3PIO1

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
53
structure length
53
Chain Sequence
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 1
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pio100
4WFN1 5DM71 5JVH1 5GADc 4U671 3PIP1 3PIO1 5JVG1 4V196 4UY81 5MLC3 5DM61 5GAEc 3J7Z1 5H1Sc 5GAGc 5GAHc 3J7Y1
chains in the Genus database with same CATH superfamily
2KN9A 1CAAA 3S1RL 4TPUA 3I4NL 1T9PA 1QYBA 3S1QL 5FLML 4C3HL 4JAGA 1OWCA 2C6BA 3M3YL 2PYAA 4AI2A 4YWMA 4A3CL 1VZIA 3GTLL 2HR5A 2H12A 1R9TL 5C3EL 3WWNB 2NVYL 4Y52L 3LWRB 2M6OA 1FHHA 1LKMA 4AHXA 4AHZA 2BE5D 4ME3A 3S15L 3VPBE 5GAEc 2CR8A 2JA6L 2WAQP 2YU9L 2A6ED 2NVTL 4BXXL 3HOXL 1IU6A 2APOB 3GTKL 1BRFA 1BFYA 3RZTA 1CADA 1R0GA 3GTGL 2J9UB 1RYTA 2XJSA 4U671 5K2ME 2JA8L 1RDVA 4POGA 4XGHA 5IP9L 5MGNA 1NNQA 4AI1A 1IRNA 3MQKB 2HVYC 1LKOA 2Z3QB 2O5JD 2M6PA 1LTLA 5C4XL 1RWDA 1B71A 3RZ6A 4LHNA 1TWHL 2XJPA 4A3IL 3KYVA 4A3LL 4UY81 2MS3A 3KYUA 2JI3A 2XJVA 4LHLA 3GTOL 2NVQL 4A3DL 1Z92B 2WB1P 3S2DL 2KKDA 2NVXL 3A44A 1VZHA 5FJ8L 4AR6A 5DM61 3HJWB 1YK4A 3FDJA 3NFPI 5M5YL 4A3JL 3HOZL 4AI3A 3JR7A 1PFYA 3S16L 4C2M1 3KYXA 3PO2L 1JYBA 1DX8A 3CQZL 2XJUA 3HOVL 3LWVB 5AN9H 4TVMA 5AI3A 1Y1VL 1DVBA 4BBSL 5JVH1 5M5XL 5MF6A 1QQTA 5IY0A 3QVDA 3B08B 2E2IL 2K2DA 4A3FL 4B8CD 4C3JL 2PSMC 1RB9A 5M5WL 1PFWA 2CKCA 1R0JA 1TWCL 3ZG6A 1ZRPA 1T9QA 5RXNA 4AHWA 5JVG1 2JA5L 2ZIXA 3IU3I 3J7Z1 1PFVA 2AQCA 3PIO1 2XJRA 1RDGA 3PIP1 5IP7L 2E2HL 3HKZP 2M4YA 5M3FL 1S2ZA 1PFUA 5EINC 8RXNA 1RYQA 2B5ID 2RDVA 4JADA 3S2HL 4A3BL 4JAEA 3FKIL 2VL6A 3S14L 3H97A 3MPSA 4BY7L 3PL5A 3GTQL 1YUXA 1E8JA 2Z3RB 1PZXA 1FHMA 5GAHc 3GTJL 5IYDL 1I50L 2Y0SP 2AYJA 1SMUA 5EIOC 1SMMA 1I6HL 5MLC3 2PVXA 2NYDA 1R0HA 3HOUL 4E6YA 1K83L 4AR4A 5MFZA 2ERSA 5GADc 3LNLA 3PWFA 4YWLA 1IW7D 2RFKB 1QCVA 1BE7A 4AI0A 5MFPA 3J7Y1 3RZOL 3HJYB 3S1NL 3KYYA 4A3EL 6RXNA 2GMGA 1S24A 2R93L 3B0AB 1VCXA 1BQ8A 4X6AL 1TWFL 4A3GL 3I4ML 1NXEA 2EY4E 5AI2A 3HAXC 5IYCL 3LPEB 1TWGL 2XJTA 3WWLA 4XXBB 2VUML 1YUZA 1B2OA 5C44L 2PMZP 2L0ZA 1Y1WL 2A68D 2CKAA 1SMWA 1P7PA 1YV1A 4AHYA 1TWAL 4ZN3B 4QIWP 3PKIA 1R0FA 4ZN1B 5IYBL 2A69D 3K7AL 4AYBP 3RYGA 1BQ9A 1IU5A 3MSUA 2PVEA 3KYWA 2C6AA 3M4OL 3HOYL 3LWOB 3P8BA 3PO3L 3LWPB 5M3ML 1NXGA 2V0EA 3P2AA 4GS7D 1I3QL 3S17L 2E2JL 2R92L 1B2JA 1WCML 4BBRL 3S1ML 4A93L 3GTML 2JA7L 3HOWL 4AR3A 3LWQB 1H7VA 2XJQA 1B13A 4Y7NL 2DSXA 3PKJA 3RZDL 5C4JL 3H0GL 5DM71 2ERJA 1T9OA 1WJVA 2LCQA 2R7ZL 5GAGc 3K35A 2A6HD 3GTPL 4K9FA 1F4LA 2AUSB 3PZAA 5H1Sc 1S30A 3H9CA 2B63L 4POFA 4A3ML 1C09A 2PPTA 4WFN1 4BY1L 2V0FA 4V196 3H99A 4JAFA 3H3VM 1VZGA 4A3KL 2M4VA 1LKPA 7RXNA 1YK5A 3H9BA 2JI1A 1SFOL 2QL0A 1ODHA 4G6BA 3QQCE 1R0IA 1IROA 2JI2A 4AR5A 1OWBA 4C3IL 2V3BB 4RXNA 3SS2A
chains in the Genus database with same CATH topology
2KN9A 2XJRA 1CAAA 2L0ZA 1RDGA 2A68D 3PIP1 1RWDA 1B71A 3RZ6A 2CKAA 4TPUA 1SMWA 1YV1A 4LHNA 4AHYA 4ZN3B 2M4YA 2XJPA 1T9PA 3KYVA 3PKIA 1R0FA 1QYBA 2MS3A 4ZN1B 4UY81 1S2ZA 4JAGA 1OWCA 3KYUA 5EINC 2JI3A 2XJVA 2C6BA 2A69D 4LHLA 8RXNA 1RYQA 3RYGA 2B5ID 2RDVA 4JADA 1Z92B 2PYAA 1BQ9A 4JAEA 4AI2A 1B2OA 1IU5A 2VL6A 4YWMA 2KKDA 3MSUA 1VZIA 3A44A 2HR5A 2H12A 1VZHA 2PVEA 3WWNB 3KYWA 3MPSA 4AR6A 2C6AA 5DM61 3P8BA 1YK4A 1YUXA 1E8JA 2M6OA 2Z3RB 1NXGA 2V0EA 1FHHA 1FHMA 3NFPI 1LKMA 3P2AA 4GS7D 5GAHc 4AHXA 4AI3A 4AHZA 2BE5D 1B2JA 2AYJA 3KYXA 1SMUA 1JYBA 4ME3A 5EIOC 3VPBE 1DX8A 1SMMA 4AR3A 5MLC3 5GAEc 2CR8A 2XJUA 2PVXA 2NYDA 1H7VA 1R0HA 2XJQA 2A6ED 1B13A 5AN9H 4TVMA 4E6YA 2DSXA 3PKJA 5AI3A 4AR4A 1IU6A 1DVBA 5DM71 5JVH1 5MFZA 2ERSA 2ERJA 5MF6A 1T9OA 5GADc 3LNLA 5IY0A 1WJVA 1BRFA 2LCQA 3PWFA 3QVDA 3B08B 5GAGc 1BFYA 4YWLA 3K35A 1IW7D 2A6HD 3RZTA 1CADA 2K2DA 1R0GA 4K9FA 3PZAA 2J9UB 5H1Sc 1QCVA 1RYTA 1BE7A 4AI0A 5MFPA 4B8CD 3J7Y1 2XJSA 1S30A 2PSMC 3KYYA 4POFA 4U671 1RB9A 6RXNA 2GMGA 1S24A 5K2ME 1C09A 3B0AB 2PPTA 4WFN1 1VCXA 1BQ8A 2CKCA 2V0FA 1R0JA 1RDVA 4POGA 4V196 4XGHA 5MGNA 3ZG6A 1ZRPA 1T9QA 4JAFA 1NNQA 4AI1A 1VZGA 5RXNA 2M4VA 1IRNA 4AHWA 1LKPA 7RXNA 5JVG1 1YK5A 2JI1A 2ZIXA 1NXEA 1LKOA 2QL0A 3IU3I 5AI2A 3J7Z1 1ODHA 2Z3QB 3LPEB 4G6BA 3QQCE 2O5JD 1R0IA 3WWLA 2XJTA 1IROA 2JI2A 4AR5A 1OWBA 2V3BB 3PIO1 4XXBB 4RXNA 2M6PA 1YUZA 1LTLA 3SS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFN 1;  5DM7 1;  5JVH 1;  5GAD c;  4U67 1;  3PIP 1;  3PIO 1;  5JVG 1;  4V19 6;  4UY8 1;  5MLC 3;  5DM6 1;  5GAE c;  3J7Z 1;  5H1S c;  5GAG c;  5GAH c;  3J7Y 1; 
#chains in the Genus database with same CATH topology
 2KN9 A;  1CAA A;  3S1R L;  4TPU A;  3I4N L;  1T9P A;  1QYB A;  3S1Q L;  5FLM L;  4C3H L;  4JAG A;  1OWC A;  2C6B A;  3M3Y L;  2PYA A;  4AI2 A;  4YWM A;  4A3C L;  1VZI A;  3GTL L;  2HR5 A;  2H12 A;  1R9T L;  5C3E L;  3WWN B;  2NVY L;  4Y52 L;  3LWR B;  2M6O A;  1FHH A;  1LKM A;  4AHX A;  4AHZ A;  2BE5 D;  4ME3 A;  3S15 L;  3VPB E;  5GAE c;  2CR8 A;  2JA6 L;  2WAQ P;  2YU9 L;  2A6E D;  2NVT L;  4BXX L;  3HOX L;  1IU6 A;  2APO B;  3GTK L;  1BRF A;  1BFY A;  3RZT A;  1CAD A;  1R0G A;  3GTG L;  2J9U B;  1RYT A;  2XJS A;  4U67 1;  5K2M E;  2JA8 L;  1RDV A;  4POG A;  4XGH A;  5IP9 L;  5MGN A;  1NNQ A;  4AI1 A;  1IRN A;  3MQK B;  2HVY C;  1LKO A;  2Z3Q B;  2O5J D;  2M6P A;  1LTL A;  5C4X L;  1RWD A;  1B71 A;  3RZ6 A;  4LHN A;  1TWH L;  2XJP A;  4A3I L;  3KYV A;  4A3L L;  4UY8 1;  2MS3 A;  3KYU A;  2JI3 A;  2XJV A;  4LHL A;  3GTO L;  2NVQ L;  4A3D L;  1Z92 B;  2WB1 P;  3S2D L;  2KKD A;  2NVX L;  3A44 A;  1VZH A;  5FJ8 L;  4AR6 A;  5DM6 1;  3HJW B;  1YK4 A;  3FDJ A;  3NFP I;  5M5Y L;  4A3J L;  3HOZ L;  4AI3 A;  3JR7 A;  1PFY A;  3S16 L;  4C2M 1;  3KYX A;  3PO2 L;  1JYB A;  1DX8 A;  3CQZ L;  2XJU A;  3HOV L;  3LWV B;  5AN9 H;  4TVM A;  5AI3 A;  1Y1V L;  1DVB A;  4BBS L;  5JVH 1;  5M5X L;  5MF6 A;  1QQT A;  5IY0 A;  3QVD A;  3B08 B;  2E2I L;  2K2D A;  4A3F L;  4B8C D;  4C3J L;  2PSM C;  1RB9 A;  5M5W L;  1PFW A;  2CKC A;  1R0J A;  1TWC L;  3ZG6 A;  1ZRP A;  1T9Q A;  5RXN A;  4AHW A;  5JVG 1;  2JA5 L;  2ZIX A;  3IU3 I;  3J7Z 1;  1PFV A;  2AQC A;  3PIO 1;  2XJR A;  1RDG A;  3PIP 1;  5IP7 L;  2E2H L;  3HKZ P;  2M4Y A;  5M3F L;  1S2Z A;  1PFU A;  5EIN C;  8RXN A;  1RYQ A;  2B5I D;  2RDV A;  4JAD A;  3S2H L;  4A3B L;  4JAE A;  3FKI L;  2VL6 A;  3S14 L;  3H97 A;  3MPS A;  4BY7 L;  3PL5 A;  3GTQ L;  1YUX A;  1E8J A;  2Z3R B;  1PZX A;  1FHM A;  5GAH c;  3GTJ L;  5IYD L;  1I50 L;  2Y0S P;  2AYJ A;  1SMU A;  5EIO C;  1SMM A;  1I6H L;  5MLC 3;  2PVX A;  2NYD A;  1R0H A;  3HOU L;  4E6Y A;  1K83 L;  4AR4 A;  5MFZ A;  2ERS A;  5GAD c;  3LNL A;  3PWF A;  4YWL A;  1IW7 D;  2RFK B;  1QCV A;  1BE7 A;  4AI0 A;  5MFP A;  3J7Y 1;  3RZO L;  3HJY B;  3S1N L;  3KYY A;  4A3E L;  6RXN A;  2GMG A;  1S24 A;  2R93 L;  3B0A B;  1VCX A;  1BQ8 A;  4X6A L;  1TWF L;  4A3G L;  3I4M L;  1NXE A;  2EY4 E;  5AI2 A;  3HAX C;  5IYC L;  3LPE B;  1TWG L;  2XJT A;  3WWL A;  4XXB B;  2VUM L;  1YUZ A;  1B2O A;  5C44 L;  2PMZ P;  2L0Z A;  1Y1W L;  2A68 D;  2CKA A;  1SMW A;  1P7P A;  1YV1 A;  4AHY A;  1TWA L;  4ZN3 B;  4QIW P;  3PKI A;  1R0F A;  4ZN1 B;  5IYB L;  2A69 D;  3K7A L;  4AYB P;  3RYG A;  1BQ9 A;  1IU5 A;  3MSU A;  2PVE A;  3KYW A;  2C6A A;  3M4O L;  3HOY L;  3LWO B;  3P8B A;  3PO3 L;  3LWP B;  5M3M L;  1NXG A;  2V0E A;  3P2A A;  4GS7 D;  1I3Q L;  3S17 L;  2E2J L;  2R92 L;  1B2J A;  1WCM L;  4BBR L;  3S1M L;  4A93 L;  3GTM L;  2JA7 L;  3HOW L;  4AR3 A;  3LWQ B;  1H7V A;  2XJQ A;  1B13 A;  4Y7N L;  2DSX A;  3PKJ A;  3RZD L;  5C4J L;  3H0G L;  5DM7 1;  2ERJ A;  1T9O A;  1WJV A;  2LCQ A;  2R7Z L;  5GAG c;  3K35 A;  2A6H D;  3GTP L;  4K9F A;  1F4L A;  2AUS B;  3PZA A;  5H1S c;  1S30 A;  3H9C A;  2B63 L;  4POF A;  4A3M L;  1C09 A;  2PPT A;  4WFN 1;  4BY1 L;  2V0F A;  4V19 6;  3H99 A;  4JAF A;  3H3V M;  1VZG A;  4A3K L;  2M4V A;  1LKP A;  7RXN A;  1YK5 A;  3H9B A;  2JI1 A;  1SFO L;  2QL0 A;  1ODH A;  4G6B A;  3QQC E;  1R0I A;  1IRO A;  2JI2 A;  4AR5 A;  1OWB A;  4C3I L;  2V3B B;  4RXN A;  3SS2 A; 
#chains in the Genus database with same CATH homology
 2KN9 A;  2XJR A;  1CAA A;  2L0Z A;  1RDG A;  2A68 D;  3PIP 1;  1RWD A;  1B71 A;  3RZ6 A;  2CKA A;  4TPU A;  1SMW A;  1YV1 A;  4LHN A;  4AHY A;  4ZN3 B;  2M4Y A;  2XJP A;  1T9P A;  3KYV A;  3PKI A;  1R0F A;  1QYB A;  2MS3 A;  4ZN1 B;  4UY8 1;  1S2Z A;  4JAG A;  1OWC A;  3KYU A;  5EIN C;  2JI3 A;  2XJV A;  2C6B A;  2A69 D;  4LHL A;  8RXN A;  1RYQ A;  3RYG A;  2B5I D;  2RDV A;  4JAD A;  1Z92 B;  2PYA A;  1BQ9 A;  4JAE A;  4AI2 A;  1B2O A;  1IU5 A;  2VL6 A;  4YWM A;  2KKD A;  3MSU A;  1VZI A;  3A44 A;  2HR5 A;  2H12 A;  1VZH A;  2PVE A;  3WWN B;  3KYW A;  3MPS A;  4AR6 A;  2C6A A;  5DM6 1;  3P8B A;  1YK4 A;  1YUX A;  1E8J A;  2M6O A;  2Z3R B;  1NXG A;  2V0E A;  1FHH A;  1FHM A;  3NFP I;  1LKM A;  3P2A A;  4GS7 D;  5GAH c;  4AHX A;  4AI3 A;  4AHZ A;  2BE5 D;  1B2J A;  2AYJ A;  3KYX A;  1SMU A;  1JYB A;  4ME3 A;  5EIO C;  3VPB E;  1DX8 A;  1SMM A;  4AR3 A;  5MLC 3;  5GAE c;  2CR8 A;  2XJU A;  2PVX A;  2NYD A;  1H7V A;  1R0H A;  2XJQ A;  2A6E D;  1B13 A;  5AN9 H;  4TVM A;  4E6Y A;  2DSX A;  3PKJ A;  5AI3 A;  4AR4 A;  1IU6 A;  1DVB A;  5DM7 1;  5JVH 1;  5MFZ A;  2ERS A;  2ERJ A;  5MF6 A;  1T9O A;  5GAD c;  3LNL A;  5IY0 A;  1WJV A;  1BRF A;  2LCQ A;  3PWF A;  3QVD A;  3B08 B;  5GAG c;  1BFY A;  4YWL A;  3K35 A;  1IW7 D;  2A6H D;  3RZT A;  1CAD A;  2K2D A;  1R0G A;  4K9F A;  3PZA A;  2J9U B;  5H1S c;  1QCV A;  1RYT A;  1BE7 A;  4AI0 A;  5MFP A;  4B8C D;  3J7Y 1;  2XJS A;  1S30 A;  2PSM C;  3KYY A;  4POF A;  4U67 1;  1RB9 A;  6RXN A;  2GMG A;  1S24 A;  5K2M E;  1C09 A;  3B0A B;  2PPT A;  4WFN 1;  1VCX A;  1BQ8 A;  2CKC A;  2V0F A;  1R0J A;  1RDV A;  4POG A;  4V19 6;  4XGH A;  5MGN A;  3ZG6 A;  1ZRP A;  1T9Q A;  4JAF A;  1NNQ A;  4AI1 A;  1VZG A;  5RXN A;  2M4V A;  1IRN A;  4AHW A;  1LKP A;  7RXN A;  5JVG 1;  1YK5 A;  2JI1 A;  2ZIX A;  1NXE A;  1LKO A;  2QL0 A;  3IU3 I;  5AI2 A;  3J7Z 1;  1ODH A;  2Z3Q B;  3LPE B;  4G6B A;  3QQC E;  2O5J D;  1R0I A;  3WWL A;  2XJT A;  1IRO A;  2JI2 A;  4AR5 A;  1OWB A;  2V3B B;  3PIO 1;  4XXB B;  4RXN A;  2M6P A;  1YUZ A;  1LTL A;  3SS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...