3PIP3

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pip300
5DM73 4WFN3 5JVG3 3PIO3 5JVH3 3PIP3 4U673 5DM63
chains in the Genus database with same CATH superfamily
5IYCH 4U68A 4ZCKA 5IP9G 2IX0A 4C56C 3H15A 5J22A 4V190 1RDPD 2J7ZA 4P72A 5A2QL 4KI0A 4RGTA 3VR4A 1PHJA 4PZ6A 4BY1H 5KIXA 1PFMA 3SK4A 3CRLC 3I4NG 3GTJB 2BDOA 2R93H 3Q23A 3PO3H 4GKKQ 2K4KA 3F2DA 2VZAA 2KBNA 5IP7H 3OSOA 4R8IA 3KBGA 3ZYYX 5C4JB 4A3KH 4RWSC 3HFZB 3N6RA 3L2PA 4GOPC 4BY7G 2Q2UA 4JI2L 3H0GH 1Q81C 4EQPA 4XYOA 4GLXA 4POGA 1VQFA 1AW7A 2N78A 1PLFA 4CJ0B 3TSSA 1S40A 4DR4L 3RZOH 5CORA 3GTQB 3R2TA 1SE4A 1GUWA 5BR8L 5JPMC 2MJ8A 3T51B 1UWVA 2A1AA 4HIOA 2BOSA 3G7LA 3RLOA 3HOUH 2A69C 3QOJA 1NJIC 4JI1Q 1XYIA 3NBIA 5EGTA 2DY8A 3KFUA 4DK0A 3HS0C 2MP1A 1JCKB 1UE6A 2RCNA 2VB3X 3AQQA 1HCZA 4A3EB 4UDUC 5BN5A 5M3FH 3P7JA 1SE2A 1OTCA 4FO2A 5IYDH 5HGTA 2WB1G 4OX9Q 3GTOB 1K0RA 2A6EC 1B1ZA 1LABA 3K58A 1VQDA 2JA6H 3FVQA 3SHLA 5AJ3Q 2LY7A 4TSSA 1YI2A 1HQMC 1IBLL 2LKVA 5ELNA 4YWMA 1CQVA 4X65L 2B39A 2BE5C 5ELEA 1PTOD 4J15A 3S1MB 4PQXA 5M5WB 1N32L 2CQOA 1CK1A 5T1IA 3DM1A 1U4RA 1Y1VH 3VR6A 1S72A 5T1GA 3K80C 1ESRA 1JT8A 4DK1A 1OO9B 4DAYB 3M3YB 5I6YA 3NPPA 5GQOA 2ZTEA 1N33Q 2ICEC 3GTMB 3G48A 4DR2Q 1WTQA 4QUCA 3GTGB 2WINB 4GNXA 4R4TA 5CV9A 5FJ8G 1EWIA 1WJJA 3KLSX 3S14B 5D3DA 3S15H 4DR6Q 1ILPA 1F2YA 2MHVA 4DR4Q 2KHIA 3TZUA 1D6EC 2A74C 1JC7A 5BR8Q 1HXYD 4HTHA 5C44B 1B4OA 3K8AA 2UXDL 1S5ED 1EY5A 1RODA 3OMCA 1JJGA 3D31A 5BN3A 4KKSA 3TP5A 1SFOB 2R92B 2D0PA 2A6HC 1BQQT 1UUPA 3RUZA 1U9RA 1FNWA 4OL7A 4OEMB 5M5YH 4ZYSA 1GVPA 1HZCA 4DPGA 2CH4W 4AIMA 1QCBD 3KDFB 1PH3A 5A2QE 3AYHB 3TDQA 1PFBA 1H9SB 1JB7A 3I3CA 3J7ZC 1ESFA 3KF6A 3GTKB 3S1RH 2VW9A 2B2UC 5IIFA 3NHHA 2DGYA 4CJ2C 3C3LA 2UXCL 1FL0A 2YTVA 4UHVA 4J1MA 2Q2TA 1A3VA 4OONA 4JCVE 1KNEA 1QVFA 3GTPB 1PYSB 1X3QA 2X6GA 4JI8L 1HA5A 5ELOA 2GVBA 2MUYA 3SDZA 1AE3A 2F0DA 1N32Q 3UDFA 4TVAB 2N88A 2K7VA 1TWAB 1VQJA 3M7NA 3I4NB 1RL2A 4QQBX 3NWSA 1B44D 4J8QA 1Q8IA 2CVRA 1CQFA 3ITPA 3HOXH 1QUQB 2CKZB 1ASZA 4CKEA 2PPBC 1QVCA 3SXHA 1LUZA 3S1NH 1F2ZA 2EJGC 2Q2HA 1HNWQ 5KNCA 2OWOA 4LF5L 4BY7B 3B6YA 1B9MA 1EYGA 1TWCH 3EJIA 4FNFA 2K1BA 2EXZA 1V1PB 4R4OA 1SJED 4IUNA 2I46A 1BO0A 4HJ7A 4OO1I 3BS1A 1X56A 2VQFL 1LTBD 5ELFA 1JOQA 4QY7A 1D5XC 3R3OA 2QEXA 2F4VQ 2EJMA 1I4PA 1QOHA 2YV5A 1TIID 4O0AA 1SMXA 3SEBA 1AFPA 1NSNS 5HY6A 3HOWG 3OHXC 3HOVB 1UEBA 2EYFA 2BA0A 4JPBW 4RHSA 3CCQA 2Z1CA 2I07B 4C3IG 4Q0FA 3IL8A 1T9HA 1X3GA 2UXCQ 1I3QH 1BDOA 4LWCA 2EYMA 4DKAC 2X69A 3TZDA 3UDIA 1Y14B 4JI8Q 4UPAA 4MZ9A 1TU2B 4EQOA 4S3SA 1EU3A 2FHTA 4HJ8A 1PV4A 3D0FA 5D3IB 2K04A 1M4VA 4K2LA 3CCSA 1H9JA 4AYBG 5FKAC 1EZ8A 3GTOH 2QDBA 2ID0A 2DJFC 4DAVA 1CZGA 3F1ZA 3STBD 1E7ZA 1K8AC 1KHIA 1SLJA 1HH2P 4UP7A 3ERQA 4QMGA 4IALA 5FLXc 1Z7TA 1VF5C 4YWLA 2C35B 4LF5Q 1Z6HA 2JP1A 3S1MH 3NUCA 1O7LA 2NVYB 3K59A 3V2TA 5NUCA 2E2HH 3CCVA 1XPUA 2F4IA 1IHZA 4H7BA 4DAYA 5FOBB 1R4PB 3EFXD 5FO8B 5C6AA 2RHSB 2M2LA 5IGEA 2VQFQ 4DNIA 4LF8L 1I4HA 1NCVA 3NTHA 3P20A 4Y7NH 3GTGH 2PMZE 2NTTA 3L0OA 1FJGQ 3HOZG 2ENBA 4LFAQ 2OXPA 1U0LA 3U50C 1KTKA 4PNYA 3NEMA 3L9AX 4HN7A 4IPHA 3AEVA 2KEEA 2JQOA 3I56A 3GD7A 5LMNQ 5HGQA 1I4RA 2HQEA 3I7FA 4CGYB 2SOBA 1JMCA 3WWVA 2IW3A 5FLXE 2YU9B 1SFOH 2UXBL 3PUWA 3UDGA 5IOCA 2VUMB 2K33A 4AH6A 1PTOF 2HCIA 4N8X1 1VQBA 3S16B 2ZM6L 4KN7C 3BDCA 3RNUA 1YNND 4K5XA 2RSNA 3Q22A 4NW2A 4R8NA 4C3HG 3HKSA 4OHJA 3W1BA 4BBRB 5GAEC 4A3IH 1XMQL 3BZCA 1H9SA 3FKIH 3KK7A 4FF4A 2JA8G 2JEAI 1K3RA 1QNKA 4OXPA 3GTKH 4X3TA 1VQPA 1L1OB 1K83H 5IP9H 3VDYA 1BBXC 5EAYA 4A93H 1B70B 4RAUC 5EPLA 4QCLA 4B9WA 1BR9A 5I2XA 2AQ2B 2EYJA 1TR5A 4L63B 1N36Q 2JSOA 4K5VA 5EBCA 1VQGA 1X6OA 2DN8A 4GN4B 4OIKA 2ZT9C 2FMMA 2F3IA 4TQUS 1G291 1E3PA 1MSGA 1QUQA 4YCWA 3KBXA 4LF8Q 3I70A 1P16A 5J3BA 1QG7A 1XPRA 1PRTB 1SYGA 1A8VA 2R6GA 4DV0L 2KCNA 4KKTA 4CDFC 4LF4L 2RDGA 4Q5VA 4XQNA 2HIVA 2MGSA 4RH6A 5IGBA 1I50H 4DR1L 4ZUJA 2NN6I 1E0BA 2PZWA 2Q8RE 2EJFC 5CBAE 4X3KA 4C3IB 4HJAA 1KL9A 2XTIA 4R9WA 1F9SA 4HR7B 3BYYB 2IHFA 3AU7A 2ZM6Q 1EEFD 4HCSA 1XMOL 2L11A 4EGVA 1DXMA 2FJ2A 4IQZA 4OIJA 4CHTB 3DHQA 1XMQQ 1YBYA 1SE8A 2JK8A 1PH6A 3V05A 4NXML 3MFYA 1YNJC 1VQ8A 3T13A 3JC66 5C4ZA 2R7ZB 4AYBB 1TWGB 5ELBA 3AFQA 3K0XA 1NR2A 4ME5A 1E2ZA 1SMYD 4A3JH 1X65A 4WJ4A 4DV1L 2A19A 2EY5A 1G2SA 1GUNA 3E3XA 2PW7A 2NUCA 3D4WA 1QWYA 2WAQE 2B2YA 2XRQD 1J5EL 4PMBA 3A0JA 4A3EG 3VA7A 2EZVA 3J80L 4KY6A 5H1SE 2RBMA 2ZXOA 3HG9A 4CKBA 4R1JA 3BDOA 5A35A 2I5MX 1SROA 1MIUA 2Z6KA 3HOZB 2EY1A 2ATWA 2NZOA 3G6JB 4H44C 2NVTH 4FYDA 4LAAA 4DR1Q 1Q90A 4IUPA 1K3BC 3QO2A 3QIAA 1A0IA 3CP0A 2RF4A 3SK8A 3VR3A 2K01A 4B3SL 4LF7L 2VXWA 2E74C 1JOKA 2RKSA 3MXNA 1QE6A 5I4DA 4DGZA 5C3EB 4CKCA 1I6HH 3MAQA 3CW2C 4DR5Q 4BBSB 2H1EA 1FGBD 2WFWA 2F0SA 3TP6A 3PUXA 1NAPA 2PQEA 3CC4A 4JV5Q 3A5ZB 4KHPL 1C0AA 1DJRD 3H6MA 3M4OB 3PCOB 1SJHD 2B2VC 2VQEL 5D65A 4C3HB 4NXMQ 1K8OA 3EROA 1LACA 2JA8B 2Z8LA 3S1QH 2VL6A 3CCUA 4O42A 5C44G 2A8VA 1BUVT 4L5TA 4TKOB 3I4LA 2C5CA 1HUNA 1CSPA 1SE3A 3MC0B 2R7DA 3RLFA 5KNDA 3JAML 3VYSA 2F52A 2N3SA 4KY7A 1LM0A 5C0XI 5IWAL 2B2WA 1J8IA 2MFIA 1ENAA 4PV1C 5IYBG 1STBA 4OELB 5G3LD 2O4XA 1X9NA 3OWEB 5EQ0A 1KRSA 1L1OA 4GKJQ 1F77A 3U9SA 1F9PA 4PG3A 3V96A 4C2MH 3R93A 1DM0B 5I6WA 5CC4A 1HUMA 2JA7G 3FMCA 3P75A 2BH2A 2FXQA 5C0XH 3SVMA 2IJ0A 1TS4A 2B3GA 2AWNA 2XNAC 1PRTD 2CW0D 1TS3A 4IJLA 2NVXB 3S2HB 4ZK9B 2CQAA 4HMJA 4L5QA 4RG1A 3K57A 4JBKA 1CHQD 3NTIA 2XWJB 3NSWA 4B3SQ 1HNXL 3K7AB 4LF7Q 2ZJPA 1SDFA 3EA6A 4UP9A 2F3WA 1BF4A 1V1OA 4R4IA 1IBKL 4N9TA 4RGNA 3TQYA 4A3BB 2QGQA 1I4GA 2GVAA 4HEDA 1Z9FA 4KHPQ 4BWGB 2OF1A 4RKBA 4NPSA 3HKZE 5L37A 5LL6S 5ISRA 3MEFA 3CXCA 1GUOA 1YEZA 1M90C 2VQEQ 1VQ4A 3HOWH 5M3MG 1T5EA 4LF6L 2KOLA 3QOLA 1KAAA 4X62L 3KF8B 5K36H 2R7FA 4JBMA 1QJOA 2Y0SE 3T1YQ 4X66L 3G71A 3ULPA 2UUCQ 1SYEA 3MZ5A 4DV7Q 1STEA 2NZHA 2KJXA 1VCIA 2RSOA 2QILA 4IURA 3WOEA 3E6ZX 1ASYA 2UUAL 4UP8A 2DUDA 3URYA 3RR5A 2LXKA 3W1GA 1D5MC 3I90A 1BBWA 4DV4L 3DM3A 5CGKA 1DYQA 3HOVG 4KK7A 4YY3L 3WOFA 3T1HL 3QR8A 5JEAJ 1TY2A 1IBMQ 4JI5Q 4ZKBB 1VMCA 2V1CC 1J9OA 4IO9A 3M4PA 1H9RA 4DR3L 3VR5A 4RKLA 3TP8A 4DN4M 1R9TH 2PZUA 4DR7L 2WB1E 3DWPA 1DOKA 5FK9C 2A6ED 5IGDA 2JE6I 2F0QA 1UNSA 4IN3A 1ENFA 4KKUA 2IY5B 1HRJA 4LFCL 4RCOA 3RMHA 1C7YA 1IXRA 1IBKQ 1TS2A 1TWFH 4NB3A 5IT9L 3K0YA 1PTOC 2FMCA 2PNRC 2Q8TA 2J0TD 3GV3A 1KXLA 2QA4A 4X3UA 1PTOH 3CC7A 1QZHA 1S5FD 3F2UA 4GNXC 2CHBD 4QUFA 4ODGA 2PCFB 3D4DA 1XX8A 3RZDH 4X62Q 2F0HA 2VB2X 4JI2Q 2B2TC 1GKHA 1DD2A 4X66Q 2Q8IB 5E1FA 3OW2A 3FEWX 4J6HA 1D5ZC 2KCTA 5C5MA 1ML0D 2F0FA 1LLRD 3HOYH 1S5BD 1EIGA 3GO5A 1N8RC 5M5XB 1PH1A 1FD7D 2XN9C 1S3OA 1SNOA 1OXSC 2MO1A 4DV4Q 4U673 1XPOA 2XSCA 2L15A 3D3RA 3CMAA 1X3FA 2N49A 3DWQA 5JJLA 3I4MH 3H3VI 1KNAA 2PI2A 3PO2G 4TRDA 4EQ5A 5JEAG 3T1HQ 3NP8A 3DMUA 1Q3LA 3U4ZA 2Q2IA 2E75C 3SK5A 1QB5D 1OXUA 1EQTA 2JA7B 1QILA 4DR3Q 1SBBB 4P74A 2VUMG 1HZBA 3H3VC 3QB3A 4KTAA 3I8ZA 1XNRL 3GDEA 4LK1C 3CQZB 4MHEA 5C4XH 3CCEA 1IBLQ 3H3VH 1LO5D 4X65Q 4BBRG 1HPCA 5M9OA 1S4ZA 4LUVA 4A3MG 4XQQA 2RA4A 4K8JA 2MPMA 2K5WA 2HHHL 1SSOA 4L5SA 3D6WA 4LFCQ 1KDAA 5CV8A 4NXNL 2B2UA 2AKWB 4GLAC 3X3NA 5C3WA 5J1ZA 1ZEQX 5JPNC 1KLUD 5GAGC 3A55A 4A3CG 1JE4A 4G7HC 1A2UA 4DK6C 1EY6A 2JYOA 2O2LD 3GTLB 3K5NA 5M3MB 3G6EA 1ZKOA 3GTJH 3PUZA 4LMQD 2EQSA 1DZ1A 1PA6A 3MWYW 2E5LL 4A3DG 1VS0A 4QL5A 3J81L 2UXDQ 5E3FA 1HFGA 2NTSA 1YJ9A 4LFBL 3HZXA 4ZUIA 2B8FA 4MN3A 5FLMH 1EOTA 1SYBA 2F0TA 2K5HA 5C4JH 1GM5A 3C46A 3ICEA 1K8MA 5G3LF 5IYCG 3KF8A 2JEBI 3AB9A 5EKIA 4DUYL 2XGTA 2XWBB 4EX5A 3DWAA 4OWTB 4HJ9A 4BY1G 3MTSA 2UU9L 3MHBA 3GTQH 4FXDA 1AEXA 2R93G 1NNXA 1MD2D 2RDFA 4IUQA 3GQBA 3OIQA 3PIOA 3PO3G 1PRTF 4BA1I 3A56A 1WTPA 5IP7G 1JB3A 2LXJA 5FO7B 4QJFA 3OPOA 4A3KG 1GOZA 2EVBA 3A5UA 2E2IB 5C3XA 2C9OA 3A7AB 3A7LA 3J7AF 3KUPA 4A3EH 3MFGA 1YHAA 2HHHQ 1G6PA 3S17B 2L0CA 5IGFA 1SAPA 3PSIA 4NXNQ 1CKNA 2R7ZG 2AQ1B 2EE1A 3BYTB 1E2VA 5EBDA 2JA5G 4IOAA 3NWTA 1I4XA 1EY7A 4P75A 5C4HA 4DU9A 1P8LA 1EYCA 1Y69U 3S2DB 1T5XD 3PGZA 4G7ZC 3HOUG 2L1BA 1O80A 3D6CA 2A68D 3STBC 4A75A 1D2BA 1PH5A 3DLLA 5M5WH 1VQAA 3ND9A 1RJTA 1EYDA 3K6OA 2DJGC 1STHA 4JG2A 5E7NA 2K5NA 2CCZA 3M3YH 3PMFA 1MJCA 3ER0A 1Y8PB 5JVG3 5IYDG 2A5HA 3GTMH 2YTYA 3MXNB 2JA6G 2GA4B 3T56B 4WFN3 1LTSD 4RHRA 1W3SA 3S14H 1AZQA 4IFDI 4LUZA 3KLSA 3NXWA 2RDHA 1MBYA 3UE1A 1S5DD 2UU9Q 4JBJA 3W5OA 1EEID 3PO2B 4JYAL 2NVQB 3S9WA 1C4QA 5C44H 3KOJA 1ZYRD 5C3EG 2AHOB 4X6AH 1D8LA 1I94L 1SEBD 4BBSG 3BDLA 2R92H 1KC8C 5C5LA 1EFWA 2F0EA 4IUTA 1PFSA 4GS3A 4IFDH 4JW0A 4HSVA 2ZXRA 1H95A 5GROA 3M85A 1RTOA 1PH8A 5BN4A 4WORA 5F2DA 3CF5A 4XDXA 1GD7A 4C1NK 4ALPA 1D7QA 3CCJA 1G8ZD 4DA2A 4XT1B 4A3MB 1WTHA 2F0NA 1YHQA 1YITA 4JK1C 1TWHB 1YNNC 2K75A 1RCVD 2QW7A 4JI6L 1VDZA 5FO9B 2FINB 1ONLA 1NMGA 1Y8OB 1AH9A 1EZ6A 4DAMA 2V4DA 1VQIA 3WDNA 1SNDA 3J81E 3GTPH 2OCEA 1EQVA 4FXKC 1X3PA 2QF7A 2I5HA 2KVMA 1A62A 2IWHA 1VQMA 1BCPB 4X64L 2ICIA 1GUSA 1E1TA 4EVOA 3TMEA 1IW7D 4A3GB 3KLWA 1FR3A 3PUYA 4K14A 1XTCD 1TWAH 4PZ7A 4A3FG 3I4NH 2BCOA 4FVMA 1G2TA 3KYHC 4NKLA 4A3DB 3AMUA 2VS1A 1U4LA 1WTRA 1AZPA 1QNUA 4K0KL 3TBIB 3F2BA 2EYPA 1A3TA 2E8GA 4BY7H 3X3MA 2G9HD 3J7AV 1L2FA 4BS9A 2WACA 1M1KC 1DOLA 2KA7A 1WCMG 4BY1B 2KENA 4Y52H 5LMUL 1O7IA 1V1QA 3CHBD 5TSSA 1O78A 3BG3A 2R93B 2UXBQ 4A3BG 4JI3L 3PO3B 1LTRD 3HOXG 4ZKCB 1ICFB 3R2IA 1Q86C 1OXVA 2P5ZX 1HR0L 4A3KB 3GP7A 4OWWB 2G5DA 3HOVH 1RKNA 4ID6A 1V43A 1K73C 1NMFA 4GOPB 3H0GB 3L7ZC 2CH4A 2QCPX 4JI6Q 2JJQA 3M4YA 1A3UA 2D0OA 2BH8A 2FFKB 3RZOB 2HD3A 4JI7L 3K5LA 2JA5B 3CMEA 4X3SA 1HZAA 2NB0A 1TQOA 4O1NA 3NQTA 3FHWA 3HOUB 1MI2A 1WI5A 3NTKA 4X64Q 5EPKA 3T4AC 3FPPA 2K6AA 5KYLA 1LT5D 4OO1G 1GJXA 2B29A 5CV7A 2XRSD 1I5FA 1ET6A 4A3LG 1HFNA 4WRDA 1VQ6A 1FGUA 3TREA 4B3ML 2AUJD 3NELA 2WAQG 3GV6A 4DV0Q 4K0KQ 3G4SA 4LF4Q 5FJ8H 2JA6B 1CA6A 2NVYH 4PMWA 1AP0A 1RHPA 1SNPA 1J6QA 1VQCA 4DXGA 4QGUA 4DV3L 2PMZB 1DONA 4C3JG 2M9VA 4IPGA 3BZKA 4JI3Q 2A73B 2E2JB 4DV5L 1SYDA 4FDBA 4G57A 1PXUA 1FNVA 2OTJA 1ILQA 3BVMA 2Z4HA 3AFPA 3MVVA 1XMOQ 1KABA 1OXXK 2ZJQA 1YIJA 2BDNA 1K28A 3PO2H 2UUBL 2ZTDA 2X6LA 2AWOA 4JOIC 4KJOA 3A8JE 3MXGA 2B63G 4A76A 1PH7A 2YU9H 1B2TA 1V9PA 1S5CD 1LT3D 2K5DA 3H91A 2TMPA 4R4QA 5AFWA 2VUMH 2G9DA 1VQLA 3S16H 1UE5A 1A63A 2IL8A 4CDEC 1JORA 4GLVB 1W6JA 4H02A 2IT1A 4DV1Q 5EKKA 2B2WC 1CUKA 3TS0A 4BBRH 4DXFA 1CHPD 1IL8A 1GHJA 2B2VA 1PYWD 4KV6A 4A3MH 2NWGA 3Q24A 1J5EQ 5M5YB 3J81j 1LTGD 3A74A 1KRTA 1BCPD 1XXGA 4A3FB 1Q1BA 3LNNA 2L55A 4P73A 4B3MQ 3T53B 4ZLTF 4R4CA 4RCNA 4MTNA 1X32A 2EYHA 3S1RB 1JICA 2EYLA 1BVSA 5CBEE 2KHJA 2AUKA 4JI1L 2R61A 2JXMB 3BVGA 3SE0A 3DXJC 4FF3A 3J80c 1PMRA 3N52A 4A3IG 4DV3Q 3CD6A 3RN5A 1MKHA 2IHEA 4HIKA 2ZXPA 4K5WA 2CW0C 1WCMB 4HMIA 4DV6L 4QIWE 4DV5Q 4ZAIA 2L12A 2H4OA 1Z47A 2K5QA 5CV5A 3S24A 4PMCA 1OXTA 4OX9L 2OTLA 3DEOA 4DFAA 3ZJYC 1Y1WG 3HOXB 4A93G 3K5OA 5AJ3L 4B08A 3CKIB 4HIMA 2B8GA 4K6DA 1XNQL 1SNMA 2UUBQ 3S1NB 2LS01 2EIFA 2AQ3B 1NTGA 4HAEA 5IY0A 1HNZL 4JVZA 1TWCB 5DLQE 1U4PA 5EKLA 1U4MA 4KHZA 4C3IH 1B7YB 2D62A 1EFID 2PQAB 3HKZG 1A6XA 1MGSA 5E4WC 5KNBA 4B9XA 1SYFA 1O7ZA 4BXXG 2IPKD 5IODA 1LTID 4ULLA 1YNXA 3J80E 1N33L 2Y0SG 3RLNA 4DR2L 2DNEA 3ONAB 5CYUA 5IWAQ 4GOPA 1VQOA 1EYAA 2EYOA 2OEOA 1D1KA 2L5TA 1DGSA 3I91A 3IFTA 4WJWA 2R7ZH 1TWGH 4DR6L 4E6IA 2A69D 1JR0D 3SGIA 3JAMc 1PH2A 3PV0A 3QWNA 1MHWC 2JA5H 3I73A 4CBVA 2KECA 2F0OA 4OGQC 1ET9A 5ELCA 2F0UA 4H13C 4L6TB 1UEAB 1CKNB 1BXTA 2WAQB 1I3QB 1Q1EA 5DM63 2F0LA 1PH4A 1LTLA 2KHSA 3D4RA 4OWXB 2NN6G 4CDCC 5JOBA 3KLRA 4O2DA 1PFNA 2Z4IA 1HNXQ 1EIYB 4B3TL 1SRUA 1N9WA 3BZDB 4DV6Q 1PZJD 2JN4A 1Q46A 5DNFA 1HR0W 1PZID 3ERSX 1HQRD 4C3JB 1UAPA 2BE5D 2LFNA 4A3JG 3HOZH 1GXDC 4I7AA 2KCMA 3CPWA 2QDLA 4UAIA 2AMCB 1XNQQ 1EIFA 4MNOA 3DEPA 4IUUA 4I65A 3JAME 4LF6Q 1G6ZA 1HNZQ 3U4VA 1M8AA 2RVLA 2PO4A 2F0GA 1VQHA 3T16A 2E2JH 5C3EH 2E2HB 4IPDA 2B63B 4BBSH 5KGUA 2IX3A 2F0KA 1AE2A 3C1FA 1JWMD 5IGGA 3FDTA 1D1IA 1TS5A 4Y7NB 5C0XJ 1B3AA 2UUAQ 3ULJA 1B53A 1VQ9A 3M4OH 3I2ZA 3J81i 4YCUA 1HNWL 2Z6BA 4AQYL 4C3HH 1LTAD 2B2TA 2JA8H 5GADC 2D2CC 1VQEA 4IUVA 1KIXA 1WTWA 3FPUB 4MTKA 3I72A 2A6HD 2D9UA 3H94A 2RCFA 4YY3Q 1HJPA 1EY4A 3TP7A 3SK6A 1PZKD 5JJIA 3TS2A 1GO3E 1ZXTA 3OWFA 3UI2A 3J7YW 1VQNA 1L0WA 1CKMA 2F4VL 2QKIC 1IKLA 1E24A 2SEBD 4JC0A 4DR7Q 1EY9A 3CCMA 2K32A 1NY4A 3L3OC 4A3FH 4B3TQ 1FYCA 1STNA 2N8NA 2O5JC 4A3IB 3FKIB 1JWSD 1YJNA 1R4QB 2K28A 4FF1A 1WFQA 4KLKA 2VNUD 1C9OA 2F0VA 1N34L 3C2PA 3VYTA 3W2DA 2OQKA 1K83B 3ULLA 2NVXH 1F2MA 3S2HH 1Y1WB 1GUTA 1TKWB 4A93B 4QIWB 4M1UB 5FLXL 3K7AH 1WCMH 1CFMA 4NP5A 4A3GG 1JE5A 4FXGC 5IT9c 1MJEA 3OOCA 2IX1A 5GAHC 2E76C 1U5KA 4A3BH 2F0WA 3HKZB 3LGJA 3KJPA 1SR3A 1VQ5A 1EUJA 1V8QA 5KEEA 4F8MA 5C0XG 1YVCA 3Q6SA 5HURA 1AN8A 3DUZA 4IOCA 2Y0SB 4AQYQ 1UE1A 3BU2A 1BCPF 3MA2B 4HJ5A 4DUZL 4MIUA 4PZ8A 1EQRA 2PQAA 4G4KA 2KUMA 2HDLA 2KCCA 1I50B 4IZ8A 1JWUD 4RGOS 3U58A 2L4NA 4XQJA 2RQXA 1IYUA 1KDCA 1W6KA 5CR3A 4HCEA 1MSHA 1SXTA 3P1HA 3BVZA 4F87A 3VYRA 4IPCA 4JI4L 3ND8A 1FJGL 4KY5A 4LFAL 1XNRQ 5CV6A 5IT9E 4G7OC 3TRZA 3HEJA 4LNQA 4OO1H 5K36G 5EJWA 5LMNL 2L9HA 3CU7A 2R3ZA 3H0GG 5COYA 3PF4A 4POFA 4GZYC 4A3LH 4NDXA 4WJ3M 1HA6A 1B9NA 2F0PA 1N34Q 5JAVA 1I4QA 2WB1B 2M00A 3PIO3 3FRPB 1SN8A 1QVGA 4AYBE 2NBFA 4A3JB 1KDBA 3SR1A 2EDGA 3D8GA 2ZTCA 1LT6D 5DM73 1WTVA 1HZ9A 4ILWA 5D14A 4N9PA 1IL2A 4KD3A 1NR4A 1WYDA 2CWAA 4ABNA 1PVOA 3QJYA 2J4XA 3EIVA 1NBWA 3TEHB 2E5LQ 4N8FA 1WD0A 2SDFA 3NBHB 3NENA 4C3JH 2WP8J 4KHVA 2WV6D 2A68C 3UE0A 1H9MA 4LFBQ 4DK3C 5M3FG 1EQQA 3IAYA 3E0EA 4ZQ3A 1QZGA 2PZTA 4F88A 1BKBA 1WVLA 4DUZQ 4DUYQ 2PW5A 1N36L 3F2CA 4LF9L 2NVTB 1TVXA 3IFDA 2DY7A 1KAWA 5E4XA 3J81c 2B63H 1CI3M 2N55A 3U9OA 2CWPA 3RN2A 1CZWA 3MXUA 5IE8A 4CJ1B 3NE5B 3CCLA 1STYA 5JJKA 1K8GA 1NE3A 1Y1VG 5M5XH 2OT2A 4JI4Q 1I6HB 4L5RC 1WTXA 5LHY1 2WKCA 1ZYRC 3CRKC 2MNAA 4YHHL 5IYBH 3EQLC 2F0MA 1G51A 2Z0SA 3CC2A 3PUVA 3PIPA 5DAUA 1IYVA 3S1QB 2JA7H 5KRUA 2SNSA 1F9RA 1B8AA 3QG1A 1B3QA 1E22A 2F0IA 3HOYG 4XXEA 3VYUA 1FVIA 1NUCA 3CQZH 1I6VC 2NYZD 2OQ0A 3R8BA 1JQYD 2PYKA 2PI2E 2YTXA 3CCRA 3KDFA 1CA5A 3J7A5 1EL0A 4ME3A 3KJOA 1JJCB 3E0JA 3HGBA 2D5DA 2BA1A 3CAMA 3E5SA 1SYCA 4KJNA 1STAA 2YYZA 5KYIA 3I4MG 2VY3A 1GHKA 1BNZA 3PIP3 3HP3A 3K5MA 1ENCA 5J39A 1RF2D 1FNUA 4BA2I 3NK9A 1HTLD 4C2MB 2SNMA 4XT3B 1CSQA 3M9BA 3LX0A 5ELDA 1IW7C 1Y1WH 3FP9A 3IRBA 4Z9CB 1L0XB 1VQ7A 1Y8NB 2K14A 1KLGD 2EPBA 3BJUA 3J80i 4JI0L 4CDDC 1TY0A 4LF9Q 4UY8C 2K52A 2WKDA 4LW1A 3GTLH 5M3MH 5C4XG 1Q7YC 1IKMA 4DNRB 1C8CA 4LUOA 3LWUA 1DOMA 4I7ZC 3OTOL 2LSSA 4JYAQ 3K7UC 1EY8A 1L0YB 4XIGS 1YZ6A 4B3RL 3OYYA 3RD4A 4BXXH 3I55A 2F1MA 3E9IA 1I94Q 1E2WA 4RMFA 2RHQB 4IJHA 1RTNA 2HQLA 1G91A 1O7YA 3IKJA 3M7GA 1GUGA 1EU4A 1V1PA 4GN5A 4XTCS 4YHHQ 5I2YA 4C1NI 2F03A 1WTOA 3OW7A 4KMUC 1A15A 1Q82C 3K81C 1PDQA 1W2BA 1BBUA 3MEHA 4QB4A 4EQNA 1EOVA 1TXYA 3HOWB 1CT1D 1K9MC 1Q12A 1Q8KA 2K5VA 4A4IA 1WD1A 2HIXA 1LT4D 1SNQA 3H09A 5JJZA 4DR5L 4ZRZA 3UDXA 3EBEA 5FLMG 4HIDA 4LJZC 4P71A 1YNJD 4KD4A 3VR2A 4YIJA 2E2IH 2WIIB 2NN6H 3EN2A 4JV5L 2XVSA 4L8JA 5I9PA 1II3A 2MO0A 2K03A 2F0JA 2HT1A 2HCCA 5CV4A 1SNCA 3S17H 4H0LC 1SMYC 2B2YC 3PF5A 3JAMi 3TN2A 5IGCA 2GN5A 4HSPA 1STGA 2ES2A 1B50A 2CFMA 1K0SA 1F2LA 1VF7A 3VA5A 1A2TA 1VMPA 3S2DH 1X54A 1YHBA 2KEDA 5M3FB 1E1OA 3HRZC 2NZ1D 4P2CB 4JI0Q 2Z6KC 4IFDJ 3NBHA 3MXPA 4RFBA 1R9TB 2HUGA 3OMGA 2LMCB 4K2KA 3OTOQ 1DCZA 2TSSA 3A8KE 2EY6A 2PNHA 4B3RQ 3EVQA 4GKJL 1TT2A 5JVH3 5LMUQ 2I5LX 1LV9A 1JJ2A 1EIHA 1XTDA 1X55A 1IZ6A 1ICWA 1TWFB 5LMNW 4FF2A 4YCVA 1HHVA 1Y1VB 1H9KA 4DV2L 1CTMA 1F9QA 1PTOB 1HR0Q 2ASBA 2EXDA 4DAPA 5LL6X 4RA8A 1KQSA 4K6LA 3RZDB 4V0BA 1VQKA 2KQ3A 4GNXB 2NVQH 5JEAH 2ALYB 2HDMA 1UE7A 3I4OA 2O5IC 3C1EA 1LYLA 5I9OA 3S15B 1RD9D 1EY0A 4GKKL 1RIPA 4JI7Q 4QF4A 1XWEA 2ZJRA 5EPJA 3HOYB 1EWHA 1XJVA 4APVA 2DNCA 1HTPA 5CMDA 4DF7A 1X3EA 2Z9HA 3M4QA 1CM9A 5K5PA 3W3AA 3Q8DA 4JOIA 4NMZA 2EOTA 3OIPA 3F8TA 1L1OC 1TWHH 2H5XA 3T1YL 3I4MB 4DNTB 1PYBA 2JA9A 4JBWA 2UUCL 1WOCA 2MQHA 3A54A 2K50A 4DV7L 2XIWA 3E9HA 4GN3B 4M8AA 4RGMA 1YJWA 2R92G 1BCPC 1LTTD 1JOOA 3A8IE 3KF6B 1KD1C 4A3CH 4IFDG 4KN4C 2F3VA 2E2DC 2QEJC 3O13A 1BOSA 4A3GH 5C4XB 4FP5D 4K8IA 4YWKA 4F7XA 2I0QA 3FKIG 3NQIA 4A3DH 1IYJB 1IBML 4JI5L 1PRTC 3LWEA 5DEHA 4XYQA 3PQIA 3Q0AA 1CKOA 1C48A 1PH9A 1EWCA 2EY2A 4DV2Q 2K05A 3CPFA
chains in the Genus database with same CATH topology
4U68A 2IX0A 4C56C 5J22A 4V190 1RDPD 2J7ZA 5A2QL 4KI0A 4RGTA 3VR4A 5KIXA 1PFMA 3SK4A 3CRLC 3GTJB 2BDOA 3Q23A 3OSOA 4R8IA 3KBGA 3ZYYX 5C4JB 4RWSC 3N6RA 4EQPA 4XYOA 1AW7A 1PLFA 4CJ0B 3TSSA 5CORA 3GTQB 3R2TA 1SE4A 1GUWA 5JPMC 2MJ8A 3T51B 2BOSA 3G7LA 2A69C 3QOJA 1XYIA 3NBIA 5EGTA 2DY8A 4DK0A 3HS0C 2MP1A 1JCKB 2VB3X 1HCZA 4A3EB 4UDUC 5BN5A 3P7JA 1SE2A 4FO2A 5HGTA 3GTOB 2A6EC 1B1ZA 1LABA 3K58A 3FVQA 3SHLA 2LY7A 4TSSA 1HQMC 2LKVA 1CQVA 2B39A 2BE5C 5ELEA 1PTOD 3S1MB 4PQXA 5M5WB 1CK1A 5T1IA 3DM1A 1U4RA 3VR6A 5T1GA 1ESRA 4DK1A 1OO9B 3M3YB 5I6YA 3NPPA 2ICEC 3GTMB 1WTQA 3GTGB 4QUCA 2WINB 5CV9A 3KLSX 3S14B 5D3DA 1ILPA 1F2YA 2MHVA 3TZUA 1D6EC 2A74C 1JC7A 1HXYD 4HTHA 5C44B 1B4OA 1S5ED 1EY5A 1RODA 3OMCA 3D31A 5BN3A 4KKSA 3TP5A 1SFOB 2R92B 2A6HC 1BQQT 1UUPA 3RUZA 1U9RA 1FNWA 4OL7A 4ZYSA 1QCBD 5A2QE 3TDQA 1PFBA 1H9SB 3I3CA 1ESFA 3GTKB 2B2UC 5IIFA 3NHHA 4CJ2C 3C3LA 4J1MA 1A3VA 1KNEA 3GTPB 1X3QA 2X6GA 1HA5A 2MUYA 3SDZA 2F0DA 2N88A 2K7VA 1TWAB 3M7NA 3I4NB 3NWSA 1B44D 4J8QA 1Q8IA 2CVRA 1CQFA 3ITPA 4CKEA 2PPBC 3SXHA 1F2ZA 2EJGC 5KNCA 4BY7B 1B9MA 3EJIA 4FNFA 2K1BA 2EXZA 1V1PB 1SJED 4IUNA 2I46A 1BO0A 4OO1I 3BS1A 1LTBD 5ELFA 1JOQA 1D5XC 3R3OA 2EJMA 1I4PA 1QOHA 1TIID 3SEBA 1AFPA 1NSNS 3OHXC 3HOVB 2EYFA 2BA0A 4RHSA 2Z1CA 2I07B 4C3IG 4Q0FA 3IL8A 1BDOA 2EYMA 2X69A 3TZDA 1TU2B 4EQOA 4S3SA 1EU3A 2FHTA 5D3IB 2K04A 1M4VA 4K2LA 1H9JA 5FKAC 1EZ8A 2QDBA 2ID0A 4DAVA 1CZGA 3ERQA 4QMGA 4IALA 1Z7TA 1VF5C 1Z6HA 2JP1A 3NUCA 1O7LA 2NVYB 3K59A 3V2TA 5NUCA 2F4IA 1IHZA 4DAYA 5FOBB 4H7BA 1R4PB 3EFXD 5FO8B 5C6AA 2M2LA 5IGEA 1I4HA 1NCVA 3NTHA 3P20A 2NTTA 2ENBA 2OXPA 1KTKA 4PNYA 3L9AX 4HN7A 2KEEA 3GD7A 1I4RA 2HQEA 4CGYB 2SOBA 2IW3A 5FLXE 2YU9B 3PUWA 5IOCA 2VUMB 2K33A 1PTOF 2HCIA 3S16B 4KN7C 3BDCA 1YNND 4K5XA 2RSNA 3Q22A 4NW2A 4R8NA 4C3HG 4OHJA 4BBRB 2JEAI 1H9SA 3KK7A 4FF4A 1QNKA 4X3TA 1BBXC 4RAUC 5EPLA 4QCLA 4B9WA 1BR9A 5I2XA 2AQ2B 2EYJA 1TR5A 4L63B 2JSOA 4K5VA 5EBCA 2DN8A 4OIKA 2ZT9C 2FMMA 4TQUS 1G291 1MSGA 3KBXA 3I70A 1QG7A 1PRTB 1SYGA 2R6GA 2KCNA 4KKTA 2RDGA 4Q5VA 4XQNA 2MGSA 4RH6A 5IGBA 4ZUJA 2NN6I 1E0BA 2PZWA 2Q8RE 2EJFC 5CBAE 4X3KA 4C3IB 4R9WA 1F9SA 4HR7B 3BYYB 3AU7A 1EEFD 4HCSA 2L11A 4EGVA 1DXMA 2FJ2A 4IQZA 4OIJA 4CHTB 3DHQA 3V05A 3MFYA 1YNJC 3T13A 5C4ZA 2R7ZB 4AYBB 1TWGB 5ELBA 1NR2A 4ME5A 1E2ZA 1SMYD 2EY5A 1G2SA 1GUNA 2PW7A 2NUCA 3D4WA 1QWYA 2B2YA 2XRQD 4PMBA 3VA7A 2EZVA 3J80L 4KY6A 2RBMA 2ZXOA 3HG9A 4CKBA 3BDOA 5A35A 3HOZB 2EY1A 3G6JB 4H44C 4FYDA 4LAAA 1Q90A 4IUPA 3QO2A 3QIAA 3SK8A 3VR3A 2K01A 2VXWA 2E74C 1JOKA 2RKSA 3MXNA 1QE6A 5I4DA 4DGZA 5C3EB 4CKCA 3MAQA 4BBSB 2H1EA 1FGBD 3TP6A 2F0SA 3PUXA 1NAPA 2PQEA 1DJRD 3H6MA 3M4OB 1SJHD 2B2VC 5D65A 4C3HB 1K8OA 3EROA 1LACA 2JA8B 2Z8LA 4O42A 1BUVT 4TKOB 3I4LA 2C5CA 1HUNA 1SE3A 3RLFA 3MC0B 5KNDA 3JAML 3VYSA 4KY7A 5C0XI 2B2WA 1J8IA 1ENAA 4PV1C 1STBA 5G3LD 2O4XA 3OWEB 5EQ0A 1F77A 3U9SA 1F9PA 3V96A 3R93A 1DM0B 5I6WA 5CC4A 1HUMA 3FMCA 3P75A 5C0XH 3SVMA 2IJ0A 1TS4A 2AWNA 2XNAC 1PRTD 2CW0D 1TS3A 2NVXB 3S2HB 4ZK9B 2CQAA 4HMJA 3K57A 1CHQD 3NTIA 2XWJB 3NSWA 3K7AB 1SDFA 3EA6A 2F3WA 1BF4A 1V1OA 4N9TA 4RGNA 4A3BB 1I4GA 4HEDA 4BWGB 2OF1A 4RKBA 5LL6S 5ISRA 1GUOA 1T5EA 2KOLA 3QOLA 1KAAA 5K36H 1QJOA 1SYEA 3MZ5A 1STEA 2KJXA 1VCIA 2RSOA 2QILA 4IURA 3WOEA 3E6ZX 3URYA 1D5MC 3I90A 5CGKA 1DYQA 4KK7A 3WOFA 5JEAJ 1TY2A 4ZKBB 1VMCA 1J9OA 1H9RA 3VR5A 4RKLA 3TP8A 4DN4M 2PZUA 3DWPA 1DOKA 5FK9C 2A6ED 5IGDA 2JE6I 2F0QA 1UNSA 4IN3A 1ENFA 4KKUA 1HRJA 3RMHA 4RCOA 1TS2A 5IT9L 3K0YA 1PTOC 2FMCA 2PNRC 2Q8TA 2J0TD 3GV3A 4X3UA 1PTOH 1S5FD 3F2UA 2CHBD 4QUFA 4ODGA 2PCFB 3D4DA 1XX8A 2F0HA 2VB2X 2B2TC 1DD2A 2Q8IB 5E1FA 3FEWX 4J6HA 1D5ZC 5C5MA 1ML0D 2F0FA 1LLRD 1S5BD 1EIGA 3GO5A 5M5XB 1FD7D 2XN9C 1SNOA 1OXSC 4U673 2XSCA 3D3RA 3DWQA 1KNAA 4TRDA 5JEAG 3NP8A 3DMUA 1Q3LA 2E75C 3SK5A 1QB5D 1EQTA 1OXUA 2JA7B 1QILA 1SBBB 3H3VC 3QB3A 4KTAA 3I8ZA 4LK1C 3CQZB 4MHEA 1LO5D 1HPCA 5M9OA 1S4ZA 4XQQA 2RA4A 4K8JA 2MPMA 2K5WA 1SSOA 3D6WA 1KDAA 5CV8A 2B2UA 3X3NA 5C3WA 5J1ZA 1ZEQX 5JPNC 1KLUD 3A55A 1JE4A 4G7HC 1A2UA 1EY6A 2JYOA 2O2LD 3GTLB 3K5NA 5M3MB 1ZKOA 3PUZA 4LMQD 1DZ1A 3MWYW 3J81L 5E3FA 1HFGA 2NTSA 3HZXA 4ZUIA 2B8FA 4MN3A 1EOTA 1SYBA 2F0TA 3C46A 1K8MA 5G3LF 3KF8A 2JEBI 3AB9A 5EKIA 2XWBB 3DWAA 3MTSA 3MHBA 4FXDA 1AEXA 1MD2D 2RDFA 4IUQA 3GQBA 3OIQA 1PRTF 4BA1I 3A56A 1WTPA 1JB3A 5FO7B 3OPOA 1GOZA 2EVBA 2E2IB 5C3XA 2C9OA 3A7AB 3A7LA 3J7AF 3KUPA 3MFGA 3S17B 2L0CA 5IGFA 1SAPA 2AQ1B 2EE1A 3BYTB 1E2VA 5EBDA 3NWTA 1I4XA 1EY7A 5C4HA 4DU9A 1EYCA 1Y69U 3S2DB 1T5XD 4G7ZC 2L1BA 1O80A 3D6CA 2A68D 1D2BA 3ND9A 1RJTA 1EYDA 3K6OA 1STHA 3PMFA 1Y8PB 5JVG3 2A5HA 2GA4B 3T56B 4WFN3 1LTSD 4RHRA 1AZQA 4IFDI 3KLSA 3NXWA 2RDHA 1MBYA 1S5DD 1EEID 3PO2B 2NVQB 3S9WA 1C4QA 1ZYRD 1SEBD 3BDLA 5C5LA 2F0EA 4IUTA 4IFDH 4HSVA 2ZXRA 3M85A 1RTOA 5BN4A 4WORA 5F2DA 4XDXA 4C1NK 1G8ZD 4DA2A 4XT1B 4A3MB 2F0NA 4JK1C 1TWHB 1YNNC 1RCVD 1VDZA 5FO9B 2FINB 1ONLA 1Y8OB 1EZ6A 2V4DA 3WDNA 1SNDA 3J81E 1EQVA 4FXKC 1X3PA 2QF7A 2KVMA 2IWHA 1BCPB 2ICIA 1GUSA 4EVOA 3TMEA 1IW7D 4A3GB 1FR3A 3PUYA 4K14A 1XTCD 2BCOA 4FVMA 1G2TA 4NKLA 4A3DB 3AMUA 1U4LA 1WTRA 1AZPA 1QNUA 3TBIB 2EYPA 1A3TA 3X3MA 2G9HD 3J7AV 4BS9A 2WACA 1DOLA 2KA7A 4BY1B 3CHBD 5TSSA 1O78A 3BG3A 2R93B 3PO3B 1LTRD 4ZKCB 3R2IA 1OXVA 4A3KB 3GP7A 1RKNA 4ID6A 1V43A 3H0GB 3L7ZC 2QCPX 3M4YA 1A3UA 2FFKB 3RZOB 3K5LA 2JA5B 4X3SA 2NB0A 1TQOA 4O1NA 3NQTA 3HOUB 1MI2A 3NTKA 5EPKA 3T4AC 3FPPA 2K6AA 5KYLA 1LT5D 4OO1G 1GJXA 5CV7A 2XRSD 1ET6A 1HFNA 4WRDA 2AUJD 3GV6A 2JA6B 1CA6A 4PMWA 1AP0A 1RHPA 1SNPA 4DXGA 2PMZB 1DONA 4C3JG 2M9VA 2A73B 2E2JB 1SYDA 4G57A 1PXUA 1FNVA 1ILQA 3BVMA 2Z4HA 3MVVA 1KABA 1OXXK 2BDNA 2X6LA 2AWOA 4KJOA 3A8JE 3MXGA 1B2TA 1S5CD 1LT3D 2K5DA 3H91A 2TMPA 5AFWA 2G9DA 2IL8A 1JORA 1W6JA 2IT1A 5EKKA 2B2WC 4DXFA 1CHPD 1IL8A 1GHJA 2B2VA 1PYWD 4KV6A 2NWGA 3Q24A 5M5YB 1LTGD 1BCPD 1XXGA 4A3FB 1Q1BA 3LNNA 2L55A 3T53B 4ZLTF 4RCNA 1X32A 2EYHA 3S1RB 1JICA 2EYLA 5CBEE 2AUKA 2R61A 2JXMB 3BVGA 3SE0A 3DXJC 4FF3A 1PMRA 3N52A 2ZXPA 4K5WA 2CW0C 1WCMB 4HMIA 4ZAIA 2L12A 2H4OA 1Z47A 2K5QA 5CV5A 4PMCA 1OXTA 3DEOA 4DFAA 3HOXB 3K5OA 4B08A 3CKIB 2B8GA 4K6DA 1SNMA 3S1NB 2LS01 2AQ3B 4HAEA 5EKLA 1TWCB 1U4PA 1U4MA 4KHZA 2D62A 1EFID 1A6XA 1MGSA 5E4WC 5KNBA 4B9XA 1SYFA 1O7ZA 2IPKD 5IODA 1LTID 4ULLA 3J80E 2DNEA 3ONAB 5CYUA 1EYAA 2EYOA 2OEOA 1D1KA 2L5TA 3I91A 3IFTA 4WJWA 4E6IA 2A69D 1JR0D 3PV0A 3QWNA 3I73A 4CBVA 2KECA 2F0OA 4OGQC 1ET9A 5ELCA 2F0UA 4H13C 4L6TB 1UEAB 1BXTA 2WAQB 1I3QB 1Q1EA 5DM63 2F0LA 2KHSA 3D4RA 2NN6G 5JOBA 3KLRA 1PFNA 2Z4IA 3BZDB 1PZJD 5DNFA 1PZID 1HQRD 4C3JB 1UAPA 2BE5D 2LFNA 1GXDC 4UAIA 3DEPA 4IUUA 4I65A 3JAME 1G6ZA 1M8AA 2RVLA 2PO4A 2F0GA 3T16A 2E2HB 2B63B 5KGUA 2IX3A 2F0KA 3C1FA 1JWMD 5IGGA 3FDTA 1D1IA 1TS5A 4Y7NB 5C0XJ 1B3AA 1B53A 1LTAD 2B2TA 2D2CC 4IUVA 1WTWA 3FPUB 3I72A 2A6HD 2D9UA 3H94A 1EY4A 3TP7A 3SK6A 1PZKD 1ZXTA 3OWFA 3UI2A 3J7YW 2QKIC 1IKLA 2SEBD 1EY9A 2K32A 3L3OC 1FYCA 1STNA 2O5JC 4A3IB 3FKIB 1JWSD 1R4QB 2K28A 4FF1A 2VNUD 2F0VA 3C2PA 3VYTA 3W2DA 1K83B 1F2MA 1Y1WB 1GUTA 1TKWB 4A93B 4QIWB 4M1UB 5FLXL 1CFMA 4NP5A 4FXGC 3OOCA 2IX1A 2E76C 2F0WA 3HKZB 1V8QA 5KEEA 5C0XG 4F8MA 3Q6SA 5HURA 1AN8A 3DUZA 2Y0SB 1BCPF 3MA2B 4MIUA 4G4KA 2KUMA 2HDLA 2KCCA 1I50B 4IZ8A 1JWUD 4RGOS 2L4NA 4XQJA 2RQXA 1IYUA 1KDCA 1W6KA 5CR3A 4HCEA 1MSHA 1SXTA 3P1HA 3BVZA 4F87A 3VYRA 3ND8A 4KY5A 5CV6A 5IT9E 4G7OC 3HEJA 4OO1H 5K36G 5EJWA 2L9HA 3CU7A 2R3ZA 5COYA 4GZYC 4NDXA 1HA6A 1B9NA 2F0PA 5JAVA 1I4QA 2WB1B 2M00A 3PIO3 3FRPB 2NBFA 4A3JB 1KDBA 3SR1A 2EDGA 3D8GA 1LT6D 5DM73 1WTVA 4ILWA 5D14A 4N9PA 4KD3A 1NR4A 4ABNA 3QJYA 2J4XA 1WD0A 2SDFA 2WP8J 4KHVA 2WV6D 2A68C 1H9MA 3IAYA 4ZQ3A 2PZTA 4F88A 1WVLA 2PW5A 2NVTB 1TVXA 3IFDA 2DY7A 5E4XA 1CI3M 2N55A 3U9OA 1CZWA 3MXUA 4CJ1B 3NE5B 1STYA 2OT2A 1I6HB 1WTXA 5LHY1 2WKCA 1ZYRC 3CRKC 3EQLC 2F0MA 3PUVA 5DAUA 1IYVA 3S1QB 5KRUA 2SNSA 1F9RA 3QG1A 2F0IA 4XXEA 3VYUA 1NUCA 1I6VC 2NYZD 3R8BA 1JQYD 2PYKA 1CA5A 1EL0A 3E0JA 3HGBA 2D5DA 2BA1A 3E5SA 1SYCA 4KJNA 1STAA 2YYZA 5KYIA 1GHKA 1BNZA 3PIP3 3HP3A 3K5MA 1ENCA 5J39A 1RF2D 1FNUA 4BA2I 3NK9A 1HTLD 4C2MB 2SNMA 4XT3B 3LX0A 5ELDA 1IW7C 4Z9CB 1L0XB 1Y8NB 1KLGD 2EPBA 1TY0A 2WKDA 1IKMA 4DNRB 1C8CA 3LWUA 1DOMA 4I7ZC 1EY8A 1L0YB 4XIGS 3RD4A 2F1MA 1E2WA 1RTNA 1G91A 1O7YA 3IKJA 3M7GA 1GUGA 1EU4A 1V1PA 4XTCS 5I2YA 4C1NI 2F03A 1WTOA 3OW7A 1A15A 1PDQA 3MEHA 4QB4A 3HOWB 4EQNA 1CT1D 1Q12A 1WD1A 1LT4D 1SNQA 3H09A 5JJZA 4ZRZA 4LJZC 1YNJD 4KD4A 3VR2A 4YIJA 2WIIB 2NN6H 2XVSA 4L8JA 5I9PA 1II3A 2K03A 2F0JA 2HCCA 5CV4A 1SNCA 4H0LC 1SMYC 2B2YC 3TN2A 5IGCA 4HSPA 1STGA 1B50A 1F2LA 1VF7A 3VA5A 1A2TA 1VMPA 2KEDA 5M3FB 3HRZC 2NZ1D 4P2CB 4IFDJ 3NBHA 3MXPA 4RFBA 1R9TB 2HUGA 3OMGA 2LMCB 4K2KA 1DCZA 2TSSA 3A8KE 2EY6A 3EVQA 1TT2A 5JVH3 1LV9A 1EIHA 1TWFB 1ICWA 4FF2A 1HHVA 1Y1VB 1H9KA 1CTMA 1F9QA 1PTOB 4DAPA 5LL6X 4RA8A 4K6LA 3RZDB 4V0BA 2KQ3A 5JEAH 2HDMA 2O5IC 3C1EA 5I9OA 3S15B 1RD9D 1EY0A 4QF4A 1XWEA 5EPJA 3HOYB 1EWHA 2DNCA 1HTPA 5CMDA 4DF7A 1CM9A 5K5PA 3W3AA 4NMZA 2EOTA 3OIPA 3I4MB 4DNTB 4JBWA 3A54A 2XIWA 4M8AA 4RGMA 1BCPC 1LTTD 1JOOA 3A8IE 4IFDG 4KN4C 2F3VA 2E2DC 2QEJC 3O13A 1BOSA 5C4XB 4FP5D 4K8IA 4F7XA 3NQIA 1PRTC 3LWEA 5DEHA 4XYQA 3Q0AA 1C48A 1EWCA 2EY2A 2K05A 4KMUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 3;  4WFN 3;  5JVG 3;  3PIO 3;  5JVH 3;  3PIP 3;  4U67 3;  5DM6 3; 
#chains in the Genus database with same CATH topology
 5IYC H;  4U68 A;  4ZCK A;  5IP9 G;  2IX0 A;  4C56 C;  3H15 A;  5J22 A;  4V19 0;  1RDP D;  2J7Z A;  4P72 A;  5A2Q L;  4KI0 A;  4RGT A;  3VR4 A;  1PHJ A;  4PZ6 A;  4BY1 H;  5KIX A;  1PFM A;  3SK4 A;  3CRL C;  3I4N G;  3GTJ B;  2BDO A;  2R93 H;  3Q23 A;  3PO3 H;  4GKK Q;  2K4K A;  3F2D A;  2VZA A;  2KBN A;  5IP7 H;  3OSO A;  4R8I A;  3KBG A;  3ZYY X;  5C4J B;  4A3K H;  4RWS C;  3HFZ B;  3N6R A;  3L2P A;  4GOP C;  4BY7 G;  2Q2U A;  4JI2 L;  3H0G H;  1Q81 C;  4EQP A;  4XYO A;  4GLX A;  4POG A;  1VQF A;  1AW7 A;  2N78 A;  1PLF A;  4CJ0 B;  3TSS A;  1S40 A;  4DR4 L;  3RZO H;  5COR A;  3GTQ B;  3R2T A;  1SE4 A;  1GUW A;  5BR8 L;  5JPM C;  2MJ8 A;  3T51 B;  1UWV A;  2A1A A;  4HIO A;  2BOS A;  3G7L A;  3RLO A;  3HOU H;  2A69 C;  3QOJ A;  1NJI C;  4JI1 Q;  1XYI A;  3NBI A;  5EGT A;  2DY8 A;  3KFU A;  4DK0 A;  3HS0 C;  2MP1 A;  1JCK B;  1UE6 A;  2RCN A;  2VB3 X;  3AQQ A;  1HCZ A;  4A3E B;  4UDU C;  5BN5 A;  5M3F H;  3P7J A;  1SE2 A;  1OTC A;  4FO2 A;  5IYD H;  5HGT A;  2WB1 G;  4OX9 Q;  3GTO B;  1K0R A;  2A6E C;  1B1Z A;  1LAB A;  3K58 A;  1VQD A;  2JA6 H;  3FVQ A;  3SHL A;  5AJ3 Q;  2LY7 A;  4TSS A;  1YI2 A;  1HQM C;  1IBL L;  2LKV A;  5ELN A;  4YWM A;  1CQV A;  4X65 L;  2B39 A;  2BE5 C;  5ELE A;  1PTO D;  4J15 A;  3S1M B;  4PQX A;  5M5W B;  1N32 L;  2CQO A;  1CK1 A;  5T1I A;  3DM1 A;  1U4R A;  1Y1V H;  3VR6 A;  1S72 A;  5T1G A;  3K80 C;  1ESR A;  1JT8 A;  4DK1 A;  1OO9 B;  4DAY B;  3M3Y B;  5I6Y A;  3NPP A;  5GQO A;  2ZTE A;  1N33 Q;  2ICE C;  3GTM B;  3G48 A;  4DR2 Q;  1WTQ A;  4QUC A;  3GTG B;  2WIN B;  4GNX A;  4R4T A;  5CV9 A;  5FJ8 G;  1EWI A;  1WJJ A;  3KLS X;  3S14 B;  5D3D A;  3S15 H;  4DR6 Q;  1ILP A;  1F2Y A;  2MHV A;  4DR4 Q;  2KHI A;  3TZU A;  1D6E C;  2A74 C;  1JC7 A;  5BR8 Q;  1HXY D;  4HTH A;  5C44 B;  1B4O A;  3K8A A;  2UXD L;  1S5E D;  1EY5 A;  1ROD A;  3OMC A;  1JJG A;  3D31 A;  5BN3 A;  4KKS A;  3TP5 A;  1SFO B;  2R92 B;  2D0P A;  2A6H C;  1BQQ T;  1UUP A;  3RUZ A;  1U9R A;  1FNW A;  4OL7 A;  4OEM B;  5M5Y H;  4ZYS A;  1GVP A;  1HZC A;  4DPG A;  2CH4 W;  4AIM A;  1QCB D;  3KDF B;  1PH3 A;  5A2Q E;  3AYH B;  3TDQ A;  1PFB A;  1H9S B;  1JB7 A;  3I3C A;  3J7Z C;  1ESF A;  3KF6 A;  3GTK B;  3S1R H;  2VW9 A;  2B2U C;  5IIF A;  3NHH A;  2DGY A;  4CJ2 C;  3C3L A;  2UXC L;  1FL0 A;  2YTV A;  4UHV A;  4J1M A;  2Q2T A;  1A3V A;  4OON A;  4JCV E;  1KNE A;  1QVF A;  3GTP B;  1PYS B;  1X3Q A;  2X6G A;  4JI8 L;  1HA5 A;  5ELO A;  2GVB A;  2MUY A;  3SDZ A;  1AE3 A;  2F0D A;  1N32 Q;  3UDF A;  4TVA B;  2N88 A;  2K7V A;  1TWA B;  1VQJ A;  3M7N A;  3I4N B;  1RL2 A;  4QQB X;  3NWS A;  1B44 D;  4J8Q A;  1Q8I A;  2CVR A;  1CQF A;  3ITP A;  3HOX H;  1QUQ B;  2CKZ B;  1ASZ A;  4CKE A;  2PPB C;  1QVC A;  3SXH A;  1LUZ A;  3S1N H;  1F2Z A;  2EJG C;  2Q2H A;  1HNW Q;  5KNC A;  2OWO A;  4LF5 L;  4BY7 B;  3B6Y A;  1B9M A;  1EYG A;  1TWC H;  3EJI A;  4FNF A;  2K1B A;  2EXZ A;  1V1P B;  4R4O A;  1SJE D;  4IUN A;  2I46 A;  1BO0 A;  4HJ7 A;  4OO1 I;  3BS1 A;  1X56 A;  2VQF L;  1LTB D;  5ELF A;  1JOQ A;  4QY7 A;  1D5X C;  3R3O A;  2QEX A;  2F4V Q;  2EJM A;  1I4P A;  1QOH A;  2YV5 A;  1TII D;  4O0A A;  1SMX A;  3SEB A;  1AFP A;  1NSN S;  5HY6 A;  3HOW G;  3OHX C;  3HOV B;  1UEB A;  2EYF A;  2BA0 A;  4JPB W;  4RHS A;  3CCQ A;  2Z1C A;  2I07 B;  4C3I G;  4Q0F A;  3IL8 A;  1T9H A;  1X3G A;  2UXC Q;  1I3Q H;  1BDO A;  4LWC A;  2EYM A;  4DKA C;  2X69 A;  3TZD A;  3UDI A;  1Y14 B;  4JI8 Q;  4UPA A;  4MZ9 A;  1TU2 B;  4EQO A;  4S3S A;  1EU3 A;  2FHT A;  4HJ8 A;  1PV4 A;  3D0F A;  5D3I B;  2K04 A;  1M4V A;  4K2L A;  3CCS A;  1H9J A;  4AYB G;  5FKA C;  1EZ8 A;  3GTO H;  2QDB A;  2ID0 A;  2DJF C;  4DAV A;  1CZG A;  3F1Z A;  3STB D;  1E7Z A;  1K8A C;  1KHI A;  1SLJ A;  1HH2 P;  4UP7 A;  3ERQ A;  4QMG A;  4IAL A;  5FLX c;  1Z7T A;  1VF5 C;  4YWL A;  2C35 B;  4LF5 Q;  1Z6H A;  2JP1 A;  3S1M H;  3NUC A;  1O7L A;  2NVY B;  3K59 A;  3V2T A;  5NUC A;  2E2H H;  3CCV A;  1XPU A;  2F4I A;  1IHZ A;  4H7B A;  4DAY A;  5FOB B;  1R4P B;  3EFX D;  5FO8 B;  5C6A A;  2RHS B;  2M2L A;  5IGE A;  2VQF Q;  4DNI A;  4LF8 L;  1I4H A;  1NCV A;  3NTH A;  3P20 A;  4Y7N H;  3GTG H;  2PMZ E;  2NTT A;  3L0O A;  1FJG Q;  3HOZ G;  2ENB A;  4LFA Q;  2OXP A;  1U0L A;  3U50 C;  1KTK A;  4PNY A;  3NEM A;  3L9A X;  4HN7 A;  4IPH A;  3AEV A;  2KEE A;  2JQO A;  3I56 A;  3GD7 A;  5LMN Q;  5HGQ A;  1I4R A;  2HQE A;  3I7F A;  4CGY B;  2SOB A;  1JMC A;  3WWV A;  2IW3 A;  5FLX E;  2YU9 B;  1SFO H;  2UXB L;  3PUW A;  3UDG A;  5IOC A;  2VUM B;  2K33 A;  4AH6 A;  1PTO F;  2HCI A;  4N8X 1;  1VQB A;  3S16 B;  2ZM6 L;  4KN7 C;  3BDC A;  3RNU A;  1YNN D;  4K5X A;  2RSN A;  3Q22 A;  4NW2 A;  4R8N A;  4C3H G;  3HKS A;  4OHJ A;  3W1B A;  4BBR B;  5GAE C;  4A3I H;  1XMQ L;  3BZC A;  1H9S A;  3FKI H;  3KK7 A;  4FF4 A;  2JA8 G;  2JEA I;  1K3R A;  1QNK A;  4OXP A;  3GTK H;  4X3T A;  1VQP A;  1L1O B;  1K83 H;  5IP9 H;  3VDY A;  1BBX C;  5EAY A;  4A93 H;  1B70 B;  4RAU C;  5EPL A;  4QCL A;  4B9W A;  1BR9 A;  5I2X A;  2AQ2 B;  2EYJ A;  1TR5 A;  4L63 B;  1N36 Q;  2JSO A;  4K5V A;  5EBC A;  1VQG A;  1X6O A;  2DN8 A;  4GN4 B;  4OIK A;  2ZT9 C;  2FMM A;  2F3I A;  4TQU S;  1G29 1;  1E3P A;  1MSG A;  1QUQ A;  4YCW A;  3KBX A;  4LF8 Q;  3I70 A;  1P16 A;  5J3B A;  1QG7 A;  1XPR A;  1PRT B;  1SYG A;  1A8V A;  2R6G A;  4DV0 L;  2KCN A;  4KKT A;  4CDF C;  4LF4 L;  2RDG A;  4Q5V A;  4XQN A;  2HIV A;  2MGS A;  4RH6 A;  5IGB A;  1I50 H;  4DR1 L;  4ZUJ A;  2NN6 I;  1E0B A;  2PZW A;  2Q8R E;  2EJF C;  5CBA E;  4X3K A;  4C3I B;  4HJA A;  1KL9 A;  2XTI A;  4R9W A;  1F9S A;  4HR7 B;  3BYY B;  2IHF A;  3AU7 A;  2ZM6 Q;  1EEF D;  4HCS A;  1XMO L;  2L11 A;  4EGV A;  1DXM A;  2FJ2 A;  4IQZ A;  4OIJ A;  4CHT B;  3DHQ A;  1XMQ Q;  1YBY A;  1SE8 A;  2JK8 A;  1PH6 A;  3V05 A;  4NXM L;  3MFY A;  1YNJ C;  1VQ8 A;  3T13 A;  3JC6 6;  5C4Z A;  2R7Z B;  4AYB B;  1TWG B;  5ELB A;  3AFQ A;  3K0X A;  1NR2 A;  4ME5 A;  1E2Z A;  1SMY D;  4A3J H;  1X65 A;  4WJ4 A;  4DV1 L;  2A19 A;  2EY5 A;  1G2S A;  1GUN A;  3E3X A;  2PW7 A;  2NUC A;  3D4W A;  1QWY A;  2WAQ E;  2B2Y A;  2XRQ D;  1J5E L;  4PMB A;  3A0J A;  4A3E G;  3VA7 A;  2EZV A;  3J80 L;  4KY6 A;  5H1S E;  2RBM A;  2ZXO A;  3HG9 A;  4CKB A;  4R1J A;  3BDO A;  5A35 A;  2I5M X;  1SRO A;  1MIU A;  2Z6K A;  3HOZ B;  2EY1 A;  2ATW A;  2NZO A;  3G6J B;  4H44 C;  2NVT H;  4FYD A;  4LAA A;  4DR1 Q;  1Q90 A;  4IUP A;  1K3B C;  3QO2 A;  3QIA A;  1A0I A;  3CP0 A;  2RF4 A;  3SK8 A;  3VR3 A;  2K01 A;  4B3S L;  4LF7 L;  2VXW A;  2E74 C;  1JOK A;  2RKS A;  3MXN A;  1QE6 A;  5I4D A;  4DGZ A;  5C3E B;  4CKC A;  1I6H H;  3MAQ A;  3CW2 C;  4DR5 Q;  4BBS B;  2H1E A;  1FGB D;  2WFW A;  2F0S A;  3TP6 A;  3PUX A;  1NAP A;  2PQE A;  3CC4 A;  4JV5 Q;  3A5Z B;  4KHP L;  1C0A A;  1DJR D;  3H6M A;  3M4O B;  3PCO B;  1SJH D;  2B2V C;  2VQE L;  5D65 A;  4C3H B;  4NXM Q;  1K8O A;  3ERO A;  1LAC A;  2JA8 B;  2Z8L A;  3S1Q H;  2VL6 A;  3CCU A;  4O42 A;  5C44 G;  2A8V A;  1BUV T;  4L5T A;  4TKO B;  3I4L A;  2C5C A;  1HUN A;  1CSP A;  1SE3 A;  3MC0 B;  2R7D A;  3RLF A;  5KND A;  3JAM L;  3VYS A;  2F52 A;  2N3S A;  4KY7 A;  1LM0 A;  5C0X I;  5IWA L;  2B2W A;  1J8I A;  2MFI A;  1ENA A;  4PV1 C;  5IYB G;  1STB A;  4OEL B;  5G3L D;  2O4X A;  1X9N A;  3OWE B;  5EQ0 A;  1KRS A;  1L1O A;  4GKJ Q;  1F77 A;  3U9S A;  1F9P A;  4PG3 A;  3V96 A;  4C2M H;  3R93 A;  1DM0 B;  5I6W A;  5CC4 A;  1HUM A;  2JA7 G;  3FMC A;  3P75 A;  2BH2 A;  2FXQ A;  5C0X H;  3SVM A;  2IJ0 A;  1TS4 A;  2B3G A;  2AWN A;  2XNA C;  1PRT D;  2CW0 D;  1TS3 A;  4IJL A;  2NVX B;  3S2H B;  4ZK9 B;  2CQA A;  4HMJ A;  4L5Q A;  4RG1 A;  3K57 A;  4JBK A;  1CHQ D;  3NTI A;  2XWJ B;  3NSW A;  4B3S Q;  1HNX L;  3K7A B;  4LF7 Q;  2ZJP A;  1SDF A;  3EA6 A;  4UP9 A;  2F3W A;  1BF4 A;  1V1O A;  4R4I A;  1IBK L;  4N9T A;  4RGN A;  3TQY A;  4A3B B;  2QGQ A;  1I4G A;  2GVA A;  4HED A;  1Z9F A;  4KHP Q;  4BWG B;  2OF1 A;  4RKB A;  4NPS A;  3HKZ E;  5L37 A;  5LL6 S;  5ISR A;  3MEF A;  3CXC A;  1GUO A;  1YEZ A;  1M90 C;  2VQE Q;  1VQ4 A;  3HOW H;  5M3M G;  1T5E A;  4LF6 L;  2KOL A;  3QOL A;  1KAA A;  4X62 L;  3KF8 B;  5K36 H;  2R7F A;  4JBM A;  1QJO A;  2Y0S E;  3T1Y Q;  4X66 L;  3G71 A;  3ULP A;  2UUC Q;  1SYE A;  3MZ5 A;  4DV7 Q;  1STE A;  2NZH A;  2KJX A;  1VCI A;  2RSO A;  2QIL A;  4IUR A;  3WOE A;  3E6Z X;  1ASY A;  2UUA L;  4UP8 A;  2DUD A;  3URY A;  3RR5 A;  2LXK A;  3W1G A;  1D5M C;  3I90 A;  1BBW A;  4DV4 L;  3DM3 A;  5CGK A;  1DYQ A;  3HOV G;  4KK7 A;  4YY3 L;  3WOF A;  3T1H L;  3QR8 A;  5JEA J;  1TY2 A;  1IBM Q;  4JI5 Q;  4ZKB B;  1VMC A;  2V1C C;  1J9O A;  4IO9 A;  3M4P A;  1H9R A;  4DR3 L;  3VR5 A;  4RKL A;  3TP8 A;  4DN4 M;  1R9T H;  2PZU A;  4DR7 L;  2WB1 E;  3DWP A;  1DOK A;  5FK9 C;  2A6E D;  5IGD A;  2JE6 I;  2F0Q A;  1UNS A;  4IN3 A;  1ENF A;  4KKU A;  2IY5 B;  1HRJ A;  4LFC L;  4RCO A;  3RMH A;  1C7Y A;  1IXR A;  1IBK Q;  1TS2 A;  1TWF H;  4NB3 A;  5IT9 L;  3K0Y A;  1PTO C;  2FMC A;  2PNR C;  2Q8T A;  2J0T D;  3GV3 A;  1KXL A;  2QA4 A;  4X3U A;  1PTO H;  3CC7 A;  1QZH A;  1S5F D;  3F2U A;  4GNX C;  2CHB D;  4QUF A;  4ODG A;  2PCF B;  3D4D A;  1XX8 A;  3RZD H;  4X62 Q;  2F0H A;  2VB2 X;  4JI2 Q;  2B2T C;  1GKH A;  1DD2 A;  4X66 Q;  2Q8I B;  5E1F A;  3OW2 A;  3FEW X;  4J6H A;  1D5Z C;  2KCT A;  5C5M A;  1ML0 D;  2F0F A;  1LLR D;  3HOY H;  1S5B D;  1EIG A;  3GO5 A;  1N8R C;  5M5X B;  1PH1 A;  1FD7 D;  2XN9 C;  1S3O A;  1SNO A;  1OXS C;  2MO1 A;  4DV4 Q;  4U67 3;  1XPO A;  2XSC A;  2L15 A;  3D3R A;  3CMA A;  1X3F A;  2N49 A;  3DWQ A;  5JJL A;  3I4M H;  3H3V I;  1KNA A;  2PI2 A;  3PO2 G;  4TRD A;  4EQ5 A;  5JEA G;  3T1H Q;  3NP8 A;  3DMU A;  1Q3L A;  3U4Z A;  2Q2I A;  2E75 C;  3SK5 A;  1QB5 D;  1OXU A;  1EQT A;  2JA7 B;  1QIL A;  4DR3 Q;  1SBB B;  4P74 A;  2VUM G;  1HZB A;  3H3V C;  3QB3 A;  4KTA A;  3I8Z A;  1XNR L;  3GDE A;  4LK1 C;  3CQZ B;  4MHE A;  5C4X H;  3CCE A;  1IBL Q;  3H3V H;  1LO5 D;  4X65 Q;  4BBR G;  1HPC A;  5M9O A;  1S4Z A;  4LUV A;  4A3M G;  4XQQ A;  2RA4 A;  4K8J A;  2MPM A;  2K5W A;  2HHH L;  1SSO A;  4L5S A;  3D6W A;  4LFC Q;  1KDA A;  5CV8 A;  4NXN L;  2B2U A;  2AKW B;  4GLA C;  3X3N A;  5C3W A;  5J1Z A;  1ZEQ X;  5JPN C;  1KLU D;  5GAG C;  3A55 A;  4A3C G;  1JE4 A;  4G7H C;  1A2U A;  4DK6 C;  1EY6 A;  2JYO A;  2O2L D;  3GTL B;  3K5N A;  5M3M B;  3G6E A;  1ZKO A;  3GTJ H;  3PUZ A;  4LMQ D;  2EQS A;  1DZ1 A;  1PA6 A;  3MWY W;  2E5L L;  4A3D G;  1VS0 A;  4QL5 A;  3J81 L;  2UXD Q;  5E3F A;  1HFG A;  2NTS A;  1YJ9 A;  4LFB L;  3HZX A;  4ZUI A;  2B8F A;  4MN3 A;  5FLM H;  1EOT A;  1SYB A;  2F0T A;  2K5H A;  5C4J H;  1GM5 A;  3C46 A;  3ICE A;  1K8M A;  5G3L F;  5IYC G;  3KF8 A;  2JEB I;  3AB9 A;  5EKI A;  4DUY L;  2XGT A;  2XWB B;  4EX5 A;  3DWA A;  4OWT B;  4HJ9 A;  4BY1 G;  3MTS A;  2UU9 L;  3MHB A;  3GTQ H;  4FXD A;  1AEX A;  2R93 G;  1NNX A;  1MD2 D;  2RDF A;  4IUQ A;  3GQB A;  3OIQ A;  3PIO A;  3PO3 G;  1PRT F;  4BA1 I;  3A56 A;  1WTP A;  5IP7 G;  1JB3 A;  2LXJ A;  5FO7 B;  4QJF A;  3OPO A;  4A3K G;  1GOZ A;  2EVB A;  3A5U A;  2E2I B;  5C3X A;  2C9O A;  3A7A B;  3A7L A;  3J7A F;  3KUP A;  4A3E H;  3MFG A;  1YHA A;  2HHH Q;  1G6P A;  3S17 B;  2L0C A;  5IGF A;  1SAP A;  3PSI A;  4NXN Q;  1CKN A;  2R7Z G;  2AQ1 B;  2EE1 A;  3BYT B;  1E2V A;  5EBD A;  2JA5 G;  4IOA A;  3NWT A;  1I4X A;  1EY7 A;  4P75 A;  5C4H A;  4DU9 A;  1P8L A;  1EYC A;  1Y69 U;  3S2D B;  1T5X D;  3PGZ A;  4G7Z C;  3HOU G;  2L1B A;  1O80 A;  3D6C A;  2A68 D;  3STB C;  4A75 A;  1D2B A;  1PH5 A;  3DLL A;  5M5W H;  1VQA A;  3ND9 A;  1RJT A;  1EYD A;  3K6O A;  2DJG C;  1STH A;  4JG2 A;  5E7N A;  2K5N A;  2CCZ A;  3M3Y H;  3PMF A;  1MJC A;  3ER0 A;  1Y8P B;  5JVG 3;  5IYD G;  2A5H A;  3GTM H;  2YTY A;  3MXN B;  2JA6 G;  2GA4 B;  3T56 B;  4WFN 3;  1LTS D;  4RHR A;  1W3S A;  3S14 H;  1AZQ A;  4IFD I;  4LUZ A;  3KLS A;  3NXW A;  2RDH A;  1MBY A;  3UE1 A;  1S5D D;  2UU9 Q;  4JBJ A;  3W5O A;  1EEI D;  3PO2 B;  4JYA L;  2NVQ B;  3S9W A;  1C4Q A;  5C44 H;  3KOJ A;  1ZYR D;  5C3E G;  2AHO B;  4X6A H;  1D8L A;  1I94 L;  1SEB D;  4BBS G;  3BDL A;  2R92 H;  1KC8 C;  5C5L A;  1EFW A;  2F0E A;  4IUT A;  1PFS A;  4GS3 A;  4IFD H;  4JW0 A;  4HSV A;  2ZXR A;  1H95 A;  5GRO A;  3M85 A;  1RTO A;  1PH8 A;  5BN4 A;  4WOR A;  5F2D A;  3CF5 A;  4XDX A;  1GD7 A;  4C1N K;  4ALP A;  1D7Q A;  3CCJ A;  1G8Z D;  4DA2 A;  4XT1 B;  4A3M B;  1WTH A;  2F0N A;  1YHQ A;  1YIT A;  4JK1 C;  1TWH B;  1YNN C;  2K75 A;  1RCV D;  2QW7 A;  4JI6 L;  1VDZ A;  5FO9 B;  2FIN B;  1ONL A;  1NMG A;  1Y8O B;  1AH9 A;  1EZ6 A;  4DAM A;  2V4D A;  1VQI A;  3WDN A;  1SND A;  3J81 E;  3GTP H;  2OCE A;  1EQV A;  4FXK C;  1X3P A;  2QF7 A;  2I5H A;  2KVM A;  1A62 A;  2IWH A;  1VQM A;  1BCP B;  4X64 L;  2ICI A;  1GUS A;  1E1T A;  4EVO A;  3TME A;  1IW7 D;  4A3G B;  3KLW A;  1FR3 A;  3PUY A;  4K14 A;  1XTC D;  1TWA H;  4PZ7 A;  4A3F G;  3I4N H;  2BCO A;  4FVM A;  1G2T A;  3KYH C;  4NKL A;  4A3D B;  3AMU A;  2VS1 A;  1U4L A;  1WTR A;  1AZP A;  1QNU A;  4K0K L;  3TBI B;  3F2B A;  2EYP A;  1A3T A;  2E8G A;  4BY7 H;  3X3M A;  2G9H D;  3J7A V;  1L2F A;  4BS9 A;  2WAC A;  1M1K C;  1DOL A;  2KA7 A;  1WCM G;  4BY1 B;  2KEN A;  4Y52 H;  5LMU L;  1O7I A;  1V1Q A;  3CHB D;  5TSS A;  1O78 A;  3BG3 A;  2R93 B;  2UXB Q;  4A3B G;  4JI3 L;  3PO3 B;  1LTR D;  3HOX G;  4ZKC B;  1ICF B;  3R2I A;  1Q86 C;  1OXV A;  2P5Z X;  1HR0 L;  4A3K B;  3GP7 A;  4OWW B;  2G5D A;  3HOV H;  1RKN A;  4ID6 A;  1V43 A;  1K73 C;  1NMF A;  4GOP B;  3H0G B;  3L7Z C;  2CH4 A;  2QCP X;  4JI6 Q;  2JJQ A;  3M4Y A;  1A3U A;  2D0O A;  2BH8 A;  2FFK B;  3RZO B;  2HD3 A;  4JI7 L;  3K5L A;  2JA5 B;  3CME A;  4X3S A;  1HZA A;  2NB0 A;  1TQO A;  4O1N A;  3NQT A;  3FHW A;  3HOU B;  1MI2 A;  1WI5 A;  3NTK A;  4X64 Q;  5EPK A;  3T4A C;  3FPP A;  2K6A A;  5KYL A;  1LT5 D;  4OO1 G;  1GJX A;  2B29 A;  5CV7 A;  2XRS D;  1I5F A;  1ET6 A;  4A3L G;  1HFN A;  4WRD A;  1VQ6 A;  1FGU A;  3TRE A;  4B3M L;  2AUJ D;  3NEL A;  2WAQ G;  3GV6 A;  4DV0 Q;  4K0K Q;  3G4S A;  4LF4 Q;  5FJ8 H;  2JA6 B;  1CA6 A;  2NVY H;  4PMW A;  1AP0 A;  1RHP A;  1SNP A;  1J6Q A;  1VQC A;  4DXG A;  4QGU A;  4DV3 L;  2PMZ B;  1DON A;  4C3J G;  2M9V A;  4IPG A;  3BZK A;  4JI3 Q;  2A73 B;  2E2J B;  4DV5 L;  1SYD A;  4FDB A;  4G57 A;  1PXU A;  1FNV A;  2OTJ A;  1ILQ A;  3BVM A;  2Z4H A;  3AFP A;  3MVV A;  1XMO Q;  1KAB A;  1OXX K;  2ZJQ A;  1YIJ A;  2BDN A;  1K28 A;  3PO2 H;  2UUB L;  2ZTD A;  2X6L A;  2AWO A;  4JOI C;  4KJO A;  3A8J E;  3MXG A;  2B63 G;  4A76 A;  1PH7 A;  2YU9 H;  1B2T A;  1V9P A;  1S5C D;  1LT3 D;  2K5D A;  3H91 A;  2TMP A;  4R4Q A;  5AFW A;  2VUM H;  2G9D A;  1VQL A;  3S16 H;  1UE5 A;  1A63 A;  2IL8 A;  4CDE C;  1JOR A;  4GLV B;  1W6J A;  4H02 A;  2IT1 A;  4DV1 Q;  5EKK A;  2B2W C;  1CUK A;  3TS0 A;  4BBR H;  4DXF A;  1CHP D;  1IL8 A;  1GHJ A;  2B2V A;  1PYW D;  4KV6 A;  4A3M H;  2NWG A;  3Q24 A;  1J5E Q;  5M5Y B;  3J81 j;  1LTG D;  3A74 A;  1KRT A;  1BCP D;  1XXG A;  4A3F B;  1Q1B A;  3LNN A;  2L55 A;  4P73 A;  4B3M Q;  3T53 B;  4ZLT F;  4R4C A;  4RCN A;  4MTN A;  1X32 A;  2EYH A;  3S1R B;  1JIC A;  2EYL A;  1BVS A;  5CBE E;  2KHJ A;  2AUK A;  4JI1 L;  2R61 A;  2JXM B;  3BVG A;  3SE0 A;  3DXJ C;  4FF3 A;  3J80 c;  1PMR A;  3N52 A;  4A3I G;  4DV3 Q;  3CD6 A;  3RN5 A;  1MKH A;  2IHE A;  4HIK A;  2ZXP A;  4K5W A;  2CW0 C;  1WCM B;  4HMI A;  4DV6 L;  4QIW E;  4DV5 Q;  4ZAI A;  2L12 A;  2H4O A;  1Z47 A;  2K5Q A;  5CV5 A;  3S24 A;  4PMC A;  1OXT A;  4OX9 L;  2OTL A;  3DEO A;  4DFA A;  3ZJY C;  1Y1W G;  3HOX B;  4A93 G;  3K5O A;  5AJ3 L;  4B08 A;  3CKI B;  4HIM A;  2B8G A;  4K6D A;  1XNQ L;  1SNM A;  2UUB Q;  3S1N B;  2LS0 1;  2EIF A;  2AQ3 B;  1NTG A;  4HAE A;  5IY0 A;  1HNZ L;  4JVZ A;  1TWC B;  5DLQ E;  1U4P A;  5EKL A;  1U4M A;  4KHZ A;  4C3I H;  1B7Y B;  2D62 A;  1EFI D;  2PQA B;  3HKZ G;  1A6X A;  1MGS A;  5E4W C;  5KNB A;  4B9X A;  1SYF A;  1O7Z A;  4BXX G;  2IPK D;  5IOD A;  1LTI D;  4ULL A;  1YNX A;  3J80 E;  1N33 L;  2Y0S G;  3RLN A;  4DR2 L;  2DNE A;  3ONA B;  5CYU A;  5IWA Q;  4GOP A;  1VQO A;  1EYA A;  2EYO A;  2OEO A;  1D1K A;  2L5T A;  1DGS A;  3I91 A;  3IFT A;  4WJW A;  2R7Z H;  1TWG H;  4DR6 L;  4E6I A;  2A69 D;  1JR0 D;  3SGI A;  3JAM c;  1PH2 A;  3PV0 A;  3QWN A;  1MHW C;  2JA5 H;  3I73 A;  4CBV A;  2KEC A;  2F0O A;  4OGQ C;  1ET9 A;  5ELC A;  2F0U A;  4H13 C;  4L6T B;  1UEA B;  1CKN B;  1BXT A;  2WAQ B;  1I3Q B;  1Q1E A;  5DM6 3;  2F0L A;  1PH4 A;  1LTL A;  2KHS A;  3D4R A;  4OWX B;  2NN6 G;  4CDC C;  5JOB A;  3KLR A;  4O2D A;  1PFN A;  2Z4I A;  1HNX Q;  1EIY B;  4B3T L;  1SRU A;  1N9W A;  3BZD B;  4DV6 Q;  1PZJ D;  2JN4 A;  1Q46 A;  5DNF A;  1HR0 W;  1PZI D;  3ERS X;  1HQR D;  4C3J B;  1UAP A;  2BE5 D;  2LFN A;  4A3J G;  3HOZ H;  1GXD C;  4I7A A;  2KCM A;  3CPW A;  2QDL A;  4UAI A;  2AMC B;  1XNQ Q;  1EIF A;  4MNO A;  3DEP A;  4IUU A;  4I65 A;  3JAM E;  4LF6 Q;  1G6Z A;  1HNZ Q;  3U4V A;  1M8A A;  2RVL A;  2PO4 A;  2F0G A;  1VQH A;  3T16 A;  2E2J H;  5C3E H;  2E2H B;  4IPD A;  2B63 B;  4BBS H;  5KGU A;  2IX3 A;  2F0K A;  1AE2 A;  3C1F A;  1JWM D;  5IGG A;  3FDT A;  1D1I A;  1TS5 A;  4Y7N B;  5C0X J;  1B3A A;  2UUA Q;  3ULJ A;  1B53 A;  1VQ9 A;  3M4O H;  3I2Z A;  3J81 i;  4YCU A;  1HNW L;  2Z6B A;  4AQY L;  4C3H H;  1LTA D;  2B2T A;  2JA8 H;  5GAD C;  2D2C C;  1VQE A;  4IUV A;  1KIX A;  1WTW A;  3FPU B;  4MTK A;  3I72 A;  2A6H D;  2D9U A;  3H94 A;  2RCF A;  4YY3 Q;  1HJP A;  1EY4 A;  3TP7 A;  3SK6 A;  1PZK D;  5JJI A;  3TS2 A;  1GO3 E;  1ZXT A;  3OWF A;  3UI2 A;  3J7Y W;  1VQN A;  1L0W A;  1CKM A;  2F4V L;  2QKI C;  1IKL A;  1E24 A;  2SEB D;  4JC0 A;  4DR7 Q;  1EY9 A;  3CCM A;  2K32 A;  1NY4 A;  3L3O C;  4A3F H;  4B3T Q;  1FYC A;  1STN A;  2N8N A;  2O5J C;  4A3I B;  3FKI B;  1JWS D;  1YJN A;  1R4Q B;  2K28 A;  4FF1 A;  1WFQ A;  4KLK A;  2VNU D;  1C9O A;  2F0V A;  1N34 L;  3C2P A;  3VYT A;  3W2D A;  2OQK A;  1K83 B;  3ULL A;  2NVX H;  1F2M A;  3S2H H;  1Y1W B;  1GUT A;  1TKW B;  4A93 B;  4QIW B;  4M1U B;  5FLX L;  3K7A H;  1WCM H;  1CFM A;  4NP5 A;  4A3G G;  1JE5 A;  4FXG C;  5IT9 c;  1MJE A;  3OOC A;  2IX1 A;  5GAH C;  2E76 C;  1U5K A;  4A3B H;  2F0W A;  3HKZ B;  3LGJ A;  3KJP A;  1SR3 A;  1VQ5 A;  1EUJ A;  1V8Q A;  5KEE A;  4F8M A;  5C0X G;  1YVC A;  3Q6S A;  5HUR A;  1AN8 A;  3DUZ A;  4IOC A;  2Y0S B;  4AQY Q;  1UE1 A;  3BU2 A;  1BCP F;  3MA2 B;  4HJ5 A;  4DUZ L;  4MIU A;  4PZ8 A;  1EQR A;  2PQA A;  4G4K A;  2KUM A;  2HDL A;  2KCC A;  1I50 B;  4IZ8 A;  1JWU D;  4RGO S;  3U58 A;  2L4N A;  4XQJ A;  2RQX A;  1IYU A;  1KDC A;  1W6K A;  5CR3 A;  4HCE A;  1MSH A;  1SXT A;  3P1H A;  3BVZ A;  4F87 A;  3VYR A;  4IPC A;  4JI4 L;  3ND8 A;  1FJG L;  4KY5 A;  4LFA L;  1XNR Q;  5CV6 A;  5IT9 E;  4G7O C;  3TRZ A;  3HEJ A;  4LNQ A;  4OO1 H;  5K36 G;  5EJW A;  5LMN L;  2L9H A;  3CU7 A;  2R3Z A;  3H0G G;  5COY A;  3PF4 A;  4POF A;  4GZY C;  4A3L H;  4NDX A;  4WJ3 M;  1HA6 A;  1B9N A;  2F0P A;  1N34 Q;  5JAV A;  1I4Q A;  2WB1 B;  2M00 A;  3PIO 3;  3FRP B;  1SN8 A;  1QVG A;  4AYB E;  2NBF A;  4A3J B;  1KDB A;  3SR1 A;  2EDG A;  3D8G A;  2ZTC A;  1LT6 D;  5DM7 3;  1WTV A;  1HZ9 A;  4ILW A;  5D14 A;  4N9P A;  1IL2 A;  4KD3 A;  1NR4 A;  1WYD A;  2CWA A;  4ABN A;  1PVO A;  3QJY A;  2J4X A;  3EIV A;  1NBW A;  3TEH B;  2E5L Q;  4N8F A;  1WD0 A;  2SDF A;  3NBH B;  3NEN A;  4C3J H;  2WP8 J;  4KHV A;  2WV6 D;  2A68 C;  3UE0 A;  1H9M A;  4LFB Q;  4DK3 C;  5M3F G;  1EQQ A;  3IAY A;  3E0E A;  4ZQ3 A;  1QZG A;  2PZT A;  4F88 A;  1BKB A;  1WVL A;  4DUZ Q;  4DUY Q;  2PW5 A;  1N36 L;  3F2C A;  4LF9 L;  2NVT B;  1TVX A;  3IFD A;  2DY7 A;  1KAW A;  5E4X A;  3J81 c;  2B63 H;  1CI3 M;  2N55 A;  3U9O A;  2CWP A;  3RN2 A;  1CZW A;  3MXU A;  5IE8 A;  4CJ1 B;  3NE5 B;  3CCL A;  1STY A;  5JJK A;  1K8G A;  1NE3 A;  1Y1V G;  5M5X H;  2OT2 A;  4JI4 Q;  1I6H B;  4L5R C;  1WTX A;  5LHY 1;  2WKC A;  1ZYR C;  3CRK C;  2MNA A;  4YHH L;  5IYB H;  3EQL C;  2F0M A;  1G51 A;  2Z0S A;  3CC2 A;  3PUV A;  3PIP A;  5DAU A;  1IYV A;  3S1Q B;  2JA7 H;  5KRU A;  2SNS A;  1F9R A;  1B8A A;  3QG1 A;  1B3Q A;  1E22 A;  2F0I A;  3HOY G;  4XXE A;  3VYU A;  1FVI A;  1NUC A;  3CQZ H;  1I6V C;  2NYZ D;  2OQ0 A;  3R8B A;  1JQY D;  2PYK A;  2PI2 E;  2YTX A;  3CCR A;  3KDF A;  1CA5 A;  3J7A 5;  1EL0 A;  4ME3 A;  3KJO A;  1JJC B;  3E0J A;  3HGB A;  2D5D A;  2BA1 A;  3CAM A;  3E5S A;  1SYC A;  4KJN A;  1STA A;  2YYZ A;  5KYI A;  3I4M G;  2VY3 A;  1GHK A;  1BNZ A;  3PIP 3;  3HP3 A;  3K5M A;  1ENC A;  5J39 A;  1RF2 D;  1FNU A;  4BA2 I;  3NK9 A;  1HTL D;  4C2M B;  2SNM A;  4XT3 B;  1CSQ A;  3M9B A;  3LX0 A;  5ELD A;  1IW7 C;  1Y1W H;  3FP9 A;  3IRB A;  4Z9C B;  1L0X B;  1VQ7 A;  1Y8N B;  2K14 A;  1KLG D;  2EPB A;  3BJU A;  3J80 i;  4JI0 L;  4CDD C;  1TY0 A;  4LF9 Q;  4UY8 C;  2K52 A;  2WKD A;  4LW1 A;  3GTL H;  5M3M H;  5C4X G;  1Q7Y C;  1IKM A;  4DNR B;  1C8C A;  4LUO A;  3LWU A;  1DOM A;  4I7Z C;  3OTO L;  2LSS A;  4JYA Q;  3K7U C;  1EY8 A;  1L0Y B;  4XIG S;  1YZ6 A;  4B3R L;  3OYY A;  3RD4 A;  4BXX H;  3I55 A;  2F1M A;  3E9I A;  1I94 Q;  1E2W A;  4RMF A;  2RHQ B;  4IJH A;  1RTN A;  2HQL A;  1G91 A;  1O7Y A;  3IKJ A;  3M7G A;  1GUG A;  1EU4 A;  1V1P A;  4GN5 A;  4XTC S;  4YHH Q;  5I2Y A;  4C1N I;  2F03 A;  1WTO A;  3OW7 A;  4KMU C;  1A15 A;  1Q82 C;  3K81 C;  1PDQ A;  1W2B A;  1BBU A;  3MEH A;  4QB4 A;  4EQN A;  1EOV A;  1TXY A;  3HOW B;  1CT1 D;  1K9M C;  1Q12 A;  1Q8K A;  2K5V A;  4A4I A;  1WD1 A;  2HIX A;  1LT4 D;  1SNQ A;  3H09 A;  5JJZ A;  4DR5 L;  4ZRZ A;  3UDX A;  3EBE A;  5FLM G;  4HID A;  4LJZ C;  4P71 A;  1YNJ D;  4KD4 A;  3VR2 A;  4YIJ A;  2E2I H;  2WII B;  2NN6 H;  3EN2 A;  4JV5 L;  2XVS A;  4L8J A;  5I9P A;  1II3 A;  2MO0 A;  2K03 A;  2F0J A;  2HT1 A;  2HCC A;  5CV4 A;  1SNC A;  3S17 H;  4H0L C;  1SMY C;  2B2Y C;  3PF5 A;  3JAM i;  3TN2 A;  5IGC A;  2GN5 A;  4HSP A;  1STG A;  2ES2 A;  1B50 A;  2CFM A;  1K0S A;  1F2L A;  1VF7 A;  3VA5 A;  1A2T A;  1VMP A;  3S2D H;  1X54 A;  1YHB A;  2KED A;  5M3F B;  1E1O A;  3HRZ C;  2NZ1 D;  4P2C B;  4JI0 Q;  2Z6K C;  4IFD J;  3NBH A;  3MXP A;  4RFB A;  1R9T B;  2HUG A;  3OMG A;  2LMC B;  4K2K A;  3OTO Q;  1DCZ A;  2TSS A;  3A8K E;  2EY6 A;  2PNH A;  4B3R Q;  3EVQ A;  4GKJ L;  1TT2 A;  5JVH 3;  5LMU Q;  2I5L X;  1LV9 A;  1JJ2 A;  1EIH A;  1XTD A;  1X55 A;  1IZ6 A;  1ICW A;  1TWF B;  5LMN W;  4FF2 A;  4YCV A;  1HHV A;  1Y1V B;  1H9K A;  4DV2 L;  1CTM A;  1F9Q A;  1PTO B;  1HR0 Q;  2ASB A;  2EXD A;  4DAP A;  5LL6 X;  4RA8 A;  1KQS A;  4K6L A;  3RZD B;  4V0B A;  1VQK A;  2KQ3 A;  4GNX B;  2NVQ H;  5JEA H;  2ALY B;  2HDM A;  1UE7 A;  3I4O A;  2O5I C;  3C1E A;  1LYL A;  5I9O A;  3S15 B;  1RD9 D;  1EY0 A;  4GKK L;  1RIP A;  4JI7 Q;  4QF4 A;  1XWE A;  2ZJR A;  5EPJ A;  3HOY B;  1EWH A;  1XJV A;  4APV A;  2DNC A;  1HTP A;  5CMD A;  4DF7 A;  1X3E A;  2Z9H A;  3M4Q A;  1CM9 A;  5K5P A;  3W3A A;  3Q8D A;  4JOI A;  4NMZ A;  2EOT A;  3OIP A;  3F8T A;  1L1O C;  1TWH H;  2H5X A;  3T1Y L;  3I4M B;  4DNT B;  1PYB A;  2JA9 A;  4JBW A;  2UUC L;  1WOC A;  2MQH A;  3A54 A;  2K50 A;  4DV7 L;  2XIW A;  3E9H A;  4GN3 B;  4M8A A;  4RGM A;  1YJW A;  2R92 G;  1BCP C;  1LTT D;  1JOO A;  3A8I E;  3KF6 B;  1KD1 C;  4A3C H;  4IFD G;  4KN4 C;  2F3V A;  2E2D C;  2QEJ C;  3O13 A;  1BOS A;  4A3G H;  5C4X B;  4FP5 D;  4K8I A;  4YWK A;  4F7X A;  2I0Q A;  3FKI G;  3NQI A;  4A3D H;  1IYJ B;  1IBM L;  4JI5 L;  1PRT C;  3LWE A;  5DEH A;  4XYQ A;  3PQI A;  3Q0A A;  1CKO A;  1C48 A;  1PH9 A;  1EWC A;  2EY2 A;  4DV2 Q;  2K05 A;  3CPF A; 
#chains in the Genus database with same CATH homology
 4U68 A;  2IX0 A;  4C56 C;  5J22 A;  4V19 0;  1RDP D;  2J7Z A;  5A2Q L;  4KI0 A;  4RGT A;  3VR4 A;  5KIX A;  1PFM A;  3SK4 A;  3CRL C;  3GTJ B;  2BDO A;  3Q23 A;  3OSO A;  4R8I A;  3KBG A;  3ZYY X;  5C4J B;  4RWS C;  3N6R A;  4EQP A;  4XYO A;  1AW7 A;  1PLF A;  4CJ0 B;  3TSS A;  5COR A;  3GTQ B;  3R2T A;  1SE4 A;  1GUW A;  5JPM C;  2MJ8 A;  3T51 B;  2BOS A;  3G7L A;  2A69 C;  3QOJ A;  1XYI A;  3NBI A;  5EGT A;  2DY8 A;  4DK0 A;  3HS0 C;  2MP1 A;  1JCK B;  2VB3 X;  1HCZ A;  4A3E B;  4UDU C;  5BN5 A;  3P7J A;  1SE2 A;  4FO2 A;  5HGT A;  3GTO B;  2A6E C;  1B1Z A;  1LAB A;  3K58 A;  3FVQ A;  3SHL A;  2LY7 A;  4TSS A;  1HQM C;  2LKV A;  1CQV A;  2B39 A;  2BE5 C;  5ELE A;  1PTO D;  3S1M B;  4PQX A;  5M5W B;  1CK1 A;  5T1I A;  3DM1 A;  1U4R A;  3VR6 A;  5T1G A;  1ESR A;  4DK1 A;  1OO9 B;  3M3Y B;  5I6Y A;  3NPP A;  2ICE C;  3GTM B;  1WTQ A;  3GTG B;  4QUC A;  2WIN B;  5CV9 A;  3KLS X;  3S14 B;  5D3D A;  1ILP A;  1F2Y A;  2MHV A;  3TZU A;  1D6E C;  2A74 C;  1JC7 A;  1HXY D;  4HTH A;  5C44 B;  1B4O A;  1S5E D;  1EY5 A;  1ROD A;  3OMC A;  3D31 A;  5BN3 A;  4KKS A;  3TP5 A;  1SFO B;  2R92 B;  2A6H C;  1BQQ T;  1UUP A;  3RUZ A;  1U9R A;  1FNW A;  4OL7 A;  4ZYS A;  1QCB D;  5A2Q E;  3TDQ A;  1PFB A;  1H9S B;  3I3C A;  1ESF A;  3GTK B;  2B2U C;  5IIF A;  3NHH A;  4CJ2 C;  3C3L A;  4J1M A;  1A3V A;  1KNE A;  3GTP B;  1X3Q A;  2X6G A;  1HA5 A;  2MUY A;  3SDZ A;  2F0D A;  2N88 A;  2K7V A;  1TWA B;  3M7N A;  3I4N B;  3NWS A;  1B44 D;  4J8Q A;  1Q8I A;  2CVR A;  1CQF A;  3ITP A;  4CKE A;  2PPB C;  3SXH A;  1F2Z A;  2EJG C;  5KNC A;  4BY7 B;  1B9M A;  3EJI A;  4FNF A;  2K1B A;  2EXZ A;  1V1P B;  1SJE D;  4IUN A;  2I46 A;  1BO0 A;  4OO1 I;  3BS1 A;  1LTB D;  5ELF A;  1JOQ A;  1D5X C;  3R3O A;  2EJM A;  1I4P A;  1QOH A;  1TII D;  3SEB A;  1AFP A;  1NSN S;  3OHX C;  3HOV B;  2EYF A;  2BA0 A;  4RHS A;  2Z1C A;  2I07 B;  4C3I G;  4Q0F A;  3IL8 A;  1BDO A;  2EYM A;  2X69 A;  3TZD A;  1TU2 B;  4EQO A;  4S3S A;  1EU3 A;  2FHT A;  5D3I B;  2K04 A;  1M4V A;  4K2L A;  1H9J A;  5FKA C;  1EZ8 A;  2QDB A;  2ID0 A;  4DAV A;  1CZG A;  3ERQ A;  4QMG A;  4IAL A;  1Z7T A;  1VF5 C;  1Z6H A;  2JP1 A;  3NUC A;  1O7L A;  2NVY B;  3K59 A;  3V2T A;  5NUC A;  2F4I A;  1IHZ A;  4DAY A;  5FOB B;  4H7B A;  1R4P B;  3EFX D;  5FO8 B;  5C6A A;  2M2L A;  5IGE A;  1I4H A;  1NCV A;  3NTH A;  3P20 A;  2NTT A;  2ENB A;  2OXP A;  1KTK A;  4PNY A;  3L9A X;  4HN7 A;  2KEE A;  3GD7 A;  1I4R A;  2HQE A;  4CGY B;  2SOB A;  2IW3 A;  5FLX E;  2YU9 B;  3PUW A;  5IOC A;  2VUM B;  2K33 A;  1PTO F;  2HCI A;  3S16 B;  4KN7 C;  3BDC A;  1YNN D;  4K5X A;  2RSN A;  3Q22 A;  4NW2 A;  4R8N A;  4C3H G;  4OHJ A;  4BBR B;  2JEA I;  1H9S A;  3KK7 A;  4FF4 A;  1QNK A;  4X3T A;  1BBX C;  4RAU C;  5EPL A;  4QCL A;  4B9W A;  1BR9 A;  5I2X A;  2AQ2 B;  2EYJ A;  1TR5 A;  4L63 B;  2JSO A;  4K5V A;  5EBC A;  2DN8 A;  4OIK A;  2ZT9 C;  2FMM A;  4TQU S;  1G29 1;  1MSG A;  3KBX A;  3I70 A;  1QG7 A;  1PRT B;  1SYG A;  2R6G A;  2KCN A;  4KKT A;  2RDG A;  4Q5V A;  4XQN A;  2MGS A;  4RH6 A;  5IGB A;  4ZUJ A;  2NN6 I;  1E0B A;  2PZW A;  2Q8R E;  2EJF C;  5CBA E;  4X3K A;  4C3I B;  4R9W A;  1F9S A;  4HR7 B;  3BYY B;  3AU7 A;  1EEF D;  4HCS A;  2L11 A;  4EGV A;  1DXM A;  2FJ2 A;  4IQZ A;  4OIJ A;  4CHT B;  3DHQ A;  3V05 A;  3MFY A;  1YNJ C;  3T13 A;  5C4Z A;  2R7Z B;  4AYB B;  1TWG B;  5ELB A;  1NR2 A;  4ME5 A;  1E2Z A;  1SMY D;  2EY5 A;  1G2S A;  1GUN A;  2PW7 A;  2NUC A;  3D4W A;  1QWY A;  2B2Y A;  2XRQ D;  4PMB A;  3VA7 A;  2EZV A;  3J80 L;  4KY6 A;  2RBM A;  2ZXO A;  3HG9 A;  4CKB A;  3BDO A;  5A35 A;  3HOZ B;  2EY1 A;  3G6J B;  4H44 C;  4FYD A;  4LAA A;  1Q90 A;  4IUP A;  3QO2 A;  3QIA A;  3SK8 A;  3VR3 A;  2K01 A;  2VXW A;  2E74 C;  1JOK A;  2RKS A;  3MXN A;  1QE6 A;  5I4D A;  4DGZ A;  5C3E B;  4CKC A;  3MAQ A;  4BBS B;  2H1E A;  1FGB D;  3TP6 A;  2F0S A;  3PUX A;  1NAP A;  2PQE A;  1DJR D;  3H6M A;  3M4O B;  1SJH D;  2B2V C;  5D65 A;  4C3H B;  1K8O A;  3ERO A;  1LAC A;  2JA8 B;  2Z8L A;  4O42 A;  1BUV T;  4TKO B;  3I4L A;  2C5C A;  1HUN A;  1SE3 A;  3RLF A;  3MC0 B;  5KND A;  3JAM L;  3VYS A;  4KY7 A;  5C0X I;  2B2W A;  1J8I A;  1ENA A;  4PV1 C;  1STB A;  5G3L D;  2O4X A;  3OWE B;  5EQ0 A;  1F77 A;  3U9S A;  1F9P A;  3V96 A;  3R93 A;  1DM0 B;  5I6W A;  5CC4 A;  1HUM A;  3FMC A;  3P75 A;  5C0X H;  3SVM A;  2IJ0 A;  1TS4 A;  2AWN A;  2XNA C;  1PRT D;  2CW0 D;  1TS3 A;  2NVX B;  3S2H B;  4ZK9 B;  2CQA A;  4HMJ A;  3K57 A;  1CHQ D;  3NTI A;  2XWJ B;  3NSW A;  3K7A B;  1SDF A;  3EA6 A;  2F3W A;  1BF4 A;  1V1O A;  4N9T A;  4RGN A;  4A3B B;  1I4G A;  4HED A;  4BWG B;  2OF1 A;  4RKB A;  5LL6 S;  5ISR A;  1GUO A;  1T5E A;  2KOL A;  3QOL A;  1KAA A;  5K36 H;  1QJO A;  1SYE A;  3MZ5 A;  1STE A;  2KJX A;  1VCI A;  2RSO A;  2QIL A;  4IUR A;  3WOE A;  3E6Z X;  3URY A;  1D5M C;  3I90 A;  5CGK A;  1DYQ A;  4KK7 A;  3WOF A;  5JEA J;  1TY2 A;  4ZKB B;  1VMC A;  1J9O A;  1H9R A;  3VR5 A;  4RKL A;  3TP8 A;  4DN4 M;  2PZU A;  3DWP A;  1DOK A;  5FK9 C;  2A6E D;  5IGD A;  2JE6 I;  2F0Q A;  1UNS A;  4IN3 A;  1ENF A;  4KKU A;  1HRJ A;  3RMH A;  4RCO A;  1TS2 A;  5IT9 L;  3K0Y A;  1PTO C;  2FMC A;  2PNR C;  2Q8T A;  2J0T D;  3GV3 A;  4X3U A;  1PTO H;  1S5F D;  3F2U A;  2CHB D;  4QUF A;  4ODG A;  2PCF B;  3D4D A;  1XX8 A;  2F0H A;  2VB2 X;  2B2T C;  1DD2 A;  2Q8I B;  5E1F A;  3FEW X;  4J6H A;  1D5Z C;  5C5M A;  1ML0 D;  2F0F A;  1LLR D;  1S5B D;  1EIG A;  3GO5 A;  5M5X B;  1FD7 D;  2XN9 C;  1SNO A;  1OXS C;  4U67 3;  2XSC A;  3D3R A;  3DWQ A;  1KNA A;  4TRD A;  5JEA G;  3NP8 A;  3DMU A;  1Q3L A;  2E75 C;  3SK5 A;  1QB5 D;  1EQT A;  1OXU A;  2JA7 B;  1QIL A;  1SBB B;  3H3V C;  3QB3 A;  4KTA A;  3I8Z A;  4LK1 C;  3CQZ B;  4MHE A;  1LO5 D;  1HPC A;  5M9O A;  1S4Z A;  4XQQ A;  2RA4 A;  4K8J A;  2MPM A;  2K5W A;  1SSO A;  3D6W A;  1KDA A;  5CV8 A;  2B2U A;  3X3N A;  5C3W A;  5J1Z A;  1ZEQ X;  5JPN C;  1KLU D;  3A55 A;  1JE4 A;  4G7H C;  1A2U A;  1EY6 A;  2JYO A;  2O2L D;  3GTL B;  3K5N A;  5M3M B;  1ZKO A;  3PUZ A;  4LMQ D;  1DZ1 A;  3MWY W;  3J81 L;  5E3F A;  1HFG A;  2NTS A;  3HZX A;  4ZUI A;  2B8F A;  4MN3 A;  1EOT A;  1SYB A;  2F0T A;  3C46 A;  1K8M A;  5G3L F;  3KF8 A;  2JEB I;  3AB9 A;  5EKI A;  2XWB B;  3DWA A;  3MTS A;  3MHB A;  4FXD A;  1AEX A;  1MD2 D;  2RDF A;  4IUQ A;  3GQB A;  3OIQ A;  1PRT F;  4BA1 I;  3A56 A;  1WTP A;  1JB3 A;  5FO7 B;  3OPO A;  1GOZ A;  2EVB A;  2E2I B;  5C3X A;  2C9O A;  3A7A B;  3A7L A;  3J7A F;  3KUP A;  3MFG A;  3S17 B;  2L0C A;  5IGF A;  1SAP A;  2AQ1 B;  2EE1 A;  3BYT B;  1E2V A;  5EBD A;  3NWT A;  1I4X A;  1EY7 A;  5C4H A;  4DU9 A;  1EYC A;  1Y69 U;  3S2D B;  1T5X D;  4G7Z C;  2L1B A;  1O80 A;  3D6C A;  2A68 D;  1D2B A;  3ND9 A;  1RJT A;  1EYD A;  3K6O A;  1STH A;  3PMF A;  1Y8P B;  5JVG 3;  2A5H A;  2GA4 B;  3T56 B;  4WFN 3;  1LTS D;  4RHR A;  1AZQ A;  4IFD I;  3KLS A;  3NXW A;  2RDH A;  1MBY A;  1S5D D;  1EEI D;  3PO2 B;  2NVQ B;  3S9W A;  1C4Q A;  1ZYR D;  1SEB D;  3BDL A;  5C5L A;  2F0E A;  4IUT A;  4IFD H;  4HSV A;  2ZXR A;  3M85 A;  1RTO A;  5BN4 A;  4WOR A;  5F2D A;  4XDX A;  4C1N K;  1G8Z D;  4DA2 A;  4XT1 B;  4A3M B;  2F0N A;  4JK1 C;  1TWH B;  1YNN C;  1RCV D;  1VDZ A;  5FO9 B;  2FIN B;  1ONL A;  1Y8O B;  1EZ6 A;  2V4D A;  3WDN A;  1SND A;  3J81 E;  1EQV A;  4FXK C;  1X3P A;  2QF7 A;  2KVM A;  2IWH A;  1BCP B;  2ICI A;  1GUS A;  4EVO A;  3TME A;  1IW7 D;  4A3G B;  1FR3 A;  3PUY A;  4K14 A;  1XTC D;  2BCO A;  4FVM A;  1G2T A;  4NKL A;  4A3D B;  3AMU A;  1U4L A;  1WTR A;  1AZP A;  1QNU A;  3TBI B;  2EYP A;  1A3T A;  3X3M A;  2G9H D;  3J7A V;  4BS9 A;  2WAC A;  1DOL A;  2KA7 A;  4BY1 B;  3CHB D;  5TSS A;  1O78 A;  3BG3 A;  2R93 B;  3PO3 B;  1LTR D;  4ZKC B;  3R2I A;  1OXV A;  4A3K B;  3GP7 A;  1RKN A;  4ID6 A;  1V43 A;  3H0G B;  3L7Z C;  2QCP X;  3M4Y A;  1A3U A;  2FFK B;  3RZO B;  3K5L A;  2JA5 B;  4X3S A;  2NB0 A;  1TQO A;  4O1N A;  3NQT A;  3HOU B;  1MI2 A;  3NTK A;  5EPK A;  3T4A C;  3FPP A;  2K6A A;  5KYL A;  1LT5 D;  4OO1 G;  1GJX A;  5CV7 A;  2XRS D;  1ET6 A;  1HFN A;  4WRD A;  2AUJ D;  3GV6 A;  2JA6 B;  1CA6 A;  4PMW A;  1AP0 A;  1RHP A;  1SNP A;  4DXG A;  2PMZ B;  1DON A;  4C3J G;  2M9V A;  2A73 B;  2E2J B;  1SYD A;  4G57 A;  1PXU A;  1FNV A;  1ILQ A;  3BVM A;  2Z4H A;  3MVV A;  1KAB A;  1OXX K;  2BDN A;  2X6L A;  2AWO A;  4KJO A;  3A8J E;  3MXG A;  1B2T A;  1S5C D;  1LT3 D;  2K5D A;  3H91 A;  2TMP A;  5AFW A;  2G9D A;  2IL8 A;  1JOR A;  1W6J A;  2IT1 A;  5EKK A;  2B2W C;  4DXF A;  1CHP D;  1IL8 A;  1GHJ A;  2B2V A;  1PYW D;  4KV6 A;  2NWG A;  3Q24 A;  5M5Y B;  1LTG D;  1BCP D;  1XXG A;  4A3F B;  1Q1B A;  3LNN A;  2L55 A;  3T53 B;  4ZLT F;  4RCN A;  1X32 A;  2EYH A;  3S1R B;  1JIC A;  2EYL A;  5CBE E;  2AUK A;  2R61 A;  2JXM B;  3BVG A;  3SE0 A;  3DXJ C;  4FF3 A;  1PMR A;  3N52 A;  2ZXP A;  4K5W A;  2CW0 C;  1WCM B;  4HMI A;  4ZAI A;  2L12 A;  2H4O A;  1Z47 A;  2K5Q A;  5CV5 A;  4PMC A;  1OXT A;  3DEO A;  4DFA A;  3HOX B;  3K5O A;  4B08 A;  3CKI B;  2B8G A;  4K6D A;  1SNM A;  3S1N B;  2LS0 1;  2AQ3 B;  4HAE A;  5EKL A;  1TWC B;  1U4P A;  1U4M A;  4KHZ A;  2D62 A;  1EFI D;  1A6X A;  1MGS A;  5E4W C;  5KNB A;  4B9X A;  1SYF A;  1O7Z A;  2IPK D;  5IOD A;  1LTI D;  4ULL A;  3J80 E;  2DNE A;  3ONA B;  5CYU A;  1EYA A;  2EYO A;  2OEO A;  1D1K A;  2L5T A;  3I91 A;  3IFT A;  4WJW A;  4E6I A;  2A69 D;  1JR0 D;  3PV0 A;  3QWN A;  3I73 A;  4CBV A;  2KEC A;  2F0O A;  4OGQ C;  1ET9 A;  5ELC A;  2F0U A;  4H13 C;  4L6T B;  1UEA B;  1BXT A;  2WAQ B;  1I3Q B;  1Q1E A;  5DM6 3;  2F0L A;  2KHS A;  3D4R A;  2NN6 G;  5JOB A;  3KLR A;  1PFN A;  2Z4I A;  3BZD B;  1PZJ D;  5DNF A;  1PZI D;  1HQR D;  4C3J B;  1UAP A;  2BE5 D;  2LFN A;  1GXD C;  4UAI A;  3DEP A;  4IUU A;  4I65 A;  3JAM E;  1G6Z A;  1M8A A;  2RVL A;  2PO4 A;  2F0G A;  3T16 A;  2E2H B;  2B63 B;  5KGU A;  2IX3 A;  2F0K A;  3C1F A;  1JWM D;  5IGG A;  3FDT A;  1D1I A;  1TS5 A;  4Y7N B;  5C0X J;  1B3A A;  1B53 A;  1LTA D;  2B2T A;  2D2C C;  4IUV A;  1WTW A;  3FPU B;  3I72 A;  2A6H D;  2D9U A;  3H94 A;  1EY4 A;  3TP7 A;  3SK6 A;  1PZK D;  1ZXT A;  3OWF A;  3UI2 A;  3J7Y W;  2QKI C;  1IKL A;  2SEB D;  1EY9 A;  2K32 A;  3L3O C;  1FYC A;  1STN A;  2O5J C;  4A3I B;  3FKI B;  1JWS D;  1R4Q B;  2K28 A;  4FF1 A;  2VNU D;  2F0V A;  3C2P A;  3VYT A;  3W2D A;  1K83 B;  1F2M A;  1Y1W B;  1GUT A;  1TKW B;  4A93 B;  4QIW B;  4M1U B;  5FLX L;  1CFM A;  4NP5 A;  4FXG C;  3OOC A;  2IX1 A;  2E76 C;  2F0W A;  3HKZ B;  1V8Q A;  5KEE A;  5C0X G;  4F8M A;  3Q6S A;  5HUR A;  1AN8 A;  3DUZ A;  2Y0S B;  1BCP F;  3MA2 B;  4MIU A;  4G4K A;  2KUM A;  2HDL A;  2KCC A;  1I50 B;  4IZ8 A;  1JWU D;  4RGO S;  2L4N A;  4XQJ A;  2RQX A;  1IYU A;  1KDC A;  1W6K A;  5CR3 A;  4HCE A;  1MSH A;  1SXT A;  3P1H A;  3BVZ A;  4F87 A;  3VYR A;  3ND8 A;  4KY5 A;  5CV6 A;  5IT9 E;  4G7O C;  3HEJ A;  4OO1 H;  5K36 G;  5EJW A;  2L9H A;  3CU7 A;  2R3Z A;  5COY A;  4GZY C;  4NDX A;  1HA6 A;  1B9N A;  2F0P A;  5JAV A;  1I4Q A;  2WB1 B;  2M00 A;  3PIO 3;  3FRP B;  2NBF A;  4A3J B;  1KDB A;  3SR1 A;  2EDG A;  3D8G A;  1LT6 D;  5DM7 3;  1WTV A;  4ILW A;  5D14 A;  4N9P A;  4KD3 A;  1NR4 A;  4ABN A;  3QJY A;  2J4X A;  1WD0 A;  2SDF A;  2WP8 J;  4KHV A;  2WV6 D;  2A68 C;  1H9M A;  3IAY A;  4ZQ3 A;  2PZT A;  4F88 A;  1WVL A;  2PW5 A;  2NVT B;  1TVX A;  3IFD A;  2DY7 A;  5E4X A;  1CI3 M;  2N55 A;  3U9O A;  1CZW A;  3MXU A;  4CJ1 B;  3NE5 B;  1STY A;  2OT2 A;  1I6H B;  1WTX A;  5LHY 1;  2WKC A;  1ZYR C;  3CRK C;  3EQL C;  2F0M A;  3PUV A;  5DAU A;  1IYV A;  3S1Q B;  5KRU A;  2SNS A;  1F9R A;  3QG1 A;  2F0I A;  4XXE A;  3VYU A;  1NUC A;  1I6V C;  2NYZ D;  3R8B A;  1JQY D;  2PYK A;  1CA5 A;  1EL0 A;  3E0J A;  3HGB A;  2D5D A;  2BA1 A;  3E5S A;  1SYC A;  4KJN A;  1STA A;  2YYZ A;  5KYI A;  1GHK A;  1BNZ A;  3PIP 3;  3HP3 A;  3K5M A;  1ENC A;  5J39 A;  1RF2 D;  1FNU A;  4BA2 I;  3NK9 A;  1HTL D;  4C2M B;  2SNM A;  4XT3 B;  3LX0 A;  5ELD A;  1IW7 C;  4Z9C B;  1L0X B;  1Y8N B;  1KLG D;  2EPB A;  1TY0 A;  2WKD A;  1IKM A;  4DNR B;  1C8C A;  3LWU A;  1DOM A;  4I7Z C;  1EY8 A;  1L0Y B;  4XIG S;  3RD4 A;  2F1M A;  1E2W A;  1RTN A;  1G91 A;  1O7Y A;  3IKJ A;  3M7G A;  1GUG A;  1EU4 A;  1V1P A;  4XTC S;  5I2Y A;  4C1N I;  2F03 A;  1WTO A;  3OW7 A;  1A15 A;  1PDQ A;  3MEH A;  4QB4 A;  3HOW B;  4EQN A;  1CT1 D;  1Q12 A;  1WD1 A;  1LT4 D;  1SNQ A;  3H09 A;  5JJZ A;  4ZRZ A;  4LJZ C;  1YNJ D;  4KD4 A;  3VR2 A;  4YIJ A;  2WII B;  2NN6 H;  2XVS A;  4L8J A;  5I9P A;  1II3 A;  2K03 A;  2F0J A;  2HCC A;  5CV4 A;  1SNC A;  4H0L C;  1SMY C;  2B2Y C;  3TN2 A;  5IGC A;  4HSP A;  1STG A;  1B50 A;  1F2L A;  1VF7 A;  3VA5 A;  1A2T A;  1VMP A;  2KED A;  5M3F B;  3HRZ C;  2NZ1 D;  4P2C B;  4IFD J;  3NBH A;  3MXP A;  4RFB A;  1R9T B;  2HUG A;  3OMG A;  2LMC B;  4K2K A;  1DCZ A;  2TSS A;  3A8K E;  2EY6 A;  3EVQ A;  1TT2 A;  5JVH 3;  1LV9 A;  1EIH A;  1TWF B;  1ICW A;  4FF2 A;  1HHV A;  1Y1V B;  1H9K A;  1CTM A;  1F9Q A;  1PTO B;  4DAP A;  5LL6 X;  4RA8 A;  4K6L A;  3RZD B;  4V0B A;  2KQ3 A;  5JEA H;  2HDM A;  2O5I C;  3C1E A;  5I9O A;  3S15 B;  1RD9 D;  1EY0 A;  4QF4 A;  1XWE A;  5EPJ A;  3HOY B;  1EWH A;  2DNC A;  1HTP A;  5CMD A;  4DF7 A;  1CM9 A;  5K5P A;  3W3A A;  4NMZ A;  2EOT A;  3OIP A;  3I4M B;  4DNT B;  4JBW A;  3A54 A;  2XIW A;  4M8A A;  4RGM A;  1BCP C;  1LTT D;  1JOO A;  3A8I E;  4IFD G;  4KN4 C;  2F3V A;  2E2D C;  2QEJ C;  3O13 A;  1BOS A;  5C4X B;  4FP5 D;  4K8I A;  4F7X A;  3NQI A;  1PRT C;  3LWE A;  5DEH A;  4XYQ A;  3Q0A A;  1C48 A;  1EWC A;  2EY2 A;  2K05 A;  4KMU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...