3PHBE

Crystal structure of human purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
PTLMENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Purine nucleoside phosphorylase
total genus 94
structure length 288
sequence length 288
chains with identical sequence Q, S, T, U, Y
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phbE00
4BMXA 1U1GA 1RSZA 5CXQA 1JE1A 3E9RA 2QSUA 2OECA 4QFBA 1B8NA 2OXFA 3PNSA 1K27A 3BGSA 5ETJA 1PR4A 3P0FA 4U2KA 5CCDA 1ULBA 1YRYE 2ON6A 4M1EA 3OZCA 3UAZA 3K8QA 4TXNA 4F2PA 3ENZA 3C74A 3UAWA 1PR5A 3UAVA 4IP0A 4TTIA 1A9TA 1PBNA 1ODKA 1Z36A 1FXUA 3SCZA 3FWPA 2QTGA 3FNQA 1JP7A 1ODLA 4NSNA 3OF3A 5KB3A 4JOSA 5DK6A 3EUEA 4DA6A 5CCEA 3KUKA 1TD1A 4DABA 3O6VA 5EPUA 4OY3A 4JP5A 2QDKA 4LDNA 1PF7E 3BSFA 1M73E 1JDVA 2A0WA 1V2HE 4LNAA 4G8JA 4OF4A 4E1VA 1A9RA 4GKAA 1JPVA 3MMSA 1Y1QA 1V3QE 2OC4A 4BMZA 3KVVA 4L5AA 2H8GA 4MCIA 3PHCA 5F76A 1T8YA 5EFOA 1Y1SA 3UAYA 2A0XA 5F78A 3DF9A 1TCVA 1NW4A 1Z35A 1OUMA 1V48A 4TS9A 1SJ9A 2OC9A 3EMVA 1U1FA 3EEIA 4G89A 1RFGE 3PNPA 3MB8A 4DANA 4QEZA 4R2WA 1V4NA 5B7NA 4WKPA 4QASA 1RXSA 4YO8A 1OTXA 1Z37A 5IFKA 1PKEA 1LV8A 2Q7OE 1V45E 4D8VA 2XRFA 2GUWA 1T8WA 5EUBA 2QPLA 1Z39A 4WKCA 4PNPA 1ZOSA 1Z5NA 4L6IA 3DDOA 1U1CA 4F3KA 1K9SA 4YNBA 1YQQA 3FOWA 4JWTA 1U1EA 4M7WA 1G2OA 1C3XA 3INYA 1ODJA 1Z34A 2HSWA 1VMKA 4DARA 4YMLA 1I80A 5B7QA 1RYZA 1RXUA 1Z38A 5CYFA 4K6OA 4R31A 4TTJA 1CG6A 2HN9A 1JDTA 3D1VA 1A9PA 4LNHA 2I4TA 2I8AA 1JDSA 1CB0A 3LGSA 4OJTA 5FAKA 1ULAA 4WKNA 4DA8A 1A69A 1YBFA 3NM4A 5F7OA 3UAXA 4G41A 3E9ZA 3KVRA 4D8YA 4NS1A 1Q1GA 1VFNA 1JDZA 4L5YA 1VHWA 1TGYA 4TS3A 1SD1A 3KHSA 3IEXA 3BL6A 4LZWA 3O4VA 1JE0A 1ODIA 4KN5A 1RR6A 1RXCA 4L5CA 1Z5OA 3LBAA 1PR1A 4F1WA 1V41E 3PHBE 1A9SA 2A0YA 3KU4A 3OOHA 2P4SA 3EUFA 4QAQA 4M3NA 1SQ6A 3FAZA 3OCCA 3NM5A 3K8OE 3GGSA 4OGKA 2AI2A 1WTAA 4L0MA 1OU4A 4P54A 4QATA 1N3IA 5F7JA 3DP9A 4TYMA 1LX7A 1PR0A 3F8WA 1TCUA 1NC1A 4UC0A 3E0QA 1Z5PA 1Y1RA 1T0UA 1OVGA 1PR2A 1T8SA 4GLFA 4DAOA 1RT9A 2QTTA 1QE5A 4BMYA 1JDUA 5CXSA 4GMHA 1B8OA 1Z33A 1PW7A 1NC3A 3FUCA 1PWYE 3OPVA 3TL6A 4D9HA 4I2VA 1OTYA 1JYSA 3U40A 1OV6A 3ONVA 1PK7A 4H1TA 3UT6A 1YR3A 3ODGA 3T94A 4WKBA 1ECPA 5B7PA 3KVYA 4QARA 4OEHA 4FFSA 3IOMA 1RXYA 1ZL2A 5C80A 3GB9A 4MCHA 1XE3A 3OOEA 5F7ZA 3DPSA 5CYGA 5IU6A 1PK9A 5B7GA 4TXJA 3DJFA 5K1ZA 3OZEA 3LA8A 1Y1TA 3OZDA 4F2WA 1SD2A 4WKOA 2PGAA 4EB8A 1A9QA 3P0EA 4DA7A 1TGVA 4TXHA 1RCTE 2AI3A 2RJ3A 2ISCA 4OGLA 2A8YA 1VHJA 4F3CA 4PR3A 2AC7A 3NBQA 1K3FA 3FB1A 1YQUA 4X24A 2HRDA 3BJEA 4EARA 1PR6A 5F7XA 4RJ2A 4NY1A 4R2XA 2B94A 3OZBA 1U1DA 5JPCA 4D98A 4TXMA 1Y6RA 1A9OA 5I3CA 2IQ5A 4TXLA 4DAEA 4D8XA 4ECEA 5F73A 2HWUA 4DA0A 4TTAA 5F77A 4MARA 4BN0A 4YJKA 2AI1A 1T8RA 2BSXA 4LKRA 4GLJA 1LVUA 1Y6QA 3NM6B 3QPBA
chains in the Genus database with same CATH superfamily
1C9MA 5IJXA 3NATA 1ZAKA 1HLPA 1SBIA 1EFRD 3ASVA 5C8VA 1ZQ1A 3G8CA 1XEXA 1RWNA 5FP0A 2WNIA 3E2PA 4V0ME 3VU8A 5FA6A 2HRBA 1FQWA 1P29A 1LSUA 3AJ8A 5ITZB 1DC7A 1MNAA 1UBRS 3ORSA 4N49A 3KSRA 3T3HA 3NBFA 4U7FA 3W5BA 2C5EA 5B4TA 3WL3A 5JSHA 4KO1S 3WGOA 3OEYA 2O6HA 2J3LA 3NHYA 3LDFA 121PA 4N1AA 3P9XA 1WU7A 1E1CA 2J0QA 1GZ6A 2OR3A 3QMWA 2R4TA 3TD2A 5AMXA 4WECA 1U3VA 4G5FA 3OLXA 5FYDA 1Z2NX 1HTWA 3CLSD 4EJSA 1D2HA 1DDGA 5COAA 1MOPA 1UK9A 1ULBA 2JIZA 3WV5A 4C2AA 3IMEA 3VSEA 2QN9A 3FROA 3PXAA 1E79D 4DEYA 2ZYVX 4L08A 1L7EA 2OHGA 3LT4A 4JEIA 4HH4A 4HX2A 2VP3A 2YFKA 1ES9A 1ZJWA 1Q1AA 3AI3A 2OPHA 1AN0A 1EFLA 4KO3S 1TK2A 1N3LA 4LI3X 2FZKA 1JG1A 2C5FA 5C18A 3S1SA 1FMTA 2VJMA 2XTZA 2J67A 1SG0A 2XIQA 2YBDA 4Q9DA 5H83A 3UUGA 1M34B 3C3DA 3NV9A 3PF8A 3QE2A 4MS1A 1A9TA 1PDWA 3COVA 1YS7A 3NBZC 1PYGA 5EKUA 1PBNA 2CB9A 5FL3A 3TIXB 1M9NA 5BQOA 3D8HA 6AT1A 5BSMA 1KGDA 1GZHB 2ZTHA 1YR8A 4HG2A 3STYA 3GVXA 3WYDA 2I2DA 2AFIA 2C2BA 3I01M 1YZVA 3ENVA 3PRKE 1ODLA 4MVXA 5F52A 1NONA 3M1LA 4ZAZA 3O8BA 2RBKA 2A6PA 1QU3A 2QTVB 5HSGA 1SZCA 4EIWA 5FLXA 3X1DA 1L7NA 2C00A 2AR0A 2MR6A 3O1HB 4LE1A 3ZCRA 1YI8A 3JTMA 4KXUA 3B6MA 4NU0A 4EFDA 4CT5A 1QB8A 2GYWA 2PXCA 3DTNA 2VJBA 3ESRA 3H5RA 3KUKA 3QENA 1HTBA 5FBVB 3PC7A 4EJFA 1P9NA 2FUG6 4C87A 4BUJA 1Q3HA 3EIXA 4LTNA 4RPLA 4DABA 3OU2A 2GZDA 1U1IA 3MILA 4JASB 4WAUA 3GX1A 1NQUA 3MT8A 3OBBA 4FD3A 4NE7A 4REMA 5FUWA 1G0NA 5LBUA 4OK6A 5TS2A 4DSTA 1QSGA 2O1WA 3ANXA 4DCMA 1MPTA 6REQA 3CCFA 4HLQB 4ZVMA 2PS3A 2HCTA 5K8UA 5FCDA 2AZXA 2FG7C 4CYMA 3TPFA 5CB8A 3BSFA 4UEWA 3C14C 5KNBA 3R0XA 1OOEA 1DWUA 2ZDGA 1DJLA 4WLFA 4MMYB 1E9VA 3G2IA 2QL5A 4ZMSA 3HUFA 1NQAO 1YUMA 2F67A 2V45A 4L50A 5KQLA 5L51A 1T9ZA 2IUYA 1F4PA 1SUDA 2WRZA 3Q7RA 1SHTX 3TNDA 1SZDA 2WDPA 4E2FA 3K96A 1LTQA 2G71A 2BAGA 3T5GA 1H1DA 3P32A 4FI3F 2FZ4A 5TEWA 4L73A 2O8CA 1TLLA 4LXYA 4BCDA 1DAMA 3ELYA 2Q8QA 3FHJA 3LQQA 3FLEA 1RE0A 4I5DA 1EFVB 4QYTA 4PX2A 1PSWA 5AM0A 5DJ5A 5BMVA 1UKYA 2YQ5A 3WHPA 2Q6KA 3PT9A 1GPUA 1G2QA 4Q1CA 2BMDA 4ZI7B 3HBJA 3N2LA 4CL8A 3F67A 1SU8A 4WXEA 2A0XA 4IQ4A 4JEHA 1SKBA 4IZ6A 1W34A 5B36A 1FMLA 2R62A 2PU5A 1Z45A 3VR6A 1E5TA 4EHBA 1NW4A 1GUFA 1CWUA 4DA9A 4DR7B 5BMOA 4TM7A 2AOTB 4FT2A 5A6SA 1CQJA 5L7TA 1WHTB 1M83A 5BYKA 3RC9A 3RRNA 1TU3A 2AKEA 2TSYB 4X94A 4BVLA 3N58A 4YRPA 3KYJB 5G2OA 3PTZA 2AN5A 4WN9A 3Q8LA 4G89A 3LM8A 5AK3A 4KX5A 4IDNA 3AG5A 5H0IA 2A7XA 1X94A 4Y6LA 3H1PA 1VLMA 4HX9A 4QRDA 1HC7A 4QRHA 4BLQA 3F9IA 2IOHA 1KHHA 2PGJA 2QXUA 2R86A 3WRVA 1BCSA 5KVVA 2NP6A 2H4FA 4XB1A 3A37A 1VP9A 2WYHA 3HDHA 4MQEB 3NRJA 4IJMA 2XZOA 4J1QA 3MWDB 2YMQA 2AE1A 3NDJA 1JHVA 1TYDE 1MX3A 1JAXA 2DR3A 1M2WA 4CM8B 3G6WA 3SBOA 5IBRA 3FD8A 2EERA 4DQ0A 1OHHD 1BE0A 2Y1DA 3I8OA 4CHGA 3HZZA 3IKVA 2FZGA 2FPXA 2EP8A 5HJ7A 4JIMA 1RKXA 4YUZA 3ACBA 4G5RA 4FMBB 1NURA 1WZNA 1DRVA 5IAKA 5KMGA 2FSVA 1U5AA 5LP6C 5I6DA 2BFWA 2VF5X 4U7TB 2QN8A 2MMGA 4D4LA 4KPYA 2X0IA 1YJQA 3UUFA 1FFSA 3CF4A 4KPUA 1U6KA 4F4FA 4ZYLA 4ITVA 1IEVA 5HM8A 3TPZA 3C85A 3C5WP 4MRRA 5M7EA 3CUKA 3G7UA 1A77A 1GNPA 2Q2QA 2ZBPA 4D80A 3OCJA 5DSZA 3A1VA 1JSZA 2BEJA 4FM9A 2J48A 3JQBC 1T9KA 2HSWA 2I62A 4K5QA 5HFNA 2PBFA 3B7GA 4RAQA 4TTSA 1AGXA 1RHKA 4MAAA 4F85A 1TVKA 2O50A 1EWQA 4RTPA 3ZV7A 2AZMA 1C7JA 3C3YA 1YFLA 5A9RA 2WIBA 5K0ZA 4EO9A 3EVBA 4MJ3A 4CF6A 3DB1A 2VSOA 3RFXA 3T9EA 2JA2A 2MSLA 1Y6JA 1AY0A 3L0BA 1IPHA 1NF8A 5AKEA 3HV0A 4ZOLF 1DRUA 1X7YB 1XGKA 4FZVA 3SQXA 3ECAA 4IRXA 4BJ5A 1JU4A 2R6ZA 2UUBB 3R7FA 1BQEA 1NHGA 3KELA 2GLXA 1EUCB 4R0NA 2EFCB 1KJNA 4I8DA 1WAMA 3EIWA 5JG7A 3PWZA 1Z08A 2BFCB 3U9SA 1YNOA 3DNPA 3LWNA 3Q9LA 2CVPA 4IXTA 4MZXA 5GJWC 1CFZA 3SHTA 1BX1A 2FE4A 1R6DA 1FYEA 1X8XA 2JCSA 1H5QA 1I6LA 2XECA 3QQPA 4H0FA 1N9KA 2BFMA 1KC1A 5AXCA 4D2IA 5IT5A 1CYEA 1EPUA 5IAAA 1I4DD 3TMAA 4R2LA 1JQEA 1I9CA 3DMTC 1W96A 1KXJA 4EO7A 1OLSB 5JXHA 4QOJA 3A1UA 1M2EA 4FGUA 3WTBA 1UKBA 5B6JA 2VK1A 3E3MA 4NS1A 4L5JA 5H8WA 2W2OA 4YRBA 3FCCA 3L84A 2GT1A 5IABA 5D85A 1ULZA 4MVJI 3L7LA 1MB0A 4HMQA 3WX0A 3BGVA 3OCXA 3OLCX 2EG5A 2WTUA 2WAAA 1DDIA 3A6PC 4GPAA 2NIPA 3QUTA 3OZFA 4ZZIA 2L42A 2GPTA 1WL8A 3FI0A 2VDKB 2POQX 1MXFA 1U63A 3D7SA 3U56A 4TLBA 1ZC4A 3L1VA 3RVJA 4C4XA 1DRWA 3KK0A 7AT1A 4YN3A 2IHKA 2A4MA 2VNSA 2WF5A 4CBVA 4K9DA 3WGNA 1F12A 1YZHA 5DU2A 3D1JA 3K9QO 2XWJI 2ZZMA 2YJ3A 1SUEA 1RWOA 1VYTA 3DFFA 3FFXA 2IS4A 3K0FA 4BN5A 4QYSA 2J9RA 4FDAA 5JEEA 1YQTA 1YOVA 4MIKA 4IIEA 3I39X 1GITA 3ZV5A 3G82C 3HQ4O 4M37A 1K0UA 5DM0A 3AVWA 3I37X 3TAHA 1P1BA 4MWOA 3BSYA 3VBCA 1ZN8A 7YASA 5FOWA 2Q41A 3I6MA 2F9LA 4G4SP 4KP7A 2QF7A 1SIWA 3LDHA 2A78A 3SDBA 2ZB7A 3I32A 1JFVA 1Y7TA 1E5LA 4RULA 2ESRA 2QTCA 4GP7A 4TV9F 4B0PA 4RTMA 1IE3A 5TY0A 4WXYB 1I4TD 5I45A 1I51A 1PN3A 1PS9A 3VC3A 1MAVA 4KQJA 4V0KA 2D5LA 5K8VA 1AKNA 1RBZA 3F8WA 3IX7A 4HKTA 1XU7A 4QDKA 1K3UB 1R50A 4GX5A 4US2R 1JI3A 1PX0A 1RVDA 1GXSB 3IDFA 3UFBA 1YI1A 2HQOA 1NRXA 1YQ9A 2R47A 3T3PB 4E6EA 2J85A 5ADVA 3ULKA 1A88A 5HVNA 3H7IA 3ZD6A 5AW2A 2PWPA 2GZSA 3R0IA 4NZYA 1YJCA 3W4IA 2OHJA 3C4JA 1SURA 3A7DA 1WE2A 4BRUA 4RMJA 1QX4A 1JDUA 3LQ4A 2A14A 1HLFA 2Z95A 4MW4A 5A4KA 1BCSB 2P6NA 3I58A 3LWBA 1CUEA 3N86A 2DTXA 4DCSA 4RYLA 1J2TA 2FHPA 1KQ3A 1NJGA 4G65A 2ECQA 1YZNA 4P4LA 1RCFA 5K4GA 2Q5OA 3AIMA 1AZTA 3DOFA 4PLZA 4D9HA 2FJ0A 1GLGA 2G72A 2UZ1B 1MV5A 4MUEA 5KIAA 3V5NA 1SHZA 1N92A 2R7NA 3LWZA 1GKLA 1W0KA 3ETEA 5CDGA 3LWDA 4N9QA 3UIEA 1OTYA 3L18A 4YALA 5KHLB 4JLPA 4S3MA 2Q4OA 3KD2A 3U40A 1MCZA 1WDWB 2FN8A 5EHQA 2EZ8A 1Q0PA 4YAKA 4ER5A 1PUIA 3LLCA 1C1HA 3MERA 3WB2A 1DWOA 1W48A 5HOEA 2CVQA 3FLMA 1PX2A 1S2MA 4V3BA 4LXXA 4X63A 3W6NA 4ALMA 4YLYA 1FUYB 2P69A 7ADHA 1FXWA 4BNHA 4LYGA 5B7PA 1QCZA 1RWQA 4WCFB 1Z68A 4ZK6A 2G76A 5FLEX 4UD6A 2ZE7A 1GDTA 3D3WA 2A88A 4QARA 3RK4A 4KPUB 3W9UA 1GZ7A 4IQ8A 4MR9A 3VHRA 1CETA 1M8KA 4LXHA 3OE7D 4DDWA 5HYVA 4Q82A 16PKA 3H5TA 1QVAA 4RENA 5CB4A 4AF7A 2PV0A 3A3NA 1ONSA 1JDBB 3NETA 3PB3A 2OVFA 2ZT8A 1Y3IA 2KB0A 2IP4A 2E21A 3GJRA 5ALHA 5G53C 2VBIA 4GOND 5FO1A 3UWPA 2RBEA 3FYSA 3VSAA 4EUNA 3LL7A 1ESDA 2AXNA 3MTIA 4F5YA 1NX9A 5GGYA 4EYSA 7REQB 1TIPA 1O1YA 2TS1A 2GZRA 1H9AA 2JH9A 4KXQA 1LY1A 4J49A 4YQZA 4UQOA 3R9KA 2FWMX 2O8BB 3BH0A 1AJEA 1TC1A 3E03A 3EIFA 1L3IA 4AMUA 5IAJA 3T1YB 4CM1A 3DHNA 1QJ4A 3GVCA 4MW7A 1FY2A 2H0QA 2XYGA 2FQWA 1X7XA 2D5CA 4NQRA 4D4MA 1AA6A 2P91A 1K8XB 1TZKA 2WTXA 2VPXA 3CC8A 2AI3A 3G0DA 4QPDA 1N1EA 3GGGA 4UD2A 4NV3A 3NHFA 2IA5A 4LJSA 4QDZA 3IP6A 1ZM7A 4F1KA 4F5WA 1GOTA 5K0CA 2GB4A 3RSFA 5CVJA 1J20A 5FTWA 4HB4A 4LOJA 4ZVPA 3AJDA 4KLZA 3VR4D 2FHSA 3MTQA 4YRDA 5LLSA 3QK7A 3RM3A 4Y6SA 1ZMOA 3JD0A 4GM1A 3CLHA 3TOZA 4PXSA 4A92A 1C9EA 1U2RA 2QZZA 2IY9A 4ZOEA 4C3ZA 4BJHB 4X66B 1W2HA 2ZP1A 5EOVA 4TLMB 2GAIA 3CLRD 1LLCA 1BFDA 3BMNB 2AOXA 4P3XA 2E6KA 5CTJA 5FJJA 4NMLA 4ARCA 2BGWA 4JLKA 1FSGA 1XO1A 3CIFA 2W2NA 3ICVA 4DV5B 4DSOA 2PDAA 3O8OB 5ADWA 4I1IA 1XDZA 2PS9A 3KAQA 4GEGA 1PNTA 2G9RA 4DJDC 3U3JA 1D4OA 3C3WA 2WTMA 1RYBA 3HJCA 3Q2OA 5JRJA 2DAPA 1G5QA 1P2FA 1UXGA 3KJXA 3PJRA 1MFPA 4KE6A 5FOUA 3ZNPA 5CM8B 2QAIA 4ZRMA 1C4WA 4CI0B 3JQ7A 4I66A 4YASA 5DB4A 2R11A 3FPKA 3IOEA 1A7JA 4A8PA 5HWSA 3R9XA 3DMDA 4MVCA 3V4OA 3KYDB 1ENYA 2YCLA 2ZWVA 3PGKA 5FFNA 3WKAA 4CV2A 5KYYB 5M04A 2IH2A 3F8TA 4TYWA 3ZKWB 3E3OA 3CNLA 3EISA 1BRMA 4Q02A 3ZCVA 3CVYA 1XPUA 3JRNA 3D4PA 5D51S 2CNWD 1R6TA 5AP9A 4WJLA 3Q3JB 2OCAA 1AKQA 2VJDA 2H18A 1LSSA 4LY9A 2VYVA 4OD0A 5DIZA 1BS9A 2ZPAA 3ZUPA 2PAAA 4A6XA 4CQMB 1N33B 2WFLB 4FDTA 1E1DA 2I91A 1YFZA 3T3NA 1V11B 3I4CA 3PE4A 4O4HA 3Q10A 5LP6B 1QQ5A 1DC4A 3FCUB 1NRJB 4BO6A 2WE8A 3FOBA 3EQ7A 3P0FA 4QOEA 3TFWA 4BU0A 3DLHA 4JB8A 2VS1A 3VGJA 3LO5A 3TGWA 3T1VA 4KFCA 3R3JA 1V9LA 1F6DA 2HBQA 3OMWA 4PTYA 4Z4QA 5KVQA 5DGTA 1SRQA 2G04A 5K0TA 3RC8A 2QRMA 1XDSA 1MO2A 2DHEA 4RA6A 3WSVA 5HNKA 3DJYA 3HDYA 3FOFC 3IVGA 3FPAA 3GDHA 3DWIA 3CB2A 3WRXC 4BMDA 1C8KA 2PO5A 3BFJA 3UMCA 5DHRA 1EEXB 1GN8A 1TKBA 4EG3A 3QWHA 4G36A 1W4BA 3L43A 3E8SA 1J49A 4J0JA 4CPDA 1PW5A 3RTEA 2JFFA 1Y5NA 2FNAA 4NZZA 4U3JB 2BONA 3FFAA 3UAWA 3NANA 2A86A 4MCAA 2VBCA 4LCEA 1Z88A 2PUTA 5B1SA 1AUOA 5J40A 3UAVA 2COEA 1UODA 2B0JA 2XLBA 2VQEB 2ENUA 5BSEA 5BWCA 1X9GA 4BFSA 4GBED 4UUAA 1W5TA 2C4MA 2FMKA 2GA9A 3CH7A 4P98A 5BWOA 4M9CA 2QRUA 3KT3A 1QGED 3ZDQA 2EQAA 3DO5A 3LCCA 3PUKA 3CINA 4H7KA 4RO0A 2GWRA 1M2VB 3BX1A 2Z4TA 3O1JC 1G8KA 4GU5A 4R69A 3KOZA 4DRXB 3R5TA 1FPQA 3V8QA 4QFCA 2ZYIA 1ZBDA 3G17A 4N3NA 4NSNA 1QVWA 1UEIA 3H6GA 3KSZO 4LJLA 4W82A 2GHQA 4KFUA 4NVRA 1X2EA 1E6LA 4E7OA 2PGLA 3G0IA 4JR2A 5E0KB 1Q0UA 2IGTA 4H15A 2PIDA 5G0WA 4H7JA 2PZGA 4UE6A 2OA0A 4A8JB 2YRFA 4BC0A 2JNWA 3PKJA 1TTPB 4UM7A 2JLUA 1U3UA 4FDLA 4N3AA 4UUNA 1OLUB 1O97C 4MR9B 3F7OA 3ZDYB 1ILWA 4R1OA 4LYJA 3I3OA 4RV4A 1EXWA 1VIDA 4J0GA 1K5HA 2XXAA 1VPVA 1K4MA 4OGGA 3FPHA 2ZSEA 1C8BA 1ZD5A 2ENWA 3QTTA 4H7DA 4I4TA 3CLUD 3DS8A 3IESA 2ORED 2FVXA 1YWGO 5DRYA 5FBWB 5MN6A 1T9CA 1YMUA 2ACWA 3BXPA 4HAZA 4JGGA 4ZK2A 1LVHA 4AX8A 3PJGA 4N0QA 4RD3A 4XYLA 2A0WA 4L1KA 3H11B 1K6IA 5BQFA 3GU3A 3H18A 5BSFA 3GJ6A 2R1UA 1XKXA 4PSUA 2V03A 1WEKA 3NB0A 3U4DA 4H4DA 2NYAA 3FDZA 1U0OC 4JXZA 1KH1A 1FXSA 3DFZA 3ZHCA 2F00A 1G5FA 1XTQA 3AJ9A 4LYHA 3DMRA 1IIRA 4FTWA 1X7XB 3ZTWA 1TT7A 1Y1QA 2D5IA 2ZT6A 5CK4A 3CJRA 3PGVA 1KWGA 4GT1A 5A3VA 3LHIA 2BI8A 2ZS9A 3RS2A 4D41A 4D0SA 5LZ4A 1FSPA 2MTBA 5IWAB 1Q1QA 3DTVA 3STTA 3AVPA 3QM1A 5E7MA 4HNGA 4JWKA 5CA0F 3REGA 2CL7X 2ZYDA 1SBZA 2GZ1A 3WLJA 3CZ5A 3THRA 1Y4SA 3ASYA 3DF9A 3FMFA 4QEKA 3M4XA 4XQ0A 2HYIC 3OFKA 2V0NA 3UAGA 1T35A 4BX0A 3HFRA 1NQ5A 2FJPA 3H8WA 1OXSC 4TSFA 4BUZA 2XCLA 4ZYWA 2RKWA 1JYFA 4YCJA 2JKVA 2QKYA 3H4TA 4QQNA 3UYLA 1T8UA 2C9MA 2JLCA 3QY0A 3S28A 2CL0X 4LRUA 1A1SA 4ZAYA 4EKIA 2Z4RA 3AVOA 4F9EA 2EV9A 2LTAA 1KPHA 5JNTA 4PPNA 4A2QA 4HLUA 4NU6A 4Q48A 5DYGA 2D5BA 4QEZA 4PIVA 2HR1A 2I76A 3OOWA 1N77A 2VC2B 3VR5A 2HHCA 1ABEA 2H85A 3BORA 4PO8A 1PQUA 1RAHA 1G18A 5DWVA 4BVGA 3QIAA 2DX7A 1DI0A 1KFEB 3KLOA 1Q95A 1SC3A 4IDPA 5JZSA 5DEOA 1FU4A 1QYWA 1IBMB 2HPHA 1U0GA 1UDRA 1Y7LA 2QR3A 3KPJA 3GDGA 4BZXA 2IVFA 5C5CA 1N9GA 2VOEA 4MW5A 5JBIA 3KU1A 2Q4BA 3VTZA 5KYYA 5EP1A 1J07A 3LQ1A 1D03A 4J1SA 4BZQA 1YC5A 1SOAA 5B58C 2ALJA 1I7SB 1CBUA 3N8HA 4CKZA 2HW8A 2JARA 2GTIA 5HW0A 2FETA 3UVEA 1R2QA 1Q16A 3IOYA 2OCKA 3EA5A 4GICA 2PSJA 3KFLA 4Y1RB 2V7QD 4WINA 3N6XA 1GPNA 2J30A 3KSDO 4HHEA 2RH5A 4CQMA 2CLKB 1FDWA 4MVJG 4F3TA 1KK3A 2EEPA 3D6FA 2ZUVA 5DN9A 2ANCA 1TX4B 5ARCA 3IERA 1JTFA 1ZCZA 1F2TB 1YBVA 3GUVA 5LP6A 3ZIAA 2E82A 2R8EA 1PTJA 1DWPA 4LAFA 5IDVA 1UFRA 3H87A 4Y6OA 4D4GA 4BVJA 1I0LA 4WESB 5JYCA 4I4CA 4KXVA 1PGOA 2AUTA 1BWQA 2Q5IA 5JC8A 4HGNA 3DZIA 4FXOA 5ALMA 3QXXA 2GASA 4XQGA 2MWMA 3SEZA 1KU6A 4RA6B 1EDBA 1JQAA 2IXDA 3OZ7A 2CDAA 4L22A 5AI9A 2Q5LA 3SBEA 2H1LA 4GRDA 1KIAA 2GMWA 2X9GA 2RB5A 3DOJA 2ZRLA 2VPTA 4YJDA 1XVIA 1MAWA 3KJFA 2NU8A 3C8ZA 4N5DA 1YS9A 2BE7A 4QKQA 1Z8NA 3TAXA 2YZ2A 2CDCA 4TTJA 4LEIA 1E0KA 3DMHA 1L4FA 1GUAA 1F2VA 1CG6A 1KEUA 3VNVA 5KYWB 1LPSA 2Y99A 2DXIA 4W9NA 3LYLA 4UUPA 1ZGHA 2O14A 3MTDA 4RNCA 4DA0A 1K0FA 1XDBA 1SXHA 1Y4UA 1FLVA 3OY7A 4WW0A 4XWTA 5J5AA 2FV8A 3E5MA 4XDZA 3CF2A 2H1VA 4Z7QB 2FP4A 1RC1A 1CVIA 1KK1A 1W76A 4BNYA 2GVNA 4AZWA 1G6KA 5HTOA 4IJWA 3AUUA 1NG9A 1GP2A 4YGXB 1FFAA 4IFBA 4MW6A 4JH0A 2ZBFA 1J99A 1R5OA 1RRVA 2H7CA 4CKEA 4WE3A 4D9CA 4DRXA 4NULA 4DMRA 3DMYA 1GGFA 4WI1A 4Z99A 2R6FA 3UW3A 2ZI4A 2HNAA 5AHXA 1XUOA 3HEAA 2FMTA 1BOFA 2XUQA 3EA4A 2VTDA 3E9ZA 3I2KA 4ND4A 3ZE2B 4EY7A 1TJ5A 2JFXA 4BRSA 4J8PA 2D1SA 1O58A 3E7DA 2UYCA 3MIZA 1I5RA 1VFNA 5KOHB 2L82A 3LD9A 3I8SA 1KXZA 2YNMD 1Y8QB 2F64A 2JKYA 4C6HA 5CGQB 2MMCA 4RVSA 1N2ZA 2ZJ7A 4NMWA 3CEAA 3HXLA 5F33A 3IUMA 2QX7A 3Q11A 4FI3C 4TVKA 4AMVA 4CV0A 5BR4A 5K2MA 2Y0EA 4L8GA 4UEQA 2IXGA 5DT9A 3LUJA 1Q0QA 1GPWB 1SUFA 3GJ7A 3JZIA 1IJFA 1HQYE 2OV6A 2Q45A 3OCWA 6PFKA 1IEWA 2GCIA 4PGGA 1ZK2A 2NPIA 3PZBA 2WYUA 1PNOA 2GLUA 2ZE8A 3IC5A 2YWJA 1IMOA 4R2JA 4E15A 1AHHA 1YL6A 1AGYA 1S7GA 4IIYA 5REQA 3GUHA 4LRYA 1IY9A 2YNMA 3WAKA 5ITVA 3RADC 5CT9A 4BP9A 4B9EA 3V8PA 4PX9A 4CTMA 3DT9A 1ZNYA 3E4DA 5LDGA 1VFPA 1T25A 1J0DA 1ZITA 1O0SA 3EVNA 3EBPA 4JUAA 4MJXA 4Y98A 5EZYB 1IXRC 2QQFA 3A3KA 5TJ9A 1EDOA 1QVVA 3BXEA 3K16A 3QBJA 4GL4A 2JFBA 3TK1A 2JFUA 1QRAA 2IEZA 3GGSA 2O3JA 3STXA 4D0LB 2I6TA 2ECFA 5I8WA 4IGIA 3ACCA 3TDKA 5GIOE 1KE2A 1P2VA 3CVOA 4Z4HA 3CCCA 3FI9A 4C0LA 5BYAA 5U9CA 1RVV1 2IHTA 4EBFA 3VDXA 1J7JA 1T5TA 1TEVA 3JCZA 2VCHA 1LJUA 3V4PB 4FNMA 3HGMA 2QQGA 4JSTA 2REXB 1AT1A 4PR0A 1ESMA 1XZ8A 2I80A 2O20A 1VPEA 2PKEA 2ZBEA 3LLMA 4BTLA 3EOAI 1N7JA 1NBAA 2H17A 3QVOA 4FBGA 2Q3LA 4UBNA 4BLWA 4M8NE 2RB4A 5JXJA 5CD1A 2SKEA 5SZJA 3KEMA 3H16A 3CH6A 4AJHA 4ZU6X 2D2FA 4JNCA 3I9FA 4RNDB 1WETA 5IX8A 3ZDBA 1SD5A 3F6BX 4GMKA 2ZXUA 5CIYA 4QBGB 1OI7A 4BMYA 1CR1A 1UL1X 4AURA 4W7SA 4K6CA 4Z54A 1LPOA 1QCDA 1L5QA 2W2TA 3C3JA 4IR7A 6Q21A 1AUVA 4LGMA 3EIQA 3EXEB 4NFSA 2N9UA 4KXMA 1CNFA 3I6YA 2NV0A 4RKEA 4C0KA 4HXEB 1USUA 1E2JA 1QBGA 2EWMA 1JYSA 4NNOA 5AJYA 2QM0A 2VJKA 1RLIA 1QG6A 3ASUA 3ONVA 1C4OA 4OA8A 4O8CA 1EUQA 1H8EA 4DNFA 5IAOA 5MGNA 1RYEA 2CCGA 1YR3A 3L7OA 3PUWA 4N9WA 3EBOA 1T9GR 1E4VA 2YV4A 4EI7A 1XHEA 2H1WA 4FYHA 3MJ4A 1XR3A 3GLHB 2WSYB 4JSYA 4KFSA 1MW9X 3EVZA 3SM3A 1L4BA 2WABA 3N2GB 1FFDA 5JMOA 3P94A 4NEHB 3P2KA 4YT8A 1PR3A 1N4DA 2XA1A 1YZFA 1WP9A 1I6WA 2QRVB 4HEJA 5ELXA 4ER3A 5FOVA 3T3IA 3UB2A 1QGZA 3BIJA 4JT2A 3CRVA 4P80A 3VYUB 4B40A 4JBHA 5TXGA 1FRNA 3R7WB 3DOCA 5CYGA 4IQGA 1HRKA 5KWSA 2V6IA 2WMNB 1YB1A 3DVSX 2H4ZA 2WZBA 4NPCA 1AQUA 4M76B 3TOXA 5BN3A 4ZVTA 3BRQA 1M6HA 2EW8A 3UWOA 5HGJA 3BGIA 1G20A 1EJ2A 2VXCA 1FDOA 2DPLA 2H7VA 2FEWB 3DD5A 3L5KA 3ZHUA 1SCNE 2IOQA 3YASA 1EK6A 2E3JA 3L79A 1CVLA 3CUUA 1T2NA 4V03A 4JHXA 5B58T 4D9GA 4ZP1A 3VNUA 1L6RA 4L72A 1A9QA 3V8EA 4IEEA 4FILA 4PIMA 1JZQA 3CXRA 1YVUA 2Y1KA 3NO4A 1ND6A 1UM9B 1W85B 1SXGA 1ZISA 3D0QA 1GG9A 4FU0A 1N6LA 2OLEA 5JSZA 4RZQA 2JHFA 1NE2A 4OGLA 3RS4A 1NW7A 3OA0A 1OYOA 5HP4A 4NFHA 4M36A 2QRJA 4RY8A 3C39A 1KAHA 2CD9A 1Y80A 2I2AA 4IYRA 4JJAA 5T64A 3T5BA 2B1QA 5JFOA 2ZZNA 2FX5A 4XUEA 2X15A 1PEKE 3DQQA 4KZPA 1EAMA 4U9UA 4W5NA 1IAQA 1ZWKA 1FQKA 1M8PA 4Q19A 2H6EA 3ILVA 4C29A 4DCTA 4HLCA 2GD6A 4YMTA 2REOA 1PG5A 4LRSB 3T34A 2DWQA 3B82A 3OZXA 3QKWA 3T7SA 4Y30A 5JDCC 4UU1A 2CNWA 1XEXB 3DFMA 4KWHA 3ZVLA 4QFMA 4DB2A 4UPVA 3G0CA 4DAEA 2NVBA 2OK8A 3OP4A 1OB5A 1QKJA 5ICSA 3VR1A 3X2EA 1J2RA 3D0OA 1FS6A 4FB5A 3R9WA 5JALA 1U9JA 4R83A 1EK1A 5AKZA 4BQSA 5LD2C 2IYLD 1XAJA 4LZOA 2ET6A 3IUSA 5TQ2A 2R8RA 3AW8A 2QY9A 4FWBA 3G2PA 3K70D 3QBEA 3FZQA 3LT1A 3MTGA 3ZOZA 2O3SA 3BERA 3W1EA 1E20A 1VE6A 4F96A 3TNLA 1L7BA 4XIYA 4O59O 3V8VA 4DC0A 2EJBA 3GOQA 4EJSB 1LVUA 3HSYA 1GPBA 1QS0A 2HCFA 3FX2A 3EGDA 4Y2SA 4GI1A 4D9MA 4EATA 1K97A 2IDMA 1G3IA 2C7BA 4GIBA 2CMDA 3N2ZB 1RCUA 4CI9A 1JE1A 4RAOA 3AM1A 1EG7A 3T7TA 3K0BA 1VE1A 4NE2A 4Q47A 3LUGA 1DVRA 2QSUA 1EX1A 3HNOA 5A3SA 5SY6A 3RASA 2QVGA 1B8NA 5I9NA 3OETA 4PYOA 1DIBA 3BILA 3LPMA 4YB8A 3Q3CA 3MJEA 1YOBA 3LX4A 4BX2A 1DFIA 4PWZA 1JUDA 3SS8A 4MQLA 4AG5A 1GUYA 4AJJA 4MS1B 3IAM1 1AIPA 1K9VF 2CUTA 2E4VA 3R09A 2DQ4A 5F21A 3SVZA 5FWXA 2O2SA 1NVXQ 3SK0A 1IHDA 4NK5A 1JPNA 3RUEA 1TVEA 2CF5A 4Q03A 3KQNA 2OCDA 3BUSA 1CQIA 3AEUA 3BWXA 3QA9A 3A4MA 2NSDA 3P2OA 1P0PA 4I4NA 4MQFA 4PTLA 4RGYA 3VKWA 2P65A 3B85A 4MUHA 2F4NA 4KOEC 4XA8A 4QTZA 1EX9A 2D00A 3SYNA 4ZV9A 4FXPA 2WTNA 5HIJA 4B80A 2H7YA 1O8BA 3WBKA 2GAJA 2WKPA 5JSKA 3VPFA 1G6OA 3EWSA 2EHDA 2GPYA 4Z0TA 5ITZA 3PQEA 1EXNA 1B7GO 1Q1NA 1FDTA 2M1XA 4FYYA 2YXDA 2EDCA 5A71A 2IBTA 3D7RA 4DNPA 4EFMA 2FGKA 3PBKA 3KJZA 3I76A 2G82A 4KQEA 1KI7A 2Q3JA 5DCYA 5A3QA 3GLIA 4CEJB 4QL3A 2G0NA 2JIOA 3BWEA 2R1TA 5P21A 2KM1A 5IKPA 3R6GA 4TMKA 1XRJA 2IYZA 4N0DA 4EY4A 1DC3A 1RTKA 1N2BA 5IK2A 1FXUA 4CM9A 2Z5FA 3TQCA 5FAXA 3SCZA 3T41A 1U5CA 1GEEA 3O82A 3ORQA 3ZS9A 5CB6A 5K03A 3LMKA 2E4ZA 5E9JA 4E11A 4ZCQA 3EE6A 3PEEA 2EP5A 2H1HA 4NMMA 2BP7A 3ME5A 3ZX5A 1U90A 1PU2A 1E3JA 3BE8A 2PZAA 1NOIA 3SSAA 5HK9A 5EWMA 1B00A 3ZQ4A 1VTKA 2A9QA 2Z9DA 2YOGA 4Q4AB 4XJXA 2FSIA 4CNQA 5JMTA 4QOHA 1M0SA 1P4HA 4QBFA 3AJAA 4D46A 4E2YA 1VL8A 3HDQA 4P4TA 1N8KA 1DHRA 3L6BA 2HA5A 4KJXA 3PHHA 5JCZA 5EPUA 4JVOA 1DUSA 1R74A 4ZO7A 2DPGA 2ILTA 1O9HA 4P0TA 2R65A 3R7WA 5IT0A 2GHTA 1G55A 1UFOA 3IP1A 3AUTA 3DBRB 4C2TA 1NQWA 3I64A 3VC7A 3R7NA 3WGTA 3OQOA 1GADO 1OXBB 3ELWA 1KS2A 2VXBA 2DLCX 3L4JA 3BG5A 2QTFA 1IN6A 5K0BA 3A28A 1V2HE 2QG9A 4LNAA 1B0UA 3WWCA 1PDVA 1UXOA 5F1PA 2GHRA 2H1FA 4RM3A 4MR8A 1B41A 5L53A 3AF4A 3SC4A 2ZR9A 2SCUB 3PDIB 5IJ0B 1FEZA 3ESBA 5KYKA 1SQSA 3OUZA 4ZHQF 4WJZA 2ZU0C 5JZOA 4HN9A 3I9V6 3GW8A 4M8KA 4DOMA 2OGTA 5HF9A 3G9TA 4XTCS 2YVAA 4PN3A 3GGPA 3A0UA 1RJ9A 3S29A 5CT6A 4RK6A 1DT3A 2WIFA 2GPBA 2BGMA 4B6OA 2HHJA 3TL3A 4IDDA 1ZGBA 4HAOA 3LY8A 5BMVF 1I5EA 4G01B 1RZRD 1UZUA 3UAYA 4WT7A 4OKIA 2CFRA 2J7KA 3MWDA 4IXMA 4R1UA 2UUPA 2NYVA 3NYWA 4A9AA 4YC7A 4CM8A 3SQNA 3R3VA 3J81A 1OQAA 3E05A 3FKSD 2F1IA 4FNOA 1QMGA 1F17A 2PS1A 2CE2X 2W00A 2WUGA 2E4AA 2OFXA 1VCOA 2OC9A 2R7KA 1E9SA 1V7QA 4GPBA 4NHEA 1N0WA 4HAWA 4O4JF 5GONF 1XTZA 3FVVA 1KP2A 1NNLA 3U1VA 1QFMA 5KMGB 2H54A 2GBIA 2WYIA 4P3OA 4RKRA 3TBHA 3CV3A 3NOXA 3VJKA 2GPJA 4H2DA 1MH1A 3IPYA 3I9OA 3OSUA 5ALQA 5H02A 4FIDA 3VJLA 3D2AA 2Q9BA 4ND7A 3N87A 3NBMA 2C54A 4OHUA 4QHYA 3HHPA 5TQ2B 1UBOS 2VA9A 4ZQIA 1JIIA 4BECA 3HRKA 1FFYA 4JOBA 3M2TA 2SKCA 1O95D 1GKYA 3FTEA 2ZIWB 3F71A 4ER6A 1I24A 1A4UA 1V45E 3QI7A 3RYFB 5LIRA 3D8TA 1MQ8B 4U2BA 4PLHA 3QELB 4BO5A 2P4HX 2CLCX 1CQJB 4BIIA 2NZ2A 4LMPA 4NR0A 4UQPA 4WK0B 1E99A 4Y9TA 3EGDB 4EPRA 1SQFA 1EHYA 3AESB 3ANLA 1ZCBA 1ZINA 2GCNA 3Q9NA 2BEUB 2QRKA 3E81A 3ZYZA 2YIVX 4HGYA 5TSDA 3G3EA 4RSHA 3Q5GA 1RJWA 4QPCA 4RYDA 4H6VA 2IF2A 4RIFA 2ZT5A 3I0MA 3F4KA 5CLHA 3G5LA 5EHNA 5AVQA 4DLVA 1IXKA 2JCYA 5MN5A 2QN7A 1LPAB 2RH4A 1GU7A 3GN2A 1VL2A 2ZOSA 3A2MA 3IUYA 4GD3Q 1XXHA 2NPFA 2G40A 3AKEA 3L7MA 4RE6A 1YQQA 4C06A 5HX7A 5M29A 4FMDF 5CLGA 5CBKA 2GTHA 2XCSB 3ZWQA 1W88A 5BW5A 1SKMA 2YOHA 3BBLA 1SBNE 3EF3A 3Q7PA 1NRWA 4P8RA 4R51A 1VLJA 3H13A 1L9KA 4KNWA 5ICGA 1UQTA 1N0HA 3H4VA 4MP8A 4QO7A 5DX8A 1J23A 1NI5A 1RAEA 2RHDA 5BOSA 4F8EA 3FSGD 4OXYA 1ENZA 4JEMA 1MGOA 2X5XA 3F6PA 3AEUB 4PQFA 5ENVA 3RU2A 5B7QA 4DR2B 1E3TA 1Z0JA 5CCXA 4NJOA 1GA6A 1LQTA 1OLSA 1E6WA 2J87A 3GIDA 4BMOB 1VMIA 4MUFA 4OGFA 5CX1A 2BKAA 1R6BX 2QD1A 3PX3A 3U3MA 1G3MA 4B2IA 1N2OA 3UO8B 1CR0A 3LFTA 1ESEA 4KFTA 4ZA2A 2QN2A 4U0JA 2IUEA 1H66A 3B89A 2VG8A 3IQGX 4QOGA 3TMYA 1W36C 5BXQC 1TA0A 3R7BA 1J8DA 1J2JA 1CY8A 2FPGB 1JDSA 3H83A 4WY8A 4I1VA 3ZIAD 1IOVA 3ZHVA 4P33A 1IUNA 3O4GA 5BORA 1JQKA 3F49S 3L0IB 2WWXA 1LBQA 1PYDA 1WDKA 3Q87B 3VR5D 4HY3A 4UMDA 3AR5A 3ZWNA 3D2BA 4CCYB 1A5TA 2IEGA 3N3AC 4XCQA 1RZRA 1KOGA 2FSSA 4L2IB 4M7RA 4EYQA 1Y4DE 2BP7B 2FMXA 2NLOA 4F3YA 5KVCA 4F45A 4QG7A 2IIQA 5CU7A 3C8UA 1WMEA 1YD7A 1TUBA 2MSNA 5EWMB 2VL7A 4M89A 3N7UA 4JI5B 3RR2A 2JBAB 1A97A 5JSYA 1WTCA 3N70A 1UZLA 3FKQA 4JC0A 1FX0A 4JHLA 4EHFA 1T0HB 1PGQA 4MHSA 3U7JA 5LXTB 3NQ41 3D0RA 1A9ZA 3M83A 4BAUA 3TO5A 1JN0A 3T3DA 1BIFA 3X2FA 2ZPTX 1AUXA 4FFOA 1QYVA 1EP2B 2AFRA 3OO0A 5DNAA 5BY2A 4RJKA 3IEXA 4ONEA 4JB3A 3WZLA 4YCSA 2HK9A 3HP1A 2QMOA 2B9EA 3UT5B 5ALZA 4C05A 3CVUA 4RHTA 4OX9Y 5ALSA 1WCV1 4WFJA 4FGSA 2ZRJA 1BTOA 1I1OA 1U0RA 4YJGB 7ABPA 1YDFA 3ESXA 5DGCA 3WKCA 1F0YA 2XHZA 3EIOA 4UUMA 4BX8A 3TECE 4AN1A 1A98A 2GX6A 2LWIA 5GJBA 3QWAA 1QYXA 4TM8A 1S8FA 2ZR7A 4DLRA 9LDTA 3LXMA 3R5JA 3NIBA 1YACA 1ZUWA 3ZG6A 1F0PA 1X2BA 4DG9A 3NGLA 2XGSA 3R7DA 2WSSD 2XVMA 3PC8A 2J33A 3AP1A 4NBVA 3EGXA 4P3NA 1EWTA 4QAQA 5FUYA 2VYFA 1DKQA 1MOSA 3H1EA 4ETWA 4NHOA 1R4AA 1Z4JA 5CH3A 5KYTA 4CEIB 1ZA1A 2FPPB 3CLKA 5ADUS 5C31A 3K8OE 4LBYA 3G0HA 2C31A 1GIAA 3KQYA 1PJLA 1PJ2A 2WWWA 4ILKA 5I7UA 2QMZA 1EEHA 2G5GX 5JVDF 2GEDA 1Z82A 1QP8A 2AI2A 3HKBA 1YH3A 3O8LA 4G8DA 3SJBA 2JFZA 1CRPA 3SC2B 2VKQA 1BMFA 1SH7A 2H9AA 2B8NA 1XOIA 3IQFA 1KZ4A 1FC0A 1L6IA 2CFTA 2WT4A 4LPKA 1K6JA 4LYYA 4LWOA 3QUBA 5TS3A 3EXG1 4F38A 3E3LA 1C7RA 2WSSA 5CFMA 3RANA 1DG9A 1N1DA 2FQ1A 1AKRA 1X0VA 4C7XA 3WHKA 5CD9A 3E0QA 2C96A 1CY6A 2XMGA 4IHQA 5HS4A 4ERNA 3T0IA 3DVAB 5GM1A 4Q9KA 3B1KA 1PFYA 2B5OA 1Y5IA 4LY0A 1ZESA 3JRWA 4POOA 5KVAA 4AC9A 1YCDA 2WSMA 4I1RA 1X92A 1E2LA 1YOVB 3PLRA 3H2GA 3SOPA 1GRQA 3ADKA 1SZJG 1RKUA 4KGDA 5SYAA 1QDUA 1WX1A 2B35A 2Q0QA 3G2KA 5GADl 1B8OA 3HVKA 3LIPA 1ZBQA 2WR8A 3ZCTA 4EG5A 1UBNA 1RD4A 4TV8B 2NO5A 4ND5A 1QAQA 4BMSA 4Q3CA 2RE8A 3VAAA 3OZUA 5G4LA 5FWAA 5BSHA 3RYFA 4L78A 1QHEA 1W35A 4FHDA 4OTZA 4XVUA 1Q83A 1PFVA 1NN3A 4MZDA 721PA 5ARBA 2DY0A 1T4GA 2BEUA 4LRXA 4UAJA 1E1LA 7REQA 1HUQA 1HDZA 1UZNA 1QVRA 1Y9JA 2XDAA 3I12A 5E8JA 1Z63A 3I01A 4MV1A 2O8BA 1Y1LA 4KUGA 1YR7A 1Z7BA 4NOKA 3T6KA 3WI7A 4CR6A 1Q19A 1W59A 2VK4A 4BBAA 4DYHA 3W2TA 1MO5A 1NVDA 5CITA 1XXHB 2PKQO 4HUQB 5CLJA 2E2WA 1UDCA 1CUIA 4OBWA 3Q98A 4HCJA 4NDZA 4R2MA 1KWKA 2V54A 4AQYB 1HE5A 3IP7A 2XH8A 3GA0A 2BFOA 4NK4A 3CBGA 1HORA 2R4UA 2OO5A 3H05A 4OHBA 5BSUA 3SYLA 4UBKA 5TIIA 2UZ1A 5I47A 3GWGA 4JBXA 1II8B 4JT4A 2YVKA 4UBIA 5FLYA 5C8YB 1K7XB 1NIPA 3GQVA 4L3WA 5CA1B 2G4CA 3UG6A 5EE0A 1JWAB 4UAGA 4KWEA 5DZSA 3ETNA 1AB5A 3CQ9A 3FGZA 3GRPA 2VH5R 3GY0A 4UW9A 5JJCA 1GSIA 4Y6RA 4WNIA 5C8DA 2L18A 2ZJ3A 4M1MA 2IH5A 1YJBA 1ZVJA 2GK3A 1R88A 1L4UA 2JFVA 3DC7A 3EK2A 3OZDA 3E5RA 5I3ZA 1DHTA 1SD2A 4WJKB 2AG8A 5JQGF 2YKGA 3B6EA 4BB0A 4BKMA 1XTIA 4FJ0A 3NTRA 4WCFA 4IDOA 1GNRA 3D3WB 3GFGA 1QIHA 2AX4A 2BFPA 1ZJ5A 4QIHA 2G1JA 3AJEA 3FOAA 4MUKA 2QW0X 2Z6VA 4IICA 4QPZA 4RTLA 1JIXA 1XLVA 2X4GA 2ISCA 1SUBA 3PFGA 3GH1A 5IJ9A 2HC9A 1BKYA 1BS1A 2ADFA 3MGBA 3Q3EA 1R7RA 1V5EA 3K0KA 1ORTA 3OM0A 4LJAA 5ALGA 1GJRA 1JG7A 1M8GA 1O87A 2F2TA 5BW6B 1WW2A 2PMEA 2P2ZA 3ZLBA 2PR7A 1Q92A 5BPHA 2R00C 3DPIA 1YQUA 3ZK7A 3UC9A 5C8YF 4OB7A 2FGJA 2J0EA 2RAPA 3R9XB 2PLWA 4IG4A 4RLSA 2I2FA 5FD8A 3ZWVA 5DCLA 5ECDA 3TRIA 1XN4A 3ER6A 2JBAA 4FSXA 4JFRA 3WDSA 3K5WA 1PL6A 2NGRA 3RHTA 5CVUA 3T4PA 3OZRA 3RTDA 3D3KA 2IOFA 2DM6A 1JQ3A 4YWJA 4GWLA 4B3MB 1ZKMA 2Y2UA 2Y77A 8LDHA 2RG1A 4M1KA 3AWIA 5K5EA 5A4AA 5ED0A 3B48A 1XKQA 4QGGA 3IBFA 4RMHA 5FJIA 3WB9A 5KQMA 1UOEA 3AOEC 1COZA 4BGVA 2ZRNA 1YO6A 3QITA 4YJGA 4CKBB 3IL2A 1IIBA 1OA1A 1TXGA 1QQAA 4Y6PA 4DWJA 4G0WA 3SEFA 3I9NA 5SV2A 3UJ6A 2XW6A 4NOJA 2J5RA 2IUSA 1D1PA 4DCPA 2PGDA 5KKAA 2YWRA 3J7TA 5DHUA 5HJ5A 4MW1A 4TS4A 2FXVA 2BMAA 4LSMA 2JGJA 3ZQ6A 3VX4A 4WDQA 3ZHQA 1YE3A 1VKJA 4V1CB 2J9XB 5BSKA 5LU8A 4IV8A 1O6FA 2I1QA 2ZETA 1P1IA 3GLRA 3QY9A 3OQNA 1W8IA 2O5VA 5BUZA 3MTBA 2QXTA 5M34A 3O8OA 1RM3A 3V33A 2VHQA 4FSDA 2V6MA 4OAPA 5ERXA 3HKBB 4B75A 1JHPA 2ONZA 4YRSA 3ZJVA 2QTZA 1J1IA 1W0CA 3L0CA 2PUCA 4IIJF 4BTEA 3EPJA 4F2HA 3B6IA 1BWRA 3UGTA 2WI8A 1IBSA 3A9WA 3SZRA 3F3KA 1L8AA 3JQGB 1UMCA 2ID4A 3K4QA 1NVFA 1RYNA 3OX4A 4K2HA 5IVDA 2PYIA 3VA7A 3EEQA 3EMDA 1N4AA 3MIIA 4TWRA 5E4YA 4D9NA 1XVUA 2CUKA 1XCBA 4ND1A 1O6BA 3AGPA 2YW9A 4Q9IA 1J2UA 1NZDA 2ZYHA 1FZQA 1BE1A 2J0VA 2QTAA 3QKUA 4EG0A 3A9TA 3JATA 3CRNA 2PMFA 1HO3A 3H1AA 1UM8A 1U7TA 4FBMA 5DF1A 4C76A 2GK7A 2ODQA 3RRXA 4RSRA 5C32A 3LG2A 1TT5A 1KYYA 4PQRA 5H5JA 3ENZA 1H6DA 4U6SA 3ND6A 1HH4A 1E8MA 3CRQA 3NT5A 5DBHX 1OLUA 5CEJA 1V11A 4O4HB 9MHTA 4BFYA 1C3JA 4PHGA 4K6KA 1YVRA 4IP0A 4TV8A 1QDEA 4FQ8A 3U2QA 2GQ0A 1YA8A 2IDZA 1PJBA 3WYEA 1UKVY 4RF5A 2DBYA 4GKJB 1XCGB 2HRCA 3MYYA 4J1NA 4AYXA 2QLTA 2QV7A 1ZM9A 4B45A 1UJMA 1DTEA 3DF7A 5H7XA 1T9HA 5JR3A 2XCUA 5ECYA 5K45A 2RH9B 4LZLA 3DEHA 4B4KA 3I61A 4QJIA 2W2KB 1JEJA 4B7XA 2WK1A 1K7CA 4JUDX 4BJ6A 2BZSA 4KUHA 4QUEA 2HF2A 5TLSA 2CFSA 4GMFA 1Z6YA 1N6IA 2CEKA 4GVXA 4DBZA 4DUGA 2B34A 3RREA 3R75A 2C4TA 2C9ZA 5JLJA 4YI5A 4ARUA 3FYTA 4OREX 1TIKA 2H63A 4FS8A 5DP1A 3C3PA 1QHYA 2CWDA 1PS8A 2IU3A 3DW1X 3FKJA 4IG9A 4J1TA 4UKDA 1NMQA 5HKLA 3WLIA 3COPA 4CT4B 5A5DA 4AM8A 1CLEA 3LYUA 4XYGA 2I7XA 2DY1A 5THKA 3CURA 4ZQEA 4JEUA 5AUQA 4YRNA 3AHHA 1BYIA 2V4ZA 3D6VA 4DDHA 5KHOC 4KVFA 4J90A 3RTGA 5CA1A 3DVRX 2AEEA 4MIYA 3AERA 4OYRA 2NUTA 1PWEA 1X1AA 3EMKA 3W8RA 4D9JA 1I7NA 1ULSA 1JG2A 1IBRA 1GA1A 2YC4C 1JDVA 4HGRA 4X65B 4R05A 3IT2A 3LHDA 3TJRA 1QV6A 2X76A 3P9RA 4TQUS 2X9NA 4KE7A 3WA7A 3W9YA 2NXWA 3B6JA 4BO0A 5LVAA 1CUYA 3DOIA 1KZ6A 2HMVA 3FTCA 1U4OA 3IP3A 3R5XA 1P45A 2CLFB 4OH7A 3RT7A 3OFSA 1U5BA 2HT6A 1UDWA 2BISA 3A31A 3UC5A 5BN5A 2B8WA 2R7AA 5HKKA 1XZCA 2LV8A 2NUAA 2OCBA 2NU9A 2QL9A 4C4RA 2IYOA 1L5HB 4X1KA 5FORA 3HN2A 2R85A 1VE3A 2HHAA 4BE9A 2XXAB 5K2OA 1FDUA 1ZNZA 1TFUA 2HJSA 3HU3A 2QUZA 1YHNA 2H4YA 1KY4A 1HY3A 3TOSA 4Q3KA 3U31A 2YS7A 2Q5FA 2O0HA 2RJNA 3V7UA 1XD9A 2DFTA 2C42A 2WMYA 3OPYA 3KCQA 2CJFA 4MUMA 4I9UA 1T15A 3NNDA 5JXGA 4FKMA 2OYCA 4H3SA 2PWBA 4Y9DA 5E3HA 2Q5QA 1IDOA 1KBZA 3UKOA 3G0GA 1TM4E 1HLDA 5IZCC 1QE3A 4H1VA 4C5BA 2JAHA 3LTEA 1TAUA 2ZANA 1VQ1A 2WF9A 4IO0A 1SJ9A 4GZ5A 1FMJA 5A9SB 4GC9A 4LC1A 2ZULA 2IV7A 3D1LA 4BBZA 1CZUA 2EJCA 4PYNA 4HBZA 4NBRA 1M0TA 3HZHA 2BRUC 5JJKA 2RGCA 4ZVRA 4MQBA 2UYQA 3EHEA 1G7CA 3OICA 4MPDA 2QUHA 2R3SA 3AU9A 3KQOA 4TWAA 3V4FA 2Z6UA 1PD1A 4Y2VA 3T7KA 2JJYA 3QJ5A 1H2HA 5MHTA 1DSSG 3EW9A 3GDFA 2PKYX 5DYTA 3OM1A 1JAHA 4NKRA 4GPD1 4UDXX 2PQ6A 3CMCO 4PBRA 1ZHOA 5LN1A 3WL5A 2CK3A 3DLAA 5A3RA 3JPYA 1HKHA 3CVWA 1ZY2A 3DV9A 1YASA 4P7KA 4Z6KA 2QNRA 4E31A 2JVJA 1ZIDA 3QRWA 1SOUA 2NNWB 3IR5A 4BEBA 4UOEA 2M6SA 5GZ3A 3OJOA 4W5QA 1YVPA 4RVUA 2F8TA 2NO4A 4NBWA 2C2WA 4ZTBA 4BZWA 1K86A 5DGHA 1U2GA 3EZGA 3KB2A 2C59A 3IP8A 3V9PA 2P8JA 2NU8B 4Q1FA 3DSRA 1D4ZA 5CIWA 1M6WA 3P5SA 2CZQA 1GQSA 3LYHA 3O2SB 3VH2A 2R9VA 1D1SA 1JVNA 1QX3A 2P6UA 3IHTA 4RPHA 1Y5RA 1X87A 1ODTC 1SVUA 1YQWA 3IQDB 1E3IA 5SICE 5KYWA 4HUJA 3NHPA 3GRVA 2PL1A 1C7IA 4UXJA 1OWMA 3VHQA 1G2OA 4MWGA 2VQ3A 3ZNOA 5KNDH 3HA7A 3D6AA 2V55B 3JQGA 3FSEA 1UMCB 4K3VA 2PKXA 1ZVMA 1SC4A 1EI9A 1IJKA 2JASA 2XX3A 5KSPA 4MJLA 3B8HA 2AMVA 4FS3A 2LVBA 1RLTA 1PIWA 1H6BA 1V25A 3IT3A 4ZCPA 3O8QB 2XSZA 4E3WA 1MGPA 3QKRA 3ADBA 2GM4A 3PQ3A 1RXUA 5LJIA 2J5KA 5EZSA 1NLYA 5G02A 1G8SA 2GBLC 1LPMA 2X2OA 3IA2A 1XKTA 3OTIA 3PVCA 4AYWA 5B3JC 1SIOA 4UHFA 1EE9A 2I4NA 3VOSA 4B31A 2IZ5A 5CFRA 1S2DA 1P9WA 4DKJA 1ZU4A 4N3CA 1Z4LA 2PK3A 2YHAA 5EEHA 3PNMA 1Y8QA 4A7PA 5FUQA 5IF3A 1JDTA 4PZAA 4R8KA 4Y9UA 1N3BA 3O4FA 4O4IA 5AJHA 1QIGA 1Z06A 1QZ3A 2R6GA 3MRTA 1H2YA 1E2GA 3QMVA 1XZDA 5AW9A 3MS7A 4ALLA 5A9TA 4WESA 1UMKA 4PYRA 5EXTA 4EW3A 4IILA 1KNXA 3FHOA 1KDVA 1RAIA 2FWPA 1MOZA 2VPYA 3F96A 4NYIQ 1XDWA 3GZNB 3VC1A 4O2LA 2PKRA 1AUPA 3AQIA 4E14A 3C3XA 3IQIX 4MA4A 4PRLA 4UVEA 1AUQA 1V6SA 4DLSA 1TD9A 5KPDA 3AETA 3W79A 1TQHA 2YUIA 2DPHA 4QHSA 2J7PA 3VR2D 2CXPA 5I51A 5LNK6 5TMBA 4BP8A 2BW0A 4GWKA 4X61A 1VRCA 5BNZA 3DEYX 3MBOA 4PC2A 2I6QA 1YTLA 5D87A 2C3MA 2X2FA 3OLVA 3H8JA 4KX3A 4OU4A 4HMOA 1Q0RA 5LQUA 4LXTA 5AQEA 4MHOA 3W3AD 4RD6A 3E3AA 1T2CA 4HEA6 3O92A 1J4AA 3SZLA 2VATA 5CVTA 1ZKDA 1XRMA 2Y1WA 5EJAA 3WA6A 4I14A 2QAGC 5HF5A 1RPJA 1YKFA 2VHWA 3L0OA 5AVUA 2YXPX 2H59A 1VLLA 1XPOA 4IDCA 3AERB 1G21E 2NUTB 3RNLA 2NACA 5C1BA 3AOGA 1OKKD 4Q7KA 3DE5X 1RU3A 4D1YA 4W1SA 4KWIA 5ALEA 5AM4A 3MUFA 1ZJZA 1E3MA 1QK5A 5EEGA 4CIDA 1Q7CA 1QQTA 1S2LA 1UC4B 2BZ1A 2IUTA 1V41E 4RD0A 4X1IA 5TPZA 3E18A 3UMJA 4ZYYA 3IAHA 2JGLA 4RBNA 4BFLA 4LX0A 5K6TA 4NECA 1CEYA 4QYWA 1DV1A 3QXJA 5CHYA 3LX6A 5BN5B 1E2QA 3PI7A 1LS6A 5GWXA 1SQ6A 2ZRKA 1C4XA 3WISA 4JI1B 4CCAA 2OO5C 1Y8AA 2NUAB 3IV9A 5KX5F 1YSCA 5C1IA 1Z8FA 3LK6A 3WIBA 1W8DA 3UMBA 5KTTA 2C9DA 3VU3A 3H19A 4FKZA 4LNUB 4C03A 4RHUA 3KXKA 4RQTA 3VOTA 2Y1OA 5JZVA 3SMVA 3L8EA 2K5UA 1OFUX 4M8SA 4HQ6A 3FMGA 2IITA 3LNTA 3LO8A 3Q3IA 3T9DA 3WY9A 1BMFD 2J5XA 2ONKA 2YC2C 4RDHA 2PVSA 1WXEA 1GL3A 5EIEA 4GYJA 1FFXB 3VGPA 5SYNA 3BGDA 4C4ZA 1OLOA 3GAZA 1JHRA 5K0SA 3CSSA 3W5VA 4JT8A 1S3GA 3G89A 3QLEA 2R6JA 4PO9A 3NWEA 4WGFA 2Q49A 4WOJA 4X8OA 4X9XA 1N6KA 3E5NA 3KO8A 2G1PA 3GUCA 4GGPA 2WQZA 3MCVA 3OIUA 1BD4A 1X7HA 2PKWA 2YVUA 3GLGB 1KDPA 3SYRA 2HA0A 2VBGA 4CXMA 2I87A 4ZWNA 3NIDB 4I6GA 1DXHA 1N5JA 4ASUA 3WFJA 4LW8A 1VJCA 4AU1A 3BFPA 5AIBA 1HYGA 3PX2A 2Q27A 1MAHA 1H0HA 3T4UA 5IT4A 2AV6A 2JJ2D 4ZMRA 1F5SA 2AW3A 4PG6A 3OPVA 2H1OA 4IIHA 3OHSX 2O6LA 3DEJA 3KTAA 1KYTA 5A02A 2X42A 4ZEWA 3DB2A 2ZM5A 4QJ5A 4AZ0B 1EA5A 1FDVA 1CUAA 3HU1A 1DBVO 4KHZA 3NHMA 1DWQA 5AK6A 3CZRA 3VV2A 3ZXXA 1WY5A 1MT0A 1Q1BA 1TUIA 2C5LA 1OXTA 5KBYA 4MVJF 1PK7A 3COWA 1PQPA 4H1TA 3VH3A 1TK3A 2VPWA 1K4KA 2XWQA 3EZ9A 4DIBA 2GDJA 4HDSA 3UT6A 1BWSA 4QNRA 4I5EA 4UNNA 5L9AA 3BIWA 3LT0A 1AKTA 1YNSA 5BSRA 4C2BA 3F6RA 2A9OA 1P74A 4US1R 5E38A 1U7XA 1VRWA 3EGWA 3OEWA 1YC2A 3KB8A 4BX9A 2VDJA 2P9FA 5BUSA 3PIIA 4YQYA 4M22A 2BWJA 3D6MA 4Q3DA 1EHIA 1K68A 3VNAA 4QO8A 2ZYAA 4PWYA 1O95A 2ZWIA 4X7PA 2HXSA 4DY4A 3Q1LA 3MW8A 1HETA 1X1CA 2CLOB 2VCEA 1BDHA 1CC1S 1QFJA 3CUYA 3DXYA 3ZTTA 4G0PA 3ZBQA 4LV5B 5T67A 4DJFC 5A2QA 2ZSUA 4RD2A 2LDXA 4V0MA 1QRTA 1DAIA 4O1IA 3O8QA 5DHTA 3Q72A 3FMVA 4EL5A 4ESVA 1KI3A 3LP8A 3ZWWA 2DP4E 4EG7A 4QJ3A 3H3XA 2CEAA 3C45A 1OI3A 3RF7A 1ZMTA 4OI4A 2QAJA 1EVKA 3FNIA 1B15A 3TG8A 4H59A 4R16A 3EF0A 3WNBA 3WGUA 1KYZA 4RTOA 4IVNA 1YRWA 1KFCB 4BFTA 3N2GA 3P9KA 2OL4A 4CMIA 4O4IB 4J75A 2Q29A 3WLPA 2PEYA 4AAYA 2VQDA 2RHLA 1G64A 3A6JA 1XCLA 2A5FA 5CA0A 1NM5C 4DUGD 1OR8A 2X8AA 4KEAA 2FA9A 2CXNA 1B16A 1QFYA 2O3TA 3C98A 3ZZMA 3L07A 4F2DA 1CY1A 2Q6LA 4HQ0A 4Q15A 1E7QA 2MR5A 1JSRA 1BXKA 1VSUA 3NBAA 1NX6A 4JJKA 3DWEX 1G1AA 5JEDA 3FYUC 3UATA 4IHJB 2HYDA 4FFMA 3HUDA 3V3KA 3A1WA 1ORIA 5I9MA 1KS9A 4W4TA 5HKBA 1VSTA 3RROA 3WL8A 1IOLA 4ES6A 1WVGA 2WU1A 3EDCA 3B9BA 1GKIA 2ZJ8A 3IEKA 4ZVOA 5LLDA 3UICA 3WYFA 4ZAXA 2XUPA 1WZ2A 3L93A 4QNMA 3S68A 1QCYA 3KALA 3W2FA 3O38A 1Q22A 4ESHA 4EY5A 2XV1A 1IONA 5IYZA 5BURA 3CY6A 5CEEA 2ZB2A 3CO5A 2R25B 3PQ2A 4RIEA 2CYAA 4HSEA 1E6EA 2QP3A 4KJZA 5EP4A 3GPDG 4V24A 3NBUA 5FNVF 4KIWA 4RY2A 1FQOA 1IUKA 1R6UA 4CF7A 3SF0A 1B8PA 3B6KA 4N54A 1QP4A 4IOLA 2KPOA 2RARA 4F84A 4IV5A 4N0PA 1C0IA 2AN3A 4YJFB 4QQ8A 1HE2A 4A2WA 2VZLA 3SR3A 2V58A 1JR2A 5FPSA 2P9TA 2HX1A 2JI4A 3DYVA 2WJJA 3I6QA 3WL6A 3DUFB 3ADPA 4QUDA 2PEZA 2RSLA 4GLJA 2QRGA 4CUJA 5IC4A 5DYNA 1YZ3A 4PQGA 4LTMA 2VLBA 1M2JA 1Q2UA 4ZMBA 1A4RA 1TB4A 3TZKA 4BFCA 1RABA 1JU3A 1E5VA 4MQFB 2WMDA 3RRMA 2Z3ZA 5F9HA 4BMXA 4OH1A 2F1OA 2YS6A 3EXAA 2GVZC 5FYQA 3V8RA 5IFLA 1XQVA 4R9NA 4HOYA 4CR8A 1OI2A 1G4AE 3M0EA 4LNUA 5EKDA 4PFJA 3L7AA 2PSEA 1V3UA 3MHPA 3WS7A 4A1FA 3UCFA 5HQ3B 2IYTA 1E5XA 5CDUA 1GCUA 2ATVA 3MC1A 3KQHA 5B1YA 2XMSA 4QJBA 3BQMB 1KDOA 4Z3DA 1O94A 2GZ3A 4ITUA 3N0RA 3O47A 3H8SA 3SGLA 1WD7A 2R1TB 4X8LA 4MVJM 3RUFA 4PNZA 4MV4A 4NONA 2XQIA 5L4LA 5DLQC 1SEPA 5LUBA 3FAKA 4J2HA 3N7TA 4OK5A 3AF0A 4ALIA 2OV4A 4BBJA 3DBIA 4LJ5A 4QTXA 1OYYA 5FNZA 5A0VA 5AKXA 1OY1A 2Q1SA 5C7YA 2AFHB 4WCFC 3UWSA 3WSTA 5CDFE 5IK2D 5BR8B 3EODA 4ZI3A 1P77A 3KXDA 1Z4QA 3QU7A 5BR7A 3GQBB 2BPOA 1U0LA 1X7WA 4UTVA 1G7TA 3CLSC 5JTUA 3NBKA 4MEBA 2Q3HA 4OVKA 1DCFA 1SB9A 1GFSA 2GNAA 2JATA 3HRIA 5T8KA 4Q4AA 2FI1A 4JROA 5AH0A 4FJ1A 5AI0A 4EMBA 2JLWA 1DGQA 3A4IA 4I1UA 2A30A 2BDEA 2F1RA 2HJGA 1US8B 1SXQA 4G0OA 4D43A 4FONA 3HHEA 5DH9A 2I4LA 3KOYA 3FCAA 1W0KD 4YWHA 3ROKA 5LL6P 2JLZA 4ZICA 4P5EA 1E4YA 1JA1A 1L7PA 3WADA 5E2IA 3L49A 1TQ8A 4H0NA 1AK1A 2XNDA 2Z8YA 3HPQA 5AM3A 3OJWA 3ZZNA 5AVVA 4QVIA 2NAPA 3RRFA 2BTQB 2GARA 3GJSA 2PJRA 1G8HA 3JVVA 3WMXA 2HDHA 4OIMA 4G9BA 3BK1A 4TRNA 3G5AA 1QO0D 6NULA 1GCGA 2HV9A 3QVJA 1A72A 1LFAA 1RQLA 2Y1GA 3E15A 4G0YA 1A8UA 1A1VA 5AHRA 5D3KA 3V1TC 4B85A 3KUUA 4MR8B 3A9CA 4CLOB 4CMKA 1QG2A 2PMKA 3FWNA 4PLFA 3UK2A 5KTPA 3ZLJA 1OJ7A 4WERA 3PXGA 1KJZA 4D96A 2IXAA 1DG3A 2P9YA 4OMDA 1B76A 4MB0A 3D64A 3G59A 4PY2A 1GYQA 4I81A 4UNIA 2ES4A 1HDCA 4LBZA 4R9SA 2NAFA 3D9QX 3WLNA 1H2WA 1L0BA 2AZTA 3O8DA 4OL0A 1BEUB 1C30B 2W93A 2GCGA 4RZHA 4GQAA 3TE7A 3W9BA 1ZSVA 1HFWA 4D25A 2CBGA 3F3YA 5IKOA 2ZW9A 2C7QA 2QORA 2WV9A 5DXFA 3T38A 4R3WA 2FSGA 4P5PA 4LMRA 1IY0A 4GG1A 3TXXA 1Z5ZA 3U6BA 4LHEA 3T1NA 3PLAE 3BJZA 1NW8A 1L4EA 5CW1A 4YX9A 2IU6A 5JAHA 1EFDN 1PD0A 5EZ5A 1FUIA 4MV3A 2VK8A 5IW8A 4BQPA 4HQKA 3P5BA 5IARA 1N1MA 4ENUA 3LPCA 3DZDA 5J1SB 2C0QA 2PBLA 1IUOA 4GRAA 4G0UA 1OX6A 5L6MB 1MF7A 2YQ4A 4IH9A 3Q9SA 2RIPA 5CR9A 3LVQE 4KFRA 5EIHA 1JBEA 1ZI9A 5BSWA 5HHTA 4L8VA 3ZWOA 3PR2B 3G8YA 2XNHA 2OOSA 4MKFA 1S1MA 3KVVA 1D09A 3BWVA 4FEYA 3JQ9C 3OPYI 4P82A 3UJPA 2O5EA 1T1GA 3I0NA 3LXUX 1AKYA 1OFGA 2GF9A 3F2VA 4NJEA 2IYEA 1L5FA 4G0MA 4DJTA 2VYQA 5KWJA 1KJ9A 5LPNA 3MLAA 4ZCRA 4ON9A 3DBRA 5D1NA 1QRRA 3X1MA 4QQKA 3PFWO 3TBKA 4UU8A 1X7ZB 3GFSA 4IVPA 1QWOA 3EPHA 3JQEA 4G9GA 4KYIB 4AKSA 1EVZA 1VPWA 1FDRA 1RXEA 2ZRFA 3QELA 4YXFA 1KO7A 1MZPA 4S2EA 4N4AA 3FIJA 2VAXA 2WY2D 4D7AA 1D6SA 4Z7NB 2BHNA 4NATA 2XE6A 1JWLA 5IYZB 2OQRA 3K0EA 2BY4A 4I50A 2Q0SA 4MCJA 3R44A 2W58A 3PNPA 3HVHA 1VCIA 2BCGY 3NP9A 1RJ9B 5GONA 3W8FA 4E21A 2BRUA 1M5RA 1A5ZA 1BAPA 2HKIA 3EZLA 4MJ7A 1DMSA 4YPFA 4LJKA 4JLOA 2CNDA 2XUGA 3PICA 4U5QA 2I3BA 1OTXA 3VR4A 2G77B 4BE4A 1IJBA 4BO2A 3RSLA 2V65A 4ZDIA 4RANA 1FUKA 4MLPA 2ATXA 3O95A 2QLJA 1QO0A 4WADA 1YB2A 5EHIA 1OXMA 1P8AA 2ECOA 3PVSA 5EN4A 3D5TA 5K9ZA 1YVEI 4JJIA 1CEXA 2C2HA 2Y9PB 3B13B 3ELDA 4GP6A 5F12A 3U7RA 3VZDA 3LF1A 4EJMA 2G9VA 2PCLA 3ESDA 5E6UB 1P5HA 1SCDA 4JYBA 4OQFA 3O2JA 1OGYA 4ZJPA 3EXIA 1KEWA 1WLYA 3VUEA 2WC1A 3HJBA 3GJZA 3H2BA 3N07A 1T1EA 1R9MA 1OXKB 3LUAA 4OJQA 3E5HA 1M0WA 1TO1E 2JIPA 1RM0A 5HUJA 1KFKB 5LMUB 2EBWA 3EN0A 1E1CB 2DBQA 4LOHA 2YMMA 5DCUA 3ZPXA 3FCXA 5AHKA 4DRZA 1K5GA 1VE5A 1Q44A 5HJ2A 3KUXA 4RH3A 1O6ZA 3SJ7A 1AHPA 4RKQA 5HZMA 4KITB 3UCXA 3K2BA 1M1NB 2Y2VA 3QTLA 2E5FA 2P62A 4XQCA 4UE2A 3EJWA 2A1UA 3SS9X 3SXUB 1VMAA 2CBXA 2EL7A 1Q7EA 1AC5A 1JR3A 2G07A 2QGFA 1DXQA 2C1EA 3MLBA 5GV8A 3TNYA 2AG5A 1YBAA 2JRLA 1ZH4A 4QLAA 2PUDA 4QPPA 2C04A 3QA3E 2WEKA 3L7BA 1LPPA 2N46A 2IX9A 2QSZA 3F6SA 2H4XA 2AFVA 1P18A 5U4XA 4XW2A 5D5QA 4YDQA 3LKVA 3FFTA 3HGQA 4C7MA 4C4AA 1EIZA 3HXOA 5EJ6A 2DLNA 2EAUA 2I8AA 4TKUA 4IL5A 3IRUA 1CY2A 1M34A 4XQ9A 3B2NA 1N0VC 1JXOA 1RJFA 1BDIA 1ORVA 2P27A 1T6NA 1VBKA 1FYVA 4MRMB 2BTQA 2PT9A 3KTDA 1Y6GA 4I2NA 4CJXA 4BP3A 1IWPB 4OUKX 5BOSB 1XLUA 5AW1A 1TZ2A 3G49A 4F4UA 1FTWA 4DMGA 4QX6A 4DA8A 5LU9A 1YBFA 4JKIA 1E0JA 4B4WA 1EGMB 4RTKA 2C20A 3NHBA 1OAAA 2AXQA 3ROXA 2YN4A 3C87A 1KOFA 1QGDA 4NENA 3AVTA 1CY0A 3NGMA 5J43A 1K7SN 4OMUA 1X8LA 3DOHA 3FB4A 4ZT5A 1PT9A 4O2AF 1IN7A 2X0DA 4DXHA 1XFDA 2NSHA 2M98A 3N5CA 3IE0A 4E2ZA 4CFZA 3FETA 4DMMA 2ATCA 4KK4A 4E5VA 1GKKA 3IEVA 2L0XA 4CKXA 2JHPA 1AV7A 4O0LA 4AQ7A 3L8GA 1E0AA 2M2IA 4O0MA 1VE9A 4EG4A 4YUXA 4PS1A 4H6WA 4PZDA 3SC2A 1ZN7A 4AJKA 5KS2A 3TZ6A 1THTA 3PXBA 3OOYA 1NZFA 5J2UF 3FZEA 1Z5OA 2YFYA 4KQ1A 5GVSA 3R9IA 3EASA 3LBAA 4HC4A 4CG3A 2HWYA 1TC2A 2UZ4A 1N34B 5JWRA 1WDTA 1XTSA 2HMTA 3EWNA 1NJ5A 1ZH8A 4EY3A 1EVEA 1SVKA 2PCJA 2CHFA 2HIAA 4F4DA 2OFFA 2FOLA 2B36A 3WNVA 1KQGA 3DYIA 4R9RA 4AMBA 4D9IA 5KC8A 1BOOA 4YMWA 5TNXA 1MJGA 1TM2A 1HNZB 4MWBA 3SG0A 1EE1A 3IAAA 5J3JA 3C1AA 4NOMA 3AM5A 4KGZA 1G8AA 4B4UA 1WXXA 2HPAA 2ZFUA 4LECA 4KQMA 2R48A 5ER6A 5BQ5A 1REQA 3L8MA 4Q9JA 1NJ6A 5DBEX 2IZ0A 3IMKA 4NJEB 5ALWA 4EAAA 1ZGJA 2NT4A 4IJKA 4Q1AA 3UT5A 4X91A 3JQ8A 5AJTA 3G68A 1JSXA 4MWSA 3EG5A 3JWPA 4BRWA 2AJCA 3JWHA 4MRNA 4WX2B 3DP9A 3X3HA 4C3UA 1LX7A 3QZUA 2WM2A 2DCUA 3RSQA 2P3QA 1AKVA 2VHTA 2IYAA 2IZ1A 4LHVA 3BB4A 2AOTA 2QHXA 5A6SB 1YIDA 2JI9A 4XCXA 4JXKA 3LDGA 1JJVA 3GP8A 1E59A 1Y1RA 1EDZA 1T0UA 2QYHA 1JTVA 1TW3A 4NICA 2D7CA 2QNIA 4WOPA 3RJ5A 3RHSA 4AP6A 3QVSA 2X19A 4RFLA 3EGXB 1H3EA 1AN9A 2PT5A 3G9ZA 3CH5A 1ZWLA 4CEIA 3TLEA 3L0ZA 2FEPA 3P4UA 1LCIA 4GEKA 3FBTA 2A5LA 4M53A 2ZIEA 4TWZA 1GZSA 4UHKA 4IZOA 2Z2JA 3IJ5A 4AUEA 4M38A 5GONB 4ZFNA 5LUAA 3AUSA 4INAA 5DNUA 3W5UA 1UJ4A 2WD9A 1IN8A 1GLNA 2BGTA 3EQ2A 4HUQA 2V4UA 1QOQB 2I8CA 2E5WA 2GPSA 2OCPA 1J70A 3C4QA 3ITKA 5TQVA 3D43A 3RU9A 4MUAA 1NC3A 4KRXA 8OHMA 2CLSA 2KBEA 3JASA 5EQTA 3ML1A 2BR4A 4GMGA 3R6DA 4ZDWA 3RSCA 3HN6A 4I5FA 4ENQA 5DTRA 3RARA 1GPJA 1USKA 4EJ6A 4EPVA 1II8A 2Q9CA 3E22B 3GCDA 4HFNA 4JLSA 4C08A 2PXHA 5DM4A 3N8KA 3PUXA 1H5NA 2FFBA 2R6DA 5TQJA 3WHLA 4BQOA 5K0FA 2KLBA 3HR4A 3T5AA 1KYVA 2CHVA 1PQWA 3E2MA 3OJEA 1CU1A 4KTVE 4DNXA 3NU1A 2J6IA 3N75A 1GTG1 2WUVA 2PLNA 4F7WA 3GAFA 5EKTA 4QBTA 1PRYA 4DYVA 4A10A 3SYTA 3WFZA 2JG3A 3KVYA 4PV7A 2G1KA 3JARA 4LZZA 4OEHA 1OH5A 2H3HA 2HZ7A 3HLYA 4UFNA 4EWLA 2UUCB 1CR2A 3SLGA 1ZSNA 4FLMA 3EZXA 4RFSB 3SU8A 2ZTSA 3TLAA 3NYIA 1JQLB 4KRGA 3O94A 5BYJA 3U9LA 3JQDA 2ZK7A 1CUXA 1R6AA 1XE3A 3GVPA 4RLFA 4X97A 5FDFA 4G0ZA 5LP1A 3BDVA 2ZQYA 1PWHA 3A3YA 1M1NA 1ZIYA 3DDUA 3CJTA 5B2FA 1LF5A 3I2IA 4HYEA 4TXJA 5E1BA 4BKOA 4DXAA 3EGOA 4M1TA 3DE7X 3E9EA 4C4SA 1L7DA 2YZ7A 5B53A 1G66A 4BLRA 4Q9HA 1Y6ZA 4FYWA 4G1BA 3FGOA 4BQFA 3DEKA 3G7SA 1RQNA 1Z7GA 2X9LA 3VPSA 4F2WA 1DELA 3GCZA 5A04A 1A71A 1Z6QA 1QGYA 3UQYS 5KQGA 4WKOA 1J22A 1Z0IA 5AKLA 2R84A 4L8YA 4HVAA 2ZE6A 2B4RO 3OF5A 3RK1A 4B7UA 1TJPB 4RPIA 3VHXA 2DPMA 2LW7A 1E6MA 4FEGA 4OV6B 3BFKA 3W5JA 2QVZX 3QWFA 5AOAA 2PFKA 2N3ZA 4RIHA 1GTZA 4C3OB 2PO7A 4DC1A 3IVCA 4KRYA 1FYWA 2D1YA 1RWMA 3C24A 4ZXPA 1T3ZA 1KI9A 2FPOA 1QAMA 2FFRA 2A8YA 5IUJC 2UKDA 1R8XA 3F6YA 3L0YA 1IPFA 1Y33E 3ZQKA 4EP1A 2I54A 4P4UA 2PPVA 1AKWA 2JK1A 3JZFA 1KYWA 5G0SA 2AKYA 3PQ8A 4W8GA 3EULA 3OC6A 4G1UC 2ZI6A 3ZWPA 2X6QA 2CCJA 3T61A 2RMKA 4PHCA 1U80A 1XMOB 2DR2A 2KW5A 1NTRA 3THYA 5EJ9A 3F1LA 4V1CA 1U2PA 2PZEA 4N0MA 2HDWA 4OQMA 1SU6A 1DKRA 3B6ZA 5P8WA 2KWIA 2QZSA 3W1WA 1N36B 3S2IA 3W34A 1A9OA 2G9QA 1FYXA 1PZXA 2IPAB 5DFAA 4KIFA 1IRXA 1EB8A 1AZWA 4D02A 4QTYA 4MYCA 2WP8J 4WLNA 3H65A 3AF1A 1SQ0A 2P4QA 3IMGA 1GCIA 4OAQA 3LQYA 5CMLA 4ZI7F 2W2MA 1JNXX 4O4LB 3JQ9A 3IVMA 4P31A 2F1KA 3NPAA 4UEJA 3ZDFA 4AZSA 2GKSA 4N5LA 3OOJA 3KWJA 3AVVA 1F1JA 3M1IA 3NV7A 3A04A 2RCYA 1QIIA 4C4YA 1WXHA 5HIAA 2WP0A 1S3SA 5EP3A 4A23A 1CUGA 4HPWA 4KLRA 2HNBA 2F7SA 4RIIA 1FL9A 4GC5A 4RU1A 4BNTA 2LP4Y 3R6LA 3CSUA 1H9CA 1N5KA 3ZHTA 1GVNB 4C6RA 1GLVA 2PZBA 3OIVA 1REQB 4X3CA 2XGJA 4G5OA 3U61B 2ADMA 2JIBA 2I03A 2P30A 3UUEA 4EHAA 2ZATA 4HXGA 3WRWA 3WWYA 5ETJA 3TM4A 5HDQA 3C48A 2W11A 4KQXA 1K6XA 4TROA 2Q6VA 4N76A 2OUKA 3CB4A 1TEZA 3DAYA 1S2IA 3IE1A 3ZWYA 5AYVA 4AB1A 3NH9A 4FMCF 3A26A 4TYPA 3PF9A 4DSUA 3OEHA 1J97A 1E3WA 2QPTA 2HBYA 1UF9A 4I55F 2FSPA 4URUR 3CXUA 4CZ2A 5CXXA 4LSWA 3ASZA 2Q1TA 4MROA 4UATA 4ZEVA 3UANA 2DUNA 2ZYWX 1YT5A 1LZLA 5T41A 3VNRA 3FNRA 4UOQA 3PEYA 3COYA 1ZAYA 3GGDA 1PQ4A 2RFLA 3NNNA 4A26A 3PTAA 1TVMA 1WU8A 1FVOA 1YCGA 2D8MA 4Q7QA 1SCQA 1Z6AA 2FJUA 2JGMA 2M6RA