3PIP1

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 5
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.120 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pip100
3J7Y1 3J7Z1 3PIP1 4U671 5GAHc 5DM71 4UY81 5JVH1 5GADc 5DM61 5MLC3 3PIO1 5GAEc 4WFN1 4V196 5GAGc 5JVG1 5H1Sc
chains in the Genus database with same CATH superfamily
2XJTA 4A3KL 3JR7A 2WAQP 2L0ZA 1RB9A 1BRFA 3LWPB 3S17L 5C44L 1P7PA 4AR6A 3S14L 3GTOL 1LKMA 1DVBA 3HOXL 2EY4E 3GTGL 3PKIA 3HOZL 3S15L 2HVYC 5MFZA 1QCVA 1YK4A 5JVH1 1TWHL 2Y0SP 3HOWL 3A44A 3HJYB 1OWCA 3H3VM 5EINC 1R9TL 1PZXA 2CKAA 4AHZA 3P8BA 2RDVA 6RXNA 2C6AA 2M4YA 4LHLA 1VZIA 2M6PA 1I6HL 3LPEB 1RYQA 4POFA 1PFUA 2V3BB 5DM61 1YUZA 4C2M1 1I3QL 1S30A 1NXEA 4AI3A 4B8CD 2JA8L 3HJWB 2R92L 2WB1P 3LWVB 2ZIXA 2E2IL 4XGHA 1IU6A 1BQ9A 2R7ZL 4A3EL 4JAFA 4Y7NL 5GAEc 1S24A 4GS7D 2E2HL 1T9PA 2M6OA 1B13A 3CQZL 2BE5D 2APOB 2AYJA 3LWRB 1T9QA 2K2DA 2M4VA 2PSMC 2NVQL 5IYDL 4BY1L 4XXBB 2PPTA 4U671 1ZRPA 1IW7D 2E2JL 1SFOL 1R0JA 3J7Y1 5EIOC 4Y52L 1YV1A 4V196 1BE7A 2XJPA 5MGNA 1SMMA 4AI0A 2VL6A 1K83L 4BY7L 2PYAA 2NVXL 3H97A 3FDJA 4JAGA 3FKIL 3GTLL 3KYWA 2JI2A 1LKOA 2PVEA 4YWMA 3S2DL 3RZDL 2RFKB 2B5ID 4G6BA 3LWOB 1H7VA 3NFPI 5GAGc 4A3GL 2JI3A 1Z92B 2VUML 3RZTA 3S16L 4K9FA 2Z3RB 3K35A 5DM71 2MS3A 1BFYA 2C6BA 3KYUA 2J9UB 4AR5A 1FHMA 1RDGA 3H9CA 3RZOL 3PIO1 5AI2A 3H9BA 3GTKL 3KYXA 3WWNB 2PMZP 1S2ZA 2XJSA 5AI3A 5IYBL 1DX8A 2PVXA 1PFVA 1PFYA 1VZGA 3IU3I 5IP9L 3GTPL 2A6HD 2JA5L 2XJRA 2A6ED 1TWAL 4A3IL 2CR8A 2DSXA 2JI1A 2LCQA 3MSUA 3HOUL 1R0HA 2NYDA 2XJUA 4BBSL 1Y1WL 1SMWA 4JAEA 3PKJA 2CKCA 3PZAA 1RWDA 3GTJL 1LTLA 3S1NL 1TWFL 3LWQB 1I50L 4BXXL 4X6AL 4QIWP 1VCXA 1VZHA 5MF6A 4AR3A 5FLML 2NVTL 1JYBA 3MPSA 1IRNA 4AR4A 4AI2A 3LNLA 5C4XL 1C09A 5MLC3 5FJ8L 1YK5A 4RXNA 4AHXA 3S1QL 3RZ6A 5IY0A 4ME3A 5IP7L 4JADA 5GAHc 1QYBA 3B0AB 1Y1VL 5H1Sc 2B63L 1RDVA 3K7AL 4E6YA 4BBRL 1PFWA 2HR5A 3PIP1 2R93L 4ZN3B 2JA6L 2XJQA 2AQCA 1BQ8A 3GTQL 3H99A 2YU9L 2AUSB 3HAXC 3S1ML 1NNQA 2H12A 4POGA 4AI1A 5C3EL 4A3LL 3HOYL 4A3BL 4C3HL 1NXGA 5AN9H 2KN9A 2ERSA 1B2OA 1QQTA 2ERJA 4A3DL 5IYCL 3M3YL 4A3JL 1ODHA 5GADc 4ZN1B 5M5YL 1CADA 1WJVA 4LHNA 1IROA 5M3FL 1WCML 1TWCL 3PO3L 5MFPA 5RXNA 1F4LA 4TVMA 3PO2L 1B71A 3WWLA 1CAAA 1IU5A 3VPBE 2GMGA 5K2ME 2QL0A 3KYVA 2A68D 3HOVL 3P2AA 1RYTA 1SMUA 1R0IA 5JVG1 4TPUA 2V0FA 3SS2A 3H0GL 3B08B 1FHHA 1T9OA 2XJVA 3I4ML 3PWFA 2JA7L 2Z3QB 1R0FA 4A93L 4A3CL 8RXNA 4A3ML 1OWBA 4C3JL 4A3FL 7RXNA 2NVYL 3M4OL 4UY81 3I4NL 2KKDA 3HKZP 3QVDA 3MQKB 3KYYA 1LKPA 3GTML 5M3ML 1TWGL 4AHWA 1B2JA 5C4JL 4AYBP 2V0EA 4AHYA 4C3IL 1R0GA 3S1RL 3PL5A 5M5XL 2O5JD 5M5WL 4YWLA 1YUXA 3ZG6A 2A69D 3J7Z1 3RYGA 4WFN1 3S2HL 3QQCE 1E8JA
chains in the Genus database with same CATH topology
1VZGA 2BE5D 2XJTA 5AN9H 2KN9A 3IU3I 2AYJA 2ERSA 1B2OA 2ERJA 1T9QA 2K2DA 2L0ZA 2M4VA 1RB9A 2PSMC 1ODHA 2A6HD 5GADc 4ZN1B 2XJRA 2A6ED 1BRFA 2CR8A 2DSXA 4XXBB 1CADA 2JI1A 2LCQA 4AR6A 1WJVA 3MSUA 1R0HA 2NYDA 4LHNA 2PPTA 1IROA 2XJUA 1LKMA 1SMWA 4JAEA 5MFPA 5RXNA 1DVBA 4U671 1ZRPA 4TVMA 1IW7D 3PKJA 2CKCA 3PZAA 1B71A 3WWLA 3PKIA 1RWDA 1R0JA 3J7Y1 1CAAA 1IU5A 3VPBE 1LTLA 5EIOC 2GMGA 5MFZA 1YV1A 5K2ME 1QCVA 4V196 2QL0A 1BE7A 1YK4A 2XJPA 3KYVA 5MGNA 1SMMA 5JVH1 2A68D 4AI0A 2VL6A 3P2AA 1RYTA 3A44A 1VCXA 1VZHA 1SMUA 2PYAA 1R0IA 5MF6A 5JVG1 4TPUA 1OWCA 2V0FA 4AR3A 5EINC 3SS2A 4JAGA 1JYBA 3MPSA 3B08B 3KYWA 2CKAA 4AHZA 3P8BA 1FHHA 2JI2A 1IRNA 2RDVA 4AR4A 1T9OA 4AI2A 1LKOA 2C6AA 2M4YA 2PVEA 2XJVA 3LNLA 4LHLA 4YWMA 6RXNA 1VZIA 1C09A 3PWFA 5MLC3 2Z3QB 2M6PA 2B5ID 1YK5A 4RXNA 4G6BA 4AHXA 3RZ6A 5IY0A 1H7VA 3LPEB 4ME3A 1R0FA 2PVXA 3NFPI 1RYQA 4POFA 5GAGc 4JADA 8RXNA 2JI3A 1QYBA 2V3BB 5GAHc 1OWBA 3B0AB 5DM61 1Z92B 1YUZA 7RXNA 5H1Sc 1S30A 3RZTA 4UY81 1NXEA 1RDVA 2KKDA 3QVDA 4AI3A 4B8CD 4E6YA 3KYYA 1LKPA 4K9FA 2Z3RB 3K35A 2HR5A 3PIP1 5DM71 4ZN3B 2MS3A 1BFYA 2C6BA 2XJQA 3KYUA 4AHWA 2J9UB 4AR5A 1B2JA 2ZIXA 2V0EA 4XGHA 1FHMA 1IU6A 1RDGA 1BQ8A 4AHYA 1R0GA 1BQ9A 3PIO1 4JAFA 2O5JD 1NNQA 5AI2A 4YWLA 2H12A 5GAEc 1YUXA 1S24A 3KYXA 3ZG6A 3WWNB 4AI1A 4POGA 2XJSA 1S2ZA 2A69D 3J7Z1 4GS7D 5AI3A 1DX8A 1NXGA 1T9PA 2M6OA 3RYGA 4WFN1 1B13A 3QQCE 1E8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y 1;  3J7Z 1;  3PIP 1;  4U67 1;  5GAH c;  5DM7 1;  4UY8 1;  5JVH 1;  5GAD c;  5DM6 1;  5MLC 3;  3PIO 1;  5GAE c;  4WFN 1;  4V19 6;  5GAG c;  5JVG 1;  5H1S c; 
#chains in the Genus database with same CATH topology
 2XJT A;  4A3K L;  3JR7 A;  2WAQ P;  2L0Z A;  1RB9 A;  1BRF A;  3LWP B;  3S17 L;  5C44 L;  1P7P A;  4AR6 A;  3S14 L;  3GTO L;  1LKM A;  1DVB A;  3HOX L;  2EY4 E;  3GTG L;  3PKI A;  3HOZ L;  3S15 L;  2HVY C;  5MFZ A;  1QCV A;  1YK4 A;  5JVH 1;  1TWH L;  2Y0S P;  3HOW L;  3A44 A;  3HJY B;  1OWC A;  3H3V M;  5EIN C;  1R9T L;  1PZX A;  2CKA A;  4AHZ A;  3P8B A;  2RDV A;  6RXN A;  2C6A A;  2M4Y A;  4LHL A;  1VZI A;  2M6P A;  1I6H L;  3LPE B;  1RYQ A;  4POF A;  1PFU A;  2V3B B;  5DM6 1;  1YUZ A;  4C2M 1;  1I3Q L;  1S30 A;  1NXE A;  4AI3 A;  4B8C D;  2JA8 L;  3HJW B;  2R92 L;  2WB1 P;  3LWV B;  2ZIX A;  2E2I L;  4XGH A;  1IU6 A;  1BQ9 A;  2R7Z L;  4A3E L;  4JAF A;  4Y7N L;  5GAE c;  1S24 A;  4GS7 D;  2E2H L;  1T9P A;  2M6O A;  1B13 A;  3CQZ L;  2BE5 D;  2APO B;  2AYJ A;  3LWR B;  1T9Q A;  2K2D A;  2M4V A;  2PSM C;  2NVQ L;  5IYD L;  4BY1 L;  4XXB B;  2PPT A;  4U67 1;  1ZRP A;  1IW7 D;  2E2J L;  1SFO L;  1R0J A;  3J7Y 1;  5EIO C;  4Y52 L;  1YV1 A;  4V19 6;  1BE7 A;  2XJP A;  5MGN A;  1SMM A;  4AI0 A;  2VL6 A;  1K83 L;  4BY7 L;  2PYA A;  2NVX L;  3H97 A;  3FDJ A;  4JAG A;  3FKI L;  3GTL L;  3KYW A;  2JI2 A;  1LKO A;  2PVE A;  4YWM A;  3S2D L;  3RZD L;  2RFK B;  2B5I D;  4G6B A;  3LWO B;  1H7V A;  3NFP I;  5GAG c;  4A3G L;  2JI3 A;  1Z92 B;  2VUM L;  3RZT A;  3S16 L;  4K9F A;  2Z3R B;  3K35 A;  5DM7 1;  2MS3 A;  1BFY A;  2C6B A;  3KYU A;  2J9U B;  4AR5 A;  1FHM A;  1RDG A;  3H9C A;  3RZO L;  3PIO 1;  5AI2 A;  3H9B A;  3GTK L;  3KYX A;  3WWN B;  2PMZ P;  1S2Z A;  2XJS A;  5AI3 A;  5IYB L;  1DX8 A;  2PVX A;  1PFV A;  1PFY A;  1VZG A;  3IU3 I;  5IP9 L;  3GTP L;  2A6H D;  2JA5 L;  2XJR A;  2A6E D;  1TWA L;  4A3I L;  2CR8 A;  2DSX A;  2JI1 A;  2LCQ A;  3MSU A;  3HOU L;  1R0H A;  2NYD A;  2XJU A;  4BBS L;  1Y1W L;  1SMW A;  4JAE A;  3PKJ A;  2CKC A;  3PZA A;  1RWD A;  3GTJ L;  1LTL A;  3S1N L;  1TWF L;  3LWQ B;  1I50 L;  4BXX L;  4X6A L;  4QIW P;  1VCX A;  1VZH A;  5MF6 A;  4AR3 A;  5FLM L;  2NVT L;  1JYB A;  3MPS A;  1IRN A;  4AR4 A;  4AI2 A;  3LNL A;  5C4X L;  1C09 A;  5MLC 3;  5FJ8 L;  1YK5 A;  4RXN A;  4AHX A;  3S1Q L;  3RZ6 A;  5IY0 A;  4ME3 A;  5IP7 L;  4JAD A;  5GAH c;  1QYB A;  3B0A B;  1Y1V L;  5H1S c;  2B63 L;  1RDV A;  3K7A L;  4E6Y A;  4BBR L;  1PFW A;  2HR5 A;  3PIP 1;  2R93 L;  4ZN3 B;  2JA6 L;  2XJQ A;  2AQC A;  1BQ8 A;  3GTQ L;  3H99 A;  2YU9 L;  2AUS B;  3HAX C;  3S1M L;  1NNQ A;  2H12 A;  4POG A;  4AI1 A;  5C3E L;  4A3L L;  3HOY L;  4A3B L;  4C3H L;  1NXG A;  5AN9 H;  2KN9 A;  2ERS A;  1B2O A;  1QQT A;  2ERJ A;  4A3D L;  5IYC L;  3M3Y L;  4A3J L;  1ODH A;  5GAD c;  4ZN1 B;  5M5Y L;  1CAD A;  1WJV A;  4LHN A;  1IRO A;  5M3F L;  1WCM L;  1TWC L;  3PO3 L;  5MFP A;  5RXN A;  1F4L A;  4TVM A;  3PO2 L;  1B71 A;  3WWL A;  1CAA A;  1IU5 A;  3VPB E;  2GMG A;  5K2M E;  2QL0 A;  3KYV A;  2A68 D;  3HOV L;  3P2A A;  1RYT A;  1SMU A;  1R0I A;  5JVG 1;  4TPU A;  2V0F A;  3SS2 A;  3H0G L;  3B08 B;  1FHH A;  1T9O A;  2XJV A;  3I4M L;  3PWF A;  2JA7 L;  2Z3Q B;  1R0F A;  4A93 L;  4A3C L;  8RXN A;  4A3M L;  1OWB A;  4C3J L;  4A3F L;  7RXN A;  2NVY L;  3M4O L;  4UY8 1;  3I4N L;  2KKD A;  3HKZ P;  3QVD A;  3MQK B;  3KYY A;  1LKP A;  3GTM L;  5M3M L;  1TWG L;  4AHW A;  1B2J A;  5C4J L;  4AYB P;  2V0E A;  4AHY A;  4C3I L;  1R0G A;  3S1R L;  3PL5 A;  5M5X L;  2O5J D;  5M5W L;  4YWL A;  1YUX A;  3ZG6 A;  2A69 D;  3J7Z 1;  3RYG A;  4WFN 1;  3S2H L;  3QQC E;  1E8J A; 
#chains in the Genus database with same CATH homology
 1VZG A;  2BE5 D;  2XJT A;  5AN9 H;  2KN9 A;  3IU3 I;  2AYJ A;  2ERS A;  1B2O A;  2ERJ A;  1T9Q A;  2K2D A;  2L0Z A;  2M4V A;  1RB9 A;  2PSM C;  1ODH A;  2A6H D;  5GAD c;  4ZN1 B;  2XJR A;  2A6E D;  1BRF A;  2CR8 A;  2DSX A;  4XXB B;  1CAD A;  2JI1 A;  2LCQ A;  4AR6 A;  1WJV A;  3MSU A;  1R0H A;  2NYD A;  4LHN A;  2PPT A;  1IRO A;  2XJU A;  1LKM A;  1SMW A;  4JAE A;  5MFP A;  5RXN A;  1DVB A;  4U67 1;  1ZRP A;  4TVM A;  1IW7 D;  3PKJ A;  2CKC A;  3PZA A;  1B71 A;  3WWL A;  3PKI A;  1RWD A;  1R0J A;  3J7Y 1;  1CAA A;  1IU5 A;  3VPB E;  1LTL A;  5EIO C;  2GMG A;  5MFZ A;  1YV1 A;  5K2M E;  1QCV A;  4V19 6;  2QL0 A;  1BE7 A;  1YK4 A;  2XJP A;  3KYV A;  5MGN A;  1SMM A;  5JVH 1;  2A68 D;  4AI0 A;  2VL6 A;  3P2A A;  1RYT A;  3A44 A;  1VCX A;  1VZH A;  1SMU A;  2PYA A;  1R0I A;  5MF6 A;  5JVG 1;  4TPU A;  1OWC A;  2V0F A;  4AR3 A;  5EIN C;  3SS2 A;  4JAG A;  1JYB A;  3MPS A;  3B08 B;  3KYW A;  2CKA A;  4AHZ A;  3P8B A;  1FHH A;  2JI2 A;  1IRN A;  2RDV A;  4AR4 A;  1T9O A;  4AI2 A;  1LKO A;  2C6A A;  2M4Y A;  2PVE A;  2XJV A;  3LNL A;  4LHL A;  4YWM A;  6RXN A;  1VZI A;  1C09 A;  3PWF A;  5MLC 3;  2Z3Q B;  2M6P A;  2B5I D;  1YK5 A;  4RXN A;  4G6B A;  4AHX A;  3RZ6 A;  5IY0 A;  1H7V A;  3LPE B;  4ME3 A;  1R0F A;  2PVX A;  3NFP I;  1RYQ A;  4POF A;  5GAG c;  4JAD A;  8RXN A;  2JI3 A;  1QYB A;  2V3B B;  5GAH c;  1OWB A;  3B0A B;  5DM6 1;  1Z92 B;  1YUZ A;  7RXN A;  5H1S c;  1S30 A;  3RZT A;  4UY8 1;  1NXE A;  1RDV A;  2KKD A;  3QVD A;  4AI3 A;  4B8C D;  4E6Y A;  3KYY A;  1LKP A;  4K9F A;  2Z3R B;  3K35 A;  2HR5 A;  3PIP 1;  5DM7 1;  4ZN3 B;  2MS3 A;  1BFY A;  2C6B A;  2XJQ A;  3KYU A;  4AHW A;  2J9U B;  4AR5 A;  1B2J A;  2ZIX A;  2V0E A;  4XGH A;  1FHM A;  1IU6 A;  1RDG A;  1BQ8 A;  4AHY A;  1R0G A;  1BQ9 A;  3PIO 1;  4JAF A;  2O5J D;  1NNQ A;  5AI2 A;  4YWL A;  2H12 A;  5GAE c;  1YUX A;  1S24 A;  3KYX A;  3ZG6 A;  3WWN B;  4AI1 A;  4POG A;  2XJS A;  1S2Z A;  2A69 D;  3J7Z 1;  4GS7 D;  5AI3 A;  1DX8 A;  1NXG A;  1T9P A;  2M6O A;  3RYG A;  4WFN 1;  1B13 A;  3QQC E;  1E8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...