3PH2B

Structure of the imidazole-adduct of the phormidium laminosum cytochrome c6 q51v variant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
ADLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGMNSIVAITTVVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQAEKGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c6
publication title Structural and kinetic studies of imidazole binding to two members of the cytochrome c (6) family reveal an important role for a conserved heme pocket residue.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Photosynthesis
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ph2B00
2N9JA 1H31B 2ZONG 1DW3A 2B10B 5GTIV 1P84D 1I8OA 2C8SA 1HJ3A 1H32A 4WQCA 1CTJA 1I5TA 5KAIV 2BGVX 1A2SA 1OAEA 2YK3A 4O1QA 3NBTA 1CO6A 351CA 4QAOA 5C9MA 1SQVD 2QJKB 4AALA 1IO3A 2C1DB 2N9IA 3DMIA 1CC5A 2FRCA 1EZVD 1A8CA 1S6VB 2AIUA 1QL3A 1LC2A 1H33B 1PP9D 3RN1A 1I54A 2N3BA 1FI7A 2CA4B 1N50A 5B66V 5KLVD 2YIUB 3ORVA 5TISV 1NTMD 4GYDA 451CA 4AANA 1DVVA 1NMLA 2BPBB 1LFMA 2EXVA 1FI9A 3RN0A 1HJ5A 1BE3D 3NBSA 4DY9A 3L4MA 2N3YA 1CCHA 1DIQC 1LC1A 1A56A 3MK7C 5CIDB 2ZBOA 2ZZS1 3L72D 3SWSA 1CTZA 4XYDB 2B4ZA 4RSZA 3PXTA 1CCRA 2HV4A 3HQ6A 2VHDA 1SQBD 3O0RC 1DT1A 4GEDB 4EIDA 1DVHA 2CXBA 3SXTA 3H1ID 1LMSA 1H1OA 3SJLA 2IBZD 1C6RA 1WVEC 4FA1A 4UB8V 3MK7B 2BCCD 1IQCA 4FA4A 5DJQB 3ZIYA 2GC7D 1KX2A 5B5EV 2GC4D 1CYJA 3PXWA 3ZBMA 1CRYA 1CYIA 1HCMA 1NNOA 4IL6V 4KMGA 1YNRA 2XTSB 3H1JD 1CNOA 1KYOD 3SVWA 3H1HD 2BLFB 2C2CA 3HQ7A 5CIEB 1C2NA 3C2CA 1C52A 2BCNB 2DVHA 3ZOWA 1BL9A 1VYDA 1FCDC 1CIHA 3L70D 4FA5A 1CSWA 4JCGA 1YEBA 4FANA 4WQAA 3HQ9A 1CXAA 4L3HA 1QN2A 4U3FD 1ZRTD 1GU2A 3ZOOA 3WC8A 2V07A 1NIRA 3PH2B 3O5CA 3WFCC 1I55A 1CSUA 1KV9A 5CIBB 1AOQA 1YEAA 1R0QA 5CIHB 4O1WA 4EICA 5DFSA 2C9XB 1K3HA 4L3GA 1AKKA 4AX3A 2LITA 2OZ1B 4AAMA 2BH4X 2BH5X 1L0LD 3TGUD 1DIIC 1DW0A 3CX5D 1CRHA 3WFBC 1L9BC 4YE1A 3OA8B 1N15A 1HZVA 1E2RA 2A06D 3WUIA 1L9JC 3CXHD 1SQQD 4J20A 1SQPD 1NMIA 1SQXD 1F1CA 1U75B 5H2FV 1HZUA 3OCDA 2YCCA 1J3SA 1AYGA 5CIFB 1QKSA 5DJQC 1KB0A 1YCCA 3TYIA 3PXSA 1DW1A 1H9YA 1YFCA 2CE0A 3ZOYA 4WQ9A 1CTYA 2PCBB 155CA 3L71D 4PW9B 1C6OA 2ORLA 2PACA 1OCDA 2FYUD 1C75A 1E29A 1RZ6A 2D0WA 1H31A 4D6TD 4Y5RA 2FWLA 4Q5PA 5E79V 1M70A 1FHBA 1MZ4A 3A0HV 4XXLA 1CHHA 2D0SA 4H0JA 3WFEC 1CRCA 1N90A 2AXTV 1F1FA 3H1KD 1NTZD 2JTIB 1CSXA 5DF5A 3KZIV 3DR0A 1AOFA 1MG3D 1FOCA 1CRGA 2C1DA 1S5LV 2DGEA 4LJIA 3CX5W 1C7MA 1H33A 3RLMA 2FYNB 3CP5A 1W5CT 2CE1A 1RZ5A 3DP5A 5CICB 1DW2A 4EIFA 4PD4D 1I6DA 4FAVA 4PJ0V 4N0KA 4FB1A 2N18B 1RAQA 5IY51 1H9XA 3L75D 2ZOOA 3OA8A 2MTAC 1CIEA 3VNWA 1EB7A 4P4QB 3WU2V 3CYTI 3SLEA 1CIGA 2C1UA 3CWBD 1NU1D 1FJ0A 2L4DA 1I6EA 3O20A 1QL4A 4H0KA 3WFDC 1HH7A 1GIWA 3ZOXA 3HQ8A 2GB8B 5KLIB 1WEJF 4WQ7A 5CIGB 1M60A 1W2LA 4L1QA 1CYCA 2B11B 1KB9D 1PPJD 5AURA 1K3GA 1HJ4A 1MG2D 1B7VA 1CRIA 4EIEA 1FI3A 2QJYB 1CSVA 4V2KA 1C6SA 1COTA 5CYTR 1IRWA 1ETPA 4AAOA 1GQ1A 1KYOW 2QJPB 5C0ZA 1KIBA 2V08A 1CORA 3M97X 3JBTB 1H32B 5B6QA 1GDVA 1E8EA 2YQBA 1GKSA 1RAPA 4NFGB 5KKZB 2GIWA 2CA3B 1YIQA 2ZXYA 1YICA 4UB6V 3A0BV 1CRJA 3NWVA 3H1LD 3VYMA 3A9FA 1HRCA 1BCCD 3O1YA 4WQDA 3VRDA 1CHIA 3L4OA 2C1VA 1QYZA 2N18C 3CU4A 1I8PA 1N9CA 1CEDA 1GJQA 5KAFV 1LS9A 2AI5A 2I8FA 1CXCA 2B12B 2PCCB 4WQEA 1BGYD 3BCCD 3L74D 1NTKD 5GTHV 4MU8A 2LIRA 4WQBA 3OCDB 4FA9A 1ZZHA 1HROA 1U74B 1L0ND 2B0ZB 2OZ1A 1CIFA 5EXQA 3L73D 1KX7A 1JDLA 3X39A 3CXHW 2MHMA 1IZL0 2JQRA 4WQ8A 4PWAA 1M6ZA 1IRVA 3RMZA 1CHJA 3ZCFA 4K3IA 1C2RA 1YTCA
chains in the Genus database with same CATH superfamily
2N9JA 1H31B 2ZONG 1DW3A 2B10B 5GTIV 1P84D 1I8OA 2C8SA 1HJ3A 1H32A 4WQCA 1CTJA 1I5TA 5KAIV 2BGVX 1A2SA 1OAEA 2YK3A 4O1QA 3NBTA 1CO6A 351CA 4QAOA 5C9MA 1SQVD 2QJKB 4AALA 1IO3A 2C1DB 2N9IA 3DMIA 1CC5A 2FRCA 1EZVD 1A8CA 1S6VB 2AIUA 1QL3A 1LC2A 1H33B 1PP9D 3RN1A 1I54A 2N3BA 1FI7A 2CA4B 1N50A 5B66V 5KLVD 2YIUB 3ORVA 5TISV 1NTMD 4GYDA 451CA 4AANA 1DVVA 1NMLA 2BPBB 1LFMA 2EXVA 1FI9A 3RN0A 1HJ5A 1BE3D 3NBSA 4DY9A 3L4MA 2N3YA 1CCHA 1DIQC 1LC1A 1A56A 3MK7C 5CIDB 2ZBOA 2ZZS1 3L72D 3SWSA 1CTZA 4XYDB 2B4ZA 4RSZA 3PXTA 1CCRA 2HV4A 3HQ6A 2VHDA 1SQBD 3O0RC 1DT1A 4GEDB 4EIDA 1DVHA 2CXBA 3SXTA 3H1ID 1LMSA 1H1OA 3SJLA 2IBZD 1C6RA 1WVEC 4FA1A 4UB8V 3MK7B 2BCCD 1IQCA 4FA4A 5DJQB 3ZIYA 2GC7D 1KX2A 5B5EV 2GC4D 1CYJA 3PXWA 3ZBMA 1CRYA 1CYIA 1HCMA 1NNOA 4IL6V 4KMGA 1YNRA 2XTSB 3H1JD 1CNOA 1KYOD 3SVWA 3H1HD 2BLFB 2C2CA 3HQ7A 5CIEB 1C2NA 3C2CA 1C52A 2BCNB 2DVHA 3ZOWA 1BL9A 1VYDA 1FCDC 1CIHA 3L70D 4FA5A 1CSWA 4JCGA 1YEBA 4FANA 4WQAA 3HQ9A 1CXAA 4L3HA 1QN2A 4U3FD 1ZRTD 1GU2A 3ZOOA 3WC8A 2V07A 1NIRA 3PH2B 3O5CA 3WFCC 1I55A 1CSUA 1KV9A 5CIBB 1AOQA 1YEAA 1R0QA 5CIHB 4O1WA 4EICA 5DFSA 2C9XB 1K3HA 4L3GA 1AKKA 4AX3A 2LITA 2OZ1B 4AAMA 2BH4X 2BH5X 1L0LD 3TGUD 1DIIC 1DW0A 3CX5D 1CRHA 3WFBC 1L9BC 4YE1A 3OA8B 1N15A 1HZVA 1E2RA 2A06D 3WUIA 1L9JC 3CXHD 1SQQD 4J20A 1SQPD 1NMIA 1SQXD 1F1CA 1U75B 5H2FV 1HZUA 3OCDA 2YCCA 1J3SA 1AYGA 5CIFB 1QKSA 3D0WA 5DJQC 1KB0A 1YCCA 3TYIA 3PXSA 1DW1A 1H9YA 1YFCA 2CE0A 3ZOYA 4WQ9A 1CTYA 2PCBB 155CA 3L71D 4PW9B 1C6OA 2ORLA 2PACA 1OCDA 2FYUD 1C75A 1E29A 1RZ6A 2D0WA 1H31A 4D6TD 4Y5RA 2FWLA 4Q5PA 5E79V 1M70A 1FHBA 1MZ4A 3A0HV 4XXLA 1CHHA 2D0SA 4H0JA 3WFEC 1CRCA 1N90A 2AXTV 1F1FA 3H1KD 1NTZD 2JTIB 1CSXA 5DF5A 3KZIV 3DR0A 1AOFA 1MG3D 1FOCA 1CRGA 2C1DA 1S5LV 2DGEA 4LJIA 3CX5W 1C7MA 1H33A 3RLMA 2FYNB 3CP5A 1W5CT 2CE1A 1RZ5A 3DP5A 5CICB 1DW2A 4EIFA 4PD4D 1I6DA 4FAVA 4PJ0V 4N0KA 4FB1A 2N18B 1RAQA 5IY51 1H9XA 3L75D 2ZOOA 3OA8A 2MTAC 1CIEA 3VNWA 1EB7A 4P4QB 3WU2V 3CYTI 3SLEA 1CIGA 2C1UA 3CWBD 1NU1D 1FJ0A 2L4DA 1I6EA 3O20A 1QL4A 4H0KA 3WFDC 1HH7A 1GIWA 3ZOXA 3HQ8A 2GB8B 5KLIB 1WEJF 4WQ7A 5CIGB 1M60A 1W2LA 4L1QA 1CYCA 2B11B 1KB9D 1PPJD 5AURA 1K3GA 1HJ4A 1MG2D 1B7VA 1CRIA 4EIEA 1FI3A 2QJYB 1CSVA 4V2KA 1C6SA 1COTA 5CYTR 1IRWA 1ETPA 4AAOA 1GQ1A 1KYOW 2QJPB 5C0ZA 1KIBA 2V08A 1CORA 3M97X 3JBTB 1H32B 5B6QA 1GDVA 1E8EA 2YQBA 1GKSA 1RAPA 4NFGB 5KKZB 2GIWA 2CA3B 1YIQA 2ZXYA 1YICA 4UB6V 3A0BV 1CRJA 3NWVA 3H1LD 3VYMA 3A9FA 1HRCA 1BCCD 3O1YA 4WQDA 3VRDA 1CHIA 3L4OA 2C1VA 1QYZA 2N18C 3CU4A 1I8PA 1N9CA 1CEDA 1GJQA 5KAFV 1LS9A 2AI5A 2I8FA 1CXCA 2B12B 2PCCB 4WQEA 1BGYD 3BCCD 3L74D 1NTKD 5GTHV 4MU8A 2LIRA 4WQBA 3OCDB 4FA9A 1ZZHA 1HROA 1U74B 1L0ND 2B0ZB 2OZ1A 1CIFA 5EXQA 3L73D 1KX7A 1JDLA 3X39A 3CXHW 2MHMA 1IZL0 2JQRA 4WQ8A 4PWAA 1M6ZA 1IRVA 3RMZA 1CHJA 3ZCFA 4K3IA 1C2RA 1YTCA
chains in the Genus database with same CATH topology
2N9JA 1H31B 2ZONG 1DW3A 2B10B 5GTIV 1P84D 1I8OA 2C8SA 1HJ3A 1H32A 4WQCA 1CTJA 1I5TA 5KAIV 2BGVX 1A2SA 1OAEA 2YK3A 4O1QA 3NBTA 1CO6A 351CA 4QAOA 5C9MA 1SQVD 2QJKB 4AALA 1IO3A 2C1DB 2N9IA 3DMIA 1CC5A 2FRCA 1EZVD 1A8CA 1S6VB 2AIUA 1QL3A 1LC2A 1H33B 1PP9D 3RN1A 1I54A 2N3BA 1FI7A 2CA4B 1N50A 5B66V 5KLVD 2YIUB 3ORVA 5TISV 1NTMD 4GYDA 451CA 4AANA 1DVVA 1NMLA 2BPBB 1LFMA 2EXVA 1FI9A 3RN0A 1HJ5A 1BE3D 3NBSA 4DY9A 3L4MA 2N3YA 1CCHA 1DIQC 1LC1A 1A56A 3MK7C 5CIDB 2ZBOA 2ZZS1 3L72D 3SWSA 1CTZA 4XYDB 2B4ZA 4RSZA 3PXTA 1CCRA 2HV4A 3HQ6A 2VHDA 1SQBD 3O0RC 1DT1A 4GEDB 4EIDA 1DVHA 2CXBA 3SXTA 3H1ID 1LMSA 1H1OA 3SJLA 2IBZD 1C6RA 1WVEC 4FA1A 4UB8V 3MK7B 2BCCD 1IQCA 4FA4A 5DJQB 3ZIYA 2GC7D 1KX2A 5B5EV 2GC4D 1CYJA 3PXWA 3ZBMA 1CRYA 1CYIA 1HCMA 1NNOA 4IL6V 4KMGA 1YNRA 2XTSB 3H1JD 1CNOA 1KYOD 3SVWA 3H1HD 2BLFB 2C2CA 3HQ7A 5CIEB 1C2NA 3C2CA 1C52A 2BCNB 2DVHA 3ZOWA 1BL9A 1VYDA 1FCDC 1CIHA 3L70D 4FA5A 1CSWA 4JCGA 1YEBA 4FANA 4WQAA 3HQ9A 1CXAA 4L3HA 1QN2A 4U3FD 1ZRTD 1GU2A 3ZOOA 3WC8A 2V07A 1NIRA 3PH2B 3O5CA 3WFCC 1I55A 1CSUA 1KV9A 5CIBB 1AOQA 1YEAA 1R0QA 5CIHB 4O1WA 4EICA 5DFSA 2C9XB 1K3HA 4L3GA 1AKKA 4AX3A 2LITA 2OZ1B 4AAMA 2BH4X 2BH5X 1L0LD 3TGUD 1DIIC 1DW0A 3CX5D 1CRHA 3WFBC 1L9BC 4YE1A 3OA8B 1N15A 1HZVA 1E2RA 2A06D 3WUIA 1L9JC 3CXHD 1SQQD 4J20A 1SQPD 1NMIA 1SQXD 1F1CA 1U75B 5H2FV 1HZUA 3OCDA 2YCCA 1J3SA 1AYGA 5CIFB 1QKSA 5DJQC 1KB0A 1YCCA 3TYIA 3PXSA 1DW1A 1H9YA 1YFCA 2CE0A 3ZOYA 4WQ9A 1CTYA 2PCBB 155CA 3L71D 4PW9B 1C6OA 2ORLA 2PACA 1OCDA 2FYUD 1C75A 1E29A 1RZ6A 2D0WA 1H31A 4D6TD 4Y5RA 2FWLA 4Q5PA 5E79V 1M70A 1FHBA 1MZ4A 3A0HV 4XXLA 1CHHA 2D0SA 4H0JA 3WFEC 1CRCA 1N90A 2AXTV 1F1FA 3H1KD 1NTZD 2JTIB 1CSXA 5DF5A 3KZIV 3DR0A 1AOFA 1MG3D 1FOCA 1CRGA 2C1DA 1S5LV 2DGEA 4LJIA 3CX5W 1C7MA 1H33A 3RLMA 2FYNB 3CP5A 1W5CT 2CE1A 1RZ5A 3DP5A 5CICB 1DW2A 4EIFA 4PD4D 1I6DA 4FAVA 4PJ0V 4N0KA 4FB1A 2N18B 1RAQA 5IY51 1H9XA 3L75D 2ZOOA 3OA8A 2MTAC 1CIEA 3VNWA 1EB7A 4P4QB 3WU2V 3CYTI 3SLEA 1CIGA 2C1UA 3CWBD 1NU1D 1FJ0A 2L4DA 1I6EA 3O20A 1QL4A 4H0KA 3WFDC 1HH7A 1GIWA 3ZOXA 3HQ8A 2GB8B 5KLIB 1WEJF 4WQ7A 5CIGB 1M60A 1W2LA 4L1QA 1CYCA 2B11B 1KB9D 1PPJD 5AURA 1K3GA 1HJ4A 1MG2D 1B7VA 1CRIA 4EIEA 1FI3A 2QJYB 1CSVA 4V2KA 1C6SA 1COTA 5CYTR 1IRWA 1ETPA 4AAOA 1GQ1A 1KYOW 2QJPB 5C0ZA 1KIBA 2V08A 1CORA 3M97X 3JBTB 1H32B 5B6QA 1GDVA 1E8EA 2YQBA 1GKSA 1RAPA 4NFGB 5KKZB 2GIWA 2CA3B 1YIQA 2ZXYA 1YICA 4UB6V 3A0BV 1CRJA 3NWVA 3H1LD 3VYMA 3A9FA 1HRCA 1BCCD 3O1YA 4WQDA 3VRDA 1CHIA 3L4OA 2C1VA 1QYZA 2N18C 3CU4A 1I8PA 1N9CA 1CEDA 1GJQA 5KAFV 1LS9A 2AI5A 2I8FA 1CXCA 2B12B 2PCCB 4WQEA 1BGYD 3BCCD 3L74D 1NTKD 5GTHV 4MU8A 2LIRA 4WQBA 3OCDB 4FA9A 1ZZHA 1HROA 1U74B 1L0ND 2B0ZB 2OZ1A 1CIFA 5EXQA 3L73D 1KX7A 1JDLA 3X39A 3CXHW 2MHMA 1IZL0 2JQRA 4WQ8A 4PWAA 1M6ZA 1IRVA 3RMZA 1CHJA 3ZCFA 4K3IA 1C2RA 1YTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9J A;  1H31 B;  2ZON G;  1DW3 A;  2B10 B;  5GTI V;  1P84 D;  1I8O A;  2C8S A;  1HJ3 A;  1H32 A;  4WQC A;  1CTJ A;  1I5T A;  5KAI V;  2BGV X;  1A2S A;  1OAE A;  2YK3 A;  4O1Q A;  3NBT A;  1CO6 A;  351C A;  4QAO A;  5C9M A;  1SQV D;  2QJK B;  4AAL A;  1IO3 A;  2C1D B;  2N9I A;  3DMI A;  1CC5 A;  2FRC A;  1EZV D;  1A8C A;  1S6V B;  2AIU A;  1QL3 A;  1LC2 A;  1H33 B;  1PP9 D;  3RN1 A;  1I54 A;  2N3B A;  1FI7 A;  2CA4 B;  1N50 A;  5B66 V;  5KLV D;  2YIU B;  3ORV A;  5TIS V;  1NTM D;  4GYD A;  451C A;  4AAN A;  1DVV A;  1NML A;  2BPB B;  1LFM A;  2EXV A;  1FI9 A;  3RN0 A;  1HJ5 A;  1BE3 D;  3NBS A;  4DY9 A;  3L4M A;  2N3Y A;  1CCH A;  1DIQ C;  1LC1 A;  1A56 A;  3MK7 C;  5CID B;  2ZBO A;  2ZZS 1;  3L72 D;  3SWS A;  1CTZ A;  4XYD B;  2B4Z A;  4RSZ A;  3PXT A;  1CCR A;  2HV4 A;  3HQ6 A;  2VHD A;  1SQB D;  3O0R C;  1DT1 A;  4GED B;  4EID A;  1DVH A;  2CXB A;  3SXT A;  3H1I D;  1LMS A;  1H1O A;  3SJL A;  2IBZ D;  1C6R A;  1WVE C;  4FA1 A;  4UB8 V;  3MK7 B;  2BCC D;  1IQC A;  4FA4 A;  5DJQ B;  3ZIY A;  2GC7 D;  1KX2 A;  5B5E V;  2GC4 D;  1CYJ A;  3PXW A;  3ZBM A;  1CRY A;  1CYI A;  1HCM A;  1NNO A;  4IL6 V;  4KMG A;  1YNR A;  2XTS B;  3H1J D;  1CNO A;  1KYO D;  3SVW A;  3H1H D;  2BLF B;  2C2C A;  3HQ7 A;  5CIE B;  1C2N A;  3C2C A;  1C52 A;  2BCN B;  2DVH A;  3ZOW A;  1BL9 A;  1VYD A;  1FCD C;  1CIH A;  3L70 D;  4FA5 A;  1CSW A;  4JCG A;  1YEB A;  4FAN A;  4WQA A;  3HQ9 A;  1CXA A;  4L3H A;  1QN2 A;  4U3F D;  1ZRT D;  1GU2 A;  3ZOO A;  3WC8 A;  2V07 A;  1NIR A;  3PH2 B;  3O5C A;  3WFC C;  1I55 A;  1CSU A;  1KV9 A;  5CIB B;  1AOQ A;  1YEA A;  1R0Q A;  5CIH B;  4O1W A;  4EIC A;  5DFS A;  2C9X B;  1K3H A;  4L3G A;  1AKK A;  4AX3 A;  2LIT A;  2OZ1 B;  4AAM A;  2BH4 X;  2BH5 X;  1L0L D;  3TGU D;  1DII C;  1DW0 A;  3CX5 D;  1CRH A;  3WFB C;  1L9B C;  4YE1 A;  3OA8 B;  1N15 A;  1HZV A;  1E2R A;  2A06 D;  3WUI A;  1L9J C;  3CXH D;  1SQQ D;  4J20 A;  1SQP D;  1NMI A;  1SQX D;  1F1C A;  1U75 B;  5H2F V;  1HZU A;  3OCD A;  2YCC A;  1J3S A;  1AYG A;  5CIF B;  1QKS A;  5DJQ C;  1KB0 A;  1YCC A;  3TYI A;  3PXS A;  1DW1 A;  1H9Y A;  1YFC A;  2CE0 A;  3ZOY A;  4WQ9 A;  1CTY A;  2PCB B;  155C A;  3L71 D;  4PW9 B;  1C6O A;  2ORL A;  2PAC A;  1OCD A;  2FYU D;  1C75 A;  1E29 A;  1RZ6 A;  2D0W A;  1H31 A;  4D6T D;  4Y5R A;  2FWL A;  4Q5P A;  5E79 V;  1M70 A;  1FHB A;  1MZ4 A;  3A0H V;  4XXL A;  1CHH A;  2D0S A;  4H0J A;  3WFE C;  1CRC A;  1N90 A;  2AXT V;  1F1F A;  3H1K D;  1NTZ D;  2JTI B;  1CSX A;  5DF5 A;  3KZI V;  3DR0 A;  1AOF A;  1MG3 D;  1FOC A;  1CRG A;  2C1D A;  1S5L V;  2DGE A;  4LJI A;  3CX5 W;  1C7M A;  1H33 A;  3RLM A;  2FYN B;  3CP5 A;  1W5C T;  2CE1 A;  1RZ5 A;  3DP5 A;  5CIC B;  1DW2 A;  4EIF A;  4PD4 D;  1I6D A;  4FAV A;  4PJ0 V;  4N0K A;  4FB1 A;  2N18 B;  1RAQ A;  5IY5 1;  1H9X A;  3L75 D;  2ZOO A;  3OA8 A;  2MTA C;  1CIE A;  3VNW A;  1EB7 A;  4P4Q B;  3WU2 V;  3CYT I;  3SLE A;  1CIG A;  2C1U A;  3CWB D;  1NU1 D;  1FJ0 A;  2L4D A;  1I6E A;  3O20 A;  1QL4 A;  4H0K A;  3WFD C;  1HH7 A;  1GIW A;  3ZOX A;  3HQ8 A;  2GB8 B;  5KLI B;  1WEJ F;  4WQ7 A;  5CIG B;  1M60 A;  1W2L A;  4L1Q A;  1CYC A;  2B11 B;  1KB9 D;  1PPJ D;  5AUR A;  1K3G A;  1HJ4 A;  1MG2 D;  1B7V A;  1CRI A;  4EIE A;  1FI3 A;  2QJY B;  1CSV A;  4V2K A;  1C6S A;  1COT A;  5CYT R;  1IRW A;  1ETP A;  4AAO A;  1GQ1 A;  1KYO W;  2QJP B;  5C0Z A;  1KIB A;  2V08 A;  1COR A;  3M97 X;  3JBT B;  1H32 B;  5B6Q A;  1GDV A;  1E8E A;  2YQB A;  1GKS A;  1RAP A;  4NFG B;  5KKZ B;  2GIW A;  2CA3 B;  1YIQ A;  2ZXY A;  1YIC A;  4UB6 V;  3A0B V;  1CRJ A;  3NWV A;  3H1L D;  3VYM A;  3A9F A;  1HRC A;  1BCC D;  3O1Y A;  4WQD A;  3VRD A;  1CHI A;  3L4O A;  2C1V A;  1QYZ A;  2N18 C;  3CU4 A;  1I8P A;  1N9C A;  1CED A;  1GJQ A;  5KAF V;  1LS9 A;  2AI5 A;  2I8F A;  1CXC A;  2B12 B;  2PCC B;  4WQE A;  1BGY D;  3BCC D;  3L74 D;  1NTK D;  5GTH V;  4MU8 A;  2LIR A;  4WQB A;  3OCD B;  4FA9 A;  1ZZH A;  1HRO A;  1U74 B;  1L0N D;  2B0Z B;  2OZ1 A;  1CIF A;  5EXQ A;  3L73 D;  1KX7 A;  1JDL A;  3X39 A;  3CXH W;  2MHM A;  1IZL 0;  2JQR A;  4WQ8 A;  4PWA A;  1M6Z A;  1IRV A;  3RMZ A;  1CHJ A;  3ZCF A;  4K3I A;  1C2R A;  1YTC A; 
#chains in the Genus database with same CATH topology
 2N9J A;  1H31 B;  2ZON G;  1DW3 A;  2B10 B;  5GTI V;  1P84 D;  1I8O A;  2C8S A;  1HJ3 A;  1H32 A;  4WQC A;  1CTJ A;  1I5T A;  5KAI V;  2BGV X;  1A2S A;  1OAE A;  2YK3 A;  4O1Q A;  3NBT A;  1CO6 A;  351C A;  4QAO A;  5C9M A;  1SQV D;  2QJK B;  4AAL A;  1IO3 A;  2C1D B;  2N9I A;  3DMI A;  1CC5 A;  2FRC A;  1EZV D;  1A8C A;  1S6V B;  2AIU A;  1QL3 A;  1LC2 A;  1H33 B;  1PP9 D;  3RN1 A;  1I54 A;  2N3B A;  1FI7 A;  2CA4 B;  1N50 A;  5B66 V;  5KLV D;  2YIU B;  3ORV A;  5TIS V;  1NTM D;  4GYD A;  451C A;  4AAN A;  1DVV A;  1NML A;  2BPB B;  1LFM A;  2EXV A;  1FI9 A;  3RN0 A;  1HJ5 A;  1BE3 D;  3NBS A;  4DY9 A;  3L4M A;  2N3Y A;  1CCH A;  1DIQ C;  1LC1 A;  1A56 A;  3MK7 C;  5CID B;  2ZBO A;  2ZZS 1;  3L72 D;  3SWS A;  1CTZ A;  4XYD B;  2B4Z A;  4RSZ A;  3PXT A;  1CCR A;  2HV4 A;  3HQ6 A;  2VHD A;  1SQB D;  3O0R C;  1DT1 A;  4GED B;  4EID A;  1DVH A;  2CXB A;  3SXT A;  3H1I D;  1LMS A;  1H1O A;  3SJL A;  2IBZ D;  1C6R A;  1WVE C;  4FA1 A;  4UB8 V;  3MK7 B;  2BCC D;  1IQC A;  4FA4 A;  5DJQ B;  3ZIY A;  2GC7 D;  1KX2 A;  5B5E V;  2GC4 D;  1CYJ A;  3PXW A;  3ZBM A;  1CRY A;  1CYI A;  1HCM A;  1NNO A;  4IL6 V;  4KMG A;  1YNR A;  2XTS B;  3H1J D;  1CNO A;  1KYO D;  3SVW A;  3H1H D;  2BLF B;  2C2C A;  3HQ7 A;  5CIE B;  1C2N A;  3C2C A;  1C52 A;  2BCN B;  2DVH A;  3ZOW A;  1BL9 A;  1VYD A;  1FCD C;  1CIH A;  3L70 D;  4FA5 A;  1CSW A;  4JCG A;  1YEB A;  4FAN A;  4WQA A;  3HQ9 A;  1CXA A;  4L3H A;  1QN2 A;  4U3F D;  1ZRT D;  1GU2 A;  3ZOO A;  3WC8 A;  2V07 A;  1NIR A;  3PH2 B;  3O5C A;  3WFC C;  1I55 A;  1CSU A;  1KV9 A;  5CIB B;  1AOQ A;  1YEA A;  1R0Q A;  5CIH B;  4O1W A;  4EIC A;  5DFS A;  2C9X B;  1K3H A;  4L3G A;  1AKK A;  4AX3 A;  2LIT A;  2OZ1 B;  4AAM A;  2BH4 X;  2BH5 X;  1L0L D;  3TGU D;  1DII C;  1DW0 A;  3CX5 D;  1CRH A;  3WFB C;  1L9B C;  4YE1 A;  3OA8 B;  1N15 A;  1HZV A;  1E2R A;  2A06 D;  3WUI A;  1L9J C;  3CXH D;  1SQQ D;  4J20 A;  1SQP D;  1NMI A;  1SQX D;  1F1C A;  1U75 B;  5H2F V;  1HZU A;  3OCD A;  2YCC A;  1J3S A;  1AYG A;  5CIF B;  1QKS A;  3D0W A;  5DJQ C;  1KB0 A;  1YCC A;  3TYI A;  3PXS A;  1DW1 A;  1H9Y A;  1YFC A;  2CE0 A;  3ZOY A;  4WQ9 A;  1CTY A;  2PCB B;  155C A;  3L71 D;  4PW9 B;  1C6O A;  2ORL A;  2PAC A;  1OCD A;  2FYU D;  1C75 A;  1E29 A;  1RZ6 A;  2D0W A;  1H31 A;  4D6T D;  4Y5R A;  2FWL A;  4Q5P A;  5E79 V;  1M70 A;  1FHB A;  1MZ4 A;  3A0H V;  4XXL A;  1CHH A;  2D0S A;  4H0J A;  3WFE C;  1CRC A;  1N90 A;  2AXT V;  1F1F A;  3H1K D;  1NTZ D;  2JTI B;  1CSX A;  5DF5 A;  3KZI V;  3DR0 A;  1AOF A;  1MG3 D;  1FOC A;  1CRG A;  2C1D A;  1S5L V;  2DGE A;  4LJI A;  3CX5 W;  1C7M A;  1H33 A;  3RLM A;  2FYN B;  3CP5 A;  1W5C T;  2CE1 A;  1RZ5 A;  3DP5 A;  5CIC B;  1DW2 A;  4EIF A;  4PD4 D;  1I6D A;  4FAV A;  4PJ0 V;  4N0K A;  4FB1 A;  2N18 B;  1RAQ A;  5IY5 1;  1H9X A;  3L75 D;  2ZOO A;  3OA8 A;  2MTA C;  1CIE A;  3VNW A;  1EB7 A;  4P4Q B;  3WU2 V;  3CYT I;  3SLE A;  1CIG A;  2C1U A;  3CWB D;  1NU1 D;  1FJ0 A;  2L4D A;  1I6E A;  3O20 A;  1QL4 A;  4H0K A;  3WFD C;  1HH7 A;  1GIW A;  3ZOX A;  3HQ8 A;  2GB8 B;  5KLI B;  1WEJ F;  4WQ7 A;  5CIG B;  1M60 A;  1W2L A;  4L1Q A;  1CYC A;  2B11 B;  1KB9 D;  1PPJ D;  5AUR A;  1K3G A;  1HJ4 A;  1MG2 D;  1B7V A;  1CRI A;  4EIE A;  1FI3 A;  2QJY B;  1CSV A;  4V2K A;  1C6S A;  1COT A;  5CYT R;  1IRW A;  1ETP A;  4AAO A;  1GQ1 A;  1KYO W;  2QJP B;  5C0Z A;  1KIB A;  2V08 A;  1COR A;  3M97 X;  3JBT B;  1H32 B;  5B6Q A;  1GDV A;  1E8E A;  2YQB A;  1GKS A;  1RAP A;  4NFG B;  5KKZ B;  2GIW A;  2CA3 B;  1YIQ A;  2ZXY A;  1YIC A;  4UB6 V;  3A0B V;  1CRJ A;  3NWV A;  3H1L D;  3VYM A;  3A9F A;  1HRC A;  1BCC D;  3O1Y A;  4WQD A;  3VRD A;  1CHI A;  3L4O A;  2C1V A;  1QYZ A;  2N18 C;  3CU4 A;  1I8P A;  1N9C A;  1CED A;  1GJQ A;  5KAF V;  1LS9 A;  2AI5 A;  2I8F A;  1CXC A;  2B12 B;  2PCC B;  4WQE A;  1BGY D;  3BCC D;  3L74 D;  1NTK D;  5GTH V;  4MU8 A;  2LIR A;  4WQB A;  3OCD B;  4FA9 A;  1ZZH A;  1HRO A;  1U74 B;  1L0N D;  2B0Z B;  2OZ1 A;  1CIF A;  5EXQ A;  3L73 D;  1KX7 A;  1JDL A;  3X39 A;  3CXH W;  2MHM A;  1IZL 0;  2JQR A;  4WQ8 A;  4PWA A;  1M6Z A;  1IRV A;  3RMZ A;  1CHJ A;  3ZCF A;  4K3I A;  1C2R A;  1YTC A; 
#chains in the Genus database with same CATH homology
 2N9J A;  1H31 B;  2ZON G;  1DW3 A;  2B10 B;  5GTI V;  1P84 D;  1I8O A;  2C8S A;  1HJ3 A;  1H32 A;  4WQC A;  1CTJ A;  1I5T A;  5KAI V;  2BGV X;  1A2S A;  1OAE A;  2YK3 A;  4O1Q A;  3NBT A;  1CO6 A;  351C A;  4QAO A;  5C9M A;  1SQV D;  2QJK B;  4AAL A;  1IO3 A;  2C1D B;  2N9I A;  3DMI A;  1CC5 A;  2FRC A;  1EZV D;  1A8C A;  1S6V B;  2AIU A;  1QL3 A;  1LC2 A;  1H33 B;  1PP9 D;  3RN1 A;  1I54 A;  2N3B A;  1FI7 A;  2CA4 B;  1N50 A;  5B66 V;  5KLV D;  2YIU B;  3ORV A;  5TIS V;  1NTM D;  4GYD A;  451C A;  4AAN A;  1DVV A;  1NML A;  2BPB B;  1LFM A;  2EXV A;  1FI9 A;  3RN0 A;  1HJ5 A;  1BE3 D;  3NBS A;  4DY9 A;  3L4M A;  2N3Y A;  1CCH A;  1DIQ C;  1LC1 A;  1A56 A;  3MK7 C;  5CID B;  2ZBO A;  2ZZS 1;  3L72 D;  3SWS A;  1CTZ A;  4XYD B;  2B4Z A;  4RSZ A;  3PXT A;  1CCR A;  2HV4 A;  3HQ6 A;  2VHD A;  1SQB D;  3O0R C;  1DT1 A;  4GED B;  4EID A;  1DVH A;  2CXB A;  3SXT A;  3H1I D;  1LMS A;  1H1O A;  3SJL A;  2IBZ D;  1C6R A;  1WVE C;  4FA1 A;  4UB8 V;  3MK7 B;  2BCC D;  1IQC A;  4FA4 A;  5DJQ B;  3ZIY A;  2GC7 D;  1KX2 A;  5B5E V;  2GC4 D;  1CYJ A;  3PXW A;  3ZBM A;  1CRY A;  1CYI A;  1HCM A;  1NNO A;  4IL6 V;  4KMG A;  1YNR A;  2XTS B;  3H1J D;  1CNO A;  1KYO D;  3SVW A;  3H1H D;  2BLF B;  2C2C A;  3HQ7 A;  5CIE B;  1C2N A;  3C2C A;  1C52 A;  2BCN B;  2DVH A;  3ZOW A;  1BL9 A;  1VYD A;  1FCD C;  1CIH A;  3L70 D;  4FA5 A;  1CSW A;  4JCG A;  1YEB A;  4FAN A;  4WQA A;  3HQ9 A;  1CXA A;  4L3H A;  1QN2 A;  4U3F D;  1ZRT D;  1GU2 A;  3ZOO A;  3WC8 A;  2V07 A;  1NIR A;  3PH2 B;  3O5C A;  3WFC C;  1I55 A;  1CSU A;  1KV9 A;  5CIB B;  1AOQ A;  1YEA A;  1R0Q A;  5CIH B;  4O1W A;  4EIC A;  5DFS A;  2C9X B;  1K3H A;  4L3G A;  1AKK A;  4AX3 A;  2LIT A;  2OZ1 B;  4AAM A;  2BH4 X;  2BH5 X;  1L0L D;  3TGU D;  1DII C;  1DW0 A;  3CX5 D;  1CRH A;  3WFB C;  1L9B C;  4YE1 A;  3OA8 B;  1N15 A;  1HZV A;  1E2R A;  2A06 D;  3WUI A;  1L9J C;  3CXH D;  1SQQ D;  4J20 A;  1SQP D;  1NMI A;  1SQX D;  1F1C A;  1U75 B;  5H2F V;  1HZU A;  3OCD A;  2YCC A;  1J3S A;  1AYG A;  5CIF B;  1QKS A;  5DJQ C;  1KB0 A;  1YCC A;  3TYI A;  3PXS A;  1DW1 A;  1H9Y A;  1YFC A;  2CE0 A;  3ZOY A;  4WQ9 A;  1CTY A;  2PCB B;  155C A;  3L71 D;  4PW9 B;  1C6O A;  2ORL A;  2PAC A;  1OCD A;  2FYU D;  1C75 A;  1E29 A;  1RZ6 A;  2D0W A;  1H31 A;  4D6T D;  4Y5R A;  2FWL A;  4Q5P A;  5E79 V;  1M70 A;  1FHB A;  1MZ4 A;  3A0H V;  4XXL A;  1CHH A;  2D0S A;  4H0J A;  3WFE C;  1CRC A;  1N90 A;  2AXT V;  1F1F A;  3H1K D;  1NTZ D;  2JTI B;  1CSX A;  5DF5 A;  3KZI V;  3DR0 A;  1AOF A;  1MG3 D;  1FOC A;  1CRG A;  2C1D A;  1S5L V;  2DGE A;  4LJI A;  3CX5 W;  1C7M A;  1H33 A;  3RLM A;  2FYN B;  3CP5 A;  1W5C T;  2CE1 A;  1RZ5 A;  3DP5 A;  5CIC B;  1DW2 A;  4EIF A;  4PD4 D;  1I6D A;  4FAV A;  4PJ0 V;  4N0K A;  4FB1 A;  2N18 B;  1RAQ A;  5IY5 1;  1H9X A;  3L75 D;  2ZOO A;  3OA8 A;  2MTA C;  1CIE A;  3VNW A;  1EB7 A;  4P4Q B;  3WU2 V;  3CYT I;  3SLE A;  1CIG A;  2C1U A;  3CWB D;  1NU1 D;  1FJ0 A;  2L4D A;  1I6E A;  3O20 A;  1QL4 A;  4H0K A;  3WFD C;  1HH7 A;  1GIW A;  3ZOX A;  3HQ8 A;  2GB8 B;  5KLI B;  1WEJ F;  4WQ7 A;  5CIG B;  1M60 A;  1W2L A;  4L1Q A;  1CYC A;  2B11 B;  1KB9 D;  1PPJ D;  5AUR A;  1K3G A;  1HJ4 A;  1MG2 D;  1B7V A;  1CRI A;  4EIE A;  1FI3 A;  2QJY B;  1CSV A;  4V2K A;  1C6S A;  1COT A;  5CYT R;  1IRW A;  1ETP A;  4AAO A;  1GQ1 A;  1KYO W;  2QJP B;  5C0Z A;  1KIB A;  2V08 A;  1COR A;  3M97 X;  3JBT B;  1H32 B;  5B6Q A;  1GDV A;  1E8E A;  2YQB A;  1GKS A;  1RAP A;  4NFG B;  5KKZ B;  2GIW A;  2CA3 B;  1YIQ A;  2ZXY A;  1YIC A;  4UB6 V;  3A0B V;  1CRJ A;  3NWV A;  3H1L D;  3VYM A;  3A9F A;  1HRC A;  1BCC D;  3O1Y A;  4WQD A;  3VRD A;  1CHI A;  3L4O A;  2C1V A;  1QYZ A;  2N18 C;  3CU4 A;  1I8P A;  1N9C A;  1CED A;  1GJQ A;  5KAF V;  1LS9 A;  2AI5 A;  2I8F A;  1CXC A;  2B12 B;  2PCC B;  4WQE A;  1BGY D;  3BCC D;  3L74 D;  1NTK D;  5GTH V;  4MU8 A;  2LIR A;  4WQB A;  3OCD B;  4FA9 A;  1ZZH A;  1HRO A;  1U74 B;  1L0N D;  2B0Z B;  2OZ1 A;  1CIF A;  5EXQ A;  3L73 D;  1KX7 A;  1JDL A;  3X39 A;  3CXH W;  2MHM A;  1IZL 0;  2JQR A;  4WQ8 A;  4PWA A;  1M6Z A;  1IRV A;  3RMZ A;  1CHJ A;  3ZCF A;  4K3I A;  1C2R A;  1YTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...