3PIO3

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
total genus 3
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pio300
5DM63 3PIO3 5JVG3 4WFN3 3PIP3 5DM73 5JVH3 4U673
chains in the Genus database with same CATH superfamily
3E6ZX 3GV3A 1YNXA 4DR4L 1VF5C 1WTQA 3HKSA 3P1HA 4WORA 3DM1A 3SDZA 1TWGH 4C3HG 4C3JH 4DXGA 3AMUA 4F87A 4HSPA 3KLSA 4DUZL 3K0XA 5C4XG 3A8KE 4CDFC 4A3KH 3PUYA 1CKNB 1STNA 1J5EL 4RGNA 1CQVA 1BOSA 1DYQA 4YWKA 1HZBA 2H1EA 1I50B 2CWPA 2A6EC 1G2SA 1MI2A 5ISRA 1LTID 1AZQA 2R61A 4DR6L 2WB1E 2K05A 4HMIA 2E2IH 3PIPA 4A3BH 3DM3A 1I4QA 1PH4A 3DLLA 3S2DB 5M3FH 2RVLA 1BUVT 2JK8A 1E1TA 5COYA 4A4IA 1WTXA 1HHVA 1CSQA 3L7ZC 3CKIB 4C3IB 1IL8A 3OPOA 3GTMB 2ICEC 4LJZC 1TY2A 1VQGA 1VQEA 1U4LA 4AH6A 4DV0L 4DR6Q 4A3JG 1XYIA 3CRLC 5IYBG 4C3HB 4FXKC 1K83H 4IALA 5DM73 1SDFA 4AQYL 4KJOA 4QY7A 1FYCA 2WKCA 3J7YW 2J0TD 4CKEA 2F3IA 1HZCA 3NQIA 5C44B 2NVXB 5IT9E 1NNXA 3K81C 4DUZQ 2GVAA 3GTKH 2JJQA 3GTLB 2PMZB 2F0NA 3W3AA 1SJHD 3T13A 1ASYA 4GOPC 5JVG3 3S16B 4JI3L 1WVLA 3K80C 3H3VC 3C1FA 2EXDA 4YHHQ 4BY1G 4IN3A 5HURA 1E3PA 3QJYA 3QOJA 1TIID 1HZAA 3CAMA 5CBAE 1VF7A 5K36H 1YIJA 2WP8J 2DY7A 3VR2A 3SXHA 1G91A 2DY8A 1YI2A 3A55A 5D3DA 4GNXB 1Y69U 1PMRA 2N88A 2B3GA 5IYBH 4F7XA 1JJ2A 3TZUA 1L0YB 2Q2TA 1GUSA 2EYPA 3A54A 3PMFA 5LMUQ 2OF1A 2VB3X 2KEEA 4GKKL 4A3GH 4KI0A 5KYIA 1E2VA 5KNCA 1XTCD 1X65A 5FO9B 5M5WH 2EE1A 5M5WB 1GXDC 4X65L 3IFTA 3OOCA 1Q1EA 4DK6C 5GADC 3NTKA 4LF8Q 4GZYC 1A62A 2HDLA 2K5DA 3I8ZA 1STEA 3PUZA 5FLMG 4KV6A 1ZKOA 3QG1A 3DWQA 2Z8LA 1WYDA 1CHPD 2QF7A 4DNIA 3MWYW 3KDFA 5C5LA 2L11A 3J80i 3TP6A 4TRDA 4IUNA 3SK6A 1GD7A 3WWVA 4J15A 1SJED 1Y1WB 1DXMA 4GNXC 4DNTB 1VCIA 2E74C 3HKZG 2DN8A 3EA6A 5EGTA 4A3MH 4PZ8A 1B44D 1LT5D 3QWNA 1X3EA 5ELDA 1N33Q 3HOVH 1CKOA 2MJ8A 1PRTC 1PTOD 4HR7B 3GTLH 1Y14B 4K8IA 4CJ2C 4DK0A 5M5YH 4UPAA 2EYHA 5IGFA 4XIGS 4ZK9B 1I4XA 1A3TA 3I4MG 1XPUA 3EBEA 3K7AH 5BN4A 3D0FA 1H9RA 1BDOA 2E2DC 3OSOA 1Z9FA 5EPLA 1PA6A 3D6CA 1F9RA 4A3MB 3K0YA 2G9DA 5AFWA 2F0SA 4B9WA 3E9HA 1O80A 5I9PA 1KDAA 4X66L 4CKBA 1LTBD 1UEBA 2IX1A 1H9SA 1WCMG 1IBMQ 3MFYA 3PF5A 2OTJA 4ILWA 1WOCA 1Y8NB 2EJMA 3T4AC 1DD2A 4P2CB 4RKLA 2ZJPA 1PH6A 2AUKA 2E5LQ 2F1MA 4KHPQ 1HXYD 3S2DH 1XWEA 1KDBA 5I6YA 4EGVA 4OONA 1SNDA 3TMEA 4CJ1B 4KD4A 3ZYYX 1PH5A 5I4DA 4DV2L 3HOZH 4TKOB 2ALYB 3I7FA 4DV4Q 1EOTA 1U0LA 1HJPA 2F0MA 4GN3B 4XQJA 4JW0A 2X6GA 1VQNA 4CDCC 2N78A 1BNZA 4B3SL 5FJ8G 4NPSA 1JR0D 2JA7B 2IX3A 2FXQA 1JWSD 3NELA 3HOUB 1KHIA 1LYLA 1HNZQ 3GTOH 1JORA 5C0XH 2VUMG 5J1ZA 4A3CH 1SNMA 3H3VI 5FLXE 1QNKA 1F2MA 2UUAL 4DK3C 5FLMH 1PH2A 1JE5A 4B3RL 1PZKD 3ULLA 3KF8A 3J80L 1PYSB 3K6OA 2PI2E 2VQEQ 4QIWE 2ES2A 2FHTA 4GKKQ 1EQQA 5A35A 1WTRA 3Q22A 1UWVA 2MUYA 1UE5A 2WAQE 2A73B 1B2TA 2EPBA 3TS0A 4IUTA 1A0IA 1TWAH 3SHLA 4QUFA 2Z1CA 4RH6A 1EEID 1STBA 5C4JB 3OWFA 3DWAA 3PV0A 1IL2A 4UHVA 1BCPB 1QVGA 3HOWH 2BOSA 1JCKB 4WJ3M 4B3MQ 3A8IE 3HOUG 4DA2A 4LF7Q 3M7NA 4C3HH 1ET6A 4KHVA 3W5OA 5J3BA 3S14H 3CC4A 5FLXc 2J4XA 2JA6G 1ZYRD 1BBUA 3KF8B 1EWHA 3M9BA 5C0XI 2F52A 1F9SA 4XXEA 3W1BA 4UP9A 5JEAH 3DMUA 1FD7D 1ONLA 3D4DA 3TZDA 1IZ6A 4DV3L 1PYWD 2H4OA 2BDNA 1X3FA 3RZOH 1JOOA 1OO9B 2O2LD 3I72A 4LF9Q 3IL8A 3R8BA 3I4OA 4OXPA 1W3SA 5KGUA 3F2BA 2NYZD 4QMGA 2G5DA 4PZ7A 1N8RC 4LW1A 3TREA 1LM0A 1YEZA 4K8JA 4G57A 1TY0A 2R92B 2A1AA 4NXNL 1C8CA 3HOYH 4DR7L 4A93G 1P8LA 5A2QL 1QZHA 3EIVA 1LV9A 4LUVA 4NXML 2HHHL 2PI2A 1K9MC 3EROA 1D1IA 2EY6A 1HH2P 1S3OA 1EIYB 1S40A 1NUCA 1B3AA 3TSSA 1EU3A 1PH3A 5GAGC 3PO3B 3K5OA 3M4OH 4IUQA 2LMCB 2K04A 4JI1Q 4GOPA 4KKSA 4B3SQ 1PTOF 2ZTDA 1OXSC 2OWOA 3F2DA 3CCQA 1KNEA 4R8IA 3MHBA 5JAVA 4X62Q 1M4VA 1SXTA 4LF6Q 1FGBD 3AFQA 4J1MA 1VQ5A 3G6EA 1KAAA 4MZ9A 4PMWA 2N55A 1YJWA 2IW3A 1SMYD 3VA5A 1E7ZA 2D0OA 3J7AV 1YZ6A 1JWUD 1DOMA 2LFNA 4OIJA 3Q23A 4R8NA 2B2YC 3I4NH 4G7OC 3GTOB 2VW9A 4OWTB 1N34Q 2F4VL 2K1BA 3GTGB 3MZ5A 2NN6H 2ATWA 3HOXG 1VDZA 4B3TQ 1L2FA 2K28A 3QOLA 1JE4A 1L0WA 1XTDA 4JI2L 3VYSA 4LF9L 4UY8C 4LF7L 1B70B 3S15B 3R3OA 2KOLA 1F2YA 3MVVA 3PO3G 1ZXTA 2CW0D 5JJLA 4NDXA 3T1YL 3MTSA 1EY9A 4JC0A 4KKTA 2SEBD 4BA2I 5C3EB 1L1OB 1LTSD 1MGSA 2NZ1D 2OCEA 3PIOA 2R7ZB 1TS5A 2F0WA 1WI5A 4CBVA 1O7IA 2ASBA 1V1OA 3CD6A 5ELNA 2M9VA 5C5MA 3CP0A 3GTPH 1VQFA 2C35B 1TVXA 4HIDA 1IBLL 3KJPA 1KDCA 2CWAA 4HJAA 3S1QB 2MGSA 1VQKA 1KL9A 1PH9A 5I6WA 4FF4A 1EU4A 3GTQB 2NTTA 3K7AB 4DAVA 4PMCA 3H0GH 5C3XA 3OTOQ 4WJ4A 5CORA 5G3LD 4DR2Q 2E2HB 5IT9L 3A5ZB 4H7BA 4CJ0B 3IAYA 2N8NA 2F0UA 5JEAJ 3MEFA 1EL0A 1LT4D 3H94A 2JA9A 4LF8L 1SE2A 3PUWA 1C4QA 4TVAB 4DUYQ 2XTIA 1HNXQ 5IT9c 2F0QA 2I07B 2R6GA 2P5ZX 2MP1A 1EWIA 4DV6Q 2IPKD 2EY1A 4DV7L 2MO0A 4N9TA 3J7A5 2VY3A 1GUOA 3H6MA 3RLFA 4JI7L 1I3QB 2MPMA 4NMZA 4DF7A 1MD2D 1K8AC 4HSVA 2Z4IA 5CV9A 2ZTCA 2J7ZA 1HPCA 1G8ZD 2V4DA 2Y0SE 3AYHB 1N9WA 4KY5A 4DPGA 4MTNA 4ZLTF 5C4XH 1IXRA 4YWMA 2KA7A 1BCPC 1SNOA 5JPMC 1M8AA 5KIXA 1HQRD 3HGBA 5AJ3L 4HIOA 4RGMA 3S1NB 4K6LA 2K01A 3U9OA 4YIJA 1FNWA 4LWCA 2NVTB 4L63B 1K3RA 4LUOA 3JAMc 4TSSA 1K8OA 1JOKA 2F0HA 1PTOB 1BF4A 1JICA 2VQEL 2JEBI 2WB1G 1V1PB 4B3RQ 4Y7NB 4P72A 3J81E 1HUMA 2Y0SB 3S17H 1Y1VG 4ME5A 4OWWB 3RZOB 1MKHA 2VXWA 1Z6HA 1D1KA 2CQAA 2B2TA 1S5FD 2TSSA 5ELOA 4K0KL 1SYBA 3ND9A 2JA8B 4GN5A 3C1EA 3R2IA 4LF5L 1VQCA 1IKLA 1H9MA 2I5LX 5FK9C 3LWEA 4X64L 1I5FA 4OWXB 2I46A 1GM5A 1AE2A 3B6YA 1A8VA 4JYAL 3GTMH 5FOBB 3SEBA 3SVMA 4JI5L 4ZAIA 4C3IH 2BA1A 4DR2L 2B63B 5HGQA 1Q8KA 2B2UA 2RDGA 1XMQQ 4LK1C 3D8GA 4B3TL 1W2BA 4R9WA 3KDFB 4I7ZC 2I5MX 4B08A 3CW2C 1YNJD 4IFDG 2F4VQ 5JJIA 1V1QA 5HY6A 1L1OA 5IYDH 3QO2A 1STAA 1LTGD 2B8GA 2A5HA 2K14A 1HNXL 1QOHA 1L1OC 2UXDQ 4GN4B 3PO2G 1EOVA 5C44G 2DJGC 2EYLA 4C1NK 3L0OA 4DK1A 1RJTA 4A93B 2NVTH 2YTVA 1S5BD 1EQRA 2IT1A 1XXGA 1Z47A 2PYKA 1EY0A 4RFBA 4DAPA 5KNBA 3NTHA 1B8AA 1TS2A 2H5XA 4HIMA 1O78A 2Q2HA 2LS01 3SGIA 4XQNA 3G6JB 1CI3M 3N6RA 1VQOA 1EY8A 2D9UA 1VQHA 1XMOQ 2DUDA 1PH1A 4L8JA 1N33L 3RZDH 4A93H 4GLVB 3JAME 1ENAA 4A76A 1PXUA 1ENCA 3VR4A 1LTLA 2YYZA 1RKNA 4A3FG 3E5SA 5KRUA 4RHRA 1DZ1A 1X3QA 3SK8A 1NJIC 3TRZA 2TMPA 4R4IA 3G7LA 2B2VC 3D4RA 2KHJA 3NPPA 3AQQA 4QCLA 4F8MA 3UDGA 1Q81C 3TP7A 4X64Q 2EYOA 3M4QA 4QIWB 3HOVG 2B63H 3VA7A 3I4NG 4DV7Q 2K4KA 4X3SA 1UE1A 2WV6D 1SAPA 2EVBA 1WTHA 3K8AA 1J5EQ 1CTMA 2WAQB 4OELB 3WOEA 2DNCA 3RN5A 1YHQA 1K0RA 5JVH3 1EYDA 4HCSA 4H44C 3HOWG 2JA8H 4A3LH 4KJNA 2K03A 3EVQA 4ODGA 5IP9H 5M5YB 2X69A 4Q5VA 1KAWA 1EIGA 1ICWA 4KY6A 1VQPA 3I90A 1Y8OB 5T1IA 2VZAA 2NZHA 5LHY1 3K57A 4IFDI 2PMZE 4X62L 3O13A 1DOKA 2ZJQA 4UAIA 3T1YQ 1KIXA 4NW2A 3BZCA 1VQDA 1AN8A 2UXDL 1I4PA 1KRSA 1UE6A 3KUPA 5CV7A 4AQYQ 3KLWA 4TQUS 1G291 5IP7G 2KENA 3I70A 1PV4A 4EQPA 4V190 4V0BA 5E3FA 2ZXOA 3AEVA 1VMCA 3KF6B 3EQLC 2K75A 5J39A 1NR4A 2GA4B 2LY7A 4BBRG 3PIP3 2KHIA 4XTCS 1GUTA 3FRPB 2E2JB 5CR3A 1STHA 5IIFA 2JQOA 5H1SE 2AQ3B 2BE5D 4JBWA 2HIXA 1A63A 2EY5A 2Q8TA 4HEDA 2VNUD 3VDYA 1X55A 4S3SA 4FF3A 4JYAQ 3I2ZA 4JPBW 5EAYA 4CDEC 5GAHC 2ID0A 3A8JE 2R92G 1D6EC 1JB3A 3EJIA 1W6KA 2UXCL 4RA8A 4LF4L 4JCVE 2K5HA 2KEDA 2YTYA 2ZXPA 2O4XA 1GOZA 4K2LA 1SNCA 3CCVA 1SFOH 1G2TA 1VQ4A 1R9TH 3PUXA 1GO3E 1SE4A 1GJXA 2RHSB 2RCFA 1HA5A 2XNAC 3W1GA 4JI6L 1KABA 1LTAD 1BBXC 3T1HQ 3NXWA 1N36L 2L55A 4KN4C 4IUPA 1NY4A 5EJWA 2EXZA 3OIPA 2AHOB 1EZ6A 4DGZA 1B4OA 1HR0W 4IPDA 3V2TA 3M4OB 4DV5Q 4DR5Q 2RBMA 3RN2A 4FNFA 1RIPA 3CHBD 2QA4A 1WTVA 3U58A 2OXPA 1ICFB 1QE6A 5JJKA 3S1MB 1PVOA 3IKJA 3RLOA 1H9JA 4L6TB 3T53B 4DUYL 2Y0SG 1YITA 1JB7A 2F0EA 2A6HD 2R92H 1X6OA 1PRTD 3S1QH 3LX0A 3UDFA 3UDIA 5JPNC 1H9KA 2EYMA 1CT1D 1OXVA 2CCZA 1B50A 2VS1A 1WCMB 1I94L 4FF1A 3I3CA 4JV5L 4RG1A 4A3EH 1TXYA 4I7AA 3J80c 2WFWA 3CCLA 1XPOA 4KHZA 4DKAC 1HNZL 4JI5Q 3HOZG 4DU9A 4A3JB 1LTTD 1HTLD 1EQTA 1PFBA 3H3VH 4A3IG 1S5ED 5GQOA 1QVCA 3NUCA 2QDBA 3TN2A 2JP1A 5BN5A 4JV5Q 4G4KA 4DAYB 4HTHA 4BBRB 5LMNW 1B9NA 1NBWA 3M3YB 2QDLA 2B2WA 3QIAA 1Q86C 4QGUA 2UUAQ 1XJVA 3FVQA 3UE0A 4KHPL 2XWBB 2F0JA 2QCPX 3KBXA 2GVBA 3KYHC 5CV6A 1V8QA 1HRJA 1PRTB 2KVMA 4JI2Q 4IQZA 1Q90A 1LO5D 3E9IA 3CMEA 3D4WA 4QL5A 2AKWB 4RMFA 3FDTA 1C7YA 2BH8A 4JBMA 1STGA 2L1BA 4M1UB 4GOPB 1XX8A 2QEJC 4EX5A 2R93H 1PFSA 1CK1A 1E24A 2A68C 5DAUA 2JA5H 2PPBC 1BVSA 4K5VA 3HOUH 1NAPA 2IHFA 5IGDA 3LGJA 3BDCA 3M3YH 5I2XA 3D3RA 1TR5A 1HFGA 2K6AA 4KMUC 3CCUA 1IYJB 2CH4W 4GLAC 3OTOL 3C3LA 3KOJA 3NP8A 1GKHA 5IOCA 5IP9G 3G71A 1EEFD 5IGBA 1XNQQ 1VQAA 1I6VC 2B8FA 2Q2IA 5LMNL 1TWFH 1AEXA 3Q24A 1IBKQ 2HDMA 1LLRD 4RWSC 1KQSA 1LT3D 4QQBX 1BKBA 4P71A 3S1RB 4K0KQ 3JAML 3SK4A 5IGGA 4QB4A 3T16A 1TS3A 4JG2A 1WCMH 2K7VA 1D5XC 3DEOA 5CV5A 2EY2A 1HCZA 3S2HH 1QZGA 5TSSA 5CC4A 4PV1C 3PQIA 4GS3A 3CCJA 2WAQG 3OMGA 3RR5A 1PHJA 2PZWA 2MNAA 4RCOA 2LXKA 3HOWB 4A3KG 2RQXA 2F3VA 3TEHB 3S1MH 4LAAA 4BXXH 3M4PA 4IPHA 1FJGL 3FPUB 3FEWX 5C0XJ 3LWUA 4AYBE 2EYFA 5JOBA 1TT2A 3DEPA 4IFDJ 4A3MG 2G9HD 2K33A 1MBYA 2A6HC 3K5MA 3I4LA 2VB2X 1SYCA 2PW5A 2A69D 2SOBA 4K5XA 4ZQ3A 2K32A 4J6HA 2QW7A 2Z6BA 2IY5B 2E8GA 4X65Q 2K5WA 1VQ9A 5D3IB 4QJFA 4HCEA 5DLQE 2Z6KC 1O7YA 2KBNA 1ET9A 2QGQA 4X3UA 4JI7Q 3BJUA 4JI4Q 1I4RA 4IO9A 1R9TB 2HD3A 2PW7A 1QJOA 1QWYA 1KTKA 3I73A 1SFOB 1V9PA 3NE5B 3M85A 2CW0C 1XMQL 3ER0A 2JA6B 2FMCA 2SDFA 4DV1Q 5E4WC 1EIHA 2GN5A 5FJ8H 3FHWA 1HTPA 2CVRA 4BWGB 2HQLA 3I4MH 1TWHH 1J6QA 1MSGA 2PQAA 3A56A 3MXUA 1DGSA 4N9PA 3GDEA 3VR3A 4X3KA 1EY6A 4LF5Q 1WD1A 3DUZA 1K73C 3AU7A 1BR9A 2VQFL 3S24A 4DN4M 4C3IG 5M5XB 4GNXA 4X66Q 1X3GA 5FLXL 4FDBA 4AIMA 1VQMA 3R93A 3RUZA 2QILA 3J81j 4OX9Q 4L5QA 1CFMA 3NHHA 4A3DG 1PH7A 3T51B 3FKIH 3V96A 3JAMi 1R4PB 2D2CC 2RCNA 4JOIC 4ZUJA 1SMYC 1VQ6A 1DONA 1CZGA 1A2UA 1JJGA 2NN6G 1CKMA 2K52A 2B63G 1YNJC 2RHQB 1WD0A 1JT8A 2X6LA 1U9RA 3STBD 2AQ1B 4DR7Q 3G48A 3WDNA 4NXNQ 2KCCA 1EWCA 3Q0AA 1T9HA 3OW7A 4A3IB 2A19A 1LUZA 1SYDA 1K83B 2NZOA 2ZT9C 3I55A 4PNYA 3VR6A 3EN2A 2HCCA 4OIKA 5DM63 2K50A 3GTPB 1X32A 3FP9A 3FKIB 2F0TA 2Z6KA 1SSOA 3KLSX 1C9OA 4YCUA 4K5WA 3KF6A 1I94Q 3K59A 1II3A 4DV0Q 3S1RH 1PH8A 1EYGA 1PTOC 1OXTA 2C9OA 4JI6Q 2R7ZH 4A3BB 2EJFC 3PIO3 4ZKBB 2RF4A 5JEAG 2E2IB 1MSHA 1QVFA 4U673 2HQEA 3URYA 2VL6A 1TWFB 3OYYA 4HN7A 2M2LA 1B7YB 4XDXA 4O1NA 4R4OA 1SMXA 1KRTA 1S72A 2L12A 3OHXC 1Y8PB 4LF6L 1CM9A 1F9QA 3X3MA 4G7HC 5A2QE 1CUKA 3I4MB 1BXTA 4C3JG 2RSOA 4JBJA 2XN9C 2OTLA 1JMCA 1QCBD 4R1JA 1I4HA 1OXUA 4FXGC 2FINB 1PLFA 1IHZA 2MHVA 3UDXA 3VYRA 5CV8A 1E2ZA 3HKZB 3HEJA 2F0OA 2UU9Q 3UI2A 3QB3A 4PG3A 2CQOA 1Q46A 3DXJC 1TQOA 2E75C 1ZYRC 4APVA 4HIKA 1VQ8A 2B2UC 4WJWA 1SN8A 2B2YA 4C2MH 1QUQA 3NBIA 4FP5D 1YBYA 4A3GG 1EFWA 4A75A 3PO2B 2R7FA 4QUCA 3TS2A 3GTKB 1D2BA 4KKUA 2UXCQ 5J22A 1DOLA 1GHJA 5FO7B 4EQ5A 2ZJRA 1RTOA 2UUCQ 2B39A 4MIUA 4IZ8A 1IKMA 4JVZA 3RLNA 1A15A 5G3LF 3H91A 4KN7C 4BBRH 1QNUA 1KLUD 3HKZE 2F0PA 2M00A 1HR0L 4Q0FA 2XGTA 2BCOA 2PNRC 1LACA 4R4CA 3STBC 4LFCL 5IGCA 3D31A 1EYAA 4H0LC 3L3OC 3UE1A 3L2PA 2NVYB 1G6ZA 1RL2A 2F0GA 4IOCA 3ULPA 2A68D 2F0FA 2PCFB 3HRZC 1O7LA 4HAEA 2AMCB 2ENBA 3T56B 4BS9A 3GTJB 5M3FB 2B29A 1N32Q 3S17B 4JI4L 3CPFA 3C46A 4LFBQ 2AUJD 5ELEA 5BN3A 2NVYH 1R4QB 1AP0A 1F2ZA 2VQFQ 3S14B 4A3CG 2AWOA 1D5ZC 1P16A 3K5LA 1SYFA 2QKIC 3TP8A 2V1CC 3MC0B 4A3EG 3ZJYC 4A3KB 1D5MC 1E1OA 2Q8RE 4FO2A 1N36Q 4DR3Q 1KLGD 2BA0A 4L5TA 5IWAL 1Z7TA 3HOXB 5EPKA 2UXBL 3MA2B 3VYTA 4YY3Q 1TWAB 4JI8Q 3BVZA 3RNUA 3H15A 4B9XA 1FJGQ 4BY1H 5M3MB 3TDQA 2HHHQ 2DNEA 4DR1L 2R93B 3CC2A 4OGQC 4LMQD 5IODA 2FJ2A 2KHSA 4PZ6A 3MXPA 2Q8IB 4DAYA 3EFXD 4LF4Q 1T5EA 2WKDA 2NVQH 1CA6A 3ICEA 2AWNA 1GUNA 2VUMH 2F3WA 3CXCA 4DV4L 5EKIA 4YY3L 1EY4A 3NEMA 4N8X1 1CQFA 2NWGA 1X3PA 3WOFA 4E6IA 4A3DH 5I2YA 1TS4A 1QILA 5AJ3Q 4DV2Q 1N32L 1H95A 5KEEA 2LKVA 2OQ0A 1Q3LA 4EVOA 3GO5A 2UUBL 4DV3Q 5NUCA 4JI0Q 2C5CA 1HNWQ 2SNMA 1V1PA 1E2WA 1U4RA 3ITPA 2HCIA 4H13C 4I65A 3S9WA 3D6WA 2KJXA 4CDDC 3DHQA 1IBML 2B2VA 1TWCH 4KY7A 4ALPA 4L5RC 2L15A 4B3ML 3HOZB 2FFKB 3CC7A 5BR8L 5HGTA 3BZDB 1CA5A 3MFGA 5FO8B 2JN4A 1N34L 2E2HH 3A7LA 2KCMA 3TBIB 4DFAA 1HR0Q 1ML0D 3BVMA 3A74A 1K28A 1QUQB 1VQBA 4DR1Q 1LABA 5EPJA 2EYJA 3KLRA 2YU9H 4IJLA 1JQYD 3BU2A 2WIIB 1W6JA 4CHTB 4KD3A 1EIFA 4FVMA 1VQJA 1WFQA 4J8QA 4A3IH 5L37A 2DJFC 1WJJA 2A74C 3MAQA 2F0KA 3BZKA 3N52A 3NSWA 2KECA 1B9MA 1NCVA 1YVCA 5EQ0A 4A3FB 3BG3A 1L0XB 1SNPA 5IYCG 2UXBQ 1I4GA 3V05A 4BBSG 5D14A 4NXMQ 3E0JA 4CKCA 2D0PA 2NBFA 3L9AX 2KUMA 3HZXA 1CZWA 1T5XD 1TWCB 4OO1G 2XRSD 4L5SA 1Y1WH 1RF2D 1CKNA 1VQIA 3CCSA 4POFA 1K3BC 2B2WC 1Q7YC 2RKSA 2K5QA 3GTGH 1B53A 1SLJA 2Z0SA 3W2DA 1TKWB 3M7GA 5LMUL 1U4PA 3PCOB 1OXXK 4DNRB 4C56C 4DR5L 1ESRA 2XIWA 2IL8A 2ZM6Q 4HJ5A 2OEOA 2Q2UA 2CHBD 1WTPA 4RHSA 3ERSX 4KLKA 2B2TC 1UEAB 3RD4A 3K58A 5IE8A 1UUPA 4LFAL 1NSNS 3F8TA 3PUVA 1RD9D 3BS1A 2VUMB 2Z4HA 5CBEE 1JWMD 2KCTA 2D5DA 1TWHB 2HT1A 1AFPA 1KXLA 1IW7C 3E3XA 3U9SA 1K8MA 3RZDB 3PGZA 1UE7A 2E5LL 2JA7G 4DR4Q 2EOTA 4MTKA 2ICIA 3PO3H 1TU2B 3FPPA 1YNNC 4BY1B 1WTWA 4GKJQ 4K14A 4P75A 3BYTB 2WACA 1Q82C 4O42A 1RODA 4QF4A 4BA1I 4XYOA 3E0EA 1CHQD 3H09A 3TQYA 3J7ZC 1FNUA 3MXNB 2PQEA 3HOYB 2EJGC 2PZTA 3C2PA 3CCEA 3SE0A 1EUJA 2IX0A 2LXJA 1YJNA 2ZXRA 1MHWC 4GLXA 3NTIA 5FKAC 4UDUC 4ZYSA 1AE3A 3ULJA 3OIQA 3CF5A 5C3WA 1NMFA 5IGEA 5IWAQ 3CCRA 2F03A 1A2TA 4IPCA 4OO1H 3H0GG 2RA4A 4LUZA 4WFN3 5C44H 3GTJH 4IUUA 2N49A 4R4TA 1I6HH 4BY7G 3IFDA 2XRQD 4JK1C 1J9OA 5ELFA 1SRUA 4BBSH 2PQAB 1HUNA 2NTSA 1UNSA 4OEMB 5IYCH 1GUWA 4HJ7A 4BBSB 1RTNA 4LFBL 3F2UA 2EDGA 1Y1WG 5EKLA 4OO1I 1SROA 2E76C 2F0IA 5C4JH 4XT3B 3KJOA 1JC7A 5IY0A 4NKLA 5DNFA 3CU7A 2JA8G 4A3LG 3U4ZA 1X56A 4P74A 3QR8A 2HUGA 1AW7A 1Y1VB 1C48A 4C2MB 1XMOL 1RCVD 1YJ9A 1H9SB 2MFIA 2MO1A 5KNDA 3Q6SA 4X6AH 2DGYA 1XPRA 4R4QA 1PZJD 5KYLA 1B3QA 1HFNA 2L0CA 1PRTF 3G4SA 1EFID 1YHBA 4IPGA 5EKKA 4JI1L 1DJRD 1FR3A 5F2DA 3AB9A 3PF4A 4FF2A 2JA5B 4RGOS 1A6XA 1RDPD 4K6DA 2Z9HA 1KD1C 4F88A 1FL0A 2JA7H 5C6AA 2I5HA 1MIUA 1NR2A 1S5DD 3SR1A 2JEAI 3K7UC 3HS0C 5C0XG 1SE8A 4O0AA 4DR3L 1IBLQ 5I9OA 4Z9CB 1BCPD 1DM0B 3GV6A 3SK5A 1Y1VH 1I3QH 2QEXA 2EZVA 4PMBA 1JOQA 2WINB 4N8FA 2JSOA 4KK7A 1OTCA 2R3ZA 3F2CA 2R7DA 5EBDA 2PO4A 3AFPA 3NBHB 2RDHA 1WTOA 2PZUA 2L9HA 2N3SA 2O5IC 4OHJA 4BY7B 2R93G 3A7AB 1SE3A 3K5NA 5JJZA 4XYQA 1XNQL 1VQLA 4EQOA 2HIVA 2IWHA 3BDLA 1Q12A 4PQXA 2OT2A 2R7ZG 3Q8DA 1KNAA 2YV5A 1AZPA 1PDQA 2A8VA 1G51A 4A3BG 2F0VA 3FMCA 5IYDG 1QG7A 5E4XA 5M3MG 1NMGA 4LFCQ 2CH4A 5C3EG 3RMHA 4C1NI 4XQQA 4IFDH 1PFMA 1YNND 4UP7A 1I6HB 2FMMA 4DV1L 4A3JH 2A69C 4JOIA 3TP5A 4HJ9A 4YHHL 4A3FH 4HJ8A 3NWTA 1MJEA 2AQ2B 1M1KC 1G6PA 1PYBA 4OL7A 1EQVA 2BE5C 4A3EB 2OQKA 5C4HA 2BH2A 4JI3Q 1STYA 3A0JA 4ZRZA 5LL6X 1GVPA 3GQBA 3P20A 1Q1BA 3MXGA 3OMCA 4Y7NH 4H02A 3GTQH 3HOVB 2L5TA 3NWSA 2MQHA 3I56A 4NB3A 4IUVA 2CKZB 5M3FG 1MJCA 1PTOH 2A6ED 4DAMA 3M4YA 1C0AA 4BXXG 1LTRD 5CMDA 1PZID 3NQTA 2YU9B 3T1HL 1BQQT 3P75A 4CGYB 2IJ0A 3CCMA 2NN6I 3HFZB 2UU9L 3S1NH 1HNWL 2O5JC 1SEBD 2I0QA 4MNOA 3NBHA 3ONAB 4FYDA 2KQ3A 5M5XH 1U5KA 1SYEA 4O2DA 5C3EH 1ASZA 1NTGA 5C4XB 5T1GA 1F2LA 4IURA 5ELBA 1D7QA 2KCNA 4ZUIA 4EQNA 4FXDA 1UAPA 5CV4A 3S15H 1YHAA 1ESFA 5M9OA 5ELCA 2JA5G 1SNQA 4RCNA 1KC8C 3A5UA 3CMAA 2LSSA 2XVSA 2JYOA 4A3GB 3KK7A 1NE3A 3VYUA 1ILPA 1BCPF 2F4IA 4ZKCB 1VS0A 4M8AA 2JA6H 2JE6I 3GD7A 3I4NB 5K5PA 3F1ZA 1M90C 2NUCA 3U4VA 1J8IA 1IBKL 3J80E 3OW2A 5DEHA 2JXMB 1SBBB 1FNVA 1VQ7A 3BYYB 5E7NA 3GP7A 4K2KA 1SR3A 1ENFA 1ILQA 3HOYG 1E22A 4IOAA 4LFAQ 1EYCA 2IHEA 4YWLA 4X3TA 1XNRL 1PFNA 2XSCA 3HG9A 4RAUC 2RDFA 1IYUA 4XT1B 3S16H 4ID6A 4ZCKA 2UUCL 2BDOA 2E2JH 2XWJB 5EBCA 1CSPA 3NENA 5M3MH 2NB0A 1EY5A 2RSNA 4AYBB 4DV6L 3J81i 3DWPA 3LNNA 4YCVA 3CRKC 3IRBA 2NVXH 3U50C 3HOXH 3H0GB 2D62A 1FGUA 1HQMC 4LNQA 3BVGA 2YTXA 5GROA 2L4NA 4RGTA 1GUGA 2SNSA 4POGA 4JI8L 1IW7D 3R2TA 1D8LA 4YCWA 4DXFA 1E0BA 3S2HB 4WRDA 1BBWA 2K5VA 3JC66 5C4ZA 1HA6A 4MN3A 3FKIG 1DCZA 4P73A 1S4ZA 5LL6S 3X3NA 3OWEB 5GAEC 4HMJA 1S5CD 3J81c 4DV5L 4U68A 2EIFA 2EQSA 2F0DA 1JJCB 4NP5A 3KFUA 2F0LA 5IP7H 1X9NA 1K8GA 5D65A 4OX9L 1VMPA 3J7AF 1LT6D 1B1ZA 1O7ZA 1QB5D 1SYGA 3P7JA 4AYBG 4ABNA 4G7ZC 4MHEA 3KBGA 3BDOA 3MEHA 3PSIA 1I50H 1BO0A 3I91A 3J81L 2K5NA 2UUBQ 2CFMA 4UP8A 1A3VA 1F77A 1K0SA 1IYVA 1U4MA 3ERQA 5E1FA 4KTAA 1EY7A 4BY7H 4C3JB 1FVIA 1TWGB 1F9PA 3CPWA 4ULLA 1GHKA 3NK9A 4ME3A 4RKBA 1ZEQX 5LMNQ 3PO2H 2ZTEA 5BR8Q 2ZM6L 3CQZB 4A3DB 5K36G 1HZ9A 1X54A 1Q8IA 1A3UA 1RHPA 4JBKA 3ND8A 4Y52H 1V43A 4IJHA 2WB1B 1EZ8A 3VR5A 1AH9A 5CGKA 2NVQB 4JI0L 2PNHA 1XNRQ 4GKJL 3HP3A 3CQZH 5CYUA 3MXNA
chains in the Genus database with same CATH topology
3E6ZX 3GV3A 1VF5C 1WTQA 3P1HA 4WORA 3DM1A 3SDZA 4C3HG 4DXGA 3AMUA 4F87A 4HSPA 3KLSA 3A8KE 3PUYA 1STNA 4RGNA 1CQVA 1BOSA 1DYQA 2H1EA 1I50B 2A6EC 1G2SA 1MI2A 5ISRA 1LTID 1AZQA 2R61A 2K05A 4HMIA 1I4QA 3S2DB 2RVLA 1BUVT 5COYA 1WTXA 1HHVA 3L7ZC 3CKIB 4C3IB 1IL8A 3OPOA 3GTMB 2ICEC 4LJZC 1TY2A 1U4LA 1XYIA 3CRLC 4C3HB 4FXKC 4IALA 5DM73 1SDFA 4KJOA 1FYCA 2WKCA 3J7YW 2J0TD 4CKEA 3NQIA 5C44B 2NVXB 5IT9E 3GTLB 2PMZB 2F0NA 3W3AA 1SJHD 3T13A 5JVG3 3S16B 1WVLA 3H3VC 3C1FA 4IN3A 5HURA 3QJYA 3QOJA 1TIID 5CBAE 1VF7A 5K36H 2WP8J 2DY7A 3VR2A 3SXHA 1G91A 2DY8A 3A55A 5D3DA 1Y69U 1PMRA 2N88A 4F7XA 3TZUA 1L0YB 1GUSA 2EYPA 3A54A 3PMFA 2OF1A 2VB3X 2KEEA 4KI0A 5KYIA 1E2VA 5KNCA 1XTCD 5FO9B 2EE1A 5M5WB 1GXDC 3IFTA 3OOCA 1Q1EA 3NTKA 4GZYC 2HDLA 2K5DA 3I8ZA 1STEA 3PUZA 4KV6A 1ZKOA 3QG1A 3DWQA 2Z8LA 1CHPD 2QF7A 3MWYW 5C5LA 2L11A 3TP6A 4TRDA 4IUNA 3SK6A 1SJED 1Y1WB 1DXMA 4DNTB 1VCIA 2E74C 2DN8A 3EA6A 5EGTA 1B44D 1LT5D 3QWNA 5ELDA 2MJ8A 1PRTC 1PTOD 4HR7B 4K8IA 4CJ2C 4DK0A 2EYHA 5IGFA 4XIGS 4ZK9B 1I4XA 1A3TA 5BN4A 1H9RA 1BDOA 2E2DC 3OSOA 5EPLA 3D6CA 1F9RA 4A3MB 3K0YA 2G9DA 5AFWA 2F0SA 4B9WA 5I9PA 1O80A 1KDAA 4CKBA 1LTBD 2IX1A 1H9SA 3MFYA 4ILWA 1Y8NB 2EJMA 3T4AC 1DD2A 4P2CB 4RKLA 2AUKA 2F1MA 1HXYD 1XWEA 1KDBA 5I6YA 4EGVA 1SNDA 3TMEA 4CJ1B 4KD4A 3ZYYX 5I4DA 4TKOB 1EOTA 2F0MA 4XQJA 2X6GA 1BNZA 2JA7B 1JR0D 2IX3A 1JWSD 3HOUB 1JORA 5C0XH 5J1ZA 1SNMA 5FLXE 1QNKA 1F2MA 1PZKD 3KF8A 3J80L 3K6OA 2FHTA 5A35A 1WTRA 3Q22A 2MUYA 2A73B 1B2TA 2EPBA 4IUTA 3SHLA 4QUFA 2Z1CA 4RH6A 1EEID 1STBA 5C4JB 3OWFA 3DWAA 3PV0A 1BCPB 2BOSA 1JCKB 3A8IE 4DA2A 3M7NA 1ET6A 4KHVA 2J4XA 1ZYRD 1EWHA 5C0XI 1F9SA 4XXEA 5JEAH 3DMUA 1FD7D 1ONLA 3D4DA 3TZDA 1PYWD 2H4OA 2BDNA 1JOOA 1OO9B 2O2LD 3I72A 3IL8A 3R8BA 5KGUA 2NYZD 4QMGA 4K8JA 4G57A 1TY0A 2R92B 1C8CA 5A2QL 1LV9A 3EROA 1D1IA 2EY6A 1NUCA 1B3AA 3TSSA 1EU3A 3PO3B 3K5OA 4IUQA 2LMCB 2K04A 4KKSA 1PTOF 1OXSC 1KNEA 4R8IA 3MHBA 5JAVA 1M4VA 1SXTA 1FGBD 4J1MA 1KAAA 4PMWA 2N55A 2IW3A 1SMYD 3VA5A 3J7AV 1JWUD 1DOMA 2LFNA 4OIJA 3Q23A 4R8NA 2B2YC 4G7OC 3GTOB 2K1BA 3GTGB 3MZ5A 2NN6H 1VDZA 2K28A 3QOLA 1JE4A 3VYSA 3S15B 3R3OA 2KOLA 1F2YA 3MVVA 1ZXTA 2CW0D 4NDXA 3MTSA 1EY9A 4KKTA 2SEBD 4BA2I 5C3EB 1MGSA 1LTSD 2NZ1D 2R7ZB 1TS5A 2F0WA 4CBVA 1V1OA 2M9VA 5C5MA 1TVXA 1KDCA 3S1QB 2MGSA 5I6WA 4FF4A 1EU4A 3GTQB 2NTTA 3K7AB 4DAVA 4PMCA 5C3XA 5CORA 5G3LD 2E2HB 5IT9L 4H7BA 4CJ0B 3IAYA 2F0UA 5JEAJ 1EL0A 1LT4D 3H94A 1SE2A 3PUWA 1C4QA 2F0QA 2I07B 2R6GA 2MP1A 2IPKD 2EY1A 4N9TA 1GUOA 3H6MA 3RLFA 1I3QB 2MPMA 4NMZA 4DF7A 1MD2D 4HSVA 2Z4IA 5CV9A 2J7ZA 1HPCA 1G8ZD 2V4DA 4KY5A 4ZLTF 2KA7A 1BCPC 1SNOA 5JPMC 1M8AA 5KIXA 1HQRD 3HGBA 4RGMA 3S1NB 4K6LA 2K01A 3U9OA 4YIJA 1FNWA 2NVTB 4L63B 4TSSA 1K8OA 1JOKA 2F0HA 1PTOB 1BF4A 1JICA 2JEBI 1V1PB 4Y7NB 3J81E 1HUMA 2Y0SB 3RZOB 4ME5A 2VXWA 1Z6HA 1D1KA 2CQAA 2B2TA 1S5FD 2TSSA 1SYBA 3ND9A 2JA8B 3R2IA 3C1EA 1IKLA 1H9MA 5FK9C 3LWEA 2I46A 5FOBB 3SEBA 3SVMA 4ZAIA 2BA1A 2B63B 2B2UA 2RDGA 4LK1C 3D8GA 4R9WA 4I7ZC 4B08A 1YNJD 4IFDG 3QO2A 1STAA 1LTGD 2B8GA 2A5HA 1QOHA 2EYLA 4C1NK 4DK1A 1RJTA 4A93B 1S5BD 2IT1A 1XXGA 1Z47A 2PYKA 1EY0A 4RFBA 4DAPA 5KNBA 3NTHA 1TS2A 1O78A 2LS01 4XQNA 3G6JB 1CI3M 3N6RA 1EY8A 2D9UA 4L8JA 3JAME 1ENAA 1PXUA 1ENCA 3VR4A 2YYZA 1RKNA 3E5SA 5KRUA 4RHRA 1DZ1A 1X3QA 3SK8A 2TMPA 3G7LA 2B2VC 3D4RA 3NPPA 4QCLA 4F8MA 3TP7A 2EYOA 4QIWB 3VA7A 4X3SA 2WV6D 1SAPA 2EVBA 1CTMA 2WAQB 3WOEA 2DNCA 5JVH3 1EYDA 4HCSA 4H44C 4KJNA 2K03A 3EVQA 4ODGA 5M5YB 2X69A 4Q5VA 1EIGA 1ICWA 4KY6A 3I90A 1Y8OB 5T1IA 5LHY1 3K57A 4IFDI 3O13A 1DOKA 4UAIA 4NW2A 1AN8A 1I4PA 5CV7A 3KUPA 4TQUS 1G291 3I70A 4EQPA 4V190 4V0BA 5E3FA 2ZXOA 1VMCA 3EQLC 5J39A 1NR4A 2GA4B 2LY7A 3PIP3 4XTCS 1GUTA 3FRPB 2E2JB 5CR3A 1STHA 5IIFA 2AQ3B 2BE5D 4JBWA 2Q8TA 2EY5A 4HEDA 2VNUD 4S3SA 4FF3A 2ID0A 3A8JE 1D6EC 1JB3A 3EJIA 1W6KA 4RA8A 2KEDA 2ZXPA 2O4XA 1GOZA 4K2LA 1SNCA 1G2TA 3PUXA 1SE4A 1GJXA 1HA5A 2XNAC 1KABA 1LTAD 1BBXC 3NXWA 2L55A 4KN4C 4IUPA 5EJWA 2EXZA 3OIPA 1EZ6A 4DGZA 1B4OA 3V2TA 3M4OB 2RBMA 4FNFA 1WTVA 3CHBD 2OXPA 1QE6A 3S1MB 3IKJA 1H9JA 4L6TB 3T53B 2F0EA 2A6HD 1PRTD 3LX0A 5JPNC 1H9KA 2EYMA 1CT1D 1OXVA 1B50A 1WCMB 4FF1A 3I3CA 4KHZA 4DU9A 4A3JB 1LTTD 1HTLD 1EQTA 1PFBA 1S5ED 3NUCA 2QDBA 3TN2A 2JP1A 5BN5A 4G4KA 4HTHA 4BBRB 1B9NA 3M3YB 2B2WA 3QIAA 3FVQA 2XWBB 2F0JA 2QCPX 3KBXA 5CV6A 1V8QA 1HRJA 1PRTB 2KVMA 4IQZA 1Q90A 1LO5D 3D4WA 3FDTA 1STGA 2L1BA 4M1UB 1XX8A 2QEJC 1CK1A 2A68C 5DAUA 2PPBC 4K5VA 1NAPA 5IGDA 3BDCA 5I2XA 3D3RA 1TR5A 1HFGA 2K6AA 4KMUC 3C3LA 3NP8A 5IOCA 1EEFD 5IGBA 1I6VC 2B8FA 1AEXA 3Q24A 2HDMA 1LLRD 4RWSC 1LT3D 3S1RB 3JAML 3SK4A 5IGGA 4QB4A 3T16A 1TS3A 2K7VA 1D5XC 3DEOA 5CV5A 2EY2A 1HCZA 5TSSA 5CC4A 4PV1C 3OMGA 2PZWA 4RCOA 3HOWB 2RQXA 2F3VA 4LAAA 3FPUB 3FEWX 5C0XJ 3LWUA 2EYFA 5JOBA 1TT2A 3DEPA 4IFDJ 2G9HD 2K33A 1MBYA 2A6HC 3K5MA 3I4LA 2VB2X 1SYCA 2PW5A 2A69D 2SOBA 4K5XA 4ZQ3A 2K32A 4J6HA 2K5WA 5D3IB 4HCEA 1O7YA 1ET9A 4X3UA 1I4RA 1R9TB 2PW7A 1QJOA 1QWYA 1KTKA 3I73A 1SFOB 3NE5B 3M85A 2CW0C 2JA6B 2FMCA 2SDFA 5E4WC 1EIHA 1HTPA 2CVRA 4BWGB 1MSGA 3A56A 3MXUA 4N9PA 3VR3A 4X3KA 1EY6A 1WD1A 3DUZA 3AU7A 1BR9A 4DN4M 4C3IG 5M5XB 5FLXL 3R93A 3RUZA 2QILA 1CFMA 3NHHA 3T51B 3V96A 1R4PB 2D2CC 4ZUJA 1SMYC 1DONA 1CZGA 1A2UA 2NN6G 1YNJC 1WD0A 2X6LA 1U9RA 2AQ1B 3WDNA 2KCCA 1EWCA 3Q0AA 3OW7A 4A3IB 1SYDA 1K83B 2ZT9C 4PNYA 3VR6A 2HCCA 4OIKA 5DM63 3GTPB 1X32A 3FKIB 2F0TA 1SSOA 3KLSX 4K5WA 3K59A 1II3A 1PTOC 1OXTA 2C9OA 4A3BB 2EJFC 3PIO3 4ZKBB 5JEAG 2E2IB 1MSHA 4U673 2HQEA 3URYA 1TWFB 4HN7A 2M2LA 4XDXA 4O1NA 2L12A 3OHXC 1Y8PB 1CM9A 1F9QA 3X3MA 4G7HC 5A2QE 3I4MB 1BXTA 4C3JG 2RSOA 2XN9C 1QCBD 1I4HA 1OXUA 4FXGC 2FINB 1PLFA 1IHZA 2MHVA 3VYRA 5CV8A 1E2ZA 3HKZB 3HEJA 2F0OA 3UI2A 3QB3A 3DXJC 1TQOA 2E75C 1ZYRC 2B2UC 4WJWA 2B2YA 3NBIA 4FP5D 3PO2B 4QUCA 3GTKB 1D2BA 4KKUA 5J22A 1DOLA 1GHJA 5FO7B 1RTOA 1IKMA 2B39A 4MIUA 4IZ8A 1A15A 5G3LF 3H91A 4KN7C 1QNUA 1KLUD 2F0PA 2M00A 4Q0FA 2BCOA 2PNRC 1LACA 5IGCA 3D31A 1EYAA 3L3OC 4H0LC 2NVYB 1G6ZA 2F0GA 2A68D 2F0FA 2PCFB 3HRZC 1O7LA 4HAEA 2ENBA 3T56B 4BS9A 3GTJB 5M3FB 3S17B 3C46A 2AUJD 5ELEA 5BN3A 1R4QB 1AP0A 1F2ZA 3S14B 2AWOA 1D5ZC 3K5LA 1SYFA 2QKIC 3TP8A 3MC0B 4A3KB 1D5MC 2Q8RE 4FO2A 1KLGD 2BA0A 1Z7TA 3HOXB 5EPKA 3MA2B 3VYTA 1TWAB 3BVZA 4B9XA 5M3MB 3TDQA 2DNEA 2R93B 4OGQC 4LMQD 5IODA 2FJ2A 2KHSA 3MXPA 2Q8IB 4DAYA 3EFXD 1T5EA 2WKDA 1CA6A 2AWNA 1GUNA 2F3WA 5EKIA 1EY4A 1CQFA 2NWGA 1X3PA 3WOFA 4E6IA 5I2YA 1TS4A 1QILA 5KEEA 2LKVA 1Q3LA 4EVOA 3GO5A 5NUCA 2C5CA 2SNMA 1V1PA 1E2WA 1U4RA 3ITPA 2HCIA 4H13C 4I65A 3S9WA 3D6WA 2KJXA 3DHQA 2B2VA 4KY7A 3HOZB 2FFKB 5HGTA 3BZDB 1CA5A 3MFGA 5FO8B 3A7LA 3TBIB 4DFAA 1ML0D 3BVMA 1LABA 5EPJA 2EYJA 3KLRA 1JQYD 2WIIB 1W6JA 4CHTB 4KD3A 4FVMA 4J8QA 2A74C 3MAQA 2F0KA 3N52A 3NSWA 2KECA 1B9MA 1NCVA 5EQ0A 4A3FB 3BG3A 1L0XB 1SNPA 1I4GA 3V05A 5D14A 3E0JA 4CKCA 2NBFA 3L9AX 2KUMA 3HZXA 1CZWA 1T5XD 1TWCB 4OO1G 2XRSD 1RF2D 2B2WC 2RKSA 2K5QA 1B53A 3W2DA 1TKWB 3M7GA 1U4PA 1OXXK 4DNRB 4C56C 1ESRA 2XIWA 2IL8A 2OEOA 2CHBD 1WTPA 4RHSA 2B2TC 1UEAB 3K58A 3RD4A 1UUPA 1NSNS 3PUVA 1RD9D 3BS1A 2VUMB 2Z4HA 5CBEE 1JWMD 2D5DA 1TWHB 1AFPA 1IW7C 3U9SA 1K8MA 3RZDB 2EOTA 2ICIA 1TU2B 3FPPA 1YNNC 4BY1B 1WTWA 4K14A 3BYTB 2WACA 4O42A 1RODA 4QF4A 4BA1I 4XYOA 1CHQD 3H09A 1FNUA 2PQEA 3HOYB 2EJGC 2PZTA 3C2PA 3SE0A 2IX0A 2ZXRA 3NTIA 5FKAC 4UDUC 4ZYSA 3OIQA 5C3WA 4OO1H 5IGEA 2F03A 1A2TA 4WFN3 2RA4A 4IUUA 3IFDA 2XRQD 4JK1C 1J9OA 5ELFA 1HUNA 2NTSA 1UNSA 1GUWA 4BBSB 1RTNA 3F2UA 2EDGA 5EKLA 4OO1I 2E76C 2F0IA 4XT3B 1JC7A 4NKLA 5DNFA 3CU7A 2HUGA 1AW7A 1Y1VB 1C48A 4C2MB 1RCVD 1H9SB 5KNDA 3Q6SA 5KYLA 1PZJD 1HFNA 2L0CA 1PRTF 1EFID 5EKKA 1DJRD 1FR3A 5F2DA 3AB9A 2JA5B 4FF2A 4RGOS 1A6XA 1RDPD 4K6DA 4F88A 5C6AA 1NR2A 1S5DD 3SR1A 2JEAI 3HS0C 5C0XG 5I9OA 4Z9CB 1BCPD 1DM0B 3GV6A 3SK5A 2EZVA 4PMBA 1JOQA 2WINB 2JSOA 4KK7A 2R3ZA 5EBDA 2PO4A 2RDHA 1WTOA 2PZUA 2L9HA 2O5IC 4OHJA 4BY7B 3A7AB 1SE3A 3K5NA 5JJZA 4XYQA 4EQOA 2IWHA 3BDLA 1Q12A 4PQXA 2OT2A 1KNAA 1AZPA 1PDQA 2F0VA 3FMCA 1QG7A 5E4XA 3RMHA 4C1NI 4XQQA 4IFDH 1PFMA 1YNND 1I6HB 2FMMA 2A69C 3TP5A 3NWTA 2AQ2B 1EQVA 4OL7A 2BE5C 4A3EB 5C4HA 1STYA 4ZRZA 5LL6X 3GQBA 3P20A 1Q1BA 3MXGA 3OMCA 3HOVB 2L5TA 3NWSA 4IUVA 1PTOH 2A6ED 3M4YA 1LTRD 5CMDA 1PZID 3NQTA 2YU9B 1BQQT 3P75A 4CGYB 2IJ0A 2NN6I 2O5JC 1SEBD 3NBHA 3ONAB 4FYDA 2KQ3A 1SYEA 5C4XB 5T1GA 1F2LA 4IURA 5ELBA 2KCNA 4ZUIA 4EQNA 4FXDA 1UAPA 5CV4A 1ESFA 5M9OA 5ELCA 1SNQA 4RCNA 2XVSA 2JYOA 4A3GB 3KK7A 3VYUA 1ILPA 1BCPF 2F4IA 4ZKCB 4M8AA 2JE6I 3GD7A 3I4NB 5K5PA 2NUCA 1J8IA 3J80E 5DEHA 2JXMB 1SBBB 1FNVA 3BYYB 3GP7A 4K2KA 1ENFA 1ILQA 1EYCA 4X3TA 1PFNA 2XSCA 3HG9A 4RAUC 2RDFA 1IYUA 4XT1B 4ID6A 2BDOA 2XWJB 5EBCA 2NB0A 1EY5A 2RSNA 4AYBB 3DWPA 3LNNA 3CRKC 3H0GB 2D62A 1HQMC 3BVGA 2L4NA 4RGTA 1GUGA 2SNSA 1IW7D 3R2TA 4DXFA 1E0BA 3S2HB 4WRDA 5C4ZA 1HA6A 4MN3A 1DCZA 5LL6S 1S4ZA 3X3NA 3OWEB 4HMJA 1S5CD 4U68A 2F0DA 4NP5A 2F0LA 5D65A 1VMPA 3J7AF 1LT6D 1B1ZA 1O7ZA 1QB5D 1SYGA 3P7JA 4ABNA 4G7ZC 4MHEA 3KBGA 3BDOA 3MEHA 1BO0A 3I91A 3J81L 1A3VA 1F77A 1IYVA 1U4MA 3ERQA 5E1FA 4KTAA 1EY7A 4C3JB 1TWGB 1F9PA 4ULLA 1GHKA 3NK9A 4RKBA 1ZEQX 3CQZB 4A3DB 5K36G 1Q8IA 1A3UA 1RHPA 3ND8A 1V43A 2WB1B 1EZ8A 3VR5A 5CGKA 2NVQB 3HP3A 5CYUA 3MXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 3;  3PIO 3;  5JVG 3;  4WFN 3;  3PIP 3;  5DM7 3;  5JVH 3;  4U67 3; 
#chains in the Genus database with same CATH topology
 3E6Z X;  3GV3 A;  1YNX A;  4DR4 L;  1VF5 C;  1WTQ A;  3HKS A;  3P1H A;  4WOR A;  3DM1 A;  3SDZ A;  1TWG H;  4C3H G;  4C3J H;  4DXG A;  3AMU A;  4F87 A;  4HSP A;  3KLS A;  4DUZ L;  3K0X A;  5C4X G;  3A8K E;  4CDF C;  4A3K H;  3PUY A;  1CKN B;  1STN A;  1J5E L;  4RGN A;  1CQV A;  1BOS A;  1DYQ A;  4YWK A;  1HZB A;  2H1E A;  1I50 B;  2CWP A;  2A6E C;  1G2S A;  1MI2 A;  5ISR A;  1LTI D;  1AZQ A;  2R61 A;  4DR6 L;  2WB1 E;  2K05 A;  4HMI A;  2E2I H;  3PIP A;  4A3B H;  3DM3 A;  1I4Q A;  1PH4 A;  3DLL A;  3S2D B;  5M3F H;  2RVL A;  1BUV T;  2JK8 A;  1E1T A;  5COY A;  4A4I A;  1WTX A;  1HHV A;  1CSQ A;  3L7Z C;  3CKI B;  4C3I B;  1IL8 A;  3OPO A;  3GTM B;  2ICE C;  4LJZ C;  1TY2 A;  1VQG A;  1VQE A;  1U4L A;  4AH6 A;  4DV0 L;  4DR6 Q;  4A3J G;  1XYI A;  3CRL C;  5IYB G;  4C3H B;  4FXK C;  1K83 H;  4IAL A;  5DM7 3;  1SDF A;  4AQY L;  4KJO A;  4QY7 A;  1FYC A;  2WKC A;  3J7Y W;  2J0T D;  4CKE A;  2F3I A;  1HZC A;  3NQI A;  5C44 B;  2NVX B;  5IT9 E;  1NNX A;  3K81 C;  4DUZ Q;  2GVA A;  3GTK H;  2JJQ A;  3GTL B;  2PMZ B;  2F0N A;  3W3A A;  1SJH D;  3T13 A;  1ASY A;  4GOP C;  5JVG 3;  3S16 B;  4JI3 L;  1WVL A;  3K80 C;  3H3V C;  3C1F A;  2EXD A;  4YHH Q;  4BY1 G;  4IN3 A;  5HUR A;  1E3P A;  3QJY A;  3QOJ A;  1TII D;  1HZA A;  3CAM A;  5CBA E;  1VF7 A;  5K36 H;  1YIJ A;  2WP8 J;  2DY7 A;  3VR2 A;  3SXH A;  1G91 A;  2DY8 A;  1YI2 A;  3A55 A;  5D3D A;  4GNX B;  1Y69 U;  1PMR A;  2N88 A;  2B3G A;  5IYB H;  4F7X A;  1JJ2 A;  3TZU A;  1L0Y B;  2Q2T A;  1GUS A;  2EYP A;  3A54 A;  3PMF A;  5LMU Q;  2OF1 A;  2VB3 X;  2KEE A;  4GKK L;  4A3G H;  4KI0 A;  5KYI A;  1E2V A;  5KNC A;  1XTC D;  1X65 A;  5FO9 B;  5M5W H;  2EE1 A;  5M5W B;  1GXD C;  4X65 L;  3IFT A;  3OOC A;  1Q1E A;  4DK6 C;  5GAD C;  3NTK A;  4LF8 Q;  4GZY C;  1A62 A;  2HDL A;  2K5D A;  3I8Z A;  1STE A;  3PUZ A;  5FLM G;  4KV6 A;  1ZKO A;  3QG1 A;  3DWQ A;  2Z8L A;  1WYD A;  1CHP D;  2QF7 A;  4DNI A;  3MWY W;  3KDF A;  5C5L A;  2L11 A;  3J80 i;  3TP6 A;  4TRD A;  4IUN A;  3SK6 A;  1GD7 A;  3WWV A;  4J15 A;  1SJE D;  1Y1W B;  1DXM A;  4GNX C;  4DNT B;  1VCI A;  2E74 C;  3HKZ G;  2DN8 A;  3EA6 A;  5EGT A;  4A3M H;  4PZ8 A;  1B44 D;  1LT5 D;  3QWN A;  1X3E A;  5ELD A;  1N33 Q;  3HOV H;  1CKO A;  2MJ8 A;  1PRT C;  1PTO D;  4HR7 B;  3GTL H;  1Y14 B;  4K8I A;  4CJ2 C;  4DK0 A;  5M5Y H;  4UPA A;  2EYH A;  5IGF A;  4XIG S;  4ZK9 B;  1I4X A;  1A3T A;  3I4M G;  1XPU A;  3EBE A;  3K7A H;  5BN4 A;  3D0F A;  1H9R A;  1BDO A;  2E2D C;  3OSO A;  1Z9F A;  5EPL A;  1PA6 A;  3D6C A;  1F9R A;  4A3M B;  3K0Y A;  2G9D A;  5AFW A;  2F0S A;  4B9W A;  3E9H A;  1O80 A;  5I9P A;  1KDA A;  4X66 L;  4CKB A;  1LTB D;  1UEB A;  2IX1 A;  1H9S A;  1WCM G;  1IBM Q;  3MFY A;  3PF5 A;  2OTJ A;  4ILW A;  1WOC A;  1Y8N B;  2EJM A;  3T4A C;  1DD2 A;  4P2C B;  4RKL A;  2ZJP A;  1PH6 A;  2AUK A;  2E5L Q;  2F1M A;  4KHP Q;  1HXY D;  3S2D H;  1XWE A;  1KDB A;  5I6Y A;  4EGV A;  4OON A;  1SND A;  3TME A;  4CJ1 B;  4KD4 A;  3ZYY X;  1PH5 A;  5I4D A;  4DV2 L;  3HOZ H;  4TKO B;  2ALY B;  3I7F A;  4DV4 Q;  1EOT A;  1U0L A;  1HJP A;  2F0M A;  4GN3 B;  4XQJ A;  4JW0 A;  2X6G A;  1VQN A;  4CDC C;  2N78 A;  1BNZ A;  4B3S L;  5FJ8 G;  4NPS A;  1JR0 D;  2JA7 B;  2IX3 A;  2FXQ A;  1JWS D;  3NEL A;  3HOU B;  1KHI A;  1LYL A;  1HNZ Q;  3GTO H;  1JOR A;  5C0X H;  2VUM G;  5J1Z A;  4A3C H;  1SNM A;  3H3V I;  5FLX E;  1QNK A;  1F2M A;  2UUA L;  4DK3 C;  5FLM H;  1PH2 A;  1JE5 A;  4B3R L;  1PZK D;  3ULL A;  3KF8 A;  3J80 L;  1PYS B;  3K6O A;  2PI2 E;  2VQE Q;  4QIW E;  2ES2 A;  2FHT A;  4GKK Q;  1EQQ A;  5A35 A;  1WTR A;  3Q22 A;  1UWV A;  2MUY A;  1UE5 A;  2WAQ E;  2A73 B;  1B2T A;  2EPB A;  3TS0 A;  4IUT A;  1A0I A;  1TWA H;  3SHL A;  4QUF A;  2Z1C A;  4RH6 A;  1EEI D;  1STB A;  5C4J B;  3OWF A;  3DWA A;  3PV0 A;  1IL2 A;  4UHV A;  1BCP B;  1QVG A;  3HOW H;  2BOS A;  1JCK B;  4WJ3 M;  4B3M Q;  3A8I E;  3HOU G;  4DA2 A;  4LF7 Q;  3M7N A;  4C3H H;  1ET6 A;  4KHV A;  3W5O A;  5J3B A;  3S14 H;  3CC4 A;  5FLX c;  2J4X A;  2JA6 G;  1ZYR D;  1BBU A;  3KF8 B;  1EWH A;  3M9B A;  5C0X I;  2F52 A;  1F9S A;  4XXE A;  3W1B A;  4UP9 A;  5JEA H;  3DMU A;  1FD7 D;  1ONL A;  3D4D A;  3TZD A;  1IZ6 A;  4DV3 L;  1PYW D;  2H4O A;  2BDN A;  1X3F A;  3RZO H;  1JOO A;  1OO9 B;  2O2L D;  3I72 A;  4LF9 Q;  3IL8 A;  3R8B A;  3I4O A;  4OXP A;  1W3S A;  5KGU A;  3F2B A;  2NYZ D;  4QMG A;  2G5D A;  4PZ7 A;  1N8R C;  4LW1 A;  3TRE A;  1LM0 A;  1YEZ A;  4K8J A;  4G57 A;  1TY0 A;  2R92 B;  2A1A A;  4NXN L;  1C8C A;  3HOY H;  4DR7 L;  4A93 G;  1P8L A;  5A2Q L;  1QZH A;  3EIV A;  1LV9 A;  4LUV A;  4NXM L;  2HHH L;  2PI2 A;  1K9M C;  3ERO A;  1D1I A;  2EY6 A;  1HH2 P;  1S3O A;  1EIY B;  1S40 A;  1NUC A;  1B3A A;  3TSS A;  1EU3 A;  1PH3 A;  5GAG C;  3PO3 B;  3K5O A;  3M4O H;  4IUQ A;  2LMC B;  2K04 A;  4JI1 Q;  4GOP A;  4KKS A;  4B3S Q;  1PTO F;  2ZTD A;  1OXS C;  2OWO A;  3F2D A;  3CCQ A;  1KNE A;  4R8I A;  3MHB A;  5JAV A;  4X62 Q;  1M4V A;  1SXT A;  4LF6 Q;  1FGB D;  3AFQ A;  4J1M A;  1VQ5 A;  3G6E A;  1KAA A;  4MZ9 A;  4PMW A;  2N55 A;  1YJW A;  2IW3 A;  1SMY D;  3VA5 A;  1E7Z A;  2D0O A;  3J7A V;  1YZ6 A;  1JWU D;  1DOM A;  2LFN A;  4OIJ A;  3Q23 A;  4R8N A;  2B2Y C;  3I4N H;  4G7O C;  3GTO B;  2VW9 A;  4OWT B;  1N34 Q;  2F4V L;  2K1B A;  3GTG B;  3MZ5 A;  2NN6 H;  2ATW A;  3HOX G;  1VDZ A;  4B3T Q;  1L2F A;  2K28 A;  3QOL A;  1JE4 A;  1L0W A;  1XTD A;  4JI2 L;  3VYS A;  4LF9 L;  4UY8 C;  4LF7 L;  1B70 B;  3S15 B;  3R3O A;  2KOL A;  1F2Y A;  3MVV A;  3PO3 G;  1ZXT A;  2CW0 D;  5JJL A;  4NDX A;  3T1Y L;  3MTS A;  1EY9 A;  4JC0 A;  4KKT A;  2SEB D;  4BA2 I;  5C3E B;  1L1O B;  1LTS D;  1MGS A;  2NZ1 D;  2OCE A;  3PIO A;  2R7Z B;  1TS5 A;  2F0W A;  1WI5 A;  4CBV A;  1O7I A;  2ASB A;  1V1O A;  3CD6 A;  5ELN A;  2M9V A;  5C5M A;  3CP0 A;  3GTP H;  1VQF A;  2C35 B;  1TVX A;  4HID A;  1IBL L;  3KJP A;  1KDC A;  2CWA A;  4HJA A;  3S1Q B;  2MGS A;  1VQK A;  1KL9 A;  1PH9 A;  5I6W A;  4FF4 A;  1EU4 A;  3GTQ B;  2NTT A;  3K7A B;  4DAV A;  4PMC A;  3H0G H;  5C3X A;  3OTO Q;  4WJ4 A;  5COR A;  5G3L D;  4DR2 Q;  2E2H B;  5IT9 L;  3A5Z B;  4H7B A;  4CJ0 B;  3IAY A;  2N8N A;  2F0U A;  5JEA J;  3MEF A;  1EL0 A;  1LT4 D;  3H94 A;  2JA9 A;  4LF8 L;  1SE2 A;  3PUW A;  1C4Q A;  4TVA B;  4DUY Q;  2XTI A;  1HNX Q;  5IT9 c;  2F0Q A;  2I07 B;  2R6G A;  2P5Z X;  2MP1 A;  1EWI A;  4DV6 Q;  2IPK D;  2EY1 A;  4DV7 L;  2MO0 A;  4N9T A;  3J7A 5;  2VY3 A;  1GUO A;  3H6M A;  3RLF A;  4JI7 L;  1I3Q B;  2MPM A;  4NMZ A;  4DF7 A;  1MD2 D;  1K8A C;  4HSV A;  2Z4I A;  5CV9 A;  2ZTC A;  2J7Z A;  1HPC A;  1G8Z D;  2V4D A;  2Y0S E;  3AYH B;  1N9W A;  4KY5 A;  4DPG A;  4MTN A;  4ZLT F;  5C4X H;  1IXR A;  4YWM A;  2KA7 A;  1BCP C;  1SNO A;  5JPM C;  1M8A A;  5KIX A;  1HQR D;  3HGB A;  5AJ3 L;  4HIO A;  4RGM A;  3S1N B;  4K6L A;  2K01 A;  3U9O A;  4YIJ A;  1FNW A;  4LWC A;  2NVT B;  4L63 B;  1K3R A;  4LUO A;  3JAM c;  4TSS A;  1K8O A;  1JOK A;  2F0H A;  1PTO B;  1BF4 A;  1JIC A;  2VQE L;  2JEB I;  2WB1 G;  1V1P B;  4B3R Q;  4Y7N B;  4P72 A;  3J81 E;  1HUM A;  2Y0S B;  3S17 H;  1Y1V G;  4ME5 A;  4OWW B;  3RZO B;  1MKH A;  2VXW A;  1Z6H A;  1D1K A;  2CQA A;  2B2T A;  1S5F D;  2TSS A;  5ELO A;  4K0K L;  1SYB A;  3ND9 A;  2JA8 B;  4GN5 A;  3C1E A;  3R2I A;  4LF5 L;  1VQC A;  1IKL A;  1H9M A;  2I5L X;  5FK9 C;  3LWE A;  4X64 L;  1I5F A;  4OWX B;  2I46 A;  1GM5 A;  1AE2 A;  3B6Y A;  1A8V A;  4JYA L;  3GTM H;  5FOB B;  3SEB A;  3SVM A;  4JI5 L;  4ZAI A;  4C3I H;  2BA1 A;  4DR2 L;  2B63 B;  5HGQ A;  1Q8K A;  2B2U A;  2RDG A;  1XMQ Q;  4LK1 C;  3D8G A;  4B3T L;  1W2B A;  4R9W A;  3KDF B;  4I7Z C;  2I5M X;  4B08 A;  3CW2 C;  1YNJ D;  4IFD G;  2F4V Q;  5JJI A;  1V1Q A;  5HY6 A;  1L1O A;  5IYD H;  3QO2 A;  1STA A;  1LTG D;  2B8G A;  2A5H A;  2K14 A;  1HNX L;  1QOH A;  1L1O C;  2UXD Q;  4GN4 B;  3PO2 G;  1EOV A;  5C44 G;  2DJG C;  2EYL A;  4C1N K;  3L0O A;  4DK1 A;  1RJT A;  4A93 B;  2NVT H;  2YTV A;  1S5B D;  1EQR A;  2IT1 A;  1XXG A;  1Z47 A;  2PYK A;  1EY0 A;  4RFB A;  4DAP A;  5KNB A;  3NTH A;  1B8A A;  1TS2 A;  2H5X A;  4HIM A;  1O78 A;  2Q2H A;  2LS0 1;  3SGI A;  4XQN A;  3G6J B;  1CI3 M;  3N6R A;  1VQO A;  1EY8 A;  2D9U A;  1VQH A;  1XMO Q;  2DUD A;  1PH1 A;  4L8J A;  1N33 L;  3RZD H;  4A93 H;  4GLV B;  3JAM E;  1ENA A;  4A76 A;  1PXU A;  1ENC A;  3VR4 A;  1LTL A;  2YYZ A;  1RKN A;  4A3F G;  3E5S A;  5KRU A;  4RHR A;  1DZ1 A;  1X3Q A;  3SK8 A;  1NJI C;  3TRZ A;  2TMP A;  4R4I A;  3G7L A;  2B2V C;  3D4R A;  2KHJ A;  3NPP A;  3AQQ A;  4QCL A;  4F8M A;  3UDG A;  1Q81 C;  3TP7 A;  4X64 Q;  2EYO A;  3M4Q A;  4QIW B;  3HOV G;  2B63 H;  3VA7 A;  3I4N G;  4DV7 Q;  2K4K A;  4X3S A;  1UE1 A;  2WV6 D;  1SAP A;  2EVB A;  1WTH A;  3K8A A;  1J5E Q;  1CTM A;  2WAQ B;  4OEL B;  3WOE A;  2DNC A;  3RN5 A;  1YHQ A;  1K0R A;  5JVH 3;  1EYD A;  4HCS A;  4H44 C;  3HOW G;  2JA8 H;  4A3L H;  4KJN A;  2K03 A;  3EVQ A;  4ODG A;  5IP9 H;  5M5Y B;  2X69 A;  4Q5V A;  1KAW A;  1EIG A;  1ICW A;  4KY6 A;  1VQP A;  3I90 A;  1Y8O B;  5T1I A;  2VZA A;  2NZH A;  5LHY 1;  3K57 A;  4IFD I;  2PMZ E;  4X62 L;  3O13 A;  1DOK A;  2ZJQ A;  4UAI A;  3T1Y Q;  1KIX A;  4NW2 A;  3BZC A;  1VQD A;  1AN8 A;  2UXD L;  1I4P A;  1KRS A;  1UE6 A;  3KUP A;  5CV7 A;  4AQY Q;  3KLW A;  4TQU S;  1G29 1;  5IP7 G;  2KEN A;  3I70 A;  1PV4 A;  4EQP A;  4V19 0;  4V0B A;  5E3F A;  2ZXO A;  3AEV A;  1VMC A;  3KF6 B;  3EQL C;  2K75 A;  5J39 A;  1NR4 A;  2GA4 B;  2LY7 A;  4BBR G;  3PIP 3;  2KHI A;  4XTC S;  1GUT A;  3FRP B;  2E2J B;  5CR3 A;  1STH A;  5IIF A;  2JQO A;  5H1S E;  2AQ3 B;  2BE5 D;  4JBW A;  2HIX A;  1A63 A;  2EY5 A;  2Q8T A;  4HED A;  2VNU D;  3VDY A;  1X55 A;  4S3S A;  4FF3 A;  4JYA Q;  3I2Z A;  4JPB W;  5EAY A;  4CDE C;  5GAH C;  2ID0 A;  3A8J E;  2R92 G;  1D6E C;  1JB3 A;  3EJI A;  1W6K A;  2UXC L;  4RA8 A;  4LF4 L;  4JCV E;  2K5H A;  2KED A;  2YTY A;  2ZXP A;  2O4X A;  1GOZ A;  4K2L A;  1SNC A;  3CCV A;  1SFO H;  1G2T A;  1VQ4 A;  1R9T H;  3PUX A;  1GO3 E;  1SE4 A;  1GJX A;  2RHS B;  2RCF A;  1HA5 A;  2XNA C;  3W1G A;  4JI6 L;  1KAB A;  1LTA D;  1BBX C;  3T1H Q;  3NXW A;  1N36 L;  2L55 A;  4KN4 C;  4IUP A;  1NY4 A;  5EJW A;  2EXZ A;  3OIP A;  2AHO B;  1EZ6 A;  4DGZ A;  1B4O A;  1HR0 W;  4IPD A;  3V2T A;  3M4O B;  4DV5 Q;  4DR5 Q;  2RBM A;  3RN2 A;  4FNF A;  1RIP A;  3CHB D;  2QA4 A;  1WTV A;  3U58 A;  2OXP A;  1ICF B;  1QE6 A;  5JJK A;  3S1M B;  1PVO A;  3IKJ A;  3RLO A;  1H9J A;  4L6T B;  3T53 B;  4DUY L;  2Y0S G;  1YIT A;  1JB7 A;  2F0E A;  2A6H D;  2R92 H;  1X6O A;  1PRT D;  3S1Q H;  3LX0 A;  3UDF A;  3UDI A;  5JPN C;  1H9K A;  2EYM A;  1CT1 D;  1OXV A;  2CCZ A;  1B50 A;  2VS1 A;  1WCM B;  1I94 L;  4FF1 A;  3I3C A;  4JV5 L;  4RG1 A;  4A3E H;  1TXY A;  4I7A A;  3J80 c;  2WFW A;  3CCL A;  1XPO A;  4KHZ A;  4DKA C;  1HNZ L;  4JI5 Q;  3HOZ G;  4DU9 A;  4A3J B;  1LTT D;  1HTL D;  1EQT A;  1PFB A;  3H3V H;  4A3I G;  1S5E D;  5GQO A;  1QVC A;  3NUC A;  2QDB A;  3TN2 A;  2JP1 A;  5BN5 A;  4JV5 Q;  4G4K A;  4DAY B;  4HTH A;  4BBR B;  5LMN W;  1B9N A;  1NBW A;  3M3Y B;  2QDL A;  2B2W A;  3QIA A;  1Q86 C;  4QGU A;  2UUA Q;  1XJV A;  3FVQ A;  3UE0 A;  4KHP L;  2XWB B;  2F0J A;  2QCP X;  3KBX A;  2GVB A;  3KYH C;  5CV6 A;  1V8Q A;  1HRJ A;  1PRT B;  2KVM A;  4JI2 Q;  4IQZ A;  1Q90 A;  1LO5 D;  3E9I A;  3CME A;  3D4W A;  4QL5 A;  2AKW B;  4RMF A;  3FDT A;  1C7Y A;  2BH8 A;  4JBM A;  1STG A;  2L1B A;  4M1U B;  4GOP B;  1XX8 A;  2QEJ C;  4EX5 A;  2R93 H;  1PFS A;  1CK1 A;  1E24 A;  2A68 C;  5DAU A;  2JA5 H;  2PPB C;  1BVS A;  4K5V A;  3HOU H;  1NAP A;  2IHF A;  5IGD A;  3LGJ A;  3BDC A;  3M3Y H;  5I2X A;  3D3R A;  1TR5 A;  1HFG A;  2K6A A;  4KMU C;  3CCU A;  1IYJ B;  2CH4 W;  4GLA C;  3OTO L;  3C3L A;  3KOJ A;  3NP8 A;  1GKH A;  5IOC A;  5IP9 G;  3G71 A;  1EEF D;  5IGB A;  1XNQ Q;  1VQA A;  1I6V C;  2B8F A;  2Q2I A;  5LMN L;  1TWF H;  1AEX A;  3Q24 A;  1IBK Q;  2HDM A;  1LLR D;  4RWS C;  1KQS A;  1LT3 D;  4QQB X;  1BKB A;  4P71 A;  3S1R B;  4K0K Q;  3JAM L;  3SK4 A;  5IGG A;  4QB4 A;  3T16 A;  1TS3 A;  4JG2 A;  1WCM H;  2K7V A;  1D5X C;  3DEO A;  5CV5 A;  2EY2 A;  1HCZ A;  3S2H H;  1QZG A;  5TSS A;  5CC4 A;  4PV1 C;  3PQI A;  4GS3 A;  3CCJ A;  2WAQ G;  3OMG A;  3RR5 A;  1PHJ A;  2PZW A;  2MNA A;  4RCO A;  2LXK A;  3HOW B;  4A3K G;  2RQX A;  2F3V A;  3TEH B;  3S1M H;  4LAA A;  4BXX H;  3M4P A;  4IPH A;  1FJG L;  3FPU B;  3FEW X;  5C0X J;  3LWU A;  4AYB E;  2EYF A;  5JOB A;  1TT2 A;  3DEP A;  4IFD J;  4A3M G;  2G9H D;  2K33 A;  1MBY A;  2A6H C;  3K5M A;  3I4L A;  2VB2 X;  1SYC A;  2PW5 A;  2A69 D;  2SOB A;  4K5X A;  4ZQ3 A;  2K32 A;  4J6H A;  2QW7 A;  2Z6B A;  2IY5 B;  2E8G A;  4X65 Q;  2K5W A;  1VQ9 A;  5D3I B;  4QJF A;  4HCE A;  5DLQ E;  2Z6K C;  1O7Y A;  2KBN A;  1ET9 A;  2QGQ A;  4X3U A;  4JI7 Q;  3BJU A;  4JI4 Q;  1I4R A;  4IO9 A;  1R9T B;  2HD3 A;  2PW7 A;  1QJO A;  1QWY A;  1KTK A;  3I73 A;  1SFO B;  1V9P A;  3NE5 B;  3M85 A;  2CW0 C;  1XMQ L;  3ER0 A;  2JA6 B;  2FMC A;  2SDF A;  4DV1 Q;  5E4W C;  1EIH A;  2GN5 A;  5FJ8 H;  3FHW A;  1HTP A;  2CVR A;  4BWG B;  2HQL A;  3I4M H;  1TWH H;  1J6Q A;  1MSG A;  2PQA A;  3A56 A;  3MXU A;  1DGS A;  4N9P A;  3GDE A;  3VR3 A;  4X3K A;  1EY6 A;  4LF5 Q;  1WD1 A;  3DUZ A;  1K73 C;  3AU7 A;  1BR9 A;  2VQF L;  3S24 A;  4DN4 M;  4C3I G;  5M5X B;  4GNX A;  4X66 Q;  1X3G A;  5FLX L;  4FDB A;  4AIM A;  1VQM A;  3R93 A;  3RUZ A;  2QIL A;  3J81 j;  4OX9 Q;  4L5Q A;  1CFM A;  3NHH A;  4A3D G;  1PH7 A;  3T51 B;  3FKI H;  3V96 A;  3JAM i;  1R4P B;  2D2C C;  2RCN A;  4JOI C;  4ZUJ A;  1SMY C;  1VQ6 A;  1DON A;  1CZG A;  1A2U A;  1JJG A;  2NN6 G;  1CKM A;  2K52 A;  2B63 G;  1YNJ C;  2RHQ B;  1WD0 A;  1JT8 A;  2X6L A;  1U9R A;  3STB D;  2AQ1 B;  4DR7 Q;  3G48 A;  3WDN A;  4NXN Q;  2KCC A;  1EWC A;  3Q0A A;  1T9H A;  3OW7 A;  4A3I B;  2A19 A;  1LUZ A;  1SYD A;  1K83 B;  2NZO A;  2ZT9 C;  3I55 A;  4PNY A;  3VR6 A;  3EN2 A;  2HCC A;  4OIK A;  5DM6 3;  2K50 A;  3GTP B;  1X32 A;  3FP9 A;  3FKI B;  2F0T A;  2Z6K A;  1SSO A;  3KLS X;  1C9O A;  4YCU A;  4K5W A;  3KF6 A;  1I94 Q;  3K59 A;  1II3 A;  4DV0 Q;  3S1R H;  1PH8 A;  1EYG A;  1PTO C;  1OXT A;  2C9O A;  4JI6 Q;  2R7Z H;  4A3B B;  2EJF C;  3PIO 3;  4ZKB B;  2RF4 A;  5JEA G;  2E2I B;  1MSH A;  1QVF A;  4U67 3;  2HQE A;  3URY A;  2VL6 A;  1TWF B;  3OYY A;  4HN7 A;  2M2L A;  1B7Y B;  4XDX A;  4O1N A;  4R4O A;  1SMX A;  1KRT A;  1S72 A;  2L12 A;  3OHX C;  1Y8P B;  4LF6 L;  1CM9 A;  1F9Q A;  3X3M A;  4G7H C;  5A2Q E;  1CUK A;  3I4M B;  1BXT A;  4C3J G;  2RSO A;  4JBJ A;  2XN9 C;  2OTL A;  1JMC A;  1QCB D;  4R1J A;  1I4H A;  1OXU A;  4FXG C;  2FIN B;  1PLF A;  1IHZ A;  2MHV A;  3UDX A;  3VYR A;  5CV8 A;  1E2Z A;  3HKZ B;  3HEJ A;  2F0O A;  2UU9 Q;  3UI2 A;  3QB3 A;  4PG3 A;  2CQO A;  1Q46 A;  3DXJ C;  1TQO A;  2E75 C;  1ZYR C;  4APV A;  4HIK A;  1VQ8 A;  2B2U C;  4WJW A;  1SN8 A;  2B2Y A;  4C2M H;  1QUQ A;  3NBI A;  4FP5 D;  1YBY A;  4A3G G;  1EFW A;  4A75 A;  3PO2 B;  2R7F A;  4QUC A;  3TS2 A;  3GTK B;  1D2B A;  4KKU A;  2UXC Q;  5J22 A;  1DOL A;  1GHJ A;  5FO7 B;  4EQ5 A;  2ZJR A;  1RTO A;  2UUC Q;  2B39 A;  4MIU A;  4IZ8 A;  1IKM A;  4JVZ A;  3RLN A;  1A15 A;  5G3L F;  3H91 A;  4KN7 C;  4BBR H;  1QNU A;  1KLU D;  3HKZ E;  2F0P A;  2M00 A;  1HR0 L;  4Q0F A;  2XGT A;  2BCO A;  2PNR C;  1LAC A;  4R4C A;  3STB C;  4LFC L;  5IGC A;  3D31 A;  1EYA A;  4H0L C;  3L3O C;  3UE1 A;  3L2P A;  2NVY B;  1G6Z A;  1RL2 A;  2F0G A;  4IOC A;  3ULP A;  2A68 D;  2F0F A;  2PCF B;  3HRZ C;  1O7L A;  4HAE A;  2AMC B;  2ENB A;  3T56 B;  4BS9 A;  3GTJ B;  5M3F B;  2B29 A;  1N32 Q;  3S17 B;  4JI4 L;  3CPF A;  3C46 A;  4LFB Q;  2AUJ D;  5ELE A;  5BN3 A;  2NVY H;  1R4Q B;  1AP0 A;  1F2Z A;  2VQF Q;  3S14 B;  4A3C G;  2AWO A;  1D5Z C;  1P16 A;  3K5L A;  1SYF A;  2QKI C;  3TP8 A;  2V1C C;  3MC0 B;  4A3E G;  3ZJY C;  4A3K B;  1D5M C;  1E1O A;  2Q8R E;  4FO2 A;  1N36 Q;  4DR3 Q;  1KLG D;  2BA0 A;  4L5T A;  5IWA L;  1Z7T A;  3HOX B;  5EPK A;  2UXB L;  3MA2 B;  3VYT A;  4YY3 Q;  1TWA B;  4JI8 Q;  3BVZ A;  3RNU A;  3H15 A;  4B9X A;  1FJG Q;  4BY1 H;  5M3M B;  3TDQ A;  2HHH Q;  2DNE A;  4DR1 L;  2R93 B;  3CC2 A;  4OGQ C;  4LMQ D;  5IOD A;  2FJ2 A;  2KHS A;  4PZ6 A;  3MXP A;  2Q8I B;  4DAY A;  3EFX D;  4LF4 Q;  1T5E A;  2WKD A;  2NVQ H;  1CA6 A;  3ICE A;  2AWN A;  1GUN A;  2VUM H;  2F3W A;  3CXC A;  4DV4 L;  5EKI A;  4YY3 L;  1EY4 A;  3NEM A;  4N8X 1;  1CQF A;  2NWG A;  1X3P A;  3WOF A;  4E6I A;  4A3D H;  5I2Y A;  1TS4 A;  1QIL A;  5AJ3 Q;  4DV2 Q;  1N32 L;  1H95 A;  5KEE A;  2LKV A;  2OQ0 A;  1Q3L A;  4EVO A;  3GO5 A;  2UUB L;  4DV3 Q;  5NUC A;  4JI0 Q;  2C5C A;  1HNW Q;  2SNM A;  1V1P A;  1E2W A;  1U4R A;  3ITP A;  2HCI A;  4H13 C;  4I65 A;  3S9W A;  3D6W A;  2KJX A;  4CDD C;  3DHQ A;  1IBM L;  2B2V A;  1TWC H;  4KY7 A;  4ALP A;  4L5R C;  2L15 A;  4B3M L;  3HOZ B;  2FFK B;  3CC7 A;  5BR8 L;  5HGT A;  3BZD B;  1CA5 A;  3MFG A;  5FO8 B;  2JN4 A;  1N34 L;  2E2H H;  3A7L A;  2KCM A;  3TBI B;  4DFA A;  1HR0 Q;  1ML0 D;  3BVM A;  3A74 A;  1K28 A;  1QUQ B;  1VQB A;  4DR1 Q;  1LAB A;  5EPJ A;  2EYJ A;  3KLR A;  2YU9 H;  4IJL A;  1JQY D;  3BU2 A;  2WII B;  1W6J A;  4CHT B;  4KD3 A;  1EIF A;  4FVM A;  1VQJ A;  1WFQ A;  4J8Q A;  4A3I H;  5L37 A;  2DJF C;  1WJJ A;  2A74 C;  3MAQ A;  2F0K A;  3BZK A;  3N52 A;  3NSW A;  2KEC A;  1B9M A;  1NCV A;  1YVC A;  5EQ0 A;  4A3F B;  3BG3 A;  1L0X B;  1SNP A;  5IYC G;  2UXB Q;  1I4G A;  3V05 A;  4BBS G;  5D14 A;  4NXM Q;  3E0J A;  4CKC A;  2D0P A;  2NBF A;  3L9A X;  2KUM A;  3HZX A;  1CZW A;  1T5X D;  1TWC B;  4OO1 G;  2XRS D;  4L5S A;  1Y1W H;  1RF2 D;  1CKN A;  1VQI A;  3CCS A;  4POF A;  1K3B C;  2B2W C;  1Q7Y C;  2RKS A;  2K5Q A;  3GTG H;  1B53 A;  1SLJ A;  2Z0S A;  3W2D A;  1TKW B;  3M7G A;  5LMU L;  1U4P A;  3PCO B;  1OXX K;  4DNR B;  4C56 C;  4DR5 L;  1ESR A;  2XIW A;  2IL8 A;  2ZM6 Q;  4HJ5 A;  2OEO A;  2Q2U A;  2CHB D;  1WTP A;  4RHS A;  3ERS X;  4KLK A;  2B2T C;  1UEA B;  3RD4 A;  3K58 A;  5IE8 A;  1UUP A;  4LFA L;  1NSN S;  3F8T A;  3PUV A;  1RD9 D;  3BS1 A;  2VUM B;  2Z4H A;  5CBE E;  1JWM D;  2KCT A;  2D5D A;  1TWH B;  2HT1 A;  1AFP A;  1KXL A;  1IW7 C;  3E3X A;  3U9S A;  1K8M A;  3RZD B;  3PGZ A;  1UE7 A;  2E5L L;  2JA7 G;  4DR4 Q;  2EOT A;  4MTK A;  2ICI A;  3PO3 H;  1TU2 B;  3FPP A;  1YNN C;  4BY1 B;  1WTW A;  4GKJ Q;  4K14 A;  4P75 A;  3BYT B;  2WAC A;  1Q82 C;  4O42 A;  1ROD A;  4QF4 A;  4BA1 I;  4XYO A;  3E0E A;  1CHQ D;  3H09 A;  3TQY A;  3J7Z C;  1FNU A;  3MXN B;  2PQE A;  3HOY B;  2EJG C;  2PZT A;  3C2P A;  3CCE A;  3SE0 A;  1EUJ A;  2IX0 A;  2LXJ A;  1YJN A;  2ZXR A;  1MHW C;  4GLX A;  3NTI A;  5FKA C;  4UDU C;  4ZYS A;  1AE3 A;  3ULJ A;  3OIQ A;  3CF5 A;  5C3W A;  1NMF A;  5IGE A;  5IWA Q;  3CCR A;  2F03 A;  1A2T A;  4IPC A;  4OO1 H;  3H0G G;  2RA4 A;  4LUZ A;  4WFN 3;  5C44 H;  3GTJ H;  4IUU A;  2N49 A;  4R4T A;  1I6H H;  4BY7 G;  3IFD A;  2XRQ D;  4JK1 C;  1J9O A;  5ELF A;  1SRU A;  4BBS H;  2PQA B;  1HUN A;  2NTS A;  1UNS A;  4OEM B;  5IYC H;  1GUW A;  4HJ7 A;  4BBS B;  1RTN A;  4LFB L;  3F2U A;  2EDG A;  1Y1W G;  5EKL A;  4OO1 I;  1SRO A;  2E76 C;  2F0I A;  5C4J H;  4XT3 B;  3KJO A;  1JC7 A;  5IY0 A;  4NKL A;  5DNF A;  3CU7 A;  2JA8 G;  4A3L G;  3U4Z A;  1X56 A;  4P74 A;  3QR8 A;  2HUG A;  1AW7 A;  1Y1V B;  1C48 A;  4C2M B;  1XMO L;  1RCV D;  1YJ9 A;  1H9S B;  2MFI A;  2MO1 A;  5KND A;  3Q6S A;  4X6A H;  2DGY A;  1XPR A;  4R4Q A;  1PZJ D;  5KYL A;  1B3Q A;  1HFN A;  2L0C A;  1PRT F;  3G4S A;  1EFI D;  1YHB A;  4IPG A;  5EKK A;  4JI1 L;  1DJR D;  1FR3 A;  5F2D A;  3AB9 A;  3PF4 A;  4FF2 A;  2JA5 B;  4RGO S;  1A6X A;  1RDP D;  4K6D A;  2Z9H A;  1KD1 C;  4F88 A;  1FL0 A;  2JA7 H;  5C6A A;  2I5H A;  1MIU A;  1NR2 A;  1S5D D;  3SR1 A;  2JEA I;  3K7U C;  3HS0 C;  5C0X G;  1SE8 A;  4O0A A;  4DR3 L;  1IBL Q;  5I9O A;  4Z9C B;  1BCP D;  1DM0 B;  3GV6 A;  3SK5 A;  1Y1V H;  1I3Q H;  2QEX A;  2EZV A;  4PMB A;  1JOQ A;  2WIN B;  4N8F A;  2JSO A;  4KK7 A;  1OTC A;  2R3Z A;  3F2C A;  2R7D A;  5EBD A;  2PO4 A;  3AFP A;  3NBH B;  2RDH A;  1WTO A;  2PZU A;  2L9H A;  2N3S A;  2O5I C;  4OHJ A;  4BY7 B;  2R93 G;  3A7A B;  1SE3 A;  3K5N A;  5JJZ A;  4XYQ A;  1XNQ L;  1VQL A;  4EQO A;  2HIV A;  2IWH A;  3BDL A;  1Q12 A;  4PQX A;  2OT2 A;  2R7Z G;  3Q8D A;  1KNA A;  2YV5 A;  1AZP A;  1PDQ A;  2A8V A;  1G51 A;  4A3B G;  2F0V A;  3FMC A;  5IYD G;  1QG7 A;  5E4X A;  5M3M G;  1NMG A;  4LFC Q;  2CH4 A;  5C3E G;  3RMH A;  4C1N I;  4XQQ A;  4IFD H;  1PFM A;  1YNN D;  4UP7 A;  1I6H B;  2FMM A;  4DV1 L;  4A3J H;  2A69 C;  4JOI A;  3TP5 A;  4HJ9 A;  4YHH L;  4A3F H;  4HJ8 A;  3NWT A;  1MJE A;  2AQ2 B;  1M1K C;  1G6P A;  1PYB A;  4OL7 A;  1EQV A;  2BE5 C;  4A3E B;  2OQK A;  5C4H A;  2BH2 A;  4JI3 Q;  1STY A;  3A0J A;  4ZRZ A;  5LL6 X;  1GVP A;  3GQB A;  3P20 A;  1Q1B A;  3MXG A;  3OMC A;  4Y7N H;  4H02 A;  3GTQ H;  3HOV B;  2L5T A;  3NWS A;  2MQH A;  3I56 A;  4NB3 A;  4IUV A;  2CKZ B;  5M3F G;  1MJC A;  1PTO H;  2A6E D;  4DAM A;  3M4Y A;  1C0A A;  4BXX G;  1LTR D;  5CMD A;  1PZI D;  3NQT A;  2YU9 B;  3T1H L;  1BQQ T;  3P75 A;  4CGY B;  2IJ0 A;  3CCM A;  2NN6 I;  3HFZ B;  2UU9 L;  3S1N H;  1HNW L;  2O5J C;  1SEB D;  2I0Q A;  4MNO A;  3NBH A;  3ONA B;  4FYD A;  2KQ3 A;  5M5X H;  1U5K A;  1SYE A;  4O2D A;  5C3E H;  1ASZ A;  1NTG A;  5C4X B;  5T1G A;  1F2L A;  4IUR A;  5ELB A;  1D7Q A;  2KCN A;  4ZUI A;  4EQN A;  4FXD A;  1UAP A;  5CV4 A;  3S15 H;  1YHA A;  1ESF A;  5M9O A;  5ELC A;  2JA5 G;  1SNQ A;  4RCN A;  1KC8 C;  3A5U A;  3CMA A;  2LSS A;  2XVS A;  2JYO A;  4A3G B;  3KK7 A;  1NE3 A;  3VYU A;  1ILP A;  1BCP F;  2F4I A;  4ZKC B;  1VS0 A;  4M8A A;  2JA6 H;  2JE6 I;  3GD7 A;  3I4N B;  5K5P A;  3F1Z A;  1M90 C;  2NUC A;  3U4V A;  1J8I A;  1IBK L;  3J80 E;  3OW2 A;  5DEH A;  2JXM B;  1SBB B;  1FNV A;  1VQ7 A;  3BYY B;  5E7N A;  3GP7 A;  4K2K A;  1SR3 A;  1ENF A;  1ILQ A;  3HOY G;  1E22 A;  4IOA A;  4LFA Q;  1EYC A;  2IHE A;  4YWL A;  4X3T A;  1XNR L;  1PFN A;  2XSC A;  3HG9 A;  4RAU C;  2RDF A;  1IYU A;  4XT1 B;  3S16 H;  4ID6 A;  4ZCK A;  2UUC L;  2BDO A;  2E2J H;  2XWJ B;  5EBC A;  1CSP A;  3NEN A;  5M3M H;  2NB0 A;  1EY5 A;  2RSN A;  4AYB B;  4DV6 L;  3J81 i;  3DWP A;  3LNN A;  4YCV A;  3CRK C;  3IRB A;  2NVX H;  3U50 C;  3HOX H;  3H0G B;  2D62 A;  1FGU A;  1HQM C;  4LNQ A;  3BVG A;  2YTX A;  5GRO A;  2L4N A;  4RGT A;  1GUG A;  2SNS A;  4POG A;  4JI8 L;  1IW7 D;  3R2T A;  1D8L A;  4YCW A;  4DXF A;  1E0B A;  3S2H B;  4WRD A;  1BBW A;  2K5V A;  3JC6 6;  5C4Z A;  1HA6 A;  4MN3 A;  3FKI G;  1DCZ A;  4P73 A;  1S4Z A;  5LL6 S;  3X3N A;  3OWE B;  5GAE C;  4HMJ A;  1S5C D;  3J81 c;  4DV5 L;  4U68 A;  2EIF A;  2EQS A;  2F0D A;  1JJC B;  4NP5 A;  3KFU A;  2F0L A;  5IP7 H;  1X9N A;  1K8G A;  5D65 A;  4OX9 L;  1VMP A;  3J7A F;  1LT6 D;  1B1Z A;  1O7Z A;  1QB5 D;  1SYG A;  3P7J A;  4AYB G;  4ABN A;  4G7Z C;  4MHE A;  3KBG A;  3BDO A;  3MEH A;  3PSI A;  1I50 H;  1BO0 A;  3I91 A;  3J81 L;  2K5N A;  2UUB Q;  2CFM A;  4UP8 A;  1A3V A;  1F77 A;  1K0S A;  1IYV A;  1U4M A;  3ERQ A;  5E1F A;  4KTA A;  1EY7 A;  4BY7 H;  4C3J B;  1FVI A;  1TWG B;  1F9P A;  3CPW A;  4ULL A;  1GHK A;  3NK9 A;  4ME3 A;  4RKB A;  1ZEQ X;  5LMN Q;  3PO2 H;  2ZTE A;  5BR8 Q;  2ZM6 L;  3CQZ B;  4A3D B;  5K36 G;  1HZ9 A;  1X54 A;  1Q8I A;  1A3U A;  1RHP A;  4JBK A;  3ND8 A;  4Y52 H;  1V43 A;  4IJH A;  2WB1 B;  1EZ8 A;  3VR5 A;  1AH9 A;  5CGK A;  2NVQ B;  4JI0 L;  2PNH A;  1XNR Q;  4GKJ L;  3HP3 A;  3CQZ H;  5CYU A;  3MXN A; 
#chains in the Genus database with same CATH homology
 3E6Z X;  3GV3 A;  1VF5 C;  1WTQ A;  3P1H A;  4WOR A;  3DM1 A;  3SDZ A;  4C3H G;  4DXG A;  3AMU A;  4F87 A;  4HSP A;  3KLS A;  3A8K E;  3PUY A;  1STN A;  4RGN A;  1CQV A;  1BOS A;  1DYQ A;  2H1E A;  1I50 B;  2A6E C;  1G2S A;  1MI2 A;  5ISR A;  1LTI D;  1AZQ A;  2R61 A;  2K05 A;  4HMI A;  1I4Q A;  3S2D B;  2RVL A;  1BUV T;  5COY A;  1WTX A;  1HHV A;  3L7Z C;  3CKI B;  4C3I B;  1IL8 A;  3OPO A;  3GTM B;  2ICE C;  4LJZ C;  1TY2 A;  1U4L A;  1XYI A;  3CRL C;  4C3H B;  4FXK C;  4IAL A;  5DM7 3;  1SDF A;  4KJO A;  1FYC A;  2WKC A;  3J7Y W;  2J0T D;  4CKE A;  3NQI A;  5C44 B;  2NVX B;  5IT9 E;  3GTL B;  2PMZ B;  2F0N A;  3W3A A;  1SJH D;  3T13 A;  5JVG 3;  3S16 B;  1WVL A;  3H3V C;  3C1F A;  4IN3 A;  5HUR A;  3QJY A;  3QOJ A;  1TII D;  5CBA E;  1VF7 A;  5K36 H;  2WP8 J;  2DY7 A;  3VR2 A;  3SXH A;  1G91 A;  2DY8 A;  3A55 A;  5D3D A;  1Y69 U;  1PMR A;  2N88 A;  4F7X A;  3TZU A;  1L0Y B;  1GUS A;  2EYP A;  3A54 A;  3PMF A;  2OF1 A;  2VB3 X;  2KEE A;  4KI0 A;  5KYI A;  1E2V A;  5KNC A;  1XTC D;  5FO9 B;  2EE1 A;  5M5W B;  1GXD C;  3IFT A;  3OOC A;  1Q1E A;  3NTK A;  4GZY C;  2HDL A;  2K5D A;  3I8Z A;  1STE A;  3PUZ A;  4KV6 A;  1ZKO A;  3QG1 A;  3DWQ A;  2Z8L A;  1CHP D;  2QF7 A;  3MWY W;  5C5L A;  2L11 A;  3TP6 A;  4TRD A;  4IUN A;  3SK6 A;  1SJE D;  1Y1W B;  1DXM A;  4DNT B;  1VCI A;  2E74 C;  2DN8 A;  3EA6 A;  5EGT A;  1B44 D;  1LT5 D;  3QWN A;  5ELD A;  2MJ8 A;  1PRT C;  1PTO D;  4HR7 B;  4K8I A;  4CJ2 C;  4DK0 A;  2EYH A;  5IGF A;  4XIG S;  4ZK9 B;  1I4X A;  1A3T A;  5BN4 A;  1H9R A;  1BDO A;  2E2D C;  3OSO A;  5EPL A;  3D6C A;  1F9R A;  4A3M B;  3K0Y A;  2G9D A;  5AFW A;  2F0S A;  4B9W A;  5I9P A;  1O80 A;  1KDA A;  4CKB A;  1LTB D;  2IX1 A;  1H9S A;  3MFY A;  4ILW A;  1Y8N B;  2EJM A;  3T4A C;  1DD2 A;  4P2C B;  4RKL A;  2AUK A;  2F1M A;  1HXY D;  1XWE A;  1KDB A;  5I6Y A;  4EGV A;  1SND A;  3TME A;  4CJ1 B;  4KD4 A;  3ZYY X;  5I4D A;  4TKO B;  1EOT A;  2F0M A;  4XQJ A;  2X6G A;  1BNZ A;  2JA7 B;  1JR0 D;  2IX3 A;  1JWS D;  3HOU B;  1JOR A;  5C0X H;  5J1Z A;  1SNM A;  5FLX E;  1QNK A;  1F2M A;  1PZK D;  3KF8 A;  3J80 L;  3K6O A;  2FHT A;  5A35 A;  1WTR A;  3Q22 A;  2MUY A;  2A73 B;  1B2T A;  2EPB A;  4IUT A;  3SHL A;  4QUF A;  2Z1C A;  4RH6 A;  1EEI D;  1STB A;  5C4J B;  3OWF A;  3DWA A;  3PV0 A;  1BCP B;  2BOS A;  1JCK B;  3A8I E;  4DA2 A;  3M7N A;  1ET6 A;  4KHV A;  2J4X A;  1ZYR D;  1EWH A;  5C0X I;  1F9S A;  4XXE A;  5JEA H;  3DMU A;  1FD7 D;  1ONL A;  3D4D A;  3TZD A;  1PYW D;  2H4O A;  2BDN A;  1JOO A;  1OO9 B;  2O2L D;  3I72 A;  3IL8 A;  3R8B A;  5KGU A;  2NYZ D;  4QMG A;  4K8J A;  4G57 A;  1TY0 A;  2R92 B;  1C8C A;  5A2Q L;  1LV9 A;  3ERO A;  1D1I A;  2EY6 A;  1NUC A;  1B3A A;  3TSS A;  1EU3 A;  3PO3 B;  3K5O A;  4IUQ A;  2LMC B;  2K04 A;  4KKS A;  1PTO F;  1OXS C;  1KNE A;  4R8I A;  3MHB A;  5JAV A;  1M4V A;  1SXT A;  1FGB D;  4J1M A;  1KAA A;  4PMW A;  2N55 A;  2IW3 A;  1SMY D;  3VA5 A;  3J7A V;  1JWU D;  1DOM A;  2LFN A;  4OIJ A;  3Q23 A;  4R8N A;  2B2Y C;  4G7O C;  3GTO B;  2K1B A;  3GTG B;  3MZ5 A;  2NN6 H;  1VDZ A;  2K28 A;  3QOL A;  1JE4 A;  3VYS A;  3S15 B;  3R3O A;  2KOL A;  1F2Y A;  3MVV A;  1ZXT A;  2CW0 D;  4NDX A;  3MTS A;  1EY9 A;  4KKT A;  2SEB D;  4BA2 I;  5C3E B;  1MGS A;  1LTS D;  2NZ1 D;  2R7Z B;  1TS5 A;  2F0W A;  4CBV A;  1V1O A;  2M9V A;  5C5M A;  1TVX A;  1KDC A;  3S1Q B;  2MGS A;  5I6W A;  4FF4 A;  1EU4 A;  3GTQ B;  2NTT A;  3K7A B;  4DAV A;  4PMC A;  5C3X A;  5COR A;  5G3L D;  2E2H B;  5IT9 L;  4H7B A;  4CJ0 B;  3IAY A;  2F0U A;  5JEA J;  1EL0 A;  1LT4 D;  3H94 A;  1SE2 A;  3PUW A;  1C4Q A;  2F0Q A;  2I07 B;  2R6G A;  2MP1 A;  2IPK D;  2EY1 A;  4N9T A;  1GUO A;  3H6M A;  3RLF A;  1I3Q B;  2MPM A;  4NMZ A;  4DF7 A;  1MD2 D;  4HSV A;  2Z4I A;  5CV9 A;  2J7Z A;  1HPC A;  1G8Z D;  2V4D A;  4KY5 A;  4ZLT F;  2KA7 A;  1BCP C;  1SNO A;  5JPM C;  1M8A A;  5KIX A;  1HQR D;  3HGB A;  4RGM A;  3S1N B;  4K6L A;  2K01 A;  3U9O A;  4YIJ A;  1FNW A;  2NVT B;  4L63 B;  4TSS A;  1K8O A;  1JOK A;  2F0H A;  1PTO B;  1BF4 A;  1JIC A;  2JEB I;  1V1P B;  4Y7N B;  3J81 E;  1HUM A;  2Y0S B;  3RZO B;  4ME5 A;  2VXW A;  1Z6H A;  1D1K A;  2CQA A;  2B2T A;  1S5F D;  2TSS A;  1SYB A;  3ND9 A;  2JA8 B;  3R2I A;  3C1E A;  1IKL A;  1H9M A;  5FK9 C;  3LWE A;  2I46 A;  5FOB B;  3SEB A;  3SVM A;  4ZAI A;  2BA1 A;  2B63 B;  2B2U A;  2RDG A;  4LK1 C;  3D8G A;  4R9W A;  4I7Z C;  4B08 A;  1YNJ D;  4IFD G;  3QO2 A;  1STA A;  1LTG D;  2B8G A;  2A5H A;  1QOH A;  2EYL A;  4C1N K;  4DK1 A;  1RJT A;  4A93 B;  1S5B D;  2IT1 A;  1XXG A;  1Z47 A;  2PYK A;  1EY0 A;  4RFB A;  4DAP A;  5KNB A;  3NTH A;  1TS2 A;  1O78 A;  2LS0 1;  4XQN A;  3G6J B;  1CI3 M;  3N6R A;  1EY8 A;  2D9U A;  4L8J A;  3JAM E;  1ENA A;  1PXU A;  1ENC A;  3VR4 A;  2YYZ A;  1RKN A;  3E5S A;  5KRU A;  4RHR A;  1DZ1 A;  1X3Q A;  3SK8 A;  2TMP A;  3G7L A;  2B2V C;  3D4R A;  3NPP A;  4QCL A;  4F8M A;  3TP7 A;  2EYO A;  4QIW B;  3VA7 A;  4X3S A;  2WV6 D;  1SAP A;  2EVB A;  1CTM A;  2WAQ B;  3WOE A;  2DNC A;  5JVH 3;  1EYD A;  4HCS A;  4H44 C;  4KJN A;  2K03 A;  3EVQ A;  4ODG A;  5M5Y B;  2X69 A;  4Q5V A;  1EIG A;  1ICW A;  4KY6 A;  3I90 A;  1Y8O B;  5T1I A;  5LHY 1;  3K57 A;  4IFD I;  3O13 A;  1DOK A;  4UAI A;  4NW2 A;  1AN8 A;  1I4P A;  5CV7 A;  3KUP A;  4TQU S;  1G29 1;  3I70 A;  4EQP A;  4V19 0;  4V0B A;  5E3F A;  2ZXO A;  1VMC A;  3EQL C;  5J39 A;  1NR4 A;  2GA4 B;  2LY7 A;  3PIP 3;  4XTC S;  1GUT A;  3FRP B;  2E2J B;  5CR3 A;  1STH A;  5IIF A;  2AQ3 B;  2BE5 D;  4JBW A;  2Q8T A;  2EY5 A;  4HED A;  2VNU D;  4S3S A;  4FF3 A;  2ID0 A;  3A8J E;  1D6E C;  1JB3 A;  3EJI A;  1W6K A;  4RA8 A;  2KED A;  2ZXP A;  2O4X A;  1GOZ A;  4K2L A;  1SNC A;  1G2T A;  3PUX A;  1SE4 A;  1GJX A;  1HA5 A;  2XNA C;  1KAB A;  1LTA D;  1BBX C;  3NXW A;  2L55 A;  4KN4 C;  4IUP A;  5EJW A;  2EXZ A;  3OIP A;  1EZ6 A;  4DGZ A;  1B4O A;  3V2T A;  3M4O B;  2RBM A;  4FNF A;  1WTV A;  3CHB D;  2OXP A;  1QE6 A;  3S1M B;  3IKJ A;  1H9J A;  4L6T B;  3T53 B;  2F0E A;  2A6H D;  1PRT D;  3LX0 A;  5JPN C;  1H9K A;  2EYM A;  1CT1 D;  1OXV A;  1B50 A;  1WCM B;  4FF1 A;  3I3C A;  4KHZ A;  4DU9 A;  4A3J B;  1LTT D;  1HTL D;  1EQT A;  1PFB A;  1S5E D;  3NUC A;  2QDB A;  3TN2 A;  2JP1 A;  5BN5 A;  4G4K A;  4HTH A;  4BBR B;  1B9N A;  3M3Y B;  2B2W A;  3QIA A;  3FVQ A;  2XWB B;  2F0J A;  2QCP X;  3KBX A;  5CV6 A;  1V8Q A;  1HRJ A;  1PRT B;  2KVM A;  4IQZ A;  1Q90 A;  1LO5 D;  3D4W A;  3FDT A;  1STG A;  2L1B A;  4M1U B;  1XX8 A;  2QEJ C;  1CK1 A;  2A68 C;  5DAU A;  2PPB C;  4K5V A;  1NAP A;  5IGD A;  3BDC A;  5I2X A;  3D3R A;  1TR5 A;  1HFG A;  2K6A A;  4KMU C;  3C3L A;  3NP8 A;  5IOC A;  1EEF D;  5IGB A;  1I6V C;  2B8F A;  1AEX A;  3Q24 A;  2HDM A;  1LLR D;  4RWS C;  1LT3 D;  3S1R B;  3JAM L;  3SK4 A;  5IGG A;  4QB4 A;  3T16 A;  1TS3 A;  2K7V A;  1D5X C;  3DEO A;  5CV5 A;  2EY2 A;  1HCZ A;  5TSS A;  5CC4 A;  4PV1 C;  3OMG A;  2PZW A;  4RCO A;  3HOW B;  2RQX A;  2F3V A;  4LAA A;  3FPU B;  3FEW X;  5C0X J;  3LWU A;  2EYF A;  5JOB A;  1TT2 A;  3DEP A;  4IFD J;  2G9H D;  2K33 A;  1MBY A;  2A6H C;  3K5M A;  3I4L A;  2VB2 X;  1SYC A;  2PW5 A;  2A69 D;  2SOB A;  4K5X A;  4ZQ3 A;  2K32 A;  4J6H A;  2K5W A;  5D3I B;  4HCE A;  1O7Y A;  1ET9 A;  4X3U A;  1I4R A;  1R9T B;  2PW7 A;  1QJO A;  1QWY A;  1KTK A;  3I73 A;  1SFO B;  3NE5 B;  3M85 A;  2CW0 C;  2JA6 B;  2FMC A;  2SDF A;  5E4W C;  1EIH A;  1HTP A;  2CVR A;  4BWG B;  1MSG A;  3A56 A;  3MXU A;  4N9P A;  3VR3 A;  4X3K A;  1EY6 A;  1WD1 A;  3DUZ A;  3AU7 A;  1BR9 A;  4DN4 M;  4C3I G;  5M5X B;  5FLX L;  3R93 A;  3RUZ A;  2QIL A;  1CFM A;  3NHH A;  3T51 B;  3V96 A;  1R4P B;  2D2C C;  4ZUJ A;  1SMY C;  1DON A;  1CZG A;  1A2U A;  2NN6 G;  1YNJ C;  1WD0 A;  2X6L A;  1U9R A;  2AQ1 B;  3WDN A;  2KCC A;  1EWC A;  3Q0A A;  3OW7 A;  4A3I B;  1SYD A;  1K83 B;  2ZT9 C;  4PNY A;  3VR6 A;  2HCC A;  4OIK A;  5DM6 3;  3GTP B;  1X32 A;  3FKI B;  2F0T A;  1SSO A;  3KLS X;  4K5W A;  3K59 A;  1II3 A;  1PTO C;  1OXT A;  2C9O A;  4A3B B;  2EJF C;  3PIO 3;  4ZKB B;  5JEA G;  2E2I B;  1MSH A;  4U67 3;  2HQE A;  3URY A;  1TWF B;  4HN7 A;  2M2L A;  4XDX A;  4O1N A;  2L12 A;  3OHX C;  1Y8P B;  1CM9 A;  1F9Q A;  3X3M A;  4G7H C;  5A2Q E;  3I4M B;  1BXT A;  4C3J G;  2RSO A;  2XN9 C;  1QCB D;  1I4H A;  1OXU A;  4FXG C;  2FIN B;  1PLF A;  1IHZ A;  2MHV A;  3VYR A;  5CV8 A;  1E2Z A;  3HKZ B;  3HEJ A;  2F0O A;  3UI2 A;  3QB3 A;  3DXJ C;  1TQO A;  2E75 C;  1ZYR C;  2B2U C;  4WJW A;  2B2Y A;  3NBI A;  4FP5 D;  3PO2 B;  4QUC A;  3GTK B;  1D2B A;  4KKU A;  5J22 A;  1DOL A;  1GHJ A;  5FO7 B;  1RTO A;  1IKM A;  2B39 A;  4MIU A;  4IZ8 A;  1A15 A;  5G3L F;  3H91 A;  4KN7 C;  1QNU A;  1KLU D;  2F0P A;  2M00 A;  4Q0F A;  2BCO A;  2PNR C;  1LAC A;  5IGC A;  3D31 A;  1EYA A;  3L3O C;  4H0L C;  2NVY B;  1G6Z A;  2F0G A;  2A68 D;  2F0F A;  2PCF B;  3HRZ C;  1O7L A;  4HAE A;  2ENB A;  3T56 B;  4BS9 A;  3GTJ B;  5M3F B;  3S17 B;  3C46 A;  2AUJ D;  5ELE A;  5BN3 A;  1R4Q B;  1AP0 A;  1F2Z A;  3S14 B;  2AWO A;  1D5Z C;  3K5L A;  1SYF A;  2QKI C;  3TP8 A;  3MC0 B;  4A3K B;  1D5M C;  2Q8R E;  4FO2 A;  1KLG D;  2BA0 A;  1Z7T A;  3HOX B;  5EPK A;  3MA2 B;  3VYT A;  1TWA B;  3BVZ A;  4B9X A;  5M3M B;  3TDQ A;  2DNE A;  2R93 B;  4OGQ C;  4LMQ D;  5IOD A;  2FJ2 A;  2KHS A;  3MXP A;  2Q8I B;  4DAY A;  3EFX D;  1T5E A;  2WKD A;  1CA6 A;  2AWN A;  1GUN A;  2F3W A;  5EKI A;  1EY4 A;  1CQF A;  2NWG A;  1X3P A;  3WOF A;  4E6I A;  5I2Y A;  1TS4 A;  1QIL A;  5KEE A;  2LKV A;  1Q3L A;  4EVO A;  3GO5 A;  5NUC A;  2C5C A;  2SNM A;  1V1P A;  1E2W A;  1U4R A;  3ITP A;  2HCI A;  4H13 C;  4I65 A;  3S9W A;  3D6W A;  2KJX A;  3DHQ A;  2B2V A;  4KY7 A;  3HOZ B;  2FFK B;  5HGT A;  3BZD B;  1CA5 A;  3MFG A;  5FO8 B;  3A7L A;  3TBI B;  4DFA A;  1ML0 D;  3BVM A;  1LAB A;  5EPJ A;  2EYJ A;  3KLR A;  1JQY D;  2WII B;  1W6J A;  4CHT B;  4KD3 A;  4FVM A;  4J8Q A;  2A74 C;  3MAQ A;  2F0K A;  3N52 A;  3NSW A;  2KEC A;  1B9M A;  1NCV A;  5EQ0 A;  4A3F B;  3BG3 A;  1L0X B;  1SNP A;  1I4G A;  3V05 A;  5D14 A;  3E0J A;  4CKC A;  2NBF A;  3L9A X;  2KUM A;  3HZX A;  1CZW A;  1T5X D;  1TWC B;  4OO1 G;  2XRS D;  1RF2 D;  2B2W C;  2RKS A;  2K5Q A;  1B53 A;  3W2D A;  1TKW B;  3M7G A;  1U4P A;  1OXX K;  4DNR B;  4C56 C;  1ESR A;  2XIW A;  2IL8 A;  2OEO A;  2CHB D;  1WTP A;  4RHS A;  2B2T C;  1UEA B;  3K58 A;  3RD4 A;  1UUP A;  1NSN S;  3PUV A;  1RD9 D;  3BS1 A;  2VUM B;  2Z4H A;  5CBE E;  1JWM D;  2D5D A;  1TWH B;  1AFP A;  1IW7 C;  3U9S A;  1K8M A;  3RZD B;  2EOT A;  2ICI A;  1TU2 B;  3FPP A;  1YNN C;  4BY1 B;  1WTW A;  4K14 A;  3BYT B;  2WAC A;  4O42 A;  1ROD A;  4QF4 A;  4BA1 I;  4XYO A;  1CHQ D;  3H09 A;  1FNU A;  2PQE A;  3HOY B;  2EJG C;  2PZT A;  3C2P A;  3SE0 A;  2IX0 A;  2ZXR A;  3NTI A;  5FKA C;  4UDU C;  4ZYS A;  3OIQ A;  5C3W A;  4OO1 H;  5IGE A;  2F03 A;  1A2T A;  4WFN 3;  2RA4 A;  4IUU A;  3IFD A;  2XRQ D;  4JK1 C;  1J9O A;  5ELF A;  1HUN A;  2NTS A;  1UNS A;  1GUW A;  4BBS B;  1RTN A;  3F2U A;  2EDG A;  5EKL A;  4OO1 I;  2E76 C;  2F0I A;  4XT3 B;  1JC7 A;  4NKL A;  5DNF A;  3CU7 A;  2HUG A;  1AW7 A;  1Y1V B;  1C48 A;  4C2M B;  1RCV D;  1H9S B;  5KND A;  3Q6S A;  5KYL A;  1PZJ D;  1HFN A;  2L0C A;  1PRT F;  1EFI D;  5EKK A;  1DJR D;  1FR3 A;  5F2D A;  3AB9 A;  2JA5 B;  4FF2 A;  4RGO S;  1A6X A;  1RDP D;  4K6D A;  4F88 A;  5C6A A;  1NR2 A;  1S5D D;  3SR1 A;  2JEA I;  3HS0 C;  5C0X G;  5I9O A;  4Z9C B;  1BCP D;  1DM0 B;  3GV6 A;  3SK5 A;  2EZV A;  4PMB A;  1JOQ A;  2WIN B;  2JSO A;  4KK7 A;  2R3Z A;  5EBD A;  2PO4 A;  2RDH A;  1WTO A;  2PZU A;  2L9H A;  2O5I C;  4OHJ A;  4BY7 B;  3A7A B;  1SE3 A;  3K5N A;  5JJZ A;  4XYQ A;  4EQO A;  2IWH A;  3BDL A;  1Q12 A;  4PQX A;  2OT2 A;  1KNA A;  1AZP A;  1PDQ A;  2F0V A;  3FMC A;  1QG7 A;  5E4X A;  3RMH A;  4C1N I;  4XQQ A;  4IFD H;  1PFM A;  1YNN D;  1I6H B;  2FMM A;  2A69 C;  3TP5 A;  3NWT A;  2AQ2 B;  1EQV A;  4OL7 A;  2BE5 C;  4A3E B;  5C4H A;  1STY A;  4ZRZ A;  5LL6 X;  3GQB A;  3P20 A;  1Q1B A;  3MXG A;  3OMC A;  3HOV B;  2L5T A;  3NWS A;  4IUV A;  1PTO H;  2A6E D;  3M4Y A;  1LTR D;  5CMD A;  1PZI D;  3NQT A;  2YU9 B;  1BQQ T;  3P75 A;  4CGY B;  2IJ0 A;  2NN6 I;  2O5J C;  1SEB D;  3NBH A;  3ONA B;  4FYD A;  2KQ3 A;  1SYE A;  5C4X B;  5T1G A;  1F2L A;  4IUR A;  5ELB A;  2KCN A;  4ZUI A;  4EQN A;  4FXD A;  1UAP A;  5CV4 A;  1ESF A;  5M9O A;  5ELC A;  1SNQ A;  4RCN A;  2XVS A;  2JYO A;  4A3G B;  3KK7 A;  3VYU A;  1ILP A;  1BCP F;  2F4I A;  4ZKC B;  4M8A A;  2JE6 I;  3GD7 A;  3I4N B;  5K5P A;  2NUC A;  1J8I A;  3J80 E;  5DEH A;  2JXM B;  1SBB B;  1FNV A;  3BYY B;  3GP7 A;  4K2K A;  1ENF A;  1ILQ A;  1EYC A;  4X3T A;  1PFN A;  2XSC A;  3HG9 A;  4RAU C;  2RDF A;  1IYU A;  4XT1 B;  4ID6 A;  2BDO A;  2XWJ B;  5EBC A;  2NB0 A;  1EY5 A;  2RSN A;  4AYB B;  3DWP A;  3LNN A;  3CRK C;  3H0G B;  2D62 A;  1HQM C;  3BVG A;  2L4N A;  4RGT A;  1GUG A;  2SNS A;  1IW7 D;  3R2T A;  4DXF A;  1E0B A;  3S2H B;  4WRD A;  5C4Z A;  1HA6 A;  4MN3 A;  1DCZ A;  5LL6 S;  1S4Z A;  3X3N A;  3OWE B;  4HMJ A;  1S5C D;  4U68 A;  2F0D A;  4NP5 A;  2F0L A;  5D65 A;  1VMP A;  3J7A F;  1LT6 D;  1B1Z A;  1O7Z A;  1QB5 D;  1SYG A;  3P7J A;  4ABN A;  4G7Z C;  4MHE A;  3KBG A;  3BDO A;  3MEH A;  1BO0 A;  3I91 A;  3J81 L;  1A3V A;  1F77 A;  1IYV A;  1U4M A;  3ERQ A;  5E1F A;  4KTA A;  1EY7 A;  4C3J B;  1TWG B;  1F9P A;  4ULL A;  1GHK A;  3NK9 A;  4RKB A;  1ZEQ X;  3CQZ B;  4A3D B;  5K36 G;  1Q8I A;  1A3U A;  1RHP A;  3ND8 A;  1V43 A;  2WB1 B;  1EZ8 A;  3VR5 A;  5CGK A;  2NVQ B;  3HP3 A;  5CYU A;  3MXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...