3PHQB

Crystal structure of s64-4 in complex with kdo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
213
Chain Sequence
b'EVMLVESGGGLVQPGGSLRLSCATSGFTFIDYYMSWVRQPPGKALEWLGFIRNKGNGYTTEYSTSVKRFTISRDNSAVYLQMNTLRAEDSATYYCARDIGYGNSPFAYWGQGTLVTVSAASITPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S64-4 Fab (IgG1) light chain
publication title Structural insights into parallel strategies for germline antibody recognition of lipopolysaccharide from Chlamydia.
pubmed doi rcsb
molecule tags Carbohydrate-binding protein
total genus 41
structure length 213
sequence length 222
ec nomenclature
pdb deposition date 2010-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3phqB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3phqB01
3BGFC 1T0PB 4OCWL 3UBXB 4Y19A 3C2AH 5GGTH 3W81A 1FN4B 4HBCH 3MV7B 2FB4L 1N2RB 3LS4H 3EOBB 4V2BA 3ZSSA 5AG9A 3DV4A 5KSBF 1S78C 3ZKNC 4ZO8A 5E9DE 4FFWD 3KXFE 5CEYB 2GSIA 3ZKSD 1IQDA 4OKVA 3MFFB 3O9WD 1LMKA 1JHLL 4BKLB 2HFEA 3RTQA 5C0JB 3FAXA 3RL1B 2VXSH 4OCMC 1BVZA 2DM4A 4LASH 1KJMA 4FXLA 3CFIC 1GHFH 3QHZH 5I1EH 3IXTA 5FYJH 1IZJA 1S7SB 1JFQL 3GJEB 5L7XH 4NJAL 3K0WA 3QJFA 1XIWD 4PP2A 4ZO9A 1K4DA 3S5LA 4HWEH 2PXYA 2FJFB 4MQXD 3EYUH 4FQLL 4JY4A 3GGWB 5CEXB 4HF5L 3C6SB 1S3KL 1QRNB 3CAFA 3FQNB 2GW5A 3PHOB 4PJBA 5DA4A 1Q9WB 1WC7A 1MHEB 4LVEA 1XGPB 3B43A 3SEPA 1G7PA 2PO6C 3T3MF 5FF6B 2EDRA 2W59A 5IFHL 5JOPE 1CE1L 1NSNH 1NC2B 2ORBL 3U9UA 1JNHB 4DKDC 4ODSH 3ROLB 3MOQA 2WINB 3S8WA 3PDDA 2V7NA 2DIBA 4RISH 5MP6H 3LKOA 3TYGL 1FRGH 2OXGA 4E0RB 3F7YB 1NMAH 4NGHL 3VFNA 4LPXA 4W6XB 3TBVB 4QWWC 2XZZA 2QQLH 4GKOA 4NO0D 2O5XL 1QG3A 2WP3O 2IBBA 3HZVA 4W4OC 3FONB 3LKRA 1R3IL 1PZUB 2W65B 3DX6A 2AABL 1VPOH 1B3JA 2EH8L 2VR5A 2ZCLL 3KWWA 4LSTH 3L5XH 1EERB 1T3FA 1WBZA 3SDXB 1FNAA 5CJXC 3GSUA 4X7CC 4QNPF 1S9XB 2BJML 4I9WD 2GQHA 3BX7C 3E3QC 5E94A 4N90E 1HH6A 1BAFH 35C8L 3PJSB 1YY8A 3C5JA 5EFIB 3RNKA 1UKSA 2XWJA 5D1XC 3V5KB 4KV5E 4BQCA 5GJTL 3ZTJH 4WCYH 2VE6B 4QHLA 4JFFE 3BPCB 1PX4A 5IHBA 4NKIL 3MV9D 1UM6H 3E6FB 4Y4FA 4QTHA 1JZ2A 3EHBC 5EZOL 2YD1A 5GISL 2HP4A 5HYSA 3UTTD 3PQYD 2X10A 5DMGC 5L88H 4DN4L 4XCNB 2APTA 4Y16C 4NM4L 1EAPB 3PIQA 1RK1A 5DHVH 3TVMC 3O8XC 4OV5A 1EUTA 4BZ1L 3RY4A 3BN9D 3HI1B 4X8JA 4GBXD 2IQAA 3L5JA 1SEBA 4ENEC 3GJFK 2I26N 2X9XA 3H9YA 1MLBB 2AK4D 4IIQC 3V4UL 3DVNB 4PUBL 4AIZA 2F58L 4P5TB 4XVTH 3O0RH 5D2LE 1ZA6A 4WW2C 2VLJE 1BFVL 1NAML 2HRPH 5IEHB 5I16B 1SY6A 1XF5B 4P3CH 5GHWH 3TN0D 3VE0A 5J57B 4DAGL 5B3NA 2WUBL 4UV7L 5IQ7L 3RWJA 4KKNA 4NQDE 1QBMH 4QHNA 1F4XL 4GUPB 1F3DH 4X5XB 4LPVA 1U8IA 3DECA 4KJYB 1YNLL 5BO1H 5JHLH 4IJ3C 2D4FA 3SKNB 5HGDB 4RMSA 5GRWA 2QSQA 4GXVL 4PRPD 3U4BL 3KLDA 3X12B 3BO8A 1KJ2A 2YPKA 4UNTA 3DSFL 5A2IH 4YXKL 5HDLA 4DGYH 1OAUH 2R8SL 3BIKB 1M6OA 4TNVF 2LU3A 4K9EC 2L7JA 5DDHB 3GBLA 4HUWA 3O81A 4OT1L 5GS2D 4LSDA 5BRZA 5HHNB 4MXWH 4MJIA 1K3IA 5I74C 5CILH 2ENYA 4HWZA 5E2JA 4JO3H 3V52L 4GKSA 3VI3E 4BQBA 4MA8H 2BSRB 3MNWA 4PJ7A 2R0LL 3BOVA 1PQZA 4RGNE 1WAAA 5TH2B 2JE8A 4FQ1L 4YBLB 3A67L 2WBJC 1JYWA 3LQAL 1CDHA 3PWUB 4CU8A 1ZEAH 3WHE0 3PV6A 3ZYOA 5T3XL 2W60B 3QIUD 2NY1B 3CPLB 5D70H 4YR6A 5IHUH 1PAMA 4EDWL 3SJVA 3S4SB 3B3IA 1YDPB 1P7QD 2XZQL 2P42B 1PVHA 1IT9H 1DL7H 2FD6L 2COQA 4HC1A 3JV6A 3AREB 5E5UB 5IB5A 1F42A 3QQ3A 2DF3A 4UDUB 1EHLL 5KSBE 1MREL 5CSZB 1T66D 5JO5A 2AJUL 2Q6WA 3PP3H 3L3IA 2EKSB 3PWLB 1IM9D 1CDUA 4MCYB 4PGZA 2YPLD 4HK3J 3MRDA 4DVBA 3UBXI 5HVHB 5BXFA 5F6HI 2VMFA 5EU4B 4HWBL 1AE6L 4G7VL 1BBJB 1D6EB 4F3FA 3MLZL 4IEFB 2VN4A 3G5VB 1A6VH 2BVEA 4J1UA 4JM4L 1EFXA 1OTUC 1A1NA 1CU4H 2AV1B 2NLJA 2IFGA 4F7TB 3AMLA 3V79C 2DQJH 3KJ4B 3S96A 4Z77B 1TJHH 2UYLA 1ZHKA 4J6RH 5H2BB 1NCDH 3ILQC 3OBAA 4XPBL 5DUML 5JXEA 3D3VE 4NP4L 3DUSA 2XWTB 4FTVB 3BWAB 4OZIA 3TIDA 3LPFA 5FYLH 3HE6A 3PP4H 2ICEA 4M48L 4TUKH 1C1EL 1RMFL 4NKMB 1CD8A 2P8MA 4C55A 3LV3A 3P77A 3T3ME 1FE8H 4EOWL 1AI1L 1CLZL 2Q76A 3LD8C 1FNFA 3QIBC 4P46D 2O5YH 2IWGA 1B2WL 2RBLA 3EYQD 2AKRA 1KCLA 1KN2H 3DUUB 1LO3L 4P4KB 5DT1H 1V05A 4PJCA 2I9LA 1G7IB 4WU7A 3QHTC 1UQSA 3HS0A 3U0PB 1EO5A 3CZJA 4KQ4L 4MDJA 4Y2OA 2VOTA 1CLYL 1EEYA 4ZFOB 3ARZA 3PHQB 4M4RA 3VG9C 4OGAC 1NCBH 5ILTL 5LBSH 2ICWJ 2OZ4H 5J9PA 5J7CC 4D9RE 4UQ2A 1RZGA 4MVBD 5IMLB 3MLSH 4MJ6B 3DI3B 5GZOC 1TTUA 1ADQA 5BZDB 1CG9B 3FAWA 4QNPE 4HFUL 4G3YH 1OAKL 3EOTH 3HE7B 4LVNB 4WUUE 1X5HA 4R97C 3LB6D 4G5ZL 3RGVA 3MRGB 3SBWA 1IAIL 4HGKC 5DJ2A 5HPOA 2O93L 4LRIA 1CLCA 4B50A 4JFEB 1QO3B 3NACH 3QEUA 5JDSB 1FGVH 3OR6A 3IJYA 1KFAH 4ZFFB 1R3JA 4JVWA 1AGBB 1CFNB 1HQRA 1KIQA 1Z9LA 3MLYL 4P5KB 3VXPA 3QIWC 4K8RL 3WHXB 3S88L 4KK9C 1A0QH 2Z8VC 4I0CC 1UCBL 4H25A 3HB3C 5TDNB 3I3DA 3OAUL 1B0GB 1RK0B 4HFWA 4AEFA 5DGRA 4PB9L 1CICC 1Z5LA 3U48A 2NR6D 2YK1L 1KTRL 3H9SB 4NNPH 1QSFE 3WIFA 1A3RL 4QRRA 1QLFB 1YEKL 1S7TA 4YHZH 5F7YC 1IRAY 1QHPA 1UACL 2AS5M 4L1DA 2EC9U 1HINL 2B5IC 1F6AA 2Y25A 3IJHB 2AEPL 3F5WA 1KCRH 4FOMA 1UKTA 2WWKT 2CGRH 3T4YA 3IFNL 4Q9BA 1QA9B 3UTPE 2BNRE 4TULH 2IH3A 3DX9A 5EBLA 3INUL 3KPSB 1ES0B 3BMVA 3IVKA 4LAQH 2X41A 1FYHB 3PL6A 5FYKH 1QVOA 3WFZA 3DXAA 5SWSD 3RUGF 3RWDA 3G04B 4FG6D 2A9ML 2XKUA 3RVXC 4KK5D 4LCYA 1U95B 4WHYG 4QRSA 2F5AH 2EDFA 4N8VB 4EI5B 2DQIL 2W92A 4LSRH 4NQCE 3ZKXB 3S34L 3HC4H 4PJAB 1MI5A 3F7QA 2Y5EA 2PO6B 4QRUB 3RPIA 4BQ9A 3WNNA 1F6LL 4S1DC 4V1DB 5AYQA 1IC1A 4MLSA 5E2UL 1X4XA 3GMRB 4M6ML 5FKAB 3RDTD 4WI7A 3EAKA 1MCKA 3VFPA 1IAMA 1DBKH 2FH6A 4FABH 4E41A 1ORQB 4D0CB 3S5LG 4HXAH 4NNYA 1VA9A 4TVPL 4LLAA 1C5DA 3KR3H 2AXHA 2B39A 3KLAB 1OQOA 3KAAA 4X6CB 5D5MA 4M7KH 5D7IF 3RZCD 3CVIH 3S3JA 4LKXB 4U6VH 4LMQI 1CZ8H 5JIIA 2F9BT 3QPXL 4NWTL 3S97C 1CGXA 4QOKE 2XXCB 1NCCL 2PUQT 2C3VA 4MD4B 5DRNB 2GJ6E 1IAKB 4BFIA 2X1QA 2CUIA 5FUOL 3VD5A 3MYJB 1E4XH 5FUCE 3KGRA 4MNGE 3O3DB 3Q3GA 5GS1C 4OZFB 4Z0XA 5CCKH 6FABH 1WFTA 5D2NE 1FL5A 1SHMA 3B9KD 1ZVHA 2X4PB 4H26B 4JM2A 4P0DA 1OGAE 1IVLA 2QHRL 1NUNB 1FG2A 4H20L 3SCMD 3SKOA 1CVSC 3WKML 3ZKQD 3ARUA 2ZSVA 3F58L 3TA3B 2WP3T 3H3BC 3O8XB 4I18A 5JQ6H 1C08B 4JRYE 1LE5B 4KVNL 1A6UH 2DLFH 1N26A 1BX2B 1MLCB 3GKZA 4XWGL 3PP3K 2RB8A 1CR9H 5FM8A 1S7WA 5T3XE 1CDBA 1I7RB 5DHYA 1KPVA 4IIQB 3EOAB 5CLTA 1T2JA 4XMPL 1RSFA 4JFYA 2JB5H 4JFHD 1OD9A 2X4QB 4NOFA 2XNAB 3UO1H 4WW2B 5I1KL 4OSUL 5J6HB 1GGIH 3DLQR 3KPOA 5C8JB 5DUBA 3MA7B 4NYLA 3V95A 5IIEB 5INCB 3MNVA 3VDCA 5HYSG 4GMSL 2R2CA 1AKJA 2ITDB 1YMMA 3QQ4A 5T33L 1G84A 3MJ6A 1NMBH 4FNLH 2XIDA 4ODWA 5IJVA 1I9IH 4TTDD 4XNYH 3ZT7A 3EO1A 3TFKD 3HN3A 1X4ZA 4HUNB 1BQSA 2HTKD 1OAYL 2FIKB 1YYLH 4HS3A 5HXMA 3NAAL 3P73B 1I8IA 3RAJH 4G8FB 3VRLF 4OV6F 5FO8B 3QWOA 3BP4B 1QYGH 5HHOD 5T1DH 4PR5B 1MUJA 1KB9J 1J5OL 4PG9B 3MUZ1 1U8MA 2NY7H 3EGSA 4AG4H 1IGCH 3H9HB 4Z7WB 1E4XI 2H2SC 3EJYC 2FX8L 4KTEH 3QNXB 1NEZG 4NC1C 1TJGL 4UINL 3IXAB 3LSOB 4Z76A 1DUZA 2DQFA 3V6OE 4JFQA 3T8XB 4FFVD 4U7MA 3C09C 5DD0H 1DEEA 5BVJA 2I07A 5D4QA 1P1ZB 4ZAKA 2P8LA 3VFUA 1ZHNA 4ZMAT 3RHWF 3MCKB 2WBJB 1JGVL 1NGPH 4G8GE 3C8DA 4K3EH 5IF0A 4P2RA 5LKNA 1A3LL 1X44A 4X6BB 3U4AA 5LG1A 3P9LB 4G6MH 4AMKL 3KYKL 4B0MM 1U2HA 2BSTA 3NCYS 1CFVL 1RU9L 4UU9B 3WNMA 5L2KE 1HH9A 1MAKA 3VFOB 3CUPB 1J8HD 3RTQC 2FX9H 1HXMA 3BZEB 1JZ6A 5JOEA 1DCLA 5FM5M 3UZEA 3QNYB 5HY9A 4ELMB 1OD7A 1I1AD 3V5DA 2CIIB 3DMMA 1R5VB 1V3MA 1O0VA 2BHYA 2PR4L 2Z93A 4PPTA 2ENSA 1N3NA 4HKJA 5I6XB 3BPOC 2CK2A 4X7SH 1F8TL 4NKDB 5D71H 3ARDA 1OTTD 1T20A 2PXYC 5C2BL 5INDA 3NVQA 2NXYC 2CKBA 4N5UA 3T65A 1E28A 4HMCA 1VERA 2VDLH 5HI4D 2Y07H 2OTPA 4QHKI 3ORJA 1YEGL 1QFWL 3UYRL 5K9OB 1UWGL 5I1IH 3VXUB 1BQLL 5IV2A 1EPFA 1A4KB 1MCPL 2Y1VA 3OWEA 1T21A 4YHIB 1JTOA 4XHJD 3BPLC 3OKLB 1IC5L 4ZD3L 4JZJA 4YDKH 2F5BL 2YD9A 3OL2A 3IS1X 3RUGE 4Q2ZB 3G08A 5E8NA 1AO7B 4JO2H 1YEJH 1GPOL 4D2NA 3U7YH 2R0KL 2VQ1B 4OZFH 4POZC 4PJEF 5F1NB 1I8MA 3VRJB 1JZ4A 5F7EH 4GW1B 2X89A 4ODUB 4JFFA 1KPRA 1BZ9B 3L5WB 4YDJB 1TQBC 5E2TL 4DKFH 4L4VD 3UPAA 3PHSA 1AQKH 1FFPB 1RZKH 3LD8B 3QIBB 5TDOA 2A6KB 1G6RB 3VXMB 3FQTB 1D5IL 2UY6A 5B21A 1A7PL 2QR0B 1Z9SA 3UXFA 3VH8G 4J4PA 3ESUF 3FO1A 2EYTB 4LLYA 5CKGA 3RBGA 3W39B 5BQ7A 1J0HA 2V2WA 1KN4H 1G7MA 1JPSH 3T77B 2PTTB 1W72A 4L8DA 3VFVB 4Q0XH 3QFJE 3UJIL 3VG9B 4HJ0D 5D7IE 3U0WL 4Y4FC 2CIKA 3OHXB 4IRZH 3VXRB 3H7LA 5KANG 4DVRH 5BS0A 1KLGB 3GSVA 2GSGB 4HD9A 1WIUA 1RULH 3NCJL 3EZJB 5GS3A 1VADB 4I4WB 4AEIH 2X6MA 1ZK9A 4R97B 4D94A 1ZHBA 4B7LA 1IEBB 2V5YA 4KMTH 1U92B 2YEZB 1AGCA 1NBQA 2VH5H 3D0VA 4EJ1C 2V6HA 5DJZB 4W6WB 3U36A 2P7TB 4I3RL 4WFEE 3B4NA 1B0RB 3HZKB 4K9EH 3D69A 4RX4A 4Z95L 2NXZD 43CAA 4XVJH 1S7VA 2P46B 4HIHB 3ULUL 1Q1JL 3VU2A 4CMMB 4TVPE 2B4CL 4GO6B 5HGGS 3CFKB 2C1PB 4P2QA 5DQDL 3T1FA 3LKPA 3BWUC 1HHIB 1CICB 4LLMA 2XXMB 4PV8A 1IGFH 1A7NH 3KPPB 2ADGB 1KEML 4M1GH 1Q72L 2FR4A 1SBSL 3C60A 5IFJB 2PW1A 4NHUB 2DL2A 3JWOC 4TUJB 3LVEA 2Y5TA 3G6DH 2A9NL 4NHCH 2MMXA 2B5IB 9CGTA 4YE4L 5DZOA 3DBXA 5A43C 4MA1C 5E99L 1XCQB 4IBLT 2BNQE 5I8EA 3QXDB 4WV1A 4PJ9A 3CZFA 2P5EB 5GPRA 4QHMB 4P59L 3PWPE 1IQWL 4OI8A 5BW7C 4H1LA 1L0QA 3S37H 4M8QA 4HS8L 1I7UA 1A7OH 5EN2A 4PJ8A 4XAKE 4Z9KB 2ADFH 3VXTA 3VRLE 5ALCH 3SGKA 1J0KA 4L29A 1KB9K 4WJ5A 3ULUF 4DGIH 1TZHB 3QG7H 4LK4A 1EH9A 1WEJH 3D2UD 1ED3B 1EEZB 2EH7L 1KXTB 1I8LA 3CSYA 5DEFB 1IE5A 5EZJB 2WUCH 4PRIA 5JHDE 3CCHB 4LFHD 1N0LA 1GAFH 4N0UA 1QLRA 1VFMA 4X6FA 4ZPVB 1S5IL 3BUYA 5TDPB 1PG7W 1JPGA 3VFGH 4BH8B 3S7GA 1DZBA 3EO0B 1G7HB 5HBBA 1UT9A 4KUZH 5L6YL 1PBYA 5KSAB 1OTSC 3JWDC 3H3PH 4U0RC 5FGRA 5D7JA 3GSXA 5D72L 5MERB 1Z9MA 1QSEB 1ZSDA 4LHUB 5EUOA 3UTSE 3GIVB 1FVDB 5HJ3B 4CW1A 3FZUD 3DVGA 5CWSA 3L7FB 4Y2DA 5KTEH 2XZAL 5DD3L 2F54D 2BY0A 3BMWA 1CFQA 4JZOB 3FB8A 1U41A 3MNZA 2MPAL 4JPKH 2OS7A 3GMNA 1JF1B 4WUUB 1A2YB 3GMOA 1G6RH 1D5ZA 5CEZD 5GS1B 1TPXC 4RQQA 4P57B 1BF8A 4GMTH 1MCSA 3SE4A 5GGSY 4TUOA 3UTZB 2VC2L 2OMBA 4RA3A 2KZWA 4DKAA 4LCWB 3WXWL 4XPHL 4C83A 3RI5K 2GITB 5JXEC 1Q0XH 5FOBA 3ABZA 3T0ED 3HE6C 1OCWH 2FL5B 5HYQA 3TWCH 3VXNB 3VFMA 1JBJA 3TCXA 1Y6MR 4LSSH 2DMBA 4IHOA 4YQXH 4HAGA 3SN6N 4ETQB 1F4HA 2J5LC 5C07D 2RQ8A 5ICZA 2CRIA 3P9MB 4X4YA 4Q7DA 4XZUB 5DF0A 3PGFL 1T5XA 2VQUA 4X6EB 2VLLA 3HPLA 2D03L 4X7FC 1FVEA 3LHPH 3CFCH 4LVOC 5DEZA 5HVWA 1Y18B 2GAZA 12E8L 4PJEE 4K23H 3HAEA 4R8WH 4JRXD 2P47B 4NRZB 2NW3A 1OT2A 3KPLA 5E56A 3QDGB 1TVHB 4DQOL 5E03A 4NFBA 1YA5A 4OD3H 1C5CL 2AJXL 3BYTA 4JFDE 4UT9L 2YD3A 4E9LA 2NW2A 3HLAB 5K59F 3BRFA 3VGAC 4C4KT 2FEEI 4KMLB 4OZHB 1MFEH 1RZIB 1DBJL 1NCUA 3HKFA 3MACL 4X7TA 3IAQA 4GRWF 1JRHI 4WO4D 1MAML 5ANMB 5IOPA 2UZYB 3NH7L 4NO3A 4YHPA 4P23D 5DD5H 2DYPB 2C7UA 2R2HA 4KY1L 1SJHA 4JZNA 4XNMA 3RGVC 3ULSA 3SBWC 2JB6B 4WDIB 1MFCH 2QQKL 2ATPA 2YPVH 8FABB 3IRZA 3R06A 4LRIC 4FHBD 4OFDA 1G1YA 2C1OA 1EBAA 1DUYA 1RIHL 1TCMA 2H6PA 4QKXB 4XH2A 5CP3A 5LVEA 1CDCA 2VISB 1N4XL 2ESVE 3C08H 5FECA 4DZBB 3QDMD 3C09B 4QT5B 2M1KA 4LPCA 4EXKA 1LO0L 4R7NA 1NJ9B 5ERWA 5GRUL 4NFDA 3N1FC 3CVHL 1EO8H 1FYTE 3P0VH 5AYUL 2HFFA 1F3RB 1IQDB 2P1YA 4OKVB 5LJYH 2HKFH 2YRZA 3GI8H 3MJ9A 4HIEA 4R26H 4KUCF 3RTQB 1U9KA 5J4MA 4ZYKA 4GQ9L 2Q8BL 1U8QB 4ZFGL 4GG6A 3IJSA 1JUFA 3O9WA 1ZTXL 5DHXB 1YEFH 5HVFB 1KJMB 4QXWA 4Y4HD 3IXTB 1EJOL 5JORA 5JPMA 3FQRA 3U6RA 5EZIH 1T0NA 1NDMA 2XZCL 3B5HA 4ONFH 4S1RL 3QJFB 1S78D 3BPOB 3ZKND 5FA4A 25C8L 1PLGL 4OCYL 3PL6C 1K4DB 3FO2B 1L9MA 4O2FA 2PXYB 2VITA 1NCNA 4JY4B 2APWA 3NIFF 2NXYB 3L95A 4PTUA 1KIRA 5IWLA 5JOFB 3H2WA 3AUVA 1WC7B 1G7QB 2VZ3A 5IHLB 2F19H 2ZPKL 4KKCC 4M5YL 4JRYB 2XRAL 2PN5A 4HKXB 3GSQB 3U9UB 3ZO0A 3EDKA 5CIPA 1KT2A 4X5WA 4JJHA 3C9NA 5FYJU 3IFOA 4H0HB 1DQJA 2BDNL 2CDGA 2NY2B 5DI8A 1I1CA 3QZWA 4ZUSA 4ZUTA 3H9ZA 5DSCA 2H1PH 2XPGB 4LCIL 5A16B 1V7MH 2VDQL 4UIKH 2ADIA 3ULUE 4MB4A 2EIDA 3H42H 3JBG7 1Q94A 2R56L 4QRTA 3GSRA 5F1IB 1FC2D 3O6FD 2HN7B 4ODVH 4NO0A 1R24A 4MHHG 1XGQA 3KWWB 2DQUH 1T3FB 1NLDL 4NSKA 2VR4A 3VFWA 1H3VA 1WBZB 4LSPH 5GJSH 2A6JA 4PS4H 3GSUB 2DQCL 3OKNA 4NGHH 3OPZH 5E94B 1HH6B 1RV6X 3RKDC 5KW9L 3C5JB 2OR9L 1SQ2N 2ZCKL 4C57C 4RAUA 5T3ZD 4I0PD 3RNKB 5IFAL 5C1MB 1CE6A 2VL5A 4YJZL 1FORL 4OF7A 3MRQB 2A2QT 3FQWA 2LV4A 2V2XA 3M17B 4QHLB 4KJPC 4Z7OE 2I5YH 4JPVL 2DOCA 2KZ1B 5E2WL 3GIZH 4JM2C 4C56E 2FLBT 2ZCLH 4Y4FB 3FQXA 2D2OA 4WI4A 1D3CA 1N6VA 1WTGT 5DXWA 1W0YT 4TSAL 1IFHL 2BVOA 35C8H 3BDYH 1L0XA 4I18C 4PB0L 3IDJA 3PQYA 4EQ3A 2FBJL 2VXVH 3RIAF 1BD2E 2HJLA 4X8JB 2FATL 1MHCB 5CZXD 4WEUD 5ID0B 4GLRH 1SEBB 5D1XD 3BPNC 3BSZH 4LQFL 5K9KA 4MZ2A 5EZOH 4LAJH 4HH8A 1ZT4A 3SKJL 1RJZA 5AZ2L 4GBXA 3U83A 2H32A 3BT2H 1JTTA 2DWDA 2AK4A 4OZ4A 1RURL 3MRIA 3O4OC 1P84J 3RWJB 4YGVA 4R7DA 4Y5XA 4Y16D 5FCUH 2QQQA 1ZT1B 1R5IA 3HHRB 1IMHC 1UGNA 3TN0A 2E7HA 1U8IB 1ZGLB 4WY7H 3FQUB 4CRPA 2EXYC 1FFNA 1GOGA 4DZ8A 1P4IH 2LTQB 4ENED 3BP7A 3KJ6L 1NAMH 1KJ2B 1TNNA 4AT6A 3WEXA 1KC5L 3Q5OA 4XXDA 2R0ZH 1LO4L 2YR3A 4FZ8L 3DGCR 4PRPA 1ONQA 1W0WB 4L8CB 4MA1B 4E42A 5JW3L 4HUWB 2Q3ZA 4EUPG 4FP8H 2XTJD 1CS6A 5EWIL 5BRZB 4CVWA 2NY0C 4MJIB 5KS9A 5DJ0A 4L3ED 4UTAL 3B2UC 4HWZB 2DDQH 2Q3AA 5DO2D 1K8IA 1DANT 4JY5L 5D7LE 5K59E 1PDKA 3BD4A 3U4BH 2V2TB 2YMXL 1NGQL 1FL3A 3MNWB 3TNMA 4GRWE 4PJ7B 2EYSA 2CK0H 4ZAKC 1PQZB 5TE6H 3O2DL 3P4NB 1FFOA 4Z8FH 3D6GA 4OIIL 4JGUA 5HD8C 1CGVA 1DQMH 1FSKC 2R2EA 1IGMH 1B4RA 3LIZL 2DTML 3PV6B 5DFVD 1P2CA 4GLRI 3DROB 4YR6B 5KAQG 3ZE2F 2J88H 4NIKB 4U6YA 4EVNB 3B3IB 2IALA 5J3HC 5I66B 1FCCA 3I6KB 1DANU 2JELL 4K7PL 1N8ZA 1X6LA 3QIUA 4XPFH 1LP9A 4PV9A 3JV6B 3BKCH 3WFCL 5IB5B 1P7QA 3QQ3B 4DFIA 4U0RB 3DMMC 1K6QH 5JO5B 3WN5B 2KH2B 4ACPA 2Q6WB 3L3IB 3AGVA 1YUHA 4JGMA 3RUGA 1H3PH 3K3QA 3QFJB 3ARDC 4RMVA 4DVBB 1G9MC 4U1SA 5ABDE 5BXFB 2FD6H 1QFOA 2BERA 4CMHC 3IETB 2JIXB 4F3FB 1I3VA 3TT3H 2HT4D 1CGSH 1EEUA 1EFXB 4F7EA 1A1NB 1TZIB 4IRSD 1TPXB 2W9EL 4D9LH 3C87A 3QEQE 1DBAL 2GJZB 4NRYA 3SE8L 3V6ZA 2VDML 3S96B 4AIXA 2UYLB 4JZJC 1ZHKB 4N0RA 1FBIL 1R0AL 1UADC 5JW5A 3DUSB 3I2CL 2GCYA 2VXUL 1CQKA 1AE6H 4JRWA 4OIBA 4OZIB 1F4AA 3QG6A 2QADC 1QFHA 3F6IA 3EFDH 2P8MB 3ZL4L 3QDJD 3LV3B 5E0QA 4EI6B 5ESAB 5EU6B 2X1PA 3JV5A 3C6LB 2UZIL 4DW2L 2DL9A 3WYRA 5DRZA 3VXSD 1UA6H 1CXEA 2PW2A 5CJOH 5DUMH 4PJXF 5LQBH 4JFZL 1DE4A 5HGAA 3DRQA 5C08D 1BQHA 2ADJA 5HYJE 3CGTA 4O02H 4LVOB 4J4PC 4ERSL 4P46A 5IBTL 4PJCB 1C1EH 5DJ8B 2I9LB 5FHBH 1KCKA 2Z31A 4D0BA 1I3GL 4MDJB 4OGXH 1EEYB 3HTLX 2FGZA 2IAND 5I1CH 1JPTL 1SY6H 1C7TA 5J9PB 4XC1L 4UQ2B 1RZGB 4Z7NF 1TVBA 3PWPB 3BGAA 4KDWA 3E2HB 1YMHA 2XN9E 3O3EA 5DC4B 2YD4A 4BSWA 1I7TA 4JFXA 3RGVB 5FK9A 3VFRA 3AB0B 1T2QL 4ODHL 5FKPB 2NY3C 4JDVA 3ZE0F 3JWOH 3QEUB 4CGTA 2LFGA 1KJ2H 2LVCA 2G60L 3OR6B 3IJYB 3UTOA 3ARBB 1EHAA 1H9VA 1MIMH 1MF2L 1HQRB 1KIQB 1CLOL 4OGAD 2AJVH 1IARB 4LSQL 3VXPB 3O2WL 1KTDA 4HFUH 5IESL 3QWRD 3ZSTA 2DJSA 4DKEH 4RFOL 5GZOD 1QTYT 5I15L 1NBYB 4G5ZH 1A9EB 1CK0H 3KPRD 1VFUA 4HFWB 1PW3A 3STLA 4NQXA 15C8H 3HC3L 2NTFA 1Z5LB 3IS0X 3CMOH 3MRHA 1AXTL 2W1NA 3RVUD 1MRCH 5ALBH 3C60C 4QRRB 5C09B 4YXLH 3QI9B 1S7TB 3O6KH 1PKQA 3S88H 3T3PF 2HH0H 4RGNC 1CFSA 1T6VN 4ALAH 1QHOA 1F6AB 3VD4A 3QIWD 3ZDYF 5F93C 3F5WB 3OAUH 4KK9D 4MJ2A 4I3GA 3T4YB 4R4ND 4OB5H 4WV1C 4AM0A 4PJ9C 4NN5C 5D7SL 5IVXE 4G9FD 4LIQL 4AEHL 2A1WL 4O4YH 1HCFX 1DEDA 1QVOB 3DXAB 3U9PL 3RWDB 4I2XE 4PJ8C 4JVPA 4F57L 4TNVK 2FJHA 4LCYB 3B2VH 4PY8I 4M6NL 3ALWA 3SGKC 4QRSB 3JWDH 4KMQA 3OKOB 1HXYB 2A73B 5SWSA 3IFNH 1AC6A 3FO9A 1RQ5A 4XMLH 3RPIB 1UFUA 1I8LC 4PP1D 4Z78B 3GRWH 4PD4K 1IEAA 3DIFA 3CXHK 3UTSA 1RUKH 4NQEB 3P2TA 5C0CD 4WRLA 3NCFB 5DEGB 3VFPB 3OGOE 2IBGA 2VSDA 3UC0H 4MD5A 5AZEH 5SWZD 4E41B 3LRHA 3QHFH 3D85A 5FYKU 3RDTA 3JVGA 3J7HA 5L9DL 4NNYB 1RZ7L 3LPGA 3S34H 3UMTA 4PRHE 4RSVA 1B4JH 1C5DB 4KC3B 1UENA 3ZDXF 1HDMA 1A14L 3ULVD 3GHBL 5D7JC 4YBQC 1DBBL 4OLUL 4R2GC 4M6MH 1K5NB 4GAYA 4MDIB 3ZE2E 1DQLH 2ZUYA 4LSUL 4G80B 3QUXD 2D7MA 1EVTC 4OFKA 4PREA 1VGKA 5E5MA 4Y2DC 3KHOA 3OGCA 2C3VB 3RZCA 4BFIB 3QZWG 2R2BB 2I9TB 2DBLL 4N0YL 2R1XB 3Q3GB 3ARXA 4Z0XB 2FX7H 1T4KA 3TJEL 2VAJA 3SE4C 1EGJA 5T1KA 5FB8A 4U49A 1KLUA 3X14A 4HV8A 4ZUVA 3QPXH 3QPQD 1FG2B 4RIRA 4HMEA 1OAXL 1ZLSH 4MNQE 2XOTA 1MCEA 1RZ8A 2ZSVB 3B9KA 1D5BA 3CFDB 5F44A 4GXUN 2R4RL 4OLZL 3SCMA 3BE1H 5C0AD 3KLSA 4X4ZA 1IC7L 3BPNB 1MSPA 1P7KB 4P9MH 1KPVB 2BC4A 3UPCA 1SYVA 4H20H 4PJ5E 4JFYB 1S7XB 3KPOB 2FEDC 4Y1AE 1QFUH 5DUBB 4HJGA 1H8SA 4NYLB 4HCRL 1Q9KB 2BY2A 1PSKH 5ITFA 3MNVB 5JA9A 4OQTH 2FHCA 3SDAB 1AKJB 5DJ6A 1YMMB 1NFDA 4XPGH 5IJVB 1NCAH 5TFSL 1BLNA 3EO1B 4XNUL 3BDXA 5J13C 1NGZB 4PJXE 5F7HA 1QR4A 3OF6A 4HS3B 5CHNB 1T03H 3MLUL 5B38G 1I8IB 5BVPL 5I1AB 3WUWA 3QWOB 2J12B 4GMSH 3U2SA 1MUJB 2VAAB 5T33H 3EGSB 2VLRA 3BEVA 2X70A 3MO1A 4CJ1A 1P6FA 4IOFD 2NY0B 5HHOA 4K3JL 3DGGA 4WTZG 4Z76B 1DUZB 2DQFB 4JFQB 4OAWB 2DAVA 3NAAH 1FPTL 2N7BA 2OP4H 4Z7NE 3MR9A 1PEZA 3EYFB 2YD8A 1HYSD 1X4YA 2I07B 5BVJB 3QUYD 2JJTA 2NY4C 5FA3A 2EDXA 4ZAKB 3RWFA 3VFUB 1KJ3L 1ZHNB 1MJ8H 1VGEH 3V7AE 1HN1A 4LOUD 5IF0B 4P2RB 1JWUA 1FSKB 4O51B 2Y9RT 2EE6A 2BSTB 3LN4A 4UINH 2R69H 1KLFA 4PJDF 3ZE0E 3BIAX 2YA2A 1HH9B 1QKZH 1UKQA 3EJYD 1U3HD 1FVCA 5K9QI 1IC4H 1BFSA 3N06B 4YFEA 5F97E 5GGTL 4FFWC 2LABA 2WWMD 3OKDB 4HBCL 4K94C 5E8PA 3LS4L 3C5SA 4WW1A 3SO3C 5J12B 4QYOA 3O9WC 2P24A 2Q87A 2FGWH 1J8HA 1T5WA 1A3LH 4Y19D 1CTNA 4YGAB 4FXKA 5GSRA 5HY9B 1B9ZA 3TCLB 3V5DB 4AMKH 3CXDH 5JW4N 2Z93B 3OG6B 3LRGA 3HUJF 3QO0A 5MEQB 4WFGD 4JHWH 5ACMA 1AR2A 1N3NB 4HKJB 1JNNH 2VSCA 4HWNA 2A6IA 2VXSL 3EIFA 3FN3A 1I1AA 3ARDB 4C56B 4LASL 5INDB 3T3PE 4J8RA 5IUSA 4CMHB 5HDOA 2BVUA 1GHFL 5I1EL 4UOW1 2CKBB 5FYJL 1E28B 5IWLC 2BXZA 1QSVA 3ZDYE 4HK0A 3D39E 5L7XL 5DTFA 4MQXC 1YY9D 5ADPH 4NO5A 2PR4H 2ZCHH 2D0HA 5IV2B 3RWGB 3I3BA 1JZ5A 2DI9A 4HWEL 1F8TH 3EYUL 4HX1B 3DV6A 1LQSR 4Z7VF 3UPRA 2B1AL 3I85A 3GK8H 3OAYK 4PTTA 2KQMA 4L5FH 4KKLD 2P5WD 5GS0D 5E8NB 4P3DA 4BSVA 4U2YA 2G9HA 1GYAA 5KSVB 2UWEF 1WFOA 4MD0A 1E4KA 1GGYA 2QADB 5F3BB 2X44D 1I8MB 2BSSA 1KPRB 1MCPH 4ODSL 2G5BA 4QXUH 4JAMA 2HVKA 1KEGH 3VW3H 1B6DA 3U7WH 4M1CC 4RISL 5MP6L 5TDOB 2F5BH 1WICA 3VFTA 2H9GA 1IEHA 1U3ZA 2VZ1A 2H45A 3ES6B 4L4VA 4S0TD 3NN8A 2QQLL 4G8IA 1ZVSA 3FO1B 4YNYA 1ZLUK 1FFQA 3ARGA 4LLYB 5BCAA 2BNUA 3QAZC 4DFHA 1VPOL 1G7MB 3K8LA 4POZD 5E2TH 2DKUA 4L8DB 2EDKA 4L8SA 2VXTL 1LGVA 5DGQA 4LSTL 1JPST 3L5XL 1DP0A 3VWJB 4LIQE 5C3LD 2CIKB 5DK2B 3O41A 2X4RA 2E9JA 1JNLH 5BS0B 3FFCE 3MX0A 5FO7A 3UTQA 1JK8A 4ODTL 5DUPL 3MRBA 5HGBB 1KTLB 4WCYL 4ZO7A 4GRWB 1E0OB 2OR7A 4BJLA 1ZHBB 1UM6L 5HI3D 4YUEH 2NY3B 3D0VB 2IADA 5L88L 5GGRA 3BN9C 3GM8A 1OP3H 3LKQB 4GBXC 4LNRA 4FQQA 4M7JL 2CXGA 1H3GA 2Z92A 3D69B 2GFBB 3D87B 1HIMH 3BGMA 5HYEA 2D9CA 4Y5XC 3DO7A 2NY6B 3PE9A 3KDMB 3VI4F 3GM0A 5EO0B 3BVNA 3W82A 3T1FB 3TN0C 3LKPB 4BELD 4LLMB 1WBXA 1XZ0A 4PV8B 4XVTL 4G6KH 4O00A 3T09A 2HRPL 2FR4B 4P3CL 5GHWL 1ZGLP 1MY7A 1LEIA 4FZEH 2PW1B 2G5RA 2Y5TB 4WENB 5ISZD 5AUMA 1QBML 1UZ6F 4RCAA 1U8LA 4XCYA 1QSZA 4P9HC 5BO1L 3NCEB 2PETA 3DBXB 5JHLL 1FHGA 5I8EB 1MPAH 1SMOA 4PJ9B 3K1DA 4WHCA 5ACZA 1TJIH 3MFGB 4H1LB 4I5BA 3LEYH 4M8QB 5L8LB 1CFTA 4JLRA 5EN2B 1OAUL 4PJ8B 4YDLC 3DYPA 4XCFH 5C0ND 2A9NH 5F7NC 2V5RA 5FGCB 4PGDA 4HGWA 1FP5A 2ZSWB 3O3BB 2R9HC 2CJUH 4U2ZA 4LQ1A 4ORGA 5TQ2H 4WJ5B 2MCG1 2HJFA 3OJDA 4MXWL 5DJYA 3QUZD 3DHMA 4JO3L 4XBEL 1RHFA 2AXJA 5J1SC 1IQWH 3DYMA 3HG1D 4PRIB 3VD9A 5KG9A 3EFFA 5J6GB 2CKBH 3CX2A 3D2UA 4N0FA 3FB7B 1QLRB 4X6FB 3RHWK 2NY5C 2ZNXA 1G9NC 3EJJX 3QIUC 4HZLA 1GZPA 1DQDH 4HS6A 4HW6A 1ZEAL 4FMKA 2KQNA 2OX5A 2V5TA 4XXCA 5H35A 3I50H 4PJDE 1KSRA 5D7JB 3GSXB 5CZVH 1E4WH 1YECL 3MRJA 4JDZB 1ZSDB 4GW4A 5EUOB 3SKUD 1IT9L 1DL7L 4K8RC 1IILE 2BHUA 2C5DC 1CGTA 4NQVA 1T66C 3WKNA 4CW1B 4S0SD 2DS4A 3SJVD 2ZG2A 1IJ9A 4KFZC 5DR5H 5L6YH 3FB8B 3MNZB 4R96A 4CN4A 3GMNB 1QACA 4OFYD 3GMOB 2XKSA 1D5ZB 2FYYA 2RFXA 5IG7B 2F54A 5GRJH 3B6SB 5D72H 4V2CB 2PYED 3HUJE 4G43A 4KHTL 4TUOB 1JGLH 5ENWA 4F9PA 4C83B 1U42A 4Y5VA 2VKWA 3V2AR 1BGXH 1SJEA 1A6AA 3GSNA 4CVXA 5FOBB 5KZCD 4X83A 2AV7B 2OJZH 3FB5B 2E3VA 2EDLA 1OSPH 5HVGB 3HRPA 1R5WA 5ESVA 1T80A 5HYQB 1AXSA 1CU4L 3HFML 2H3NA 5JDJA 3VFMB 4JHBA 4AQOA 2DQJL 3UEZA 4J6RL 1NCDL 3OJ2C 1AD0A 4XPHH 5FYLL 3PP4L 3MLRL 4Z7VE 1T5XB 1WTLA 2VLLB 5KN5A 2IPUK 1FVEB 4GRWH 2WLZA 2PF6A 4GOSA 2DI8A 4TUKL 1S7QA 5F7DA 5FYKD 5C07A 3V4PH 5EO9B 3WXVH 5JXED 1MWAA 2UWEE 4P46C 4QHUA 2GAZB 2OI9C 1F2QA 4L4JA 1FE8L 1XAUA 3HAEB 3HE6D 2NW3B 4G6FB 2IPUG 2Z31C 4R0LA 3LQZB 1A1MA 2O5YL 3B9AA 1V3LA 5C6PB 4JRXA 1T7YA 1MQKH 1CQYA 1KN2L 5JXAH 5DT1L 4MGXA 3WFHB 4X7TB 4LDEB 3DTXA 1R3LB 5IOPB 2E6JA 5C2UB 4YHPB 5CZKA 4NO3B 5B22A 4FQPA 5FYJE 3KYMA 2C7UB 5BMFL 1MCJA 4WNQA 3OR7A 4R9HA 4JZNB 4XNMB 3ULSB 1ULVA 4JN1H 1NCBL 4WO4A 5LBSL 2ATPB 2NX5B 2OZ4L 3R06B 4UTBL 2C1OB 1DUYB 4RRPA 3MLSL 4P23A 4OF8A 5J1AA 4XH2B 2C3GA 2AJ3A 3LB6C 1NKRA 2QJDA 1DBJH 5I8KH 4X4ME 3EOTL 3QULA 4F8QA 1IGYA 3QUML 2NY4B 4WI6A 1H5BA 3HMXL 5HPMA 4M02A 3WUZA 3QDMA 2WK2A 1XF1A 4R7NB 2ZUWA 5ERWB 1QLEH 2QQKH 1BZQK 1FGVL 5IVXA 2D0FA 4H1LH 3O2VH 4L8BB 4JG1L 3MUGA 3EDEA 4RFNC 4UDTA 5E6ID 2HFFB 1KACB 5AEAA 2D7QA 4URTB 3BIBX 3WFEH 1ZANH 1N59A 2KBGA 4HIEB 1A0QL 2VZVA 4L3CA 3WLBA 3QR2A 2FWOA 3PNWA 1JI1A 4ZYKB 5C6TH 4OD1H 4ZNEA 1Z6JT 4JDTH 4J3XA 2NR6C 4JG0H 3GBMH 1T83A 2F53D 4GG6B 1FIGL 1FJ1B 3IJSB 1KIPB 3O9WB 1AJ7L 1I9RH 4XVSL 3VI4E 5JORB 5HHQA 4NNPL 5JPMB 3FQRB 2JLLA 1LHZA 3U6RB 1T0NB 1UWXH 4LEOA 4XP6H 4F9LA 3FOLA 3L5IA 4FFYH 4HUUA 4RWYH 4Y4HA 4YHZL 5FA4B 3H0TB 1CDJA 3MREA 3FRUB 4O2FB 4HGMA 4RMRA 4XCEA 2I60H 1KCRL 3L95B 1XIWB 3HMWH 2CGRL 1UZ6E 4PTUB 5EH1A 3BN3B 1KIRB 4MNQB 1HHHA 4DK3A 4TULL 3FTGB 1EJOH 4H8WC 3NOIA 1NQBA 4FG6C 4KK5C 4LAQL 4XX1E 4QRPE 5CIPB 5B39A 4PJIA 1JGUH 1KT2B 2Z91A 4X5WB 3C9NB 3VWKD 1DQJB 2CDGB 2QV2A 3HPJA 2F5AL 1DSFH 4ZUSB 3PL6D 4ZUTB 5DSCB 4LSRL 3RDTC 1WJ3A 3JVGC 4PRBB 3RQ3A 2ADIB 1SJXA 1YPZA 3U7AA 2XA8H 4O5LL 2Z9TA 3VA2C 1VFBA 1Q94B 2EIEA 2V7HA 4QRTB 1GSMA 3G6JA 4YC2C 2EDBA 1M7IA 1FZJA 4OM1H 1MI5D 1JGEB 1SYSB 4NO0B 1R24B 3K4AA 4FABL 4PLJD 4YHNB 1A1OA 3W11D 3VFWB 1N6QH 2A6JB 4HXAL 3OKNB 4PJXB 4XGZA 5C0RH 3WV0A 1RHHA 3BAEH 3O6FA 3RZCC 2BMKA 4Z7UF 1F3JB 3K74B 5C0BE 4PGBA 4LLQA 3SGJA 1CE6B 2HFTA 4M7KL 4F33A 4LLWB 3K2MC 3CVIL 1Q8MA 1I85A 5KOVC 4U6VL 2V2XB 3UZVB 1CZ8L 5JLZA 5IM7A 4I0PA 3CDCA 3RVWD 3B9VA 3FQXB 1C12A 4FS0A 2G75A 3ILPA 3C5ZD 4WWID 5E1AA 1CXHA 1FL6A 3HAEH 2NNAA 2BVOB 3B9KC 1E4XL 3MV9B 4RAVA 1NL0H 5CCKL 4BUHA 5C6WH 3IDJB 3PQYB 3UTTB 2N4IA 4P3WA 3SCMC 4UNVA 3IU3A 4JPVH 4G6JH 2CMRH 5K9KB 4V1DD 1JMXA 4AQ1B 2EDYA 3VDAA 3O4LA 4M9OA 4GBXB 3VGDA 2H32B 4ZFOL 1WLHA 5JQ6L 2DLFL 2DWDB 2AK4B 4OZ4B 2F8VA 3MRIB 1CR9L 2VZUA 4YGVB 4R7DB 4U1MA 1DVFD 1MJ7H 1R5IB 2FATH 5GGVL 3TN0B 5KVMC 3L9RB 3OZ9H 3QFDA 2X4OB 3QO1B 1QRNE 1YC7A 2FRGP 2JB5L 3UO1L 1GGIL 4LGPB 4MA7H 4DZ8B 5AZ2H 2JKXA 3BP7B 2VLKE 3PWVA 5DZNA 2OJEA 2CSPA 4WIQA 3K46A 4AT6B 3JSSA 3TFKC 3RKPA 3WEXB 4XXDB 3D48R 3RWEA 1NMBL 2HTKC 4FNLL 1JHKH 2D7TH 3UP1A 1I9IL 4PRPB 1KB5B 1U6AH 4Q97A 4E42B 3V0WH 1AGEA 5EUKB 4N0CC 1YYLL 5KS9B 1I4FA 1VENA 3T0AA 1WBYB 3KJ6H 2UUDK 3RAJL 4ZTPH 3MUY1 2EXYD 1QYGL 4KI5F 5T1DL 4YDLB 1LK3H 3ALPA 1UYWH 4WFFD 3TNMB 1URLA 3TA3D 1ZHLA 2JJTC 4L3EA 2NY7L 4RBPH 1ETZA 4AG4L 1IGCL 4FZ8H 2B1HL 1FFOB 1CBVH 3TBYA 4KTEL 4JO1H 4FFVC 5FIEA 5BV7B 1F97A 4YK4B 3WO4C 1TVDA 2R2EB 5E9DD 1X5GA 3KXFD 3X13A 1P2CB 5DD0L 5K93A 5FYLE 1ERNA 5EULV 3BZFA 2I25N 2D31A 2IALB 3VXOB 3W0WE 1WZ1H 5I1GH 3BP5A 2R15A 4TVSa 1NGPL 1N8ZB 4K3EL 3QIUB 1JCKA 3O2DH 4PV9B 1I8KB 4OF3A 4G6ML 3P11H 5CIPH 1P7QB 5D6CA 2E7LA 4P5MB 2VUYA 3L3OA 4WUKL 3ROOB 1GOHA 2D9QB 1CYGA 3MRMA 4IOIA 1VKXA 1YUHB 4YO0A 2R39A 1N7ML 1RUAH 3KNBA 2VZTA 1I1AC 4OCRH 4XB7A 5I8OL 1OWRM 4K7PH 1BVLB 4U6XA 4Q74A 3TPUA 1IM9B 3WFCH 4X6DF 2YPLB 2W38A 3LKSA 2QSCL 3EYSH 4MMZC 1DFBH 1OAQH 4F7EB 4K71C 4X7SL 2LU4A 4OCSH 5D71L 4NRYB 1LWRA 4OLWH 5A1AA 2CO7B 3V6ZB 5JOPD 3OB0K 2YA0A 4HLJA 1KXVC 4UQ3A 4IRSA 1X5XA 2VDLL 2GCYB 1QFPA 2Y07L 4K7FA 3ARVA 4WEBL 3SDCD 3T4AA 4XHJC 5IJKA 4LPTA 3QG6B 1E4KC 1JPFB 5M94B 3CX5J 1X9QA 1LEGB 5AWNH 2EYRA 1WV7T 4U6TA 4YDKL 3B8YA 3OXRA 3REVA 1QBAA 2C3HA 4E5XB 1HQ4A 5DRZB 1QPPA 2PW2B 1YEJL 1FBIH 4JO2L 3T1WA 5C92A 1WFNA 3U7YL 5A2LH 4OZGF 1DE4B 4QXGH 4O9HL 3ARYA 5HGAB 3DRQB 4G7YL 3IDNA 4UIMB 1BQHB 2ADJB 3BKJH 5F7EL 5ETUA 3LKNB 1ZAGA 4P46B 3VXSA 3D9AH 2OI9B 4N90D 4A6YL 3ARGC 3ZHLA 3GSWA 5D1QD 1TQCB 5LAXA 4DKFL 1AQKL 5C08A 1BEYL 1JGDB 3PXHA 4LMQE 1T1XA 1FZMB 1RZKL 4JE4B 4D0BB 3OQ3B 4L8SC 4NQSA 2X2YA 4PBVC 4JFFD 4U1NA 2H32H 1EMTH 3KS0J 4F58H 3RGHA 4NO2A 1TVBB 2DQTL 1E6JH 1YMHB 3NFPA 3O3EB 4X6CF 4KZDH 2IANA 3IFLH 4L9LA 2EDHA 2D7OA 4HJ0C 1KN4L 1JPSL 1WITA 3HR5B 4BSWB 1X7QB 4Z7UE 3L3DA 3O6MH 4PLNC 2JJSA 3MROA 5I8CA 4JFXB 2HLAA 4XNXH 1I3GH 4J4PD 5FK9B 3HR6A 3THMH 3S9DB 4WHTA 3GMMA 2GUOA 4JDVB 4IRZL 1UH2A 4DVRL 4NPYA 2ARJQ 3K7UA 4FXGB 2Q7NA 1RULL 5FUZH 4JN2B 4P9HH 4X0KB 4AEIL 1KTDB 2YS4A 3N9GH 1KB5H 5D8JH 2VLJD 4LPUA 4HDIB 3RIAK 3SGDH 4KMTL 3CH1A 3T0EE 2VH5L 3FT4A 2D0GA 3GJFA 4NQDD 3QWRA 5MI0C 3STLB 4MQSB 1CF8H 2NXZC 4RFNB 2BRQA 3X3FL 4KWUA 3MRHB 4ODXB 3W5NA 3KPRA 2F8XC 3ARQA 4K9EL 4N8PA 2EDTA 4PJDB 3WJJA 3O2WH 4XVJL 1PKQB 3QJHA 1NGXB 5BV7H 1NAKL 4OLVH 1RY7B 2DKMA 1CFSB 4PYHA 5I15H 2RJMA 2F74B 1PYWA 1IGFL 2CKNA 5KJRH 1A7NL 4WW2F 4FFZL 3CMGA 4FTVE 4M1GL 5DLMH 1HI6A 3U4EA 2B2XH 1L7IH 2JTDA 4AM0B 1HNGA 4H5SA 4P2QD 2NY5H 2WIIB 4M61B 1G9NH 5LGKA 4G9DA 1C16A 3G6DL 3L3KB 3OJVC 4NHCL 2P44B 3MJ7A 5C0DB 1INEL 2DQHH 3C60D 4G9FA 1V3KA 4HWUA 2YUVA 3MJ8A 4HSQA 5I71C 4RGND 3I84A 4HG4K 2JK5A 5SWSB 2X9WA 3FO9B 3SO5A 3TT1H 3G5YA 3CC5B 5T1LD 4LIQH 4RGMC 3S37L 4AEHH 4XBPA 2A1WH 1A7OL 2KPNA 2APFA 1IEAB 4MLIA 1G7JA 2ADFL 1UVQA 5ALCL 4Z7WF 4PJHF 3F7VB 4KI5E 5F6IC 1WIOA 5F3HB 3QG7L 4YHOH 1S7RA 1YNTA 3S6CA 4XVUC 5JIHA 3QXAA 3RDTB 4XNZC 3SGDI 5C0CA 4OLXH 1PEWA 2WUCL 1XMWA 1JWSA 4N9GA 4XXCC 4UZGA 1GAFL 5SWZA 2P8PB 5JMOC 3CU7A 2F8OA 3X11A 5CJ8A 4GAYB 3VFGL 4U1HB 1BECA 3MV11 3QCVH 4EDXA 4JFEE 2OBGA 4KUZL 5ESQB 1VGKB 3BW9B 3OGCB 2HFGL 3RZCB 4DUVA 1JVKA 1RZ7H 3H3PL 3F7PC 4YIQB 2FEEL 3QUXA 3BP6B 4HHAA 1MCOH 1JRHL 2IAMD 5FB8B 3X14B 4OLUH 4HV8B 4ZUVB 4F9PC 3ARSA 4MAYA 5JR1H 4Y5VC 4ELMF 5KTEL 5SX5H 4RIRB 3HRZB 4KXZI 4R2GD 5HI5D 3D3VD 3MOBL 4JPKL 1RZ8B 3B9KB 3H9SE 4GKZA 3BEWB 5B4MD 2A74B 1G6RL 4X6DE 5DMIH 1OVZA 4GMTL 4N0YH 4OUUA 4Y2DD 1A02N 3V0VA 3SCMB 5SV3A 1Y0LA 1Q0XL 3DETD 2DM7A 2BC4B 2FIRT 4B5EA 1OCWL 5C0AA 3S98A 3TWCL 5C70A 4IRJB 3KPSE 5ID1A 3QCUL 1UZ8A 4LSSL 4C58B 1LVEA 5ITFB 4YQXL 4I8DA 1CD1A 3BYYA 3G9VA 3ZE1F 5ADOH 3FHAA 5EIIB 4OLZH 5KSAD 1LD9A 5DJ6B 5CBAB 2P49B 1NFDB 2WV3A 4R0LC 4R3SA 4J3TA 5IBUB 3TZVD 3O6LH 1UXWB 5DRXB 1YQ2A 3EW3B 1Q0YH 4ZUWA 4X4MA 3KHQA 5I30L 3LHPL 2CLRA 2XFXA 1U8NA 2E27H 3CFCL 5CP7B 2X1OA 2YBRA 1VHPA 4D9RD 4OZGE 4QCIA 4K23L 4R8WL 1TTGA 4UOW0 3JTSB 3WUWB 4KJWD 4WWKA 2BVQB 3U2SB 2WSKA 4Z0BH 1DLFH 1A4JB 4WUUD 4OD3L 1U8PA 2RHEA 5C0FA 3BEVB 5DQJA 3MO1B 2X70B 1BJ1J 2NTSP 1H0DB 5TFSH 5FHAH 2J6EA 4NC0B 5HHOB 4J23A 2A38A 4IMLB 3LRSA 4P23C 3DGGB 5EO1B 4F7PA 3MR9B 5DD5L 1RZJC 1QRKA 3RX7A 4X6CE 1HKLH 1H5BC 3J8F7 2P4AB 4CKVX 5F96H 2YPVL 3ZHKA 1GL4B 4ZXBB 4HKZA 1IL1A 3WO4B 3QUYA 3V7AG 5GGQH 3LS5H 3E3QE 3LN4B 3AXLA 4L3AA 3BQUD 1CCZA 3AS3A 2EEAA 3NGBC 4EN3A 1OT1A 1QSFD 3SPVA 4CVZB 1IM3A 1K8DA 2W0LA 4LLVB 3RA7H 5E8PB 1L4IA 1T83C 4H8WH 4DCQB 3C5SB 32C2A 1MCWW 4WW1B 1E27A 1U3HA 2P24B 3IGAB 4GW5A 4BUGA 3GKWH 4CN1A 1EO8L 1T5WB 3FMGH 1HILB 4JPWH 4M6AA 3P0VL 4FXKB 3MRKA 2AXFA 2OK0L 5DK0A 3MMEA 3RX8A 2HKFL 4R26L 3PDOA 3E1F1 3S37X 3UTPD 4UUJA 2AERT 4NN7C 2BNRD 2R1YA 1F4WH 4Y4HC 1FZKA 1HHGB 3GMPA 4MA3A 5LGHH 5HGHB 1I1AB 1VFAB 3NZ8A 1FNEB 1VACB 1T7VA 1WIPA 1YEFL 1WCBA 4ZFZB 1EIBA 3ZYJA 3S36H 5EZIL 4HK0B 4MX7A 4ONFL 5DTFB 3DURA 1S9KC 4EZMA 1MY5A 4D8PA 2NZ9D 4NQCD 4HKBA 1BIHA 5EOCH 5C7XH 3HI6H 3UPRB 2MQCA 4PTTB 2H8PA 4U1GC 4P3DB 2G9HB 3SDDD 4MD0B 2R0WH 1VFOA 2F19L 2IG2H 1T1WA 4G8EA 1EGJH 2P5WA 2Z4QA 1FN4A 4X80H 1UJ3A 4YHMH 3MV7A 2HVKB 1N2RA 3EOBA 4ONOA 4PY7B 3CNKA 3V8CA 4CADA 4ISVA 2B1AH 2MHAA 3N1PC 4GQPH 4DTGH 2H1PL 3VFTB 2H9GB 2GTZA 4O2CA 4Z7WE 4KK8D 1V7ML 4L4VB 4UIKL 3P4OB 4QOKD 3NN8B 1YNKH 3HZMA 1FH5H 2VLKB 4G8IB 4PG2A 3H42L 3O6FC 3V6FB 1ZVSB 4YNYB 4HUXA 4BKLA 1J87A 2BNUB 2CR6A 2GJ6D 2Z8RA 5SWQA 3SGJC 3SQBA 5F9WC 5TF1H 4UILH 1I85C 4ODVL 1MQ8A 5EG6C 1UH3A 3L6FB 4L8SB 1ZLWK 2DQUL 1CD0A 4LSPL 5GJSL 4I0PC 1MHPH 4PS4L 5BZWB 4POYA 1KOAA 5B8CA 3OPZL 3O41B 5CGTA 4LVHC 2X4RB 5HDBF 4M1CD 1OGAD 1CN4A 1INDL 5MENE 3P4MA 5JW4R 4LRNH 3MRBB 4TOYH 2LU7A 1GGBH 4R4FL 2FJFA 3QA3A 2I5YL 3GGWA 2WNGA 5CEXA 3GIZL 1QRNA 2VXTH 3FQNA 1O7VA 4N9OB 5IW3A 4YHYB 5GGRB 5T3XD 3WFBH 2DD8H 5EORH 3D18A 3BDYL 4ZPTB 4ELME 4LNRB 5CZXC 3N1GC 5DVMA 4ODTH 4FQQB 5DUPH 5F7LB 3L7EA 4WTXA 2HT3D 2Z92B 2VXVL 3W0WB 4U0QB 3BGMB 4HPOH 4RFEA 4N1HB 4KKAD 3BSZL 5DMKB 4E0RA 3F7YA 3BVNB 3UJTH 3P0GB 4KK6C 5MI0B 4Q9RL 5I17B 3TBVA 1WBXB 2NXZB 5SX5K 3BT2L 3FONA 3RVVC 1LEIB 1FNSH 1SBBA 2W0PA 4PRDA 3AU1B 3MUHL 3VXUE 5IB2B 1AIFA 3GMQA 4M7JH 1FIEA 4MSWB 5FCUL 1RAMA 3CSPA 2J4WH 5AUMB 4XCYB 3WNOA 2RIKA 3ZE1E 4WY7L 3SDXA 3WNKA 2XWBB 1F58H 4GJTB 1AO7E 3B5GA 5ISZA 4UT6L 1P4IL 1I1FA 5E8DL 4K7PY 5DJAA 5FCSH 4DOHB 3RL2A 4P99A 2RCSL 2CXKA 3V5KA 4I5BB 1P5UA 1NFKA 1AY1H 1CFTB 1NEZA 2XTJC 4JLRB 3BPCA 3T0VA 4DGVL 2R0ZL 4OGYL 4UV4H 5C0GA 1U91A 4HGWB 5DO2C 4OTXH 4PFEA 4FP8L 5I71B 1C8PA 1LDSA 4OZHF 4ORGB 2VLME 3QUMB 3VXME 3OJDB 1RVFH 4XCNA 1HEZB 1XCTB 4G8GD 2DDQL 1R3KA 1JE6A 2ICWA 1BP3B 2EDWA 1WVZA 2QEJA 3H6JA 3NA9L 4J3WA 5L2KD 4TYUA 2VDKL 3QUZA 2CK0L 3D2UB 3NIDF 4XP5H 1CT8A 1F3DJ 5TE6L 1OF2B 5DFVC 4Z8FL 5L2JB 1H3UA 3HG1A 4HZLB 1GZPB 3QRFM 1P7HL 4HS6B 4P5TA 4APQD 1A9BA 6CGTA 1DQML 1NUDA 2VXQL 1IGML 3T08A 3VXRE 5IEHA 5I16A 2E7LC 5F6HJ 2KDGA 2R9HD 5BW7A 2K9UA 1EUUA 2A0LD 4XBEH 4UBDC 1EDQA 2J88L 5FDWA 5GGSA 1QEWB 5DD1H 4GUPA 4HIJB 4X5XA 2MFNA 2GJJA 3MV8E 4RA0C 1MH5B 1T6WA 4GW4B 4XPFL 4D3CL 5HYFA 4NQVB 1CD9B 3BKCL 4JREC 3LPWA 5JZ7D 4M7ZC 1K6QL 4L4TE 3BH8B 4NFCA 2FJGB 1JTPA 4N68A 4Z7UB 1JZ7A 2FDBP 4RGOH 2FYYB 1H3PL 2F54B 4G43B 5ENWB 1YECH 2HT4C 2V9RA 4LNVA 2FH8A 4OFYA 5CINH 3PABB 1SJEB 4IRSC 1A6AB 3GSNB 5DA0B 4CVXB 5E24E 5IKCB 3TT3L 2PYEA 1CGSL 1N0XH 5ESVB 4MNHA 4K8RD 3CDYA 5IJKC 1AXSB 2ZOLA 3DWTA 3GI9H 4G6AC 4WI2A 4D9LL 1J0IA 2CO6B 3LZFH 2DM3A 4HMDA 3T0EB 3W2DH 3FOMB 4KHTH 4OF6A 4PJBF 3QWQB 4M3KB 4PJFA 2ZUUA 3BH9A 2DLIA 4GG8A 5KN5B 3L5HA 3CU1A 1U36A 2W60A 2E7CA 5C07B 5F7DB 1YQVH 3EFDL 2P5EE 5DYOB 2BP3A 1MWAB 3HFMH 1YDPA 3G5ZA 4KHXH 1R6VA 1NUFA 2BXYA 4OLYH 3VH8A 1UB5A 1UA6L 3C8KA 2FSEB 5CJOL 5LQBL 3EDFA 5TE7H 3I6LE 2PNDA 4UDUA 4JRXB 3MLRH 3HCVA 4HLZH 3V5HB 1H3WM 4O02L 2APVA 4WI5A 5M95B 2JIXD 3PWLA 5FHBL 2EEDA 4L9LC 2QLVB 3KYMB 2XY2A 3HNVH 4WNQB 4OGXL 2JJSC 1I9JH 5I1CL 1BBJA 1SY6L 4WO4B 1DN0B 1YN6A 3G5VA 1NCWH 2Z31D 4GRMB 5J1AB 4ZSOA 3NCBB 4M4PA 1XF2B 2AV1A 5HDBE 4F7TA 4QXTB 5JTWA 1MFBH 3TNNA 4WFED 1FNHA 3NPZB 4NZUH 4Z77A 1H5BB 2O26U 1QR1B 5ELIA 3G5XB 5BMFH 5H2BA 5IVZA 5HPMB 1QSEE 3E0GA 2XWTA 3QDMB 4FTVA 4QTIH 3BWAA 3JWOL 1KJ2L 4UTBH 4TVPD 1MIML 2X7LA 5FXCH 5HHME 1T7XA 1BBDH 3U0TA 4UDTB 3VMOA 1HWGB 5BOPA 1KENH 1FC1A 1A6WH 2AJVL 2BVYA 4NKMA 3CSBA 3P30H 2XTLA 4DKEL 1HHKB 1B88A 1P4BH 3WLBB 3WJJC 2FWOB 3PNWB 1ITCA 3MRLA 3W5MA 3QUMH 3HMXH 5E6IA 1AHWB 1CK0L 4AEEA 4X98B 3RVUC 3FL7A 3CDGA 4LCWE 1EZVX 4EIGB 2VABA 5DMJB 4ESKA 15C8L 3EO9H 4CU6A 4LP5A 2X09A 4FQJL 1NBZB 3CMOL 1T0MA 4JG1H 5C86A 5HHQB 3M1BA 2F53A 1MRCL 5IR1B 5ALBL 1G7IA 2BNQD 3TP4A 3PXJA 4YXLL 4TRPH 3BGFB 3O6KL 2CUHA 2HH0L 3PWPD 3MREB 1OM3L 4R4NC 3U46A 4ZFOA 4U3XA 4ALAL 2L4OA 1X5AA 4XCEB 1FIGH 4XAKD 5E7FA 1IKFH 2AQ1A 5IMLA 5CBEA 1AJ7H 2AEIT 1HHHB 4OB5L 4XVSH 5CGYC 5BZDA 1F11A 1UH4A 2O5ZH 1KCVL 4X6DB 3LEVH 3ZTJG 3TBSA 4O4YL 1G9EA 1FO0B 3ARBD 3L3JB 4HC1L 2Z91B 2DIAA 1ZLVH 3WIHA 1L0YA 2GK2A 3B2VL 3QDGE 5JHDD 4JFEA 3JWDL 2Z8WC 4UOJA 4PP1C 3RZWA 5DWUL 4F2MB 2JCCA 2FHBA 4ZFFA 3MV01 5MEOA 1AGBA 4XMLL 2N1KA 2OL3B 4JKWA 4OZHE 4RZCA 4P5KA 3VWKA 2VDNH 1YPZB 2VTFA 5KBNC 3GRWL 1ZA3A 4PJGA 4PJ7F 3G6AA 1VFBB 5ANME 1RUKL 2FBOJ 3N0PB 5CEZH 1WAAF 3GSNH 2R23B 1M7IB 5GRZA 5TDNA 5CD5D 1FZJB 4HEPG 1B0GA 3RNQA 1RK0A 3UC0L 2EZ0D 3QI9D 5AZEL 3QHFL 3NIDE 1A1OB 4XNQA 4D9QE 3WDJA 3UTSD 4NC1E 1UB6A 3OKMA 3ULVC 3GB7A 1FLRH 3QUKA 3E8UL 1RIVH 1RHHB 2VRAA 3O6FB 4OZGB 1QLFA 2BMKB 2DQGL 1JP5A 3BXNB 1B4JL 3IAGC 4YDVB 4PGBB 5DD6B 4O5LH 4LDLB 3QUXC 5F9WB 3MODH 1CGUA 3D85D 3B9DA 5A3ID 3IJHA 5JLZB 1DQLL 1KGCE 3RBSA 4I0PB 3UBXG 4M93C 4MAYC 4WFHE 1MWAH 2JJUA 2Y72A 4LVHB 1C12B 2G75B 2J8UA 5EU5B 1FL6B 4NJ9H 4YPGB 3QXUA 4EIZC 5IB4A 2DKSA 4RAVB 5FGSA 1EAJA 2FX7L 3QPQC 3C5ZA 3IU3B 1U95A 3X3GH 3AMKA 1D6VH 4N8VA 4EI5A 4KGJA 4M5ZH 1ZLSL 3EDDA 4YFLI 3HNTH 3MCLL 4PJAA 3F7RA 3NFSL 2BY3A 1C7SA 5T1KD 4LBEA 4HXBH 1M71A 5D1XB 5TPWH 4V1DA 1YEIH 3BE1L 1UXSB 1WQVT 3ZYIA 1ADQL 3B83A 5DQ9B 4OZIF 4P9ML 5I73C 4A6YB 1ORQA 4D0CA 4LLDB 4QO1A 1RZJH 4PJBE 5IBLC 4C4KO 4Y16B 1DVFA 4JFDD 3TVMB 1QFUL 3CLFH 3RRQA 1PSKL 2DICA 3PWVB 2OJEB 4OQTL 2EE3A 1MEXL 3V6BR 3QEGL 4LKXA 4P49A 5F1KC 2BRRH 4WWKC 4XPGL 1U2CA 1SEQH 2KL6A 1U8HA 1NCAL 5J11C 5GGVH 4KI1A 2XQBL 4I13B 5LXGH 4MD4A 1IAKA 2VZSA 3GFUA 4PJCF 1I4FB 3MYJA 1MAJA 3DX8A 5LGJA 1T03L 1H8NA 3O3DA 4JHAH 4JB9H 1U8JA 2H26B 2XTJB 1QNZH 1MCCA 2ESVD 4IOFC 3S35H 4H26A 4EKXA 2HG5B 1ZHLB 4L3EB 3VCLB 4A2MA 1AP2B 1ETZB 3OF6D 3O3UN 4P48A 1HYSC 4IJ3B 3QUYC 3TA3A 2VLRD 2OP4L 1C08A 1LE5A 4XPTH 1FYTD 4LOUC 1A6ZA 2APXA 4N0CD 3QQ9D 2Y6SC 4EN3C 2D31B 1MJ8L 1VGEL 3BP5B 1GXEA 2K3TA 1A21A 4YBHA 5E9DA 3KXFA 4PJHB 2B1HH 1OB1A 3P40A 1U3HC 5I74B 5J6HA 1FO0H 2R69L 1M4KA 3QH3A 1NBVH 5D6CB 2ID5A 5C8JA 2L0DA 2WWMC 4WI3A 3L3OB 5IIEA 1YJDC 3NMEA 1QKZL 3ZHDA 4OLEA 1IC4L 1LE9B 5E4EC 3MRMB 4QHKJ 2IGFH 1VKXB 4YO0B 1FGNH 2YRLA 5H94A 3KNBB 4ONHA 5KVGL 1MRDH 2OL3H 4U6XB 4U31A 2FGWL 3N85H 4JREB 5E95B 5H37H 3GMLA 3TPUB 4MCZA 2PTUA 3IDIA 4MAUH 4KVCL 5A40E 1T89C 2NCMA 4M7ZB 3CXDL 5MENB 4U1IA 1AGFA 1PKOA 1RJCA 2ARJB 4WUKH 4JHWL 3JUZA 3WLWD 1PJ9A 1JNNL 2W9LA 3IF1A 4QGTA 1BVKB 1II4E 1N7MH 3VXQB 2ZJSH 4J12A 4UQ3B 3ZZ1A 5I8OH 1YY9C 1ODAA 4IRSB 4K7FB 3UX9B 4QRQB 3T4AB 5D7KE 3T8XA 5ADPL 2ZCHL 4PGJA 2QSCH 4ORZC 2BFVH 5GS0C 4KKLC 2X4SA 5T3ZH 3ULUD 1P1ZA 4K55A 1J1OL 3SDCA 1ZT7A 2ED7A 3MCKA 1UJ3C 1IGTB 3GK8L 3OXRB 1YEDA 3ECBB 4L5FL 1WSST 1NKOA 2GK0A 2LAAA 1HQ4B 3QDJB 3P9LA 4NRXB 1LK2A 4LEXH 3B8SA 1J11A 5BRZE 4WEBH 1P69B 3RFZC 4MJIE 2QSVA 3VFOA 4PG2C 3CUPA 4JKPL 4M6OH 1YC8A 3VXSB 5IVNA 2VN7A 4Z5RA 1TLKA 3ARWA 3KYOB 3GSWB 4QXUL 3FT2B 3BZEA 1KEGL 3VW3L 3PDGA 3U7WL 5C08B 3MRPA 5EDXA 3WCYA 5L0QC 4PJ7E 1RUQH 1NLBH 1WAAE 4NQSB 4X7DC 4U1NB 1S9WB 2PCPB 2IQ9H 5D1QA 1SVZA 5B8CC 4U3CA 4O9HH 4G7YH 4MZ3A 3NFPB 3DUHA 1D9KD 2QKIA 5D5MF 4X99B 4NKDA 4L9LB 4A6YH 2J3SA 2DLGA 3VGFA 3OJMB 3SJVE 3MROB 3GHEH 1BEYH 1Q9OA 2FO4B 2A6DA 5EC1B 3ARGD 1MCHA 4HJJH 3DARA 1BD2D 4WHTB 3S4SG 4CNIB 4CVUA 3SKMA 1JNLL 4LLUA 4NPYB 3VXUA 5IB3A 5CD3A 2DQTH 5HI3C 4MS8C 4X9FA 3OKLA 5JA8B 3WS3A 2EXWC 4JM2F 2X4TB 5E08H 3NCCB 4R4BA 2IH1A 3CH1B 4YUEL 3FT4B 2E9BA 5D2LA 2VLJA 2VQ1A 5F1NA 5F9AC 4N5EC 2OSLA 4JFPA 4GW1A 5KSUA 3I02A 1FDLH 3KPRB 4NQDA 3V4VH 1HIML 2JF1A 4M62L 5DVOA 3QJHB 4HT1H 3MV8B 1Q9LB 4NZJA 5I1JH 1OOAA 1G6RA 2D3VA 1IAOA 1PYWB 3OKEA 2QR0A 5IHZB 3NIGF 4G6KL 2EDEA 1UWEH 4OZIE 1HI6B 4NUGH 3ZT5A 2EYTA 4L4TB 1DLHB 5T1MA 3T04D 3X3FH 4FZEL 4ZOEA 3QIWB 1X5JA 5DJXA 1OAZH 1C16B 4EUPA 5J0BA 3K81A 2PTTA 5D7LD 3VFVA 4HPYL 3UYPA 3MJ7B 1NAKH 4KGLA 5EU6E 3V8OA 4G9FB 2YUWA 5GGUA 4XP9H 3OHXA 1JV5A 3VGHA 3VXRA 5C71A 5J56B 1MPAL 1A5FH 1KPUB 2JK5B 4FFZH 5C0NC 4NZDA 1TJIL 4NC2B 3LEYL 1YN7B 2YWZA 4OM0H 4XBPB 3SE9H 3PWNB 5EIQA 4PJCE 4XCFL 1DR9A 4YHLH 4ZDHA 3QUZC 1IEBA 1UVQB 3N50A 1INEH 5T1LA 2CJUL 4OGZA 4UB0H 5HHXH 4KZEH 5TQ2L 1KNOA 4MQ7A 4DK6A 1S7RB 1YNTB 2HA1A 4P5TC 5E5RB 5IK3A 2P7TA 2GEEA 3CFBA 3QXAB 2V17L 5C0CB 1G9ML 1F02I 4Y5YA 1GCFA 1A64A 4N9GB 2CKBL 3TF7C 1OWWA 4CMMA 4GAJH 3CFKA 3CLEH 1EEQA 3X11B 3MTRA 1EA9C 1DQDL 4ZQKA 1Z9OA 4TTGA 1JF6A 4W68A 2ADGA 1J18A 4EDXB 4KUCD 5KSBA 3PGDB 5EU7C 1P4LB 4M3JA 1TDQA 3I50L 4KKBD 4XVUD 3Q1SH 3QUXB 1E4WL 5CZVL 3KPQA 5CJQH 4HHAB 3QEQD 4NQTA 4M93B 4U4BA 1OARL 2Y06H 1ROWA 5I1HL 4QHMA 5DR5L 5F9DC 1IGJA 2IAMA 2HFGH 5IMOA 5F8RC 4IS6A 1S7UA 2DLEA 4QRRE 5C09E 5GRJL 2VDPH 4LF3A 3L3HB 4OUUB 4PLKD 1GOFA 3V0VB 2VDRH 1JGLL 1P9MC 1RZFH 3D3VA 4FQHA 4YBLC 1JRHH 1TZHA 1BGXL 1J0JA 5HHVH 2YD2A 2OJZL 1H3XA 5HHMB 1OSPL 4UMGA 5C0AB 1A6PA 2HLFD 1J10A 2P45B 3MOBH 2BVPA 3BKYH 5KVDH 3WSQH 4K07A 5F70A 4TSCH 5HYJD 4ZPVA 2DQDH 3DXAE 5GZND 1HOCA 2C9AA 1LD9B 3OTTA 5TDPA 4R3SB 4NDMA 3I9GH 1Z0MA 5I1DA 1GH7A 1G7HA 1BOGB 1J05B 5T5FH 1SVCP 2M8XA 2GI7A 5KSAA 1MJJA 3D0LA 1OHQA 3UZQA 2CLRB 1ND0A 1U8NB 2XFXB 3V4PL 3WXVL 1J1XL 1NGYB 2YBRB 4KAQH 5HYIA 4N8VG 4QCIB 3TZVA 3QCUH 3RPKA 5MERA 2XN9D 4LHUA 1IAIM 1KG0A 4TPRH 3SDYH 4F8TA 3IKKA 1IBGH 1ZVYA 4NQEE 1FVDA 1WWBX 5HVHC 5C0FB 5J11B 2AXGA 4FQXD 3VA6A 1KCUH 1MQKL 5JXAL 2PKDA 4E41E 5GSVA 4FQIH 1AD9B 2WMPA 3W9DA 5I30H 4WUUA 1M1SA 1A2YA 1A7BA 1TCRA 5EOQH 3RWIB 2OLDA 3O45A 2ATKA 3UTZA 4HQQH 4Q6IA 1VEOA 1ZXQA 3KJ4C 5D5ME 1YEEL 4JN1L 1NFIB 5IB1B 4K3DH 3NZHH 2Z8SA 4HKZB 1IL1B 3QUYB 2YC1A 3AXLB 5I8KL 4YZFF 5HDQH 1EHNA 4JR9H 4YAQA 1DQTA 1JI2A 4LCUA 1IM3B 5E6IC 1I7ZB 3BQUA 1A8JH 1QLEL 32C2B 4OZFG 4X6EA 1E27B 1U3HB 1F5WA 3O2VL 3Q6FB 1QSFA 2XQYK 1I9EA 2BOBB 1CI5A 5DK0B 3WFEL 2AI0H 1ZANL 1PD6A 3BHBB 3PDOB 1WK0A 4UUJB 4NRZA 1NDGA 1DBML 2R1YB 3TO4D 5E1HB 5C6TL 4OD1L 3QDGA 4JDTL 4Y19B 5EBMA 1FZKB 4JG0L 3GBML 2XQYG 1EVUA 3NZ8B 4YDIL 3CDFA 3HLAA 2BNRA 1I9RL 3DV4B 3GBNH 1XH3A 4GFTB 1OSZA 5F9OH 3IT8D 2GSIB 4MX7B 2OK0H 4XP6L 2P43B 4LL9A 3DRTA 1B6UA 3TGXA 4FFYL 4IDJH 4RWYL 4D8PB 4NBYB 2HFEB 4JKKA 1TXKA 1UC6A 2CQVA 3ULVH 2I60L 4WDIA 2D4DA 4PGCA 8FABA 1ZKAA 1YMME 3HMWL 5KAQF 4N8CH 4NQCA 2H8PB 3GNMH 1L7TH 5JNYA 4ZS6D 4G8EB 5DJDA 1LILA 1K2DA 3VWKC 4GRLD 1RJLA 4Y4KD 2P5WB 2Z4QB 3RVTC 4PP2B 4QT5A 1JGUL 1N5YH 4PRHD 3S5LB 1NAMA 3SDDA 1UJ3B 1F6FB 1NJ9A 1DSFL 4CADB 3QSKB 4ISVB 1RPQA 2MHAB 2CRMA 4PJBB 2GTZB 4O2CB 3WL9A 4CJ0A 4Y88A 4QF1A 1G7PB 3HZMB 5GRVK 1G7LA 2AEQH 3I75A 2XA8L 4HUXB 5EBWA 4PLJC 2AQ2A 5SWQB 3W11C 1U8QA 3BPLB 3OKKA 4OM1L 5L0QB 4QOKA 2V7NB 4NQUA 3LKOB 1N6QL 2GJ6A 4KRPD 3R0NA 4P2RE 5B8CB 5C0RL 3VFNB 3BAEL 4I3SH 4MNGA 3Q5YA 5GGVY 3P4MB 2YKLH 5I2IA 3MZGB 2MCPH 3HZVB 5CMAA 4MNQD 5D2NA 3A6CH 3LKRB 3FO2A 1TQBB 3RVWC 3IFPA 2DI7A 2VNCA 5EUOF 3DX6B 1MJUH 3QA3B 1OGAA 3C5ZC 5CS7A 3MBXH 4EEEA 1GRWA 1MFAH 5JOFA 4EI5C 1G7QA 3BZDA 2GKIA 3ZKXC 3D18B 4JRYA 1YY8B 1INDH 1QBLH 3GSQA 4HKXA 4PJ5D 4XAWH 2XWJB 1NL0L 1IGIL 3L7EB 4Y1AD 4TN9A 4BFGA 4R4FH 4RFEB 2PYFA 2J6EH 4G6JL 5C9JA 2CMRL 4QTHB 5IGXH 2XPGA 4B53A 1MVUA 5A16A 5HYSB 2ZUTA 3BDBA 1DVFC 1TETH 3PIQB 1J12A 1RK1B 4PRDB 4OV5B 1AIFB 4KQ3H 5F1IA 3GMQB 1MCQA 4ZNCD 1S5HA 1MJ7L 2CLZA 2HN7A 1IKNA 2DLHA 2JJWA 3O4LD 4AJ0A 2IQAB 3HC0A 3OZ9L 5E00A 4BA8A 5B38A 1BHGA 4Q9RH 2XV6B 5ISZB 3AS2A 4AIZB 4OD2A 4MA7L 1I1FB 1R3HA 4HWBA 5DJAB 1ZA6B 5E6YA 3RL2B 3VE0B 4KK6D 5DJCA 3JZ7A 3MRQA 4KH2A 1NEZB 3M17A 3MOAH 3PGCA 2VWEE 1JHKL 2CD0A 2D7TL 4QHNB 4WTZA 3RVVD 3PWJA 4BQ6A 5C0GB 1U91B 1U6AL 1YJDH 3IU4H 3V0WL 3MJ9L 1J88A 3LH2H 1ACYH 1RZKC 3V6OA 4K94L 4UT6H 1R3KB 5E8DH 3TA3C 2ICWB 4AYFA 5F1OB 3NCMA 1E4JA 2RCSH 2AQ3A 3BO8B 5D1ZD 4ZTPL 5GXBB 2HJKA 2YPKB 4IOSD 1LK3L 1UYWL 2APBA 3QUZB 4G8GA 5IEKA 1MHCA 5ID0A 3IYLW 4DGVH 1CT8B 1M6OB 4OGYH 1CBVL 4JO1L 3HG1B 4WHYH 5L2KA 1GC1C 1A9BB 4K3GA 1OQXA 4Y8AA 2AJZA 4PD4J 3QDHA 5BS0E 3HI5H 3MGTA 3CXHJ 4GKSB 4APQA 1MRFL 5FDWB 5GGSB 4YZFE 3NA9H 1ZT1A 1WZ1L 2VDKH 5I1GL 1VEPA 4H0GA 4H88H 1ZGLA 3FQUA 4YPJA 4DN3H 2WLYA 3QRGH 3P11L 5GS0H 1QFWM 1GVIA 4KRLB 2VXQH 2YN3A 4J7RA 1UEMA 3D39D 4BQ8A 4XBGA 4GG6F 3SJVB 4B41A 1RUAL 1T1ZA 1MCRA 4OCRL 1W0WA 4L8CA 3WIIH 4UBDD 5I19H 4D3CH 4P2QE 5F71A 1AQDA 3CK0H 3TO2A 2PYEB 3BISA 3STZA 3EYSL 4MNHB 3VG0H 1DFBL 1OAQL 2V2TA 2ZOLB 4OCSL 5KZCB 4OLWL 1YEHH 1U3YA 5IW6A 3SDCC 1FAIH 3MRDB 1M7DA 3P4NA 4JQXA 4YX2H 3MLPA 4PJFB 4UI2A 3BH9B 2F15A 4GG8B 1AR1D 4J1UB 3KPMA 3DROA 2NLJB 5AWNL 4EVNA 3G5ZB 5I66A 4CU7A 3I6KA 4KROD 5E70A 3LMJH 4X4XA 3VH8B 4ELKA 1UB5B 2VUOA 4G6AD 5FGCE 2OCFD 3C8KB 4PYGA 4OI7A 1EK3A 2E9IA 4QXGL 3TIDB 2XICA 3NIFE 3HE6B 5D1QC 3HCVB 3I6GA 4ODBD 1UEYA 3BKJL 5DURD 2ICEB 3SE3A 1HNFA 3WN5A 3D9AL 3VJ6A 5I6XC 3FFCD 3P77B 3QFJA 5FDYA 4PRIE 3MBED 5E8EA 2J5LB 5D7IA 3GRWA 3K8MA 4N0UE 4S1SL 2IMMA 2Q76B 2BY1A 3IETA 2JIXA 3UCRA 1EMTL 4F58L 2ZG1A 3TJHD 2QL1A 1YN6B 1CIDA 2ZOKA 2AKRB 2LAGB 3QXVA 1E6JL 1N6UA 4S11A 2YOCA 3CJJA 4ZSOB 1TZIA 4KZDL 1EX0A 2XY1A 1NC4D 4X9BA 4Z7QF 3IFLL 1WWCA 1EHXA 4WU7B 4O58L 3FN0H 4LHJB 2GJZA 1UQSB 3TNNB 3O6ML 3HS0B 4XNXL 5IVZB 3JUYA 5EUOE 5MHSE 4J3UA 5TE4H 3VGAB 2RAMA 4LHUG 2X7LB 5FUZL 2AEWA 3U0TB 2GT9A 4P9HL 4XCCL 5ICXA 3N9GL 1KB5L 5D8JL 5CUSH 5ESAA 4EI6A 5EU6A 2E8YA 7FABH 3C6LA 3MRLB 5E6IB 2EIZA 2DMCA 3MCG1 5DJ2B 1F90H 2BOCA 4YXHH 3CDGB 2VABB 2VL4A 1CF8L 5I75C 5E8OA 1T0MB 1R3JB 2AW2A 3LCYA 2F53B 3M1BB 4PY8J 1JZ3A 5DJ8A 3T0XA 4AH2A 2IPTH 1JNJA 4NN6C 4Q9QH 5BV7L 5JIPA 4OLVL 4JHZA 3U46B 3M07A 4H25B 4L9DA 1TFHA 1GGTA 2BNQA 4AZ8A 1T22A 5KJRL 1RJYA 5CBEB 5DLML 4DWHA 4WTWA 2B2XL 1L7IL 3PWPA 1CL7H 4FQJH 3WJLA 1F11B 5DVNA 2NY5L 5CAYB 3WIFB 1G9NL 3K4DA 3TBSB 4J3SA 1HCVA 1OGTA 4AL8H 4LPWA 2DQHL 1OM3H 4EQ2A 1PFCA 5DVLA 4OQTA 5FKPA 5E6ZA 3CH8A 2QQNH 5KS9F 1RUPH 3ARBA 2JCCB 3HA0A 3TT1L 3AAZA 5MEOB 2EC9T 2IH3B 4RZCB 1CXLA 3DX9B 5EBLB 5C0EA 1K3ZA 1W8NA 3VWKB 5JHDA 1KCVH 1U8OA 3IVKB 2OTUA 1UJTA 1ZA3B 2W9DH 1CGWA 1F45A 4PJGB 3G6AB 3PL6B 4Y5YC 1N64H 3WFDH 1INQA 3KYNA 1NBYA 5CGYD 4HC1H 1A9EA 5IW1A 4CN6A 1BIIA 4K7PX 1G0YR 3RNQB 1GGCH 4YHOL 4F7MA 4XNQB 2NX5E 3T2NH 3MLXH 5DWUH 1UB6B 3OKMB 3EBAA 3KVQA 5KVEL 3GB7B 3LOWA 4PBWD 3QUKB 4OLXL 1MI5B 5C09A