  3E30 A;  4RSY A;  1X81 A;  5EYP F;  3ZW3 A;  4UWL A;  3CHP A;  1IYG A;  4KZ0 A;  4PDX A;  3AU4 A;  2BKK B;  4NRH B;  2EIL E;  3QWW A;  4TV3 A;  2B0O E; 
#chains in the Genus database with same CATH homology
 4L2L A;  3ZPJ A;  4JL0 A;  4AVX A;  2WXK A;  4BTA A;  3MGB A;  2L6J A;  4GAA A;  3MZL B;  4MLP A;  5FQ7 A;  4WNF A;  3RIB A;  4JXT A;  4FHJ A;  3T5X A;  2OOE A;  5FTP A;  1UN8 A;  2ILR A;  3KD7 A;  4UWF A;  3TXN A;  1P5Q A;  4ILI A;  1JWG A;  2VTB A;  2GGF A;  4ANW A;  2KZT A;  3QKY A;  3RRM B;  2J4B A;  4OVV A;  5A23 A;  3CVP A;  2J07 A;  1OWL A;  4RG6 A;  3RO2 A;  4BT8 A;  3SBS A;  4CCA A;  5M72 A;  3LVR E;  3ZHE A;  4HOT A;  2KCV A;  3IHY A;  1OWP A;  4JZY A;  3CVL A;  3ONL A;  3CSF A;  3OXG A;  3QC1 A;  2AW6 A;  2IOS A;  3G2S A;  3FY4 A;  4L7T A;  4ACK A;  3CVW A;  2MRI A;  3P2B A;  2OND A;  3FDH A;  3UX4 A;  4CDN A;  3QWP A;  4HOU A;  3KEZ A;  2PQN A;  1KLX A;  3L08 A;  2GW1 A;  3TL5 A;  3HVE B;  5ARF A;  4C9B B;  3FUE A;  1SQM A;  1H2T C;  2PQR A;  3D9P A;  2XRZ A;  2I1K A;  3ZYQ A;  2XPZ A;  4ME2 A;  3CHR A;  3RU0 A;  3LDZ A;  1DNP A;  5DIZ A;  3ZIM A;  2WXG A;  4H7X A;  1H0A A;  3CHO A;  4YVQ C;  3PH0 C;  3CVU A;  3FTV A;  5E75 A;  2L0T B;  3BG1 B;  1JPL A;  4UI9 C;  3L54 A;  3PS6 A;  5KJM A;  4ILH B;  1E90 A;  2IU1 A;  2UWJ G;  1PAQ A;  3QJZ A;  2JLB A;  2XGO A;  3ESK A;  2J9Q A;  4Y6W A;  1TEZ A;  4IUL A;  1NZN A;  4MS6 A;  4GZD A;  2X38 A;  4JPS A;  3I5P A;  2WXJ A;  4Q94 A;  3CLJ A;  4R7L A;  2CHZ A;  3L6A A;  4BY6 A;  4QFV A;  2C2L A;  3PUJ A;  3EDT B;  2NC9 A;  5FZR A;  4B94 A;  4ANX A;  2CHX A;  2IJG X;  3UT7 A;  3SGH A;  3SNX A;  5JHB A;  4WWO A;  5DBK A;  3R7R A;  3HHM A;  3C98 A;  5CMY A;  4FA6 A;  1HH8 A;  1ELK A;  4GB9 A;  3LY9 A;  2V8S E;  4XKB A;  2JEK A;  4A1G A;  4WUY A;  3CVQ A;  2AXZ A;  4YVO A;  3FWV A;  2RD0 A;  4JHK A;  4CEM A;  2NSZ A;  4LEU A;  3D9L A;  2LO6 A;  4PS7 A;  3NF1 A;  3JCK C;  2VSX E;  4GA0 A;  4FJY A;  4L2Y A;  4BTB A;  4DJA A;  2VGY A;  4N3C A;  3UT4 A;  3ZGQ A;  1B89 A;  3TGO A;  2AWI A;  4HVB A;  2FI7 A;  2XPI A;  4GU5 A;  2X3M A;  4TRQ A;  4LRZ A;  3B7T A;  1E7V A;  2HR2 A;  1XGW A;  4FHK A;  3ZVV A;  3ZFW A;  4KT6 B;  4YND A;  1KT1 A;  3LS8 A;  4A3V A;  1W3B A;  1IQR A;  2VSN A;  4GCN A;  3JQ1 A;  3Q47 B;  3G2T A;  4PH4 B;  2P58 C;  4CT0 A;  4OVU A;  3HDX A;  4IYP A;  3RK6 A;  3PNL B;  1HFA A;  3MKQ A;  4WNE A;  2FBN A;  3WXX A;  4N3B A;  1EYH A;  3HVE A;  5LCW J;  4HOS A;  2BTD A;  3CK9 A;  4J6I A;  4GZ5 A;  2PM6 A;  1H2V C;  3CVY A;  1HG5 A;  4ACL A;  2LAH A;  4FAD A;  4AP2 A;  5AIJ A;  2VQ2 A;  3D9N A;  3LPZ A;  3PEV B;  1MHQ A;  3FUF A;  4HS2 A;  4KZC A;  4HFG A;  2WXR A;  2PM7 A;  3GYZ A;  5LX8 A;  3JQ0 A;  2V4L A;  3SI5 A;  4F1S A;  2UY1 B;  5ENN A;  5EDS A;  1NP7 A;  2LNI A;  3JYS A;  3AS8 A;  4G11 A;  2WQ6 A;  4G26 A;  2Q7F A;  3ZYL A;  4Q69 A;  2WVI A;  3D9J A;  4CT4 A;  1NA0 A;  3CHQ A;  4KYO B;  3S7J A;  3TXM A;  2NXP A;  4JA7 A;  5C1D A;  3L22 A;  5T4Y A;  3SD5 A;  5KJK A;  1H6K A;  2I2O A;  4GPK A;  2E2E A;  3LJ3 A;  4AOF A;  4EZL A;  4B0Z A;  1ZBP A;  4E6H A;  3QOU A;  5ANL A;  3BG0 B;  3S7F A;  3CR3 A;  3MV3 B;  4AV7 A;  4L1B A;  4K0R A;  3G2W A;  1E8Y A;  3QK0 A;  4UWK A;  1JUQ A;  3FEY A;  4P29 A;  1X5B A;  4UI9 K;  3TG5 A;  2DCP A;  4JEH A;  4BFR A;  3Q5M A;  4GA2 A;  5CMW A;  1N52 A;  2J08 A;  1H19 A;  1Z6T A;  3FTU A;  3CVX A;  5G04 C;  1SZ9 A;  1BPO A;  2J4D A;  4BWR A;  4DI4 A;  3PNT B;  2J09 A;  3DPD A;  5AYW D;  3FU3 A;  4I6J A;  5G2N A;  2VSO E;  3O4Z A;  3B7U X;  4NQ0 A;  1UN9 A;  1JWF A;  3ULQ A;  2R17 C;  2R5S A;  2OVF A;  2DIW A;  4PUC A;  4UQY A;  3FUH A;  3LYA A;  3VLF A;  1INZ A;  2J49 A;  2XCB A;  2C0M A;  3PRE A;  4KBQ A;  4O6F A;  5J08 A;  3MEK A;  4AY6 A;  5T8I A;  4DLQ A;  4KMO A;  1H2U A;  4JHR A;  4XKC A;  4DK5 A;  2X6K A;  3FH7 A;  2LAI A;  2CG2 A;  2Y3A A;  2XPY A;  3N71 A;  3BEE A;  3Q49 B;  5EKQ D;  3U4T A;  3DBS A;  4A55 A;  1U3D A;  3HIZ A;  5BPP A;  4HOR A;  3CHM A;  3MJW A;  1UW4 B;  3FFL A;  3TG4 A;  5J90 A;  2WB2 A;  1EF1 C;  4JHJ A;  3LCA A;  3CV0 A;  2FEZ A;  2XGS A;  3L16 A;  3APF A;  2WXN A;  4N2S A;  4U04 A;  3LVQ E;  4DLO A;  4APO A;  4I1A A;  2I6H A;  3ASD A;  1E8X A;  4J8D A;  2A5U A;  4URK A;  2ZU6 B;  4GZ6 A;  2IFU A;  3B7S A;  3CGH A;  3FH5 A;  3IKO B;  2OVB A;  3CIA A;  1OWM A;  4N5C A;  2WXQ A;  4C0E A;  3SBT B;  2YHE A;  3APC A;  1DVP A;  1U3C A;  2L0I A;  2CFU A;  4FLH A;  2A4Z A;  3S7B A;  4GYW A;  5LFA A;  1UJK A;  2L9B A;  4ABN A;  5EX0 A;  4J8F A;  3ASH A;  4DPR A;  5HI7 A;  5G05 J;  3S7D A;  2XHE A;  3GZ2 A;  3NZU A;  3UMV A;  3LY8 A;  1UG3 A;  2VJ8 A;  4I2W A;  4B89 A;  3EIJ A;  2YHC A;  3KAE A;  4CDR A;  2PZI A;  3FU5 A;  2CG3 A;  3FTY A;  2GRM A;  3RRN B;  4EZK A;  4NUR A;  3UQ3 A;  5ANR A;  4L23 A;  1HS6 A;  2AVP A;  4GCO A;  2GRL A;  3ZXS A;  1UJJ A;  2C0L A;  4B8C B;  1E96 B;  2LSU A;  2WMO A;  3QAR A;  1HE8 A;  2WXI A;  4MRU A;  2X6F A;  4XI9 A;  2HYZ A;  3CVN A;  3T8M A;  4DI3 A;  2KZT B;  2KCL A;  4GYY A;  4A3T A;  1OWO A;  3P1U A;  4HOQ A;  3FTZ A;  4U0S A;  3TAX A;  3VLE A;  4CGV A;  5BT1 A;  1GW6 A;  3CST A;  1XNF A;  4J0U A;  1HF8 A;  5E76 A;  5KCM A;  3RKV A;  2ION A;  2R59 A;  2XEV A;  3ZRH A;  3CKB A;  4LUN U;  3VLD A;  5CCM A;  3U66 A;  2CFZ A;  3URZ A;  2XRY A;  3FP3 A;  2X6J A;  4BT9 A;  2WXH A;  2DBA A;  3FUK A;  3NZS A;  5LOZ A;  4EBA A;  2YNQ A;  2V0P A;  4FUL A;  1LF8 A;  4I43 A;  4I1O B;  2I1J A;  2VGX B;  3ONK A;  2EQX A;  4F53 A;  3IHV A;  3I3N A;  1IHG A;  4HLE A;  1S0P A;  3PVL A;  4IN3 B;  3AS4 A;  3MA5 A;  4JW1 A;  1ELR A;  2WXP A;  4KVM A;  2CHW A;  3FUD A;  5CCL A;  1MQS A;  1Z3X A;  1Z3Y A;  4I17 A;  3AS5 A;  3ASF A;  4GYO A;  4I2Z A;  3G2V A;  1SZA A;  2KM4 A;  2WXO A;  3MKR A;  3O48 A;  3FUJ A;  4N3A A;  4PS8 A;  1FVH A;  5G04 J;  3UPV A;  3APD A;  3QDN A;  3ZN3 A;  2RG8 A;  4N39 A;  3ZEF A;  4MKT A;  1PC2 A;  4K03 A;  4KXK B;  5JJ6 A;  2AXU A;  3LKU A;  1WY6 A;  4OYS A;  2QFC A;  4G24 A;  4CDM A;  4U0U A;  1HXI A;  3ESL A;  3EHN A;  3R7Q A;  1WAO 1;  2OV8 A;  3EJN A;  4AJW A;  4E85 A;  3FH8 A;  3FU0 A;  3IEG A;  4XE0 A;  2WQH A;  2E0I A;  3FUN A;  4KVO A;  2FO7 A;  1HU3 A;  4EPZ A;  2IOL A;  2IQC A;  3IBE A;  3VTY A;  1IQU A;  4Y6C A;  3GZ1 A;  2BUG A;  4UQX A;  3OXF A;  5AEN A;  5BUZ A;  3QAQ A;  2FF4 A;  4AY5 A;  4TUU A;  2V5F A;  2YQ8 A;  4UI9 J;  3GZS A;  4GZC A;  3OAW A;  5A6C A;  1E7U A;  2BF0 X;  4V3I A;  4XZ4 A;  5LCW C;  3PDN A;  5FT9 A;  3G2U A;  3T5V A;  5KJN A;  5FZQ A;  4N2Q A;  1KT0 A;  4I9E A;  2XGM A;  3LY7 A;  3D9I A;  3L17 A;  3IV0 A;  3MV2 B;  3MYV A;  2MHK A;  1QQE A;  2QY7 A;  2WPV A;  5JJT A;  2KAT A;  4I6G A;  2YIN A;  4Q96 A;  4WWP A;  1EPU A;  2PL2 A;  3CQG B;  3R9A B;  4FLB A;  4GZ3 A;  4JEU A;  3D9M A;  3JUI A;  3QNK A;  2HO1 A;  3CQC B;  1E8Z A;  5EX3 A;  5KJL A;  3CHS A;  3HYM B;  3VTX A;  3FEX A;  3D9O A;  3FUI A;  4I6E A;  3FUM A;  4PS3 A;  1OWN A;  3FHE A;  4EQF A;  2X6I A;  1FCH A;  3LEW A;  3OXL A;  5AJL A;  2XCC A;  3MKQ B;  4WWN A;  3FUL A;  4C0M A;  3SHF A;  2VGX A;  4BSX A;  4FP7 A;  1TJC A;  4I1M A;  3Q4A B;  1YA0 A;  1HG2 A;  3TJP A;  4HXI A;  4BX8 A;  3SZ7 A;  2AXV A;  2IF4 A;  5ARG A;  4FJZ A;  4RG9 A;  2UY1 A;  5BNW A;  3CK7 A;  4G1T A;  3U9W A;  2KC7 A;  3ZYK A;  3EIQ C;  4A1S A;  1PY1 A;  3B7R L;  4GA1 A;  3FTW A;  1E8W A;  2FUL A;  5G55 A;  4JVS A;  3NQP A;  5CHE E;  1VDY A;  2XQ0 A;  4WND A;  3U64 A;  4F7A A;  2M63 A;  3Q15 A;  5FQ6 A;  3LXU X;  4EZJ A;  5LP0 A;  4D10 C;  1OUV A;  2KCK A;  3PE4 A;  3PRZ A;  3SFZ A;  3RRU A;  4ATG A;  3U3W A;  4XI0 A;  3K9I A;  5FQ4 A;  5C2Y A;  2LSV A;  4U8H A;  3D3M A;  5BW8 C;  4U0Z A;  3EHM A;  1ELW A;  2HM8 A;  4J8S A;  4UWG A;  1ZU2 A;  5T3R A;  3L13 A;  1TJF A;  3QB2 A;  3PZD A;  3B13 A;  1Y6I A;  4M3O A;  2VTB B;  4XX5 A;  4J8E A;  3FTS A;  2X6H A;  3S2A A;  4GMJ A;  1NA3 A;  5D0O D;  1N54 A;  3PEU B;  1FVF A;  3FTX A;  3OTN A;  4ANV A;  4FU3 A;  4WAF A;  3ZHE B;  4APF A;  5BV1 A;  3MX3 A;  3ML8 A;  4U63 A;  3CKC A;  4RVB A;  3CVV A;  3D9K A;  3QWV A;  4GML A;  5D0Q D;  3PUK A;  5FWQ A;  4AEZ C;  5FQ8 A;  4NAC A;  3ML9 A;  3MCX A;  1WM5 A;  2I9C A;  3AU5 A;  3FU6 A;  4H7Y A;  2Y4T A;  3RO3 A;  4LER A;  4AIF A;  4UQZ A;  1HO8 A;  4IRU A;  4B8A A;  3I4G A;  4AM9 A;  2WQ7 A;  5BV0 A;  4JC8 A;  3UUX A;  3UT8 A;  4LCT A;  1HX8 A;  5G05 C;  4F3V A;  4JA9 A;  3PE3 A;  3ASG A;  1L5J A;  3GW4 A;  4CGW A;  2WXF A;  3I4R B;  2VYI A;  2MOW A;  1QZ2 A;  4ANU A;  4EEC A;  4G23 A;  4WNG A;  4UWH A;  5JJ7 A;  4EBA G;  3CK8 A;  5HQ8 A;  1EDU A;  4CRW A;  3SF4 A;  5A7D B;  4RSY A;  3E4B A;  3ENE A;  3KS2 A;  3ZYM A;  4ILG A;  5AJD A;  5FZS A;  5JHA A;  3ZW3 A;  4U07 A;  1HZ4 A;  3CHP A;  4UWL A;  2WMN A;  3CEQ A;  4G25 A;  4W9R A;  1IYG A;  4KZ0 A;  4PDX A;  4G2V A;  3AU4 A;  4I9C A;  2VSY A;  3RJV A;  4AXH A;  2WXL A;  1A17 A;  2WM9 A;  4FC8 A;  3QWW A;  4NRH B;  4TV3 A;  1QNF A;  4BX9 A;  2WXM A;  2Y4U A;  1Y8M A;  5FJY A;  4XIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...