3PIP3

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
b'THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pip300
5JVG3 5DM73 4WFN3 3PIP3 4U673 5DM63 3PIO3 5JVH3
chains in the Genus database with same CATH superfamily
1SMYC 2ZTEA 1UE6A 1PTOD 5A2QE 4BXXG 2R7ZB 1GD7A 1Y1WB 1PH3A 1ASYA 1UE5A 3J7YW 1PH7A 1WCMG 1V43A 4PZ8A 4LUZA 1VQ6A 1RTNA 4DAYB 2BOSA 4N8FA 4DV0Q 4DV7L 3FPPA 4J8QA 1B3QA 2A68D 1NTGA 3J7A5 3GTKB 3KLSX 1TWFB 4KTAA 1W3SA 5JJZA 1MD2D 1LT6D 1ICFB 1RKNA 1IBMQ 3JAMi 2SOBA 4L63B 3STBC 2LSSA 2OTJA 5C0XG 1H95A 3OOCA 3NPPA 2MFIA 4RH6A 4K5WA 4QCLA 3D4DA 4BBRB 2ATWA 3Q0AA 1OXUA 2PYKA 3VA5A 2F0HA 5IYDH 3D6WA 1Y14B 3H0GH 2OWOA 1NR2A 1L0XB 1KDCA 1PFNA 1PZID 1TIID 3VYUA 4MIUA 2MO1A 3EFXD 5K36G 1YNNC 1TT2A 3MFGA 4OEMB 1FNWA 2B2UA 1I6HH 4XYQA 4BY1H 1R4QB 4A3FB 1D5XC 3KF6A 2KJXA 5C4XB 3FKIB 3CPFA 1B70B 5CGKA 4R8NA 4JI7Q 2F0JA 5EPJA 4XYOA 4Y7NH 5ELBA 1JB3A 2F3IA 4JI6Q 3NXWA 2QCPX 2NZ1D 3T1YQ 4A3DG 2VB3X 5HGQA 3DXJC 4DV5L 1VQFA 3NBHB 4X3SA 3T13A 1WCMB 2PNHA 1ESRA 1G6ZA 1WTHA 1VQPA 3NTKA 1QUQB 3BG3A 1AE2A 4L5TA 1TQOA 1KL9A 4F8MA 1JE5A 1KNAA 1Q46A 4DR6L 3RZOB 3M4PA 4A93B 2NTTA 1VQDA 2F0VA 3DUZA 3K5NA 1OXSC 1S5FD 1ENCA 2K32A 3M85A 4DV0L 3HP3A 3W1BA 2K4KA 4J15A 2K5NA 1ESFA 4R8IA 4A3MG 2PI2E 4AH6A 2R93G 4EQPA 2EYMA 2B39A 1B53A 2HUGA 2KECA 2M9VA 1KLGD 4RCOA 5M5XH 1EFWA 1IL2A 1HXYD 2G9DA 4BY7G 1IBML 2G9HD 1UWVA 3J81i 4A3BH 3S2HB 1F9QA 1NSNS 1PTOH 3BDOA 4GS3A 1M8AA 1BOSA 3H6MA 3X3MA 1TWHB 4BBSH 3KLRA 2A8VA 3HKSA 3DWPA 1K3BC 2CVRA 3JC66 3U9SA 1DZ1A 2VW9A 3A74A 3S14B 2DGYA 4JI1L 2AMCB 3K57A 3AMUA 5FK9C 2D5DA 4RCNA 1SYFA 2Y0SG 4J6HA 4MTKA 5M5WH 2P5ZX 1G2TA 4CJ1B 3QJYA 2K6AA 4JI7L 2A69C 2E2IB 4UP9A 4A3DB 4JOIA 3VR3A 5JJKA 1KAAA 5FO7B 3CXCA 4KD3A 5J22A 3PUYA 4JI6L 5FO9B 3S1MH 1ZYRD 2ID0A 3IFDA 1Q8IA 2RSNA 5GAEC 5I6YA 2QA4A 3T1YL 1TY0A 2VUMG 3MXPA 5EPKA 5LMNQ 3EVQA 4NDXA 3MC0B 1V1PB 3K80C 3R3OA 5IYDG 1EY6A 3I2ZA 2CKZB 4X6AH 4OHJA 1IZ6A 1AEXA 1VQLA 4G57A 2VY3A 1X55A 3PO3H 1FD7D 1PYBA 5KNCA 5I9PA 2RHQB 2PQAB 1GUGA 3RZDH 2R93B 4BY1G 4J1MA 3GTJH 5TSSA 1ZEQX 1EWHA 1V8QA 2WB1E 2ZXPA 2EY5A 2V4DA 4C56C 4PMBA 2J0TD 4BY7B 4FXKC 2IL8A 1HUMA 2EYPA 4ZK9B 2RBMA 4Z9CB 2DN8A 1X3EA 4WORA 1II3A 1EZ8A 2JE6I 5CV6A 1QWYA 2N8NA 2L0CA 1Y8OB 5CBEE 5J39A 2SNSA 1TWAH 1KDBA 1J8IA 1GUOA 3HGBA 1G291 3HRZC 1H9SA 3MEHA 1K3RA 2N88A 3GV6A 3AU7A 1EY7A 1X32A 3SXHA 5BN3A 1EIGA 3OIQA 4DNRB 4R9WA 1N8RC 1E1TA 3AFQA 2F0WA 3KJOA 1H9RA 3ULLA 3PCOB 5DAUA 5JVG3 2VNUD 4JI5Q 1DONA 2FJ2A 3CCRA 4P74A 1JR0D 1HQRD 1SNOA 5F2DA 4ZAIA 4C3IH 3MXGA 4KHVA 3TP7A 1BUVT 1SMYD 2FXQA 4B3MQ 5EBCA 3ERSX 3K7AH 2NTSA 3PF4A 3CRLC 1IKMA 3H0GB 2F0KA 2L4NA 3M4QA 3M4YA 2HQEA 4FO2A 1HZBA 1DOMA 1YHBA 4A3BG 1HH2P 3CKIB 1IYUA 5KIXA 4HJ8A 5LMNL 1Y8PB 3AYHB 3HOUG 1I6HB 4R4IA 3PIOA 4DAMA 4BY1B 3CQZH 3SGIA 3K58A 3GTLH 3SEBA 1J6QA 1HNZQ 4C2MH 1HZ9A 1A63A 5CV7A 4FVMA 4Y7NB 2N3SA 4XIGS 2JA6H 2R61A 3KYHC 4UPAA 4HCEA 2KEDA 4B3RQ 1LO5D 4AYBE 1KC8C 2K04A 3ND8A 3STBD 1KDAA 2PI2A 4DR2Q 1SR3A 4RWSC 1PH9A 1F9RA 2D0OA 2KOLA 1BCPC 4KV6A 1RODA 4N9TA 3NWTA 1PTOC 1HA6A 5IODA 3K0YA 1SE3A 1GOZA 2IJ0A 3PMFA 3A8JE 3NHHA 2ES2A 4IPGA 4JK1C 3EROA 4YCWA 4POGA 3QO2A 2BDOA 1VMPA 1YNND 2EYLA 4C3HH 4WJ4A 3BZDB 5GQOA 5HGTA 1NNXA 3NK9A 3PO3G 2KHJA 3J80i 2WP8J 4K8JA 2ASBA 1SE4A 5EAYA 4MZ9A 1AE3A 1BBWA 1CA5A 1SMXA 2F0FA 1B1ZA 4QB4A 4N9PA 4KY6A 5M5XB 4JI5L 1Q1EA 3KDFA 2X69A 1PH8A 2HT1A 4HIKA 1VQOA 4IUPA 5FO8B 3J80E 1K8MA 1Y1WH 3AQQA 1BCPB 3HOVH 4A3BB 2FINB 3KK7A 4B3ML 1A2TA 1CHPD 4H02A 4L6TB 2ALYB 4ABNA 4GNXA 1ENAA 1Z9FA 2XWJB 3M7GA 4K6LA 1Q3LA 3U58A 3BVGA 3W5OA 1GM5A 4GN5A 1FL0A 4LAAA 5DM63 2SNMA 4IUVA 4ZKCB 4YWLA 3HOZH 1TVXA 4YHHL 2ZTDA 3QOJA 3VR2A 4RKBA 2AQ3B 1AZPA 4DAPA 5M5WB 4JV5Q 1HNZL 4PMWA 1S4ZA 1RD9D 1EQQA 1F77A 4KLKA 2JEBI 4B3RL 3MZ5A 3DLLA 1OTCA 3S1MB 4OO1I 1LT5D 4DR2L 3I4NH 2OT2A 5ELOA 4DF7A 4YCUA 4JBMA 2RVLA 1BXTA 3PQIA 4DV3Q 2NUCA 3FRPB 1PTOF 2FFKB 1XPRA 2F4VQ 1R9TH 4QL5A 1UEAB 4LJZC 2NVYH 5LL6S 1L0YB 2Z6KC 1SYGA 3PO3B 5IGBA 1QZGA 5E7NA 3SK5A 3AFPA 2KEEA 1N34Q 5FLXL 3RZDB 4ULLA 1WTOA 4JBKA 1OO9B 3GV3A 4C1NI 3PO2H 1Q90A 3GTJB 3KOJA 1N32Q 4IOCA 2WACA 2Q2TA 2A69D 2D2CC 3IAYA 1HFGA 4RFBA 1PH6A 4OIJA 1EY4A 4WJWA 3SHLA 4BXXH 3URYA 5GAHC 2IHFA 4LF6Q 1LT4D 4A3EH 5IP9H 5ELFA 1VQ4A 5KNBA 2HCIA 1HA5A 1XXGA 2L55A 1TWAB 4JI2Q 3LWEA 2IX0A 3R2IA 1CTMA 4CHTB 2GN5A 3BYTB 3FP9A 4MN3A 1B9MA 1A8VA 1FNUA 3PIP3 3MAQA 4L5SA 1CFMA 3UDFA 2NVQB 1EWIA 4U68A 5IYBH 4C3HG 1YI2A 1O7ZA 3QIAA 5G3LF 1EQTA 2K03A 4A3CH 1OXVA 1SE8A 4MNOA 3HZXA 5C0XH 3P1HA 3CW2C 4M8AA 4C3IB 4ZUJA 1SBBB 2JP1A 4JV5L 2BE5C 1CKMA 2F0DA 1VQAA 4ZRZA 1H9KA 1EFID 1LTBD 3K7AB 4XXEA 2CWPA 3Q6SA 4WRDA 2OF1A 4EX5A 3PUWA 3MTSA 2JJQA 3S1RH 1DOLA 1Y1VH 4G4KA 4CKCA 4DU9A 3HOVG 1SDFA 1I6VC 5C6AA 3E0EA 4H13C 3I56A 1VQKA 4DV3L 2K14A 2NB0A 4C3JH 2JA5G 4BA1I 2F4VL 1UEBA 4LF5Q 3CQZB 2XN9C 3GTLB 1JJCB 1VQCA 2BH2A 3SK4A 2MUYA 4IZ8A 1IBLQ 1W6KA 4C2MB 2LFNA 1HR0W 2F52A 2JA6B 3WWVA 1N34L 4A3JG 3HOZG 2PO4A 1WD1A 1CQFA 3HOYH 3M3YH 1CKNA 1B9NA 1N32L 3T1HQ 1STHA 2AUKA 1QZHA 1DOKA 5CORA 1DGSA 3DWAA 5C3EG 1CHQD 3HFZB 1WFQA 3J7AF 1LUZA 4LF6L 4F7XA 2L1BA 3I70A 4LWCA 5CV4A 1LTAD 3T51B 3K59A 1Q82C 3I4NG 5JVH3 3RN5A 1SYEA 3FVQA 4APVA 2DY8A 3TEHB 1EYCA 4JI2L 4C3HB 1ML0D 2E2HH 1PFBA 1K9MC 2NN6I 2E75C 2MGSA 2I5HA 4RKLA 3Q22A 4R4OA 4NPSA 4A3MH 2EYJA 2KHIA 4V190 3BZKA 2ZM6Q 1IL8A 1STGA 1E1OA 4QIWE 3CCLA 4WFN3 5CBAE 4TKOB 4BY7H 2LXKA 1JQYD 1EL0A 1CUKA 1VQ8A 1XX8A 4NXNQ 4KI0A 4JI0Q 1PV4A 1I5FA 2DUDA 2Q2IA 1BCPD 5AJ3L 4LFAQ 4JI8Q 1PYWD 1MSGA 3VDYA 1V1OA 2JK8A 2Z4HA 4LF7Q 3HOVB 1GJXA 2OEOA 1YJWA 4QGUA 1GVPA 2Z8LA 4YIJA 4A3EG 5IP9G 1YVCA 2EE1A 1IBKQ 3C3LA 1CSPA 3ITPA 4RGOS 1GHJA 3OWFA 5FLMH 1SNMA 4UAIA 1XJVA 2PW7A 2EJMA 1E7ZA 4KK7A 1A6XA 4X66Q 2B2UC 4GOPC 3BVMA 4XT1B 3HOZB 1D7QA 2QDLA 1SYDA 4DAYA 1CT1D 1L1OA 3R93A 5IYBG 4LF5L 2R7FA 4P75A 3T56B 1SJHD 2QF7A 1KHIA 3F2UA 1IBLL 5T1IA 2EDGA 4A3CG 4FXGC 5JOBA 5CV8A 4IUUA 3LWUA 4DXFA 1CQVA 2I46A 4ZCKA 1Q81C 2VUMH 2K5VA 5DM73 3Q8DA 3T1HL 3I4NB 4GN3B 2D0PA 3OYYA 5EPLA 4JYAQ 2A74C 2K01A 4AIMA 4O0AA 2N49A 4R4QA 3H3VI 1QCBD 4L5RC 5G3LD 1R9TB 2HQLA 2IT1A 1BVSA 4OO1G 1Y1VG 2NVYB 2Z1CA 3HKZB 3SE0A 1XYIA 4Y52H 1M90C 1DYQA 4ZYSA 1DXMA 4OL7A 3GTPH 4NXMQ 1LM0A 2AQ2B 1FGBD 3V2TA 4C3JG 3PO2B 1I50H 1WVLA 4GOPB 1MKHA 3UE1A 3J80c 1Q86C 3KF6B 2KQ3A 2ZM6L 3U9OA 4XTCS 4B3SQ 3GDEA 1EU4A 1KAWA 1STEA 1RIPA 1DJRD 3CD6A 3OSOA 3HOYG 5CC4A 4NXNL 1R4PB 3I91A 5JPMC 2DNEA 4A3EB 4JI0L 1O7LA 4K5VA 4DR4Q 2RKSA 3CC2A 1YJ9A 3H94A 3I8ZA 4LFAL 4JI8L 1LTTD 3A54A 4HN7A 1I4PA 2WKDA 1SNDA 5ELDA 4LF7L 3A8KE 3NBHA 4RA8A 1FGUA 3MHBA 1XTCD 3NQIA 1X3QA 1JOQA 1IBKL 2HD3A 3TS2A 5DLQE 3RMHA 3VR6A 1EYGA 5K5PA 1E2WA 2AHOB 4X66L 4IFDI 1MHWC 2CW0C 3TP6A 1WTRA 1GUWA 3EJIA 1VQBA 2K5DA 4KMUC 2RDGA 4TQUS 4RGMA 1Q1BA 2FHTA 2F0UA 2RCFA 4JOIC 3ER0A 5AFWA 3G6EA 1QVGA 1I4HA 3F8TA 1LV9A 3NE5B 5I2YA 3S16H 1KRSA 1UE7A 2EJGC 4IALA 3S1RB 1Y1VB 4C1NK 3HOUH 2AUJD 3L0OA 4FF4A 2UUCQ 1M1KC 1GHKA 4JYAL 3F2BA 2UXDQ 1IKLA 2Z6BA 4JVZA 4DV1Q 1VCIA 4C3JB 1BBUA 3H3VH 5FLMG 5EKKA 5EKLA 2WAQE 4A75A 3F1ZA 2Z0SA 2R7DA 2GVAA 4DV2Q 4DV6Q 3GP7A 3UE0A 4NXML 2E74C 2XRSD 1JE4A 3HOYB 3M3YB 1IXRA 2BE5D 4F87A 1VDZA 4FXDA 1EQVA 4IPCA 4RGTA 1TWCH 4CBVA 1SRUA 1C8CA 4B3SL 1J5EQ 4MHEA 1SJED 1F2ZA 3TDQA 5JEAJ 3JAML 3TN2A 1IW7C 2O2LD 1JOOA 3I55A 3I73A 1KD1C 1MIUA 4DKAC 4DR4L 3KBGA 3VYRA 3OW7A 5EGTA 4DA2A 1D8LA 1VQJA 4A3IG 2JA8G 1ILQA 5CV5A 4GN4B 1PXUA 2E2HB 3H15A 4JI4Q 2Q8RE 4IOAA 1LTID 3S1QH 1SXTA 3G6JB 4A3MB 2F1MA 1I3QH 2A1AA 4FNFA 2O4XA 4IPHA 1UE1A 3QR8A 1XNQQ 1AZQA 4HJAA 4H44C 3UDGA 2NN6G 2PQAA 4IUTA 4XQQA 3HG9A 4IFDH 2L12A 2JYOA 3D4WA 1S40A 2ZJQA 5A35A 4JI3Q 1RTOA 1PMRA 4OWXB 1H9MA 3OMGA 3I4MH 1CZWA 2A5HA 4KN7C 1HRJA 5LMNW 2CQOA 1YEZA 3OTOQ 1PFSA 2A6HC 1HTPA 1G8ZD 3S24A 1B44D 4A3KH 2NVQH 2EY2A 1QVCA 2EYFA 2UUCL 3RLFA 2UU9Q 3N6RA 3OHXC 2Y0SB 4A3GG 4L8JA 2E76C 4OELB 4DV1L 4O42A 5M5YH 4CGYB 2B2TA 2B63G 3DHQA 4LF4Q 1X54A 2F0GA 5BN4A 1LABA 2WINB 4DV2L 4O2DA 4DV6L 2LXJA 1M4VA 2UUBQ 4JC0A 3RLOA 2VUMB 3PSIA 4KKTA 5IT9L 4BWGB 1U9RA 1O7IA 4CDCC 4NW2A 1J5EL 2RHSB 2F3VA 4DK1A 3K5OA 3VR4A 1EY5A 3NBIA 5LL6X 4QJFA 1IYJB 2IY5B 3J81L 1E2ZA 1U5KA 3WOFA 2PMZB 4HIDA 3BJUA 2KCNA 1JB7A 2EOTA 1B3AA 4S3SA 2VXWA 3P7JA 1MJEA 3GTPB 4LUVA 2B2YA 2NVXH 4JI4L 1I50B 2PZTA 2CH4W 2LKVA 3PIO3 1A15A 3I4LA 3PUXA 3LGJA 1T5EA 1KABA 1AFPA 3VYTA 1PRTB 4CKEA 5IIFA 1MSHA 2F0EA 1UAPA 4F88A 1N33Q 2OXPA 3D8GA 1XNQL 4KHPQ 2KA7A 3NTIA 3K6OA 4HTHA 4QF4A 4I65A 5D65A 4GKJQ 4JI3L 1NMGA 2WB1G 5FLXE 3PUZA 2XGTA 3TP5A 3NQTA 2RSOA 3TZUA 2Z4IA 3H3VC 2BH8A 1NY4A 3CPWA 4HJ5A 3QG1A 5E4XA 4E6IA 4HSVA 1SNPA 3OTOL 3TZDA 3O13A 5IY0A 3PUVA 1G51A 4X64Q 4P71A 2K75A 4UP8A 1EY9A 1LTGD 2UU9L 1B2TA 3CMEA 4DR3Q 3F2CA 3MXNA 3A7AB 4ME3A 3BZCA 3CCEA 1HNWQ 3ZJYC 1DM0B 2K5HA 3S17B 5ISRA 4HAEA 2PZWA 1Y69U 1L0WA 4O1NA 4X62Q 3NELA 5KNDA 2F0SA 4LF4L 1EU3A 1YJNA 1EYDA 2M00A 4IFDG 2VZAA 2UUBL 3KBXA 4GLXA 3DM1A 1JC7A 2JSOA 3S16B 4EQNA 1Z7TA 1YHQA 1J9OA 3KDFB 4JG2A 2NZHA 2B2VC 1XTDA 1N9WA 2HIVA 3HOUB 1RJTA 2E8GA 1P16A 3I4MG 1I94Q 2JA5H 2EXDA 4JW0A 2JXMB 2EYHA 2R92H 2B2WC 1YHAA 3M9BA 1A3VA 4A3JH 3L2PA 4A3KG 1BF4A 1QB5D 1X6OA 4DNIA 4Q0FA 5FJ8H 2CW0D 3KF8B 4NKLA 3CMAA 2XIWA 3FMCA 2RQXA 4XQNA 2F0MA 4HMJA 1HTLD 1GKHA 1RCVD 3HEJA 5C3EH 3QB3A 1EIFA 2CHBD 1W6JA 3W2DA 3ICEA 3ND9A 1TWCB 1F2LA 2WB1B 1U4PA 1N33L 2QKIC 5E4WC 4KHPL 5C3XA 2V1CC 3TBIB 4RHSA 1HZCA 4K2LA 1S5ED 4FP5D 3L7ZC 3A5ZB 1BCPF 1YIJA 2K33A 4AYBG 4DGZA 4GKJL 1F2YA 4EQOA 3MFYA 4GLVB 1YBYA 3Q24A 2VS1A 3HOWG 1VMCA 4Q5VA 1K0SA 3S1QB 3D0FA 1STAA 3R8BA 2CH4A 3DMUA 1I3QB 1H9JA 2YTYA 4G7ZC 4RGNA 3F2DA 2F0OA 3CHBD 3W3AA 4X64L 4G7OC 3CCQA 1XMQQ 3MVVA 2UUAQ 1NJIC 5KGUA 2X6LA 1HNWL 3GTQH 1G91A 2XNAC 4G7HC 1JCKB 1Z6HA 1SFOH 3K8AA 4IJLA 3SK8A 4X62L 1ET9A 3D6CA 1IW7D 4HCSA 3I4MB 1EUJA 3P75A 3KJPA 1EOVA 5ELEA 2F0QA 3ULJA 1EIYB 4LUOA 2F0NA 3CF5A 3DWQA 1TXYA 1WD0A 3I72A 5C44H 2C5CA 3A8IE 4A3KB 1WTPA 2QEXA 5JJLA 4DUZQ 1EEFD 3FEWX 3HKZE 4HEDA 4KHZA 3DEPA 2FMCA 2WFWA 5M5YB 2F0LA 4OONA 3KUPA 2X6GA 1K83H 1XPOA 4LK1C 4KY5A 1XNRQ 4DV4Q 1S5BD 5IGGA 4OX9Q 1FVIA 4DR1Q 1WJJA 2GVBA 1CM9A 1LTLA 3M4OH 1GUSA 1TY2A 3V05A 3OW2A 2JA7H 4HR7B 2KENA 1VF7A 1TS5A 2A19A 5CMDA 3TREA 4P72A 1LTRD 4OO1H 3IFTA 1A3UA 1CZGA 3E6ZX 1WTWA 1VQEA 2A6HD 2EIFA 3CCJA 1HHVA 3VA7A 2D9UA 4NB3A 1AP0A 2VQFQ 1A62A 1U4RA 2F03A 2PCFB 3U4ZA 2R92G 4JBJA 2NVXB 1PRTD 3OPOA 5L37A 5IOCA 5JAVA 2R7ZG 1GXDC 2K5WA 2OQ0A 4HJ9A 5FJ8G 2R3ZA 4HJ7A 1ILPA 5C4ZA 1K28A 4LW1A 5DEHA 2WIIB 1X9NA 4IUQA 1XMQL 3C1EA 1MBYA 2UUAL 2Q2HA 1TS3A 1Z47A 4PG3A 4XT3B 4A76A 1UNSA 2HIXA 3G4SA 3BS1A 1JJGA 4R4CA 1PH1A 5NUCA 1QILA 4ID6A 3GTMH 5C4HA 1SEBD 2N55A 3PV0A 5IYCG 3GD7A 4DPGA 2A6EC 4KN4C 1NE3A 5HY6A 2SDFA 3OWEB 2XRQD 5M3MH 1WTQA 1TS2A 2FMMA 3S15H 4AQYQ 4YWMA 2K7VA 3BDLA 1F9SA 1K73C 4DUZL 3I3CA 1FYCA 3GO5A 4KJNA 1KXLA 4X65Q 1LTSD 2ZJRA 2KBNA 1TU2B 2C9OA 5KRUA 3Q23A 1TR5A 2JEAI 2EYOA 1PH5A 1XNRL 3UDXA 4DV4L 4CJ2C 2AKWB 4LNQA 2DY7A 4DR1L 4JBWA 3FPUB 5FKAC 3RLNA 1X3FA 5JEAG 3RD4A 1P8LA 1EEID 1U4MA 2ZXRA 4ZQ3A 2JA5B 3E5SA 2EY6A 4CKBA 5ELNA 2MJ8A 1BR9A 2XWBB 2YV5A 4H0LC 3RNUA 1X3PA 2R92B 1B7YB 4OXPA 5C44G 3CCVA 4A3JB 4DR6Q 1TKWB 3FHWA 2VQFL 3B6YA 1U0LA 4IN3A 1C4QA 2IW3A 2H4OA 3L9AX 4PZ7A 1T9HA 3U50C 1PH2A 1NR4A 5FLXc 4K6DA 5C3EB 3AB9A 1KIXA 4FYDA 1L1OB 3TSSA 1STBA 1YNJC 3MA2B 4A93G 4P73A 1WYDA 2UXBQ 4FF2A 3HS0C 3UDIA 2L5TA 3E3XA 4RG1A 3TRZA 3K0XA 2JA7G 4A3IH 2JA8H 2BA0A 3K81C 4P2CB 2Z9HA 4A3LG 1K0RA 1SAPA 4MTNA 5BR8Q 5EQ0A 4EQ5A 3SVMA 4V0BA 1ASZA 1FJGQ 3HOXH 3OMCA 4GLAC 4DUYQ 1HQMC 1JWMD 4R4TA 4A4IA 2NZOA 5C4JB 2E2JH 1O7YA 2NN6H 2ICIA 2Y0SE 4NMZA 2K28A 4RHRA 1AN8A 3JAME 4YWKA 4AQYL 4KD4A 3ERQA 4JI1Q 1ONLA 4DN4M 1STNA 3CP0A 4X65L 4GOPA 3GTQB 5GROA 1JWSD 1ICWA 5GAGC 4XQJA 1SFOB 4HSPA 4TRDA 3BVZA 4GKKQ 1HNXQ 3FDTA 2VB2X 5CYUA 3J7AV 1OXTA 3EA6A 1XMOQ 1FR3A 3WOEA 1JT8A 1K8OA 1RL2A 3I90A 5I2XA 1QNUA 4A3GH 5I9OA 3GTGH 4JCVE 5C44B 4DAVA 4UDUC 1QUQA 3D4RA 2PMZE 1EYAA 3MXUA 3D31A 1B4OA 2B63H 2WV6D 1V9PA 3GTOH 5M3MG 5IGDA 3LX0A 3TQYA 1B50A 2RDFA 2KUMA 1E0BA 1K83B 2C35B 1EWCA 4U673 2E2DC 3RUZA 3S17H 5A2QL 3RR5A 4DK6C 3M4OB 5KYIA 1W2BA 2JA7B 4M1UB 2A73B 2G5DA 1A0IA 2EVBA 5HURA 2H1EA 2I07B 2B3GA 4TSSA 1X65A 1C7YA 2UXBL 4K8IA 3A5UA 1CSQA 2B8GA 1I4QA 5LMUQ 5M9OA 2BDNA 2M2LA 1VQGA 1K8GA 4PNYA 5BR8L 5I6WA 2K1BA 1FJGL 4DUYL 3E9IA 5M3FH 5IT9E 1KLUD 2PPBC 2HHHQ 1BO0A 1YITA 1TS4A 2ZTCA 4B3TQ 3ULPA 3TMEA 3S2DH 1VF5C 2K05A 5D14A 1SE2A 3C2PA 2MQHA 1E2VA 3J81E 4X3KA 4QIWB 3TP8A 1CKOA 4UHVA 1SLJA 3BU2A 4ZLTF 1BDOA 1ZKOA 5EBDA 4NP5A 4QUCA 5CV9A 1VQ5A 4GKKL 4KJOA 3NP8A 1HNXL 1PFMA 1XMOL 1XPUA 1PHJA 1LLRD 5IGCA 3GTMB 2WKCA 1V1PA 2EY1A 2QW7A 1T5XD 5M3MB 4PZ6A 1KRTA 1D1IA 3HOXG 1WTXA 2EZVA 3S15B 2ZXOA 3A55A 5J3BA 3KLWA 1BQQT 4B9WA 3H0GG 3PF5A 4IPDA 1QE6A 2B2TC 4ILWA 4DR7Q 3GQBA 3MWYW 3C1FA 2Q8IB 1NAPA 2Q8TA 2XVSA 1AH9A 2O5JC 3G7LA 2GA4B 4JPBW 2HDLA 2XSCA 2R6GA 2KCTA 5T1GA 1KTKA 5C0XJ 1A3TA 3CAMA 2AWOA 3S1NH 2QILA 2NYZD 1HJPA 4PV1C 2A6ED 4CDDC 1D6EC 1KQSA 2UXDL 4IQZA 5LMUL 1H9SB 2CQAA 1I4GA 2NVTH 5BN5A 4FDBA 1PRTC 4B08A 1HPCA 2B2YC 3PGZA 2L11A 5D3DA 1LACA 4XDXA 5IWAQ 1WOCA 1RF2D 1D2BA 2MNAA 2HHHL 4DR5Q 1NBWA 1ZXTA 2I5MX 2EQSA 2ZT9C 3I4OA 4X3UA 1BBXC 4B3TL 2WAQG 4KKUA 1SYCA 2QDBA 3QOLA 3ZYYX 1YZ6A 4QUFA 4K14A 1Q7YC 4A3IB 2O5IC 2JA8B 3AEVA 4TVAB 3J7ZC 4B9XA 5KYLA 3BDCA 1NUCA 4LF8Q 3HOWH 1VQMA 5EKIA 1U4LA 1IYVA 3EQLC 3NSWA 2I5LX 2BCOA 5KEEA 3HOXB 1PZKD 1VQHA 3EBEA 3MEFA 3T16A 2ENBA 1PDQA 3A7LA 2E2JB 2YTVA 2TSSA 4OWWB 4YY3Q 2DNCA 2QGQA 5COYA 4GZYC 1WI5A 1SSOA 5M3FG 1D1KA 2MO0A 1TWGH 2YTXA 1F2MA 3W1GA 1K8AC 4YHHQ 1YNJD 4CJ0B 1C48A 4BBSG 3UI2A 3LNNA 1JWUD 3E0JA 1QNKA 4DR7L 3TS0A 2YU9H 1E22A 4DK0A 3I7FA 4IO9A 3K7UC 3EN2A 3H91A 4GNXC 4R1JA 2CFMA 2IPKD 5JPNC 4A3GB 3GTGB 3NWSA 1QJOA 5C3WA 2K5QA 1GUTA 2EJFC 4HIOA 3KFUA 1X56A 3X3NA 1RDPD 2KCMA 5D3IB 2B63B 4LF9Q 3GTOB 4FF3A 3V96A 1L2FA 1Q8KA 4QMGA 5CR3A 3BYYB 2VQEQ 2J7ZA 3NEMA 4DNTB 5IP7H 2WAQB 3DEOA 1PRTF 3CC7A 1QOHA 3MXNB 4I7AA 2A68C 5IWAL 4OWTB 1JJ2A 3NTHA 1C9OA 1MI2A 5IE8A 4DR5L 3D3RA 1EOTA 2F0TA 1EIHA 1D5ZC 1CA6A 3VR5A 2EPBA 3E9HA 3JAMc 2JQOA 3IL8A 2ZJPA 4GNXB 1GO3E 4LF8L 2YYZA 1C0AA 1VS0A 2R7ZH 1IHZA 3DM3A 4YCVA 1PTOB 3P20A 5M3FB 2XTIA 1MGSA 2DJFC 2RCNA 1LT3D 4BBSB 1N36Q 2F0IA 5ELCA 1S5CD 3S2DB 4YY3L 3KF8A 4ME5A 2RF4A 3GTKH 1G2SA 1TWFH 3U4VA 5C0XI 2KCCA 1NMFA 2CCZA 1SNCA 1GUNA 1RHPA 4L5QA 4N8X1 3S9WA 3RN2A 1A2UA 2L9HA 3T4AC 1G6PA 2B29A 5IYCH 5E1FA 4WJ3M 3WDNA 5H1SE 4IJHA 3N52A 3K5MA 1E3PA 4BBRH 4C3IG 3J81j 3M7NA 1S72A 4CDEC 2MP1A 5C4JH 5JJIA 2B2VA 4QQBX 2K50A 1HZAA 1PLFA 1HCZA 1Y8NB 2SEBD 3L3OC 3G48A 1X3GA 2AQ1B 4K2KA 4DFAA 4LMQD 4DK3C 4LF9L 1VQ7A 3ONAB 4DR3L 2B2WA 1JICA 1BKBA 2LMCB 3CRKC 2IWHA 1EY0A 4UY8C 3NENA 4A3FH 5C4XH 3FKIH 2J4XA 5C5LA 2VQEL 1JORA 5JEAH 4ZKBB 4PQXA 1SROA 1ENFA 1PZJD 2PNRC 3QWNA 4EVOA 2KVMA 1MJCA 1O80A 1B8AA 5IT9c 2AWNA 1NCVA 1QVFA 2JA6G 3S1NB 1D5MC 4HIMA 5IGEA 1PYSB 4QY7A 1I94L 2RDHA 1WCMH 4HMIA 1KNEA 2NVTB 1SN8A 4CDFC 3PIPA 3J81c 5C5MA 1HUNA 3SR1A 4LFCQ 2QEJC 4BS9A 1SYBA 1WTVA 3RZOH 5GADC 1F9PA 3C46A 2IX1A 4A93H 1EQRA 2Z6KA 1ET6A 1VQ9A 2DJGC 4K0KQ 4IUNA 4OIKA 3J80L 5E3FA 4BA2I 1EY8A 2UXCQ 1HFNA 2K52A 1N36L 2OTLA 5IP7G 2HCCA 4RAUC 1HR0Q 2I0QA 2JA9A 3IKJA 2L15A 1E24A 2PQEA 4A3LH 4AYBB 2E5LQ 2F4IA 2NBFA 4PMCA 1FNVA 2CWAA 1I4XA 4LFBQ 4OGQC 5AJ3Q 5J1ZA 1LYLA 3SDZA 3CCMA 3HOWB 4ZUIA 2PW5A 1Q12A 2VL6A 4H7BA 2F3WA 2PZUA 2NWGA 3K5LA 1DD2A 1ZYRC 2LS01 4UP7A 5FOBB 3S2HH 3CU7A 3NUCA 1PVOA 5K36H 3T53B 1JOKA 4KKSA 4DV7Q 2H5XA 1Y1WG 1PA6A 1TWHH 2RA4A 3A56A 5EJWA 1TWGB 4RMFA 2HDMA 3S14H 1QG7A 1CKNB 1YNXA 3KLSA 3R2TA 2YU9B 1VQNA 3IRBA 1BNZA 2OCEA 5LHY1 2LY7A 1CI3M 1VQIA 1AW7A 2E2IH 4A3DH 1EZ6A 3CCSA 1PH4A 4IURA 2IX3A 4IFDJ 1S5DD 2OQKA 2TMPA 4DXGA 5I4DA 1UUPA 3OIPA 2BA1A 4BBRG 4X3TA 3A0JA 1OXXK 2EXZA 4K5XA 1L1OC 3SK6A 3CCUA 3EIVA 2F0PA 2IHEA 5IGFA 1XWEA 1CK1A 4LFCL 1V1QA 2JN4A 4ALPA 4EGVA 1O78A 3CC4A 1DCZA 2MPMA 4OX9L 4K0KL 3HKZG 2MHVA 2R93H 4A3FG 5C4XG 1S3OA 3FKIG 2D62A 2KHSA 2UXCL 4KY7A 4ODGA 2Q2UA 1SNQA 1HR0L 3PO2G 1I4RA 5DNFA 2ICEC 3H09A 1STYA 2B8FA 4POFA 3VYSA 2E5LL 4DV5Q 2N78A 1JMCA 4FF1A 4I7ZC 3G71A 4LFBL
chains in the Genus database with same CATH topology
1SMYC 1PTOD 5A2QE 2R7ZB 1Y1WB 3J7YW 1V43A 1RTNA 2BOSA 3FPPA 4J8QA 2A68D 3GTKB 3KLSX 1TWFB 4KTAA 5JJZA 1MD2D 1LT6D 1RKNA 2SOBA 4L63B 5C0XG 3OOCA 3NPPA 4RH6A 4K5WA 4QCLA 3D4DA 4BBRB 3Q0AA 1OXUA 2PYKA 3VA5A 2F0HA 3D6WA 1NR2A 1L0XB 1KDCA 1PFNA 1PZID 1TIID 3VYUA 4MIUA 3EFXD 5K36G 1YNNC 1TT2A 3MFGA 1FNWA 2B2UA 4XYQA 1R4QB 4A3FB 1D5XC 5C4XB 2KJXA 3FKIB 5CGKA 4R8NA 2F0JA 5EPJA 4XYOA 5ELBA 1JB3A 3NXWA 2QCPX 2NZ1D 2VB3X 3DXJC 3T13A 4X3SA 1WCMB 1ESRA 1G6ZA 3NTKA 3BG3A 1TQOA 4F8MA 1KNAA 3RZOB 4A93B 2NTTA 2F0VA 3DUZA 3K5NA 1OXSC 1S5FD 1ENCA 2K32A 3M85A 3HP3A 1ESFA 4R8IA 4EQPA 2EYMA 2B39A 1B53A 2HUGA 2KECA 2M9VA 1KLGD 4RCOA 1HXYD 2G9DA 2G9HD 3S2HB 1F9QA 1NSNS 1PTOH 3BDOA 1M8AA 1BOSA 3H6MA 3X3MA 1TWHB 3KLRA 3DWPA 2CVRA 3U9SA 1DZ1A 3S14B 3K57A 3AMUA 5FK9C 2D5DA 4RCNA 1SYFA 4J6HA 1G2TA 4CJ1B 3QJYA 2K6AA 2A69C 2E2IB 4A3DB 3VR3A 1KAAA 5FO7B 4KD3A 5J22A 3PUYA 5FO9B 1ZYRD 2ID0A 3IFDA 1Q8IA 2RSNA 5I6YA 1TY0A 3MXPA 5EPKA 3EVQA 4NDXA 3MC0B 1V1PB 3R3OA 1EY6A 4OHJA 1AEXA 4G57A 1FD7D 5KNCA 5I9PA 1GUGA 2R93B 4J1MA 5TSSA 1ZEQX 1EWHA 1V8QA 2ZXPA 2EY5A 2V4DA 4C56C 4PMBA 2J0TD 4BY7B 4FXKC 2IL8A 1HUMA 2EYPA 4ZK9B 2RBMA 4Z9CB 2DN8A 4WORA 1II3A 1EZ8A 2JE6I 5CV6A 1QWYA 2L0CA 1Y8OB 5CBEE 5J39A 2SNSA 1KDBA 1J8IA 1GUOA 3HGBA 1G291 3HRZC 1H9SA 3MEHA 2N88A 3GV6A 3AU7A 1EY7A 1X32A 3SXHA 5BN3A 1EIGA 3OIQA 4DNRB 4R9WA 2F0WA 1H9RA 5DAUA 5JVG3 2VNUD 1DONA 2FJ2A 1JR0D 1HQRD 1SNOA 5F2DA 4ZAIA 3MXGA 4KHVA 3TP7A 1BUVT 1SMYD 5EBCA 2NTSA 3CRLC 1IKMA 3H0GB 2F0KA 2L4NA 3M4YA 2HQEA 4FO2A 1DOMA 3CKIB 1IYUA 5KIXA 1Y8PB 1I6HB 4BY1B 3K58A 3SEBA 5CV7A 4FVMA 4Y7NB 4XIGS 2R61A 4HCEA 2KEDA 1LO5D 2K04A 3ND8A 1KDAA 4RWSC 1F9RA 2KOLA 1BCPC 4KV6A 1RODA 4N9TA 3NWTA 1PTOC 1HA6A 5IODA 3K0YA 1SE3A 1GOZA 2IJ0A 3PMFA 3A8JE 3NHHA 4JK1C 3EROA 3QO2A 2BDOA 1VMPA 1YNND 2EYLA 3BZDB 5HGTA 3NK9A 2WP8J 4K8JA 1SE4A 1CA5A 2F0FA 1B1ZA 4QB4A 4N9PA 4KY6A 5M5XB 1Q1EA 2X69A 4IUPA 5FO8B 3J80E 1K8MA 4A3BB 1BCPB 2FINB 3KK7A 1A2TA 1CHPD 4L6TB 4ABNA 1ENAA 2XWJB 3M7GA 4K6LA 1Q3LA 3BVGA 4LAAA 5DM63 2SNMA 4IUVA 4ZKCB 1TVXA 3QOJA 3VR2A 4RKBA 2AQ3B 1AZPA 4DAPA 5M5WB 4PMWA 1S4ZA 1RD9D 1F77A 2JEBI 3MZ5A 3S1MB 4OO1I 1LT5D 2OT2A 4DF7A 2RVLA 1BXTA 2NUCA 3FRPB 1PTOF 2FFKB 1UEAB 4LJZC 5LL6S 1L0YB 1SYGA 3PO3B 5IGBA 3SK5A 2KEEA 5FLXL 3RZDB 4ULLA 1WTOA 1OO9B 3GV3A 4C1NI 1Q90A 3GTJB 2WACA 2A69D 2D2CC 3IAYA 1HFGA 4RFBA 4OIJA 1EY4A 4WJWA 3SHLA 3URYA 1LT4D 5ELFA 5KNBA 2HCIA 1HA5A 1XXGA 2L55A 1TWAB 3LWEA 2IX0A 3R2IA 1CTMA 4CHTB 3BYTB 4MN3A 1B9MA 1FNUA 3PIP3 3MAQA 1CFMA 2NVQB 4U68A 4C3HG 1O7ZA 3QIAA 5G3LF 1EQTA 2K03A 1OXVA 3HZXA 5C0XH 3P1HA 4M8AA 4C3IB 4ZUJA 1SBBB 2JP1A 2BE5C 2F0DA 4ZRZA 1H9KA 1EFID 1LTBD 3K7AB 4XXEA 3Q6SA 4WRDA 2OF1A 3PUWA 3MTSA 1DOLA 4G4KA 4CKCA 4DU9A 1SDFA 1I6VC 5C6AA 4H13C 2NB0A 4BA1I 3CQZB 2XN9C 3GTLB 3SK4A 2MUYA 4IZ8A 1W6KA 4C2MB 2LFNA 2JA6B 2PO4A 1WD1A 1CQFA 1B9NA 1STHA 2AUKA 1DOKA 5CORA 3DWAA 1CHQD 3J7AF 4F7XA 2L1BA 3I70A 5CV4A 3T51B 1LTAD 3K59A 5JVH3 1SYEA 3FVQA 2DY8A 1EYCA 4C3HB 1ML0D 1PFBA 2NN6I 2E75C 2MGSA 4RKLA 3Q22A 4V190 2EYJA 1IL8A 1STGA 4WFN3 5CBAE 4TKOB 1JQYD 1EL0A 1XX8A 4KI0A 1BCPD 1PYWD 1MSGA 1V1OA 2Z4HA 3HOVB 1GJXA 2OEOA 2Z8LA 4YIJA 2EE1A 3C3LA 3ITPA 4RGOS 1GHJA 3OWFA 1SNMA 4UAIA 2PW7A 2EJMA 4KK7A 1A6XA 2B2UC 3BVMA 4XT1B 3HOZB 1SYDA 4DAYA 1CT1D 3R93A 3T56B 1SJHD 2QF7A 3F2UA 5T1IA 2EDGA 4FXGC 5JOBA 5CV8A 4IUUA 3LWUA 4DXFA 1CQVA 2I46A 5DM73 3I4NB 5EPLA 2A74C 2K01A 1QCBD 5G3LD 1R9TB 4OO1G 2IT1A 2NVYB 2Z1CA 3HKZB 3SE0A 1XYIA 1DYQA 4ZYSA 1DXMA 4OL7A 2AQ2B 3V2TA 1FGBD 4C3JG 3PO2B 1WVLA 2KQ3A 3U9OA 4XTCS 1EU4A 1STEA 1DJRD 3OSOA 5CC4A 1R4PB 3I91A 5JPMC 2DNEA 4A3EB 1O7LA 4K5VA 2RKSA 3H94A 3I8ZA 1LTTD 3A54A 4HN7A 1I4PA 2WKDA 1SNDA 5ELDA 3A8KE 3NBHA 4RA8A 3MHBA 1XTCD 3NQIA 1X3QA 1JOQA 3RMHA 3VR6A 5K5PA 1E2WA 4IFDI 2CW0C 3TP6A 1WTRA 1GUWA 3EJIA 2K5DA 4KMUC 2RDGA 4TQUS 4RGMA 1Q1BA 2FHTA 2F0UA 5AFWA 1I4HA 3NE5B 1LV9A 5I2YA 2EJGC 4IALA 3S1RB 1Y1VB 4C1NK 2AUJD 4FF4A 1GHKA 1IKLA 1VCIA 4C3JB 5EKKA 5EKLA 3GP7A 2E74C 2XRSD 1JE4A 3HOYB 3M3YB 2BE5D 4F87A 1VDZA 4FXDA 1EQVA 4RGTA 4CBVA 1C8CA 4MHEA 1SJED 1F2ZA 3TDQA 5JEAJ 3JAML 3TN2A 1IW7C 2O2LD 1JOOA 3I73A 3KBGA 3VYRA 3OW7A 5EGTA 4DA2A 1ILQA 5CV5A 1PXUA 2E2HB 2Q8RE 1LTID 1SXTA 3G6JB 4A3MB 2F1MA 4FNFA 2O4XA 1AZQA 4H44C 2NN6G 4IUTA 4XQQA 3HG9A 4IFDH 2L12A 2JYOA 3D4WA 5A35A 1RTOA 1PMRA 1H9MA 3OMGA 1CZWA 2A5HA 4KN7C 1HRJA 2A6HC 1HTPA 1G8ZD 1B44D 2EY2A 2EYFA 3RLFA 3N6RA 3OHXC 2Y0SB 4L8JA 2E76C 4O42A 4CGYB 2B2TA 3DHQA 2F0GA 5BN4A 1LABA 2WINB 1M4VA 2VUMB 4KKTA 5IT9L 4BWGB 1U9RA 4NW2A 2F3VA 4DK1A 3K5OA 3VR4A 1EY5A 3NBIA 5LL6X 3J81L 1E2ZA 3WOFA 2PMZB 2KCNA 2EOTA 1B3AA 4S3SA 2VXWA 3P7JA 3GTPB 2B2YA 1I50B 2PZTA 2LKVA 3PIO3 1A15A 3I4LA 3PUXA 1T5EA 1KABA 1AFPA 3VYTA 1PRTB 4CKEA 5IIFA 1MSHA 2F0EA 1UAPA 4F88A 2OXPA 3D8GA 2KA7A 3NTIA 3K6OA 4HTHA 4QF4A 4I65A 5D65A 5FLXE 3PUZA 3TP5A 3NQTA 2RSOA 3TZUA 2Z4IA 3H3VC 3QG1A 5E4XA 4E6IA 4HSVA 1SNPA 3TZDA 3O13A 3PUVA 1EY9A 1LTGD 1B2TA 3MXNA 3A7AB 1DM0B 3S17B 5ISRA 4HAEA 2PZWA 1Y69U 4O1NA 5KNDA 2F0SA 1EU3A 1EYDA 2M00A 4IFDG 3KBXA 3DM1A 1JC7A 2JSOA 3S16B 4EQNA 1Z7TA 1J9OA 2B2VC 3HOUB 1RJTA 2JXMB 2EYHA 2B2WC 1A3VA 1BF4A 1QB5D 4Q0FA 2CW0D 4NKLA 2XIWA 3FMCA 2RQXA 4XQNA 2F0MA 4HMJA 1HTLD 1RCVD 3HEJA 3QB3A 2CHBD 1W6JA 3W2DA 3ND9A 1TWCB 1F2LA 2WB1B 1U4PA 2QKIC 5E4WC 5C3XA 3TBIB 4RHSA 4K2LA 1S5ED 4FP5D 3L7ZC 1BCPF 2K33A 4DGZA 1F2YA 4EQOA 3MFYA 3Q24A 1VMCA 4Q5VA 3S1QB 1STAA 3R8BA 3DMUA 1I3QB 1H9JA 4G7ZC 4RGNA 2F0OA 3CHBD 3W3AA 4G7OC 3MVVA 5KGUA 2X6LA 1G91A 2XNAC 4G7HC 1JCKB 1Z6HA 3SK8A 1ET9A 3D6CA 1IW7D 4HCSA 3I4MB 3P75A 5ELEA 2F0QA 2F0NA 3DWQA 1WD0A 3I72A 2C5CA 3A8IE 4A3KB 1WTPA 1EEFD 3FEWX 4HEDA 4KHZA 3DEPA 2FMCA 5M5YB 2F0LA 3KUPA 2X6GA 4LK1C 4KY5A 1S5BD 5IGGA 1CM9A 1GUSA 1TY2A 3V05A 4HR7B 1VF7A 1TS5A 5CMDA 1LTRD 4OO1H 3IFTA 1A3UA 1CZGA 3E6ZX 1WTWA 2A6HD 1HHVA 3VA7A 2D9UA 1AP0A 1U4RA 2F03A 2PCFB 2NVXB 1PRTD 3OPOA 5IOCA 5JAVA 1GXDC 2K5WA 2R3ZA 1ILPA 5C4ZA 5DEHA 2WIIB 4IUQA 3C1EA 1MBYA 1TS3A 1Z47A 4XT3B 1UNSA 3BS1A 5NUCA 1QILA 4ID6A 5C4HA 1SEBD 2N55A 3PV0A 3GD7A 2A6EC 4KN4C 2SDFA 3OWEB 2XRQD 1WTQA 1TS2A 2FMMA 2K7VA 3BDLA 1F9SA 3I3CA 1FYCA 3GO5A 4KJNA 1LTSD 1TU2B 2C9OA 5KRUA 3Q23A 1TR5A 2JEAI 2EYOA 4CJ2C 2DY7A 4JBWA 3FPUB 5FKAC 5JEAG 3RD4A 1EEID 1U4MA 2ZXRA 4ZQ3A 2JA5B 3E5SA 2EY6A 4CKBA 2MJ8A 1BR9A 2XWBB 4H0LC 2R92B 1X3PA 4A3JB 1TKWB 4IN3A 1C4QA 2IW3A 2H4OA 3L9AX 1NR4A 4K6DA 5C3EB 3AB9A 4FYDA 3TSSA 1STBA 1YNJC 3MA2B 4FF2A 3HS0C 2L5TA 2BA0A 4P2CB 1SAPA 3SVMA 5EQ0A 4V0BA 3OMCA 1HQMC 1JWMD 5C4JB 1O7YA 2NN6H 2ICIA 4NMZA 2K28A 4RHRA 1AN8A 3JAME 4KD4A 3ERQA 1ONLA 4DN4M 1STNA 3GTQB 1JWSD 1ICWA 4XQJA 1SFOB 4HSPA 4TRDA 3BVZA 3FDTA 2VB2X 5CYUA 3J7AV 1OXTA 3EA6A 1FR3A 3WOEA 1K8OA 3I90A 5I2XA 1QNUA 5I9OA 5C44B 4DAVA 4UDUC 3D4RA 1EYAA 3MXUA 3D31A 1B4OA 2WV6D 5IGDA 3LX0A 1B50A 2RDFA 2KUMA 1E0BA 1K83B 1EWCA 4U673 2E2DC 3RUZA 5A2QL 3M4OB 5KYIA 2JA7B 4M1UB 2A73B 2EVBA 5HURA 2H1EA 2I07B 4TSSA 4K8IA 2B8GA 1I4QA 5M9OA 2BDNA 2M2LA 4PNYA 5I6WA 2K1BA 5IT9E 1KLUD 2PPBC 1BO0A 1TS4A 3TMEA 1VF5C 2K05A 5D14A 1SE2A 3C2PA 3J81E 1E2VA 4X3KA 4QIWB 3TP8A 4ZLTF 1BDOA 1ZKOA 5EBDA 4NP5A 4QUCA 5CV9A 4KJOA 3NP8A 1PFMA 1LLRD 5IGCA 3GTMB 2WKCA 1V1PA 2EY1A 1T5XD 5M3MB 1WTXA 1D1IA 3S15B 2EZVA 2ZXOA 3A55A 1BQQT 4B9WA 1QE6A 2B2TC 4ILWA 3GQBA 3MWYW 3C1FA 2Q8IB 1NAPA 2Q8TA 2XVSA 2O5JC 3G7LA 2GA4B 2HDLA 2XSCA 2R6GA 5T1GA 1KTKA 5C0XJ 1A3TA 2AWOA 2QILA 2NYZD 4PV1C 2A6ED 1D6EC 4IQZA 1H9SB 2CQAA 1I4GA 5BN5A 1PRTC 4B08A 1HPCA 2B2YC 2L11A 5D3DA 1LACA 4XDXA 1RF2D 1D2BA 1ZXTA 2ZT9C 4X3UA 1BBXC 4KKUA 1SYCA 2QDBA 3QOLA 3ZYYX 4QUFA 4K14A 4A3IB 2O5IC 2JA8B 4B9XA 5KYLA 3BDCA 1NUCA 5EKIA 1U4LA 1IYVA 3EQLC 3NSWA 2BCOA 5KEEA 3HOXB 1PZKD 3T16A 2ENBA 1PDQA 3A7LA 2E2JB 2TSSA 2DNCA 5COYA 4GZYC 1SSOA 1D1KA 1F2MA 1YNJD 4CJ0B 1C48A 3UI2A 3LNNA 1JWUD 3E0JA 1QNKA 4DK0A 3H91A 2IPKD 5JPNC 4A3GB 3GTGB 3NWSA 1QJOA 5C3WA 2K5QA 1GUTA 2EJFC 3X3NA 1RDPD 5D3IB 2B63B 3GTOB 4FF3A 3V96A 4QMGA 5CR3A 3BYYB 2J7ZA 4DNTB 2WAQB 3DEOA 1PRTF 1QOHA 2A68C 3NTHA 1MI2A 3D3RA 1EOTA 2F0TA 1EIHA 1D5ZC 1CA6A 3VR5A 2EPBA 3IL8A 2YYZA 1IHZA 1PTOB 3P20A 5M3FB 1MGSA 1LT3D 4BBSB 2F0IA 5ELCA 1S5CD 3S2DB 3KF8A 4ME5A 1G2SA 5C0XI 2KCCA 1SNCA 1GUNA 1RHPA 3S9WA 1A2UA 2L9HA 3T4AC 5E1FA 3WDNA 3N52A 3K5MA 4C3IG 3M7NA 2MP1A 2B2VA 1PLFA 1HCZA 1Y8NB 2SEBD 3L3OC 2AQ1B 4K2KA 4DFAA 4LMQD 3ONAB 2B2WA 1JICA 2LMCB 3CRKC 2IWHA 1EY0A 2J4XA 5C5LA 1JORA 5JEAH 4ZKBB 4PQXA 1ENFA 1PZJD 2PNRC 3QWNA 4EVOA 2KVMA 1O80A 2AWNA 1NCVA 3S1NB 1D5MC 5IGEA 2RDHA 4HMIA 1KNEA 2NVTB 5C5MA 1HUNA 3SR1A 2QEJC 4BS9A 1SYBA 1WTVA 1F9PA 3C46A 2IX1A 1ET6A 4IUNA 4OIKA 3J80L 5E3FA 4BA2I 1EY8A 1HFNA 2HCCA 4RAUC 3IKJA 2PQEA 4AYBB 2F4IA 2NBFA 4PMCA 1FNVA 1I4XA 4OGQC 5J1ZA 3HOWB 3SDZA 4ZUIA 2PW5A 1Q12A 4H7BA 2F3WA 2PZUA 2NWGA 3K5LA 1DD2A 1ZYRC 2LS01 5FOBB 3CU7A 3NUCA 5K36H 3T53B 1JOKA 4KKSA 2RA4A 3A56A 5EJWA 1TWGB 2HDMA 1QG7A 3KLSA 3R2TA 2YU9B 1BNZA 5LHY1 2LY7A 1CI3M 1AW7A 1EZ6A 4IURA 2IX3A 4IFDJ 1S5DD 2TMPA 4DXGA 5I4DA 1UUPA 3OIPA 2BA1A 4X3TA 1OXXK 2EXZA 4K5XA 3SK6A 2F0PA 5IGFA 1XWEA 1CK1A 4EGVA 1O78A 1DCZA 2MPMA 2MHVA 2D62A 2KHSA 4KY7A 4ODGA 1SNQA 1I4RA 5DNFA 2ICEC 3H09A 1STYA 2B8FA 3VYSA 4FF1A 4I7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVG 3;  5DM7 3;  4WFN 3;  3PIP 3;  4U67 3;  5DM6 3;  3PIO 3;  5JVH 3; 
#chains in the Genus database with same CATH topology
 1SMY C;  2ZTE A;  1UE6 A;  1PTO D;  5A2Q E;  4BXX G;  2R7Z B;  1GD7 A;  1Y1W B;  1PH3 A;  1ASY A;  1UE5 A;  3J7Y W;  1PH7 A;  1WCM G;  1V43 A;  4PZ8 A;  4LUZ A;  1VQ6 A;  1RTN A;  4DAY B;  2BOS A;  4N8F A;  4DV0 Q;  4DV7 L;  3FPP A;  4J8Q A;  1B3Q A;  2A68 D;  1NTG A;  3J7A 5;  3GTK B;  3KLS X;  1TWF B;  4KTA A;  1W3S A;  5JJZ A;  1MD2 D;  1LT6 D;  1ICF B;  1RKN A;  1IBM Q;  3JAM i;  2SOB A;  4L63 B;  3STB C;  2LSS A;  2OTJ A;  5C0X G;  1H95 A;  3OOC A;  3NPP A;  2MFI A;  4RH6 A;  4K5W A;  4QCL A;  3D4D A;  4BBR B;  2ATW A;  3Q0A A;  1OXU A;  2PYK A;  3VA5 A;  2F0H A;  5IYD H;  3D6W A;  1Y14 B;  3H0G H;  2OWO A;  1NR2 A;  1L0X B;  1KDC A;  1PFN A;  1PZI D;  1TII D;  3VYU A;  4MIU A;  2MO1 A;  3EFX D;  5K36 G;  1YNN C;  1TT2 A;  3MFG A;  4OEM B;  1FNW A;  2B2U A;  1I6H H;  4XYQ A;  4BY1 H;  1R4Q B;  4A3F B;  1D5X C;  3KF6 A;  2KJX A;  5C4X B;  3FKI B;  3CPF A;  1B70 B;  5CGK A;  4R8N A;  4JI7 Q;  2F0J A;  5EPJ A;  4XYO A;  4Y7N H;  5ELB A;  1JB3 A;  2F3I A;  4JI6 Q;  3NXW A;  2QCP X;  2NZ1 D;  3T1Y Q;  4A3D G;  2VB3 X;  5HGQ A;  3DXJ C;  4DV5 L;  1VQF A;  3NBH B;  4X3S A;  3T13 A;  1WCM B;  2PNH A;  1ESR A;  1G6Z A;  1WTH A;  1VQP A;  3NTK A;  1QUQ B;  3BG3 A;  1AE2 A;  4L5T A;  1TQO A;  1KL9 A;  4F8M A;  1JE5 A;  1KNA A;  1Q46 A;  4DR6 L;  3RZO B;  3M4P A;  4A93 B;  2NTT A;  1VQD A;  2F0V A;  3DUZ A;  3K5N A;  1OXS C;  1S5F D;  1ENC A;  2K32 A;  3M85 A;  4DV0 L;  3HP3 A;  3W1B A;  2K4K A;  4J15 A;  2K5N A;  1ESF A;  4R8I A;  4A3M G;  2PI2 E;  4AH6 A;  2R93 G;  4EQP A;  2EYM A;  2B39 A;  1B53 A;  2HUG A;  2KEC A;  2M9V A;  1KLG D;  4RCO A;  5M5X H;  1EFW A;  1IL2 A;  1HXY D;  2G9D A;  4BY7 G;  1IBM L;  2G9H D;  1UWV A;  3J81 i;  4A3B H;  3S2H B;  1F9Q A;  1NSN S;  1PTO H;  3BDO A;  4GS3 A;  1M8A A;  1BOS A;  3H6M A;  3X3M A;  1TWH B;  4BBS H;  3KLR A;  2A8V A;  3HKS A;  3DWP A;  1K3B C;  2CVR A;  3JC6 6;  3U9S A;  1DZ1 A;  2VW9 A;  3A74 A;  3S14 B;  2DGY A;  4JI1 L;  2AMC B;  3K57 A;  3AMU A;  5FK9 C;  2D5D A;  4RCN A;  1SYF A;  2Y0S G;  4J6H A;  4MTK A;  5M5W H;  2P5Z X;  1G2T A;  4CJ1 B;  3QJY A;  2K6A A;  4JI7 L;  2A69 C;  2E2I B;  4UP9 A;  4A3D B;  4JOI A;  3VR3 A;  5JJK A;  1KAA A;  5FO7 B;  3CXC A;  4KD3 A;  5J22 A;  3PUY A;  4JI6 L;  5FO9 B;  3S1M H;  1ZYR D;  2ID0 A;  3IFD A;  1Q8I A;  2RSN A;  5GAE C;  5I6Y A;  2QA4 A;  3T1Y L;  1TY0 A;  2VUM G;  3MXP A;  5EPK A;  5LMN Q;  3EVQ A;  4NDX A;  3MC0 B;  1V1P B;  3K80 C;  3R3O A;  5IYD G;  1EY6 A;  3I2Z A;  2CKZ B;  4X6A H;  4OHJ A;  1IZ6 A;  1AEX A;  1VQL A;  4G57 A;  2VY3 A;  1X55 A;  3PO3 H;  1FD7 D;  1PYB A;  5KNC A;  5I9P A;  2RHQ B;  2PQA B;  1GUG A;  3RZD H;  2R93 B;  4BY1 G;  4J1M A;  3GTJ H;  5TSS A;  1ZEQ X;  1EWH A;  1V8Q A;  2WB1 E;  2ZXP A;  2EY5 A;  2V4D A;  4C56 C;  4PMB A;  2J0T D;  4BY7 B;  4FXK C;  2IL8 A;  1HUM A;  2EYP A;  4ZK9 B;  2RBM A;  4Z9C B;  2DN8 A;  1X3E A;  4WOR A;  1II3 A;  1EZ8 A;  2JE6 I;  5CV6 A;  1QWY A;  2N8N A;  2L0C A;  1Y8O B;  5CBE E;  5J39 A;  2SNS A;  1TWA H;  1KDB A;  1J8I A;  1GUO A;  3HGB A;  1G29 1;  3HRZ C;  1H9S A;  3MEH A;  1K3R A;  2N88 A;  3GV6 A;  3AU7 A;  1EY7 A;  1X32 A;  3SXH A;  5BN3 A;  1EIG A;  3OIQ A;  4DNR B;  4R9W A;  1N8R C;  1E1T A;  3AFQ A;  2F0W A;  3KJO A;  1H9R A;  3ULL A;  3PCO B;  5DAU A;  5JVG 3;  2VNU D;  4JI5 Q;  1DON A;  2FJ2 A;  3CCR A;  4P74 A;  1JR0 D;  1HQR D;  1SNO A;  5F2D A;  4ZAI A;  4C3I H;  3MXG A;  4KHV A;  3TP7 A;  1BUV T;  1SMY D;  2FXQ A;  4B3M Q;  5EBC A;  3ERS X;  3K7A H;  2NTS A;  3PF4 A;  3CRL C;  1IKM A;  3H0G B;  2F0K A;  2L4N A;  3M4Q A;  3M4Y A;  2HQE A;  4FO2 A;  1HZB A;  1DOM A;  1YHB A;  4A3B G;  1HH2 P;  3CKI B;  1IYU A;  5KIX A;  4HJ8 A;  5LMN L;  1Y8P B;  3AYH B;  3HOU G;  1I6H B;  4R4I A;  3PIO A;  4DAM A;  4BY1 B;  3CQZ H;  3SGI A;  3K58 A;  3GTL H;  3SEB A;  1J6Q A;  1HNZ Q;  4C2M H;  1HZ9 A;  1A63 A;  5CV7 A;  4FVM A;  4Y7N B;  2N3S A;  4XIG S;  2JA6 H;  2R61 A;  3KYH C;  4UPA A;  4HCE A;  2KED A;  4B3R Q;  1LO5 D;  4AYB E;  1KC8 C;  2K04 A;  3ND8 A;  3STB D;  1KDA A;  2PI2 A;  4DR2 Q;  1SR3 A;  4RWS C;  1PH9 A;  1F9R A;  2D0O A;  2KOL A;  1BCP C;  4KV6 A;  1ROD A;  4N9T A;  3NWT A;  1PTO C;  1HA6 A;  5IOD A;  3K0Y A;  1SE3 A;  1GOZ A;  2IJ0 A;  3PMF A;  3A8J E;  3NHH A;  2ES2 A;  4IPG A;  4JK1 C;  3ERO A;  4YCW A;  4POG A;  3QO2 A;  2BDO A;  1VMP A;  1YNN D;  2EYL A;  4C3H H;  4WJ4 A;  3BZD B;  5GQO A;  5HGT A;  1NNX A;  3NK9 A;  3PO3 G;  2KHJ A;  3J80 i;  2WP8 J;  4K8J A;  2ASB A;  1SE4 A;  5EAY A;  4MZ9 A;  1AE3 A;  1BBW A;  1CA5 A;  1SMX A;  2F0F A;  1B1Z A;  4QB4 A;  4N9P A;  4KY6 A;  5M5X B;  4JI5 L;  1Q1E A;  3KDF A;  2X69 A;  1PH8 A;  2HT1 A;  4HIK A;  1VQO A;  4IUP A;  5FO8 B;  3J80 E;  1K8M A;  1Y1W H;  3AQQ A;  1BCP B;  3HOV H;  4A3B B;  2FIN B;  3KK7 A;  4B3M L;  1A2T A;  1CHP D;  4H02 A;  4L6T B;  2ALY B;  4ABN A;  4GNX A;  1ENA A;  1Z9F A;  2XWJ B;  3M7G A;  4K6L A;  1Q3L A;  3U58 A;  3BVG A;  3W5O A;  1GM5 A;  4GN5 A;  1FL0 A;  4LAA A;  5DM6 3;  2SNM A;  4IUV A;  4ZKC B;  4YWL A;  3HOZ H;  1TVX A;  4YHH L;  2ZTD A;  3QOJ A;  3VR2 A;  4RKB A;  2AQ3 B;  1AZP A;  4DAP A;  5M5W B;  4JV5 Q;  1HNZ L;  4PMW A;  1S4Z A;  1RD9 D;  1EQQ A;  1F77 A;  4KLK A;  2JEB I;  4B3R L;  3MZ5 A;  3DLL A;  1OTC A;  3S1M B;  4OO1 I;  1LT5 D;  4DR2 L;  3I4N H;  2OT2 A;  5ELO A;  4DF7 A;  4YCU A;  4JBM A;  2RVL A;  1BXT A;  3PQI A;  4DV3 Q;  2NUC A;  3FRP B;  1PTO F;  2FFK B;  1XPR A;  2F4V Q;  1R9T H;  4QL5 A;  1UEA B;  4LJZ C;  2NVY H;  5LL6 S;  1L0Y B;  2Z6K C;  1SYG A;  3PO3 B;  5IGB A;  1QZG A;  5E7N A;  3SK5 A;  3AFP A;  2KEE A;  1N34 Q;  5FLX L;  3RZD B;  4ULL A;  1WTO A;  4JBK A;  1OO9 B;  3GV3 A;  4C1N I;  3PO2 H;  1Q90 A;  3GTJ B;  3KOJ A;  1N32 Q;  4IOC A;  2WAC A;  2Q2T A;  2A69 D;  2D2C C;  3IAY A;  1HFG A;  4RFB A;  1PH6 A;  4OIJ A;  1EY4 A;  4WJW A;  3SHL A;  4BXX H;  3URY A;  5GAH C;  2IHF A;  4LF6 Q;  1LT4 D;  4A3E H;  5IP9 H;  5ELF A;  1VQ4 A;  5KNB A;  2HCI A;  1HA5 A;  1XXG A;  2L55 A;  1TWA B;  4JI2 Q;  3LWE A;  2IX0 A;  3R2I A;  1CTM A;  4CHT B;  2GN5 A;  3BYT B;  3FP9 A;  4MN3 A;  1B9M A;  1A8V A;  1FNU A;  3PIP 3;  3MAQ A;  4L5S A;  1CFM A;  3UDF A;  2NVQ B;  1EWI A;  4U68 A;  5IYB H;  4C3H G;  1YI2 A;  1O7Z A;  3QIA A;  5G3L F;  1EQT A;  2K03 A;  4A3C H;  1OXV A;  1SE8 A;  4MNO A;  3HZX A;  5C0X H;  3P1H A;  3CW2 C;  4M8A A;  4C3I B;  4ZUJ A;  1SBB B;  2JP1 A;  4JV5 L;  2BE5 C;  1CKM A;  2F0D A;  1VQA A;  4ZRZ A;  1H9K A;  1EFI D;  1LTB D;  3K7A B;  4XXE A;  2CWP A;  3Q6S A;  4WRD A;  2OF1 A;  4EX5 A;  3PUW A;  3MTS A;  2JJQ A;  3S1R H;  1DOL A;  1Y1V H;  4G4K A;  4CKC A;  4DU9 A;  3HOV G;  1SDF A;  1I6V C;  5C6A A;  3E0E A;  4H13 C;  3I56 A;  1VQK A;  4DV3 L;  2K14 A;  2NB0 A;  4C3J H;  2JA5 G;  4BA1 I;  2F4V L;  1UEB A;  4LF5 Q;  3CQZ B;  2XN9 C;  3GTL B;  1JJC B;  1VQC A;  2BH2 A;  3SK4 A;  2MUY A;  4IZ8 A;  1IBL Q;  1W6K A;  4C2M B;  2LFN A;  1HR0 W;  2F52 A;  2JA6 B;  3WWV A;  1N34 L;  4A3J G;  3HOZ G;  2PO4 A;  1WD1 A;  1CQF A;  3HOY H;  3M3Y H;  1CKN A;  1B9N A;  1N32 L;  3T1H Q;  1STH A;  2AUK A;  1QZH A;  1DOK A;  5COR A;  1DGS A;  3DWA A;  5C3E G;  1CHQ D;  3HFZ B;  1WFQ A;  3J7A F;  1LUZ A;  4LF6 L;  4F7X A;  2L1B A;  3I70 A;  4LWC A;  5CV4 A;  1LTA D;  3T51 B;  3K59 A;  1Q82 C;  3I4N G;  5JVH 3;  3RN5 A;  1SYE A;  3FVQ A;  4APV A;  2DY8 A;  3TEH B;  1EYC A;  4JI2 L;  4C3H B;  1ML0 D;  2E2H H;  1PFB A;  1K9M C;  2NN6 I;  2E75 C;  2MGS A;  2I5H A;  4RKL A;  3Q22 A;  4R4O A;  4NPS A;  4A3M H;  2EYJ A;  2KHI A;  4V19 0;  3BZK A;  2ZM6 Q;  1IL8 A;  1STG A;  1E1O A;  4QIW E;  3CCL A;  4WFN 3;  5CBA E;  4TKO B;  4BY7 H;  2LXK A;  1JQY D;  1EL0 A;  1CUK A;  1VQ8 A;  1XX8 A;  4NXN Q;  4KI0 A;  4JI0 Q;  1PV4 A;  1I5F A;  2DUD A;  2Q2I A;  1BCP D;  5AJ3 L;  4LFA Q;  4JI8 Q;  1PYW D;  1MSG A;  3VDY A;  1V1O A;  2JK8 A;  2Z4H A;  4LF7 Q;  3HOV B;  1GJX A;  2OEO A;  1YJW A;  4QGU A;  1GVP A;  2Z8L A;  4YIJ A;  4A3E G;  5IP9 G;  1YVC A;  2EE1 A;  1IBK Q;  3C3L A;  1CSP A;  3ITP A;  4RGO S;  1GHJ A;  3OWF A;  5FLM H;  1SNM A;  4UAI A;  1XJV A;  2PW7 A;  2EJM A;  1E7Z A;  4KK7 A;  1A6X A;  4X66 Q;  2B2U C;  4GOP C;  3BVM A;  4XT1 B;  3HOZ B;  1D7Q A;  2QDL A;  1SYD A;  4DAY A;  1CT1 D;  1L1O A;  3R93 A;  5IYB G;  4LF5 L;  2R7F A;  4P75 A;  3T56 B;  1SJH D;  2QF7 A;  1KHI A;  3F2U A;  1IBL L;  5T1I A;  2EDG A;  4A3C G;  4FXG C;  5JOB A;  5CV8 A;  4IUU A;  3LWU A;  4DXF A;  1CQV A;  2I46 A;  4ZCK A;  1Q81 C;  2VUM H;  2K5V A;  5DM7 3;  3Q8D A;  3T1H L;  3I4N B;  4GN3 B;  2D0P A;  3OYY A;  5EPL A;  4JYA Q;  2A74 C;  2K01 A;  4AIM A;  4O0A A;  2N49 A;  4R4Q A;  3H3V I;  1QCB D;  4L5R C;  5G3L D;  1R9T B;  2HQL A;  2IT1 A;  1BVS A;  4OO1 G;  1Y1V G;  2NVY B;  2Z1C A;  3HKZ B;  3SE0 A;  1XYI A;  4Y52 H;  1M90 C;  1DYQ A;  4ZYS A;  1DXM A;  4OL7 A;  3GTP H;  4NXM Q;  1LM0 A;  2AQ2 B;  1FGB D;  3V2T A;  4C3J G;  3PO2 B;  1I50 H;  1WVL A;  4GOP B;  1MKH A;  3UE1 A;  3J80 c;  1Q86 C;  3KF6 B;  2KQ3 A;  2ZM6 L;  3U9O A;  4XTC S;  4B3S Q;  3GDE A;  1EU4 A;  1KAW A;  1STE A;  1RIP A;  1DJR D;  3CD6 A;  3OSO A;  3HOY G;  5CC4 A;  4NXN L;  1R4P B;  3I91 A;  5JPM C;  2DNE A;  4A3E B;  4JI0 L;  1O7L A;  4K5V A;  4DR4 Q;  2RKS A;  3CC2 A;  1YJ9 A;  3H94 A;  3I8Z A;  4LFA L;  4JI8 L;  1LTT D;  3A54 A;  4HN7 A;  1I4P A;  2WKD A;  1SND A;  5ELD A;  4LF7 L;  3A8K E;  3NBH A;  4RA8 A;  1FGU A;  3MHB A;  1XTC D;  3NQI A;  1X3Q A;  1JOQ A;  1IBK L;  2HD3 A;  3TS2 A;  5DLQ E;  3RMH A;  3VR6 A;  1EYG A;  5K5P A;  1E2W A;  2AHO B;  4X66 L;  4IFD I;  1MHW C;  2CW0 C;  3TP6 A;  1WTR A;  1GUW A;  3EJI A;  1VQB A;  2K5D A;  4KMU C;  2RDG A;  4TQU S;  4RGM A;  1Q1B A;  2FHT A;  2F0U A;  2RCF A;  4JOI C;  3ER0 A;  5AFW A;  3G6E A;  1QVG A;  1I4H A;  3F8T A;  1LV9 A;  3NE5 B;  5I2Y A;  3S16 H;  1KRS A;  1UE7 A;  2EJG C;  4IAL A;  3S1R B;  1Y1V B;  4C1N K;  3HOU H;  2AUJ D;  3L0O A;  4FF4 A;  2UUC Q;  1M1K C;  1GHK A;  4JYA L;  3F2B A;  2UXD Q;  1IKL A;  2Z6B A;  4JVZ A;  4DV1 Q;  1VCI A;  4C3J B;  1BBU A;  3H3V H;  5FLM G;  5EKK A;  5EKL A;  2WAQ E;  4A75 A;  3F1Z A;  2Z0S A;  2R7D A;  2GVA A;  4DV2 Q;  4DV6 Q;  3GP7 A;  3UE0 A;  4NXM L;  2E74 C;  2XRS D;  1JE4 A;  3HOY B;  3M3Y B;  1IXR A;  2BE5 D;  4F87 A;  1VDZ A;  4FXD A;  1EQV A;  4IPC A;  4RGT A;  1TWC H;  4CBV A;  1SRU A;  1C8C A;  4B3S L;  1J5E Q;  4MHE A;  1SJE D;  1F2Z A;  3TDQ A;  5JEA J;  3JAM L;  3TN2 A;  1IW7 C;  2O2L D;  1JOO A;  3I55 A;  3I73 A;  1KD1 C;  1MIU A;  4DKA C;  4DR4 L;  3KBG A;  3VYR A;  3OW7 A;  5EGT A;  4DA2 A;  1D8L A;  1VQJ A;  4A3I G;  2JA8 G;  1ILQ A;  5CV5 A;  4GN4 B;  1PXU A;  2E2H B;  3H15 A;  4JI4 Q;  2Q8R E;  4IOA A;  1LTI D;  3S1Q H;  1SXT A;  3G6J B;  4A3M B;  2F1M A;  1I3Q H;  2A1A A;  4FNF A;  2O4X A;  4IPH A;  1UE1 A;  3QR8 A;  1XNQ Q;  1AZQ A;  4HJA A;  4H44 C;  3UDG A;  2NN6 G;  2PQA A;  4IUT A;  4XQQ A;  3HG9 A;  4IFD H;  2L12 A;  2JYO A;  3D4W A;  1S40 A;  2ZJQ A;  5A35 A;  4JI3 Q;  1RTO A;  1PMR A;  4OWX B;  1H9M A;  3OMG A;  3I4M H;  1CZW A;  2A5H A;  4KN7 C;  1HRJ A;  5LMN W;  2CQO A;  1YEZ A;  3OTO Q;  1PFS A;  2A6H C;  1HTP A;  1G8Z D;  3S24 A;  1B44 D;  4A3K H;  2NVQ H;  2EY2 A;  1QVC A;  2EYF A;  2UUC L;  3RLF A;  2UU9 Q;  3N6R A;  3OHX C;  2Y0S B;  4A3G G;  4L8J A;  2E76 C;  4OEL B;  4DV1 L;  4O42 A;  5M5Y H;  4CGY B;  2B2T A;  2B63 G;  3DHQ A;  4LF4 Q;  1X54 A;  2F0G A;  5BN4 A;  1LAB A;  2WIN B;  4DV2 L;  4O2D A;  4DV6 L;  2LXJ A;  1M4V A;  2UUB Q;  4JC0 A;  3RLO A;  2VUM B;  3PSI A;  4KKT A;  5IT9 L;  4BWG B;  1U9R A;  1O7I A;  4CDC C;  4NW2 A;  1J5E L;  2RHS B;  2F3V A;  4DK1 A;  3K5O A;  3VR4 A;  1EY5 A;  3NBI A;  5LL6 X;  4QJF A;  1IYJ B;  2IY5 B;  3J81 L;  1E2Z A;  1U5K A;  3WOF A;  2PMZ B;  4HID A;  3BJU A;  2KCN A;  1JB7 A;  2EOT A;  1B3A A;  4S3S A;  2VXW A;  3P7J A;  1MJE A;  3GTP B;  4LUV A;  2B2Y A;  2NVX H;  4JI4 L;  1I50 B;  2PZT A;  2CH4 W;  2LKV A;  3PIO 3;  1A15 A;  3I4L A;  3PUX A;  3LGJ A;  1T5E A;  1KAB A;  1AFP A;  3VYT A;  1PRT B;  4CKE A;  5IIF A;  1MSH A;  2F0E A;  1UAP A;  4F88 A;  1N33 Q;  2OXP A;  3D8G A;  1XNQ L;  4KHP Q;  2KA7 A;  3NTI A;  3K6O A;  4HTH A;  4QF4 A;  4I65 A;  5D65 A;  4GKJ Q;  4JI3 L;  1NMG A;  2WB1 G;  5FLX E;  3PUZ A;  2XGT A;  3TP5 A;  3NQT A;  2RSO A;  3TZU A;  2Z4I A;  3H3V C;  2BH8 A;  1NY4 A;  3CPW A;  4HJ5 A;  3QG1 A;  5E4X A;  4E6I A;  4HSV A;  1SNP A;  3OTO L;  3TZD A;  3O13 A;  5IY0 A;  3PUV A;  1G51 A;  4X64 Q;  4P71 A;  2K75 A;  4UP8 A;  1EY9 A;  1LTG D;  2UU9 L;  1B2T A;  3CME A;  4DR3 Q;  3F2C A;  3MXN A;  3A7A B;  4ME3 A;  3BZC A;  3CCE A;  1HNW Q;  3ZJY C;  1DM0 B;  2K5H A;  3S17 B;  5ISR A;  4HAE A;  2PZW A;  1Y69 U;  1L0W A;  4O1N A;  4X62 Q;  3NEL A;  5KND A;  2F0S A;  4LF4 L;  1EU3 A;  1YJN A;  1EYD A;  2M00 A;  4IFD G;  2VZA A;  2UUB L;  3KBX A;  4GLX A;  3DM1 A;  1JC7 A;  2JSO A;  3S16 B;  4EQN A;  1Z7T A;  1YHQ A;  1J9O A;  3KDF B;  4JG2 A;  2NZH A;  2B2V C;  1XTD A;  1N9W A;  2HIV A;  3HOU B;  1RJT A;  2E8G A;  1P16 A;  3I4M G;  1I94 Q;  2JA5 H;  2EXD A;  4JW0 A;  2JXM B;  2EYH A;  2R92 H;  2B2W C;  1YHA A;  3M9B A;  1A3V A;  4A3J H;  3L2P A;  4A3K G;  1BF4 A;  1QB5 D;  1X6O A;  4DNI A;  4Q0F A;  5FJ8 H;  2CW0 D;  3KF8 B;  4NKL A;  3CMA A;  2XIW A;  3FMC A;  2RQX A;  4XQN A;  2F0M A;  4HMJ A;  1HTL D;  1GKH A;  1RCV D;  3HEJ A;  5C3E H;  3QB3 A;  1EIF A;  2CHB D;  1W6J A;  3W2D A;  3ICE A;  3ND9 A;  1TWC B;  1F2L A;  2WB1 B;  1U4P A;  1N33 L;  2QKI C;  5E4W C;  4KHP L;  5C3X A;  2V1C C;  3TBI B;  4RHS A;  1HZC A;  4K2L A;  1S5E D;  4FP5 D;  3L7Z C;  3A5Z B;  1BCP F;  1YIJ A;  2K33 A;  4AYB G;  4DGZ A;  4GKJ L;  1F2Y A;  4EQO A;  3MFY A;  4GLV B;  1YBY A;  3Q24 A;  2VS1 A;  3HOW G;  1VMC A;  4Q5V A;  1K0S A;  3S1Q B;  3D0F A;  1STA A;  3R8B A;  2CH4 A;  3DMU A;  1I3Q B;  1H9J A;  2YTY A;  4G7Z C;  4RGN A;  3F2D A;  2F0O A;  3CHB D;  3W3A A;  4X64 L;  4G7O C;  3CCQ A;  1XMQ Q;  3MVV A;  2UUA Q;  1NJI C;  5KGU A;  2X6L A;  1HNW L;  3GTQ H;  1G91 A;  2XNA C;  4G7H C;  1JCK B;  1Z6H A;  1SFO H;  3K8A A;  4IJL A;  3SK8 A;  4X62 L;  1ET9 A;  3D6C A;  1IW7 D;  4HCS A;  3I4M B;  1EUJ A;  3P75 A;  3KJP A;  1EOV A;  5ELE A;  2F0Q A;  3ULJ A;  1EIY B;  4LUO A;  2F0N A;  3CF5 A;  3DWQ A;  1TXY A;  1WD0 A;  3I72 A;  5C44 H;  2C5C A;  3A8I E;  4A3K B;  1WTP A;  2QEX A;  5JJL A;  4DUZ Q;  1EEF D;  3FEW X;  3HKZ E;  4HED A;  4KHZ A;  3DEP A;  2FMC A;  2WFW A;  5M5Y B;  2F0L A;  4OON A;  3KUP A;  2X6G A;  1K83 H;  1XPO A;  4LK1 C;  4KY5 A;  1XNR Q;  4DV4 Q;  1S5B D;  5IGG A;  4OX9 Q;  1FVI A;  4DR1 Q;  1WJJ A;  2GVB A;  1CM9 A;  1LTL A;  3M4O H;  1GUS A;  1TY2 A;  3V05 A;  3OW2 A;  2JA7 H;  4HR7 B;  2KEN A;  1VF7 A;  1TS5 A;  2A19 A;  5CMD A;  3TRE A;  4P72 A;  1LTR D;  4OO1 H;  3IFT A;  1A3U A;  1CZG A;  3E6Z X;  1WTW A;  1VQE A;  2A6H D;  2EIF A;  3CCJ A;  1HHV A;  3VA7 A;  2D9U A;  4NB3 A;  1AP0 A;  2VQF Q;  1A62 A;  1U4R A;  2F03 A;  2PCF B;  3U4Z A;  2R92 G;  4JBJ A;  2NVX B;  1PRT D;  3OPO A;  5L37 A;  5IOC A;  5JAV A;  2R7Z G;  1GXD C;  2K5W A;  2OQ0 A;  4HJ9 A;  5FJ8 G;  2R3Z A;  4HJ7 A;  1ILP A;  5C4Z A;  1K28 A;  4LW1 A;  5DEH A;  2WII B;  1X9N A;  4IUQ A;  1XMQ L;  3C1E A;  1MBY A;  2UUA L;  2Q2H A;  1TS3 A;  1Z47 A;  4PG3 A;  4XT3 B;  4A76 A;  1UNS A;  2HIX A;  3G4S A;  3BS1 A;  1JJG A;  4R4C A;  1PH1 A;  5NUC A;  1QIL A;  4ID6 A;  3GTM H;  5C4H A;  1SEB D;  2N55 A;  3PV0 A;  5IYC G;  3GD7 A;  4DPG A;  2A6E C;  4KN4 C;  1NE3 A;  5HY6 A;  2SDF A;  3OWE B;  2XRQ D;  5M3M H;  1WTQ A;  1TS2 A;  2FMM A;  3S15 H;  4AQY Q;  4YWM A;  2K7V A;  3BDL A;  1F9S A;  1K73 C;  4DUZ L;  3I3C A;  1FYC A;  3GO5 A;  4KJN A;  1KXL A;  4X65 Q;  1LTS D;  2ZJR A;  2KBN A;  1TU2 B;  2C9O A;  5KRU A;  3Q23 A;  1TR5 A;  2JEA I;  2EYO A;  1PH5 A;  1XNR L;  3UDX A;  4DV4 L;  4CJ2 C;  2AKW B;  4LNQ A;  2DY7 A;  4DR1 L;  4JBW A;  3FPU B;  5FKA C;  3RLN A;  1X3F A;  5JEA G;  3RD4 A;  1P8L A;  1EEI D;  1U4M A;  2ZXR A;  4ZQ3 A;  2JA5 B;  3E5S A;  2EY6 A;  4CKB A;  5ELN A;  2MJ8 A;  1BR9 A;  2XWB B;  2YV5 A;  4H0L C;  3RNU A;  1X3P A;  2R92 B;  1B7Y B;  4OXP A;  5C44 G;  3CCV A;  4A3J B;  4DR6 Q;  1TKW B;  3FHW A;  2VQF L;  3B6Y A;  1U0L A;  4IN3 A;  1C4Q A;  2IW3 A;  2H4O A;  3L9A X;  4PZ7 A;  1T9H A;  3U50 C;  1PH2 A;  1NR4 A;  5FLX c;  4K6D A;  5C3E B;  3AB9 A;  1KIX A;  4FYD A;  1L1O B;  3TSS A;  1STB A;  1YNJ C;  3MA2 B;  4A93 G;  4P73 A;  1WYD A;  2UXB Q;  4FF2 A;  3HS0 C;  3UDI A;  2L5T A;  3E3X A;  4RG1 A;  3TRZ A;  3K0X A;  2JA7 G;  4A3I H;  2JA8 H;  2BA0 A;  3K81 C;  4P2C B;  2Z9H A;  4A3L G;  1K0R A;  1SAP A;  4MTN A;  5BR8 Q;  5EQ0 A;  4EQ5 A;  3SVM A;  4V0B A;  1ASZ A;  1FJG Q;  3HOX H;  3OMC A;  4GLA C;  4DUY Q;  1HQM C;  1JWM D;  4R4T A;  4A4I A;  2NZO A;  5C4J B;  2E2J H;  1O7Y A;  2NN6 H;  2ICI A;  2Y0S E;  4NMZ A;  2K28 A;  4RHR A;  1AN8 A;  3JAM E;  4YWK A;  4AQY L;  4KD4 A;  3ERQ A;  4JI1 Q;  1ONL A;  4DN4 M;  1STN A;  3CP0 A;  4X65 L;  4GOP A;  3GTQ B;  5GRO A;  1JWS D;  1ICW A;  5GAG C;  4XQJ A;  1SFO B;  4HSP A;  4TRD A;  3BVZ A;  4GKK Q;  1HNX Q;  3FDT A;  2VB2 X;  5CYU A;  3J7A V;  1OXT A;  3EA6 A;  1XMO Q;  1FR3 A;  3WOE A;  1JT8 A;  1K8O A;  1RL2 A;  3I90 A;  5I2X A;  1QNU A;  4A3G H;  5I9O A;  3GTG H;  4JCV E;  5C44 B;  4DAV A;  4UDU C;  1QUQ A;  3D4R A;  2PMZ E;  1EYA A;  3MXU A;  3D31 A;  1B4O A;  2B63 H;  2WV6 D;  1V9P A;  3GTO H;  5M3M G;  5IGD A;  3LX0 A;  3TQY A;  1B50 A;  2RDF A;  2KUM A;  1E0B A;  1K83 B;  2C35 B;  1EWC A;  4U67 3;  2E2D C;  3RUZ A;  3S17 H;  5A2Q L;  3RR5 A;  4DK6 C;  3M4O B;  5KYI A;  1W2B A;  2JA7 B;  4M1U B;  2A73 B;  2G5D A;  1A0I A;  2EVB A;  5HUR A;  2H1E A;  2I07 B;  2B3G A;  4TSS A;  1X65 A;  1C7Y A;  2UXB L;  4K8I A;  3A5U A;  1CSQ A;  2B8G A;  1I4Q A;  5LMU Q;  5M9O A;  2BDN A;  2M2L A;  1VQG A;  1K8G A;  4PNY A;  5BR8 L;  5I6W A;  2K1B A;  1FJG L;  4DUY L;  3E9I A;  5M3F H;  5IT9 E;  1KLU D;  2PPB C;  2HHH Q;  1BO0 A;  1YIT A;  1TS4 A;  2ZTC A;  4B3T Q;  3ULP A;  3TME A;  3S2D H;  1VF5 C;  2K05 A;  5D14 A;  1SE2 A;  3C2P A;  2MQH A;  1E2V A;  3J81 E;  4X3K A;  4QIW B;  3TP8 A;  1CKO A;  4UHV A;  1SLJ A;  3BU2 A;  4ZLT F;  1BDO A;  1ZKO A;  5EBD A;  4NP5 A;  4QUC A;  5CV9 A;  1VQ5 A;  4GKK L;  4KJO A;  3NP8 A;  1HNX L;  1PFM A;  1XMO L;  1XPU A;  1PHJ A;  1LLR D;  5IGC A;  3GTM B;  2WKC A;  1V1P A;  2EY1 A;  2QW7 A;  1T5X D;  5M3M B;  4PZ6 A;  1KRT A;  1D1I A;  3HOX G;  1WTX A;  2EZV A;  3S15 B;  2ZXO A;  3A55 A;  5J3B A;  3KLW A;  1BQQ T;  4B9W A;  3H0G G;  3PF5 A;  4IPD A;  1QE6 A;  2B2T C;  4ILW A;  4DR7 Q;  3GQB A;  3MWY W;  3C1F A;  2Q8I B;  1NAP A;  2Q8T A;  2XVS A;  1AH9 A;  2O5J C;  3G7L A;  2GA4 B;  4JPB W;  2HDL A;  2XSC A;  2R6G A;  2KCT A;  5T1G A;  1KTK A;  5C0X J;  1A3T A;  3CAM A;  2AWO A;  3S1N H;  2QIL A;  2NYZ D;  1HJP A;  4PV1 C;  2A6E D;  4CDD C;  1D6E C;  1KQS A;  2UXD L;  4IQZ A;  5LMU L;  1H9S B;  2CQA A;  1I4G A;  2NVT H;  5BN5 A;  4FDB A;  1PRT C;  4B08 A;  1HPC A;  2B2Y C;  3PGZ A;  2L11 A;  5D3D A;  1LAC A;  4XDX A;  5IWA Q;  1WOC A;  1RF2 D;  1D2B A;  2MNA A;  2HHH L;  4DR5 Q;  1NBW A;  1ZXT A;  2I5M X;  2EQS A;  2ZT9 C;  3I4O A;  4X3U A;  1BBX C;  4B3T L;  2WAQ G;  4KKU A;  1SYC A;  2QDB A;  3QOL A;  3ZYY X;  1YZ6 A;  4QUF A;  4K14 A;  1Q7Y C;  4A3I B;  2O5I C;  2JA8 B;  3AEV A;  4TVA B;  3J7Z C;  4B9X A;  5KYL A;  3BDC A;  1NUC A;  4LF8 Q;  3HOW H;  1VQM A;  5EKI A;  1U4L A;  1IYV A;  3EQL C;  3NSW A;  2I5L X;  2BCO A;  5KEE A;  3HOX B;  1PZK D;  1VQH A;  3EBE A;  3MEF A;  3T16 A;  2ENB A;  1PDQ A;  3A7L A;  2E2J B;  2YTV A;  2TSS A;  4OWW B;  4YY3 Q;  2DNC A;  2QGQ A;  5COY A;  4GZY C;  1WI5 A;  1SSO A;  5M3F G;  1D1K A;  2MO0 A;  1TWG H;  2YTX A;  1F2M A;  3W1G A;  1K8A C;  4YHH Q;  1YNJ D;  4CJ0 B;  1C48 A;  4BBS G;  3UI2 A;  3LNN A;  1JWU D;  3E0J A;  1QNK A;  4DR7 L;  3TS0 A;  2YU9 H;  1E22 A;  4DK0 A;  3I7F A;  4IO9 A;  3K7U C;  3EN2 A;  3H91 A;  4GNX C;  4R1J A;  2CFM A;  2IPK D;  5JPN C;  4A3G B;  3GTG B;  3NWS A;  1QJO A;  5C3W A;  2K5Q A;  1GUT A;  2EJF C;  4HIO A;  3KFU A;  1X56 A;  3X3N A;  1RDP D;  2KCM A;  5D3I B;  2B63 B;  4LF9 Q;  3GTO B;  4FF3 A;  3V96 A;  1L2F A;  1Q8K A;  4QMG A;  5CR3 A;  3BYY B;  2VQE Q;  2J7Z A;  3NEM A;  4DNT B;  5IP7 H;  2WAQ B;  3DEO A;  1PRT F;  3CC7 A;  1QOH A;  3MXN B;  4I7A A;  2A68 C;  5IWA L;  4OWT B;  1JJ2 A;  3NTH A;  1C9O A;  1MI2 A;  5IE8 A;  4DR5 L;  3D3R A;  1EOT A;  2F0T A;  1EIH A;  1D5Z C;  1CA6 A;  3VR5 A;  2EPB A;  3E9H A;  3JAM c;  2JQO A;  3IL8 A;  2ZJP A;  4GNX B;  1GO3 E;  4LF8 L;  2YYZ A;  1C0A A;  1VS0 A;  2R7Z H;  1IHZ A;  3DM3 A;  4YCV A;  1PTO B;  3P20 A;  5M3F B;  2XTI A;  1MGS A;  2DJF C;  2RCN A;  1LT3 D;  4BBS B;  1N36 Q;  2F0I A;  5ELC A;  1S5C D;  3S2D B;  4YY3 L;  3KF8 A;  4ME5 A;  2RF4 A;  3GTK H;  1G2S A;  1TWF H;  3U4V A;  5C0X I;  2KCC A;  1NMF A;  2CCZ A;  1SNC A;  1GUN A;  1RHP A;  4L5Q A;  4N8X 1;  3S9W A;  3RN2 A;  1A2U A;  2L9H A;  3T4A C;  1G6P A;  2B29 A;  5IYC H;  5E1F A;  4WJ3 M;  3WDN A;  5H1S E;  4IJH A;  3N52 A;  3K5M A;  1E3P A;  4BBR H;  4C3I G;  3J81 j;  3M7N A;  1S72 A;  4CDE C;  2MP1 A;  5C4J H;  5JJI A;  2B2V A;  4QQB X;  2K50 A;  1HZA A;  1PLF A;  1HCZ A;  1Y8N B;  2SEB D;  3L3O C;  3G48 A;  1X3G A;  2AQ1 B;  4K2K A;  4DFA A;  4LMQ D;  4DK3 C;  4LF9 L;  1VQ7 A;  3ONA B;  4DR3 L;  2B2W A;  1JIC A;  1BKB A;  2LMC B;  3CRK C;  2IWH A;  1EY0 A;  4UY8 C;  3NEN A;  4A3F H;  5C4X H;  3FKI H;  2J4X A;  5C5L A;  2VQE L;  1JOR A;  5JEA H;  4ZKB B;  4PQX A;  1SRO A;  1ENF A;  1PZJ D;  2PNR C;  3QWN A;  4EVO A;  2KVM A;  1MJC A;  1O80 A;  1B8A A;  5IT9 c;  2AWN A;  1NCV A;  1QVF A;  2JA6 G;  3S1N B;  1D5M C;  4HIM A;  5IGE A;  1PYS B;  4QY7 A;  1I94 L;  2RDH A;  1WCM H;  4HMI A;  1KNE A;  2NVT B;  1SN8 A;  4CDF C;  3PIP A;  3J81 c;  5C5M A;  1HUN A;  3SR1 A;  4LFC Q;  2QEJ C;  4BS9 A;  1SYB A;  1WTV A;  3RZO H;  5GAD C;  1F9P A;  3C46 A;  2IX1 A;  4A93 H;  1EQR A;  2Z6K A;  1ET6 A;  1VQ9 A;  2DJG C;  4K0K Q;  4IUN A;  4OIK A;  3J80 L;  5E3F A;  4BA2 I;  1EY8 A;  2UXC Q;  1HFN A;  2K52 A;  1N36 L;  2OTL A;  5IP7 G;  2HCC A;  4RAU C;  1HR0 Q;  2I0Q A;  2JA9 A;  3IKJ A;  2L15 A;  1E24 A;  2PQE A;  4A3L H;  4AYB B;  2E5L Q;  2F4I A;  2NBF A;  4PMC A;  1FNV A;  2CWA A;  1I4X A;  4LFB Q;  4OGQ C;  5AJ3 Q;  5J1Z A;  1LYL A;  3SDZ A;  3CCM A;  3HOW B;  4ZUI A;  2PW5 A;  1Q12 A;  2VL6 A;  4H7B A;  2F3W A;  2PZU A;  2NWG A;  3K5L A;  1DD2 A;  1ZYR C;  2LS0 1;  4UP7 A;  5FOB B;  3S2H H;  3CU7 A;  3NUC A;  1PVO A;  5K36 H;  3T53 B;  1JOK A;  4KKS A;  4DV7 Q;  2H5X A;  1Y1W G;  1PA6 A;  1TWH H;  2RA4 A;  3A56 A;  5EJW A;  1TWG B;  4RMF A;  2HDM A;  3S14 H;  1QG7 A;  1CKN B;  1YNX A;  3KLS A;  3R2T A;  2YU9 B;  1VQN A;  3IRB A;  1BNZ A;  2OCE A;  5LHY 1;  2LY7 A;  1CI3 M;  1VQI A;  1AW7 A;  2E2I H;  4A3D H;  1EZ6 A;  3CCS A;  1PH4 A;  4IUR A;  2IX3 A;  4IFD J;  1S5D D;  2OQK A;  2TMP A;  4DXG A;  5I4D A;  1UUP A;  3OIP A;  2BA1 A;  4BBR G;  4X3T A;  3A0J A;  1OXX K;  2EXZ A;  4K5X A;  1L1O C;  3SK6 A;  3CCU A;  3EIV A;  2F0P A;  2IHE A;  5IGF A;  1XWE A;  1CK1 A;  4LFC L;  1V1Q A;  2JN4 A;  4ALP A;  4EGV A;  1O78 A;  3CC4 A;  1DCZ A;  2MPM A;  4OX9 L;  4K0K L;  3HKZ G;  2MHV A;  2R93 H;  4A3F G;  5C4X G;  1S3O A;  3FKI G;  2D62 A;  2KHS A;  2UXC L;  4KY7 A;  4ODG A;  2Q2U A;  1SNQ A;  1HR0 L;  3PO2 G;  1I4R A;  5DNF A;  2ICE C;  3H09 A;  1STY A;  2B8F A;  4POF A;  3VYS A;  2E5L L;  4DV5 Q;  2N78 A;  1JMC A;  4FF1 A;  4I7Z C;  3G71 A;  4LFB L; 
#chains in the Genus database with same CATH homology
 1SMY C;  1PTO D;  5A2Q E;  2R7Z B;  1Y1W B;  3J7Y W;  1V43 A;  1RTN A;  2BOS A;  3FPP A;  4J8Q A;  2A68 D;  3GTK B;  3KLS X;  1TWF B;  4KTA A;  5JJZ A;  1MD2 D;  1LT6 D;  1RKN A;  2SOB A;  4L63 B;  5C0X G;  3OOC A;  3NPP A;  4RH6 A;  4K5W A;  4QCL A;  3D4D A;  4BBR B;  3Q0A A;  1OXU A;  2PYK A;  3VA5 A;  2F0H A;  3D6W A;  1NR2 A;  1L0X B;  1KDC A;  1PFN A;  1PZI D;  1TII D;  3VYU A;  4MIU A;  3EFX D;  5K36 G;  1YNN C;  1TT2 A;  3MFG A;  1FNW A;  2B2U A;  4XYQ A;  1R4Q B;  4A3F B;  1D5X C;  5C4X B;  2KJX A;  3FKI B;  5CGK A;  4R8N A;  2F0J A;  5EPJ A;  4XYO A;  5ELB A;  1JB3 A;  3NXW A;  2QCP X;  2NZ1 D;  2VB3 X;  3DXJ C;  3T13 A;  4X3S A;  1WCM B;  1ESR A;  1G6Z A;  3NTK A;  3BG3 A;  1TQO A;  4F8M A;  1KNA A;  3RZO B;  4A93 B;  2NTT A;  2F0V A;  3DUZ A;  3K5N A;  1OXS C;  1S5F D;  1ENC A;  2K32 A;  3M85 A;  3HP3 A;  1ESF A;  4R8I A;  4EQP A;  2EYM A;  2B39 A;  1B53 A;  2HUG A;  2KEC A;  2M9V A;  1KLG D;  4RCO A;  1HXY D;  2G9D A;  2G9H D;  3S2H B;  1F9Q A;  1NSN S;  1PTO H;  3BDO A;  1M8A A;  1BOS A;  3H6M A;  3X3M A;  1TWH B;  3KLR A;  3DWP A;  2CVR A;  3U9S A;  1DZ1 A;  3S14 B;  3K57 A;  3AMU A;  5FK9 C;  2D5D A;  4RCN A;  1SYF A;  4J6H A;  1G2T A;  4CJ1 B;  3QJY A;  2K6A A;  2A69 C;  2E2I B;  4A3D B;  3VR3 A;  1KAA A;  5FO7 B;  4KD3 A;  5J22 A;  3PUY A;  5FO9 B;  1ZYR D;  2ID0 A;  3IFD A;  1Q8I A;  2RSN A;  5I6Y A;  1TY0 A;  3MXP A;  5EPK A;  3EVQ A;  4NDX A;  3MC0 B;  1V1P B;  3R3O A;  1EY6 A;  4OHJ A;  1AEX A;  4G57 A;  1FD7 D;  5KNC A;  5I9P A;  1GUG A;  2R93 B;  4J1M A;  5TSS A;  1ZEQ X;  1EWH A;  1V8Q A;  2ZXP A;  2EY5 A;  2V4D A;  4C56 C;  4PMB A;  2J0T D;  4BY7 B;  4FXK C;  2IL8 A;  1HUM A;  2EYP A;  4ZK9 B;  2RBM A;  4Z9C B;  2DN8 A;  4WOR A;  1II3 A;  1EZ8 A;  2JE6 I;  5CV6 A;  1QWY A;  2L0C A;  1Y8O B;  5CBE E;  5J39 A;  2SNS A;  1KDB A;  1J8I A;  1GUO A;  3HGB A;  1G29 1;  3HRZ C;  1H9S A;  3MEH A;  2N88 A;  3GV6 A;  3AU7 A;  1EY7 A;  1X32 A;  3SXH A;  5BN3 A;  1EIG A;  3OIQ A;  4DNR B;  4R9W A;  2F0W A;  1H9R A;  5DAU A;  5JVG 3;  2VNU D;  1DON A;  2FJ2 A;  1JR0 D;  1HQR D;  1SNO A;  5F2D A;  4ZAI A;  3MXG A;  4KHV A;  3TP7 A;  1BUV T;  1SMY D;  5EBC A;  2NTS A;  3CRL C;  1IKM A;  3H0G B;  2F0K A;  2L4N A;  3M4Y A;  2HQE A;  4FO2 A;  1DOM A;  3CKI B;  1IYU A;  5KIX A;  1Y8P B;  1I6H B;  4BY1 B;  3K58 A;  3SEB A;  5CV7 A;  4FVM A;  4Y7N B;  4XIG S;  2R61 A;  4HCE A;  2KED A;  1LO5 D;  2K04 A;  3ND8 A;  1KDA A;  4RWS C;  1F9R A;  2KOL A;  1BCP C;  4KV6 A;  1ROD A;  4N9T A;  3NWT A;  1PTO C;  1HA6 A;  5IOD A;  3K0Y A;  1SE3 A;  1GOZ A;  2IJ0 A;  3PMF A;  3A8J E;  3NHH A;  4JK1 C;  3ERO A;  3QO2 A;  2BDO A;  1VMP A;  1YNN D;  2EYL A;  3BZD B;  5HGT A;  3NK9 A;  2WP8 J;  4K8J A;  1SE4 A;  1CA5 A;  2F0F A;  1B1Z A;  4QB4 A;  4N9P A;  4KY6 A;  5M5X B;  1Q1E A;  2X69 A;  4IUP A;  5FO8 B;  3J80 E;  1K8M A;  4A3B B;  1BCP B;  2FIN B;  3KK7 A;  1A2T A;  1CHP D;  4L6T B;  4ABN A;  1ENA A;  2XWJ B;  3M7G A;  4K6L A;  1Q3L A;  3BVG A;  4LAA A;  5DM6 3;  2SNM A;  4IUV A;  4ZKC B;  1TVX A;  3QOJ A;  3VR2 A;  4RKB A;  2AQ3 B;  1AZP A;  4DAP A;  5M5W B;  4PMW A;  1S4Z A;  1RD9 D;  1F77 A;  2JEB I;  3MZ5 A;  3S1M B;  4OO1 I;  1LT5 D;  2OT2 A;  4DF7 A;  2RVL A;  1BXT A;  2NUC A;  3FRP B;  1PTO F;  2FFK B;  1UEA B;  4LJZ C;  5LL6 S;  1L0Y B;  1SYG A;  3PO3 B;  5IGB A;  3SK5 A;  2KEE A;  5FLX L;  3RZD B;  4ULL A;  1WTO A;  1OO9 B;  3GV3 A;  4C1N I;  1Q90 A;  3GTJ B;  2WAC A;  2A69 D;  2D2C C;  3IAY A;  1HFG A;  4RFB A;  4OIJ A;  1EY4 A;  4WJW A;  3SHL A;  3URY A;  1LT4 D;  5ELF A;  5KNB A;  2HCI A;  1HA5 A;  1XXG A;  2L55 A;  1TWA B;  3LWE A;  2IX0 A;  3R2I A;  1CTM A;  4CHT B;  3BYT B;  4MN3 A;  1B9M A;  1FNU A;  3PIP 3;  3MAQ A;  1CFM A;  2NVQ B;  4U68 A;  4C3H G;  1O7Z A;  3QIA A;  5G3L F;  1EQT A;  2K03 A;  1OXV A;  3HZX A;  5C0X H;  3P1H A;  4M8A A;  4C3I B;  4ZUJ A;  1SBB B;  2JP1 A;  2BE5 C;  2F0D A;  4ZRZ A;  1H9K A;  1EFI D;  1LTB D;  3K7A B;  4XXE A;  3Q6S A;  4WRD A;  2OF1 A;  3PUW A;  3MTS A;  1DOL A;  4G4K A;  4CKC A;  4DU9 A;  1SDF A;  1I6V C;  5C6A A;  4H13 C;  2NB0 A;  4BA1 I;  3CQZ B;  2XN9 C;  3GTL B;  3SK4 A;  2MUY A;  4IZ8 A;  1W6K A;  4C2M B;  2LFN A;  2JA6 B;  2PO4 A;  1WD1 A;  1CQF A;  1B9N A;  1STH A;  2AUK A;  1DOK A;  5COR A;  3DWA A;  1CHQ D;  3J7A F;  4F7X A;  2L1B A;  3I70 A;  5CV4 A;  3T51 B;  1LTA D;  3K59 A;  5JVH 3;  1SYE A;  3FVQ A;  2DY8 A;  1EYC A;  4C3H B;  1ML0 D;  1PFB A;  2NN6 I;  2E75 C;  2MGS A;  4RKL A;  3Q22 A;  4V19 0;  2EYJ A;  1IL8 A;  1STG A;  4WFN 3;  5CBA E;  4TKO B;  1JQY D;  1EL0 A;  1XX8 A;  4KI0 A;  1BCP D;  1PYW D;  1MSG A;  1V1O A;  2Z4H A;  3HOV B;  1GJX A;  2OEO A;  2Z8L A;  4YIJ A;  2EE1 A;  3C3L A;  3ITP A;  4RGO S;  1GHJ A;  3OWF A;  1SNM A;  4UAI A;  2PW7 A;  2EJM A;  4KK7 A;  1A6X A;  2B2U C;  3BVM A;  4XT1 B;  3HOZ B;  1SYD A;  4DAY A;  1CT1 D;  3R93 A;  3T56 B;  1SJH D;  2QF7 A;  3F2U A;  5T1I A;  2EDG A;  4FXG C;  5JOB A;  5CV8 A;  4IUU A;  3LWU A;  4DXF A;  1CQV A;  2I46 A;  5DM7 3;  3I4N B;  5EPL A;  2A74 C;  2K01 A;  1QCB D;  5G3L D;  1R9T B;  4OO1 G;  2IT1 A;  2NVY B;  2Z1C A;  3HKZ B;  3SE0 A;  1XYI A;  1DYQ A;  4ZYS A;  1DXM A;  4OL7 A;  2AQ2 B;  3V2T A;  1FGB D;  4C3J G;  3PO2 B;  1WVL A;  2KQ3 A;  3U9O A;  4XTC S;  1EU4 A;  1STE A;  1DJR D;  3OSO A;  5CC4 A;  1R4P B;  3I91 A;  5JPM C;  2DNE A;  4A3E B;  1O7L A;  4K5V A;  2RKS A;  3H94 A;  3I8Z A;  1LTT D;  3A54 A;  4HN7 A;  1I4P A;  2WKD A;  1SND A;  5ELD A;  3A8K E;  3NBH A;  4RA8 A;  3MHB A;  1XTC D;  3NQI A;  1X3Q A;  1JOQ A;  3RMH A;  3VR6 A;  5K5P A;  1E2W A;  4IFD I;  2CW0 C;  3TP6 A;  1WTR A;  1GUW A;  3EJI A;  2K5D A;  4KMU C;  2RDG A;  4TQU S;  4RGM A;  1Q1B A;  2FHT A;  2F0U A;  5AFW A;  1I4H A;  3NE5 B;  1LV9 A;  5I2Y A;  2EJG C;  4IAL A;  3S1R B;  1Y1V B;  4C1N K;  2AUJ D;  4FF4 A;  1GHK A;  1IKL A;  1VCI A;  4C3J B;  5EKK A;  5EKL A;  3GP7 A;  2E74 C;  2XRS D;  1JE4 A;  3HOY B;  3M3Y B;  2BE5 D;  4F87 A;  1VDZ A;  4FXD A;  1EQV A;  4RGT A;  4CBV A;  1C8C A;  4MHE A;  1SJE D;  1F2Z A;  3TDQ A;  5JEA J;  3JAM L;  3TN2 A;  1IW7 C;  2O2L D;  1JOO A;  3I73 A;  3KBG A;  3VYR A;  3OW7 A;  5EGT A;  4DA2 A;  1ILQ A;  5CV5 A;  1PXU A;  2E2H B;  2Q8R E;  1LTI D;  1SXT A;  3G6J B;  4A3M B;  2F1M A;  4FNF A;  2O4X A;  1AZQ A;  4H44 C;  2NN6 G;  4IUT A;  4XQQ A;  3HG9 A;  4IFD H;  2L12 A;  2JYO A;  3D4W A;  5A35 A;  1RTO A;  1PMR A;  1H9M A;  3OMG A;  1CZW A;  2A5H A;  4KN7 C;  1HRJ A;  2A6H C;  1HTP A;  1G8Z D;  1B44 D;  2EY2 A;  2EYF A;  3RLF A;  3N6R A;  3OHX C;  2Y0S B;  4L8J A;  2E76 C;  4O42 A;  4CGY B;  2B2T A;  3DHQ A;  2F0G A;  5BN4 A;  1LAB A;  2WIN B;  1M4V A;  2VUM B;  4KKT A;  5IT9 L;  4BWG B;  1U9R A;  4NW2 A;  2F3V A;  4DK1 A;  3K5O A;  3VR4 A;  1EY5 A;  3NBI A;  5LL6 X;  3J81 L;  1E2Z A;  3WOF A;  2PMZ B;  2KCN A;  2EOT A;  1B3A A;  4S3S A;  2VXW A;  3P7J A;  3GTP B;  2B2Y A;  1I50 B;  2PZT A;  2LKV A;  3PIO 3;  1A15 A;  3I4L A;  3PUX A;  1T5E A;  1KAB A;  1AFP A;  3VYT A;  1PRT B;  4CKE A;  5IIF A;  1MSH A;  2F0E A;  1UAP A;  4F88 A;  2OXP A;  3D8G A;  2KA7 A;  3NTI A;  3K6O A;  4HTH A;  4QF4 A;  4I65 A;  5D65 A;  5FLX E;  3PUZ A;  3TP5 A;  3NQT A;  2RSO A;  3TZU A;  2Z4I A;  3H3V C;  3QG1 A;  5E4X A;  4E6I A;  4HSV A;  1SNP A;  3TZD A;  3O13 A;  3PUV A;  1EY9 A;  1LTG D;  1B2T A;  3MXN A;  3A7A B;  1DM0 B;  3S17 B;  5ISR A;  4HAE A;  2PZW A;  1Y69 U;  4O1N A;  5KND A;  2F0S A;  1EU3 A;  1EYD A;  2M00 A;  4IFD G;  3KBX A;  3DM1 A;  1JC7 A;  2JSO A;  3S16 B;  4EQN A;  1Z7T A;  1J9O A;  2B2V C;  3HOU B;  1RJT A;  2JXM B;  2EYH A;  2B2W C;  1A3V A;  1BF4 A;  1QB5 D;  4Q0F A;  2CW0 D;  4NKL A;  2XIW A;  3FMC A;  2RQX A;  4XQN A;  2F0M A;  4HMJ A;  1HTL D;  1RCV D;  3HEJ A;  3QB3 A;  2CHB D;  1W6J A;  3W2D A;  3ND9 A;  1TWC B;  1F2L A;  2WB1 B;  1U4P A;  2QKI C;  5E4W C;  5C3X A;  3TBI B;  4RHS A;  4K2L A;  1S5E D;  4FP5 D;  3L7Z C;  1BCP F;  2K33 A;  4DGZ A;  1F2Y A;  4EQO A;  3MFY A;  3Q24 A;  1VMC A;  4Q5V A;  3S1Q B;  1STA A;  3R8B A;  3DMU A;  1I3Q B;  1H9J A;  4G7Z C;  4RGN A;  2F0O A;  3CHB D;  3W3A A;  4G7O C;  3MVV A;  5KGU A;  2X6L A;  1G91 A;  2XNA C;  4G7H C;  1JCK B;  1Z6H A;  3SK8 A;  1ET9 A;  3D6C A;  1IW7 D;  4HCS A;  3I4M B;  3P75 A;  5ELE A;  2F0Q A;  2F0N A;  3DWQ A;  1WD0 A;  3I72 A;  2C5C A;  3A8I E;  4A3K B;  1WTP A;  1EEF D;  3FEW X;  4HED A;  4KHZ A;  3DEP A;  2FMC A;  5M5Y B;  2F0L A;  3KUP A;  2X6G A;  4LK1 C;  4KY5 A;  1S5B D;  5IGG A;  1CM9 A;  1GUS A;  1TY2 A;  3V05 A;  4HR7 B;  1VF7 A;  1TS5 A;  5CMD A;  1LTR D;  4OO1 H;  3IFT A;  1A3U A;  1CZG A;  3E6Z X;  1WTW A;  2A6H D;  1HHV A;  3VA7 A;  2D9U A;  1AP0 A;  1U4R A;  2F03 A;  2PCF B;  2NVX B;  1PRT D;  3OPO A;  5IOC A;  5JAV A;  1GXD C;  2K5W A;  2R3Z A;  1ILP A;  5C4Z A;  5DEH A;  2WII B;  4IUQ A;  3C1E A;  1MBY A;  1TS3 A;  1Z47 A;  4XT3 B;  1UNS A;  3BS1 A;  5NUC A;  1QIL A;  4ID6 A;  5C4H A;  1SEB D;  2N55 A;  3PV0 A;  3GD7 A;  2A6E C;  4KN4 C;  2SDF A;  3OWE B;  2XRQ D;  1WTQ A;  1TS2 A;  2FMM A;  2K7V A;  3BDL A;  1F9S A;  3I3C A;  1FYC A;  3GO5 A;  4KJN A;  1LTS D;  1TU2 B;  2C9O A;  5KRU A;  3Q23 A;  1TR5 A;  2JEA I;  2EYO A;  4CJ2 C;  2DY7 A;  4JBW A;  3FPU B;  5FKA C;  5JEA G;  3RD4 A;  1EEI D;  1U4M A;  2ZXR A;  4ZQ3 A;  2JA5 B;  3E5S A;  2EY6 A;  4CKB A;  2MJ8 A;  1BR9 A;  2XWB B;  4H0L C;  2R92 B;  1X3P A;  4A3J B;  1TKW B;  4IN3 A;  1C4Q A;  2IW3 A;  2H4O A;  3L9A X;  1NR4 A;  4K6D A;  5C3E B;  3AB9 A;  4FYD A;  3TSS A;  1STB A;  1YNJ C;  3MA2 B;  4FF2 A;  3HS0 C;  2L5T A;  2BA0 A;  4P2C B;  1SAP A;  3SVM A;  5EQ0 A;  4V0B A;  3OMC A;  1HQM C;  1JWM D;  5C4J B;  1O7Y A;  2NN6 H;  2ICI A;  4NMZ A;  2K28 A;  4RHR A;  1AN8 A;  3JAM E;  4KD4 A;  3ERQ A;  1ONL A;  4DN4 M;  1STN A;  3GTQ B;  1JWS D;  1ICW A;  4XQJ A;  1SFO B;  4HSP A;  4TRD A;  3BVZ A;  3FDT A;  2VB2 X;  5CYU A;  3J7A V;  1OXT A;  3EA6 A;  1FR3 A;  3WOE A;  1K8O A;  3I90 A;  5I2X A;  1QNU A;  5I9O A;  5C44 B;  4DAV A;  4UDU C;  3D4R A;  1EYA A;  3MXU A;  3D31 A;  1B4O A;  2WV6 D;  5IGD A;  3LX0 A;  1B50 A;  2RDF A;  2KUM A;  1E0B A;  1K83 B;  1EWC A;  4U67 3;  2E2D C;  3RUZ A;  5A2Q L;  3M4O B;  5KYI A;  2JA7 B;  4M1U B;  2A73 B;  2EVB A;  5HUR A;  2H1E A;  2I07 B;  4TSS A;  4K8I A;  2B8G A;  1I4Q A;  5M9O A;  2BDN A;  2M2L A;  4PNY A;  5I6W A;  2K1B A;  5IT9 E;  1KLU D;  2PPB C;  1BO0 A;  1TS4 A;  3TME A;  1VF5 C;  2K05 A;  5D14 A;  1SE2 A;  3C2P A;  3J81 E;  1E2V A;  4X3K A;  4QIW B;  3TP8 A;  4ZLT F;  1BDO A;  1ZKO A;  5EBD A;  4NP5 A;  4QUC A;  5CV9 A;  4KJO A;  3NP8 A;  1PFM A;  1LLR D;  5IGC A;  3GTM B;  2WKC A;  1V1P A;  2EY1 A;  1T5X D;  5M3M B;  1WTX A;  1D1I A;  3S15 B;  2EZV A;  2ZXO A;  3A55 A;  1BQQ T;  4B9W A;  1QE6 A;  2B2T C;  4ILW A;  3GQB A;  3MWY W;  3C1F A;  2Q8I B;  1NAP A;  2Q8T A;  2XVS A;  2O5J C;  3G7L A;  2GA4 B;  2HDL A;  2XSC A;  2R6G A;  5T1G A;  1KTK A;  5C0X J;  1A3T A;  2AWO A;  2QIL A;  2NYZ D;  4PV1 C;  2A6E D;  1D6E C;  4IQZ A;  1H9S B;  2CQA A;  1I4G A;  5BN5 A;  1PRT C;  4B08 A;  1HPC A;  2B2Y C;  2L11 A;  5D3D A;  1LAC A;  4XDX A;  1RF2 D;  1D2B A;  1ZXT A;  2ZT9 C;  4X3U A;  1BBX C;  4KKU A;  1SYC A;  2QDB A;  3QOL A;  3ZYY X;  4QUF A;  4K14 A;  4A3I B;  2O5I C;  2JA8 B;  4B9X A;  5KYL A;  3BDC A;  1NUC A;  5EKI A;  1U4L A;  1IYV A;  3EQL C;  3NSW A;  2BCO A;  5KEE A;  3HOX B;  1PZK D;  3T16 A;  2ENB A;  1PDQ A;  3A7L A;  2E2J B;  2TSS A;  2DNC A;  5COY A;  4GZY C;  1SSO A;  1D1K A;  1F2M A;  1YNJ D;  4CJ0 B;  1C48 A;  3UI2 A;  3LNN A;  1JWU D;  3E0J A;  1QNK A;  4DK0 A;  3H91 A;  2IPK D;  5JPN C;  4A3G B;  3GTG B;  3NWS A;  1QJO A;  5C3W A;  2K5Q A;  1GUT A;  2EJF C;  3X3N A;  1RDP D;  5D3I B;  2B63 B;  3GTO B;  4FF3 A;  3V96 A;  4QMG A;  5CR3 A;  3BYY B;  2J7Z A;  4DNT B;  2WAQ B;  3DEO A;  1PRT F;  1QOH A;  2A68 C;  3NTH A;  1MI2 A;  3D3R A;  1EOT A;  2F0T A;  1EIH A;  1D5Z C;  1CA6 A;  3VR5 A;  2EPB A;  3IL8 A;  2YYZ A;  1IHZ A;  1PTO B;  3P20 A;  5M3F B;  1MGS A;  1LT3 D;  4BBS B;  2F0I A;  5ELC A;  1S5C D;  3S2D B;  3KF8 A;  4ME5 A;  1G2S A;  5C0X I;  2KCC A;  1SNC A;  1GUN A;  1RHP A;  3S9W A;  1A2U A;  2L9H A;  3T4A C;  5E1F A;  3WDN A;  3N52 A;  3K5M A;  4C3I G;  3M7N A;  2MP1 A;  2B2V A;  1PLF A;  1HCZ A;  1Y8N B;  2SEB D;  3L3O C;  2AQ1 B;  4K2K A;  4DFA A;  4LMQ D;  3ONA B;  2B2W A;  1JIC A;  2LMC B;  3CRK C;  2IWH A;  1EY0 A;  2J4X A;  5C5L A;  1JOR A;  5JEA H;  4ZKB B;  4PQX A;  1ENF A;  1PZJ D;  2PNR C;  3QWN A;  4EVO A;  2KVM A;  1O80 A;  2AWN A;  1NCV A;  3S1N B;  1D5M C;  5IGE A;  2RDH A;  4HMI A;  1KNE A;  2NVT B;  5C5M A;  1HUN A;  3SR1 A;  2QEJ C;  4BS9 A;  1SYB A;  1WTV A;  1F9P A;  3C46 A;  2IX1 A;  1ET6 A;  4IUN A;  4OIK A;  3J80 L;  5E3F A;  4BA2 I;  1EY8 A;  1HFN A;  2HCC A;  4RAU C;  3IKJ A;  2PQE A;  4AYB B;  2F4I A;  2NBF A;  4PMC A;  1FNV A;  1I4X A;  4OGQ C;  5J1Z A;  3HOW B;  3SDZ A;  4ZUI A;  2PW5 A;  1Q12 A;  4H7B A;  2F3W A;  2PZU A;  2NWG A;  3K5L A;  1DD2 A;  1ZYR C;  2LS0 1;  5FOB B;  3CU7 A;  3NUC A;  5K36 H;  3T53 B;  1JOK A;  4KKS A;  2RA4 A;  3A56 A;  5EJW A;  1TWG B;  2HDM A;  1QG7 A;  3KLS A;  3R2T A;  2YU9 B;  1BNZ A;  5LHY 1;  2LY7 A;  1CI3 M;  1AW7 A;  1EZ6 A;  4IUR A;  2IX3 A;  4IFD J;  1S5D D;  2TMP A;  4DXG A;  5I4D A;  1UUP A;  3OIP A;  2BA1 A;  4X3T A;  1OXX K;  2EXZ A;  4K5X A;  3SK6 A;  2F0P A;  5IGF A;  1XWE A;  1CK1 A;  4EGV A;  1O78 A;  1DCZ A;  2MPM A;  2MHV A;  2D62 A;  2KHS A;  4KY7 A;  4ODG A;  1SNQ A;  1I4R A;  5DNF A;  2ICE C;  3H09 A;  1STY A;  2B8F A;  3VYS A;  4FF1 A;  4I7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...