3PHQB

Crystal structure of s64-4 in complex with kdo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
213
Chain Sequence
EVMLVESGGGLVQPGGSLRLSCATSGFTFIDYYMSWVRQPPGKALEWLGFIRNKGNGYTTEYSTSVKRFTISRDNSAVYLQMNTLRAEDSATYYCARDIGYGNSPFAYWGQGTLVTVSAASITPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.
pubmed doi rcsb
molecule tags Carbohydrate-binding protein
molecule keywords S64-4 Fab (IgG1) light chain
total genus 41
structure length 213
sequence length 222
ec nomenclature
pdb deposition date 2010-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3phqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3phqB01
1G9NL 4WIQA 1HKFA 5I1KL 1A7RH 1N2RB 2GUOA 2NR6D 3O8XC 1MCWM 4RNRB 3T0WA 3VFRA 4CN4A 1EEQA 4YHOH 4R2GD 2NY6C 3DX7A 1R3JA 4Z77B 5J7CC 1CK0L 5E2VL 1TPXB 2DQJL 4YGVB 4X9GA 4DKFL 1T20B 4EQ3A 3WIIL 1KG0B 3S96A 1JNHB 3DGGB 3ZDZE 3SDCB 2DB8A 3UYOD 4P9HC 2I60H 3DIFA 3VA6A 1UKTA 3QDAA 1H15B 5F21B 4Q9QH 1WFUA 1LEIA 4NQDA 4ZUUA 1CL7L 1OAKL 3HMXL 1DLHB 2M1KA 3R1GH 5E2TL 4X8JA 3SDYL 1UM6H 2P5EA 1AXTH 2P8LA 1KFAH 3MZGB 4QNPF 3MV9B 3V6OE 1EBAA 4PRAA 2ZUUA 1R24A 3EO9H 2VDPH 1HHGA 4W4OC 1YNTB 3ARVA 3TNNA 4H0IA 3MLPA 1LWRA 5SX4I 4WHTA 2VXTL 1C12A 5JPNA 5HSFA 5D1ZC 3WUZA 3KYNB 4ODXA 2FEEI 2YK1L 3RX7A 1DQTA 3SDAC 4WU5B 5FM4A 3X3GL 1NFDF 3E3QE 1KNOA 1CGSL 5D7IE 3P9MA 4C56E 4AYFA 5FK9A 3IDJB 4N8VG 1P7KB 3MRDB 3VI4F 15C8L 1WBZA 4MB5A 4QGYA 4IJ3B 4YIQA 3OB0H 3DI3B 3O6KH 4I1NB 3T0EE 1AO7A 1HIMH 5INDB 4ETQA 4WUUE 3IVKA 3VFVA 5DEGA 4UDTB 4ODWB 3HAEB 2Q8BL 2BSTA 1ZV5A 1JRHH 3PXHA 1GGCH 4G9DA 1VADA 1RJYB 5FO9B 3IT8D 7FABH 3VXRB 1CXLA 3PHSA 1MAKA 3L3GA 4P4RB 4PR5B 5FYKL 1S5IH 2HN7B 3X14B 3VWJC 3VH8A 4HG4K 1RUQH 3NCBB 5L9DL 4Y1AA 1TTFA 2V2TB 2OSLA 3C8KA 3RVVD 4KDVA 3B5HA 4QHLA 1GSMA 2C4XA 2BDNH 1D5BB 1NAML 3R8BB 5HY9A 4NC2B 1BZ7B 4OV5A 1WFOA 3IS1X 2GAZA 4NFCA 2R23B 4L4TE 2CK2A 5EU3A 3EOBA 4H5SB 4HIXH 3STLB 1XZ0A 4LCIL 3PV6A 4RGOL 1R24B 1NC2A 4Z7QE 2DWEA 3CX5K 2AJSL 2HH0L 3E6HA 4R8WH 5MENB 4LEXH 1DUYB 1LEGA 1CICD 1E4JA 1V3JA 3MR9A 2E7LA 2D0HA 2QL1A 4TOYH 4P4KB 4FQCL 4TVPL 4Z7WF 4MWFA 4XPAL 1YYLL 1GL4B 3CMOH 1MF2H 4D8PA 3ZYOA 1WQVT 2I07B 2DL2A 5FHBL 3SDDA 3S36L 4OLUH 1KN4L 4RAVA 5FOBA 4NUGL 1M05B 4XC1H 2CDGA 5ISZA 4RFNB 3EOAB 2MQ0A 4D0BA 3BKYH 5DMJB 2B1AH 2DDQL 1NBVL 3RGVC 1LD9A 3CX5J 4QRPE 4P5TB 4ZXBA 2D7MA 5IGXH 1O7SA 2BNRE 2CJUL 2VMFA 1EZVX 1ZE3C 2MHAB 2QEJA 5DI8A 2MKLC 2IMNA 3C60B 1OAQL 2JJTC 4JFEB 4OF7A 1S7RB 3PWUB 4UINL 4OUUB 3OPZH 1N64L 4YNYA 1I8MB 1S9WB 2QR0B 1KCRL 4FQHB 4ZFZA 5L88H 3FQWA 5CBEB 2AABH 4UNVA 3HHRB 2Z4QA 5D96C 1DTUA 3BKJL 1J10A 5B39G 3CH8A 4QHMB 2A9ML 3C8HA 2XNAB 1ZT4B 4KJQC 1U93A 3IB4A 3O2WH 5JXED 3H9SA 4WU5A 4GKOA 2BX5A 1DCLA 2VUOA 3LHPL 1CQYA 5C0BE 5EU7C 3CD4A 4PRPE 4AMKH 4OCMC 5C08B 3MOBL 3VWKB 2ICES 3BP4B 5E1AB 4LVOB 4JO1L 4HHAB 1T22B 4XTRC 4ZUWB 1V8HA 3S5LG 4AL8H 3SOBL 2VZSA 1P4LA 3F7VA 1NGWB 3IU3A 4JRYD 5TQ2L 1JGEB 3BKYL 1RV6X 4R97B 1I9IL 3PF2A 4I3SL 5KSVB 3VXSE 1HDMA 1MFEL 4JFFB 1UADC 3ULVL 3G5ZB 5E9DB 1WUNT 1IGTB 3G6JF 5TDPA 1OLZA 3WD5H 3RKDC 1JMXA 1GC1H 4X6CE 5F7WC 4HIIB 2PYEE 3GSQB 4XMLH 1X5IA 4Z7OE 4U3CA 2ZPKL 4GRWF 5HDLA 1FO0H 2W59A 4L8BB 1GGBL 4PJDE 3IFLH 3PHQB 4P23B 3LN4A 1H5BA 4YHYB 4G43A 3MRIB 4K3EH 1HXMA 5J06A 3SDAB 3VFUA 5H37H 2MMXA 3EKCA 3RI5K 2A1WL 1RZ7H 3QNZA 3TBTB 3VFPB 2IH1A 2P8LB 2P8PB 3GSNH 4DGIH 3EJYC 4RNRA 1WTLA 1S7TA 3B9KB 2IADA 4PRHA 1D6EB 2GSIB 4JFDE 1VCAA 2E8ZA 2EYTB 5F7NC 5J1SC 2E7MA 3KWWA 3OV6A 5I1IL 3I2CL 3DGGA 1F6AB 4BELD 5L2KD 2N1KA 1Y0LB 5CLTA 5DJAA 3IDXL 5CJOL 3MGOB 3IKCB 5EIIA 1NMBL 4OSUH 4AQ1B 4FXGB 1Q9LB 2VQUA 1NBZA 2J88H 3MBEB 3ARWA 1MVUB 5J11C 1KXTB 4M7KL 2A83A 3PIQB 4WU7A 5C07E 5GZOC 2PR4L 2O61B 3IFOA 5C0FB 3TVMD 1KTLB 4FOMA 2OR8A 3L9RB 1DQJB 5GQBA 3TO4D 4ZDHA 1NBYB 4GBXD 1X5LA 3O6KL 4HZLB 3SE8H 4HCRH 1P4IH 4L9DA 1VENA 2NTSP 3PWNA 2KBGA 4OF5A 4HX1B 4LOUC 2NMSA 2R15A 4P2RA 5CGYC 3H9HA 1A21A 3MXVH 2MSPA 2ZUQC 5DRZA 1KACB 5KSBF 5ERWB 3RVTD 2GI7A 5B38B 2ZJSH 1OY3B 4NT6A 3OB0K 1A7OL 5E6ID 2X4SB 3BEVB 1OTUD 1PZUB 1MQ8A 1OPGL 3CSYB 3TNMB 4YNYB 3T2PA 1RUPL 4RQQA 2VAAA 3CX2A 3P9MB 4KKBC 4QY8A 1CICC 5D7JD 2A74B 1FFPB 5IMKB 2VABB 4KAQL 4YR6A 1FNEA 3QUKB 3O8XD 1ITBB 3UP1A 1OVZA 2E8YA 2C26A 4JFHE 4MNGE 4P2QA 1MHHB 2EDHA 2F8OA 3VCLB 2P8PA 5CUSH 4JAMA 3CC5B 4ZXBC 3ULVC 1GYAA 2AW2A 1G7JA 1LILA 5ALCH 1NC4A 5J12B 5DLMH 2HTKC 3WJJA 2VC2L 3HNTH 1RIUH 3BPNC 4WHYG 1ZT1A 4U1SB 1BECA 5D9SB 3HMWH 2BZDA 2QSVA 3QUXC 4OFIA 4GFTB 3NIFF 1AKJA 4WCYH 2Z35A 4QHLB 4I4WB 4LLDB 5SWSA 3PABB 3G6JB 1Q9LA 1A6VH 4PJEE 1WWBX 2HKHH 4WV1B 4U1MB 1BVLA 4R4NC 2VLJB 1NCDL 4Y4HC 4LGRB 2RB8A 2R4RL 3NH7H 3PQYB 3TA3C 2EDNA 2H32A 1EAPA 1A1OA 4KVNL 2PNDA 3NCMA 4F8TA 2X4RA 3QULA 4G80B 4HD9A 3EDDA 4JG0H 4M6AA 2NX5A 1NC2B 1D5XB 4PJGE 4LK4A 1A4JB 5E2VH 3D2UA 1MOEA 3LRGA 4WWKB 2AAVA 3A6OA 4LLVA 4OZFG 1HWHB 5B3JF 4GQ9H 3FO9B 1N3NB 4AT6A 4PGDA 1N59A 4WJ5B 4M1GL 2IALB 5HDOA 4PP1C 3W2DL 3EOYG 1AHWB 1QYGL 2OR9H 4MLIA 4DGYL 5DUBB 1MJJA 5AAWA 1YQVH 3UCRA 5IB4B 3ROOA 1GOHA 3EO1B 3MREB 3KR3H 5L7XL 4UINH 5D2LA 2PYFA 3Q6GH 4ODTL 2QADD 4QHNA 3O2DH 4U6VH 1MCKA 2VDOL 4LLWA 3TBSA 1A6WH 3SCMA 3STZB 1RUMH 4MJ4A 2NR6C 3FO2B 5TF1L 3M17A 1MH5A 4F3FB 1G7JB 2CKBB 5FGBA 1OWWA 4EI5B 4HMEA 4AEFA 1YEFL 1WCBB 3GMMB 3OAUH 2DQTL 3LB6C 5EC2A 4KI1A 4P46D 4G8IB 4QTIL 4YDIL 2X4QB 3V9FA 2BVEA 2YOCA 4EI5C 1D6VH 5DWUL 1BWWA 4NWUH 4MDIB 4QRPB 1JWUB 4NOFA 1A9BB 4MCYA 3RKPA 4XPHH 4TVPE 1GRWA 3UMTA 2X41A 3WDJA 2VDQH 3O9WC 4U6HB 4R9HA 3MZTA 2EDEA 1FL6B 5E7FA 2FH6A 2HAZA 2YPLB 1MEXH 1W8OA 4OM1L 4CNIB 1FBIH 1C08A 1UJ3C 1MCPH 5EPMB 1IM3B 1EDQA 2ZPKH 1NKOA 4M4RA 3W39B 2XG4A 5EFIA 1DN0B 1QQDB 2NXZB 5E6ZA 5HJ3B 4Z5RB 5L9DH 2VLLA 2GSGA 5FCUH 4Y0GA 4QRTA 4QXTA 4L3ED 3QDMB 2ADIA 5EOCH 4P99A 2BDNL 1GGUA 4M8QB 3WFDL 5KG9A 5CHNB 4MQ7A 1GIGL 3LSOB 5J56B 1IBGH 1TZHB 4NM8H 3UBXI 1BD2A 1I3RA 4ORZC 4H26A 3RWJA 1ZAGA 2V5YA 3BESR 4PJXA 4LCIH 3QEGL 4JJHA 2NY7H 3IDNA 4YDVA 5JIPA 2F53D 4JM4L 1S8DA 2QV2A 4QOKB 2CDFB 3ULSB 1KTDB 1MRCH 3QNZB 3QUXB 3ARDA 1T89C 4PY8I 1MFDH 2DQGH 1JF1A 5H37G 3QJFA 3STLA 3U79A 3D85A 4YQXH 3F7YB 3C8DA 1P7QD 2HJFB 5CEYA 4Z6AT 2EDQA 4PJAA 5C3TA 3VFNB 2HFFA 1KCUH 3U7YL 1KCVH 3P9LA 1K85A 1L0XA 1X5FA 2IALA 3BEVA 5EOQL 2BSSA 3DVGA 3HNSH 1FN4B 1FV1A 1D5MB 5HHME 5TPWH 4J3SA 5IT2L 4I48B 5E8OA 1IBGL 2B1AL 2DDQH 4ETYA 3WS6C 1LP9F 4XPFH 3LKSB 4PJBE 4WGVB 4Z7OF 4NHUB 2RJMA 2YD2A 2MQCA 3S88L 2F5AH 5FV2A 3X12A 2VZUA 3G6JE 1IAIM 2OTWB 2AGJH 4YXHH 3IVKB 5I71B 2O5XH 1NDMA 2DKUA 4NRYB 1ACYL 3MGAA 4WWKD 1W72L 5F7EL 2VLRB 3MACH 5GGRB 1UCBL 2IC2A 4MX7A 1L4IA 3KPQA 1U92A 1A7BA 2B7DT 2AK4A 4YHIA 3TYFA 4HJJL 5T1KA 4LDOB 4XI5C 3VMOA 2NPLX 1G7QA 3OKOB 3KPRE 1LEKA 4L3CA 4ISVB 2QR0A 3NCEB 5I2IB 3HRZB 3MOBH 4KUZL 1AJ7H 4PBXA 4BKLA 2DI9A 2D7NA 2XWTA 1G1CA 5HI4D 4AL8L 3U46A 4RBPH 2AEIT 1SM3L 3HPLB 1F2QA 3QWOA 2G60L 5E94A 4YWGL 3TJHC 4XWOD 4J6RL 3V5KA 2CLZB 2YN5A 3SKNB 4BA8A 2QKIB 1VACB 2RR3A 1E6JL 1EEUA 4UU9B 1H3PL 4EOWL 2NX5B 3MV7E 1QRNB 2YRPA 4QNPE 1EX0A 2GTZB 3D18B 1CLZH 4PLJD 5ESQB 3TBWB 4CJ1A 1HWGB 4NIKB 2QSCH 4WY7H 4JHAH 1KPUA 1MFNA 5D1ZD 5IEHB 3CDFA 1S7UB 1GGBH 5BS0D 2J8HA 3KPSA 1U8KB 4P23C 3QXAB 3LKSA 3MUY1 3CLFL 4Y89A 4LEOB 2IAMC 4H26B 4RISH 4HWBH 3TO4A 3BD4A 1KG0A 5HYJD 3P0YH 3IU4H 4Y2DB 5DUML 5E2UH 2V17H 3SDDC 3ARED 3LS5L 2X9WA 2LQRA 3TH4T 4JM2F 3GNML 2EZ0C 1SMOA 4F3FA 1CFTB 1JV5B 3U4BL 3BFOA 2GJJA 4O4YL 1INQA 1QNZL 1TVBA 3BRGC 3LKOA 1LP9E 1S8DB 1HXMB 1S7VA 1XCTA 5H8DA 5E5RB 1WCBA 3I2CH 3U36A 4NKMA 3NGBC 4XP1L 5D70H 3EIFA 4JHWH 1A7RL 1J0IA 3C6LD 3TV3H 1ZA6A 4ZFOL 4ZNCD 1QPPA 2XRAL 1Z9MA 2IBBA 3S98A 1F02I 3RJDA 3VXPA 4BKLB 35C8H 1F42A 5CCKH 2QLVB 3KJ4B 4JHAL 1JIBA 4AEHL 2JB5L 1FYTA 3EFFA 3G5XB 1HZHL 3TZVD 4JLRA 5DK3A 2JCCB 2VDMH 5ID0A 3R0NA 5L2KB 1R3IL 4OCYL 1P84K 3QQ9D 3BZ4A 5FKPA 1M6OA 5I9QB 3RFZC 4Q9QL 2FNBA 4ZAKD 5C0GB 5CD5C 3PWPB 5BW7A 4NJAH 1D5ZA 3AREB 3I50L 2O61A 5E2TH 2UZXB 4ZFFA 1NCTA 1DP0A 3F7VB 3NACH 3ULUD 3AS3A 2VJXA 3B9KD 3QJHB 3SE4A 2CO7B 3T4YB 4UDTA 3WXVL 4JRXE 1MIML 4HFWA 3VGAC 4E41B 3VD4A 1ZLWH 2Y25A 5GJSL 4UTAL 3P4LA 2HVJA 5EOCL 4NKIL 1AGDB 4LEOA 1U2HA 1K3IA 3DX8A 43C9B 1EJ6A 4ZFGL 2CRIA 4N8PA 4U6HA 5F1IB 4M03A 3RRQA 5J1TC 1IVLA 3DVNB 5KSBB 1IGCH 1LVEA 2AJYH 3FT4B 1I8LC 3CCHB 3TNMA 1QTYT 2BC4A 3KNBB 2K9UA 4WW2B 5ANME 5HGBA 4PJAE 1IC7H 4GXVH 2DAVA 4Y19B 4NZRH 1U41A 5CINL 4KZEL 4TNWF 5HHXH 1HIML 2RGSA 5E6IC 3TN0A 1HHHB 3M45A 3DMMD 4IOFC 4GW1B 2O5YL 5HGAA 4ZMAT 4HC1L 3WJLA 3I3BA 4RCAA 1WZMA 3OJDA 5D7LA 3ZE1F 1FAIL 4FRWA 3N06B 1I8KA 4Z76B 1M7XA 1ZLSH 4OLWH 2DLEA 3JWDH 2X4OA 1OTTD 2M2DA 1DVFA 1KJ3L 5BJTA 3SDCA 2EKJA 4ZXBD 1MFBL 2D9CA 4NSKB 1S7XA 5J12C 4I4WA 5DT1L 5H94B 3TCLA 3SN6N 3BPLB 3FJTA 3CAFA 4ACPA 5GZNC 3VH8G 1PVHA 4PIRF 1ZVHA 4UOJA 2WWKO 1JUFB 2AJYL 4CVWA 3HCVA 2DQIL 3I6GB 3SGEH 5D2NC 1HN1A 1VA9A 1KJ2H 3UAJC 3V4UL 3QULB 2DLIA 4K7FB 4RGOH 1OTSC 4L3EA 4G8GB 1JPFB 4I0KA 4MYWB 4P59H 5IIEA 3AROA 3L5HA 1MREH 1RSFA 4NZUL 1LP9A 1C7TA 1T83C 1U0QA 2VDOH 4JRXA 4BQ8A 5ICXA 1MCOH 4OKVB 4X5WA 1BQHG 4KRPD 4ODVH 1NEZG 2K7PA 1BEYL 5CLWA 1UB5A 4GSDH 1NMAL 1K3ZA 1SBSL 5I1CH 3V95A 2CH8A 4S1RL 4DJMA 2W65B 1QSFA 1ZLSL 3EOTH 2OJEA 3DETC 4H1LA 1M71A 4MDJA 1A6TA 2Z31B 5J4MA 2XNAA 3VXUE 4JM2B 5B8CB 4LSVL 1B2WH 5KVMC 1S7TB 1FNHA 3B9KA 1CDYA 1NQBA 4XNXL 5I76B 3S34H 4WVRA 4HUNB 4KQ3H 5TGBB 5FM8A 4FTVE 5B3JE 3V6ZB 4ZOAA 4HUWB 3MRCA 1XR8B 1S3KL 2CJUH 5DHVH 2A9NL 4TSCL 3K4DA 5CJXC 5DQJB 1WICA 1N4XH 4ZUVA 2B5IB 3ES6A 4TNVK 5HDBE 3RL2A 5GSVA 3HZYA 1AKJB 1IC1A 1JRHI 1N0XH 1S7UA 5DD5L 2Q87A 4G9FA 5GGVY 2W07A 5DEFA 3IKCA 1HDMB 1QHOA 5L88L 3S7GA 4KV5E 1CGWA 3TYGL 1FZOB 1P53A 3KPMA 4PJ5A 2HVJB 1G7HB 3RUGF 3SQOL 1GH7A 4RFOH 3VRIA 5DMGC 1CD9B 3RVUD 1T7WA 5E6IA 2OI9B 1NDGA 2P7TA 2ZWLT 5HDQL 4OFKA 4LHUG 3EYSH 5C9JA 5I1CL 3O2WL 4K23L 4DUWA 1AR1D 1PD6A 1QFWM 5C3LD 4P4KD 4CNIA 2LABA 1QFUH 4S0TD 1S7SB 4R4FH 2C3HA 1INQB 1TVBB 3QXVA 1T04A 2D0GA 4DTGH 2DOCA 4UT9L 4YDJA 2CPCA 3SBWC 3F6IA 4LU5H 2NX5E 2BMKA 2FBJH 2GJ6A 1IAOA 3S4SG 1NGZA 4LSRL 4OJFH 4XNQA 1TJGL 3LS4H 2G5BA 2R29H 1A5FH 3DVIA 1MFDL 2DQGL 5HYSG 2KUTA 1XGTA 3HC3H 4NHCL 1JNHA 4LHUA 1VFOA 5IV2A 1E27A 3IDNB 3L95A 3MLRL 2XN9E 2QQQA 1YNKH 4D0BB 2VZOA 3FOMA 4DK3A 2V7NB 4KROC 5DGRA 4HGWB 5DSCA 4IIQA 5LKNA 1AGBB 4ZUUB 1KCUL 2VR9A 1HH6A 2YRLA 4K23H 4A2LA 4KGLA 4NKOA 2LTQC 5D2LF 3HNSL 4PFEA 1KN2L 5CJXA 1FNSH 3DARA 3MJ7B 4HK0A 1YNTA 1DEDA 5GGSA 1LNUB 3NTCH 1G7HA 2F5AL 1I1CA 1H3VA 3EDEA 1MAJA 2X1WL 3ORJA 1Z3GH 4NNPH 4ONHA 3L3HA 1N5YH 3BAEL 2JTDA 3QQ4A 4YXHL 5HI5C 1QLRB 1EO7A 5JNYB 4JQVC 4JPKL 4P5TC 1DBJL 3LZFH 1WAAA 1G84A 3BW9B 3MV8A 1ED3B 3ZE0E 5DFVD 1S7WB 3D2UD 4GKZA 2ZUWA 1BJ1J 4X4MA 5GGTA 5J1AA 4HDIA 3QPQC 4L29B 3F65A 4R26H 3QHZH 1LGVA 4HS8L 3DX6A 4HKXB 4WWKA 4P2QB 1WEJH 3MRJB 3ZDXE 1EO8H 5BMFH 1RUKL 4X0KA 2Z93B 4MJ2A 5IB4A 3MLXH 2VWEC 4JRWA 5MP6H 4V1DE 4U1JA 2VDKH 1S9KC 1DEEA 5D7LB 3HLAA 2DICA 4R4BA 1O5DT 1T20A 4TUKH 4UT6H 4UAOB 2QJDA 5FEBA 2YEZA 4PJXB 4GJTB 1LO4H 5DJ6B 4P5KB 2E27H 4PG2C 2OSLB 5FCSH 2XFXB 1MCNA 3B43A 3FN3A 4HPYH 4TTDC 1YEDB 4ERSH 1EMTL 1NCWH 3QHFL 5I8CA 3T1FA 4UI2A 4Y19A 2F8VA 4R97C 5CZVH 1YC7A 4X8JB 1QO3B 4DN4H 2B4CL 3HR5B 1INDL 1DBJH 4ZUTB 2EXYC 4M5YL 1CDHA 2YPKA 3U1SL 3C08H 3UTSA 2VXUL 2BVPA 5EO9A 3QCTL 4CVXB 2ARJQ 3DGCR 4Y19E 2NY2B 2PN5A 3IRZA 3KJ6L 3VGEA 1GAFL 5LAXB 3WO3B 4PY8J 2MOVA 3W9DA 3KLAA 1T4KA 4WFHD 3DVGB 3LS5H 5BJTB 3CXDL 5T3XL 3VD7A 1CGYA 4ZQKB 2VDKL 2GJ6B 3NABH 2PXYC 4ZTPL 4G8FA 1M7DB 1KTRL 1PKQB 3ULVF 1OP5K 4K3DH 1JPST 4JRYB 2FJHB 4JDVA 4EN3B 4MD4A 5A3ID 3KPPA 4U7KA 5KVGH 1DQJA 2E27L 1A6TB 1BJMA 1HHKB 1K4DA 1BFVH 5IROC 2BSTB 1Z6JT 3BPLC 4KHXH 3DRQB 5GHWH 2OMBA 2W92A 3BEWA 4HXAL 4KHTL 4LP5A 4POYA 1S9VA 3N0PB 3NCJH 5F7KC 1ORQA 1LE5B 3NFNB 1G7MA 2ZSVA 2Q8AH 3W9EB 3ES6B 4ZD3L 4M1GH 5DJ6A 4FQLH 3Q5TA 1N4XL 5ENWA 4ISVA 4GW5A 2BNUA 2GIYA 1SQ2N 3FFDA 3DURA 3MRBA 5E03A 5TFSL 5D7SL 4OLZL 5C0DB 1TTGA 4KMLB 4L8DB 5I1LA 4AM0B 1U8IA 2DJSA 1MJUH 3RZCB 1A6AB 2FZ3B 4JM2D 3AU1A 2P42B 3BDBA 1R3HA 3LRSB 3UTSD 3F58L 4YH6A 3ARGB 1T83A 5J13B 3JSSA 5I1JL 5CJ8A 4MXVF 3WIIH 5EBWB 5ACZA 1QFOA 5DQDL 3PWPA 4LKXA 4UZGA 2ZUVA 1EPFA 3O3AB 3QIUB 1NCAL 1ZA3B 4WFFE 4DAGH 5GSVB 4WFGE 1BMGA 2VZ3A 3VXUB 3PGCB 4TPRL 3X13B 1CTOA 5F7YC 5GZND 3CFCL 1RZKC 3WIFA 4XC3H 1G9ML 1MCWW 3ELAT 5DXWA 4LSPL 4ZAKC 4GO6B 4O2EB 1NLDH 1JTPA 3O8XB 3RIAK 32C2A 4KH2A 1JF5A 2VAJA 5TDPB 1TZGH 2AK4E 3G5YB 3D3VD 4LSRH 3U7AA 2R1XB 5IOPB 4W68A 2WQ8A 3L95B 3MRMA 3WJLC 5EA0H 3S97C 1J1PL 1QEWA 2BSED 3V5HB 5B3NA 3QFDB 3LKOB 3OXSA 3K4AA 3PL6A 3QXWA 4I3GA 2N4IA 3C9NA 1KJMA 4JVUA 2JELH 1MRFH 1CFVL 5TDOA 3K2UH 1MY5A 1TVHA 1N3NA 4LPXA 1X5JA 3K8MA 4FQ2H 1KEGH 1RVFL 1C1EL 4FQ1H 1CDCA 3WCYA 1JHLH 1AD9B 4K7PX 4JDZA 1CU4L 4OD3L 1UVQA 5DJ0A 5JPMB 2DTMH 4CVXA 1BIHA 3L3IB 1RUAL 1GIGH 4Y5VA 2AI0L 4D0DA 1LNUA 1L9NA 3GJFK 4NPYA 5JW4M 3WXWH 1CXFA 1T5WA 2J8UA 5DRWA 1TDQA 1DBBH 4GRWE 3NCCB 3QO0A 2APWA 4X98A 4YHZH 4JLRB 5CSGA 5DHYA 3QG7L 4CAGA 2AKRA 5GGTH 2EDRA 5TH2A 2EKSB 3I85A 4D9QD 2J6EL 1DSFH 1QUNA 1M6OB 5ACZB 4KK5C 1XGYH 1RY7B 5E8DL 2VR4A 3D5OF 5D7LD 1UH3A 3MLUL 3VXRE 5L8LB 3CIQA 3GFUA 1UWGL 2P44B 3VFTB 2KDGA 1YMMD 4PJHB 3FOLA 2W0LA 4OIIL 1RZ8A 3HC4H 3WIFB 5C0EB 2OBGA 1QBML 1IKFH 1CLOH 3FRPG 3O41B 2Y7QA 4P2QD 3U0TA 3UJIL 4KXZI 2CRZA 2W60B 2X1PA 1CDJA 3O8XA 3TT1L 5D6DC 5D7JB 3IDGA 1IC4L 2DQCH 3MCKB 1TCRA 2X6MA 4FABH 5IB2B 1KXVC 3BDXA 1CFNB 4LRIC 3O6MH 1YQ2A 4JQXA 1GPOH 1MLCA 2RBLA 2GITB 4QY8B 4N0CD 3UYPA 3AB0B 4JR9L 5D71H 2EECA 4DFHA 1A1MB 3C9NB 4HPYL 3C2AH 3DUUB 5IFHH 3NFPA 4Y4FD 4QXUL 2WIMA 4DZBB 4WW1A 5EU3B 3HR5A 2B0SH 2X4UB 4ZOBA 1U3JA 1A2YA 5CEZE 1MHCA 3GMQB 1H5BC 1SEQH 2DLFL 3TYGH 3B5GA 1ADQA 1C5BH 3QCUL 3FTGB 1T2QH 4MAYA 5DRNB 3O11A 1LO2L 5K33A 3FCTA 3OAYK 1F3DJ 2RQ8A 1JK8B 2ZCHL 4OIIH 1GCFA 5D9SA 3W9DB 5JHLL 4CVZB 3TO4C 4HXBL 2F19H 3ARDC 2BFVH 2JCCE 4D9LH 2R69H 3OJVC 3VDCA 4M8VA 1JCKA 1FPTL 4FQJH 3TLRA 1MELA 3GBNH 2YUWA 3VXNB 1Q9KA 2CIKA 4L4VA 5D7LE 3P4MB 2CDFA 3ULSA 4F7TA 1RHFA 1YMMA 3IDIB 3OXRA 4YK4C 4ZFFB 1KCRH 3F7QA 2OL3B 3LEXA 1BFTA 2IPTH 3QJFB 3FT2B 4PRHD 3QCVH 1KJ2B 1D5XA 4LAJH 1IEBB 3DXAD 3MRKB 4M7JL 3PL6B 3WFHA 1HEZB 3HS0B 4E0RA 3EDJA 3ECBA 1RMFL 4FFZL 2ZKHL 3VW3L 2CRYA 3ZYIA 1L7IH 4LCCC 3GJFB 1A02N 4KKAD 3CFJA 1T1XA 2NY3C 1U3HD 3QWRD 4X6BA 2NXYC 5GS1A 5ANMB 1CGUA 5E9DD 3CUPB 1I9IH 1MCIA 5MHSD 2RIKA 5F3HB 9CGTA 5TFSH 4P46B 4PJDF 1U95A 4J4PC 4OLZH 4AIZA 4IRJA 3V6FB 4DZBA 4TULH 4C56A 2JK5A 4OKDA 5GS0D 2V17L 4PJFB 2YN3A 1MCBA 1UQSB 1MHCB 2BHUA 2O93L 1UKSA 1GC1L 1X5HA 1QP1A 1OHQA 4JFFE 5C08A 3QUYA 4S1SH 4JFXA 1E4WH 5EUOF 1DLHA 2OZ4H 4X4ZA 5ESVB 3CFDB 5J3HD 3NBNA 3BX7C 5T1KB 4YO0A 3DV4A 12E8H 4NQSA 1NFDA 1DVFB 5TJWK 2DIJA 1U8JB 2YR3A 4OGAC 4LLDA 2WBJB 4LIQE 2XTJE 1YDPB 4N0UB 5C0DA 5I1LB 2CD0A 2F74B 4JFPB 4PJ8A 1C12B 5BQ7B 1QFPA 1CE1H 1WC7B 4OFYD 5EU5A 1UENA 5HPMA 3P77B 4Y4FA 4U1HA 3D0VB 1KPRB 3ZHKA 4K7FA 2YPVL 3WE6A 5KS9E 1PW3A 3H9ZA 5J0BA 2FL5B 3GMOB 4RX4D 1JE6A 3LKNA 1CICB 4HLZG 3D2UB 3WNKA 1WBZB 5IBLC 4LEXL 2LAAA 5IW1A 3D6GA 3I50H 1Z5LB 4Q7DA 3SGDI 3CU7A 5IJVA 3OF6A 5K9JL 4LCWB 2D7OA 5JZ7C 4QF1A 1CF8H 1LO4L 3QUML 3D69B 3PGCA 1FSKC 4LPWA 1Q0XL 1CR9L 4PGCB 8FABA 4J1UB 2XQYK 4HJGA 1UWEH 3O4LA 4MVBC 1BAFH 2EYSA 5A3IC 3TPKA 1NGZB 4LRNL 4XMKH 5DJ0B 5JPMA 3GBML 4MS8D 4CUCA 3HI1A 3SDAD 1LHZA 4N68A 4GAYA 5KN5A 1MJ8H 3NPSC 1OL0A 4MHHI 2W1NA 4Y1AB 3DRTB 1ZHLB 5DUPH 3T3ME 2YWYA 4O2CA 4QWWD 3RY4A 3QG6B 3LN5A 5TGBA 4GXUN 2AJUH 4N0FB 1S9XA 1JHTB 1S7VB 1BZ7A 4HK3J 1DSFL 4XVUC 4XCNB 2L7JA 1JUFA 5C0FA 3QUXA 3OTTA 4PGZA 4RSVA 1IGYA 4YZFE 4PJIA 4OCXL 3JV4A 3UDWC 4C4KT 2WWMC 1FVDB 3MA7A 4XWGL 1KB9K 3KG5A 2DKMA 4X6CB 3FQWB 4P2YA 1M7IB 4Z0BH 5CEYB 5FO8A 1AHWC 1LK3L 5JDSA 1Q9OA 3GUTB 5BS0A 4WHTB 4DOHB 3QEUA 1CR9H 1YECL 5E6IB 3UEZA 4XZUB 2X4NB 3BP5A 2W9EH 4QRUB 3EDKA 4IRSA 3KYNA 4ODXB 1DFBH 1XF2A 2IPKA 5IEKA 4I48A 1BLNB 2HMID 3N9GH 4BQ9A 3T2QA 1KELH 1CICA 4W4OA 4I3RH 2QHRL 2NY0D 4K8RL 2EO1A 2FGZA 4HUXA 1U8NA 3LQMA 3ZKXB 4Z7UE 5SX5K 5HVHC 4HQQL 3VCLA 4ETQB 5LCVH 1P9MA 3SDXA 4CMMB 3UZVB 1NANH 2EIEA 4WV1C 2COQA 4KK9D 3ULVH 2JIXD 4PJGF 3KPOA 1LDPL 4YHKL 5EO0B 3VD3A 5GGRA 3SE4C 4QHUB 43C9A 1I1FA 4DW2L 4PBVC 4J3XA 1FO0L 1NAMH 5DFWH 3RHWK 4GSDL 1A7NH 1OARH 3RWDA 3MRFB 5E56A 3PP4H 2J3SA 4TN9A 3RVWD 2CIKB 4M6OH 4KJWC 4M48L 4OLEA 4PY7B 1XF3A 5D7IF 3KPRA 2OP4L 4PJXF 3T08A 1F90H 5HPMB 1KLGA 4HS6B 4DZ8B 4NO5A 3SKNA 1L9MA 5T33H 1KELL 3U48A 3S34L 1NAKL 3LKNB 4WFEE 4B0MM 1UB6A 1YPZE 4Y4KA 5JW3H 4P2RE 4MAYB 5DRNA 2BNQE 5EN2B 1JL8A 3TO2B 1FQ9C 4CU6A 1XEDA 4HWZB 2J2ZA 5FGSA 3QIUA 3AY4A 4NDMB 4KGJA 3WKML 1NMBH 1G9NH 2BSSB 3H9SE 1Y0LA 5DFTA 4J1UA 3UTZB 2Z8RA 2DQTH 5HYJB 3MCG1 4OLUL 2LAGB 3TJEH 4KQ4L 3ZT6A 4BYHA 4LAQL 1BWMA 3K2UL 2A6IB 3OKMA 2XTJB 2L0DA 3LMJH 4C56B 3O6FD 4XI5D 1NBVH 4UTBH 2BXZA 4LMQI 1NBYA 4BQCA 1JPGA 1YY8A 2DQDH 5IOPA 1EBPA 2UZYB 1BQUA 4M48H 4OLVL 3NA9H 2HLFD 3OXSB 4OZGF 1ORSB 4FZ8H 3SDAA 5A2FA 1F90L 3R1GL 3O2VL 3HAEH 1C16B 4YJZL 4RGNC 5E7BA 3V5DA 4KK6C 4NRZA 3T09A 3TESA 2Y07L 4K9EC 4RAHA 2GCYB 1F4HA 1AD9A 1ZK9A 1PYWB 4TTDD 3GSUA 3AM8A 2PCPA 3L5XH 1V7MH 4O9HL 1P69B 3Q2CA 1F58L 3W0WB 1WAAE 4Z78B 4XNYH 4N9GA 1JGLL 4XNMA 2FLBT 3DMMB 3P0VH 5KS9F 3BGMB 3H0TA 1F6AA 3O3BB 4G5ZL 4MAUL 1A6ZA 2V7HB 5C0IB 3K8LA 1CE1L 4KRMB 5J1AB 3MFGB 2R1WA 3SOBH 1DDHB 4G6AC 4LKXB 1CGSH 3BIBX 3L5JA 1W2KT 2BVQB 4QCIA 2EE9A 5AD0A 3ESUF 4K3HA 1T1WA 1TXKA 2IH3A 2NY7L 4FFWD 5CBAA 3QA3A 4E41D 1J0HA 1IC4H 4PGJA 3FQUB 3QXDB 4FN0A 2XWJB 4JM4H 4MA1C 5MENE 2HKHL 4JZNA 3V4PH 5TE7L 3KLHC 1GGIL 1RULH 4EUPG 5CAYB 1GOFA 1JWMB 1DQDH 1UXWA 3A67H 4KFZC 3ULUL 2R2CA 3JTSB 4YFLF 1FJ1B 2WM0A 1IL1A 4V1DD 5DK2A 1EHLH 4I8DA 2ADGB 1A3LH 1A14L 4B7IA 4J3WA 3FN9A 4HUMB 5D1QA 3P73B 4K3EL 5IB5A 5JIHA 2XFXA 4IRJD 4L4TD 2ILLA 5KJRL 1CFTA 1JV5A 2A6JA 3WS6A 2E7CA 2X42A 3GJEA 3K0WA 3UPCA 1OT1A 4KKAC 4P5TA 4NZJA 5IB3B 5A16B 4MXWH 4XBGA 3V0WH 3X17A 4NRZB 1CFSB 3SCMD 3BUYB 2ITCB 4LOUD 3VXOA 1OSZB 4WRLA 1HYSD 3JV4B 4R96B 3VG9C 3X3FH 1HKLL 1PG7H 1IAOB 3GK8H 5JXAH 5CD5D 2R0LH 5GS0C 4W6WB 4L8DA 3FCTB 3TGXA 2X44D 4BSVA 4TUKL 3KWWB 3SGKC 5GGQL 5E08L 2IAMB 2YHGA 1D9KB 2LU3A 1W72H 5F7EH 2PTTB 3CMOL 3TBYB 4TOYL 5IW3A 3QXUA 1E28B 1TZIA 2R2BB 3IJSA 5E4EC 5FHBH 4RFNC 4XP5H 4QRRA 1MPAL 4PRID 1DBMH 5FGCE 2EDJA 4EN3A 4NQXA 3DROA 2X4PB 3T77A 1WBXA 3MLZL 3IFOB 1U8NB 3TEUA 4K9EH 2O26U 4G9FD 3RHWF 4LLYB 4AQOA 5K9KA 1VGEH 4XC1L 43CAA 1T21A 1ZGLA 3T8XA 4JFHD 5FO8B 2FJFA 3V0WL 2R56L 5ESAA 2HVKA 1JWUA 1Q0YL 1C16A 4GUPB 2H2PD 3ECBB 2WWKT 4PJGA 3V5DB 5C7XL 2V5TA 4ZYKA 2AK4B 3KYOA 3DVNA 1VFAB 3BH8B 2GCYA 3B5TA 4QOKE 5KVFH 5MEND 4JG1L 4P3WA 1FL5B 1LEKB 4Y4HD 3FQXA 1A6PA 1HINL 5GGUB 1IRAY 5FYJE 1RZGA 4KKLD 4NYLB 4YUEH 5MHSE 2NYYD 4MVBD 5CP3A 1G9NC 5E2WH 3MRJA 3VI3E 4JAMB 3M17B 1Y18B 4ZOCA 4AZ8A 1F3RB 5DQ9A 2X70A 3BJLA 4XP5L 4LLUB 3EZ8A 3ZKNC 1VEOA 3INUL 3CSPA 3QDGD 4FQPA 3ZZ1A 2QQNL 2C7UB 3NN8B 3QEQB 3LV3A 4OLXL 4NPYB 4HWZA 5JW3L 4YXKH 1CE6B 1CGXA 5FUZL 1YYMH 2Q8AL 3IDYC 2XWJA 4YEEA 4ZO7A 5LXGL 1NGXA 1QFHA 4XVUD 4IDJH 2WBJA 1U8QA 4HT1H 5T1MA 1IKNA 4LBEA 4LKCB 5I8CB 4FP8H 2OQJB 1XF3B 3CVHA 4X7EC 4F9PC 1JGDB 3ZDXF 4KRPC 3QI9D 4U1HB 4N1HB 1ZWIA 2FCBA 5JLZB 5BXFB 3IFLL 3D1MC 1JPFA 4Y4KC 1C08B 1E4XI 3DTXA 1AP2A 3H9YA 5CZXC 4L9LB 5C8JB 1AQKH 3OJMB 2A1WH 1U8MA 4TVSa 2BY3A 4GUPA 4OD2A 1R5VA 3HI5H 1VFUA 3EGSB 4DGYH 2HMIC 3BP7A 3GJFA 2OI9C 1FYTD 1GHFL 5FXCH 3RTQC 3VXOB 4I2XE 2Y1VA 4JB9H 3MUZ1 4H88H 3IETB 1G6RB 1FC1A 4MAYD 1MJJB 2WBJD 4RMQA 2R0KH 3MLYL 3WNMA 2Y6SC 1VHPA 1YN7A 2DJUA 3FQNB 1AIFA 3ALXA 4WFED 3O3BA 4KZDH 3F7RA 1NDMB 1Y18A 1A3QA 2NZ9D 1T66C 1J1PH 4JCMA 4ZFGH 2NY4B 4OSUL 1UCBH 1AGBA 4UB0L 3L3OB 3LN9A 2XTJC 1IGFH 4MQXC 1LK2B 5IVXA 2EEBA 1U2CA 1J1OH 3W81A 2XQBH 4G9FB 1FVDA 3MA7B 4NBZB 2AVGA 3MROA 3RA7H 1CDIA 2P24A 3GUTA 3NFSL 4EN3D 5C0AA 5LQBH 1GHFH 4CGTA 3AU1B 3QO1B 5I1EH 3MLTB 5LCVL 4J8RA 1I9JH 1NUNB 2XKNB 4D9QE 25C8H 1EHLL 2NY2C 5F1OB 5IB5B 1YA5A 4LP4A 4OLWL 4GKZB 4HDIB 3GIZH 2CR6A 3IAGC 3MRIA 1UXSB 4B5EA 5BVPL 5MENA 4JN1H 1QVOA 1BFSA 3ARFD 4FMFA 4UILL 1UFUA 1KB5A 5DVKA 4EXKA 4XH2A 3T2NL 2D03L 5D5MA 4ZPTB 4NM8L 4HJGB 3PP4L 3AS1A 2YZ1A 2J4WL 2HKFL 4X6BB 2DQIH 4Y5YB 3HI1B 4HWBL 2XZQL 4PTUA 3RDTB 4P49A 5T1KD 3REVA 5F7FA 1U95B 3HNTL 1A9EA 4CDGC 2VL5B 4Z7VA 1UEMA 1IEHA 1QLEL 4UIKL 5E8PB 4RDQF 1EGJL 3EOAA 5J11B 1I9RL 4WDIB 4DKAA 5CS7A 5BZWA 1NBZB 1NCDH 5LBSH 5D7KD 5IFHL 1NANI 1DANU 3VI4E 4GRMB 3D3VA 3KPSD 1YJDC 4WWKC 2FIRT 1S5IL 1I3UA 3U7WH 1CGVA 5IMLA 1U8JA 4MNGB 1P1ZA 4L4TA 4XMLL 3FFCE 3L3IA 1T2QL 2P24B 5I75C 4JFPA 3VGFA 1JZ5A 1IAMA 5TPWL 4AENA 4XNXH 3L3HB 4X4YA 4KQ3L 5JHLH 3BDYH 1R3IH 4KVCH 5C0BD 3HZVA 3ZMRA 3H6JA 5C7XH 4U6TA 4HIXL 1EXUA 4TUJA 1RZ7L 2JB6A 2P5WE 4N1EA 5DZOA 5DJYA 4JFYB 2DMBA 4U3XA 4N9OB 2UZIH 4I0PA 4O02L 5JORB 2CUHA 5E1AA 5IW1B 4NQXB 4XPGL 4OZIE 1HYRC 2XZZA 1NLBL 5I8KH 2BRQA 4BQBA 4WTZA 3EFDL 1IQDB 4PRPA 1A6WL 1OB1A 1M05A 4PJFA 4FFVC 5D72H 1SYSA 5IR1B 3QNXA 2DM3A 4HUVB 3L5XL 2D7TL 4IOSD 1R3JB 4NJ9H 2EXWC 3FHAA 3EUUA 5AWNL 3BPCB 2K7QA 5ILTH 2FO4A 4AJ0A 2EYRA 3GI8H 3HR6A 4YHOL 3IDYB 4IRJC 2AJXH 3CDCA 5JHDE 4ZUVB 4Q9BA 1N6QH 3RL2B 3FO1B 3BMWA 1L0YA 3O6FB 1UC6A 3SKOB 3SGJC 2CSPA 3H3PL 1FFNA 1IC7L 4GXVL 4F2MB 2EDFA 3MRGB 3WFCH 4W4NA 2IJ0C 5A2LH 3QDJE 4GAJL 1E6JH 2I60L 3HUJB 2OXGA 1S78D 1ZT4A 4S1DD 1QA9A 4X5XA 1KIPA 4NQCE 4OM1H 3GKWH 3TPUB 4NRXA 1A7PL 1MCPL 2P5EE 3HE6A 5LVEA 3OJDB 3EYQC 5I8KL 2YUXA 4B53A 1C5DA 1UACL 2X7LB 3P9LB 2X4NA 3HE7D 2NTFB 4BZ1H 4KXZH 1MRDL 1CBVH 2Q1EA 1IQWL 3QXTA 5EIIB 3UYRL 2EO9A 3TM6A 5HGDB 4JB9L 3KDMA 4ZSOE 2ARWA 2YK1H 3IRPX 4HF5H 1BQHB 3MREA 1MCRA 3Q1SL 1KN2H 3PNWA 4ELMA 3E6FA 4F7MA 4HUXB 1YMMB 5E24E 5CIPA 3D87B 4Q97A 4L8CB 3HZMA 3HCVB 4BFBD 4K3GA 3OX8A 5F9OH 4LNRA 4W81A 3D0LA 4H0GA 5FA3A 2GFBB 4KTEL 4RGNE 1J88A 3CJJA 5E4EB 1MI5B 5IG7B 3HMWL 4GMSL 2PF6A 1N5YL 2A6JB 1Q72L 5EUOB 4QXGL 1Q1JH 5FGBC 1HI6B 2WSKA 3B9KC 5DJZA 4FHBD 4F57L 1VDGA 1MRCL 1YMHA 3V7AG 4FZEH 2X2YA 1PG7X 3KPQB 1R5VB 4OGYH 5TDOB 5DDHB 4OKVA 4X5WB 1A7PH 2JJSC 2Y06H 5C0ND 2H1PH 3MOAL 5I16A 3MV11 2IADB 5IF0A 5FYJU 3MRBB 5DFVC 4WHDA 2IEPA 2XQBL 2PW1A 4GMTH 4XBEH 4IMLB 2H6PB 5BZDB 5HI3D 3WS3A 5HHOA 3KPRB 2BP3A 1TCMA 3P4NA 3U7YH 1B2WL 1X5ZA 3UYRH 2MFNA 2YS4A 5DUPL 4PLNC 5JQHC 4M7LT 5DS8A 5MEQB 5I1EL 5CZKA 3OBAA 3IJSB 3U4AA 3UPRA 4EZMA 1E6OH 1ZA3A 3GIZL 2F53E 4MJ6B 3QFJA 2FX9H 1A8JH 1QRNE 3FONB 2CQVA 3Q48A 5F96H 4MNQB 4IM8A 3OG6B 1O0VA 4NKIH 2O5XL 2YC1A 3VGGA 3I6KA 3IDXH 4MMZC 3TA3D 5L8KB 1XIWA 5K59F 1INDH 1ONQB 2XWBB 2FEEL 1D3CA 4FQCH 4XPAH 3GSRA 2XN9B 3KPNA 2D3VA 2I9LA 3RU8H 3LKQA 2EIZA 4M7KH 1U8PA 1NCNA 3BVNA 5IMOA 4HUKB 1CQKA 5FUOH 3CZFA 4NM4L 1J1XH 2W65A 5EG6C 2XT1B 4PYHA 4HCRL 1BFOB 5C92A 2QHRH 5E00A 3O3DA 2Y5EA 3VI3F 3EJYD 3C60C 3HUJA 4PY7A 2HRPH 1GJIA 2CLRA 4J6RH 3EOBB 4HJ0C 4LCWA 3TN0C 3MV7D 4HC1H 4KJYA 4JKPH 2NX5D 3WMSA 5JOFB 1OCWL 3WLBA 4LVHB 1QG3A 1FE8H 5E70A 3UTQB 2XTLA 4WW2C 1VSCA 2QBWA 4PB0H 5D6CB 5EN2A 2EH8H 4P5TD 3V0VA 2VWEE 4KHXL 1T4KB 1JPSL 1ZLVK 4RMVA 2VLRD 4Y16B 6FABH 4NQVA 1KIRA 5J6GB 3SKMB 3N85L 1YEGL 3RWFB 4KVCL 4AIOA 2AEPH 3F62A 1T7XA 4XPTH 1OT2A 2V7NA 4Z7NF 3VU2A 2OP4H 1CD0A 3D3VB 4N8VB 4YC2C 3U30B 5F88B 1AKJD 4EN3C 1VFBA 4LCYA 1UZ8A 4PG9B 1P84J 4D0CB 1LO0H 4M61A 4P5MB 4P9HL 1IAIH 4G42B 3LKRB 5DA4A 1S78C 1X44A 4HIEB 4OCRL 3CPLA 1HXYB 4NNYB 3MLYH 4NQUA 5BO1L 2XZAL 2DI8A 2W0PA 4JRXB 1MFCL 3A6CL 1MWAA 3QUYD 2D2OA 4ONHB 1BREA 1KENH 4YDJB 2DYPD 3QI9C 1UA6L 3MRPA 1JFQH 1F6FB 2XRAH 4IS6B 3SJVA 4X6FB 3GSWB 4U3HA 3C5JB 2KKQA 4R26L 3TIEB 3O3UN 1RZGB 2ZOLB 3ZYZA 4RX4A 4TPRH 1IAKB 4AEHH 3MLSH 1VKXA 5IB3A 35C8L 4RAUA 3WFBH 4N9GB 1ADQH 5ACLA 4PJBF 3S3SA 5IK3A 2CKBL 3QI9B 2VTFA 2XA3A 4HAFA 4LMQE 3MRNB 1KSRA 2CIIB 3UTTA 3U0PA 2VLLB 3ZL4H 2HTKD 5IWLA 3GBLA 3ARGA 4OZFB 4K7PL 4M6ML 3MXWH 3LIZH 2IBZX 3UTSE 3UJTL 2QQKL 2IFFH 2IQAA 3BXNB 3L6FB 3VWKA 2C7UA 3QEQA 3EYVA 4R4BB 5F1SA 4BSVB 1LO0L 4P9HH 4TSBH 4QRRE 2VLJE 4P4KA 5I18L 3SO5A 1MIMH 3VXNA 5HDQH 4HV8B 3BYYA 3R0MA 4PJ5E 1RVFH 3VXMB 3MRQA 3PNWB 4UILH 3EJZC 2C3GA 5I0ZA 4M5YH 3L9RA 4TQEL 5KANG 4KTDL 1QA9B 1XIWD 1IGCL 4X5XB 3X11A 5C9JB 4V1DA 2BSRA 5KTEH 1B4RA 1KJ2A 2CDGB 4TYUA 2V2WB 5DZLA 2JF1A 3MLSL 3PHQA 3AS2A 4OTXL 2W0KA 2DQFB 5CGYD 5LJYH 2NXZD 5CINH 5DWUH 4PP1D 3RVTC 3H7BB 5TE4L 1MWAB 3DXAB 4XPHL 4I9WD 5IESH 4ORGB 3LS4L 2A73A 1TJIH 2Z93A 3QUMA 1J8KA 4YWGH 3LKPB 4MXVE 1IJ9A 5HTSA 1CXKA 2I07A 3S9DB 2XPGA 3ILPA 3MRHA 1JN6B 4ZODA 3DUSA 3MYJB 4YHNA 5JO5B 3ESVF 3OKMB 4ENED 2VN7A 4X99A 1JJUA 3DRTA 1ZEAH 1UYWH 3VFVB 2VH5H 1OW0C 4J7RA 1F8TL 4LLQA 3VXSA 3R06B 3T3MF 1SJVA 5C07D 3WDHA 1K4CB 3CDYA 5ALCL 1CFQB 3ZSTA 4KI5D 5AAMA 3DV4B 2WNGA 3GGWA 2Q3ZA 4WI5A 1V3LA 5I6XC 1G7QB 1KJ2L 1RIUL 5JA8B 5D7SH 3D25A 5J8OA 2F5BL 1FIGL 1SY6A 4R4ND 4GH7B 5ERWA 4MA1B 4PLKC 1BM3L 3H8NA 4OZ4A 4JFZH 1CD1B 3WSQL 4GG6E 3U4BH 3E8UL 4XCEB 4Q6IA 3D0VA 1NSNH 3BN9C 3QQ3B 1KPRA 3QRFM 4IS6A 4J2XA 4MSWA 4MCZA 1XF1A 1YPZF 2QTEA 1EK3A 4NN6C 5JMRA 4HS8H 5B22A 1EHAA 1PFCA 3J7HA 4QHKI 5EBWA 4JQXC 5DD0H 1NC2D 4R7NA 2AEQH 3QDJD 4RWYH 1J1XL 1WEJL 2PKDA 5ADOH 4BFEA 4ZUWA 4HWEH 3BKCL 3RWEA 4AEIH 3FONA 2G9HA 5DJCA 3UC0H 2VISA 4IIQC 4GQ9L 1D6EA 5ELIA 4M9PA 2PYED 4ALAL 1OW0A 3W82A 3QIWD 2HA1A 1RIVH 4XNQB 5F70A 2Y6SD 3BE1H 4WGWB 4MX7B 2IBGA 4IRZL 1JGUH 3GO1L 2PXYD 3F12B 3G5YA 1XR9A 4W70A 2DF3A 4A6YB 1LMKA 4JG1H 4Y16A 3PHOB 3RWIA 2CKBA 3IAPA 4F15C 3DV6A 4U1MA 5E8EB 5GS0L 4IDLA 3MRQB 4FQIH 4PJ7F 3C6LC 1U36A 3W0WE 2HT3C 2R0WL 4C56D 3EYSL 3TIDA 3LB6D 1DL7H 2Z31C 4HS3A 1GZPA 1VACA 1IQWH 1J05B 2QKIA 4Z7VE 2XN9D 4JY4B 5F44A 3IFPA 5LWYH 2W9DH 1OQXA 4K3JH 1HILA 1CG9B 4TULL 3GJFH 3U9PL 3WFHB 3F5WB 4OLXH 5IVOA 1IAIL 5GIRA 7CGTA 3EFFB 1N59B 4HBCH 2X1XR 5F72S 3S4SB 3GMRB 3MPCA 3D48R 4N8CL 3DBXB 2P5WA 2B8OT 5DJYB 3PL6D 2BOCB 5HGDA 2VDQL 3TZVA 5KVGL 2AJ3A 1H3PH 3MLUH 4EOWH 5K9OB 4YBLC 5ICZA 4OBSA 4HWBA 1SJEA 2VE6B 3W39A 4YZFF 5ISZD 2FJHA 4JDVB 5DK0A 1WVZA 3NPSB 2P49B 3A6BL 1MHHA 5GHWL 1YN6A 2MPAL 5CD3A 2VISB 1F11A 1YNKL 5C0AD 5LGHH 5HVGB 3WL9B 3C6LA 1TTUA 5FYLD 2DI7A 3RWHB 1BD2D 4XBEL 4HCRA 4Y5YA 3HRPA 4Y16D 2VXSH 4LSUH 4DCQA 2ESVE 3D39E 1BD2B 1ORQB 4XRCB 4OUOA 1OP3H 3ARXA 1VERA 4K55A 4BSWA 1JZ6A 3GM8A 3BRDA 4NNXA 3FN0H 5IJKC 5DUMH 2NNAA 3ZHDA 4HJ0D 4YBQD 2HG5B 1R0AL 4D94A 5SWZE 4PJXE 1BX2B 2ERJC 4OCWL 3CFBA 3WN5A 2OX5A 2H6PA 5BZDA 7FABL 3FL7A 5F93C 4H20H 2FX9L 4KC3B 1XF4B 1WC7A 4WW1B 2P5EB 4N8CH 4HS6A 1KLGB 4Z8FL 2H32B 2XKNA 4X6DE 3S37L 3OQ3B 1F3DH 3JWDC 1X6LA 1YEIL 5FKPB 1NCAH 4DAGL 5F6IC 1NMAH 1SBSH 3OAZH 4UB0H 3V8OA 4AIXA 5D1QD 2ADFL 3AC0A 1RJZA 4Z76A 2F19L 5MEPA 4D9LL 4CVZA 2JB5H 5T5NG 3WBDA 5MI0B 2QQLH 5JW4Q 1NLDL 3QQNA 3GBNL 2EE3A 5SWSB 2B2XL 2ZCLH 2WLZA 4FTVA 4JFYA 1YUHA 2PETA 4PJ7B 2WIIB 5EOQH 5FDWB 4NQDD 3ARBB 3MRRA 1IL1B 2GJ6E 3ZKSD 1KTLA 1KXQE 3D0LB 5AZEH 3GSQA 1J8HD 1A7QL 1QD0A 2G2RB 1K4DB 4YE4L 4TVPH 4HW6A 2BC4B 1QRND 2F53A 1WK0A 2HRLA 3W5MA 1QEWB 5EBLA 3T0ED 1BVKB 4FQ2L 3VG9B 1KEGL 2VR5A 4NCC2 1FC2D 1H0DA 4AG4H 5JR1L 1JZ7A 1ACYH 3OGCB 1CU4H 2AP2A 2HFEA 1KIQB 2I26N 3TYFB 1ZVYA 4I3RL 3GGWB 5D5ME 3PGFL 4XXDB 1AHWA 1MIEH 2FGWH 3UTQA 4OZGA 3QDGA 4HK3N 3TT3L 3ZDYE 3D9AL 2CO6B 4G6AD 4MNHB 4YHZL 3CVHL 4PUBH 2VNCA 1XGUB 3DUSB 3KGRA 4YHNB 5JO5A 2YSSB 4JDTL 2F54E 3KJ6H 1FIGH 3TN0D 3TJHD 1FP5A 2E3VA 1NMCB 4BFIA 4G6ML 3CC5A 3TF7C 3CXDH 5T3XH 3BW9A 4UT9H 1MCLA 3QEHA 1RZKH 4LSQL 2Y9RT 4D9RE 4I2XA 3M8OL 1DE4A 1ZTXH 2ZSWA 2SEBA 4JFDA 4G7VL 1KLFA 3DJ9A 4U1KA 1ZT1B 3P30H 3RNQA 3MX0A 5C0CE 4YO0B 3B2VH 1MI5D 5IQ7H 5DD3H 3L3JB 4UV7L 2FJFB 4M6NH 4OQTL 1A3RL 2NY0B 4CMHB 4Q0XH 5HVFB 3LY6A 4ZD3H 1RIVL 3SGKA 3O6ML 1I3GL 1R5WA 4M3KB 3T65B 1FL6A 4MGXA 4ONGL 3JTTB 4FQLL 2VAAB 2EZ0D 5ITFB 4BUHA 3HE7B 1UM4H 4P9ML 3QWQB 1RZFL 2ZOLA 1MJUL 3BJ91 3QUZD 1N8ZA 1KB9J 2K1MA 4IMKA 4DQOL 4YAQB 2G9HB 1XZ0B 3ZDYF 3BKML 1KLUA 1ZLUK 2BK8A 1RJCA 4JDZB 5IF0B 4WTWA 3GMQA 3WNPA 1DUZA 2NW3B 5CHNA 4JPKH 1BQSA 2R2EB 4HXBH 3TV3L 2G5RA 4UIMB 4R90H 4OLVH 4UV7H 3KLAB 5I19H 3ZTJG 2ITDA 1NGPL 3GSNL 4X9IA 2OK0H 1RFDL 3K4ZA 2R1YB 3C09B 4FS0A 1NC4D 4TUOA 2ICEA 3D3VE 4N0FA 1PKQA 4L4VB 1F5WA 1EO8L 1XF5A 4PRIE 4JKKA 1DQML 3CVHB 1NDGB 5CIPB 4ONGH 4YBQC 3MLWL 1REIA 4PJIB 1NGYB 3BGFB 3O4LD 5LGJA 2APVA 1UM4L 3OR6B 4P9MH 5HHMD 4PG9A 3UROR 3UZEA 4DVBA 4WUUD 5HYSA 5GSRA 4EUPH 3STBA 4X6CA 5DC4B 3C2SA 5CP7A 4PTTB 4ONFL 2GJ6D 3TP4A 1U3HB 4QRPA 3EW3B 5IBUG 4E5XB 1MRFL 1HEZA 1VB9A 1H0DB 2AJVH 3L1OL 3LRHA 3BKMH 5JXEC 4WO4B 1ZEAL 4KJWD 5HYQB 2VH5L 3SO3B 2BVUA 5KS9A 1BBJA 4FQHA 4TRPH 1FORH 4MNHA 1OOAA 4N90E 4WW2A 3FKUS 3P11L 4I0PB 5ICZB 4R90L 1BX2A 3SE9L 3WN5B 4OGXH 1A6AA 1T03L 4H8WL 1NCBH 2HJLA 1AO7B 3QCTH 2YD1A 3MRNA 3MC0A 1AXTL 4Y5XC 4QT5B 3VXTA 3O81A 1KIUA 3KPSE 4AK1A 4HKBA 3JWNC 1GVIA 1VGKA 1YEIH 1KYOJ 2VQ1A 5D6CA 1A14H 4U1JB 2DQEL 1HH6B 1I85A 1F3JA 4UIMA 3CFDA 5C0RH 3GRWA 3RNQB 5GS3A 3X14A 5I17A 5T3ZE 1BVZA 3QJHA 2BRRL 4NZTL 1NGXB 2FH8A 3BT2H 1WV7T 2CMRH 5MERB 1LO5A 3PABA 1OAYH 2YMXL 5H94A 1JNNH 4JQIH 4NQCA 5C0AB 5KZCD 4JN2A 2YPVH 3CK0L 5GGSY 3QIBD 3ZE1E 5I1AB 2APBA 2AS5M 3SCMC 5E95B 3ILQC 3GK8L 5JXAL 5DVOA 1RU9L 2EDKA 3WE6B 2XZCL 3C5ZD 5HYSB 4U7SA 1A1NB 2LVEA 5D1XD 1TENA 4HFUL 5FDYA 5ETUA 4YE4H 1OGAD 5KSUB 1JYNA 4E5XA 4N0YL 1U8MB 3CFKB 2X05A 2X7LA 4X8XA 3TN0B 4PJCF 1I9EA 4R6UA 1CZ8L 2ERJB 2A73B 3I9GL 5DR5H 2DMCA 3IGAB 5EIVA 1IEAB 1N5AA 3BOVA 4Y2DD 3EYFA 1FNFA 2FHBA 2BJML 2EDBA 1DJSA 1FZMB 3WUWB 1MIEL 2FGWL 2ZCHH 1T1ZB 4OCSL 2LTQB 2VIRA 2JJSA 4KKCD 2VSDA 4LVNC 1A9EB 3OMZA 4NN5C 4FFYL 4P3DA 2OTWA 4LNRB 3NCFB 4OF3A 3RWDB 4PJAF 4YXLH 5L2KA 3QR2A 4PJ8C 4HGKC 2HLAB 1H3GA 1QPXA 5L7XH 1I1RA 1S7QB 1H9VA 2OLDA 4I0CC 3QIWB 4K2UL 4PD4J 3HNVL 1MJ7H 3NFNA 3S35X 3OGCA 1BQLH 5FKAB 3MNWB 1G0XA 5TF1H 1CXIA 3QCVL 5IMLB 1DLFH 1XFPA 3ROLB 4G42A 3LKRA 1YYLH 1PZ5B 2PYEB 2Y7QB 1M7IA 1MF2L 1U3HA 3QWRA 1XGPA 4XNYL 4KKLC 1AQDB 3QUZB 4N90D 1QSZA 3QHFH 3P2TA 1L7IL 3B3IB 3GMPA 4XX1G 4M62L 1J18A 3NIGE 1A3RH 4KJQD 4XVJH 2D9QB 4NUGH 4F80A 4JFQA 1PDKA 2WANA 3B2UC 5HYJA 5FYKE 1QRNA 2X1OA 3B8SA 5EFIB 1PY4A 5EZOL 3IKKA 4JFDB 4IHOB 3FB5A 4XX1E 4K94L 2Z31A 1QFUL 4ZPVB 5BVJB 1VPOL 2HJKA 4RGNB 3L3JA 5H35A 4DN3L 4F15B 4JZNB 4OF6A 2R4SL 4NQED 1U3ZA 3ULUH 4WHYH 5GGTL 4HUWA 3SDYH 3S6CA 3NABL 1ODAA 3VXRA 4H25A 5DHVB 1U91B 1XGYL 2UWEA 12E8L 5I15H 4OJFL 5FCUL 5FM5O 1CDBA 4LHUD 4P0DA 4S0SD 3HTLX 3GSUB 4HH8A 4X83A 2XV6B 3R06A 4Y1AE 3VXMA 3G9VA 2ADFH 5F7LB 5DMKB 4OV5B 5DGQA 2Q7YB 3U9UA 5AEAA 1HKLH 1W0WA 4EVNB 3BO8A 1F13A 2JCCF 4BUGA 4EJ1C 5TQ2H 2Y72A 3LIZL 15C8H 1D7FA 1F4WH 3KVQA 1KBGH 4S1QH 3DECA 5IB1B 1FFOA 4ODSH 4L4JA 5I73C 3MBXL 1LP9B 5FYLH 5IHLB 4Y8AA 1J0YA 2DLGA 3RQ3A 3DO3A 1JZ3A 1PKQE 2VXVL 4DGVH 3RY6C 3MODL 2DD8H 4ZO6A 1J8HB 4ONOA 1FVEA 4JFQB 5F9JA 2EEAA 1S7WA 3TZVB 1DBML 3P0GB 3KXFD 2P8MA 5EPMA 3SY0A 1ZANL 4JVPA 5T5NF 5E6YA 5DA0B 3TO4B 4L3AA 5EULV 5A2KH 1KULA 1OP9A 4RAVB 1I3VA 5FYLE 3RWCB 4GKNA 3VJ6B 2J8UF 1SEBA 1EZVY 4G9FE 5H35B 1W72A 1HQ4A 4GW4A 4JCLA 1WGOA 1G7IA 2Q76A 3DO7A 5DJDB 5J6HA 4KY1L 2HVKB 5A16A 5ISZE 4LSPH 3QIWA 4B41A 2NLJB 3RWJB 1I1YA 4U1GB 2LU7A 4XP9L 1RZIA 5GJTL 3OKOA 4HKZB 3H42L 5GISH 1PAMA 4H1LG 4R8WL 1BZQK 1YEKL 5CJOH 4C83A 1S9WA 1IM9B 4LDLB 2VYRE 3M8OH 1YZZA 1C8PA 3FQRA 3IDMB 2D03H 1IAKA 1K5NB 3ARBD 5FGRA 5C1MB 1M71B 2P7TB 4LHJB 2JELL 4AY0A 3P77A 1T2XA 3IFNL 1R3KB 2OS7A 3CGTA 4UU9A 1EUUA 3VGHA 4JY4A 2ZKHH 3VW3H 3BZ4B 5CSBA 2JJUA 4M6NL 4OQTH 3RTQD 4I2XB 4Z7VF 3F5WA 1CLYH 1F4YL 3K8KA 3RNKA 4YX2L 4ZPVA 2ZJSL 2X4OB 3I3EA 1P4BL 2EC8A 3T4YA 2EDWA 5HHNB 4E9LA 4EUPA 1FN4A 3KPSB 43CAB 3DBXA 3LQAL 2NW2B 3PL6C 1AO7D 3DOSA 4AH2A 4NQEB 1NFIA 2W0FB 2FRGP 4F58L 2NZ9C 2LU4A 2XN9A 3KHQA 1N6VA 4YFLI 1JGDA 3VFWB 2AXFB 4S1SL 1UWGH 1OM3L 5DJXA 4O2CB 4FFYH 1RJLA 4OIBA 4QTHB 3CZJA 1TMCB 5J89A 1ZSDB 4ZG1A 2GJZA 4QOKA 1MLBA 2ESVB 1QSVA 3ARPA 3D39B 1NGQH 4GRWH 3DXAA 1YY9D 1G7MB 5ICXB 4DEPB 1CFSA 4C4KO 3P0YL 5JOFA 1JGVH 3UTSB 2R0KL 1X3DA 3MLVH 3GSOB 4QRQA 5C09B 3AMKA 3MGTA 5CMAA 2XWTB 4L4VD 4OZIB 2EE6A 1P5VA 1Y6KR 4P3DB 2YD8A 2H45A 1DN2A 2DQUH 4YFDB 3RPKA 2FR4A 3LQAH 2X9XA 4URTB 3NZHH 5ALBL 2V7HA 1KV3A 1MFEH 4XNZC 5BRZE 3CVIL 5BV7L 5SV4A 5JQ6H 4U1IA 3QUMH 4NWTH 1D5IH 5FK9B 1VEPA 5IFAH 5K9OA 4K9EL 3G04B 5HD8C 5SWQB 3QDME 3AFLA 4YC2B 2AXGA 1H3XA 1CDUA 3C87A 5JHDB 3DPBA 1IQDA 4PRPB 5BVJA 3CH1A 1LE9B 3ZDZF 3OR6A 3MBEC 4XTRD 2DQDL 1IEBA 4IBLT 3NFSH 5HVWA 5HYFA 4ESKA 4UOW0 3G5ZA 3QDJB 3PJSA 4XAKE 1KT2A 1JWSB 4YHIB 2HN7A 3WHE1 4S1DC 3RZCC 5SWZA 4O5LL 3O45A 2D31B 4O00A 4MSWB 4NOBA 5IVXE 3QSKB 3R4DA 4L29A 5IMKA 2VRAA 4BZ2L 3MRLB 5F3HA 4P46A 4UQ2A 4RRPG 1WJ3A 4G5ZH 3OAUL 3A6BH 5E94B 3P0VL 1FNGA 1U58B 2BRRH 1ES0A 1GGTA 4YHYC 3RIFK 3WNOA 5FYJL 4M93C 4LARL 4YXKL 2DQJH 5EZJA 2YD7A 2XZQH 5F1NA 1XGRB 3RGHA 1I8KB 2HWZH 3MJ9L 8CGTA 2WZPD 4JY5H 2EE2A 2A38A 5D93C 1KPUB 4HT1L 3I02B 4PJEF 4EUPB 4YDVB 3TBYA 1ZVSB 3PQYD 4HFUH 3MODH 4KK5D 5EU6B 4HGWA 4RMSA 4PJ8B 2EDDA 1NFDE 3SY0B 5I71C 1IMHC 2WWMD 3EYOB 1CXHA 3QO1A 5IFJA 2OZ4L 3BZDA 3I9GH 1A3LL 5FGCB 2DS4A 3DYPA 2V6HA 4DW2H 4E42B 3CMGA 3CPLB 1AY1L 1G7LB 1OF2A 3HC0A 1BF8A 1WZ1H 1YMHB 3GB7B 4H88L 2ZZUT 4PJEA 1BIIA 1QFWI 2ZSVB 1MCSA 4R0LB 3GSWA 5DLML 5I1DA 3FQTB 1HHIB 4P59L 3X3FL 5D1XA 2IPUG 1PG7L 3QBTB 3GSVA 4XPGH 5F96L 1OTUC 4XAKD 1ZLVH 4U2YA 2WUBH 2J8UE 3FQNA 2OJZL 5D7JC 1ZHLA 4X5LA 4FQXC 5BRZA 1KGCE 5F6HJ 3RU8L 1IKNC 4MA7L 1B4JL 2J5LB 3IFNH 1OD7A 2B0SL 3DO7B 3HE7C 1XGQA 3VRLF 4CVUA 4M1CD 1HE7A 5ID1B 4LRNH 2XY1A 3ALWA 1RUQL 1Q94B 4U6XA 3V7AE 4G8IA 3VXUA 5KSBE 1OLLA 1BZ9B 2V2TA 1FG2A 2Q86A 2N7BA 3G6AB 3VE0A 5DURB 3D9AH 4FXKB 4NCC1 4LBEB 4LKCA 4M3JA 2M8XA 5EOCJ 3C60D 4JFED 1D9KC 3SGDH 1JYWA 3MV7A 2YA1A 4U05A 3GRWL 4YEFA 5AYQA 4PB0L 4QGTA 5KSBA 4GOSA 4I18B 5DD5H 2CDEA 3SJVE 3VRLE 3MV8B 4HKJA 2I9TB 5EU6D 2O5ZL 4Q74A 1AP2B 5I9QC 3HZKA 5DD6B 4PRNB 4XNUH 1W8NA 3WIHA 2B1HH 3UDWA 4Z0BL 4MXQD 5KBNC 3TBTA 2F9BT 2VOTA 4DEPC 4WEBH 4WJ5A 1OSZA 2UVFA 4L1DA 5JOPD 5HI3C 2GSIA 3R8QA 3ROOB 3ET9F 1NUGA 4PJHF 3WDIA 3O6FC 2XPGB 1KB5H 3DSFH 3GSVB 5CEZL 3B9DA 2A6DB 5FV1L 5FUZH 1T1ZA 1RURL 3PWVA 4Q0XL 1RHHA 3EBAA 1AFVH 1AO7E 3HZMB 5KAQF 4I77H 4JZJC 3EYUL 4PJFE 4D2NA 4YBLB 1F4WL 1Q72H 2EIBA 3GMLB 3IJYB 1DVFD 4KK8D 4TUOB 1NH6A 3ME0A 4W6YB 2R8SL 1BVKA 4JREC 2ZP0T 3CVIH 5BV7H 5JQ6L 3NAAH 4OGYL 1TJGH 3L3OA 4JFFD 3AAZA 3HPJB 1P5UA 3MMEA 3ZKXC 2EXWD 4EVNA 2AEWA 1Z9OA 1VFBB 4LCYB 5JOPE 3MFFA 1QRKA 5CJQH 3OKLB 4WI8A 3D25B 3VMPA 5IB1A 1T21B 1ZGLB 3FAXA 2PO6B 3TO2A 3BDYL 2A9MH 4Y19D 4ZS6C 3HE6D 3ARGC 4XHQA 4JO3L 3QIBC 3NZ8B 4PRDA 4FQXA 3OAZK 1OP5H 1ETZB 5CJBA 5ID0B 1A6ZB 5E2UL 3CSYA 4BZYA 4GAFB 5KS9B 1UM6L 5HI4C 3NIGF 4GKSB 2CUIA 3FQXB 3P4OB 3QQ9C 3T0EB 3C5ZA 2QSTA 2R1WB 2XIDA 5D1XC 4OB5H 2VABA 2ZUYA 3IDJA 4OCNC 3PP3H 2EICA 2VZ1A 4PGBA 1JBJA 3QRGH 4TVPD 3MQIA 3QZWB 3L3KA 4WWID 3TA3B 4KPHH 5GJTH 1F4XL 3EYQD 5T5FH 3TH3T 2WW8A 4ZO8A 4PRHE 4X6DF 4HFWB 3O4LB 4OM0L 3Q6FB 4X4XA 2P46B 4OT1H 4PJ9A 2W60A 1N7MH 3FTGA 2MKWA 4KDTC 5DMGD 3RVUC 1FO0B 5FHAL 1AGCA 3HN3A 1FL3A 3KXFE 3MSPA 4KKCC 1Q94A 3JZ7A 1DR9A 4P23D 4U6XB 5CJQL 3BISA 4OD1H 1EVTC 4YPGA 3I02A 4JY5L 1SJXA 4KKNA 4YDLC 3LMJL 5T1LD 2LVCA 3KNBA 2I5YH 4WDIA 3UPAA 4KROB 1QBAA 3BZFB 2C3VA 5E8EA 1WWWX 3P11H 1FLRH 1KCVL 3CFIC 5ECJE 1K5NA 3FO0L 3MYZA 2YD9A 3SBWA 3SDDD 4PYGA 3Q5OA 2BNRA 3VFUB 5FYJD 5IKCA 3WV0A 5BQ7A 3L3DA 3ZKMD 3O2VH 3HG1B 2HT4D 25C8L 5FKAA 1ES0B 1UWXH 2YD3A 3MFFB 4OB5L 2EDYA 4M43H 1P1ZB 5EZJB 2EH8L 4I9WE 4JG0L 1YC8A 2GYSA 1DQLL 1CGTA 3CLEL 2A77H 5LAXA 1CBVL 4XWGH 4X7TA 2K3TA 3QA3B 4IRSD 2UVEA 5K59E 4MNQA 1PEWA 4JPIB 4MAUH 2GEEA 4WUKL 1U8LB 2E5EA 1OAYL 3FQTA 3MACL 5EBMB 3P4OA 3T0EA 1YUHB 2PR4H 5DRXA 3HUJF 1XF5B 2A83B 3PIQA 4ELMB 4F7MB 3LPGA 4YIQB 5KVDH 3IDIA 3OXRB 5HYEA 1AXSA 2NY1C 3WUWG 4QXGH 4MA3B 1E4XL 5DYOA 4L8SB 4JANA 3FO2A 3THML 5ISZB 3W5NA 2FO1A 1SYSB 5IR1A 2VLJD 2XZCH 1HQ4B 2HYMA 3WSQH 4QRRD 2FWOB 4LVEA 4ZTPH 4HIEA 3RWHA 4R3SA 4ZS7H 5KAQG 2JJWA 3VXRD 4PRBB 2G60H 5I0DA 1GGIH 3KPOB 4IDJL 1YEEH 3HLAB 1UA6H 1JZ8A 1JFQL 4GRLC 5IMMB 4PJHE 4XCYA 3VXME 4YHKH 2XA8H 2ICWB 1ZA6B 2AXHA 1DQLH 2ICWI 3PDDA 1B3JA 1X4XA 3QDGB 2WP3O 4QTIH 2ATPA 3RVWC 3CFEB 1X9QA 4NYLA 2HT2C 2XXMB 3KHOA 4OZ4B 2E6PA 5EBGA 4EDXA 2HJLB 1BOYA 4NFBA 3ZL4L 5L0QC 4X4ME 4WUKH 1R3HB 2CLZA 4Y8DC 1U93B 2AV1B 3TFKD 1ED3A 1C7SA 2HTLD 1T0MB 4BH8B 3CSBA 3WEXB 5T1DL 3HZKB 2W91A 1Z5LA 4X6CF 3VWJA 5C0BA 3VFTA 4N5EC 1U6AL 1URLA 3D69A 4LLYA 4QRTB 1FG2B 1INEH 1IAII 3VFRB 1S5HB 4Y5YC 2VDRH 4E41E 5KG9B 2P8MB 3WKMH 5JMOC 5IROA 1DEEB 2J7LA 3QDMD 1AGCB 5ILTL 2A6IA 3WO4C 3VFWA 5KTEL 2FB4H 3TJEL 4GG8B 4ZSOB 4JEGB 3TVMB 5IHBA 4X6EA 4Q6YA 4P5KA 4Z7VB 1AR1C 3FB6B 3WJJC 3RP1A 4XC3L 2NY4D 1CFNA 5CFHA 3DIFB 1E4KC 5EH1A 4EI6A 3NVQA 4ODUA 4RMTA 4P23A 1LO3L 4UTBL 4LIQH 3BWAA 3MJ8B 1HYSC 3V8CA 3HS0A 2YA0A 3H7BA 2NY5H 2P5ED 5GRJH 4OD2B 2VZVA 1FHGA 3EGSA 3NAAL 1QYGH 2OR9L 3FB7A 2C9AA 4HSQA 3MCLH 5IM7B 5I73B 2BMKB 3VFSB 1WT5C 5J9PB 3GSOA 1I9JL 3DURB 3FQRB 3K1KC 3V4VH 5DEZA 1NKRA 1AI1L 2NY5C 3N1GC 1T66D 2VIRB 3V0VB 1R5IA 4BZ1L 3DNKA 1QSFD 1UYWL 1UACH 3O3EB 1V7ML 3BP5B 3JUYA 4YDKH 3SQBA 3LRSA 4JN1L 5C07B 1YNLH 1FRGH 3OR7B 1YEFH 2R1YA 1TNMA 4KV5F 4Y16C 4PG2A 1MQKL 2DM7A 3V6OC 3QZWA 2LFGA 1WWCA 4V1DB 4MA3A 4GKNB 3OKDA 4CADB 2AK1H 3EZJB 1YYML 4LFHD 2R0ZL 4KTEH 3WHXA 2FBJL 5HHXL 1G7PB 4OM0H 4F7PA 3E8UH 3ZT7A 2EIZB 4JM2C 4PRDB 4HG4J 5B8CC 3REWB 3PP3K 4GG8A 4X6DB 5FUCE 3A67L 5FHAH 1F00I 1EO5A 3S36X 3CZFB 3P73A 5GS2H 2YD5A 2NXYB 1L6ZA 5IHZB 4I0PC 3MRMB 1BLNA 5ITFA 1QSFB 2NY3B 2ATPB 4JJ5A 2NZIA 1MAMH 3CFBB 4AEIL 4JZOA 2UYLB 2I5YL 2Q7NA 1CTNA 5KVEH 1AJ7L 3U46B 4JQVA 1MFBH 1IM9D 1EEYA 4I13B 4X80L 5IQ9B 2JK5B 2DQCL 3QIBA 3FB7B 2CIIA 3UTTB 4AEEA 4FA8A 3WLBB 2H3NA 2XG5A 3BMVA 4UMGA 2EDLA 3O4OC 4XGZB 1E6OL 2GTWA 2PTUA 1I3RB 3FT3A 3VWJB 5FM5M 2WLYA 2UZIL 1ZXQA 2ORBH 1I85C 1N64H 4CN6A 3PHOA 5C07A 3O4OB 4X9BA 1PLGL 3TCLB 2NY6D 1A6UL 2B1HL 2X5PA 2QADB 2C1OA 4HMCA 4PJFF 1EJOH 5EWIL 3UZQA 2FSEA 3LQZB 2IFGA 5DK2B 3QDGE 5EU5B 4NJ9L 4J4PA 5FUOL 4Y2DA 4MHHG 1MPAH 2LE9A 3CH1B 5LWYL 3SPVA 1Q9WA 3V6OA 4U6YA 4WEMB 1MWAH 5CEXB 3EOTL 2AJXL 5BMFL 1QLFA 4FQJL 4L4TB 1KB5L 5CEZH 3GHEH 4WCYL 1KJMB 1MLBB 2ESVA 3D39A 1I7TB 2W38A 4LLVB 4YGAB 4GQPH 2WQRA 5JPNB 1X5KA 1HSBB 1MHEB 2X4SA 1G6RL 2Z92A 4RMRA 1FE8L 4S2SA 1YEHL 3O45B 1HQRA 1S7RA 1CI5A 4QO1A 2GKIA 1Q38A 2PW2A 2IPKB 5IEKB 5F9JB 5J9PA 3DX7B 3TIEA 5DRXB 4ZFOB 3CSGA 4P2CG 4EBQH 2ZNXA 4QHKJ 2BNQD 4XNMB 5BVPH 3I75A 5GRYA 1QSEB 2GK2A 2B4CH 1NCCL 5TH2B 1W72B 4FG6C 4XPTL 3UTPE 1EJOL 1T0MA 3RGVA 3BXNA 3L6FA 2G75B 4NC1E 1B0WA 3LV3B 3DROB 4OZFH 4K71B 3S3JA 4GRMA 5JHDA 1ITCA 2MCPL 4H8WC 3PUCA 3Q6GL 2RCSL 4XMPH 3U83A 5F6HI 2HFGH 3C5ZC 4PJ9D 5BO1H 4JREB 2XZAH 4OI9A 3QFJE 3U0TB 4MJIA 4R2GB 2XXCB 3VFOA 5IWLC 4F7TB 2E7LC 2R9HC 1XF4A 5GJSH 4UTAH 4KPHL 2J6EA 1MFCH 3A6CH 5D7JA 1F4XH 3MA9H 5ALBH 3C6SA 3T3PE 3QQ3A 3G6DL 3QPXH 1T1YA 2BOCA 4EBQL 5IFAL 3LN4B 4PRNA 5JTWA 1TITA 3WNNA 3OWEA 1I4FB 2ZUSA 1UCTA 1PEZA 3OKKA 2UYLA 4U33A 4Z0XA 1D6VL 2C5DC 4NWUL 3FQUA 3HB3C 1UH2A 2QQLL 3VA2C 4HH9B 4XAWL 3KPRD 5EOTB 1P4IL 5EO1A 3G08B 4U1LA 4MWFB 4APQB 1WZLA 3IF1B 3KPLA 2IANA 5MEOB 1CLCA 4NQDE 2IFFL 1HHJA 3JTSA 3ULUF 1JN6A 4I18C 5BV7C 4H25B 5D2NA 4MD0B 5D93B 4DKEH 1KFAL 1G1YA 3ZTNH 1W0YT 4K8RC 3EFDH 3O6FA 2OTUB 3EO9L 1TVDA 2R0WH 3C09C 3RGVB 2AK4D 3M1BA 3V5HA 3H7LA 4BZ2H 1HI6A 1XGQB 3MJ8A 4OAWA 3S5LB 3BQUC 3G6DH 4FTVD 5E5MA 3PWLA 5DDHA 3FFCB 5F89B 2BNQA 5AG8A 1JTTA 4UBDC 5F6IB 4GBXB 1IGFL 2NY3D 3PWNB 1HHGB 1WT5A 3QEGH 4MDIA 5ESAB 5TE4H 1X5XA 1H8OA 1HZHH 4OCLC 2YUVA 4Q2ZA 4KTYA 1RZJC 5C2BL 5ADPL 4OZIA 1PSKL 2OM5A 1UM5L 4IRSB 4POZD 4XCFH 4XCEA 5EZIH 2JCCA 2FJGB 3SJVB 1TETL 2CKNA 1O7VA 4RQQB 3KDMB 1GGCL 4N5ED 3K81A 4QRRB 4YQXL 5HHOD 4Z18A 1I4FA 3EJJX 1KYOK 1YEEL 3IXAA 5BOPA 4U2ZA 5F97E 5GRUL 1T7ZA 3UJJL 1H8SA 3RWCA 5DJ2B 1SEBB 1NCWL 5C6TL 3UTOA 1UG9A 4M4PA 2EDOA 2EDXA 4ZAKA 2NY6B 4KUCF 3B83A 2YC1B 5C0EA 3TCXA 5T3ZD 3N9GL 3FRUB 4JY6B 4LLAA 5IT2H 3LSOA 4JFFA 1DQQA 5C08E 4ZXBB 2ZG3A 2DBLH 4JFXB 2AI0H 1MCCA 1HHJB 2IF7A 5EUKB 4Y88A 1B90A 3C08L 4HIIA 2VLKA 4X7CC 4HQQH 4BSJA 2Y5TA 1JI2A 4WI9A 5E8PA 3GI9L 2IAND 3H9SD 4ZFZB 2C3XA 3ARZA 1U8QB 3QT2A 5C09E 3T1FB 3IXTA 4KJPC 1BVLB 4NQCB 5IW6A 1A4KA 3GKZA 5DVLA 3MV7B 3HPJA 5IQ9A 3BYTA 3HG1D 4NN7C 1EAPB 3T04D 4H5SA 2APFA 5F89A 2BSRB 1WBYB 1A2YB 3AGVA 4HKJB 5DVNA 5IUSA 4K3DL 4LLUA 1U42A 2IG2L 3E6HB 1A64A 4ZS6D 4GS7C 1WSST 1NUDA 2FB4L 5IJVB 3S3PA 5D1ZB 4A6YH 5KOVC 5DT1H 1UEYA 4S2SB 5EO1B 4IEFB 5J6GA 2P5WB 1YMME 2BCKA 2WUCH 4FABL 4BQ6A 2XICA 1GC1C 1H3WM 2WBJC 1TZIB 4HLZH 4LIQL 2R39A 3MRDA 2FSEB 4M6MH 3RDTA 2I9LB 3ARYA 4LCUA 4FQQB 3LD8C 2X09A 3KS0J 2OL3A 3LEXB 4J3VA 1Q9WB 3MV9E 5TDNA 5I1GH 3EDFA 3QUYC 4KI5F 4ZTOH 5GSRB 1SMAA 4M62H 5DJ8A 2PXYA 1NAMB 3T8XB 1FFRA 1G7LA 1PQZA 3BEWB 1I1AB 1EH9A 4RMWA 4LDEB 4DCQB 1XCTB 3B8YA 2AJZB 1LE5A 4Z95H 3GM0A 4PJGB 2CK0H 1IILE 1FH5L 4P46C 4NO0A 3MV9A 4D3CH 3MRPB 4TRPL 1YNLL 3GI8L 3FHQA 3V7MA 1IM9A 5EU7E 2NW3A 4K94H 2J8OA 4M5ZL 2W9DL 4ZFOA 1SVCP 2HFGL 4MJIB 4FZ8L 3SE3C 1J0ZA 1FNEB 2E9WA 3QUKA 4DN3H 2GAZB 4LCWD 4AIZB 4QHMA 4NN7B 3VD9A 1G6VK 3VFGH 3V5KB 4S10A 5DJAB 2IPTL 3QUZC 4PV9B 4KU1A 4YHPA 4XVSL 4CN1A 5JW4R 1RK1A 2VDNH 4HIHB 3RAJL 3MBEA 1IFHL 3NIDE 2IQAB 2BVQA 3LZFL 4QCIB 1Z9LA 4JO2H