3PHBE

Crystal structure of human purine nucleoside phosphorylase in complex with dadme-immg
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
288
structure length
288
Chain Sequence
b'PTLMENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal Structure of human purine nucleoside phosphorylase in complex with DADMe-ImmG
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 288
sequence length 288
chains with identical sequence Q, S, T, U, Y
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3phbE00
3ENZA 4BMZA 1B8OA 2A8YA 1JPVA 4LZWA 5EPUA 1NC3A 2BSXA 4TXHA 5EFOA 3KHSA 1OUMA 1ULBA 4L0MA 4P54A 5F78A 4E1VA 1TD1A 1K27A 3UT6A 3KVYA 3BGSA 1ZOSA 5IFKA 1PK9A 1A9PA 1ZL2A 4K6OA 2I4TA 2P4SA 2B94A 3PNSA 1Y1SA 5K1ZA 2H8GA 4F2PA 3PHBE 3EEIA 4LNAA 1VHWA 3KUKA 3FAZA 1SQ6A 2ON6A 1TGVA 4L5AA 1WTAA 1PR2A 4DABA 1U1CA 1ECPA 2OXFA 4GLFA 4TS3A 3IEXA 4JWTA 2HSWA 4OGLA 2QTGA 1K3FA 5CYGA 2AC7A 2QPLA 1PR0A 1A9RA 1C3XA 3OOHA 4U2KA 4LNHA 1U1FA 4FFSA 3E0QA 4JP5A 1Q1GA 5JPCA 3KVVA 4OF4A 1CB0A 1PKEA 1RR6A 4KN5A 1T8WA 5I3CA 5KB3A 4BN0A 5F7JA 4DA7A 2AI3A 3C74A 2PGAA 1CG6A 2HRDA 4TXLA 1JP7A 2AI1A 1Z39A 3KVRA 4X24A 1NC1A 3O4VA 1N3IA 4GKAA 2QSUA 5F73A 3P0EA 1T8YA 4QASA 1TCVA 4DA0A 3INYA 2OC9A 5F77A 2Q7OE 4BMYA 4MCIA 4QFBA 4F2WA 3E9ZA 3GGSA 1A9QA 3OZBA 1Z36A 1LX7A 4WKPA 1JDVA 1PR5A 2A0XA 1RYZA 1Z37A 1TCUA 1ODIA 4L5YA 1RT9A 4R2WA 1PK7A 1Z33A 4GMHA 5ETJA 4MCHA 1M73E 2AI2A 2OECA 4WKOA 1PF7E 5CXSA 1V45E 4F1WA 1Z35A 1YQQA 3E9RA 5CYFA 3D1VA 1SD1A 1T8RA 1T8SA 3DF9A 1ODKA 3UAVA 4TXNA 3K8QA 4NY1A 4F3CA 1RXYA 3ODGA 3UAWA 4L5CA 3U40A 3SCZA 1RXSA 1B8NA 1ODJA 3OOEA 1NW4A 3NM6B 4TTIA 1JE1A 3O6VA 4D9HA 4DAOA 4LDNA 4YJKA 4NSNA 5CCEA 3DDOA 4DARA 2I8AA 5C80A 1VFNA 3EUEA 4TXJA 3OCCA 3OZDA 5B7NA 4QARA 1RSZA 1RFGE 3T94A 3F8WA 1VHJA 4QAQA 1I80A 3K8OE 4G89A 1ODLA 4PNPA 4D8VA 1Z5OA 4OGKA 3BJEA 3KU4A 1V2HE 1PBNA 1T0UA 1A69A 4QATA 1PWYE 3FOWA 1V48A 2HWUA 5FAKA 3P0FA 3BL6A 2QTTA 3DJFA 3DP9A 1Z38A 4RJ2A 1VMKA 3GB9A 4IP0A 3IOMA 1Y6RA 1SD2A 2RJ3A 2OC4A 1K9SA 4OJTA 4L6IA 2IQ5A 3MB8A 4OEHA 3LBAA 3FUCA 1OVGA 4WKCA 1RCTE 3QPBA 3OPVA 5B7QA 3MMSA 5CXQA 1PR1A 4DAEA 1JYSA 1XE3A 3UAYA 1LV8A 3PHCA 1A9TA 4TTJA 5F7OA 1JE0A 1U1EA 3EUFA 4R31A 3OF3A 1A9SA 4UC0A 3FWPA 3ONVA 3NM5A 1YRYE 3LGSA 4M1EA 4D8XA 1Y1RA 5CCDA 3LA8A 3UAZA 1YQUA 4JOSA 3FNQA 1Z5PA 4MARA 1OTYA 4G41A 2ISCA 1PW7A 3UAXA 1OV6A 4EB8A 1FXUA 1JDZA 4QEZA 4DA6A 3FB1A 4F3KA 1A9OA 4LKRA 4R2XA 4NS1A 1QE5A 4OY3A 5F76A 1V4NA 4YMLA 1LVUA 4D98A 4M3NA 4TS9A 5DK6A 1PR4A 4G8JA 1JDSA 5F7ZA 1PR6A 1RXUA 3EMVA 4I2VA 2XRFA 3DPSA 1ULAA 1V41E 4DA8A 4TTAA 1Y6QA 3BSFA 4WKBA 1JDTA 1Z34A 1YR3A 1G2OA 2GUWA 1JDUA 1OU4A 1SJ9A 5IU6A 2A0WA 4M7WA 4DANA 1YBFA 3NBQA 4GLJA 3NM4A 3TL6A 1U1GA 1Y1TA 1Z5NA 3OZEA 3PNPA 4TYMA 4TXMA 4EARA 5B7GA 4YO8A 4D8YA 2A0YA 4BMXA 5F7XA 2HN9A 1OTXA 4WKNA 1Y1QA 5B7PA 4YNBA 1U1DA 4PR3A 1V3QE 2QDKA 3OZCA 1TGYA 4ECEA 1RXCA 4H1TA 5EUBA
chains in the Genus database with same CATH superfamily
3HCFA 4OHPA 4ZOQI 2P4UA 4PYNA 3FPFA 2FW8A 4XSVA 4EMTA 1O0CA 2ZT5A 3RKRA 2LXNA 1LI4A 1NMXA 2HXSA 2LKDA 3MAGA 421PA 4KHZA 3HN7A 4AUMA 1SZJG 4ID9A 4J7AA 5JNVA 3BPSA 5EFOA 1CEQA 3PUIA 3U4QB 1U0OC 3MGKA 4FFBB 4YI5A 1K27A 5TS2A 5CFQA 3ZDXB 1FX0A 1P81A 2VTBA 1SN7A 2GPTA 3MG9A 1JR3D 3BGSA 4ADSG 1V3VA 4CTNA 1KVUA 2PD4A 2IBMA 1AGNA 1RIFA 1UKEA 1ZOSA 2V45A 3JYHA 4IDFA 4JQSA 3WFZA 4ZI3A 1QHNA 1W1UA 3AHIA 4HH0A 3HZHA 3HL0A 2AYYA 2HA2A 2PJUA 3NALA 4M1WA 3QF7A 4Y6GB 5AVWA 4BASA 3HVRA 2V3WA 4FYXA 5DGXA 5AK0A 3H6KA 4P3YA 4BQQA 4PFSA 2OFWA 4EFLA 3WK6A 4MDFA 2OWEA 3DHEA 1RZRD 2VZ0A 1U2GC 4ZEWA 2C9MA 4OUDA 1N92A 1YA4A 3L8FA 5E8JA 4F2PA 3QX3A 3ZWPA 2QRHA 4E5NA 2IDKA 1ZMTA 2E0IA 1R0LA 3FNGA 1FTGA 3AV3A 4MEAA 4OHZA 3BE8A 1ZJ4A 2DU8A 3Q3JB 4TMXA 4Z0HO 4YPFA 1RJ9B 4FMDF 1NG9A 5HM8A 3PWTA 1P9OA 3A4IA 4IFEA 2GJAA 3KAJA 4HNRA 1HT3A 2BHTA 2ZWPA 3NC1C 4HDMB 4NL4H 4H3VA 5F33A 3CPEA 2P9BA 1Z2EA 2NSJA 3GFFA 3OJWA 1VCNA 1ZLXA 1CJCA 1W75A 4TT8A 1WULS 3WYNA 1QRTA 1JLHA 2CB0A 1J0AA 2E2WA 4TYQA 3TZEA 2VFAA 2Y1GA 4YECA 4MP3A 4RHTA 4NBVA 1PRYA 3QELA 2AC7A 4JMPA 3VZDA 4NU5A 1VPWA 2FWNA 3ETCA 3IOBA 1B6SA 3ETLA 4IBOA 1IHUA 3DWEX 3WB0A 4L4ZA 1L7OA 2GWRA 1SAYA 2JIRA 1DEXA 2YYYA 3G7SA 5BNWA 4BNUA 4LXTA 1ZRNA 2H52A 3KZMA 2XVZA 1UPBA 2W6QA 4G25A 4BDTA 2ZB7A 3FI9A 5HIIA 2YJTD 3PFGA 2WVJA 2O6HA 1YZLA 1S89A 2CVHA 4Y67A 4A2QA 1DPFA 4D3XA 3GW8A 2F6RA 5HUHA 3UV6A 2JDIA 2Y92A 3IE0A 3DAFA 2OILA 1ESZA 4GIBA 1OLXA 2AN1A 3PXBA 4MYUA 3B6JA 5FNVF 1T5LA 2GPWA 2WE7A 3SEZA 4QC2A 4ZDJA 1Z15A 3D4OA 3KETA 2CGEA 1RR6A 4YJ2F 2AFHE 1W36C 2D1RA 1XZPA 3KPUA 4I4TA 4O4IA 3R2JA 4P4GA 4QE3A 2C92A 2QMUA 3DVAB 4ZODA 5JUWA 1GXSA 5CB4B 4NECA 4LQDA 1E96A 1AE1A 1V1JA 5JS8A 3IALA 3TF5A 1CV2A 1AZWA 4L72A 1X74A 4A73A 1D0IA 2R8YA 2WU1A 2VJAA 3EIFA 1YOVA 2JH9A 3LF1A 2X9GA 4B6EA 3KC2A 3EVDA 3WNDA 5AQEA 4C76A 3PNOA 2YFKA 3O2SB 1DEAA 1OT3A 3TZQA 3UCEA 3QJYA 4H16A 3WGLA 3R9XB 1T3HA 3G3EA 1UQTA 3G5UA 2ID7A 1JKMA 1U7DA 1MNQA 2ZRKA 4KX5A 1X87A 4B73A 3DBVO 4BQPA 2EAUA 1ZCJA 2I7TA 2QRNA 3KALA 3NVAA 3P2IA 1O87A 4QBGB 5AHKA 5MFZA 2QVYX 3U09A 4ZCMA 1SUIA 4LZNA 5CA0F 1Y8RA 3HU5A 4V1CB 3OBIA 3QVTA 1U94A 5AVYA 1AQJA 5GJBA 3WP0A 1LH0A 3GLSA 1II9A 4KE9A 4KFCA 4XAQA 3M2TA 4ZO4A 4P5EA 4A6PA 3R24A 3QF4B 4ZICA 5M29A 1EA5A 2VS1A 1J20A 1XJWA 2G40A 5ITZB 4MV6A 1E1CA 3T7KA 3E81A 1ONNA 4ZMSA 3A2MA 2P3LA 2C88A 1EEHA 2QAGB 3Q5EA 2A5GA 4B6RA 4YCMA 1A5BB 1GSOA 1BXRB 3KL2A 4R2MA 3GGCA 4G09A 4YJHB 1ISRA 1SVNA 1WPXA 3A4VA 3Q3VA 4YAIA 1X7XA 1G9XA 4WUTA 1FLVA 3L43A 1U4NA 2CL5A 1L5VA 1S96A 3D2LA 1Z17A 3OC6A 1FXWF 1JFRA 4R71A 3BWEA 4ZEVA 2YUTA 1P3Y1 4BNKA 1KIMA 4UCFA 5REQB 1NQVA 1A9QA 1T10A 1R4AA 2FJ0A 4RHEA 1QIGA 3OZBA 3PEFA 4MKFA 3OIFA 4AZTA 4EAQA 2H5EA 2ZBVA 4A8TA 1A9ZA 5JVDB 4HYEA 3WYEA 1JXAA 2WABA 4PYOA 3SIXA 4Y2UA 4KNVA 2BI7A 3LBHA 2IXBA 5BNFA 1LSSA 3ACBA 4JEMA 1BX1A 4MW4A 4P83A 2HJVA 1V0JA 2BFAA 3DEHA 1A7JA 3QE2A 4LI0A 1ODIA 3VYWA 1XQ1A 2LNDA 4OP1A 1YUNA 1BJTA 3HY4A 3HYNA 1F1JA 4QUJA 2UAGA 2C5SA 2PZKA 4GOOD 4F9TA 1EFPB 2PYDA 2DUUA 1H94A 1M73E 3RO7A 1CZOA 1HT2E 1P2DA 1UC8A 2OO5C 1RD4A 2PWAA 4L08A 3A58B 4HC4A 4LX0A 5HKLA 4X8OA 1AQNA 4NOJA 4DQLA 5CXSA 4MP6A 2RKWA 4FZJA 1QYWA 5AVRA 2XGOA 1WAMA 1U0GA 2Z2YA 3MYRA 4KDCA 2VAPA 1TM5E 4R1PA 1YQQA 1S7GA 2LCFA 3WJ2A 3C87A 1UEIA 4P6VF 1R6DA 1S3SA 2F1JA 3EDOA 4HPJB 2ZI7A 2FMKA 3SOPA 2PFKA 3LRTA 1V8PA 1WD5A 3JZFA 4ZYVA 1VPLA 3AKYA 3LKDA 3AOEC 4E07A 5TVKA 1E9DA 2BBWA 5JCJA 1DP4A 3WRVA 4I5IA 1JBKA 4IH9A 4B3CA 1NW7A 2ZRBA 4GNRA 1POWA 2ZUDA 4DIOA 3GD5A 5I01A 3X2SA 1IVNA 3UPTA 5A5EA 2C2ZA 2D2VA 2HF7A 2VJLA 4JFAA 4TXNA 4U1RA 5EJMA 3ZDAA 4XDYA 2VK4A 1R5OA 3BFVA 4LJ8A 2OAGA 1IEQA 1I2MA 2CXXA 1NVVQ 3GOQA 4L3VA 2IU3A 5EEGA 4CR8A 3SCZA 4GI2A 4MKXA 3QFCA 5L4SA 3B8EA 1OMOA 4J1NA 1I24A 1KIAA 1TRHA 2QKYA 4LVUA 1CJMA 4H15A 4F21A 1EFRA 1C80A 1YIOA 2DT8A 3HUFA 3LHDA 5M3BA 4KN8A 3ZCVA 5GADl 1JFTA 3LP5A 3LTEA 1FTWA 4YCBA 3NETA 1Z0IA 2J46A 4JU8A 2Y68A 3H83A 1NR5A 3HJFA 1WDKA 3N59A 1G20E 1LC3A 1L8AA 3PF8A 4JJ8A 4HF7A 2NO1A 2QYSA 2XUDA 4E08A 4D25A 2CBXA 5EOVA 2QPAA 3H65A 2Z5VA 4QPNA 3PFHA 4PVCA 2FETA 2WUWE 2OGTA 3TEMA 3WGKA 4D6YA 1HE4A 3USZA 3FWKA 2FZWA 5C35A 4GR4A 1H23A 5CU7A 4KN9S 4ZKDA 5CFLA 3LXMA 4R1QA 1XVIA 4HO1X 2JLAA 4MUAA 1E63A 1P6QA 1E6KA 5LQUA 5EP2A 3DYVA 3GLGE 1YIAA 3M6FA 4K0RA 1T2DA 1HUQA 1KZ4A 3ITNA 2OHJA 4PV7A 4Z1MD 5K3DA 1GQRA 1JNYA 4NCHA 1C3VA 4ZFNA 3NNSA 1JDBB 3P2MA 5DF1A 2FVYA 1TW2A 3LO8A 1YF3A 5HMLA 3GZNA 1GTG1 2GVNA 3JS5A 3SHWA 1Y1KE 2AG5A 2E7ZA 1UAGA 4D6PA 3U6KA 2F7SA 2HSJA 3NX4A 4L4YA 3TSZA 2NSDA 3B1XA 5ICGA 2D54A 5FI3A 4MRAA 1QVZA 4EHIA 5HTOA 3UXEA 2VG8A 5JCOA 2PXXA 4OXIA 3H97A 1YC2A 1YDHA 5C2JB 1BW9A 3W8EA 1I10A 5A6VA 5KVCA 4D74A 4D2IA 3X2FA 3SF8A 1IBLB 2XYHA 3I12A 3AEYA 3JQAD 2JA1A 1Z6PA 3KWJA 5JXHA 3HVHA 5H4HA 4ND2A 3VV3A 3EVTA 1F0NA 2VQSA 3C5HA 4RA6A 1E6UA 3WLHA 5A4JA 2PVCA 1O95D 1L7XA 4P38A 3BEOA 4GD3Q 2IV7A 1SHJA 1U80A 4IQ8A 4KWCA 3QEKA 1U04A 4G0UA 3ENWA 5G3YA 1PJQA 2YIVX 1FYEA 2ZRHA 3ELDA 3ILHA 3LU1A 2IP1A 3IOMA 1XQ9A 3OUTA 3KUUA 2BEWA 3NJRA 4LF8B 2AN5A 2PR2A 2VBFA 3LUKA 3W8DA 2HHJA 4BX8A 3QFHA 1KWKA 3C3AA 1N5OX 5FB3A 2CW5A 4FX5A 2O2CA 2YMMA 3PQFA 1IQUA 4IDCA 3ORRA 4MB0A 5E7MA 1Z7YA 3CISA 4C4ZA 5ICSA 1KO4A 1QWSA 3MB8A 1X7ZA 4MYHA 4RNDB 2EFJA 3EYAA 1QVVA 5HCNA 5T8KA 3ZDDA 3MBOA 4LS3A 2YVLA 4EY4A 2AE1A 4AF7A 1JU4A 5CAEB 1FFHA 5U1PA 2OP1A 3U4DA 5HJ7A 4EAAA 3SLGA 3BTUA 2ENUA 5FTKA 5ED4A 1P1BA 1F5NA 1JDNA 2H2FA 2J0VA 1K5DA 4RVUA 2XCRB 5B6JA 1RYHA 1TCBA 3VR2D 2AOUB 1S02A 3IELA 1R8XA 3CGWA 1T3TA 2Y67A 2V5UA 2PUHA 3ONNA 3ZW8A 3AIKA 1TAQA 3OM9A 4R8SA 2W2TA 3NEPX 1M10A 1WE2A 5DLEA 1NASA 1BRMA 2IHJA 1UK9A 2P4EA 2WDPA 1IN7A 4GPTA 3GN2A 1QF6A 1A5AB 1VJRA 3EHEA 3ZPXA 1VPVA 2BC9A 2ZREA 3M4XA 1RQRA 2AW3A 2X7JA 4NZPA 1CJBA 5LBIA 4B4KA 4BO3A 2QTLA 2FP3A 4MINA 4CMIA 4CLXA 5JATA 1ISSA 2I2AA 2YC2C 2YMPA 4ENVA 1DBQA 4BGEA 3HSYA 3N2YA 5EZYA 3T1OA 5BUZA 1VCOA 4M4SA 4CMAA 3BXFA 3K4QA 1KOLA 5DRTA 4L4SA 4MVJM 4DSNA 4B47A 4C2TA 2Y66A 4YQYA 5AM1A 3TNYA 4BATA 1CZRA 2PL5A 2YBDA 1DXQA 2QNBA 1CUJA 1U2EA 4I9HA 1OTYA 1BCRA 1ZNWA 2NUAA 3MSXA 2B5OA 4TTTS 1I7DA 3IEMA 1YFKA 4ZJZA 4L57A 4CQMB 1Q6ZA 1TYAE 2EYQA 3SX0A 4F6RB 3AHEA 1XA3A 4EEZA 1BIFA 1BS2A 4RPCA 5ES3A 1NP6A 1P7CA 3UAXA 1OV6A 2WD7A 2BMFA 1NLUA 1E0SA 2HIGA 4YJ3A 3JVVA 3PPXA 4WOKA 1M2OB 1Q0UA 5DX8A 3VR5H 1JQKA 3AIMA 5D3QA 3T5DA 1VYVA 3TKAA 1VRCA 1MG5A 3QLJA 5EMMA 1R6VA 2C2KA 2GASA 4I5GA 4MMXB 5DO9A 5ERXA 3LQKA 1M7BA 4OM7A 3S0JA 5F76A 3W2EA 3AOGA 1P72A 2MU1A 4MW1A 3SJCA 5D2CA 5JAIA 3UA3A 2I34A 5AHRA 2D1YA 2REQA 3DZJA 3T7AA 4ALKA 1AIPA 1UM8A 4CMEC 3QU4A 1KI9A 2QTCA 2PRYA 1H2AS 2GCGA 2ZSHA 4LBZA 5EC8A 3GMDA 5JVDF 3TQOA 5CM8B 3FPJA 1RXUA 3H6HA 4WK2B 5TQ0A 1E2KA 1X8XA 3V1LA 3MEQA 3I09A 3PE6A 4PONA 4JOBA 2HMUA 3FZEA 4HOYA 5JDIA 3K15A 1TK3A 2M9MA 2PFGA 4DPKA 3G0HA 1N8NA 1PZHA 3LUJA 2HQ1A 3OTGA 1B42A 3FSGD 2E21A 2JKZA 1QYVA 3ESRA 3H75A 3CVUA 4PLPA 1J9ZA 3QKRB 4Q3DA 5FKJA 1G2QA 1EWYA 3J81A 3A1SA 2E5LB 4JT9A 1W5FA 2WICA 1LPSA 2WMYA 3KQTA 3SWWA 4X84A 3KTDA 1RWNA 2V3CC 1SIWA 2B8TA 4NJEA 1ECFA 3W90A 4F92B 1SHUX 4RD4A 1Q12A 3MJEA 5EHNA 5AVXA 3OQNA 4AJOA 2JH8A 4QTTB 2F8TA 4NEGA 4A92A 4E03A 4PG8A 4RV4A 3EWIA 1RWMA 1JEEA 1ZX1A 5F5NA 3VSDA 2JCSA 2R6R1 2ZLBA 4NHOA 1P5FA 4M9RA 3AL0C 1V7QA 4D8YA 4W1SA 2A0YA 2R66A 1F8YA 1M8KA 3RTEA 4WINA 2BELA 3OU2A 3TQHA 2WWFA 1E69A 1ENZA 1VA5A 2PKWA 5NLLA 4WXEA 5EXSA 1Y9DA 4YXWA 4HQKA 4EKDA 5JXGA 1R1DA 4CQJA 4YRZA 3EZFA 4IQ4A 4GVPA 4AT1A 3MZ0A 3ANXA 1QVWA 4R0NA 1HK7A 2W2PA 5BN5A 3LOPA 1ADGA 3ZNOA 5BNIA 4IG4A 1XEAA 4UJ5A 4P0QB 3FLEA 1K89A 4ATNA 3R7BA 2XB4A 2AJLI 2W90A 5BSUA 1G8YA 2C3OA 4FBLA 5DCWA 4ON9A 1COWA 1RWVA 3H8WA 4X7PA 1Z5VA 5F1OA 2EFHB 3FMGA 2JLYA 3WDKA 2A9VA 2I3BA 4M53A 4D9KA 2D5CA 4LGCA 1ECLA 1R0RE 4J94A 2ORVA 5FBKA 1PT6A 4NF2A 2FRXA 4KMMA 5JZSA 1SOMA 3TMAA 1UPUA 3C3PA 2HA7A 2YVQA 2ZK7A 4TM8A 3BRQA 4BV8A 3P0JA 5F78A 4W6QA 4E1VA 3DBRB 1BSVA 2FMIA 2F1OA 1KMHB 2P2ZA 1MEJA 4JVLA 5GV8A 2BH2A 2VYQA 1I4OA 4KK3A 4I81A 4V02A 4DQ0A 1HG0A 4QPDA 4ZHQA 2R5FA 1CULC 4AO6A 1AS3A 1MRNA 3V1MA 3Q2IA 3ZCUA 2VR1A 3RJZA 2Q8NA 2N75A 3HO8A 4JYZA 3PLRA 1NJFA 3PJEA 1R0BA 1XVAA 5FWXA 5JW6A 3S55A 1RRCA 1ZGAA 2B82A 1MB2A 4PGMA 3QEBZ 2RAVA 2Z8XA 4HEA6 2DM6A 3ANNA 2CUKA 1X7GA 3CSSA 3GLHE 1SC1A 3IUBA 5ALHA 1OKKD 3OPYI 1NFRA 3M6VA 3RIEA 1U5BB 4U0JA 3T54A 5ISMA 1RWBA 2EJWA 5C7OO 1BA2A 2XE6A 3AERB 3PYXA 5I7RA 4LNAA 4Q34A 4V38A 9ABPA 4ITVA 2DSTA 1BWRA 3AJRA 7REQA 3PLAE 2PJZA 4HLQB 1OXMA 2G5GX 1JUDA 3DFKA 4BQSA 2CFOA 3U7HB 3AY3A 1KGSA 1QIKA 2BISA 3K0FB 4LPSA 4XCVA 1P45A 4J3JA 4OLJA 4GLFA 1KJWA 3AEQB 3UCXA 4ER3A 4MW9A 2IP4A 4CIBA 4R2JA 5AKXA 4MA4A 1S4MA 1VKJA 3O8DA 1E3MA 3JPWA 4DDVA 1JG6A 3V34A 3FDZA 4F2DA 5SYMA 4HK4A 4R40A 1RRVA 3QNWA 4OO3A 4PYKA 5GQSA 3C5CA 4RKQA 2BFDA 3M49A 4NENB 2ZW9A 1HDOA 2D0PB 3QVJA 1F2DA 1VBNA 1YS9A 3PGXA 4RPIA 5C5CA 2WC1A 3EX7C 1X77A 2BONA 3MA0A 3FOZA 1Y81A 1JVSA 5KHLB 4FI3F 4WZAA 4NATA 4DV5B 3FDFA 4NMMA 2VXCA 5I9TA 3LYLA 3NC4A 1KTVA 1Q92A 3W34A 4XGIA 1IDOA 1RCFA 5C3UA 4OJYA 1XBTA 3E0QA 1XRRA 4D4GA 1USWA 1OAAA 1R64A 4M0KA 3ZZMA 4B6SA 3E7DA 3PXGA 2OD7A 4BFYA 3T1YB 2HA4A 5CT6A 4DV0B 4DLPA 1T15A 1XR3A 1GFWA 2O3JA 3F73A 2I1LA 1GU0A 3IYLW 3A1WA 2VP0A 4TMWA 5AFSA 1PS9A 3D7KA 4QUKA 3TAXA 4EL5A 2J0SA 1I5OA 3WK4A 1E1RA 3RVQA 1XJQA 2Y8EA 3A9WA 4BFSA 2FUNB 5LBUA 2RGXA 4TSRA 5HIKA 4EFDA 1CY0A 4BN0A 3HB1A 1K8QA 2H31A 4BIIA 3CRNA 2J9YB 2JIZA 3MMZA 3V2GA 5LL6P 2PXCA 4JI5B 2XMRA 4FN4A 3PX2A 2XOXA 3E3OA 2RJNA 2P1DA 3G0BA 2OCDA 1CY4A 1U8CB 3IDAA 3IT1A 1H9CA 4B1FA 5GOZA 4RDHA 4INPA 4JELA 4KPUA 1VPDA 4KIWA 3AY6A 2A0UA 4XJTA 4AC9A 1SXJA 3IT3A 1U0JA 2PE5A 1HSOA 3HUTA 5BQFA 3H8VA 3S5UA 1VL6A 3HJGA 4D97A 2Z83A 1T8PA 2EHDA 3LX8A 1S4QA 6PFKA 4J9UE 2AJ8A 1ZKMA 4B09A 2B4TO 5HOQA 2C07A 2H4JA 3LVRE 4YC7A 1O58A 4LKOA 4G2NA 5FYDA 1PUIA 2QSUA 2PUBA 2Z30A 3C5WP 1AMNA 5IJ9A 1ZG3A 1JG4A 3SAJA 3FMFA 4J2OA 4FR5A 5ECYA 3TNDA 2DVMA 1P39A 4J2HA 1Z4QA 2R79A 1W1WA 2XOKD 3IEUA 2I7CA 4GBMA 4ODIA 5DI3A 3IDOA 3IVGA 5ALSA 5KMGA 1XRSB 4IDEA 1B16A 1YKSA 4ND8A 5GJCA 1Z0AA 3BCSA 2VYFA 3VHQA 3LXUX 1I4WA 2XGSA 2PL9A 5EKXA 3HM9A 1IC6A 1PJ2A 2QM8A 3IDFA 2MINB 4BO0A 1N2OA 1VE1A 2DPYA 4L7QA 2O8VA 4O5AA 4OQLA 5D5QA 4UREA 2GEKA 1OFGA 1Z7EA 3COJA 3PIDA 4IRMA 4IICA 3A10A 1ZR4A 1S3GA 5TQVA 3TJRA 1CQPA 1WPRA 3C15C 3QIAA 2V8OA 4IMPA 1TEXA 3A6GA 2CMFA 1N0WA 4RVOA 2VDUE 3VFDA 3TRDA 5LQMA 1QV6A 1GGFA 2BVNA 3VPGA 5K03A 3GRUA 4QRDA 1MO6A 2VNIA 2G7ZA 3DTNA 3HCCA 1M1ZA 3HEMA 4B46A 3NIBA 3SJ7A 1U0NA 4N39A 4WSOA 4AP6A 3RVOA 3CIOA 3FLBA 3TAUA 3B6ZA 1ZWKA 2VNAA 3TM5A 4RSRA 5JO0A 2OHGA 3M3HA 2JBWA 1AN9A 3SZ3A 1QV7A 1R6TA 2QUAA 2FN8A 3WIUA 1Q57A 1Z82A 3JSXA 4A7PA 4DLYA 1QP0A 4KQCA 4QG3A 5KMGB 3MWEA 3OKFA 4XI9A 1YTLA 5SZJA 3BK7A 2JLVA 3L4EA 5J2UB 5BUCA 1UK8A 1P5RA 1G9TA 4RD6A 2WIKA 1K63A 4IJVA 5FLXA 4P4SA 2CDBA 1WJGA 1WP9A 3DG9A 5JNTA 5K6RA 4J1SA 5JAHA 2GNPA 2ZJFA 1JWBB 3HHPA 5BYJA 3WISA 4BWFB 1JQ5A 1BOFA 3Q9UA 4PTYA 1OZGA 2W6IA 3C5EA 4D3ZA 5CDYA 2P5SA 4ZAWA 4Z7OB 3C45A 2XDWA 1SBQA 1OJ7A 3G0DA 1XDSA 2IEZA 4R6XA 3WSVA 1M2GA 1XXHB 1KGDA 5KJCA 5AQ1A 1PLLA 3T3OA 3E18A 2P9JA 3ZU6A 2PX4A 3S68A 2SICE 3I4LA 4OHKA 4XEHA 3Q3CA 1KKLA 2VRCD 3K8QA 4KYIB 1USKA 1B8VA 3G0CA 3RHFA 4ND5A 1QNLA 3PV0A 3RTAA 3TE7A 4BHTA 4C4YA 2W83A 1P74A 3E35A 3LRPA 4X5OA 2OCYC 3F0TA 2J45A 3FYHA 4R68A 3G9XA 2QI9F 3TNJA 3TO5A 2IW1A 4GDFA 3RRJA 1KYQA 3MAJA 2JLUA 3N8NA 5A0VA 3TR0A 1A96A 1AMUA 4FP9A 1KH1A 1NN1A 1OLSB 1WA5A 2Q2OA 3KYIB 1KQOA 2D59A 3K9BA 4WPGA 1K7SN 2A94A 3PL5A 3RJ5A 1BXZA 4AMYA 3LZDA 3CLUC 4UDNA 1JWAB 3U4IA 3V1TC 4AW9A 1P6UA 2G72A 4DOMA 3D4BA 1MABA 3CKLA 3ESQA 4S1VA 5C8YB 3E2MA 3S2UA 2VF4X 3H17A 4QLBA 1SKYE 4KQMA 5ENZA 1WNFA 1SZPA 3TXAA 5A4IS 2H5JA 1KERA 1NFQA 5ERGB 1M3SA 4BQNA 2AUNA 1YFZA 3LQYA 2R25B 1BX0A 1WQ4A 3KLNA 1P91A 4HQ6A 2PGNA 4DT1A 4R8VA 1WMFA 1WTCA 4S1WA 5FOTA 1AUXA 2RHTA 1UZNA 1BQ4A 1BGXT 3ABRB 1FMLA 3UC5A 1YZQA 1E2MA 1EDBA 1TD9A 2ILVA 1NF8A 4H18A 1Z56C 2OB2A 4HWPA 4RL6A 1PJCA 4FDLA 1JFVA 3OFJA 3ELUA 5FBQB 2ZU0C 3QY9A 3T9BA 3D0RA 2HX1A 3U1VA 1JIIA 3DJYA 3RFVA 4YIKA 2I6SA 3OZ7A 3GGOA 1NP3A 1SQ5A 2P6MA 4LSGA 4BB9A 1CQWA 1O89A 1JIXA 2OYSA 1O96B 1OTHA 4BWGA 1K8XB 3IAFA 1EUCB 4BNFA 3O83A 1KA9H 2ZROA 1ZIXA 3KE9A 2PJRA 2CVQA 3JD2A 4B7UA 3RIXA 4EATA 2KWIA 3WLIA 5L3SA 1T36B 4EI9A 3SVTA 2R8XA 3F6EX 4F11A 3HFRA 1O94A 4FSDA 3C98A 1NLMA 1ZA1A 4JI6B 2VHTA 4BP3A 4EA9A 4GP6A 3UT5B 4R1SA 1CP2A 1J09A 1E60A 1R8QA 2EKBA 2WSIA 3DZGA 4UNPA 4BVHA 2HMAA 3CKKA 1XFDA 1DU4A 1T2NA 5GPBA 1NULA 2BWJA 4Y98A 1E66A 2JVJA 3TG2A 4JC0A 1L1RA 5FAKA 4YCNA 2NV6A 3CX3A 3S2ZA 1WUHS 2C5AA 3LWBA 1II8B 3HHEA 3OCYA 2C77A 3DOIA 4LZJA 5DGDA 3T41A 4RDXA 3E4CA 3BCUA 3BCRA 1SZDA 4CL3A 1SKBA 3SR3A 1TMKA 4YT5A 2F17A 1C81A 2C20A 1ZMRA 1M0TA 4UUOA 5J4KA 2R1UA 4MZDA 4F3RA 3SQXA 2H00A 4FCTA 4K6FA 4QL3A 5AOCA 3MCZA 5KINB 2WTMA 1G5IA 1SD2A 4K6KA 1I7PA 4HWTA 4HBGA 2PBRA 2F3RA 4KV9A 2JIDA 2WQZA 5B30A 2DJIA 4KR2A 4Q3BA 4W5NA 3H4MA 4EHFA 1TW3A 3IQHX 5EWJB 3C1TA 3B48A 3WXBA 4IDAA 3FGNA 2NUTB 1Z8FA 4O0LA 4WRRA 4XJXA 3AF2A 1H2EA 3BBPA 2EDAA 4BVKA 2COEA 4FYPA 3U4HA 1R0CA 3TW6A 4S3MA 3DEFA 2JCBA 4J0QA 1TEVA 4OHYA 4K6CA 4Q1EA 3U3RA 1P7VA 1I9GA 3LBNA 4U6SA 3BD6A 1EE1A 4MVJH 4Y6PA 4OQZA 1X7DA 4HKTA 1K2VN 2QN3A 5G0SA 4TUYF 1XK6A 1XAGA 2OFOA 4UXHA 3R5HA 1IBMB 2G70A 3N53A 2W6ZA 2FVXA 3IXQA 1K5PA 1C7ZA 4EBBA 2XMGA 1NVFA 1PDVA 1JWLA 2XXAA 3AC0A 3QEAZ 2Z5FA 4L0QA 3T7JA 1T5DX 1EUYA 5JSUA 4D0NA 2YJZA 4DV3B 4L73A 1DJMA 3NASA 2AW5A 3OPYB 4HZIA 1WUJS 1HT0A 4LNUB 2CJPA 4LJ6A 3FPCA 1I3KA 4Y1RA 2A9FA 4YMWA 5D3MB 2XRMA 1J2EA 4UC0A 1SCDA 2BMVA 3K6RA 3N39C 5AT1A 2XNHA 3G2IA 5TE9A 1SULA 2JFGA 2G9QA 1MFPA 5AKIA 1PFQA 3EHDA 1RLTA 3R09A 4J2TA 3QUAA 4JNCA 5DT2A 5EXDA 4OLAA 3K1JA 4IF6A 3N28A 3D4LA 5FPQA 4G1EB 3BWVA 4EGAA 3F4LA 2OV1A 3EH1A 3FOAA 1L4HA 2PFSA 1M54A 4K3UA 1XU9A 1JSXA 4MNTA 4XFJA 1UBGA 1DT3A 4YXFA 5AOVA 5C5EA 5IUNC 2PYZA 5IAJA 4OX9Y 3NGXA 1BVRA 4UM5A 4X7RA 1R8JA 3IAS6 1VHLA 1QP7A 1KVSA 4ZYTA 5KVQA 4RK5A 4N8EA 4MWDA 2HMWA 4BYMA 1Q3HA 3AJEA 5CK5A 4BV9A 1NUUA 1P80A 4AQDA 1XT6A 2QR2A 3NU1A 3V4OA 4O2LA 3HCAA 4QEZA 4DA6A 5E1OA 4LMPA 3FNRA 1XU7A 4A82A 3K9GA 4NS1A 3PFBA 3UJNA 4D9CA 2NPOA 4QICA 5FNVA 4JB3A 1W4RA 3HKDA 1KFJB 3HJRA 2ZZMA 2W11A 3LPCA 3P9CA 4LJSA 1D9ZA 4Q9AA 5JSFA 2CFRA 1B0PA 2V4UA 3HJCA 4JGGA 4L9RA 4PPYA 1FJHA 2D62A 3DR3A 4YJ2A 2UUBB 5G4KA 2I6QA 5F64A 1HKHA 1Y8QB 3ADPA 3FNIA 2WIDA 5CPBA 2JANA 5TJHA 4QEKA 2ZUSA 4BB5A 1TUBA 2HNKA 2ZTUA 4HPXB 1Q0PA 1L5KA 2BMAA 2E6KA 1HSZA 3EXHC 4L22A 4NFLA 5JY1A 4GW3A 5F5XA 2QD3A 3AUUA 2BFEB 5TQ2A 5ESDA 4ZU3A 1M6YA 4NFYA 2IWHA 8ATCA 3UYLA 4EKIA 5FFMA 3JASA 2UZ1A 4LUCA 3P9XA 4XXHA 2BY4A 3QW4B 5H80A 1UZAA 4OGFA 1JDTA 1LW6E 1MH9A 4PN3A 2ZUEA 4ZREA 3IBGA 2YN2A 3PGJA 3FFTA 1BEUB 4HRAA 2JAOA 1G0NA 1ZP6A 3K32A 1G4AE 5J2UF 4CKBB 1IPEA 4DANA 4JB0A 2CVZA 3W6ZA 4L4UA 1A95A 1A72A 5CA0A 3SIPA 1L4MA 3GARA 3IHTA 4QSHA 3UJPA 3LC2O 1Q7RA 1FP2A 1HLPA 4WQMA 5E6RA 1RTTA 1QCCA 4U3JA 3VV2A 2W2OA 3QLEA 4MJ3A 3CSUA 3TKYA 3Q8KA 3J7AC 1SQ0A 2CYBA 1K4KA 2Q3EA 3JALA 4FYVA 3CZCA 1LNZA 4ASUD 1E0AA 4YO8A 2CLIB 1U2SA 3PHJA 4YCJA 1NR1A 5FEUA 4UVIA 1J8VA 3ETDA 2XRZA 3HTXA 4ZYYA 5LYJB 5DCYA 3QXGA 1LSUA 3BXOA 4HFRA 4WFIA 2FPSA 1GKYA 3L6UA 3X0DA 2VJPA 1JG1A 3F9IA 4N40A 1V5GA 4C22A 4JI2B 5EP4A 1U1DA 2R47A 1JJAA 4TKZA 1FNNA 3O47A 5JAPA 3EOBI 1L5GB 1F51E 1E2EA 1JH8A 3L8EA 4LJ5A 3WADA 4PR3A 3SJZA 5DHQA 1OZAA 2E48A 2EZ9A 1EFVB 4HWOA 5KNDD 3DE7X 1DQPA 5K3FB 1C1XB 2YY6A 1U9IA 2QU7A 5BNTA 1AO3A 4DM3A 1QIIA 1Y34E 3KKQA 4X9XA 5TF4A 5BQ3A 2XYQA 4S1OA 4EFMA 5D01A 4IDQA 1DTWA 4Q37A 4B9AA 1SVLA 4UQPA 1V37A 3KAKA 3RS8A 2UXBB 2X13A 5KNCD 4GPAA 4HQ0A 1KU6A 1U3TA 2A9JA 4RORA 4FSXA 2D2FA 2FWIA 1TJ4A 2G3YA 3LQFA 4CM9D 4F46A 4UU7A 1CNMA 1WB6A 4DZZA 2G9VA 1PQUA 3OZIA 4MV1A 1YHZA 2QL9A 4OKNA 4XRGA 3KLMX 3PI6A 4DCPA 4RXMA 1W76A 1HGXA 3E84A 4DIBA 4RVDA 3H3FA 5DHSA 4U02A 2EEZA 3GMTA 3KWFA 3OZTA 3QBDA 4MV8A 2OAP1 3ETJA 4OP3A 5FFFA 4CJXA 3MBIA 5K0SA 1QH1B 3EFHA 3OKCA 4GZLA 2JIZD 1GL9B 2VCHA 1GPJA 3AVXA 3GDFA 5I9SA 3RVLA 2K2WA 2SKEA 3AEZA 4WGFA 4YH1A 3TUJC 3O38A 4NOKA 2ZE8A 3RB8A 3QVKA 2IUYA 1D7OA 1TM2A 2V55B 2WM8A 3A06A 5FNZA 4GRIA 4HZUB 2EGHA 4FFVA 1XF1A 3DEIA 4JIGA 4MKHA 1MAHA 3M81A 1UBSB 1DJLA 5IDQA 2PVPA 4BO6A 4CKCB 2C7RA 4Q7JB 1HXHA 5CYOA 3G5MA 4MKIA 1PWZA 4ZAFA 2CKMA 4BCCA 2VWHA 4JQOA 1WTAA 5FI1B 3ZOZA 1FYDA 3GJSA 4LZOA 4RTJA 1L7PA 3EPHA 1C4XA 1M1NA 2BKVA 4INZA 3VNVA 4TS4A 1TZJA 2AN9A 2B2NA 1G6OA 2PT6A 1ONOA 2HSWA 3HJNA 4RXTA 1E0DA 1RMTA 3BGIA 4W7IA 5KU7A 5DM0A 3RE1A 1FNCA 4UM7A 4ZVLA 2Z09A 2PUDA 1Z2DA 1C4WA 1UBNA 2RBEA 4MWOA 2ZUTA 3C6BA 3TFOA 3CQ9A 4WXYB 2DF8A 2BR5A 3RQIA 1QHSA 4MPTA 1RXVA 4N18A 1GPWB 3PFIA 3GNQA 4RS4A 3U4QA 1IONA 4FFBA 4YUVA 1YRBA 2IYAA 3V4ZA 1DEKA 1NW6A 2RK3A 3DE1X 2O54A 2G63A 5FR2A 5JSKA 1BE6A 2IF0A 3P96A 2Q9BA 2YC4C 4KW7A 5JZMA 5JHGB 4LDAA 1EFCA 4FVTA 4R1UA 5D6OA 5G0WA 5JHHB 5G53C 1DC8A 5IZCC 2ZUWA 4BN5A 4PN7A 2A59A 3SQNA 3EF3A 5AHOA 2PLFA 3TZHA 4KQ9A 2P3OA 2ZB8A 2F2TA 5JSZA 1TFRA 2E4XA 2ZDHA 3GJ6A 2J3IA 4LX8A 4RADA 4KQXA 2FSSA 4Y6LA 5DXJA 2BRUA 1SU6A 4I55B 3H9GA 5SZKB 4OMFG 4MB6A 1K0FA 3LL4A 4TT3A 1O95C 4HATA 3WLMA 4B4WA 5L7TA 4RANA 4YRGA 4HAVA 4TWZA 5IXYA 4XIIA 2GAJA 4P5PA 5CJJA 4UD6A 3ZCRA 4NAHA 2EW8A 1BE8A 4D9NA 2AI3A 1G8PA 5KPDA 1A2OA 4NPHA 3UMVA 1CVRA 3KB6A 2IX3A 4C3ZA 1ZGJA 2G88A 4HDMA 4Y9TA 1JHOA 2QY9A 4B9EA 1RC8A 2W8ZA 2XB8A 4O2RA 3PZBA 3QW2A 4RC9A 2C1EA 3D59A 3I32A 3K1ZA 4B17A 1Z74A 2FDXA 2KI5A 3FZGA 4U9HS 1EK1A 3AU9A 5K0FA 1PG2A 1WD7A 2ZZNA 4FWTA 1C0IA 2IC5A 4WLFA 1JR3E 1NC1A 2NGRA 2W2XA 4ARAA 1MB3A 1CY8A 4IQGA 3AF5A 2W6ID 1NKVA 4PRYA 4JROA 1RVV1 4RZXA 2NT4A 1RKVA 2XF8A 5D1HA 5F2KA 1ORVA 1K3TA 4BC1A 4HSGA 2ODPA 4WNYA 4XLZA 5GVRA 3UMJA 4F5WA 5KVSA 2BSAA 3OLYA 1AC5A 5JBIA 1HFEL 2H6EA 2OXCA 1TZKA 2PZGA 1ZW6A 1OXSC 3D8UA 4H3SA 1YA8A 2MR6A 1LBEA 3B2QA 4HDCA 4P08A 5EHGA 1SUCA 5TX7A 3GBVA 4EFNA 1QFXA 1UFKA 4MULA 3T3MB 4BYGA 3TLEA 4IFTA 3RLIA 4MV3A 2QWXA 1JHQA 1F7UA 4JXZA 3DCIA 2FR1A 1FS5A 3KR0A 3HCNA 3P9NA 4RD2A 2DECA 1PBTA 3WGVA 2XEDA 3G2HA 4QFBA 2QSYA 5LLDA 2XODA 1E9EA 3S2GA 3LUAA 3BTOA 1KOGA 4ND1A 1UWCA 2Q4DA 1NQTA 1W2GA 1K88A 2NQ8A 3DVAA 4MUYA 1TIPA 3P94A 4MQ4A 5K2OA 4JJAA 4JBXA 3BGVA 1VSBA 4W5WA 4JLSA 5GWXA 2H5LA 4DA9A 5CNKA 3TIIA 2Q28A 1Q1ZA 4KG7A 4WKPA 5LD2B 1EUDB 1J2RA 1S3IA 3TOCA 1UL1X 5T4BA 2A1TS 2X19A 3QKWA 3FB4A 4XVRA 2J33A 3L7JA 3QUSA 3A1VA 3CN7A 3CZ5A 3I6YA 2ID4A 1GRRA 3EVNA 4KXYA 4LSZA 3U39A 3UWDA 3WIEA 4S05A 3R9XA 2LCIA 2XVAA 1NBMA 2Z4SA 1L7NA 3D4NA 4IO1A 1HMPA 1DRUA 5IK2A 1VSUA 2QLFA 3FX2A 1H2WA 1VE3A 2A9QA 1XEXA 1U5AA 4ZV4A 4XQGA 5J5VA 2IYEA 3NMUF 4C0SA 1NBWB 1PGOA 3DV0B 4DCSA 4V1CA 2GM9A 2P1RA 1OWPA 3PQDA 2FSHA 5E0KB 3E15A 4CLDA 3BFKA 1ZHHA 2VQ3A 4JH0A 1W19A 2OBXA 3QF4A 4QSMA 1PD0A 1Y63A 2CXOA 2ZTSA 2XT6A 1CTQA 3BDAA 3IOCA 4KEAA 1PSDA 2FWPA 3Q0IA 5DE3A 1G6HA 4ZCPA 4IH4A 5ITZA 1IJEA 3TQFA 2QAGA 1T9AA 5HTKA 5CDTA 5ALVA 4LJLA 1BXRA 5LBTA 3RFFA 5BWCA 4B3TB 1YB2A 2P6UA 1WHTA 5LYJF 4YJHA 4R01A 1QUEA 3V5NA 3GEDA 2A1TR 4LRTB 4EFKA 2WUFA 1Y3FE 3BWMA 1SVOA 2PDAA 3FWHA 4OJMX 1MDFA 4OI2A 3SYLA 2ZSUA 4L2IA 4KQ2A 5KTNA 1IRIA 1DLIA 1Z5WA 4YQZA 3R8FA 2AR9A 5M7EA 5ICFA 4XWGA 3CG0A 5REQA 4X94A 2ZCUA 2GBGA 1Z45A 4UZSA 1SUAA 1RKUA 1IJKA 2C57A 1REQB 2RHGB 3ZX5A 4IEFB 5CDHA 5IT9A 3LSTA 3RSQA 4GE0A 3HDTA 3DZHA 5JVDA 2A86A 1YZFA 3ODPA 1NW4A 3EGIA 3KXPA 3TBFA 2B9EA 3REQB 1YI8A 3HJHA 4G84A 4DNFA 1KAQA 4URVR 3MT9A 3GEBA 3F49S 3A1NA 4EUNA 3E9YA 4Y9SA 3WIBA 1JIJA 2ZBPA 4NIMA 3FXAA 1NRJB 1R5NA 2WVHA 2ZJ3A 3HA2A 4INJA 4J0EA 3T7DA 3EZ2A 5DM60 2YQ5A 3DDHA 4KO1S 1HM5A 3E03A 3GDWA 4HVAA 5AW5A 1EFPA 2DFVA 2GXUA 2VPIA 3DW3X 3JR7A 4N3NA 5JS2A 1VDZA 3IR5A 3BJRA 5EERA 1TQ4A 1FA9A 3ETEA 2HC9A 4DIDA 3PHHA 5AVSA 1E9VA 3R0QA 4Q3AA 4JI1B 4AWAA 3AV0B 3BQNB 4AY4A 4E14A 5KUTA 3LFUA 821PA 1O08A 2NOAA 6ABPA 3Q41A 1XPUA 1T1GA 5ALDA 3NORA 4G85A 3MWFA 4G81A 5K4AA 4YMVA 3FNEA 4CL8A 1JIKA 1LPNA 3TIGA 5JNWA 2X41A 4RKWA 1O97C 2DWCA 2OCGA 3GLQA 1RFGE 2HREA 3CPSA 3LSYA 5FX2A 3PEYA 3P71T 2IOQA 1V4VA 2E3JA 1VL1A 3KOMA 4BVFA 4XCQA 4NG4A 1T5IA 1R9GA 3CTPA 521PA 4S24A 4QAQA 4RMHA 3WB1A 1U0TA 2DYKA 1QAQA 2PUJA 3UTCA 1R16A 3FSEA 1UXIA 4OK6A 1XGKA 2E4UA 2WPDD 2CE2X 2H59A 5GGYA 1Z5OA 3ROTA 3C7CB 3PR1A 3W2TA 1T26A 1TJ5A 4G56A 5L7WA 2R9VA 1FW8A 3K53A 4FFWA 4IM7A 4B3XA 4D0GA 2AXNA 2P40A 5HK8A 1PBNA 1ZUWA 3TLAA 1U9YA 3GJ7A 2JC3A 1MAVA 4NKRA 1MGPA 3VO8A 4DM7A 1Q0QA 1NKTA 4IV5A 1G8KA 2QMZA 3DMDA 3H86A 5EG5A 5HMMA 2VUSA 2XBLA 1GGVA 4GI7A 1R3UA 1ENYA 3LOQA 3ZY5A 1T9CA 4P53A 5BWLA 2C4TA 5A9TA 2ERXA 3ZNNA 4GWKA 5C4IA 5DZSA 1Q0TA 5A9RA 4LCJA 4TQ9A 3RVDA 4P3XA 1J9GA 4I9GA 5EE3A 3VNRA 4OD0A 2OBYA 1NXXA 4ME6A 1DCMA 2DBRA 3K70C 1AMOA 1N75A 4QBKA 1XDBA 4AZSA 4DUGA 3CF4A 3PK0A 4TLMB 4QRHA 1DC3A 3D5TA 4MVXA 4B81A 3CUYA 2D2XA 4EPYA 4BC0A 3FKQA 1TKBA 5KOYA 4P3NA 2PSHA 2RHBA 3A0RB 2GXSA 2QVGA 1RPTA 1RP1A 2J08A 2FH5B 2O0KA 3KTFA 4RESA 3GP3A 4OI0A 1YUMA 5AOAA 1NQUA 3MMXA 3HRHA 3G2KA 1GTJ1 1PEDA 4RMIA 1ZBDA 1B2LA 4I55F 1IZZA 2IOFK 1ORDA 1YDWA 3PKJA 2ZYDA 3IJPA 4WNAB 1S0UA 1Z0FA 5BW6B 2AJDA 1QGED 3WGGA 5F1YA 4A8HA 1CRWG 4JHLA 2D2IA 4BUZA 1XE3A 1TKCA 3VAAA 1H6BA 4JBGA 5C7IO 5L8VA 1VDMA 4ZEMA 2B5WA 2PZLA 2V7WA 5BMVF 1E89A 4FIDA 4QIHA 2RIRA 4JI7B 2ODBA 3SX2A 1IWPB 3ZHVA 5TMBA 1XF9A 1DKLA 2H4ZA 2RGUA 4IGIA 4QWMA 1GG9A 2PANA 1Y80A 1GLGA 4TMTA 5B55A 4RUKA 4B4DA 4IEEA 4O3FA 4OHUA 5BY2A 1GZ6A 1N1EA 3BG5A 3BZUA 2BDEA 5DNWA 3DPIA 4CF3A 4FT4A 4BKOA 2YXEA 3LGSA 2WOJA 4JLOA 3LM8A 4Y6RA 4AG6A 3JQBA 4E6EA 1JSCA 3O2NA 4QODA 3VISA 4KR6A 5HF8A 5TNXA 4B87A 1KEVA 2NIPA 1T9ZA 3N8GA 4JLDA 1OW3B 2YHSA 4MMYB 1CQXA 2DULA 3R0IA 4ZQGA 3EH2A 3VMFA 2FU5C 1L8QA 3C8HA 4UVDA 1QOZA 3HP7A 1FRNA 1ZRSA 3TBHA 2JPDA 4UAUA 1PW7A 4PC1A 4I9NA 1WKBA 1GZUA 3GPCA 4ITRC 5DHTA 2DQYA 3NGLA 1GQ2A 2V59A 3GGGA 3GY0A 2YZ7A 1WZUA 4XIYA 5BN3A 3KLBA 3CX8A 3QKSB 5CLGA 3H13A 3HCBA 3NTRA 1NXQA 1JDZA 2J9RA 4KL8S 4P84A 3OE7A 1SXIA 3RRZA 4ZVTA 3H2YA 3CNEA 1DRWA 5CAEA 4PYRA 4LKRA 4MWZA 4OFZA 3GDGA 9GPBA 2XYVA 3DL2A 4IINA 1ECBA 3ZE1B 2IODA 1H1DA 2X9QA 1N32B 1V6CA 2EGUA 2HCFA 2SHKA 4BQEA 2AOUA 4RF4A 3ZVNA 4KJZA 3SEQA 4BU0A 1ISFA 1R50A 3ASVA 5EWLB 3QHAA 3M89A 4BE9A 1SBIA 3PA6A 1N6HA 1QYIA 4JN6B 2D6FA 2FSVA 5JG7A 3HSKA 3O31A 1GNSA 1KSJA 2ZRAA 2YYSA 4JLMA 1JA9A 2XRFA 4MSUA 4YUWA 2XVXA 5CB0A 4HZGA 2ATVA 1M6NA 3IUEA 2VPPA 4I19A 1UP7A 1KYTA 3G82C 2W6JA 3ML1A 1HURA 5AM2A 2DKOA 2CXNA 2O7QA 2O50A 1IB0A 3MRTA 3TTVA 3ABZA 1SEPA 5J1TB 4D9IA 2FOXA 3RT1A 3AR8A 2QN6A 4KBYA 4CV2A 4DLAA 1RMQA 1R4ZA 3KBBA 2G09A 3TEFA 2VDKB 2HDHA 3ND7A 1RXWA 4ALNA 4HRYA 3R76A 4CQMA 4RPJA 1FIUA 5LPNA 2MWMA 3D3KA 3PC3A 4IIUA 4FE3A 1X6VA 3EDQA 5AJXA 1ZOPA 1I1QB 2GEJA 1GO2A 1TYDE 2AOTB 2NVWA 5FLYA 2FX3A 1L5NA 5FAXA 2X4LA 5IDVA 5DJ5A 4AZ0B 1C1HA 2JJ8A 1Q7CA 1NJSA 2ACWA 2P9HA 2IDJA 4KDRA 5AKLA 3ESAA 1N1MA 5AW1A 3MJDA 3MWJA 3GT3A 2F1HA 3ZGZA 4OH7A 3WZMA 4LWZA 1C3OB 2QZSA 2QRKA 5GV7A 2NZ8A 4YAEA 3RKUA 4R1MA 1I8TA 4JMLA 1QM5A 1I5RA 2D7JA 4EY6A 4Q02A 1Y89A 3RNLA 4EELA 4HDRB 4BCBA 2GN6A 1NNLA 2GYUA 3CZAA 2ZT8A 2YKGA 2P5YA 1EJ6A 3OWXA 1EP3B 3DOFA 2KBFA 1SVKA 1RXCA 3ZBQA 4BGUA 1YDMA 4NCAA 4CEJB 5K05A 3STWA 1H85A 4G5XA 3L0DA 3QGMA 3P32A 2IITA 2OV8A 2WYWA 3QE0A 1NXPA 1YQEA 3QBTA 3PJDA 2Q5FA 1JPVA 2WM9B 3PGVA 3TCNA 1W85B 3D3EA 1TE2A 3UZUA 5H3HA 4CI0B 1M33A 3QKRA 4TXHA 3DFIA 5JCOC 5JAOA 4RZ2A 1S2NA 3H5AA 3PXDA 3O4FA 5AW4A 4EYSA 4XJSA 2FPGB 1JALA 4IPTA 1MO5A 4J8PA 4BNGA 1WMBA 1QDLB 4RGVA 3VSCA 3R5XA 1QKIA 4MV7A 4MQFB 5EUMA 5FYQA 2PAAA 5EL0A 3CIFA 3U6BA 1G5TA 1JEYB 3OE4A 1KRHA 4UZEA 5IFKA 4IDBA 3FETA 3HXTA 4LHZA 4TT3D 1TTPB 1ZSVA 2I4TA 1GRQA 1PCXA 3DB2A 4EF6A 4R5MA 1NW9B 1Y8AA 4FJ0A 1FK8A 1BMFD 1EAMA 2BZ1A 3D0QA 4CM4B 5IABA 1OBCA 4GPZA 3KQMA 4X44A 5K1ZA 3ZDRA 3GVPA 3KDAA 1TU3A 1BWPA 3I58A 3NT4A 3HE3A 5IJAA 3QMVA 3EGWA 4H7HA 2TSYB 1YOBA 4ZQFA 2E85A 2X1VA 1AGXA 2ZB4A 2EATA 2OCLA 1UDAA 1EVEA 2PKXA 3HC7A 3HJBA 3NLLA 2JHFA 1TVEA 1ZIPA 2QYTA 5K45A 1ZSNA 4XPZA 1JVNA 3THYB 3HYSA 3Q5DA 3TQRA 2OCIA 1KI4A 1WM1A 2YWCA 3OMLA 4PGGA 4DQKA 5IVPA 4XARA 4Q4DA 1U02A 1U2RA 2HUNA 3ADOA 4L5AA 4LHSA 4UHCA 2Q6VA 3LT4A 5DH9A 1ECPA 1S8OA 3TR5A 2Z4RA 4B2IA 1A71A 2C3MA 4S2EA 2D1QA 3L05A 1TIKA 1UM9B 3CSDA 4WGGA 3IIKA 4Q93A 1C9MA 2CD9A 3L07A 1KBOA 1L2TA 1CFZA 1PO7A 4FGJA 1G16A 3I1YA 1A8HA 5AKGA 4YR9A 3SC6A 1VE6A 2C31A 5JWHA 3UWOA 3LLCA 4PIPA 3U56A 4MJLA 4E5UA 4FLFA 2VSNA 4J0GA 3DBRA 4AO8A 2C7GA 2VHCA 2K7ZA 2VJNA 5LCXA 1KMHA 3DCJA 3DXFA 1GKUB 4RULA 3A6JA 3P2EA 1UXGA 3LDUA 2X0EA 3R7FA 4KRYA 4DPMA 4JZYA 4E5YA 1X39A 3D2AA 4P3KA 3QU9A 1EDOA 2ZIZA 2EFEB 1NFFA 1MD9A 2V97A 2RHOA 3VKHA 1R5JA 1ABEA 2ZIFA 3R7AA 2VJDA 2WJVA 5GZ3A 4ALMA 4ZGWA 1L7VC 5CP8A 4UNNA 2XWPA 3N8KA 4BWYA 3F5FA 4WKGA 4P3PA 2R7LA 5HSGA 5FCDA 2B8NA 5B58C 1G4HA 1ND5A 4ZAYA 5BT9A 3WB9A 1QCYA 3TW0A 4MPJA 4UBOA 5ALQA 2GT1A 2EF1A 1T8WA 1U5BA 2Z3WA 1DIGA 2CL0X 4RFLA 3AERA 3QVWA 4FFLA 4ZYZA 3GGDA 1LK7A 1Z4NA 1HEYA 1Q1AA 3RPEA 3STHA 4A8JB 1SXPA 4QDKA 5IK2D 1ZQ1A 3C74A 1RU3A 3CRQA 2OGWA 3BE6A 4H9GA 2B7LA 2JJ2D 2YQ4A 3VC2A 1IN6A 5F9MA 2Q5EA 3OLWA 3A1EA 2J5QA 1NLFA 3AEQA 3FLAA 3PI7A 2JASA 5CW2A 2P4QA 3WRWA 3ZHOA 2P11A 3T4PA 1CY6A 1JPUA 3ECSA 1TZCA 4QXAA 3AFMA 3WHIA 3BXZA 5JD6A 1O6ZA 3QVUA 4OJQA 2DSNA 3EDMA 3NWEA 4KUEA 4FYHA 4LJYA 4YRIA 4ZGGA 1QPBA 2L19A 5T64A 1KI8A 2Z08A 4G0ZA 1UQRA 4NENA 3O4VA 4AUNA 4TVKA 4IHAA 4RHYA 3ZE0B 2ZM6B 1WXFA 2AMVA 1RAFA 3DAGA 2XSZA 4IEIA 4KIFA 4N7RA 5JSHA 1H42A 3N9IA 4GOJA 3S2YA 2C8VA 1IB6A 3IR7A 3RCBA 4AK9A 3HGQA 2MYPA 5J4VA 1IATA 4OXKA 1XRQA 2FF7A 4G4JA 3RUAA 4YRMA 1SB9A 3EG5A 3EWAA 5JDIC 3ET4A 1OI4A 5CT8A 5FRDA 1BTOA 3P9SA 4X8MA 3RSSA 3VR4A 2O8FB 1E2QA 1JFFB 3TE6A 2H3HA 1GQFA 2GEDA 3QFFA 2VBIA 1GRCA 1M1XB 3EW7A 3WGNA 2WT4A 5F77A 3SXPA 2C03A 5LP6B 1NVEA 5AVZA 5J4HA 4F2WA 4Z49A 3EQZA 5H82A 3L01A 1NMZA 4OJKA 4TUYA 4AYTA 5MN4A 1PUXA 5A0TA 1ILWA 4IJKA 4URFA 2IFTA 3D64A 3Q9NA 3X1YA 4EUSA 4F6CA 1LI5A 2CVPA 1CY2A 3X2EA 3UCFA 5H4GA 4PG5A 3A4YA 3IVRA 5LJLA 1YB1A 1BKYA 4A0HA 4N48A 1LKZA 4ERXA 2C82A 4KIUA 1PZNA 3I9NA 3TOXA 5F52A 2XE7A 2QVLA 3JQ8B 3DT9A 2QDXA 4BP1A 1OH6A 4IDDA 1HORA 2OXTA 1TX4B 3LMKA 2DTDA 4CRWB 1Y3HA 1RT9A 2HLPA 5I51A 4LQ4A 5NULA 2OQVA 1U0BB 1CX9B 3NHPA 3ZVRA 1XCMA 2PT7A 4DWJA 3GI1A 4MYTA 2IS1A 2BKXA 2X2OA 3HBNA 4G4SP 2NMVA 4I2NA 1XMOB 1IFXA 5KSPA 1WXXA 3QBJA 1XKLA 1Z2CA 1XHEA 5JNLA 1I32A 2I91A 1I2BA 1V45E 3LO5A 1G6Q1 3RAJA 5TF0A 3UWKA 3G02A 5IMSA 2XTZA 5AESA 4LDQA 4Q5IA 5CFOA 3TSCA 1BFUA 1M0WA 1E98A 4F5YA 3DOUA 3REFA 2HWYA 5IPFA 3N87A 1J4AA 3TDMA 3X1MA 1R7RA 1WZEA 1P8JA 4ENTA 4KXLA 2TMYA 1T8SA 2QPTA 4UTOA 1G19A 4A91A 1QO9A 4WT7A 2AC4A 2MINA 3GVXA 3IAAA 4JBLA 2O8DB 1EXWA 1RJGA 1Z08A 3AR4A 2IV2X 1V6SA 1GL6A 3RV3A 1GCGA 3VMMA 1PTJA 1PK8A 1ZINA 1FBTA 4IW3B 4HP8A 5B3KA 3W6UA 3UXYA 4IJ6A 4AKHA 3L4SO 3HL4A 2Q41A 3UH1A 1XVVA 1UDCA 3BSYA 1H2BA 1OZFA 1RQGA 1SHKA 1D4OA 2BAGA 3FRJA 4M37A 2YWHA 2R11A 4L8FA 2GYYA 4V0OA 4NZYA 4D99A 4IJUA 4MS3B 3MYYA 3KWLA 4KXQA 4DUGD 1FP7A 4S1PA 2ZSFA 2OBLA 1TIBA 3OPMA 4HB4A 4ZZ0A 3I9JA 1WZNA 1R0KA 1GA6A 1YQDA 2WUEA 1ADFA 4IVNA 5A2QA 2IS6A 4GP9A 4L9AA 4OB6A 3HKCB 1UKZA 5FD8A 2QR5A 2WA1A 5LNK6 2R8RA 1E2GA 4G0XA 5J2UA 5EQTA 5LXTF 3RU3A 5AMXA 3WY9A 1YFJA 4JQYA 4C4OA 5BRJA 4PHGA 3RIHA 1RYYA 1MCZA 1CNFA 3M1LA 4P31A 3ZDFA 1VE7A 3DMYA 3NBMA 3Q7EA 1VYHA 4QXPA 4D0RA 1Z6ZA 1L3BA 1MOSA 2ZXEA 1NW8A 4ETNA 2B0JA 4O63O 4LYAA 4EW2A 1CVIA 1ZITA 2FK8A 4P2BA 2DEUA 3ICWA 1KYXA 4LDPA 3R6WA 3TDKA 5BWNA 4P32A 3H7IA 1QLHA 4B8WA 3BN3A 1XPRA 1XXHA 1MVOA 1N1GA 2O2HA 3TQIA 3RC3A 4JXKA 2PMEA 3PCRB 5BSMA 3K8OE 4ENPA 4G89A 2PZFA 1P4JA 2ZJ8A 1ZN7A 2VQEB 4MVJP 3AO0B 3WS7A 4M21A 1DLJA 2BHNA 2YV5A 3HO1A 5K0GA 5BN4B 4CLRB 1MMFB 1KJIA 3CW9A 3NTUA 3C3EA 2WIBA 4MR8B 3AWDA 2IEAA 4AY5A 2A3RA 1X2EA 3CRW1 4E4RA 1AKMA 4HRXA 2Y2UA 2EHJA 1V48A 5EIXA 3AH8A 1OLSA 2C7VA 3R44A 4FR2A 1XD2B 4QOFA 1S01A 3LCMA 1MV5A 1IRXA 2QTTA 4LDZA 3NOOA 4KYVA 1EWKA 4RVHA 4TMFA 3ER8A 1CRZA 1NX9A 5C8YA 2J5BA 4D4KA 5IDWA 3ZLTA 1Y7IA 1EK2A 2EZUA 2FFBA 3MW8A 4JUIA 1W0JA 2WD8A 4REOA 2C8LA 2AVNA 1WXIA 4Y2XA 5TPWB 1DO8A 1KYYA 2NYRA 3TVTA 2QTHA 3N2NA 3MUOA 4LZPA 4C3OB 1Y9JA 2VK1A 5EXEA 4RV9A 1QK4A 2BJWA 1FL9A 4BVAA 3I3OA 3MAAC 1FYXA 4KBFA 4I46A 3RANA 1TB4A 1RZVA 4I4LA 2CZGA 2HT1A 4QRIA 2CV1A 1U2PA 1F8GA 2R60A 4OJTA 4RZUA 3VR1A 3QH4A 4HAIA 1VYTA 1ISGA 2HTFA 1GTZA 3OJ0A 3JVEA 5DMHA 1SXJC 1VMEA 4OEHA 2ZIAA 3T35A 4E46A 2DFTA 3VPBA 1RACA 2W2QA 3A6EA 1RCTE 3DE6X 1OLUB 1O96A 5BSHA 3LTNC 2C29D 4UMFA 1EUCA 1MEEA 2FW6A 1XOIA 1HNWB 3VPFA 1OWLA 4BEBA 4DAEA 4DCUA 3D2CA 1S8AA 3VI4B 3IP1A 1T36A 1UMCB 4R81A 1TU4A 4GC9A 5DLYA 1S2DA 2OEPA 2PRKA 2Q7XA 1XCGB 3UT5A 1L7QA 4F5DA 1UBRS 4YP7A 4PLYA 1UIRA 3DTTA 1ARZA 2QY6A 1ZXXA 4BO1A 2QLBA 4XWTA 3IODA 3UBMA 1ZDMA 2CLSA 3BGDA 2WNSA 1NQAO 2ZR8A 4EKEA 1LDEA 4QDJA 1QGAA 2IHYA 5THQA 4F5ZA 3IA7A 1E7MA 1E9CA 1GQSA 1VMDA 2X0RA 3WWCA 3MWKA 1II8A 3IPYA 3DC7A 4WFQA 2HBZA 3ZOKA 4DMKA 4UFOA 1F7VA 1WSBA 3D3JA 2PQMA 3SYNA 2ZYSA 4JAVC 1RNLA 3L7KA 2QG4A 4YO7A 5JIBA 2JGEA 4BXOB 4D7AA 1YQUA 5ABPA 4HUTA 4FM9A 1S1CA 1V26A 2H4XA 2WSSA 2YWDA 3NIFB 4A0SA 4BGVA 3KBOA 3PBKA 4RQBA 4JHXA 2V7XA 2PWZA 5FV7A 1MB0A 3T1VA 5HJ5A 1WBBA 3S2SA 4V39A 1EDEA 4AY6A 3CUKA 3OMWA 2WYVA 3O82A 4QDXA 3FTEA 2D0DA 1LPMA 3C3JA 5EWJA 3ZDCA 5TV2A 4H27A 5EIWA 4DNQA 2NUTA 2BN4A 1XTTA 1YRAA 2ZKIA 4EY8A 1AY0A 3JAKB 1SIUA 1P2UA 1L5SA 4AQ7A 5EIHA 2FEOA 2ZYHA 5JSQA 4MRPA 3VRHA 1UANA 5GIOE 1CZLA 3I2GA 5LP6F 4RKRA 4Q9KA 1R27A 2YZKA 3ITDA 4ES6A 2CV0A 3RVKA 1KMQA 2IP2A 4H17A 4L4RA 1G3UA 4NFHA 1BHJA 3X1ZA 3F8SA 3HPRA 2GS9A 2I54A 4FYMA 4N5HX 2BUCA 4BZXA 2IY9A 4YMLA 2VHXA 4ROTA 1C9JA 4BECA 5K3BA 2A2ZA 3L3BA 4DSOA 4E51A 1Z28A 2XPCA 3JQQA 4RTOA 2R4TA 3HV2A 2Y27A 4GKBA 2H7XA 1O4VA 1Q0HA 3AZPA 3OPYA 1FP6A 4QDTA 1YS2X 3P9YA 4ND7A 1YBVA 3SN6A 3AEUB 1M1YB 5D3MA 3ZWDA 3SZUA 5KNBA 4FFMA 4Q7KA 4DA8A 5ALKA 5FI5A 4CQNA 5D6NA 1YR6A 4GOXA 4HGNA 2J6IA 3SSOA 3EE6A 1TF5A 3GWGA 1PJAA 4HVTA 4N9QA 2RD2A 1ZKDA 3OO1A 1JDUA 5AK6A 1TLTA 3IP3A 5CEEA 1RLMA 3KD2A 4M7WA 4P4LA 1Q0SA 2PZMA 4E5MA 2GYWA 4A6XA 4ZK6A 3EZ7A 3ZQ4A 4BAUA 2OCPA 1Z5NA 4M0CA 4KAXA 5A0FA 3ZGOA 3PNPA 4TYMA 1H8HD 3CNLA 1W5SA 4EARA 4WA8A 3R9WA 3MXTA 4KMSA 2EDCA 4KPFC 3EXG2 4MR9B 3KOYA 1WIWA 5BPFA 5J4LA 4Y1EA 2Q9CA 4RHCA 3KUXA 5EA2A 2XD4A 3ABIA 2Y1OA 2EP5A 4Q1VA 3PYLA 4HNQA 4D43A 2YJ6A 4OAQA 3B2EA 4Y30A 4PGAA 3WX0A 2V96A 3QU7A 1D5CA 1FU4A 3NBZC 4MWGA 2PX2A 4QOHA 2I4OA 3IAHA 3HKEB 5IKMA 3AQIA 4U2CA 5ESWA 1W6RA 3DL0A 2VNKA 2VP5A 3H5NA 5JOQA 2AK2A 2DTXA 3F6SA 4PLTA 1Y8QA 4WTOA 2J3HA 4GR5A 4M9XA 1ZNYA 3EPLA 4CT4B 1SBCA 4C7VA 2QN8A 2YFQA 2JVKA 1YJQA 1WB4A 2IYRA 3BFXA 1MEOA 2HLDD 2A9RA 3LQRA 4MQUA 5GJVC 2IHTA 2JFNA 4AMZA 5ARCA 1O8BA 3KJXA 3PX7A 3ZD9A 2BFEA 3OOJA 4BO4A 2O2JA 2PO7A 1RHRA 1GPAA 2OE2A 3EQ2A 2CNWD 3HZZA 3IE2A 4JKYA 2BHSA 5HUJA 1GTRA 2V7EA 4AKSA 1YJXA 1E9FA 1ZY2A 3NOQA 1M6HA 2A8YA 3TKLA 2JRLA 5K3SA 4K9SA 4MW7A 5EPUA 2HXGA 2MYUA 3ROPA 1NAIA 4IIHA 3THSA 1GZ7A 5KJ6A 2GM3A 5A3RA 1HDEA 1O94C 1XWWA 2VF5X 2ZJ2A 4MKRA 1YVPA 1ULBA 4F9FA 5LU8A 4LVCA 4QTZA 3WWPA 4A5SA 2C5GA 4LMAA 4CKBA 3GOHA 1TC1A 4F4FA 1ZK1A 1E5XA 1UZMA 1ADJA 1EQUA 1V25A 5B58T 1I6WA 2DCMA 3RUDA 3TWOA 3V2HA 5FH9A 4C08A 4ABYA 2ACEA 1KVQA 1PYOA 3WICA 4J0JA 2BGMA 1CS0B 4LSMA 2QGNA 3B2NA 3P4YA 5EQFA 5IARA 1M83A 3NJ4A 1A4UA 1J56A 2QLNA 2GK7A 2O3TA 2RIPA 2WZQA 4WA7A 4NOLA 2W8BB 3CZ9A 3BJIC 1SKMA 2WMOB 3KOWA 5LYJA 4P80A 4CW7A 2MYTA 5IJWA 4QJ5A 3COVA 4PLGA 4WDRA 4GM4A 2IV3A 2VSQA 3AY0A 5HIMA 5F3WB 2GN1A 2GPNA 3A05A 4IDNA 2J6HA 2XECA 4GZMA 2HMTA 2HIHA 3IULA 4TPKA 1VI5A 4B31A 3GZJA 3EEIA 4ZC1A 1MX3A 4ZVRA 1UH5A 1QPZA 4ALJA 3Q3EA 1AN0A 4AG3A 1MJGA 2A0KA 4HS9A 1SQ6A 1EFVA 2C2OA 3HCEA 4MS1B 3IBYA 4ZU1X 5K3FA 2ZWVA 1C1XA 3P4UA 1IUNA 1ULSA 3W5CA 4RTNA 1JILA 2QAJA 4TS3A 5IBPA 2NX2A 4CFSA 3QSYA 1JW9B 2DP4E 2NYAA 2XSZD 3B6IA 3OCWA 1T0IA 1ECGA 1U3GA 4JX8A 3W7BA 3I9V6 4Q6WA 5CEJA 3KVNA 5CYGA 1P18A 4J29A 4JX9A 3V7YA 4LECA 3AI1A 1NVDA 2AR7A 1UOEA 3ECAA 4L2IB 1JZQA 1PNTA 3VR4D 2JS7A 5B53A 4BZZA 3EMKA 3PXEA 4IDPA 3FDXA 4OYRA 4KMOA 3TMYA 1IMOA 4RJIA 5IYZB 2Z9BA 4AG5A 2FWAA 3PSHA 1HYGA 2WJIA 1CR4A 4GLOA 3ZR4B 4F2GA 5L9AA 4CBVA 2KS6A 2ZPUA 1Z6XA 1A98A 3AXTA 5HDQA 3REGA 3EMDA 4BMCA 1B74A 3SVZA 5E4JA 1NVTA 5FPTA 1XRMA 1WZIA 2D3TA 5AIAA 3CBQA 4C7OB 1NNI1 4F71A 2FOLA 1QH1A 2RK6A 3C3KA 1N0HA 3FBGA 4S0ZA 5AK5A 3KTAB 3DV9A 3M6XA 4OATA 4W9RA 3A1TA 3FF4A 3GDOA 3UWMA 4DR7B 3ZWNA 2M32A 1GOTA 3ESDA 2Z6QA 2BI4A 1FJ2A 1EGVB 1N6LA 2H65A 1EBFA 3UT0A 3PHIA 1CJUC 5KCMA 2C99A 4I5FA 4CL2A 1UXHA 4C5CA 2NO9A 3ZDBA 4RH0A 3UY4A 4WN9B 3SBEA 4HZUA 1XKQA 1JMKC 2IUSA 2WAXA 5TT1A 5LWQA 4B44A 2FG7C 2ZIUB 3KTOA 3JR3A 5SYAA 5JAMA 3IP5A 2I29A 1K98A 3P2KA 4CKCA 5GONB 4ZQHA 4IIGA 4QOEA 3KVOA 3RM3A 2AMJA 1UIMA 5DNVA 1GPNA 1UBTS 3QXJA 4HI0E 3CONA 2ZAYA 1QJ4A 4NV3A 3O8CA 1R6UA 2GZAA 4FMCB 5FWAA 1XDWA 5KTYA 2F4VB 1JP7A 2MDTA 2FQ1A 2V9ZA 4KAAA 5AR1A 5T4EA 2O0JA 4KI7A 4FK8A 1WF6A 4LG1A 3PXUA 1RKQA 1KEKA 1EFUA 2HJSA 4JJ4A 4BBPA 1N3IA 2Q2QA 4KFTA 1SURA 2G9UA 3CX7A 1F3OA 3P2OA 2BZSA 1KY3A 3TLJA 1KOJA 2AQHA 5FBLB 5FTJA 2FHSA 2OLKA 4UPDA 2ZI3A 1CVLA 1RPZA 1KI3A 5BW4A 3RGWS 1FFGA 1U7UA 1Y1LA 4FE7A 3V8NA 3TIVA 3JQ9A 3MCTA 4E5VA 1OIXA 1FE8A 2HU7A 4WAUA 4DTIA 4TWJA 3CXUA 1WMEA 3OU6A 4FCVA 5B36A 2AFHB 2A6PA 2BL4A 3LS2A 3NP9A 4I55A 4QO8A 5FWDA 1PZFA 2FPIB 5EJFA 3E8XA 2X3FA 3FCAA 2E49A 3IESA 1CRLA 3QOXA 1J33A 4D42A 3GGSA 3P9IA 3KAPA 1TJ3A 3CUEF 3VPHA 4B43A 3GBSA 2JGFA 5BMVA 3N74A 1JXQA 2DFKB 3T3EA 2OHOA 3D7NA 3HMKA 2OXEA 4IJMA 3U13A 3GELA 5H8WA 1P0FA 2GEBA 2G36A 4PWYA 1C7JA 2XGMA 2H1IA 3I2YX 3GCXA 1OXBB 1J49A 5EZSA 1Z37A 1UZLA 1EJBA 4W1RA 3EPJA 4LXGA 3NKFA 3RDPA 3EIEA 3RIYA 1HOXA 4WDQA 4CLEA 3AVTA 4MVJG 5CVEA 4V0SA 2C5BA 3RYFA 3LHKA 5KO2A 4M1SA 3GG2A 3OHSX 1EPUA 1L5OA 4L8GA 2LE0A 2OCKA 3D31A 4RGQA 2GZMA 5ENDA 4ETMA 3FTFA 1EVLA 1JAZA 2QTRA 3F2VA 3FPBA 5CVJA 3T3IA 2FEXA 3GLKA 3A1UA 1Q7EA 3EIHA 3NDPA 3U5ZB 4C4XA 3OLCX 1U9IC 2QUZA 2FFJA 1T5BA 1Z35A 1QBKC 3T95A 1U65A 1OAKA 1DC5A 2OV2A 2ZJOA 4C7MA 3M5WA 2BH9A 5E1MA 4Z3DA 3QX8A 2FGJA 2O8BB 3D1VA 1GPYA 1L4UA 1MORA 4QDZA 1M6WA 2NO4A 3S28A 3ZIUA 2PS1A 5ALEA 2Q4TA 3O4RA 4JYPA 3KQOA 2V7QD 4DEYA 3W5UA 2VL7A 1N2ZA 1UJBA 5H5JA 2RI1A 3WVNA 2GJKA 4BNNA 3B5EA 5GTDA 1X1CA 3CLHA 3L0SA 4D4JA 4DILA 5TEWA 2GBFA 5CH3A 1BN7A 1MKYA 4AF8A 2FUEA 1GWNA 3ESZA 1KI7A 1E58A 3IDZA 3MTAA 4YV2A 4HAXA 4Z7NB 1FVXA 3M6AA 4L9WA 4U7GA 1GSHA 4Q9LA 4GOKA 1RFLA 1EUDA 4BVBA 3ENQA 4CI9A 1QX4A 1JBQA 1ENOA 1L7BA 4TTIA 1DZIA 1PE0A 4HADA 5JH7F 1IBKB 2A14A 1EHCA 5DBHX 3UW3A 1M0EA 3B9RA 1ZBQA 1G8SA 3FY4A 2QRQA 4LISA 3FWZA 2X4DA 3LUHA 3M0EA 4OQEA 5EVJA 1T9GR 3PEWA 2VTDA 1DELA 2JBHA 3FTPA 4U6NA 2WG1A 4E21A 4M46A 3F9RA 5JNSA 3DV0A 5KOIA 3ZXXA 2XNKA 2I8AA 1WCIB 5HVNA 1F1BA 1SU8A 1YONA 1TM4E 3TZBA 1DBWA 3KJZA 1NBIA 2PLWA 2QD2A 3S44A 4IIBA 4TXJA 3B1VA 2NU8A 1P5JA 4JKIA 4CCAA 2BR4A 2W22A 3MUNA 1DADA 2Q1XA 3B7PA 2FPUA 3QWFA 5ALOA 4LK3A 3OZDA 3IUMA 4HAYA 4WACA 4RV5A 4A27A 3GQBB 4DQVA 3MTGA 4KLRA 2PMDA 4RF5A 4PQYA 1L4BA 1U7XA 1XCLA 1W5EA 4HMQA 2JJ1A 5D5PA 1AKNA 5BYAA 2CFCA 2H1SA 1OD6A 2WVAA 3FIUA 5TGZA 4LE0A 4U39A 5JWRA 3HLKA 3N6XA 4EPXA 4RETA 2FUKA 1TK9A 1Q2XA 4OHBA 1KJNA 5I45A 1D1SA 2QRLA 3HRIA 4NV1A 4XRRA 3SZRA 3B13B 1Y7PA 4PNPA 4ER0A 1Q2UA 1NE7A 3VJKA 2ZCJA 3WNVA 4FIZA 3V46A 3ZD6A 1Z6GA 5EIBD 4MVJF 1FUUA 5FT9A 4OLFA 4ZYUA 3WBJA 1QF9A 1REQA 3I04A 3O94A 1GZ3A 3RU9A 3WLAA 1QRAA 3JD4A 1T0UA 3QPCA 5J5AA 3ZNQA 5C5DA 1W25A 3RKSA 3KZVA 4OBWA 4RKFA 3REQA 2POCA 4ESOA 3PT5A 1QQTA 1EJ0A 3DE3X 3VR6D 3FOWA 2HWUA 2WSSD 1G20B 2VHJA 3UF0A 3S3TA 3KJIA 3SICE 1KR2A 2XTAA 2QVCA 2Y1LA 2BRUC 1K3UB 1Q95A 2TECE 2IDMA 1SHZA 2C2YA 1WG8A 1PQYA 2YWJA 2ZJ1A 3HFSA 4B8ZA 4HNVA 3DM5A 1M2JA 2QGFA 4F60A 1QFJA 3DVQX 4P33A 1YRHA 5IAGA 1JPNA 2B9VA 2PKYX 3KSUA 2YQZA 1V47A 3FR7A 5IYZF 1TYEB 3THRA 1SHLA 1TCCA 3WR5A 3N2GB 4XKJA 1VQ1A 3TSAA 4BMNA 5EMHA 3GLGB 1CEEA 2H1HA 2VWPA 2OC4A 3CA8A 3OT4A 1J8QA 3R8CA 3QJ5A 5FUWA 1W8DA 2IQ5A 2B20A 2KYRA 4TQUS 2HOQA 3E3AA 3RYCA 4EKNB 2DWPA 4CNBA 1G5HA 1UT8A 2IXAA 3WSTA 4N6NA 5F4ZA 1E4EB 4EJ6A 1VBKA 5IG2A 1DEHA 3OQ6A 3NRCA 4C5BA 3KU1A 4WKCA 2DHQA 4IHJB 4J0IA 3RSCA 4AXXA 4WBNF 3R4VA 1KO7A 1RRKA 3IUSA 2I22A 4FE4A 3TSYA 3F1KA 4CCSA 1BDMA 5CXQA 3FNHA 4I50F 3ZWOA 3ED1A 4L02A 3ERCA 1X9GA 5IZ4A 3HDQA 5KNBD 3LHFA 4K03A 3WK8A 4CG1A 1UP4A 1NVWQ 2AT1A 2B1GA 2WLSA 3LH5A 2X77A 1KZ1A 3P27A 4LMBA 4EHDA 3M6MD 4V0MA 1Z63A 1O6FA 1RRGA 5F7OA 3CW2A 2HZ7A 2VBCA 5ADVA 1KMMA 1B7GO 5K0TA 1N3LA 1KS9A 4W9NA 2Q4BA 4DR6B 2Q6TA 5M04A 4Y2SA 2C4NA 4K1XA 2PGLA 4IZIA 1G0OA 2QG9A 2VIIA 3FWPA 1SG9A 1B43A 2ZYWX 3LX4A 4G4SO 3ZWQA 1KY4A 3C85A 1QHXA 3B60A 3MWDB 4RAOA 4D44A 2AH5A 1DX4A 2BP7B 1CQJB 1TF2A 3JRXA 5A9SB 3D7SA 1NHWA 1P5ZB 1SUDA 4ZCQA 1ZJ6A 2G04A 2V6IA 2YJ5A 3C8UA 2V3VA 4IWYA 3WYAA 5BSWA 4JJGA 4F6LA 3OEED 1SOWA 3E8SA 3I2KA 3FYUB 1YAHA 2CK3A 1KR5A 5A7HA 1N33B 1TCAA 4BFZA 3AFIA 1YZUA 2P9GA 1QTQA 5KQLA 4UBJA 4TKUB 1MAWA 3OJLA 3VU3A 1OLOA 1HQKA 5B3JA 1FFXB 2RI0A 4D3DA 5ICCA 3VUFA 3F96A 2RAPA 1D2MA 1O77A 3Q3IA 5IHPA 4C29A 1T3GA 2LDBA 2WTAA 1JKXA 1CUXA 5HBGA 1ZD9A 4BU1A 1FMFA 2H5IA 1O8CA 5A02A 1JRLA 3HWWA 4KDEA 4XVQA 3NTLA 5D3ZA 3T9CA 1QIFA 3MCWA 3SFVA 1KFEB 2EWVA 2ZAMA 3GFGA 1WB9A 1PT5A 3BE5A 1IDN1 1LDBA 2IYUA 4OIMA 1JLRA 4WNAA 4XWOA 4Z3OA 1P2FA 4YRAA 1CLUA 1E2PA 1LBTA 2L18A 4PQEA 3GH3A 4LY3A 3Q3HA 2UVPB 2F1KA 3O4IA 2YW2A 4D79A 3E05A 2EBUA 1U28A 3G8BA 4IOMA 1IN5A 2JCGA 1V71A 1IG3A 1EG2A 1QB7A 1X38A 2J87A 1JDSA 3D0OA 4U7JA 2QAGC 2RGWA 5F7ZA 3RRXA 5L53A 4D26A 4TYWA 5DHPA 4Q3EA 2Y1FA 3KM0A 1KY2A 2JK0A 3E2PA 4G37A 4GKJB 1HL7A 2B7CA 1PJBA 1QC5B 5U9CA 3L1IA 1AUQA 4IIDA 3NTOA 3EQ7A 2GF0A 4KGZA 1KAGA 3BSFA 4O2AB 3ROMA 4DYVA 8ADHA 1QGYA 5F2NA 4ER5A 4KR7A 3PNYA 4HNAB 5ARBA 3PUHA 3L2OB 2X8WA 2HQOA 2O3UA 1Y3IA 1E7YA 1PQ4A 1R6BX 4PLZA 4M83A 3S5JA 3LL7A 3O90A 2ZG6A 2GJ8A 2XE4A 3KK0A 1Q0LA 2R85A 3KZKA 3I5XA 3EXAA 4K40A 4KXNA 5I7AA 5IM5A 1T3ZA 4FLMA 3MLAA 1JTEA 3D2BA 3FUTA 3FYDA 4Q21A 4ZO6A 1LSOA 4BIMA 2V4ZA 2DLNA 3B1YA 4OQDA 1F0KA 3OQVA 1ZSYA 3PDHA 2JF0A 4MUHA 4WH0A 5ECGC