3PIO1

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
53
structure length
53
Chain Sequence
b'AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 1
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pio100
4UY81 5GADc 3J7Y1 3J7Z1 3PIO1 5JVH1 4U671 4V196 5H1Sc 5GAEc 3PIP1 5GAGc 5GAHc 5JVG1 5DM71 5MLC3 4WFN1 5DM61
chains in the Genus database with same CATH superfamily
3PKIA 4A3BL 4POGA 2ERJA 1NNQA 3PL5A 1QCVA 5MLC3 3GTLL 1K83L 1B2OA 1TWFL 5M5YL 1PFYA 4AI3A 4JAGA 1T9OA 1F4LA 4G6BA 4A3DL 2JA6L 4Y7NL 2AUSB 1P7PA 5M3ML 7RXNA 3GTJL 2WB1P 2ZIXA 5MF6A 3ZG6A 3LWVB 5M5WL 1S24A 6RXNA 2B63L 2GMGA 5JVG1 2XJTA 1FHMA 1B13A 2VL6A 5AN9H 1PZXA 4AHXA 1SMMA 2JI3A 3S17L 3A44A 2XJUA 5MFZA 1TWHL 2LCQA 3QVDA 3RYGA 2V0EA 4XGHA 1Z92B 4AR3A 4U671 4A3GL 1IU5A 2C6BA 5AI3A 3WWNB 5FLML 3S2HL 1RYQA 3H9CA 3GTQL 3S1ML 1TWGL 5DM61 2PVXA 3H97A 3RZOL 1RB9A 2O5JD 4JADA 4TPUA 1WJVA 3GTGL 2PSMC 3HOVL 2RDVA 5C3EL 5GAEc 2B5ID 4JAEA 4C3HL 5IP9L 1I6HL 3B08B 4A3CL 2R7ZL 4AR4A 3PIO1 2MS3A 3JR7A 3MQKB 1R0IA 2XJVA 1SFOL 2M4VA 4AYBP 3HAXC 1H7VA 3M3YL 3LPEB 3P2AA 4AHZA 1YUXA 4Y52L 1PFWA 2PMZP 1B2JA 4XXBB 2JA5L 3CQZL 2M6PA 4TVMA 3HOWL 3S16L 2L0ZA 4AR5A 2Y0SP 1JYBA 2XJSA 2NVQL 3PZAA 4A3ML 4BXXL 1Y1VL 1ODHA 1SMWA 3LWQB 1CAAA 4AHWA 2EY4E 2A6ED 2V3BB 1T9PA 2Z3QB 2CKCA 2QL0A 1RDVA 1C09A 1RWDA 5EINC 2AQCA 4BY7L 2DSXA 3K7AL 3HOZL 1BRFA 5IYBL 5IP7L 1B71A 2Z3RB 2JA7L 5M3FL 1WCML 2APOB 2K2DA 4AI0A 4GS7D 4V196 1PFUA 5IY0A 4A3FL 3LNLA 1QQTA 3GTML 3S1NL 4QIWP 1TWCL 1IROA 4AI1A 4BBRL 2PVEA 1E8JA 2KN9A 4C2M1 4B8CD 3FKIL 3RZDL 2CR8A 2J9UB 4AHYA 1S2ZA 2KKDA 1R0GA 2HVYC 1ZRPA 4A3KL 2JA8L 2NVTL 3KYXA 5EIOC 2HR5A 1RDGA 5C4JL 3S1QL 2R92L 2E2HL 3IU3I 5RXNA 3S14L 3HOYL 1QYBA 2NVYL 5GADc 2M4YA 8RXNA 2NVXL 4YWLA 3NFPI 3PO3L 3B0AB 5MGNA 1R9TL 2A6HD 3RZ6A 5M5XL 4AI2A 4ZN3B 3H99A 1OWCA 4LHNA 1YK4A 4E6YA 2R93L 1LKOA 4ZN1B 1SMUA 4X6AL 1PFVA 2A68D 2NYDA 1RYTA 1YUZA 2H12A 5AI2A 3K35A 1DX8A 1LKPA 1LTLA 5H1Sc 3GTOL 3KYYA 2A69D 1OWBA 4A93L 5IYDL 1CADA 2PYAA 3QQCE 2E2IL 2JI2A 5DM71 1IU6A 4RXNA 4JAFA 4C3IL 2RFKB 3KYVA 3S15L 1BFYA 3PKJA 5GAHc 3I4NL 3LWPB 3J7Y1 3LWRB 4LHLA 3S2DL 3HOUL 4C3JL 4WFN1 4AR6A 2YU9L 3M4OL 5K2ME 2AYJA 2C6AA 1LKMA 3P8BA 1IRNA 5C4XL 3H9BA 3PO2L 1DVBA 3RZTA 2BE5D 4A3JL 1VZGA 1BE7A 3WWLA 2M6OA 5FJ8L 1VCXA 4YWMA 3KYUA 3KYWA 1YK5A 1NXGA 3GTKL 2XJRA 3HKZP 1S30A 1BQ9A 5JVH1 3VPBE 2ERSA 3GTPL 1BQ8A 5GAGc 1R0HA 1I50L 4POFA 3H3VM 1YV1A 2E2JL 3H0GL 4K9FA 3MSUA 4ME3A 3HOXL 2CKAA 3HJWB 3LWOB 1TWAL 1VZHA 2PPTA 5C44L 3SS2A 5IYCL 3S1RL 4A3LL 2WAQP 1VZIA 3FDJA 4A3EL 1Y1WL 3MPSA 3J7Z1 4BY1L 2XJQA 2VUML 1I3QL 1FHHA 1NXEA 1IW7D 4UY81 3I4ML 4BBSL 2JI1A 2XJPA 2V0FA 5MFPA 1R0FA 4A3IL 3HJYB 1R0JA 3PIP1 1T9QA 3PWFA
chains in the Genus database with same CATH topology
4AI1A 2PVEA 3PKIA 4POGA 2ERJA 3B08B 1BFYA 2KN9A 1NNQA 3PKJA 5GAHc 1E8JA 4AR4A 3J7Y1 4LHLA 3PIO1 4B8CD 2MS3A 2CR8A 2J9UB 1QCVA 5MLC3 4AHYA 1S2ZA 2KKDA 4WFN1 4AR6A 1R0GA 1R0IA 2XJVA 2M4VA 5K2ME 1ZRPA 2AYJA 1B2OA 1H7VA 3KYXA 3LPEB 2C6AA 5EIOC 2HR5A 1LKMA 3P8BA 4AI3A 4JAGA 1IRNA 1T9OA 3P2AA 1RDGA 4G6BA 1DVBA 3RZTA 4AHZA 2BE5D 1YUXA 3IU3I 5RXNA 1B2JA 1BE7A 1VZGA 4XXBB 3WWLA 2M6OA 7RXNA 1VCXA 2ZIXA 4YWMA 3KYUA 3KYWA 1YK5A 5MF6A 1QYBA 3ZG6A 2M6PA 4TVMA 1NXGA 5GADc 2M4YA 8RXNA 2L0ZA 2XJRA 4AR5A 3KYVA 1S30A 1JYBA 1S24A 2XJSA 4YWLA 1BQ9A 3NFPI 5JVH1 3VPBE 2ERSA 3PZAA 1BQ8A 6RXNA 2GMGA 5GAGc 3B0AB 1R0HA 1ODHA 5JVG1 5MGNA 1SMWA 2A6HD 4POFA 2XJTA 1YV1A 1FHMA 1B13A 2VL6A 3RZ6A 5AN9H 4AHXA 1SMMA 1CAAA 4AHWA 3PIP1 4K9FA 4AI2A 3MSUA 2JI3A 3A44A 4ME3A 2XJUA 5MFZA 2LCQA 2CKAA 2A6ED 3QVDA 3RYGA 2V3BB 4ZN3B 2V0EA 4XGHA 1T9PA 1VZHA 1OWCA 1Z92B 2CKCA 2PPTA 2Z3QB 2QL0A 4LHNA 1YK4A 3SS2A 4AR3A 1RDVA 1C09A 4U671 4E6YA 1RWDA 5EINC 1VZIA 1LKOA 1IU5A 2C6BA 4ZN1B 5AI3A 3WWNB 1SMUA 2A68D 2DSXA 3MPSA 3J7Z1 1BRFA 2NYDA 1RYTA 1YUZA 2H12A 2XJQA 5AI2A 3K35A 1DX8A 1RYQA 1LKPA 1LTLA 1FHHA 5H1Sc 1NXEA 3KYYA 1B71A 2A69D 2Z3RB 1OWBA 1IW7D 2K2DA 2PVXA 5DM61 4AI0A 4UY81 4GS7D 1CADA 1RB9A 4V196 2PYAA 2O5JD 2JI1A 4JADA 4TPUA 2XJPA 3QQCE 2V0FA 5MFPA 1WJVA 2JI2A 1R0FA 5DM71 5IY0A 2PSMC 3LNLA 1IU6A 2RDVA 4RXNA 4JAFA 1R0JA 5GAEc 2B5ID 4JAEA 1IROA 1T9QA 3PWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 1;  5GAD c;  3J7Y 1;  3J7Z 1;  3PIO 1;  5JVH 1;  4U67 1;  4V19 6;  5H1S c;  5GAE c;  3PIP 1;  5GAG c;  5GAH c;  5JVG 1;  5DM7 1;  5MLC 3;  4WFN 1;  5DM6 1; 
#chains in the Genus database with same CATH topology
 3PKI A;  4A3B L;  4POG A;  2ERJ A;  1NNQ A;  3PL5 A;  1QCV A;  5MLC 3;  3GTL L;  1K83 L;  1B2O A;  1TWF L;  5M5Y L;  1PFY A;  4AI3 A;  4JAG A;  1T9O A;  1F4L A;  4G6B A;  4A3D L;  2JA6 L;  4Y7N L;  2AUS B;  1P7P A;  5M3M L;  7RXN A;  3GTJ L;  2WB1 P;  2ZIX A;  5MF6 A;  3ZG6 A;  3LWV B;  5M5W L;  1S24 A;  6RXN A;  2B63 L;  2GMG A;  5JVG 1;  2XJT A;  1FHM A;  1B13 A;  2VL6 A;  5AN9 H;  1PZX A;  4AHX A;  1SMM A;  2JI3 A;  3S17 L;  3A44 A;  2XJU A;  5MFZ A;  1TWH L;  2LCQ A;  3QVD A;  3RYG A;  2V0E A;  4XGH A;  1Z92 B;  4AR3 A;  4U67 1;  4A3G L;  1IU5 A;  2C6B A;  5AI3 A;  3WWN B;  5FLM L;  3S2H L;  1RYQ A;  3H9C A;  3GTQ L;  3S1M L;  1TWG L;  5DM6 1;  2PVX A;  3H97 A;  3RZO L;  1RB9 A;  2O5J D;  4JAD A;  4TPU A;  1WJV A;  3GTG L;  2PSM C;  3HOV L;  2RDV A;  5C3E L;  5GAE c;  2B5I D;  4JAE A;  4C3H L;  5IP9 L;  1I6H L;  3B08 B;  4A3C L;  2R7Z L;  4AR4 A;  3PIO 1;  2MS3 A;  3JR7 A;  3MQK B;  1R0I A;  2XJV A;  1SFO L;  2M4V A;  4AYB P;  3HAX C;  1H7V A;  3M3Y L;  3LPE B;  3P2A A;  4AHZ A;  1YUX A;  4Y52 L;  1PFW A;  2PMZ P;  1B2J A;  4XXB B;  2JA5 L;  3CQZ L;  2M6P A;  4TVM A;  3HOW L;  3S16 L;  2L0Z A;  4AR5 A;  2Y0S P;  1JYB A;  2XJS A;  2NVQ L;  3PZA A;  4A3M L;  4BXX L;  1Y1V L;  1ODH A;  1SMW A;  3LWQ B;  1CAA A;  4AHW A;  2EY4 E;  2A6E D;  2V3B B;  1T9P A;  2Z3Q B;  2CKC A;  2QL0 A;  1RDV A;  1C09 A;  1RWD A;  5EIN C;  2AQC A;  4BY7 L;  2DSX A;  3K7A L;  3HOZ L;  1BRF A;  5IYB L;  5IP7 L;  1B71 A;  2Z3R B;  2JA7 L;  5M3F L;  1WCM L;  2APO B;  2K2D A;  4AI0 A;  4GS7 D;  4V19 6;  1PFU A;  5IY0 A;  4A3F L;  3LNL A;  1QQT A;  3GTM L;  3S1N L;  4QIW P;  1TWC L;  1IRO A;  4AI1 A;  4BBR L;  2PVE A;  1E8J A;  2KN9 A;  4C2M 1;  4B8C D;  3FKI L;  3RZD L;  2CR8 A;  2J9U B;  4AHY A;  1S2Z A;  2KKD A;  1R0G A;  2HVY C;  1ZRP A;  4A3K L;  2JA8 L;  2NVT L;  3KYX A;  5EIO C;  2HR5 A;  1RDG A;  5C4J L;  3S1Q L;  2R92 L;  2E2H L;  3IU3 I;  5RXN A;  3S14 L;  3HOY L;  1QYB A;  2NVY L;  5GAD c;  2M4Y A;  8RXN A;  2NVX L;  4YWL A;  3NFP I;  3PO3 L;  3B0A B;  5MGN A;  1R9T L;  2A6H D;  3RZ6 A;  5M5X L;  4AI2 A;  4ZN3 B;  3H99 A;  1OWC A;  4LHN A;  1YK4 A;  4E6Y A;  2R93 L;  1LKO A;  4ZN1 B;  1SMU A;  4X6A L;  1PFV A;  2A68 D;  2NYD A;  1RYT A;  1YUZ A;  2H12 A;  5AI2 A;  3K35 A;  1DX8 A;  1LKP A;  1LTL A;  5H1S c;  3GTO L;  3KYY A;  2A69 D;  1OWB A;  4A93 L;  5IYD L;  1CAD A;  2PYA A;  3QQC E;  2E2I L;  2JI2 A;  5DM7 1;  1IU6 A;  4RXN A;  4JAF A;  4C3I L;  2RFK B;  3KYV A;  3S15 L;  1BFY A;  3PKJ A;  5GAH c;  3I4N L;  3LWP B;  3J7Y 1;  3LWR B;  4LHL A;  3S2D L;  3HOU L;  4C3J L;  4WFN 1;  4AR6 A;  2YU9 L;  3M4O L;  5K2M E;  2AYJ A;  2C6A A;  1LKM A;  3P8B A;  1IRN A;  5C4X L;  3H9B A;  3PO2 L;  1DVB A;  3RZT A;  2BE5 D;  4A3J L;  1VZG A;  1BE7 A;  3WWL A;  2M6O A;  5FJ8 L;  1VCX A;  4YWM A;  3KYU A;  3KYW A;  1YK5 A;  1NXG A;  3GTK L;  2XJR A;  3HKZ P;  1S30 A;  1BQ9 A;  5JVH 1;  3VPB E;  2ERS A;  3GTP L;  1BQ8 A;  5GAG c;  1R0H A;  1I50 L;  4POF A;  3H3V M;  1YV1 A;  2E2J L;  3H0G L;  4K9F A;  3MSU A;  4ME3 A;  3HOX L;  2CKA A;  3HJW B;  3LWO B;  1TWA L;  1VZH A;  2PPT A;  5C44 L;  3SS2 A;  5IYC L;  3S1R L;  4A3L L;  2WAQ P;  1VZI A;  3FDJ A;  4A3E L;  1Y1W L;  3MPS A;  3J7Z 1;  4BY1 L;  2XJQ A;  2VUM L;  1I3Q L;  1FHH A;  1NXE A;  1IW7 D;  4UY8 1;  3I4M L;  4BBS L;  2JI1 A;  2XJP A;  2V0F A;  5MFP A;  1R0F A;  4A3I L;  3HJY B;  1R0J A;  3PIP 1;  1T9Q A;  3PWF A; 
#chains in the Genus database with same CATH homology
 4AI1 A;  2PVE A;  3PKI A;  4POG A;  2ERJ A;  3B08 B;  1BFY A;  2KN9 A;  1NNQ A;  3PKJ A;  5GAH c;  1E8J A;  4AR4 A;  3J7Y 1;  4LHL A;  3PIO 1;  4B8C D;  2MS3 A;  2CR8 A;  2J9U B;  1QCV A;  5MLC 3;  4AHY A;  1S2Z A;  2KKD A;  4WFN 1;  4AR6 A;  1R0G A;  1R0I A;  2XJV A;  2M4V A;  5K2M E;  1ZRP A;  2AYJ A;  1B2O A;  1H7V A;  3KYX A;  3LPE B;  2C6A A;  5EIO C;  2HR5 A;  1LKM A;  3P8B A;  4AI3 A;  4JAG A;  1IRN A;  1T9O A;  3P2A A;  1RDG A;  4G6B A;  1DVB A;  3RZT A;  4AHZ A;  2BE5 D;  1YUX A;  3IU3 I;  5RXN A;  1B2J A;  1BE7 A;  1VZG A;  4XXB B;  3WWL A;  2M6O A;  7RXN A;  1VCX A;  2ZIX A;  4YWM A;  3KYU A;  3KYW A;  1YK5 A;  5MF6 A;  1QYB A;  3ZG6 A;  2M6P A;  4TVM A;  1NXG A;  5GAD c;  2M4Y A;  8RXN A;  2L0Z A;  2XJR A;  4AR5 A;  3KYV A;  1S30 A;  1JYB A;  1S24 A;  2XJS A;  4YWL A;  1BQ9 A;  3NFP I;  5JVH 1;  3VPB E;  2ERS A;  3PZA A;  1BQ8 A;  6RXN A;  2GMG A;  5GAG c;  3B0A B;  1R0H A;  1ODH A;  5JVG 1;  5MGN A;  1SMW A;  2A6H D;  4POF A;  2XJT A;  1YV1 A;  1FHM A;  1B13 A;  2VL6 A;  3RZ6 A;  5AN9 H;  4AHX A;  1SMM A;  1CAA A;  4AHW A;  3PIP 1;  4K9F A;  4AI2 A;  3MSU A;  2JI3 A;  3A44 A;  4ME3 A;  2XJU A;  5MFZ A;  2LCQ A;  2CKA A;  2A6E D;  3QVD A;  3RYG A;  2V3B B;  4ZN3 B;  2V0E A;  4XGH A;  1T9P A;  1VZH A;  1OWC A;  1Z92 B;  2CKC A;  2PPT A;  2Z3Q B;  2QL0 A;  4LHN A;  1YK4 A;  3SS2 A;  4AR3 A;  1RDV A;  1C09 A;  4U67 1;  4E6Y A;  1RWD A;  5EIN C;  1VZI A;  1LKO A;  1IU5 A;  2C6B A;  4ZN1 B;  5AI3 A;  3WWN B;  1SMU A;  2A68 D;  2DSX A;  3MPS A;  3J7Z 1;  1BRF A;  2NYD A;  1RYT A;  1YUZ A;  2H12 A;  2XJQ A;  5AI2 A;  3K35 A;  1DX8 A;  1RYQ A;  1LKP A;  1LTL A;  1FHH A;  5H1S c;  1NXE A;  3KYY A;  1B71 A;  2A69 D;  2Z3R B;  1OWB A;  1IW7 D;  2K2D A;  2PVX A;  5DM6 1;  4AI0 A;  4UY8 1;  4GS7 D;  1CAD A;  1RB9 A;  4V19 6;  2PYA A;  2O5J D;  2JI1 A;  4JAD A;  4TPU A;  2XJP A;  3QQC E;  2V0F A;  5MFP A;  1WJV A;  2JI2 A;  1R0F A;  5DM7 1;  5IY0 A;  2PSM C;  3LNL A;  1IU6 A;  2RDV A;  4RXN A;  4JAF A;  1R0J A;  5GAE c;  2B5I D;  4JAE A;  1IRO A;  1T9Q A;  3PWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...