3PHBE

Crystal structure of human purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
PTLMENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal Structure of human purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 288
sequence length 288
chains with identical sequence Q, S, T, U, Y
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phbE00
1V3QE 1C3XA 4K6OA 2QDKA 3PHBE 4P54A 4LDNA 3BL6A 1JDZA 1CB0A 4R31A 3C74A 3E9RA 1Q1GA 2GUWA 4DA8A 3P0EA 1A69A 1A9RA 1PR5A 4TXMA 5F77A 4WKCA 1TGYA 2HN9A 4G8JA 1YBFA 3EEIA 3UAZA 5JPCA 1ULAA 4QATA 4GMHA 3UAWA 3OZBA 4EARA 1A9OA 2RJ3A 4F3KA 3OZEA 3FB1A 1OTXA 1PK7A 3NM6B 2A0YA 3MB8A 3OZCA 5B7PA 4DA6A 2OXFA 1U1CA 3FOWA 1TCVA 1JP7A 1Y1QA 1PR4A 4DABA 1NC1A 2OC9A 1K27A 4LKRA 5B7QA 4L5AA 1V41E 1JDVA 5CXSA 2HSWA 4TXHA 1V45E 4WKOA 1VFNA 1LVUA 4F2PA 4F1WA 1OTYA 1VHWA 4L5CA 1RXCA 2PGAA 4TXLA 1A9TA 2IQ5A 1PR1A 3IOMA 1WTAA 4QARA 4L0MA 5F76A 2A0XA 1OU4A 1YRYE 4TS9A 1RFGE 1RXYA 3DF9A 1Y1RA 1Z5PA 4YJKA 3KUKA 4GKAA 4TXJA 4MCIA 1JPVA 1ECPA 1V2HE 5F73A 1Z35A 4OGKA 1RT9A 5ETJA 1PF7E 4LNAA 1V4NA 1PBNA 4OEHA 3FAZA 2Q7OE 3QPBA 3T94A 1RYZA 4DA0A 4YMLA 3LGSA 2H8GA 4DANA 4JOSA 1CG6A 2AI2A 4TTAA 1M73E 3KHSA 3OCCA 3PHCA 4PR3A 1SJ9A 5CCEA 3KVVA 4R2WA 1G2OA 4F2WA 4OY3A 1OUMA 4M1EA 1T8RA 1JE0A 3IEXA 4NS1A 1OVGA 2OECA 3ODGA 3OOHA 4BMXA 1Y6QA 4X24A 4D8YA 2QPLA 1ODIA 3DPSA 1SQ6A 3EUEA 1PW7A 5B7GA 4FFSA 3D1VA 4M7WA 1Y6RA 1PR6A 3NM4A 4ECEA 3DP9A 1Y1TA 4LNHA 1B8NA 4WKBA 3KVYA 5CCDA 5F7OA 3K8OE 4YNBA 4BN0A 1T8YA 1LV8A 4L5YA 1TD1A 1U1FA 1U1EA 5IFKA 5K1ZA 1VHJA 1YR3A 1JDTA 1Z36A 2ISCA 2XRFA 2B94A 4GLFA 3BJEA 1Z37A 5I3CA 1RXSA 2HRDA 3NM5A 1ODLA 1U1GA 3OOEA 2I8AA 2QTGA 5EUBA 2QSUA 1K3FA 5F7ZA 3OZDA 1XE3A 4QAQA 1PR2A 3EMVA 4LZWA 4DA7A 3KU4A 1Z39A 3K8QA 4R2XA 1ODJA 5CYFA 5FAKA 3GB9A 1PWYE 4D8VA 1K9SA 1RR6A 2HWUA 1Y1SA 3U40A 1SD2A 3UAVA 1JDUA 1OV6A 3TL6A 5EPUA 1Z34A 4MARA 4OJTA 2AI3A 3GGSA 1I80A 4QEZA 4NY1A 3BSFA 4JP5A 1JDSA 1YQQA 2OC4A 1JYSA 1TGVA 2A0WA 4JWTA 2AC7A 1A9SA 4E1VA 1ULBA 1T8SA 2ON6A 4PNPA 4NSNA 4BMYA 3EUFA 1RXUA 4QASA 1FXUA 3LBAA 2BSXA 4DAEA 4KN5A 2I4TA 3FUCA 4OGLA 3PNSA 2AI1A 1JE1A 3P0FA 4U2KA 5B7NA 4G41A 5F7XA 4IP0A 4WKNA 1SD1A 4D98A 4QFBA 4M3NA 4WKPA 1RSZA 4TS3A 4TYMA 4TTJA 1ZL2A 3F8WA 3BGSA 3ENZA 4GLJA 5EFOA 5CYGA 3FNQA 1NW4A 1PKEA 3ONVA 1N3IA 5F78A 1VMKA 3SCZA 3OF3A 3INYA 5CXQA 3KVRA 2P4SA 1Z38A 3E9ZA 1ZOSA 3UAXA 5C80A 3FWPA 4DAOA 3LA8A 1NC3A 1A9PA 5IU6A 4MCHA 1Z33A 3OPVA 4EB8A 5F7JA 1RCTE 4UC0A 4OF4A 4D8XA 4L6IA 4TXNA 1V48A 1PK9A 5KB3A 3MMSA 3DDOA 3NBQA 4BMZA 3E0QA 4D9HA 3DJFA 1YQUA 4F3CA 3UT6A 4G89A 1T0UA 1QE5A 3O6VA 4DARA 1PR0A 5DK6A 4H1TA 2QTTA 4TTIA 3O4VA 1LX7A 1B8OA 3PNPA 4YO8A 1U1DA 1Z5OA 4I2VA 1A9QA 2A8YA 3UAYA 4RJ2A 1Z5NA 1ODKA 1TCUA 1T8WA
chains in the Genus database with same CATH superfamily
3TRIA 2R11A 1DBPA 3TNDA 3LQFA 3JQFA 2DQSA 4BAGA 3CMMA 3IILA 4IGFA 5HF6A 1EXMA 4Q9JA 5IYZB 3F9RA 3KKKA 4TLEA 5EJFA 2IS2A 1T6ZA 2HSJA 4JMPA 3OA2A 3STHA 3X44A 3ZHXA 3IUSA 2JFQA 3WRWA 4JLBA 3W5BA 1FVOA 3NBYC 5EL0A 1FZTA 4D25A 3FSGA 3N8DA 4LOKA 4LQLA 3NTLA 2OBXA 4DRYA 1MORA 5IBQA 4QKQA 3FA2A 2V7PA 3HBAA 4AECA 1RJEA 1U7OA 1EZZA 4DIUA 2Y4NA 5DU2A 3RVSA 1PS0A 1GGMA 3THWA 2AUMA 3WZMA 5GVRA 1YL6A 4MVJM 3X2EA 1M54A 1FA9A 1Q7RA 2JLCA 1SM4A 2P0AA 2WHYA 2OWDA 4M8IA 2M32A 3CEMA 2E37A 3FPHA 3ZJVA 2XEDA 3DB2A 1SB9A 4DMRA 1JZSA 1ZN8A 2AJBA 2XYHA 1ECBA 3RASA 5KKAA 4F91B 2RGNC 5TJ9A 1WQ3A 2ATXA 2EBWA 2EKDA 1I7DA 1IZ8A 1NQWA 4R7TA 4QATA 3O1LA 1AV7A 1ULZA 5AQEA 5C8YA 4KXLA 1NX6A 3WJ2A 4DYDA 2EF1A 3LRPA 2HM7A 3LFTA 1DNPA 3O4GA 4R2MA 5JS8A 4ZV9A 5ERGB 1TVMA 1A9OA 1SC3A 4J1SA 1H94A 3TLEA 1FSZA 2YN2A 4IXWA 5G1PA 4H1VA 3GXBA 4L5IA 4QXQA 1ZNXA 1T2NA 4Y2GA 2RB4A 4MITA 5I3ZA 2SBTA 4FE7A 1U1CA 3C15C 1U8EA 2EL7A 4Y30A 2NU8B 2CVFA 1QVAA 4I9GA 4ZCMA 3RJMA 3HR7A 2GXQA 3HJGA 3MXTA 2GXAA 3BERA 2XODA 2P6RA 4BQIA 1ZGBA 1QR6A 1LTQA 2P4UA 3OOWA 3ZVNA 4QSHA 4LTMA 1P18A 3QGMA 2IYZA 2VJLA 3PBKA 1KJYA 1JU4A 3SJ7A 2QL5A 3HZOA 1GQRA 4LKRA 3BIWA 2JD0A 1YB4A 4KP7A 1VBMA 3T06B 3WTCA 3ZK9A 2ZJAA 3FTNA 5B7QA 1NQAO 2H4XA 1KIMA 4HDNB 5DX1A 5JARA 5P21A 4PYQA 2JGDA 5FNZA 4HQ6A 5GPBA 1QZUA 1XDZA 1NE7A 2CJWA 3E03A 3R74A 4P3OA 2HU2A 3CMCO 4KR9A 2C9ZA 2J3LA 1WR8A 2WD7B 2YHAA 4BDSA 1ADYA 1K7SN 1G7SA 1OI2A 3VDQA 4ALLA 4YQFA 3K6SA 4C4RA 3KPUA 3T7RA 1NY6A 3A4LA 2I8LA 3RV4A 2VCYA 3V2IA 1TMKA 2H3EA 5LXTB 4RLQA 2I55A 1TKRA 3ONFA 2FPRA 1FMLA 3D6HA 2H07A 1ILWA 4LMAA 5T4FA 2PKEA 3TE7A 1XKQA 3BMQB 4JYMA 5AVOA 4B74A 2ZIXB 1QTNA 4TGLA 3TL2A 2P41A 4IH9A 2YRXA 1GPKA 2XOEA 4IBOA 4LOAA 1BVYF 4DWVA 5B3JC 2JJ2D 1D9XA 1H2WA 2H11A 1XD9A 2WTBA 3KPWA 4X61A 5E2IA 3TM5A 4BMDA 3BSYA 3ROZA 5BN4B 3BORA 3DBLB 4D97A 3SXPA 1SR8A 1WTAA 3CEPB 2FP3A 2VXYA 3ZXXA 2QTRA 1N0HA 3QUBA 2ZATA 3CUKA 3E18A 4CG3A 3T54A 1DCTA 2DE0X 2A2ZA 2ODTX 4PHTA 4TMTA 4CMKA 2B99A 2BLLA 2CK3A 2FUG6 1RFGE 5EKSA 2PL1A 1E2MA 1X70A 4PIPA 5BV1A 1NP3A 2F8MA 5BW8A 3H1BA 3ICQB 2QUAA 3NCHA 4FVTA 2NNWB 2YTZA 4HYEA 3EDQA 3R8CA 4WOKA 4BDTA 4PICA 2BFDB 2RH9B 3T1YB 1JPVA 2AHRA 1NG9A 5A5FA 3HO1A 5EE1A 3FM9A 3R6GA 4E31A 4OGKA 4B87A 3PL1A 5K8VA 3PDWA 5CH5A 5EE9A 1Y5MA 4PC6A 1C0IA 2NXNA 3E22B 3V4OA 1IOWA 2ONYA 1P31A 2P5TB 4IV8A 2NV0A 4KZPA 4RFSA 4EY3A 1EJ2A 4PFQA 4LC0A 1KMHA 2Y1LA 2B8WA 1E9CA 1VJRA 2ZS8A 4W9MC 2JFFA 2DLCX 2V1UA 1Z06A 2W6OA 3E3LA 3QP9A 1DMRA 4YRFA 1Z88A 4XLZA 3GFOA 3DNFA 5TNXA 2X9LA 4NS4A 1E3QA 3ILVA 1WHSB 1RJWA 2R1VA 3DFMA 3RVPA 3VH3A 1TA9A 3PYMA 4QG7A 4E2XA 1U9IA 5BQXA 1YC5A 2GJSA 2QX6A 4QBGB 4ZVLA 2JIDA 3ETEA 2OP1A 1WZ2A 5ALIA 1I2AA 4U3JB 4DBLE 4E2FA 4B6SA 1W2WB 2PWAA 2H65A 4DNQA 4QGSA 3ZYZA 1MGPA 2HMWA 4RMGA 5KJ1A 2JAWA 2QN3A 3IEMA 1W4BA 3WQHA 1EWYA 2QM3A 3KVVA 3MSCA 5BWMA 4R2WA 1LSOA 3I5MA 5F33A 3D8TA 2Z98A 2ZE7A 5CVDA 1JE0A 4JJ4A 1S2OA 1ADGA 1L4HA 2OYRA 5E0OA 3CLTD 4R1SA 4MGHA 2ZIVB 4HAUA 3FSGD 3IODA 1SUCA 5AH0A 4R9VA 3QKWA 4MCJA 4I0WB 4K3VA 4N65A 4MLZA 3WQQA 5AXAA 4FYVA 1C7IA 1NAHA 3A6FA 4D3ZA 1RXEA 3KSZO 1QLWA 1I13A 1E66A 1EA7A 1M7BA 1V16B 2RK3A 2D1TA 3AFHA 1XJQA 3H2GA 4GDMA 4NZOA 4QNRA 2ZIAA 2WOOA 3VR4H 5INTA 2RJNA 2Q3BA 3UW3A 3A2LA 1E3LA 2XTJA 3UJ6A 1VXRA 4MW0A 3QKSB 3U1VA 2Z9BA 3V97A 2XAUA 4E2YA 5DGDA 4B3MB 5WRFA 3NHLA 5H7XA 1XCGB 1B6RA 3LX8A 1N8NA 1JB9A 1Q7CA 3O83A 2ALJA 4Q3EA 4C0QC 1WQ1R 2C98A 3QLVA 3PQ4A 3SEAA 3D4NA 4BNHA 1CCWA 2Z95A 4FDAA 1TD9A 5E95A 1X13A 2JVIA 3SYLA 4TZ6A 1XEWX 5KWEA 2FLKA 3K09C 4X00A 1V1RA 3QH4A 1CIPA 3R6TA 1CJVC 3PHJA 3ISJA 3IKLA 2DERA 3ZH9B 2CXOA 2E4WA 3RU9A 1UEIA 1DINA 4L3OA 3R7SA 1OFUA 3H13A 5CT8A 1IXSB 1VE6A 4BZXA 1F48A 1G8FA 1AXGA 1JYFA 2MDTA 2QN7A 3EIUA 3OKCA 1ZNZA 2R1TB 3EDCA 4E5DA 4YRSA 5AW3A 2CD9A 5ITSA 1TD1A 4DV0B 3QPCA 4UULA 3QW4B 5EMMA 5EJ6A 2VQFB 1V8OA 4MQUA 4D4GA 4LHXA 1G1MA 1X1BA 2CVPA 3TECE 2VJOA 5TGZA 2A35A 4BCBA 1HDZA 1UM8A 2GO1A 3KQYA 4KQXA 5BRAA 3ANYB 2QW1A 1F8UA 2QRQA 1T3GA 2GKGA 2GR9A 1R0KA 3B1KA 4OQNA 1THGA 4POAA 2QLMA 4ONEA 3AF2A 4L3WA 2HU5A 3RSOA 3M6VA 4E15A 2VSOA 5I3CA 1HM5A 4B4WA 4FQ5A 2GXSA 2GCNA 2PWPA 2O2HA 1RJ9B 4BAUA 2JIQA 2F1IA 2JA2A 2P27A 2JH3A 4LMBA 4YJHA 3RO7A 2VDNB 4O33A 4JSYA 2J85A 1TU3A 3G79A 4NEHB 2WY2D 2VTBA 1UXGA 2G17A 3SSAA 4QOGA 5AVRA 2PWBA 1CEQA 3KQOA 4QUDA 3ZU3A 1NV8A 1NOJA 4LTDA 1KPIA 2CJPA 4Q66C 4UAUA 5HILA 4YCNA 2I03A 2Y9MB 2QTGA 2GK7A 3ZW8A 1H0RA 5CDTA 1IHXA 4WZ6A 3TQIA 1PKXA 2W2VA 2C88A 4U1RA 3VX3A 1JSRA 1B1AA 1M8KA 1T91A 2F9LA 1L4UA 3OPYB 3E4CA 2PQMA 3CT6A 4Z9BA 3S4YA 1NT2A 3AERA 3DVLA 1EE9A 3PGLA 2W58A 3DS8A 3KT6A 3PXAA 4FFPA 2RGYA 4Y1FA 4CMIB 1KMCA 1XMPA 2QRJA 3SFTA 1UOOA 3EH1A 3M0EA 5KIAA 4AI6A 4KUGA 4JUAA 4JB2A 1J0EA 4L8YA 3L8HA 4LIPD 2D74A 4QDJA 4TSKA 3UAVA 3V3TA 3MHTA 1YZ3A 3LKZA 3WWPA 4MV4A 1CS4C 4GZLA 2FN7A 1IPFA 2ZDQA 2G1AA 1OWOA 1WMAA 4KPUB 1HC7A 5ULLA 3X1JA 5J4LA 3RUEA 5ITVA 3T6KA 1BQEA 2YJ6A 4L4XA 4MUGA 4QEZA 5KYWA 2V6IA 2HIMA 1XQYA 4WZZA 3HXTA 3JYOA 2EJUA 5ALNA 3PDIB 4PONA 5EE0A 4B6GA 1YDGA 2IUFA 2YMLA 3DYVA 3HHPA 4ZDJA 2GBGA 5A2GA 1FFEA 1Z8HA 1ESMA 3NIDB 3SIPA 1RVV1 2FETA 1RKXA 2C8VA 1IY8A 4FN4A 1JIXA 2HHLA 1LD3A 2ZSIA 1KI9A 3CEHA 3H18A 4GE3A 4LSMA 3WNZA 7YASA 2FZLA 4S35A 2IZZA 3VSBA 3AUTA 1UP6A 3ER8A 1OBVA 2ZR0A 3FRHA 4B31A 1U5BA 4A10A 4IOMA 5KNCA 3TQCA 5ALHA 4X63A 4CUKA 3PXCX 5CA1B 4YCAA 5AI8A 1SBIA 2QZ4A 4XJXA 4A5SA 1XYGA 3QVWA 4C06A 4B32A 1GKIA 3ZDEA 2IY8A 5GAJA 1T5BA 1FXUA 1R4AA 1Z4QA 5D3QA 3JQDA 1BCRB 3I1IA 3AVXA 1WPXA 3QXJA 1KEVA 1ZUNA 4KN5A 5JS7A 4BXOB 2FZVA 4EA7A 1H1TA 3U4QA 4N9QA 1XVAA 3FUVA 5JZOA 1S3GA 4GNRA 2J7PA 5A02A 3F47A 3L92A 2VHXA 3D3WA 2IEGA 3OWOA 5HBRA 1AMUA 3GOHA 3I53A 1FW6A 1Z47A 2OMKA 3M1YA 5DLPA 4B6JA 5JCJA 2E4XA 4K0KB 5KOYA 3CRVA 1GPYA 4IP0A 3CB4A 4B85A 5HQTA 3M2TA 5I9MA 1QP0A 3UA4A 2BM0A 1E63A 3DOUA 4JNCA 3RM3A 2O5CA 2Z5LA 4HRAA 3VPDA 3CKKA 3QUTA 4HN2A 1GRCA 5AM0A 3GVCA 4IRXA 5CK4A 1QHHB 1II8A 2IUYA 4I08A 3V4FA 4DM3A 4XTCS 3WHIA 1NWHA 3OE7D 1H1LB 4LDZA 5BUCA 2P2DA 3ZQ6A 4MQEA 4XOUA 5TMBA 1U2TA 5J4KA 2XGJA 1RXWA 4C4SA 2DUMA 4UHCA 3V2GA 1T6NA 1XXHE 5ICSA 4Y3UA 5CB4F 2Q9CA 2GPSA 4CV0A 5KSOA 2YY7A 3KDAA 4KITB 4KAXA 2NO1A 1J0BA 3AHHA 4P3XA 2I7VA 4RV5A 1KSGA 4LZPA 3ICPA 3Q11A 1KO4A 2C4VA 4REQB 2V1XA 3QVJA 3BFVA 3EE6A 3OIVA 4RGQA 4XVCA 4HDOB 1TM7E 2ETVA 4LQDA 4HG2A 1T36B 1QE0A 2ZYVX 4EGFA 2PD3A 5CXQA 2QRHA 3T1OA 1PJSA 3BXPA 3ZTTA 4CLHA 1QKJA 2EJVA 3HN7A 2GBIA 1P1RA 1SHJA 3GLHA 3ESXA 4O4IA 4AM8A 1G8KA 3VU9A 4XDZA 3K16A 1XLTC 2H48A 3EQ8A 5KCMA 1VE9A 1QHXA 3B38A 2R48A 3AU8A 3H2KA 3OHMA 1SIWA 2O48X 5GGYA 3HXLA 5JV5A 3CX6A 2YVKA 3QTLA 5J5CA 3LA8A 2R60A 2QYTA 4NOKA 1U0SY 1PHRA 2X4GA 4IXMA 1KR5A 2BGIA 1WDWB 4BUJA 2FY8A 4OHMA 1TT5B 2WNIA 2GZMA 3BMXA 3IMFA 4P7BA 4Q4JB 4AXBA 4EB8A 3A0RB 3RSGA 4TZ0A 5FHQA 3AKCA 3FBTA 1NXXA 3I4FA 2JHFA 1U3WA 3MXOA 4INAA 1Z8FA 3NV7A 4YCLA 1Q0LA 3GLGE 3UMYA 4BJ5A 3HH8A 3WICA 5E6UB 3U5TA 3C41J 4L6IA 4Y2VA 1EVJA 2YH2A 3WQSB 1IIRA 1JIVA 1WVGA 2ZPUA 3AOEC 4G5SA 3D8NA 4CM4A 3PE6A 3QVOA 2D5AA 4EHLA 4C7OB 1NU8A 4U4AA 3BRWA 5JS2A 1M1XB 2IDKA 2DY1A 1PL6A 3HV0A 2IQIA 2RGNA 3MAGA 3MMSA 1GZ3A 2ANCA 1A9XA 3DL4A 2B34A 3OQ1A 4HWGA 3MRTA 5ESDA 3OIUA 1Q5PA 3R2JA 5G1NA 1IE3A 2DYKA 2H1RA 1HQKA 4WZAA 3UM9A 3ZKWA 1NOIA 2H8KA 3MJTA 4BTVA 4ZI3A 3LECA 1ZPDA 4KTVE 2PCJA 4M1SA 4CEHA 3LT2A 4UU7A 4LKOA 4B82A 2DR2A 1XCJA 1RAFA 2HT6A 1HYBA 1VE3A 2H31A 4L7VA 3O8QB 1Y8RB 4Y0NA 1WHTB 3W5SA 3ZY2A 3G6WA 1A4XA 1WLSA 3HCBA 4FKMA 3AY6A 5KTPA 4TRRA 1A0OA 1IM2A 5IH3A 1WY5A 4M0DA 2SCUB 1EA5A 4YUAA 1SAYA 4IJWA 4M8KA 1I51A 2C5EA 4RFVA 4TLMB 1BIFA 3IPYA 1LDYA 1TUBB 4AZ3A 1L5QA 3MS2A 2HO5A 4A1FA 2ZCVA 1Y3IA 4CLDA 3AUKA 2B36A 3L6EA 2QTZA 1CJKC 1ESZA 1EFHA 2CSXA 1X7DA 2A8YA 4Z0TA 3VJMA 1YBHA 3AHIA 3CO0S 2YMPA 3O4HA 4RJ2A 3DMGA 4U5QA 4OQZA 3H1GA 4BFYA 4IQ4A 4RZIA 2P0EA 3FSEA 5FUWA 5JJ5A 2IDJA 3COYA 4TRJA 3AGQA 2QDKA 5IYZF 2JEZA 2C29D 2WIKA 3QJ5A 5KNBH 1KFBB 4H4DA 3M5PA 2ZT5A 3VVBA 1EBBA 4YMVA 2A14A 3DHYA 3IOBA 2AX4A 5KNDA 1GUZA 3AR9A 2Q28A 3C48A 3D4BA 1RS0A 1K6MA 4C6HA 1FSFA 4RH3A 1FFCA 3FHLA 1DO8A 5FH9A 5CIWA 4F1JA 2BISA 2QUKA 2ILVA 2WIFA 1O6ZA 3I5UA 1XRJA 4PFSA 2ZS7A 3QUQA 1F7VA 3IQHX 4JHLA 4JUBA 1Q1GA 1R7RA 2XIJA 3LUPA 3ESYA 4BLPA 2YQ4A 5KI6A 4R9UC 3P0EA 4U00A 1M6YA 5NULA 4GMKA 1DLIA 2BE7A 4TYYA 4MKHA 2N47A 3KJZA 5CEEA 1G8SA 4HRYA 4Y1GA 4Y6RA 1Y1PA 3ROKA 3T7KA 4DR5B 2ZYIA 4QFCA 3BMNA 2X1LA 4MPPA 3ILYA 4KKXB 4MHOA 2HXYA 4NV3A 1UFOA 4ZVSA 5B1DA 1KQNA 2N1BA 5BUQA 4TYWA 3MWFA 1BCSB 1AMNA 4R68A 3CZPA 3D0OA 3K71B 5KNCD 1MOZA 1WQ4A 4LRQA 4N0PA 1UKYA 5FBVB 2WP8J 1JG6A 5D5PA 1ZM3A 4TTSA 3HXOA 4ISCA 3C98A 1CYDA 1UFVA 4LHYA 2W8BA 3EGVA 3W8FA 3C2QA 3R0VA 5FPQA 4M8LA 3ZWXA 4AYTA 4TQ9A 4YAWA 4KQ6A 3OZGA 4TSRA 3NM6B 1YRHA 1R4NA 4Q21A 1P39A 1P80A 5J23A 2CYAA 3MS7A 1GGJA 3SK0A 2II6A 1NKVA 4L51A 4XLTA 2J7PD 2WE8A 4M0KA 1X0VA 2G40A 3H65A 3T4EA 4GW3A 4A0QA 1C1XB 1TC1A 1H2RS 5CG2A 5JCJD 1PDVA 3LXUX 2IU3A 3C0KA 1SKUA 3FZYA 3H05A 5E3IA 1SCDA 2MJLA 4NZ9A 2YWDA 1IJEA 5ERYA 4BNDA 4M22A 2OC9A 2WE7A 4YJGB 1I4TD 4YYZA 1BRTA 4ZOLA 4O1MA 4LY3A 4EJMA 1Y1KE 4UBJA 1EX1A 3EVBA 3VNUA 1NMZA 4RU1A 4MMZB 3C3MA 2EGHA 2G6BA 1NV9A 5CX4A 1PSZA 3UICA 2MYUA 2XCQA 3GNLA 3R5TA 4BQNA 4BVFA 3AKYA 2I2DA 3B36A 3GJ7A 4BVHA 3AHCA 4ILKA 2P6MA 3DTVB 1VL1A 3JYQA 1AGRA 4PYKA 3ECSA 3PK0A 4PGAA 1JJFA 2OCPA 3BZWA 4M1KA 4WKOA 2JZCA 3F6RA 5LXTF 3NIFB 1GZ6A 3UK6A 2B83A 5AVUA 1UINA 3T38A 1WUTA 3EC2A 3PC3A 4WBNA 1DG3A 2XMZA 1L7BA 3LPMA 1JWAB 3AV3A 4JP2A 1O87A 4XDHA 1RU3A 4M38A 5FTLA 1E98A 3SAJA 2O0JA 2Q5CA 4A16A 5EEGA 5HX7A 2UYCA 2NGRA 5AQ1A 2C4MA 2H5LA 5JAHA 2ID4A 5AK0A 2Z83A 4QOJA 5E4JA 3RREA 1EM6A 3ON5A 1TUGA 2WJYA 3M89A 4CTJA 1KKMA 3TLCA 1QRUA 1JECA 2BSAA 1YZUA 2JHGA 5IAJA 4BJHB 4J0EA 1UK9A 2RARA 1Q95A 3QU2A 1M6HA 1ZGJA 4M9XA 2A5JA 5F76A 4ADSG 4EY4A 4EO9A 1N5JA 4MYSA 2I34A 3ZVLA 1A5BB 4DXAA 1KDZA 4DR3B 1QYVA 2P9HA 4ZRNA 1GPUA 3R3ZA 1FQWA 1T4BA 2COEA 3TLJA 3VJLA 1RXYA 2CLCX 4DEVA 4AQDA 1VKNA 4NDZA 3DEZA 4FE4A 1E0SA 3BSWA 1HZZC 3QPWA 3HBJA 4WIAA 3BRWD 4YRQA 1L7PA 2R6GA 4TXJA 4AJOA 1L1EA 2V7XA 1SG9A 4EG6A 2J7KA 3IHWA 5C1IA 2C9YA 2FHPA 1A72A 1ZONA 2NTNA 5KYYA 2B1IA 4YA6A 1SIUA 3PQ5A 1O96B 4DCVA 2C95A 3TW6A 2VT7A 5JASA 2WF9A 3AI3A 3DMFA 1GLNA 4UNNA 4AZSA 3S2GA 2CNWA 2XB2A 2GXUA 3OCWA 3DOHA 3ET5A 4IX9A 3T7AA 3CINA 3QEOA 2CXUA 5A5VA 1GRNA 2W2MA 4WNIA 1AS0A 4FNAA 3WKEA 3VMMA 2Y0EA 4B47A 3R5FA 5DEIA 4XSGA 1QZ3A 2DWUA 3ZWBA 2ZTSA 2XZLA 4JP8A 4RM3A 3BWBA 1I1OA 1UBLS 1C0KA 2VJMA 2DRIA 3OJCA 2VPPA 3IS3A 3KHTA 4G85A 1M1NB 4MUNA 3RSQA 2PBLA 3OCYA 3WKBA 4WMLA 2YBEA 1CZUA 4ND1A 1HL3A 1WOYA 4C5BA 2QM0A 2AXQA 3O7WA 1ATIA 3K2QA 4H3KB 1L9KA 4RPIA 3FPAA 1C8VB 3QPDA 1UIMA 2A5YB 4Z4IA 4TS1A 3HJTA 1JG1A 4C7VA 1IU9A 2H7XA 3KQMA 1E6KA 4LEIA 4XQEA 2H2FA 4OP1A 3UPDA 3WL5A 3KQLA 3W5AA 3PJRA 1T2UA 4JASB 4BCCA 1TU4A 2CLSA 1IEWA 4FYWA 2R8YA 2WBLC 2JIRA 2Z6VA 4D96A 3W8NA 1FF9A 4J75A 2ES4A 4BZPA 3T3EA 4JBLA 3GWGA 1GEEA 4MROA 5AJHA 5P8WA 4TN5A 3DUFB 4FIZA 4D0SA 2VT3A 4IDCA 4PGFA 4LWQA 1DDGA 2HGZA 2O8BB 1UDXA 3OX4A 5JD6A 2ZYTX 1EIZA 4ZQBA 1R0YA 3VNRA 1V25A 3FPKA 4AYWA 3CF0A 3JAWB 5AW2A 3HBLA 2YZ2A 4JC5A 3ASZA 3PQEA 3S28A 1FDOA 4JLSA 4PC7A 3A1TA 3ZDRA 5C32A 2PVSA 3MVEA 3OCJA 2ZW9A 3SEFA 1B0AA 2BP7B 3PUJA 3AT1A 1ZVMA 3W8RA 2IHYA 2V7UA 2MTBA 3P2YA 3VC7A 4CFYA 3P94A 3ZY3A 1LLCA 1RQLA 2X5XA 1IWPB 1K3TA 1YHYA 1ONNA 3L8DA 1SKBA 2IUTA 4RGVA 1DJPA 1IUNA 1XMIA 2AN4A 2IPAB 1U2PA 4BV3A 5JMTA 3MJ4A 3GRPA 1YKSA 4M7PA 1B8NA 2ODEA 1NLZA 2P7HA 1GCAA 1XNJA 3BAFA 5HQ3B 2HBYA 2HCBA 3NTOA 2VZ9A 1LX6A 5AI5A 5U4XA 5TE9A 1DC8A 3U3DA 4ZYUA 4B3JA 1L8LA 3PP8A 5ALOA 1TZKA 3O8OB 2R65A 1OCEA 1NSTA 4TM8A 4ALIA 5IJAA 1T13A 2ARKA 1YVPA 2B4TO 2QLBA 4C20A 3VDXA 4ES6A 4LFBB 2C7GA 2QAGC 3I23A 3OZIA 3ZE7A 1PK8A 3DDSA 4WY8A 5BT9A 2W42A 1I3CA 2OM6A 5A2QA 4BCDA 3GLIE 3H9CA 4DRXB 2H54A 2ZJZA 3A4NA 1T3ZA 4M1OA 2XEXA 1MJ5A 2BELA 1Z5ZA 3IBTA 4YIHA 2A4KA 1YF3A 5BW6B 2QBYA 3NMUF 1NFFA 1XKTA 2P6OA 4WBSA 1GYQA 1G5TA 2EV9A 3GQBB 3NDJA 3ONWA 5L3VA 3L1KA 4P5DA 5C1BA 4EO4A 4X60A 2HK7A 1GAQA 1SBTA 3CYFA 3AEUB 2RH8A 3K0BA 1X86B 3ILHA 4K9PA 4P4GA 1H0KA 1P6XA 4ZCPA 1T9AA 4ZMRA 2PGIA 1USKA 2CL0X 2O59A 3EBLA 2EFEB 2P3OA 4U7WA 1JDNA 1IL0A 1E99A 1VCIA 4M21A 4M0UA 4ILEA 2QMUA 2FWBA 4MIEA 4R0MA 4ZVPA 5KYUB 4JBGA 2ZIFA 1MO3A 4E5UA 2PRKA 5H83A 3PC4A 2GLTA 1N32B 3PDCA 1K92A 4PE5B 1O97C 2FK8A 1Z39A 2FRVA 2XNHA 2JAXA 3WSTA 2AQHA 2QV7A 2VUIB 3QFHA 4B1FA 1I6LA 3OESA 4W5NA 2G9VA 4LI0A 5ESXA 2WYWA 1L5NA 1MPXA 4RD4A 4DHEA 4MR8B 4FLMA 5H9VA 1PFKA 4Y2HA 2C3YA 1QZTA 2QA5A 5F4ZA 5FD8A 4ER7A 4O08A 4XIGS 4AKGA 5JISA 4BFUA 2NT4A 1GUDA 2VUTA 3UHOA 1MB9A 2OCYC 3LBIA 3O75A 1KI3A 4AP5A 3D6TB 2AOVA 1NI4A 2OXRA 2PMKA 1BE8A 2BDEA 2H4WA 3L02A 2EZ9A 1QOPB 2PZLA 1QC5B 4JUCA 4ML3A 2UYQA 4N5DA 3DL7A 5FO0A 1KL7A 4HX5A 3T52A 4RMNA 1SZPA 5LQNA 2XKBA 3Q5GA 1TM1E 1VHQA 4B3GA 4YN3A 2ZWPA 3AJ9A 1MAWA 3L6OO 4WXRA 5AW7A 3A6DA 4PLYA 4TQAA 4NPAA 1XCBA 5JS6A 5J2TA 1GR0A 1GCOA 2IYSA 2OC4A 1XLTA 4FGZA 4MR9A 4JR1A 1I4DD 5EUQB 2WU8A 2XNSA 1NZJA 1QSGA 1RP1A 2BKLA 1JIIA 1HDEA 1VE5A 2FPMA 3OCZA 2MINA 3OT4A 4N7JA 2EX4A 3TJMA 2CNWD 1US8A 2GPNA 3L0SA 4DPKA 2OD9A 1A2BA 5LVAA 3NVKI 2QK4A 1XEXB 2WJ4A 4EIWA 1R3DA 2BZ1A 2NV2B 2IEYA 4XGRA 2J08A 1E2KA 1T6BY 2WA1A 3B6IA 1CWUA 3RIMA 5BRNA 4QASA 1OF1A 3WVNA 1J7KA 1P1CA 4RD3A 1VFPA 2BSXA 3Q6MA 4DAEA 1J21A 1KK0A 3I9FA 1TOAA 4HDSA 4RXMA 4WJKB 1CU1A 3SMVA 2RJOA 4EZBA 1QV7A 2Q4TA 4Q01A 1V9LA 2O7NA 4MUYA 2GF2A 3M1LA 5DCYA 4IV5A 4OBBA 3WL8A 5ADVA 4QTUB 1JQ3A 1TK2A 5JRZA 1EG7A 5BN1A 3TR6A 2PG3A 3FJ1A 4UPEA 3EGCA 3U37A 3AKDA 4ZGGA 3OLCX 3V8EA 3H75A 1RAHA 2O5VA 1DZIA 1YR8A 2BW0A 5TPZA 4C29A 1I0LA 3AWIA 4OK3A 4R3UC 1SD1A 3U26A 3FTCA 2OCGA 1KKUA 4JT4A 1TPZA 4Z86A 2PT7A 4RSHA 3LP6A 4KQFA 1QPGA 3JQAA 2C59A 4AC9A 5I8WA 5HTOA 1IQUA 4M36A 2AUTA 1ZL0A 4HKTA 2VP2A 3DJYA 1V2GA 2AJ8A 3UMGA 2BBTA 1ZK4A 2FCRA 3CX4A 3KKZA 3LV8A 5CT9A 3ZTYA 4OVKA 4O59O 4FQ7A 4BNYA 2W6ZA 3MUNA 1ZD1A 2W90A 5L7YA 4IZOA 4TYPA 4U8GA 4B8YA 1E9DA 2HDHA 1GCGA 3DULA 3OCUA 3K1AB 4KFRA 4XUEA 2V5VA 5HF8A 1RE1A 3STTA 2IZ1A 3VR5H 4BFZA 3BGSA 3BXXA 1HEYA 1PZNA 5CB6A 1R00A 2P2SA 1MCZA 1VMDA 3KE8A 2XCSB 3UUEA 3HWX1 1NE2A 3OAAA 3FNQA 4RTNA 1KO8A 1NULA 1H05A 3MINA 3FPBA 3P9YA 5F78A 3HY3A 2PU5A 2V7BA 1L5VA 2KX7A 3DGEC 4I55B 3LQYA 4JC4A 3SF0A 2NMVA 3E7XA 3OZUA 4BZWA 4IIJB 4J9VA 1M2FA 1RQGA 2B35A 4RPCA 2XNDD 5EHGA 2JLBA 2YWRA 3WTBA 4L73A 4R8SA 3GF4A 3SC3A 1HDCA 1IOZA 2H0AA 3C39A 4AO7A 1NPTO 3OTWA 3IQZA 1HK7A 2XWQA 1ZVVA 1T0HB 4KVGA 3ILSA 2UZ4A 3L7JA 1XKLA 2UUAB 2XYRA 3K0SA 2D5BA 2ADFA 2VPYA 3GU3A 1SUDA 1KAGA 1IZ0A 1ZMTA 3JY6A 4X95A 4BBAA 3IUJA 3LY5A 2HPVA 4NBLA 1T3HA 2DJ5A 3MCZA 2A0UA 5EINA 2WJAA 4U9HS 3OFJA 4JYZA 3IVRA 3KOMA 3LWBA 4X6UA 3IUQA 4KIWA 3PXDA 5JBQA 2VHEA 3MT9A 1T5LA 5TF0A 1K4MA 4P4UA 3UMJA 3I9JA 1JJ7A 2E18A 1OIXA 1S2IA 3I0ZA 2ZIGA 4LISA 1E2UA 1MB4A 1YE3A 5IJXA 3HVHA 4A2WA 4C05A 8MHTA 1GL9B 3ODPA 1PZEA 2DBVO 3FDJA 2GRJA 2XCOA 4IHQA 5JPIA 1N34B 1MT0A 1JAZA 1B00A 3UMFA 1TMGE 4TOIA 1JJVA 1THTA 4B2YA 5D6NA 4CEHB 1DQRA 4MKRA 2Z6AA 3EODA 4DSNA 2OL4A 5E8JA 2BBSA 3GJQA 3LSTA 1YH3A 3OVMA 1M2NA 5I9TA 3DEIA 1T9BA 3B6EA 1E9BA 3OTQA 1NVVR 4G5FA 3ZHUA 1SCNE 1Z08A 2PUTA 4JCOA 4CKBA 1IN4A 4EEZA 2R66A 1M72A 4G4IA 3SF8B 1NWCA 1Y5IA 2V6GA 3DP7A 5GOZA 5BXYA 3WWYA 4BFSA 2UDPA 1K97A 2QSYA 3FB4A 3D8UA 2I6SA 2HCFA 3GEHA 1D7OA 3H3JA 2XA1A 2Z08A 4QUBA 5SICE 1JSCA 1MJGA 2Q3HA 1GZUA 3R0QA 4GD3Q 3WK5A 4YO8A 3LQ2A 2Q29A 4PHCA 3SFVA 3I72A 4UVDA 2WFLB 5EIAA 2INGX 1E6CA 3QWFA 5EWMB 2BFFB 3D8RA 4DCSA 1DRUA 3GT3A 2QVBA 4RS3A 2P9FA 1OASA 1QIHA 2FVXA 4PX9A 3I83A 1XELA 1DJLA 4GPIB 4EG5A 2CLLB 1YKGA 1JSXA 2H1HA 4DGSA 4QU0A 4DNXA 2Y0DA 1FUIA 1LSUA 5DXFA 4EWLA 4YUYA 5F9HA 4RQBA 3G59A 3SU8A 2X1VA 4IM7A 2XB8A 2YUIA 2IE0A 3GLHE 3N07A 3PD0A 3THOA 4R31A 4FS3A 1JV2B 2CE7A 3ZJUA 4GS5A 2GUWA 4B80A 2DB3A 5IVKA 2V0CA 1MJFA 5F9FA 4HK4A 1XMOB 4HO1X 1AHHA 1TZCA 1OBHA 1WUJS 4M46A 4R1NA 4DMKA 1G8HA 3DBRA 4Z49A 1M8FA 4IDHA 1QIGA 4CUZA 5FOXA 5B36A 4X1YA 2C3PA 4HF7A 1P4HA 4DQUA 1O58A 2BIFA 3O93A 1XRPA 1BROA 2ZRQA 3N2EA 2HY7A 1LI4A 3MTAA 5IAEA 3IR5A 3ICEA 3EQZA 3AW9A 5B64A 3V6LA 4F5EA 2GAOA 1W0KD 2R44A 5HK8A 4U2BA 3UF0A 4NCHA 3UFXA 2PNJA 4E2ZA 4FSHA 2PUAA 5I7UA 2WTNA 2OD2A 3CH5A 1FVFA 3M1AA 1AB6A 1AQJA 5IT4A 5IRCD 3H8WA 5JSZB 4Y2YA 5JWOA 4MRVA 4WGGA 2BI4A 2QNBA 3VUEA 1E77A 4S3MA 4WZAE 1HZZA 3C8UA 1BMTA 2FFHA 3SNKA 5IBRA 5IF3A 2CNKA 3TTVA 1P9RA 3KT3A 4FYMA 3IJPA 4W7HA 3B5IA 4UCXA 4EUHA 2F90A 3U3RA 2QMZA 2V6MA 3QRWA 3EEYA 1JVBA 1N2CA 4RL4A 1MO4A 4FR2A 1S96A 5DVZA 1GG2A 5TPZD 6REQB 3AVOA 3OJXA 4CCYA 2CBGA 3JWGA 1NC1A 2BMJA 3HVIA 2V4MA 4G81A 5BNIA 4MLCA 1FP2A 2B25A 2HO4A 2VDWB 3I8OA 5DTEA 2IOHA 3NORA 3ORYA 4S24A 5EMHA 3P71T 3R7DA 2HMAA 3T5PA 2BJVA 1UBTS 5FLXA 5B58T 2OAGA 4Q1VA 5IC4A 3GX1A 3H2YA 4W7SA 3WRVA 2XQGA 2XW6A 3NYQA 1YZTA 2C04A 3V55A 3IRUA 3KT0A 1VLJA 4GRDA 4RIFA 1GFIA 2H2HA 2HSWA 4FFDA 1SU4A 1ZBDA 3T9DA 1CF4A 2J4CA 1V45E 4MYRA 1SHLA 3ZWDA 3HUUA 1KJ8A 2ZKIA 1XD8A 2J46A 3OPYI 4U02A 2J0EA 5DW0A 3MWKA 3SR4A 4U2FA 3DE2X 1P1BA 3NEYA 1EYZA 1NA5A 3OZRA 4O3MA 5EUCA 3N2GA 3RARA 1Z2CA 3KELA 4XE5A 1IOLA 4MGEA 5TARA 4EVRA 3HGQA 1JQLB 3C6KA 4F1WA 3CY6A 1CR2A 1SZCA 1ZD5A 2FSVC 2YFQA 2Z09A 1Z0SA 1SC1A 4NDAA 2QE6A 4R2LA 4FW8A 4YRAA 1OA1A 1V47A 1D6SA 4OHKA 5KTOA 4P3KA 2FWMX 2YXPX 4YECA 2BTEA 3CLKA 4ZVKA 3MAJA 5GMOA 2JRLA 5E2BA 5EE5B 1H2EA 4CDRA 3IMKA 4WN3A 1VG8A 1KNXA 1ZIOA 2CYBA 2GBPA 2HX1A 2VJKA 5IANA 5L3SB 1KWGA 4K9QA 2PZAA 1F2UB 2HK8A 1NU6A 5FOVA 2X15A 5K0NA 4J0IA 3OHSX 5AXBA 3ZE8A 3GAMA 1YRYE 2FDRA 3O3MB 2NSYA 4FEEA 3TNFA 4B3TB 2BEJA 1Z0JA 3D3EA 3OT1A 3J81k 4FBMA 3UXHA 4FJ1A 1G3UA 4DCUA 1N8TA 4P92A 3BXFA 3OD5A 5F9MA 1F6BA 1W6UA 4HOYA 2IXEA 4A6EA 4GGPA 4YJ3B 3OQNA 1MDBA 2HW8A 3FYHA 3BCHA 3P4XA 4OQPA 4BB5A 1GAXA 3RIHA 3IT0A 2JA1A 4DEYA 4GVLA 1FBNA 1KZ6A 4C6SA 2FEPA 5HRAA 1SEPA 1GIAA 1NBEA 5GIOE 3G5UA 2BRUC 1O08A 3L40A 5DNDA 4BRWA 1ZWKA 4IAOA 2X0FA 4F9GA 1JB1A 1U3VA 2XRZA 4DV5B 2M1XA 2G06A 3QVKA 4JENA 1F60A 3U3MA 2QJRA 3WL3A 2KLBA 4M0EA 1QTIA 4F3TA 2QAGA 3X43A 1T9GS 3P9PA 4HD8A 4ZXPA 1OAKA 1CG6A 2JFYA 4FUTA 1UXHA 1U8CB 1I9GA 1V6SA 2ID7A 3EZ7A 5C37A 4ZZ3A 4TTAA 1NKTA 3RSFA 4XSVA 1PGNA 1GGNA 4TWJA 1ENOA 4DIBA 1DX6A 4I5FA 5JAUA 4CQNA 4M89A 1U9ZA 1V8PA 4P34A 4RH1A 5A9RA 1BHO1 3JD4A 3K2IA 4HWRA 3T15A 3MBOA 5LDGA 1P8JA 4XQGA 3DLBA 4JI4B 5CPBA 3P9ZA 4YHBA 4F5ZA 2Q3MA 3H5VA 3H1FA 4FDUA 2QTMA 2P2ZA 1NVDA 3QEMB 1XDDA 2BWJA 4Z2YA 1KJIA 1HMPA 4IDEA 2HMSA 1FU7A 4RTJA 4XGQA 4FYPA 1M34B 2PPLA 3TCKA 4TTVA 4DJTA 4DB2A 5EXXA 2HQBA 2CUNA 3BTSA 3AHJA 2ZIUB 1WMEA 2NQTA 1DUSA 2IHZA 1DIGA 1KJZA 3I6IA 1JPJA 5CK5A 1KBOA 3L1VA 4C0AC 4PS0A 2GCEA 4E3ZA 4TRMA 3EUEA 3P7MA 4MV6A 2DSTA 1XZEA 3LPCA 3EWAA 2DPYA 2GCPA 3O94A 3OQIB 1UJ6A 2I91A 4YBRA 3ZGLA 5HUQA 1ELOA 2VWGA 1IZ7A 1EDZA 1K89A 5L6MB 1CEYA 4ZYVA 2QUBA 5DBGA 3DMYA 1X7ZA 1YBMA 2OZLA 4L0CA 3WDMA 3LBNA 4QC2A 4EJ6A 4EA9A 4HEQA 2OMEA 4DCGA 4F46A 3WOVA 3O8BA 1XDWA 5D7NA 2GRAA 3CH4B 3NIGB 3AHDA 1DT5A 1KTVA 4IEEA 1B15A 1S3SA 2JK0A 5ESRA 1HYGA 1RWVA 3TW8A 2GZRA 3COPA 3GCXA 2PH1A 2HUNA 2ZJYA 1N92A 3WIOA 1K0FA 2C82A 4B3SB 1E4YA 4NG5A 3RT9A 3PXEA 5F7OA 2AEFA 1JW9B 1YOVB 3JATB 3ABIA 4YCMA 2EZUA 4MJXA 4X97A 3DC2A 2OGZA 4EM6A 3S81A 5JVDA 1T8YA 4MGKR 4B6RA 1QQ6A 4J2TA 4DJEC 3RBAA 4DQLA 4L6AA 4D8UA 3UV6A 2EEPA 5FP0A 1VLLA 3A6LA 2YIMA 1XRLA 2B21A 3IKMB 4TTRA 4V0QA 2R8PA 3CIOA 4L27A 1UKBA 2PKRA 2DG2A 3HA2A 1V37A 1XZBA 4HFJA 1SU6A 2QPTA 3A9CA 3Q88A 4E1BA 3BD8A 5IDQA 4YRRA 2CMDA 3HJAA 1YR3A 2OPBA 4D82A 5BW5A 5JTUA 3MHPA 1E6UA 3TLGA 4NBUA 3ZU4A 3F5QA 3PQDA 2XTNA 3NT2A 3TG2A 4PZPA 3HCOA 4MB2A 5KEIA 1L4BA 2BGWA 3H87A 4GPTA 2G1PA 3WK4A 5K6AC 1XYYA 4MV8A 1ZD2P 4TKVB 3H3FA 5HCNA 2D8MA 3L4EA 4S1WA 3GUCA 3D8HA 4ZT4A 4DUGA 3RFFA 3HN6A 3EIEA 1R6VA 4EG4A 4KR3A 3GZTB 5HIJA 2Y67A 4D6XA 4L78A 1ODLA 4CKZA 4I1PA 4JYCA 1FXWA 5DHQA 3EA4A 1E7WA 3ZG6A 3ZNQA 4EW3A 1ZLYA 4ITVA 4PM4A 4Q4DA 1QYCA 5DOVA 3WLJA 2Y99A 3Q15C 1K3FA 1GTMA 4KOEC 4QPJC 3X1ZA 5JATA 5F98A 3D7MA 4X6XA 1WPRA 3QE9Y 1GZSA 4DA7A 2V8BA 3LUFA 1SBCA 1TO1E 1SQ5A 3NR2A 2DETA 1SOMA 1ODJA 1SCIA 3BN3A 4KIGA 3T0GA 3U48A 3L07A 3U3XA 1R0XA 4KLRA 4P36A 2H1VA 1AK2A 1Y3DE 1FPQA 2WSMA 3BJZA 4WY5A 4ZCSA 3VTZA 2ZUTA 2QW0X 2XDQB 2ZRJA 3HGTA 4OFZA 3ANTA 5KDDA 3KJGA 5CLHA 3G2PA 3TLAA 1VM6A 3G0DA 1HYEA 2EKPA 4V0OA 1U0JA 1XRNA 4F92B 4M86A 2WZDA 4HWKA 1Z07A 1BMFA 1VP9A 3M3HA 3TL6A 3DV0B 4M98A 5ALZA 1M33A 2CLOB 4JN6B 2ZM5A 5BYJA 4U7JA 2I1LA 4BFVA 3KTOA 4EELA 4QPCA 4U2GA 3D59A 3TLMA 4YLGA 3WYDA 2BDUA 2ASEA 3AILA 3JQ7B 4WXHA 5F5LA 3ID6C 4NHOA 2ZBQA 5GM2A 1E1CA 2I6TA 3UAGA 4EH1A 2NVBA 4O63O 2Q3LA 5KYXA 4HFRA 3VTAA 2JLVA 2UVDA 4X3PA 3F7TA 1HTBA 5F2OA 1H69A 3N76A 4WD3A 5CA0A 4FHCA 5EJ4A 4NU0A 4OATA 1UK6A 1FNSA 3HYNA 2JG3A 1XHFA 1UT8A 3RRMA 2PZJA 3LAWA 2JI8A 3N2LA 1F1JA 1BXZA 3FYSA 3NI2A 4FMBB 5DX8A 4X8MA 3B52X 2DHQA 3THXA 4PZ0A 3FLEA 1YBAA 1M76A 1OXXK 1PT6A 4E09A 5LKAA 4NL4H 2WWVD 3EUFA 4L8GA 3PFNA 4IO1A 4N48A 4GYKA 3II6X 3ZCRA 5DYNA 3JPWA 1U63A 3TINA 1RQPA 1U6JA 4HNSA 4NQRA 1UZMA 5LQKA 1CY4A 3WY9A 1X7XB 2YCBA 3W4IA 3LNCA 2HLHA 3OKPA 4N5MA 5E6RB 1PWEA 4IMPA 3FGZA 1W5AA 2BGMA 1TA4A 2G4CA 2JIZD 2DTEA 3WNCA 3FPLA 2RKBA 1TFUA 3LUCA 3PCXA 1U0TA 4G09A 4XARA 1D1TA 3LLMA 1VBNA 1ULSA 3DXYA 1UMDA 4M7OA 1G9TA 3CPEA 3JR7A 3GIWA 1UWVA 3RBXA 3NAMA 5HCIA 4OJNA 1NXQA 3WIEA 1IXYA 3ETHA 4CIDA 4GKKB 2VJAA 2GM3A 3D1JA 4L9RA 4RZ2A 4O8CA 1XJWA 2XMGA 2ID9A 1YASA 4ZZ1A 1E2BA 1X80B 2VEDA 4GP7A 3B9PA 3D3NA 1RI1A 2ZI5A 3MWEA 4II2A 4FZ3A 4HYQA 4UNIA 1ZL2A 4NECA 1QIEA 4RD1A 2WNHA 1GAWA 5JNWA 5JFTA 1DADA 1DAHA 1I6WA 1B76A 2FMFA 4W1RA 2RGRA 1G8YA 2WIGA 2R7LA 2CZQA 2JI4A 1O97D 1UK8A 2X13A 1MV8A 4QVKA 3KAPA 1ZUHA 4KWIA 5K3FA 4YT8A 5C7YA 5FUBA 5EAIA 3WFZA 4DPMA 4EKIA 2CLKB 1SCBA 4AUKA 2ET6A 4EO7A 1E3JA 2GARA 2N3ZA 3K0AB 3TLZA 1JFFA 1XVUA 4I55F 1DIAA 1N3IA 4L4ZA 1GNQA 3KZXA 4IIJF 1O77A 4H7FA 4M9RA 4QDKA 5JQWA 1FFDA 5EVCA 1JFRA 5JI2E 3AIIA 5F3DA 5K0BA 1XN4A 1MQ8B 2H2WA 2HAEA 3GEIA 4MW4A 4Q9AA 1K86A 6Q21A 3VDNB 4MS3A 2COUA 5DWDA 3M4ZA 1NMQA 4EY6A 3ETCA 1LK7A 4BO8A 1EK2A 4REOA 4C0KA 2JLSA 4UM7A 1DAIA 4TLCA 4AMYA 2OFPA 1GO2A 1KSJA 1TJ5A 3FMIA 4CJXA 2HKIA 4Q16A 2V7QD 1W581 3P4UA 4RNCA 4UU8A 1N57A 5CVCA 2CL7X 3HSKA 1K8YB 3LKBA 1UJCA 4Z9YA 1B74A 1QHSA 1JQJC 2XOKD 3CLSC 5JQGA 1FNNA 1ZICA 4NYJR 4WXEA 2BUCA 4CTNA 5A5EA 5FX2A 1LUAA 4YROA 5CT4A 1MGOA 1YS7A 2K7FA 2AA3A 1SD5A 1TYDE 1RWMA 1ZG3A 3RC9A 4C4OA 2I99A 3DBOB 1BH6A 2O6HA 1G9XA 2RHTA 3ED1A 3FCCA 3P2OA 2ORED 3E6AA 3WP0A 3N2KB 5AK5A 3G7SA 4RX1A 1FMFA 2PJZA 5DHUA 1FRZA 4G2NA 3E7DA 4HLCA 5JYEA 1HETA 4L1KA 4Z99A 4P9NA 1HFWA 2WSYB 2QI9F 4NLLA 3RF6A 1PLKA 3P2KA 3IHKA 4X1KA 3CVYA 5LNK6 4BNJA 2ZT7A 2PU7A 3MEQA 4GQAA 3T7SA 4UPDA 3K0CC 3BYZA 2ZIZA 4F3CA 1WZEA 4G89A 4LJLA 2QAIA 3MF4A 3ZY4A 3FPFA 4DCCA 3EUAA 3HJFA 3JASB 3DE0X 3OLWA 3HP1A 2W2TA 3GVIA 3JS5A 4ITUA 2NXCA 4TTIA 2A67A 1ZH8A 4EJSA 4PYJA 1XU7A 1O54A 4KMRA 1M5RA 4RPLA 3GP8A 1ISRA 4OXIA 4TL7A 5B3LA 4N41A 4ER6A 3CRRA 1ZLXA 4RJJA 1CDOA 2WVHA 3L0BA 5IABA 1EK5A 2Y0CA 3VNSA 4XWWA 3HB5X 3UAYA 4HDRB 2OQRA 1QFYA 4ZQCB 1G4UR 3QE3A 3K4HA 4B4VA 4E22A 1P75A 3ERCA 1C0LA 2WICA 3W5DA 1A8PA 3CM0A 4GZ5A 4MV7A 1JLKA 1TL7C 3MGKA 4K26A 1SC6A 1P7VA 3I76A 4CQMB 4DMHA 3ER9A 5AHXA 1Z5WA 1REQB 2CNNA 3D5TA 4NVRA 3LY9A 5C7IO 4LF8B 2FLWA 3JQ6A 1AUXA 2H57A 2W00A 3C70A 3GHHA 5J4YA 1GZVA 3EVDA 3OC0A 1QJCA 1Y7PA 3B2QA 1KSFX 4G0PA 4I14A 3CH6A 1G21A 5FCDA 1KOJA 2AOTB 5GIPE 3M6WA 5ALFA 1ODCA 4YP1A 3ZXIA 1WMSA 1WS6A 2XF8A 4AUMA 4QM6A 1UADA 1A69A 1A9RA 1JLLB 1XI2A 2AYXA 1MIOB 3O38A 4FT2A 4P35A 4UBLA 4ZO6A 3JQ9A 2AG5A 1FK8A 5REQB 3QUAA 4B6QA 2QRLA 4C4AA 4IIVA 3SE7A 2NUPA 2A33A 2DPGA 4KWEA 1DEOA 4O2LA 3WJ7A 4ZAVA 5D51S 3U3JA 2M2IA 3MUEA 3BT7A 4MWTA 2VDOB 4FYXA 4N3CA 3FWYA 4KX5A 3VR0A 5HFNA 4GIBA 3USCS 5JI3E 4IV0A 3OFNA 1NUHA 2O2DA 4QRHA 3Q40A 3ZWOA 3ZEIA 3I2JA 2VTVA 3L8ZA 2O3JA 3PXUA 4ROTA 2QVYX 4UUAA 3GY0A 1HKUA 1NYQA 3EQ2A 3OLZA 5LZ2A 1J5PA 4NYMR 3RSHA 1FB5A 1RRGA 2R8ZA 2C7QA 1DOHA 1O8BA 1Q92A 2X8WA 3C5CA 3QX9A 4LVNA 2O5EA 1DJQA 1YACA 4G9GA 2FE1A 1SG6A 3FCXA 2C58A 4EL5A 4V39A 2YJ3A 4Q82A 2RAVA 1IHDA 3KKQA 1GADO 3IESA 1KKLA 1BOFA 3F4BA 3TVYA 1CFZA 3KJIA 3OFKA 4JVNA 4BECA 2FMHA 1FDUA 1V6CA 1HMYA 5GWXA 3IV7A 3WLOA 4DABA 2X58A 2WKRA 3DR3A 3WMWA 4B7XA 3LUBA 1W25A 2JAPA 2PH7A 4UTZA 2CSUA 5ILGA 2WOJA 4Z54A 3Q8LA 4A23A 1FE8A 1KVQA 1NQTA 2A3NA 2AYZA 2BRUA 2JGRA 4MVJA 4ATNA 4CQJA 2R84A 2EW1A 1FLNA 1QQAA 4HEA6 3VSAA 4EKEA 4WLUA 1V7QA 3O2QB 4ZALA 1TVKA 3R76A 1EDEA 5LU9A 4BGUA 1SIOA 2AD1A 4CU2A 4L5AA 1ZM2A 2IYNA 2P2NA 3GGGA 2DP4E 4HVLA 3WBBA 3DVRX 3SZRA 2BUBA 4XWGA 1GPH1 2R6AA 3AI7A 4BB9A 2ZRLA 1PTJC 1ZIYA 4TV9A 2B61A 1I14A 4OAPA 3UGQA 2YN4A 1XQXA 4R0NA 2FPPB 1KEZA 3MWYW 1JHQA 2Q3EA 4ID9A 4R3WA 3V7NA 5AIBA 1R0SA 3RYCB 1LRLA 1U8FO 4RULA 3T4PA 4UUOA 4WNYA 2W4MA 1R16A 1R0BA 3IYLW 3RTAA 1EHIA 1WABA 1KXZA 3VISA 3B6ZA 1IHOA 1OTYA 5LDDC 2PGOA 4K9DA 4ZZ0A 1DGQA 1Z0AA 1E2EA 2QMEA 3FCYA 3MMXA 4IRMA 3P9RA 5IHXA 1DTWB 3JYPA 4E2WA 1AHPA 1KI6B 5JXJA 4WEOA 4X7RA 3M49A 3K9LA 3R6DA 4HYYA 4TXLA 4BLOA 3ZU6A 2Z1DA 1P4JA 1A9TA 5ARBA 3TLYA 5ES3A 4HWTA 1LPOA 5DI3A 4J4HA 3TOXA 1Q1EA 3FROA 4QGFA 3B5JA 2EARA 2C3MA 4BP9A 1MAVA 1U2ZA 3MB5A 1T9GR 1MABB 3GZNA 3OZTA 1L4KA 4X1IA 3Q2OA 3L8MA 3ANSA 4EJFA 1EFVA 1EWTA 3D7SA 3FOFC 2D8AA 1GZ5A 4MULA 5IDYA 4CR6A 3DLCA 4DQDA 5AVSA 2C9MA 2ZRPA 1JF8A 2GDJA 2PGJA 1UKVY 3WWOA 3IPRA 2J09A 3Q6NA 3TS1A 4C7BA 4RV9A 1JA9A 1Z7GA 4YJ3F 1CLUA 2GZ2A 2NZ8A 3DHEA 3BA1A 4LYJA 1EBFA 4XIIA 4DLPA 421PA 1L3BA 4GSLA 4UCQA 4IWNA 3IAHA 4M6WB 1ECPA 4N54A 5K0LA 1N0UA 3KYJB 3PJFA 4W63A 2Q41A 1E59A 1RBMA 3HA7A 3ESAA 2XUHA 1EINA 2E0IA 1HT0A 2NO4A 3HEMA 3N2NA 4Y2QA 3VR3A 5ADHA 1GCUA 1S02A 1RVDA 1J5EB 1X38A 2EW8A 4RF3A 1O1YA 1W44A 1GSIA 1D1PA 2FX2A 1E6MA 3BTOA 3DVSX 4JZYA 5K2MA 1V71A 3FAZA 5E2AA 3KPJA 1N2CE 2QTCA 1BWQA 4G6ZA 1DOZA 4J0DA 4BLTA 4F85A 1M6NA 1ZN9A 1KZ7B 1ODFA 1RYZA 1U7XA 2D7JA 2I2FA 2OO5A 3JARB 4KI0A 1X1TA 1JPNA 2JGFA 3A3OA 1KS2A 3N8HA 3C3YA 4IDPA 1KMMA 3E61A 1M2OB 2EWVA 4QU9A 3I2HA 2IV3A 3ZE1B 4B3XA 4D57A 4YUWA 2V97A 2VKTA 1JAHA 3RVOA 2NX2A 4DIMA 5KVQA 2ONJA 1O4WA 1NXTA 4I1VA 1Y4DE 2C8JA 4DANA 5CNJA 1H22A 3PVSA 4P7FA 1GQQA 2JRCA 1SJ9A 3W2FA 3S29A 1PR9A 4UEOA 3R41A 2W6IA 3R3SA 4QULA 3GLVA 2SKEA 4CR7A 2JJQA 5K6AA 4MB6A 4NONA 2DFVA 1C4WA 1MU0A 1OGIA 1X87A 2OGWA 2ZTMA 3I09A 4FCVA 4N47A 5LQUA 1SBHA 2SKDA 3CR7A 3H6HA 4A8JC 3RAEC 2IXTA 2Z8YM 4XB2A 1T8RA 2IEBA 2AFHA 3QXXA 3EGIA 1QHYA 1MW9X 2AW3A 3AONB 2J3IA 3AQ4A 3IEXA 3E9MA 1ISJA 1E58A 1WXFA 2F59A 3P5SA 1QFMA 4IWYA 3VHXA 3QBTA 3EMKA 3DHNA 2QE7A 3CV3A 3DO8A 1D2NA 1M1YA 2V74B 4YQYA 4US2R 2VVTA 1ZA2A 4KK3A 1M0TA 2D1YA 4GBED 5EQJB 1WW3A 3EQ7A 1SU7A 5JSHA 4DMGA 3UWDA 2HDOA 2RGGA 2XY4A 4MINA 2WHXA 3GN1A 4H1UA 4XWAA 1G20B 1I30A 1G38A 5ER9A 2GUGA 2QS9A 1OKKD 4J07A 1U31A 5DDIP 1JAXA 1VIVA 1VPTA 4FOPA 4EZIA 1IBLB 2VBIA 3ZZUA 3NZEA 3G5MA 4BQSA 4DGQA 1XDGA 4LOIA 3NXKA 1PT7A 2QD4A 2VWPA 1QRAA 4MA0A 4UXJA 1CNFA 3OFND 4M7WA 1NUSA 4QPDA 1YHZA 2PXHA 1XV5A 2EZ8A 3NBKA 4CEIB 4MQBA 2NADA 3MOGA 4IJQA 3FY4A 1M5UA 1W19A 1Z16A 3C6BA 1VDZA 2QD3A 4PAOA 3UWKA 4B34A 5LOVA 1MQ9A 2B37A 4WKBA 1JDJA 3O0TA 4PPFA 2FMKA 5LWHA 2I9KA 3K8OE 1XC7A 4HSGA 4A0FA 1QU2A 3I8XA 4Q1DA 4OIMA 3G9TA 5E9JA 4E0BA 4KO4S 1Z4KA 2QM8A 5CURA 5IJ9B 2VSFA 1OZAA 4IXTA 1DQSA 4CKYA 3R9XA 2WMDA 2D7CA 1KVSA 3KALA 4E46A 3COWA 2YXEA 2RI6A 4F4JA 2JW5A 4PIMA 3Q72A 3O8RA 1Y3BE 2P40A 2JLYA 3CHYA 4YMIA 4H1WA 3Q3HA 4RDIA 3IT2A 1FYWA 4MVJD 1ZDMA 1O0SA 1KH1A 3MJDA 4G5GA 1A96A 5BUZA 1M75A 1ONBA 2WIAA 3ABSB 3AXTA 3BXHA 4IIBA 4AXXA 2I4RA 1MW8X 3G13A 3EFHA 4M0CA 2HF9A 3TTWA 3GDGA 3KDPA 4J90A 2VN8A 5I9IA 3R3UA 3G9XA 2PUWA 1SXIA 5B2ZA 3GNTA 5G3ZA 4D6YA 3GEDA 4TUYB 5TS2A 1ZN7A 3WA6A 4ABYA 5DV9A 3SSOA 5E7IA 1UAYA 2YWGA 4DC1A 3AKZA 2VDVE 1X7HA 2PXXA 4LPKA 4JC8A 4EHNA 2FRDC 3IMEA 1K06A 4GT1A 4N03A 5EGNA 4OHPA 4UM9B 3S68A 5TJHA 2I8AA 3QMVA 4OHXA 3AG5A 5J2UB 3A1DA 1XE3A 4I4LA 5ALEA 4BYGA 1W96A 1PR2A 5KNCH 4Q12A 4YAOA 1GAEO 2RKWA 4WY2A 2AF3C 1OQAA 3WGGA 3I2IA 3VJRA 2BKUA 1YIDA 5JPDA 2C0QA 4R6XA 4XDGA 1LW6E 3MJVA 4RIIA 4IOLA 3O8LA 3G89A 4Y0VA 1RWBA 3DF7A 2HWUA 1QRTA 4BE7B 1NNUA 4U7DA 4PIVA 1YBVA 2WI8A 3DCJA 3Q87B 5H82A 1PSWA 3C3BA 3LYAA 1VMIA 1EUCA 3H5IA 5FPKA 3L4BC 1OLXB 4TKUB 1WW8A 2ZTHA 4CF4A 3OY2A 1OILA 2HHAA 3SM3A 3K20A 3I42A 4RD0A 1G20E 4XX1A 4DY4A 5CB8A 3M6MD 1Y4UA 3MZ0A 4D56A 1TO6A 3DOIA 3K9GA 4GOOD 2PAAA 1TO2E 5KWJA 4RHYA 3ZBUA 5C51B 1LBSA 2NTJA 1JDSA 1XZFA 5CCXA 3EVEA 1DDOA 1WUHS 4RJIA 1RYYA 2QRGA 3N86A 3R0IA 1JYSA 4NK4A 1XTSA 5D3ZA 1OA0A 3U16A 1E6LA 1RMYA 3B8HA 2FEXA 3IVXA 2V3CC 3VR3D 1T29A 1OIWA 4RKYA 4IHJB 4OQLA 1FLDA 1RWPA 1ZU5A 1W49A 2KBFA 4KQWA 1JU3A 1ULBA 4HZUA 2QP9X 3QVXA 4G24A 4Y6OA 5FJJA 4GDFA 5D7BA 2AZMA 4DEXA 1OC2A 3NALA 1MV5A 3K0FB 1KGSA 4ZQHA 5DHPA 5ALDA 1LW7A 1IULA 2I7XA 1NBOA 2ZIWB 5DBEX 5TVKA 5I6DA 1AA6A 1ORVA 2KHZA 3ORFA 1U0GA 2EL9A 5JH7B 3EA5A 1Z8DA 2O8VA 2OCLA 3KLPX 4RAOA 1DP4A 2VR1A 3QVGA 5K3BA 2V55B 1VCOA 3NEPX 5K4AA 3N8KA 4IUBS 1Q7BA 1GQYA 4OGLA 1H4TA 5KBYA 4PGHA 1VL2A 1SVMA 4EQ6A 1OI4A 2BFBB 1JH9A 4TVBA 1YRAA 5B7NA 4DDHA 4RZXA 3KKPA 3HDVA 3W34A 2G7ZA 1F5SA 1ORHA 4FC7A 2W6ID 5BXQC 3QW2A 4G26A 3EJ6A 3F7NA 5B37A 5EJ7A 2WQ7A 1JTVA 1AKVA 1ZOIA 3X1XA 3DWFA 2CFCA 5C3UA 2VIIA 1PZGA 1Y63A 5I01A 1MH9A 2W83A 4EB6A 1A8UA 2P11A 5D2CA 3BREA 2Z43A 4WK4B 3K0CA 1UPBA 1U81A 1P3DA 2JGDB 1OXTA 4ETIA 2JCVA 3S2ZA 1L5YA 3OOSA 4TYMA 4CDMA 1X9IA 1I3NA 1X7GA 3STXA 1UQRA 2JGMA 2Y93A 4EHFA 1MZVA 4OI4A 4Z1OA 1JI3A 3B1XA 5LB4A 1Z25A 2A5FA 3TE6A 4NU6A 3U6BA 3SYRA 4H6PA 1CS0B 1SXJC 3SHOA 3CKLA 1M1UA 2NWQA 1R9MA 1Z0KA 5FOWA 3DM5A 3UNXA 1BX3A 5J58A 4TMYA 2IPLA 4K0RA 2XGMA 1CB7A 1DMSA 2FZCA 4RIGA 3ENVA 5CFNA 2B1GA 2XUQA 4R8MA 4BTLA 2OQIA 1Q2UA 4R5HA 2OCBA 4Q39A 1G3IA 3HKBB 3FPJA 1CQJB 2ZI4A 4AWXA 3RFCA 1N9ZA 5UKDA 3WGYA 2GN2A 4DVJA 2XUAA 1PYGA 1LJLA 3WO0A 5LP6A 2RAUA 3T7EA 4ESVA 2FX3A 4O2AB 1EFTA 1EUYA 4JB8A 1ZUWA 4RLFA 5GJWC 1M10A 1ZN2A 5CBPA 1IQ0A 1X9HA 3PGJA 1W87A 3RK0A 4A8PA 4DAOA 1Z56C 3EXFB 1KP9A 4PCAA 5SZHB 1QRSA 5PGMA 3S5JA 3T5MA 3CNOA 5CDUA 1YZYA 3QBVA 3CO5A 2P2LA 3BVPA 1QGUA 3FWNA 3WHPA 4NENA 1SK9A 3QF4A 2VNAA 1O94A 1T4GA 5JD4A 4TN1A 3BM5A 4ND5A 4TMZA 4UMVA 2PD4A 3UJNA 1G8MA 2O1SA 3ZE2B 5IVPA 5ITZA 3GC6A 3TXXA 1P91A 3PQ6A 4G1BA 4GX0A 1C2YA 1K2VN 2ERYA 2RHDA 4QUKA 4EATA 1E20A 2ZTLA 2B6HA 1W47A 4KXMA 821PA 1WU7A 3RVBA 2FEKA 3TTTA 4RJKA 4ZP1A 3WE7A 4DM7A 1E2LA 2LDBA 1SVLA 2TECE 1XLVA 3HKEA 4LDRA 2D1RA 3GJRA 4OYHA 3LCUA 1VI6A 2PHZA 1G8PA 2D0PB 3VZQA 4BAZA 1EWKA 4TVOA 4OI1A 1XCOA 3UT6A 4DSAA 4KFCA 1U0EA 4PPGA 1L7AA 4QYIB 1CUSA 4C0JA 4BVLA 4G9BA 4WNCA 5HKKA 3PEEA 2FZ4A 2Z2IA 4XLLA 4Q0MA 4AY5A 4MWCA 1Z29A 2R1VB 1KYWA 4HC4A 4NNOA 3QITA 1EH5A 4BIMA 3L0OA 1OX5A 4XJSA 3QKRA 3BIXA 5E7JA 4WK0B 1ZESA 2PLAA 4B8WA 1QWOA 1E9FA 5TT1A 3IVGA 1XZQA 4ESEA 1WDTA 1AB5A 3WQRA 4UATA 1QMPA 1XTTA 3NHZA 4OTZA 5JBNA 4NR0A 1R88A 1GWNA 2OORC 3I8SA 2FTKE 1Z3IX 3OQHA 2I2CA 4K8RB 3IAM1 2NQ2C 4LC1A 4A0SA 3HL4A 1KWKA 4DR4B 1ESDA 2I4LA 3NUGA 2ZM6B 2G8LA 3KSDO 4TYQA 3RYHB 3K70B 3PNYA 1RIIA 4GXQA 3RWMB 1IY2A 1U8AA 3CVVA 4G2TA 3LDHA 4PLCA 5DSXA 2CXRA 2LW7A 4G67A 2O7RA 1YU6A 3RJ9A 2WUFA 2WT9A 3FFBA 3M4JA 3WZ2A 1X8LA 5EXEA 1T10A 4Y9RA 3GFVA 3NP9A 4FOOA 4D8TA 1WZNA 3DVQX 3NBMA 1Y3CE 3ENNA 4KPEC 2VTEA 2XZDA 3P97A 1N78A 1MRZA 3EGWA 4GMHA 3ZXUB 4AMZA 2EG9A 5IUJC 2Z8ZA 3UAWA 3H9UA 4YR9A 2Z6UA 3PGVA 1KP3A 4D79A 5HSGA 2VFAA 3M2PA 5B57C 2A1TS 2RJ3A 3CLSD 1W5TA 1PQUA 2FOXA 1W85B 2QDXA 4G1MB 3WXMA 3TNLA 2O1EA 4OGWA 2XCIA 3S1AB 3U19A 5LD2C 3CU5A 1LRJA 4L2IB 3C4QA 1TQ2A 3L0ZA 3OZCA 1Z4IA 4JJEA 5ENDA 5HIIA 2CNLA 2RK6A 1QCYA 1I2BA 2YV3A 3LLVA 2F1RA 1POXA 2P75A 3L05A 3MBKA 5A0TA 1NR7A 4XCQA 4XQ0A 1X7YA 1Y7IA 2CLFB 3EXEB 3DVAA 4FWBA 3VKFA 3KB8A 3WHLA 1JWLA 2PZFA 1U9CA 1BNCA 4FX5A 1MJHA 4EW1A 2FVYA 4UE2A 5B58C 3HVRA 1IONA 4AMGA 2QTFA 4H35A 4QGAA 3WJAA 1JKFA 4Y2TA 3GG2A 4PTZA 3KQUA 1Q7TA 1RKVA 2ZI9A 2CFSA 4EPRA 1AE1A 4HYTA 1AKYA 2D4HA 3VKUA 3MQFA 3NQ41 5EMKA 1OXVA 4KNYA 3ZHTA 3R3YA 4KIFA 4XM1A 1XHLA 2HQOA 3G68A 3C3WA 4G65A 3RFVA 1LRKA 4C4XA 5C7LO 2UUBB 4RVOA 1PDWA 4FINA 5IPFA 2HZBA 3AF0A 2ZWMA 3A9RA 3DO5A 4KLZA 3WC4A 4ASUA 1JQKA 1M9NA 2BBOA 1YDWA 5FA6A 1TW2A 5AYVA 5MGNA 1M2EA 2J4DA 2ZJ4A 4XVUA 3MYRA 1NBHA 4NC9A 1IN6A 4N7MA 4CMHA 4L5CA 3VR4A 1RXCA 5C53B 3H0CA 2GKOA 3OJEA 3U0VA 4CTMA 4A8JA 4EDFA 3EAGA 9LDBA 3E7WA 4JMLA 2Q6TA 5G41A 3PI7A 3JD2A 4ZAYA 1XROA 5G4KA 3OBBA 1L5OA 3SJUA 3RI3A 3TKAA 2FSFA 4RQTA 4R69A 2ZVJA 1E94E 1E2HA 1HV8A 2BFCA 5CJ2A 2VP3A 3PJDA 4RKFA 3U3ZA 4DMUB 3RYIB 3RAFC 4NG4A 2E49A 2A0XA 3TWOA 3TEMA 4KDEA 3ZWAA 4BNKA 1IDOA 3PR2B 1LDNA 4A3SA 2IBTA 5A9SA 4WNAB 3FMFA 1VL6A 3OEHA 4R41A 4CT4B 5LDHA 3F46A 4V1CA 2Q5OA 1QDUA 4HP8A 1E79A 4F5YA 1SHUX 2BM1A 2QQ0A 2J3MA 2ZUUA 2X9QA 3E58A 2H2DA 2DT5A 4HDMA 3GCGA 2NG1A 2AGVA 4ZAWA 2V3WA 4DVGA 1CW2B 1T35A 1DOAA 3OC6A 4NFSA 2IS1A 1HT2E 1PAUA 3I6BA 4QQ8A 2NQ8A 1GFZA 4A2CA 3INGA 3C3JA 3KZNA 3CX7A 4RYDA 1CF9A 1HZJA 2QR5A 3MPOA 5JXGA 1GN8A 2YHIA 5KU7A 4L07A 1BC5A 1DHTA 2FFJA 1KI1A 2BFAA 5K0FA 2IE8A 4YI5A 5JCPA 4YS6A 1MC1A 1OYWA 2AN9A 4U63A 1OFIA 3PUIA 3AEXA 3BX1A 1KO5A 3TB4A 1DELA 1OBOA 1BZYA 1JR4A 2ONKA 3KL2A 1RRCA 1OHHA 4MVJE 3U4QB 4JXKA 2IWRA 1GPJA 2E5FA 1UJNA 5A7GA 2BFNA 3HCRA 5B30A 3AO0B 1QH8B 5EKTA 4KB5A 3CKYA 5IC5A 4PNHA 3LDUA 1AN0A 4U9IS 3VM6A 3NDRA 2MU1A 4GGMX 4UAJA 4HRVA 1GL6A 1GVNB 3EXIB 2UZ1B 3RHFA 3W2HA 4BWVA 5ICMA 2M98A 2MYPA 2XVYA 3RV3A 3BWEA 1KYXA 3FNHA 4QD3A 4TTTS 4C3UA 3Q0TA 2C92A 4L4UA 4DLXA 4KE7A 2IHBA 3NH9A 3GRKA 3LC0A 1EU1A 3DKIA 4RGBA 4EHKA 2ZDHA 2AV6A 3LC2O 3M9LA 2A1UA 4LWZA 2ZT6A 3E8MA 4V3CA 4MX8A 3TIVA 5HKLA 2V7GA 1YJAA 3C97A 4MQEB 4L7QA 4YPOA 3PUXA 1E62A 1KFJB 2FRDA 3EK2A 2GESA 2OECA 4ZAXA 4E21A 2PEZA 4DIKA 1Q84A 1KBZA 1Z22A 2OGUA 4L4RA 1FFGA 3ODGA 3BQMB 4OUKX 1KOGA 3NYWA 1YL7A 3RC7A 4X24A 4E51A 4I4IA 5B1YA 2XGSA 3OE5A 2AE1A 4LBVA 2X1HA 1WG8A 3FCSB 3G8CA 3IIEA 4AJKA 3OWXA 5JALA 3UMCA 3EEOA 3FZGA 3HUFA 3KVOA 1E9VA 5HG0A 3TVTA 5JZVA 4NEQA 4PBSA 1UFRA 4UEQA 3KSBC 2N46A 2O7VA 1Y8QA 4ARSA 3HWRA 3QYAA 1M6WA 4KZKA 4OA5A 4LZAA 3KKMA 2ZUBA 4PEVA 1EZ1A 1JZQA 2ZR9A 3AESA 1E5TA 3CW8X 1QGED 2CXXA 4H4CA 3HVKA 3C7DB 1BAPA 5AJTA 3FVRA 4HNAB 3WDKA 1PD1A 1NXWA 2YS6A 3L4BA 3NNSA 4QBIA 4EHDA 4EG3A 5AVYA 4UEJA 2DWCA 1C41A 1X2EA 1DQZA 3H42B 4UAGA 4UXHA 4X8HA 3SYKA 4F4FA 3QXCA 4GMXA 3N0WA 2JFUA 3KBBA 1Y81A 3ZTWA 4EG1A 2WM9B 3JD1A 5HJEA 3DKPA 1Z2PX 4A26A 2YYYA 1L4MA 4RGYA 4NOLA 4K05A 2GERA 2J8ZA 4UDXX 3B6KA 3ZCXA 4PC1A 1E3IA 2G71A 1PEKE 1U1FA 3A6HA 1WP4A 5D5HA 1QG2A 1JXAA 1RJGA 2HBZA 3V5NA 4KG7A 1JEEA 4X20A 1TM5E 5M04A 1NYRA 2J6CA 3QFRA 1CULC 5K3EA 1V39A 4XD7A 2VC2B 2HIGA 1BVRA 1DC7A 1TPYA 2IIBA 1ZSNA 3FHJA 3WK8A 4F3NA 1MR3F 1R66A 2XRFA 3FD8A 2W43A 1YXMA 3OM9A 1AQYA 5D86A 4BNGA 5AUPB 5EPEA 3KK0A 3VU8A 2CCGA 3PSAA 4G5QA 1VRCA 4HH4A 5K3SA 2AHOA 4TUYF 5EIBC 2VK4A 2WG0A 4KRYA 2C8LA 4EA6A 3GA0A 3GFBA 3UWSA 2BEUA 4YJ2B 3I04A 5DNAA 2FW1A 2WJ6A 3NM5A 1RYFA 1BE1A 2CMGA 2NAPA 3L93A 3KNZA 4RDHA 1XVIA 2PUGA 4JOQA 4WCFB 1I24A 4C3OB 1B4DA 4MRPA 1RC0A 3AINA 1T3TA 4ASUD 4OU4A 5J2UF 3WGIA 3I92A 5DISB 2P5YA 1EVYA 2D1FA 2I6QA 5IJ0A 1JEQA 1JKJB 1P7WA 4NATA 4P98A 2AFHE 1LSJA 2WAAA 3O4IA 4Z4FA 4A91A 3VR4D 3JW8A 4H7JA 1TMOA 4RHXA 4C3VA 1IATA 1SKYE 1Y8AA 3EG9A 3HZZA 3OM8A 5KAPA 1M1YE 2FZWA 5IBPA 2H5IA 3IEVA 3A1SA 2X2EA 2OV3A 3VYWA 4QXAA 3WB2A 1W4CA 4G07A 1KE2A 1K9SA 1RI3A 3AW8A 3U40A 1T1GA 5AHOA 4BNUA 1C1HA 4RKWA 5JMOA 3F9CA 3ZV6A 1K6JA 3ANNA 1C2TA 5PNTA 4YAGA 4N3AA 4EFNA 2I71A 1SXJA 4WOJA 4M0FA 4GOKA 3KHKA 2VT2A 1WMFA 1KDTA 1OBFO 1W88B 2AF4C 2DHCA 1E79D 2NVUA 3I3OA 4KK4A 2H1OA 4F84A 4PX2A 3ONNA 1LB1B 4HNRA 4XB1A 1WCXA 4MR7B 4JBXA 5IT9A 5EFZA 4RH0A 4OAOA 1YQQA 1CY6A 1Q15A 3F67A 1N3BA 3R5JA 4FGUA 3RU3A 1KEPA 3IQXA 1RZRA 3SE0A 1GILA 1RLUA 3JVUA 4WVFA 4IHJF 4AY4A 4F7WA 5KOJA 1OTHA 1PS9A 1Z6GA 5AD1A 4Y0AA 4K9SA 1ZISA 4R05A 1W1UA 2GHQA 1WCWA 5HTKA 1QH1B 4P8RA 2M6LA 4J7AA 1DS6A 2YY5A 2ZJ0A 4OAQA 2J5QA 3K5PA 1UMBB 5DT9A 2FR1A 1HE1C 3SDBA 4BKOA 1Z28A 5JH7F 1A5AB 2VJCA 1NZFA 2PX2A 1W6RA 5H1YA 3NXSA 1E7RA 1UBJS 4NCIA 1OHHD 5FBRB 2OZVA 4KNVA 2LKCA 1F4LA 2HF8A 5IZCA 2WJJA 3EX7C 1NJ5A 4OUDB 1RHJA 1QQTA 4KN6A 4KSYA 3HDJA 2ZRHA 1YUMA 3QG5A 3WMXA 5A4IS 2HMYB 5TC4A 5TLSA 3C8ZA 1Q0UA 2RHJA 2CHEA 4ZEXA 2YZNA 4DLUA 4URYR 1R15A 1MX9A 1Q6YA 2YDXA 3ZVRA 2J0UA 3Q6IA 3ESZA 4ZZ2A 1TZBA 2H18A 3WGKA 4D46A 1F51E 2VKQA 1P29A 3WYEA 4HQOA 1A9YA 3L77A 4FFVA 3SBOA 3LK7A 1HLPA 2QQ5A 2Q7XA 4PQFA 5CFMA 3HUTA 2CF6A 4MMXB 5CVUA 5DO9A 4RTLA 1CBUA 5HJ2A 1I2CA 5KNBA 3UGJA 2M6KA 3SC6A 1Q19A 2VHYA 2IW3A 4OV6B 1X1CA 5CD9A 3S8MA 3BHNA 4K9NA 5IEJA 7REQB 2UV8A 4DPLA 4AG3A 4GE0A 1XDUA 4KH0A 4JDPA 4WAUA 2VJQA 1PJLA 1HSOA 1U7HA 2QRMA 2VP5A 4XPIA 3KTAB 3ZCSA 4WBNB 4YLYA 1CJBA 1NUPA 2WVGA 2JEOA 1OH7A 4NEGA 1NSYA 1FNBA 1PYDA 2HBRA 3HLTA 3BQ9A 3PWSA 3V4SA 4E5SA 3CSSA 2ID8A 1J1IA 2OORA 2VDKB 2HFKA 4O2AF 3FW1A 5GZ1A 1BKSB 3TW0A 1HE3A 1U8XX 1IVYA 4YAEA 5HP4A 3ZD9A 4J2OA 1IBSA 2IZ5A 3V00A 3CEJA 5JRJA 3S5UA 1QG4A 4NYIR 4BVJA 1YFLA 1A2QA 3ELBA 3B70A 4JU9A 4WXMA 4XB6B 2JD1A 1B6SA 1U8YA 3LOUA 3UB4A 4A03A 2DLNA 1TU0A 2JGIA 5ELLA 4MH0R 3EOZA 4K46A 1SQGA 4DLWA 5LMUB 3E3AA 1WP9A 3W1VA 3M82A 4ICIA 4UC0A 4B6PA 4GL2A 3B9RA 5I7VA 5KNLA 5EIXA 1K8QA 2XQJA 2D7DA 3L8CA 3AYXB 2OEPA 2Z58A 1NLMA 1F12A 2D5LA 2PGXA 3Q3IA 1MX3A 4W8OA 5FFMA 4G5XA 2QYHA 3QXSA 3U7QA 3ZQUA 2I3GA 1V48A 3X1YA 4Z3KA 5T7BA 1X8KA 4YT4A 2PH3A 2Q5FA 2JS7A 3H1TA 4YP9A 3P45A 5SZKB 3IUBA 4XD7D 2DTXA 5CPFA 1XTPA 5IASA 5KCZA 2QTAA 2FX5A 5BWBA 2YXNA 4TMXA 1SEVA 3VZBA 4RLHA 1YDEA 1JLHA 1KYYA 1X6VA 4IJMA 2DPLA 1BA3A 1Z68A 4N3NA 1GTSA 1BO6A 1MPTA 1UC9A 4FFBA 3DBHB 4FPXA 4QLAA 3PJGA 4IIGA 5CD1A 3WBFA 4IZIA 2A88A 5T8KC 5DH9A 2J0QA 2IU0A 1Z4LA 5AM5A 4UHEA 3TGLA 2QQEA 4ZIRA 3LWNA 3P4YA 5CDGA 2LBPA 1C0PA 1HDXA 4KMSA 3TSAA 2WQZA 3UBMA 2C78A 3OURA 2YFHA 1OH5A 1FTSA 4YY3B 1VPVA 1HNXB 1YSCA 4FMCB 4R0VA 2HA7A 1N1MA 1XZKA 4J6EA 1OD6A 1P2BA 1V3TA 3AY7A 1J2JA 3QJGA 3OQPA 2P3QA 1Z5OA 3KCNA