3PIP3

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
59
structure length
59
Chain Sequence
THKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
total genus 2
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3pip300
5DM63 3PIO3 3PIP3 4WFN3 5JVG3 5DM73 5JVH3 4U673
chains in the Genus database with same CATH superfamily
2KA7A 2I5LX 1JWMD 1STHA 1CHPD 5CV9A 4OONA 4LF8L 3GTJH 1XNQL 3IRBA 5DAUA 4IPGA 3EIVA 1Y1VH 2OQ0A 5HGTA 4PMWA 4OO1G 1HHVA 4U68A 2R93H 1BF4A 4A3DH 3MA2B 3NEMA 1FR3A 2KCNA 3CQZH 4UY8C 1ENFA 1D6EC 3QOJA 4HJ5A 1HNWL 1VQ7A 3H3VC 1LTID 4KI0A 1M90C 2UXCL 1R9TB 1FGUA 1CSQA 1UE6A 2RDFA 3OOCA 4CDCC 4ALPA 2ICEC 5M5WH 4RH6A 1TS4A 1BO0A 4GN3B 3P20A 3MXPA 3W1GA 5FJ8H 4JI2L 4R4OA 1EUJA 5I2YA 5E4XA 2QA4A 2ZTDA 3EBEA 1HNXQ 2QW7A 1AE3A 4Q5VA 3R3OA 1K83B 2EYMA 3ONAB 4HSVA 1I3QB 4A76A 1O7ZA 3K0XA 4BY1B 5EPKA 4JI8L 2R92H 1UE5A 2RA4A 2C5CA 3I4MH 1CA5A 1CKNB 2OQKA 3MXNA 1XTCD 1EY8A 2CH4W 2R7DA 2SNMA 4CKCA 2EYOA 1IW7D 1GUNA 2WB1G 2LKVA 2FXQA 3JAMc 3IKJA 3NBHA 5ELEA 1JQYD 4DPGA 2JA8H 1BBWA 1STEA 1SYCA 2RBMA 1KNAA 3SK8A 1NR2A 3B6YA 2KVMA 3I3CA 2Y0SB 1JWSD 1H9SB 1Z9FA 1CTMA 3MTSA 2JA7G 4LNQA 3EROA 1GM5A 3AB9A 1K8AC 1FGBD 1EYGA 1NAPA 4C3JB 3M4YA 1AE2A 1K3RA 4JI6Q 4ZKBB 2F1MA 4JCVE 1F9RA 4AIMA 5IP9H 1VF7A 1KDAA 3PUWA 2NZOA 1O80A 5BR8L 1ILQA 4F88A 1XMQL 2VUMB 4NXNL 3FVQA 4JK1C 1PH2A 1V1PB 4YHHL 1MKHA 4YWMA 1OO9B 1GHKA 1SEBD 4JW0A 2K5VA 1XPRA 2CW0C 4B3TQ 1B44D 1Q8IA 1ZXTA 1ENCA 4B3TL 1DZ1A 1X6OA 1OXUA 1WTOA 3QB3A 3GDEA 1H9JA 1PZJD 1PFMA 4O42A 4N8X1 1B53A 4RHRA 2J0TD 3HZXA 1DJRD 3DEOA 3E3XA 4A75A 1Q3LA 3OW2A 1DOLA 5BN5A 4GN4B 2KEEA 3O13A 4BY1G 3CCVA 2JA6H 5I4DA 3BU2A 3SEBA 5FOBB 1IKLA 4C3JG 1YZ6A 5ELFA 2BOSA 3AQQA 4KY5A 3NQIA 1RIPA 3QG1A 1T5EA 3FMCA 1EQVA 3PUZA 2XGTA 4NW2A 3UE1A 1A8VA 1SNCA 1RKNA 1PA6A 1SYDA 4A3LG 4FYDA 3V2TA 3QWNA 4L5TA 3KDFB 1EFWA 4N8FA 5IE8A 1ICFB 3J81j 1DYQA 2JA7H 1DOMA 2EJFC 1YHBA 2DY8A 2F4IA 1HZAA 2PYKA 2ZT9C 3OYYA 3D0FA 3S9WA 1JJCB 2I5MX 1IBMQ 1A3TA 4LFAQ 1YI2A 1JC7A 2XNAC 1B9MA 3OTOL 3WOFA 3I4MG 3D4RA 1S5FD 2JA6G 2E2HH 3NSWA 4FXKC 3I4NB 3JAMi 3J81c 1HRJA 1EU4A 2F0GA 3CC2A 5C0XJ 4WFN3 1QCBD 5JEAG 5L37A 4YWLA 1SNPA 3L7ZC 1SFOB 4IFDI 1I6HH 3Q24A 1IW7C 3DM1A 5BN4A 2IY5B 2PI2A 4JBMA 5C4XG 4FXGC 1STGA 2Q2TA 3TRZA 4NDXA 3S1QH 1Y8OB 4AH6A 4B3SQ 2JJQA 2R6GA 4C2MB 2Q2UA 2LFNA 3HOXB 2RVLA 4G7OC 4R9WA 2F0NA 3E5SA 4TQUS 4R4TA 4XT3B 3S16B 2RCNA 1J6QA 5IGFA 1EWHA 2MGSA 2Y0SG 3HGBA 4ULLA 3KJPA 4DV0Q 2R93G 5I6WA 4OO1H 4DV3L 2DUDA 2F03A 1XX8A 1EL0A 1Y1VG 2B29A 1KDBA 4KKSA 1WTQA 3BZCA 1B2TA 3J7A5 2IX1A 4QMGA 5GADC 3GP7A 1YHAA 2UXBQ 2N49A 3W5OA 4JI0Q 3RLOA 3DM3A 4PZ6A 2K05A 5EBDA 4GNXA 3IFDA 2H4OA 2CQAA 3CKIB 3MHBA 4AQYQ 3S2HH 2RHSB 1VQHA 1KQSA 3X3NA 5G3LD 1BR9A 4HEDA 2K28A 4IFDG 2KCCA 5EJWA 3VYRA 1SNMA 3VR4A 4X3SA 3A8JE 3M9BA 3RN5A 1XXGA 1VMCA 4A3KH 2KBNA 4XQQA 3I4NH 1D1KA 2CH4A 2XWJB 2Z4HA 4DR1L 1C4QA 4XYQA 2GN5A 5KYLA 1MI2A 1SRUA 2MJ8A 2SOBA 3A8KE 3Q8DA 2AQ3B 4DK0A 4NMZA 2JEBI 2R92B 4MHEA 4KHZA 3D4WA 5ELOA 5FO8B 4A3JH 4DNTB 1Y1WH 5FO7B 2DNCA 1PRTF 4K5WA 3OIQA 2RSNA 2Q8IB 1Q82C 3VYUA 4NB3A 4R4IA 2UUBL 2O2LD 1F2ZA 4JBWA 2HD3A 4BA1I 4I7ZC 1TQOA 5M3FG 1XNRL 1B8AA 2HCIA 1N32L 4DR6Q 3S1MB 1K8GA 1VDZA 2K33A 2KOLA 3NWSA 2E2HB 4DK6C 5DEHA 4B3ML 3CCJA 3RLNA 5IYBG 4DR1Q 4DR4L 1K8OA 4IUNA 1CSPA 4FF2A 5KGUA 1E0BA 1PH1A 3I4LA 3W2DA 1Y14B 1JJ2A 3HP3A 4JI3L 2F0OA 4KN4C 3H0GB 1IBKQ 4OL7A 1K83H 2F0FA 2FFKB 1S72A 1IL2A 4HJ9A 1XMQQ 3NELA 3SXHA 4LFAL 4IOAA 2PQAA 2F0HA 2IJ0A 2K52A 1EYCA 1UEAB 4X6AH 4KKTA 1B3AA 2E2IB 5GAEC 4QL5A 4LWCA 2HDMA 1I6VC 4L63B 1M4VA 1VQAA 1EY5A 5A35A 4JI3Q 3GTLH 3HKSA 3CCQA 4GOPB 1KAAA 1YNND 1Y1WB 5JAVA 3M4OB 4X64L 5E7NA 3S17H 5IP7H 3EJIA 2F3VA 1FNUA 5NUCA 1XNRQ 2UUAL 1FL0A 4RGNA 4A3EG 4FF4A 4DV4Q 2QDBA 4P71A 1TXYA 1HR0W 1E22A 1WTWA 4FF1A 1R4PB 2A74C 4DK3C 1CZGA 3KF6B 4APVA 4EX5A 1JE4A 4WRDA 2BDOA 4DXGA 1QZHA 4LF5L 3NTHA 4ME3A 1WJJA 3HS0C 4IURA 3TBIB 5I9PA 2L4NA 4XTCS 4M1UB 2UUCL 3R93A 5J1ZA 2F0DA 5KIXA 2PCFB 4DNIA 2VQFL 2H1EA 4HIDA 1K3BC 2BE5C 3I72A 2HIXA 2LMCB 1GO3E 2EY2A 3NXWA 3J7YW 4J8QA 1VQNA 4IUPA 3HG9A 1KXLA 5C3EG 5LMUQ 3RMHA 3QIAA 1QVFA 4LMQD 4RWSC 5ELNA 1VS0A 1KC8C 4LUVA 4MN3A 3GTLB 3H0GG 1ET6A 5FLMH 3KF8B 1I94L 1VQCA 2YU9H 1WTHA 4RGTA 1NCVA 1TY2A 3T1HQ 1PZID 1JWUD 1SSOA 1UE1A 4JYAQ 3S15H 4QUCA 1STAA 4KN7C 1Q81C 2HHHQ 1WCMH 3TREA 1QJOA 3MVVA 3SGIA 2L5TA 1I6HB 2PZUA 1O7YA 5ELBA 5M5WB 5C4XB 4HIKA 1I50H 1HTPA 1IYVA 3T1YL 3HOUH 1N36Q 5JEAJ 3Q6SA 1VMPA 5JVH3 1HZCA 4A3IH 5CV8A 1LTSD 1FD7D 2NVTH 4L8JA 2B8GA 4L5SA 3HOWB 4OO1I 1SMYC 1B1ZA 4H7BA 5IGDA 2VZAA 1TS2A 3NWTA 2R93B 1X9NA 4POGA 4DK1A 1HTLD 1PH6A 3ULJA 2VQFQ 4RAUC 4OWWB 1HCZA 4QCLA 2KUMA 2AKWB 1PH4A 2NUCA 1B70B 4KHVA 1L1OC 1LO5D 3PQIA 4ZK9B 3HOVB 4G57A 5EKKA 2LXKA 3S2HB 2PW5A 4C3IG 3CCRA 4JI1L 5C0XG 3S1NH 4X66L 5C0XI 2JA9A 1L0XB 1K0SA 1DGSA 2UUAQ 1AP0A 3CCUA 1HZ9A 2JN4A 3RLFA 2EZVA 2VS1A 2RDHA 3TZDA 1U9RA 4YIJA 3I56A 1B4OA 3SK5A 3D6CA 4HIMA 2A68D 3GTOH 3J7AF 1YNNC 4BBSB 3T56B 3U4ZA 4IJHA 2DN8A 3DHQA 1ILPA 4XDXA 1S3OA 2YV5A 4OHJA 4DAVA 3G71A 2ZTCA 1BVSA 2RQXA 4BBSG 3K5OA 4GKJL 4CBVA 4GKJQ 2XSCA 2NVXH 1N33Q 5EBCA 3NE5B 1YJNA 5IT9E 1X3QA 4K5VA 1SE2A 1RODA 1SYFA 3QOLA 1RTNA 3I7FA 1ZKOA 4Y7NB 1VQMA 1PFBA 1GUSA 4OX9L 5CBAE 3ITPA 3OMGA 3MXNB 2DGYA 4CDFC 5ELDA 5M3MH 2ICIA 4HJ8A 3HRZC 4JI5L 5LMUL 2F0LA 2WAQE 2GVAA 1WD0A 4IPDA 2ZXOA 2KECA 3LX0A 1UEBA 1BCPF 4F8MA 4H0LC 2CCZA 1PYSB 2UUCQ 4DR3Q 4DV6L 1W2BA 5GAGC 2XIWA 2ASBA 1QOHA 5FK9C 1X3GA 3FKIB 1PYBA 3A56A 1SNQA 4HMJA 1VQFA 2PNHA 4F7XA 2KENA 3HOYB 3L2PA 2EYPA 2K50A 2HCCA 2NVTB 4HMIA 4DR7Q 2A8VA 3GTMH 4I7AA 4DN4M 3HKZB 3JC66 4RCOA 3H3VI 1DXMA 3J7ZC 3M4QA 3S2DB 3KOJA 1G6PA 4A3MB 1LTGD 2JE6I 4HCEA 3UDIA 4CDDC 2VXWA 4BBRB 4V190 2C9OA 2D2CC 4RMFA 2ZM6L 4ABNA 4GLVB 3VDYA 3G6EA 3CXCA 1KLUD 4QIWB 2QCPX 5M3MG 1SR3A 2Q8TA 1MSGA 3AYHB 5IYDG 3P1HA 2ZXRA 1EQTA 4K6DA 2BA0A 2JA7B 3J81E 2E5LQ 1STNA 2VY3A 4KJOA 3RZDH 5M3MB 1RTOA 2WKDA 3H3VH 2B2UA 3L9AX 1U4RA 3FKIH 3D3RA 1MGSA 3A54A 5FLXc 1BOSA 3HFZB 2XVSA 5JPNC 2EYHA 4GOPC 3HOYH 1PRTC 3E9HA 1GUTA 5IT9c 1J8IA 5C3EB 4DNRB 4DR2Q 1QG7A 3J7AV 4JV5Q 3CC7A 1TWHB 3I4OA 4DV3Q 2PI2E 2K6AA 2PNRC 3GTPH 1NMFA 2ZTEA 5I2XA 3KFUA 5C0XH 4C3IH 4ZQ3A 2BA1A 3FPPA 1Q86C 3X3MA 5ISRA 3Q22A 4ZKCB 2KCMA 3SVMA 1KNEA 1L0YB 4YCVA 4H13C 2ID0A 4ZCKA 4C2MH 2E76C 3PIPA 1N32Q 1KLGD 1EOTA 2KJXA 3BDOA 3A55A 5E3FA 1GHJA 1PFSA 2F4VQ 1PV4A 1NUCA 2O4XA 1NE3A 1SNOA 4FDBA 1CA6A 3J81L 3S14B 3ND9A 2UXDL 5I9OA 3QO2A 1C0AA 3K7AH 1HR0Q 5JVG3 3OHXC 1SLJA 2G9HD 3KF8A 3G6JB 2NB0A 1EYDA 3ND8A 1EEID 1FNVA 2L55A 2Q8RE 2WAQB 4WORA 2JSOA 4X65L 1WTXA 3T4AC 3DEPA 4DAYB 5CORA 4IQZA 1JMCA 2BDNA 1SBBB 5D3DA 4QQBX 3P7JA 3MXGA 1HA5A 1M1KC 1ICWA 1C48A 2CQOA 4MIUA 5KNBA 2N55A 5FO9B 3DWQA 2K75A 1BCPD 1WTPA 2L9HA 2NVYH 1NTGA 2DNEA 3GV6A 1Q8KA 5T1GA 4LF4L 4BY7H 4DV2L 1VQDA 1V1PA 3J80c 2IHFA 2MHVA 4ZUJA 2XWBB 1Z47A 1VQ8A 1X56A 4R8NA 1ESFA 2OT2A 4IJLA 4TRDA 2KEDA 2WV6D 5IWAQ 1D5ZC 1PRTB 2NN6G 4BBRH 1HH2P 3H94A 4J1MA 4DR7L 3RNUA 3KBGA 4R4CA 4RCNA 4KD4A 2OTLA 1VF5C 1YEZA 4C56C 4WJ3M 2B2TC 3PIO3 1UNSA 5LHY1 1SYBA 3MEFA 4NP5A 1IXRA 4OWTB 5KEEA 3A5UA 1STYA 3EFXD 2QDLA 4X3UA 1K73C 3FRPB 3OTOQ 4HAEA 1SXTA 2UU9L 5JPMC 1J5EL 1PTOF 3Q0AA 1IZ6A 1ZYRC 3K8AA 3E0JA 2PO4A 1WFQA 2A6HD 1LUZA 1GD7A 2QEXA 3CD6A 1AZQA 1AW7A 1V43A 1KD1C 3J80L 4N9TA 1CKMA 5CV5A 1W3SA 4LFBQ 4MNOA 2B2VC 3HOUG 2MP1A 4DR2L 4KTAA 3BVGA 1HQRD 1TWAB 4ZRZA 1U4MA 5CV4A 1UWVA 2TMPA 1EIYB 1WCMG 1WTVA 3TP6A 1JR0D 3SE0A 3F2CA 3K7AB 3G7LA 4GKKL 2CFMA 1G291 1E3PA 2JK8A 3EA6A 3CCLA 2F0MA 5C4ZA 3FPUB 2R7ZB 2B2UC 1NBWA 2R3ZA 3OW7A 1LTRD 1B50A 3E9IA 4X62L 4LF6L 4PMCA 3C1EA 2Z9HA 4PZ8A 4XQNA 2L0CA 4CGYB 1XYIA 2QGQA 2K32A 4BWGB 1G8ZD 4OXPA 3K5MA 2OWOA 1EWCA 2K5HA 3GTQH 2K1BA 3A8IE 4AYBG 1E1TA 2EQSA 3VR3A 5BN3A 2EDGA 4PG3A 3LGJA 2O5IC 1K28A 2F0JA 4I65A 4CHTB 2MO1A 1M8AA 1XMOL 4P73A 2K4KA 1AN8A 1JB3A 3KLWA 3WDNA 3PMFA 4DV7Q 1PTOB 3BZDB 1GOZA 2EY1A 3CCSA 1RF2D 3ERSX 4KY6A 1AZPA 1IBML 1Y1WG 4A3JG 2B2TA 1GXDC 3I4MB 3KBXA 2VW9A 1VQ4A 3BDLA 4K8IA 4A3IB 5M5YH 4DUYQ 1GVPA 5A2QL 2Q2HA 2E74C 3AU7A 1KIXA 3D31A 4AQYL 5IODA 5C44B 3SR1A 2HQEA 3T1YQ 1LABA 1ENAA 5CR3A 5FLXL 2A69C 4A3KG 2Q2IA 4A3MG 3U4VA 5JJIA 1A0IA 4LF8Q 3F8TA 1XNQQ 1LTLA 3KDFA 2YTXA 1STBA 1AFPA 4JI4L 4Q0FA 2Y0SE 2LY7A 2ZXPA 1X55A 4IPHA 1R4QB 3I73A 1ML0D 4EQPA 5M5XB 2I0QA 4NKLA 1L1OB 2TSSA 3A0JA 2CHBD 3CCEA 1H9KA 4B3RL 2K7VA 2JA5G 4A3CH 1ZYRD 4GNXB 2A6HC 1XMOQ 2I5HA 3NTKA 2GVBA 5C5LA 4C1NI 1G6ZA 3I91A 3IL8A 1KHIA 5M3FH 1GKHA 3V05A 1K0RA 4UAIA 2HQLA 2A6ED 4DV7L 2WKCA 4R1JA 1PH9A 1CM9A 2KHJA 4B3MQ 1EY0A 4A3GB 2OTJA 5FLXE 5K36H 4KJNA 3TZUA 4JI2Q 2KQ3A 2N8NA 1LLRD 4B9XA 3S17B 3TEHB 1S5DD 4OIJA 3SK6A 5HURA 2UXCQ 1PTOD 1JCKB 3QJYA 1S5BD 4G7HC 1DOKA 5LMNQ 3RD4A 1F9SA 1KABA 3MFGA 1TIID 3CMEA 2N88A 5AJ3L 2E2IH 5M5XH 4X62Q 2B63G 5JJKA 4DKAC 4DV1L 2SNSA 3RR5A 3PCOB 2XN9C 4MTNA 1LYLA 4TVAB 1RL2A 1OXTA 4N9PA 4GKKQ 2CVRA 3K57A 3GD7A 3OMCA 1OXXK 2ZM6Q 1PH8A 4NXMQ 1DONA 1EY9A 5IYCG 4A3LH 1SNDA 3OIPA 2AQ2B 2A5HA 3W1BA 3NP8A 1T5XD 1SYGA 3PUVA 4UPAA 2VNUD 1VQ6A 1XWEA 2YTVA 1A63A 2PZWA 1HNZL 1HJPA 1NSNS 5J3BA 2J7ZA 4U673 3T1HL 1C8CA 3L0OA 4LAAA 2F0UA 4IOCA 3J80E 4RG1A 4JC0A 4BY1H 1E2WA 1D7QA 4ID6A 1NJIC 3CF5A 2MUYA 3GTGH 4DR4Q 3H91A 3ER0A 1V1OA 4O0AA 3RZDB 4KLKA 2WB1B 2K5NA 5C4XH 1A15A 1I3QH 2ENBA 3T13A 1S5ED 3DWAA 4IUVA 4BXXH 2R7FA 4RKBA 5JEAH 2EYJA 3JAML 1TKWB 4LF6Q 4JBKA 2FMCA 4UP9A 2L12A 5IGEA 4JI6L 1N9WA 3S24A 5IOCA 2R7ZG 1HUMA 2AWNA 2EXZA 2RSOA 1PHJA 4DV4L 1X32A 3MEHA 4LUOA 4R4QA 3H6MA 2L1BA 4FF3A 2ZJRA 3TP7A 5IGCA 4HSPA 1LTBD 1Y1VB 5IP9G 2VUMG 4C3IB 1EZ6A 4CKBA 2YU9B 4A3DB 3GTPB 3LWUA 4LF9Q 2EXDA 1X54A 3N52A 1CHQD 2MQHA 1H95A 2VQEL 1EY6A 2RDGA 3I90A 1G91A 1C9OA 1SE4A 1JOKA 3PUXA 1PH3A 3SK4A 1BNZA 4JI7L 1HXYD 4V0BA 1TWCB 2WACA 1MD2D 4DAMA 2VUMH 2JA8G 3STBC 1YJ9A 1E24A 2B63H 4QJFA 3E0EA 3PIOA 2CWAA 3S1RB 2I46A 1SYEA 1WI5A 2NZ1D 3KLSX 2ATWA 2R7ZH 4LK1C 1YBYA 5CYUA 1I94Q 1EQRA 2QEJC 4C3JH 1D2BA 1S5CD 3S1QB 3W3AA 1EZ8A 2HDLA 1S40A 1B7YB 1RHPA 4H02A 1VCIA 1IBKL 2R92G 4IUQA 1GUWA 1EWIA 1PTOC 1NY4A 1TWFB 1FNWA 3NBHB 1TWGB 1BXTA 2JQOA 3EQLC 2ZJQA 4BXXG 4LF5Q 4P75A 1NNXA 5K36G 1PH7A 3U9SA 2EPBA 4E6IA 5J39A 4P72A 1Q1EA 1PZKD 1PYWD 4HTHA 2F0PA 5JOBA 4G4KA 3VA7A 2F3IA 3NTIA 3ZYYX 1JJGA 2JYOA 3CAMA 2JEAI 3FHWA 1I5FA 2B2YC 2KHIA 1F2MA 1CFMA 1U0LA 2A73B 4LFCQ 4DR5Q 2JA5H 3OWFA 3K58A 5IT9L 2B2WC 4L5QA 4LUZA 1QVGA 2RKSA 2JXMB 1EU3A 4K2KA 3U9OA 1JB7A 5IYCH 2P5ZX 4Z9CB 1P8LA 1X65A 3BVZA 5C3WA 4LF4Q 4OEMB 4LF7L 3HEJA 2F0QA 2QILA 5GROA 3GO5A 1SROA 3R2IA 4DA2A 1TT2A 3M3YH 3PF5A 4DV5Q 3GTJB 4DV5L 3L3OC 1MHWC 3CC4A 3HOVG 2WB1E 1YIJA 1HZBA 2E5LL 2PQAB 4A3MH 1SDFA 1JOQA 4QGUA 3PIP3 1FYCA 4NXML 2AQ1B 2F0TA 2X6GA 4LF7Q 4QUFA 1IYJB 3K5NA 1D5XC 1QILA 1PVOA 3BS1A 5FKAC 1CI3M 4C1NK 3SHLA 1K9MC 2WIIB 4DV1Q 3KYHC 3NHHA 1L1OA 2B63B 3BYYB 1BBXC 1V1QA 4A3FH 2DY7A 1LT6D 2WP8J 3GTMB 2NN6I 2EJGC 2EVBA 2UU9Q 4J6HA 3M7NA 1N34Q 2EY5A 4EVOA 4CJ2C 1LTAD 3CW2C 4A3GH 1P16A 4MTKA 1Q46A 4KHPQ 5FJ8G 1Q7YC 2PMZE 1IHZA 3BJUA 1JT8A 3PGZA 1TWFH 3TP5A 3CHBD 3S15B 3ULLA 1UE7A 2C35B 3PUYA 4X64Q 1BKBA 4FVMA 4YCUA 3URYA 4A3CG 2SDFA 3PV0A 5EAYA 3M85A 1QNUA 4H44C 1SAPA 2FJ2A 4QY7A 3STBD 4A3DG 1LTTD 1TWHH 3MWYW 4HCSA 2F0VA 1PXUA 2IHEA 4AYBB 2R61A 5C6AA 4OX9Q 2HT1A 5DNFA 2CKZB 1PH5A 3ERQA 2JA8B 1KTKA 4IZ8A 3DWPA 2BE5D 4WJWA 1MJEA 2F0KA 1E2ZA 2HIVA 4BA2I 2AHOB 3HOXH 1LV9A 3QR8A 4CJ1B 5I6YA 3F2UA 5F2DA 1EIHA 1LM0A 1PMRA 5TSSA 2F0SA 1G51A 4UP8A 1QUQA 3S16H 1TWAH 2MFIA 1MSHA 2ALYB 4QIWE 4C3HH 3RZOB 4DF7A 4UDUC 3PSIA 4EGVA 3K59A 1A62A 2EYLA 2IT1A 2NZHA 4A3FB 3JAME 2IX3A 5C44G 3K6OA 1EQQA 1Z6HA 1SJED 4OIKA 4IUUA 5IIFA 2HUGA 3OPOA 4DV0L 2F0IA 3M4PA 4EQNA 4CJ0B 3J81i 1SN8A 4DR5L 3H09A 4ZYSA 1WTRA 1I4HA 1XPUA 4JI1Q 3J80i 3IAYA 3M3YB 1F2YA 2K5DA 3HOWH 1T9HA 4L6TB 1X3FA 3VR2A 1H9RA 4RGOS 4O2DA 3R2TA 4KV6A 3E6ZX 3KLRA 5LL6X 3K5LA 4A3JB 2F0EA 1HQMC 3AMUA 3BDCA 1A2TA 3C46A 3BVMA 3S1MH 2Z6KC 3I2ZA 4BBRG 2NN6H 2E75C 4IALA 5D14A 1YITA 2D5DA 1PTOH 3PO3G 2F0WA 5C3XA 1CQFA 4MZ9A 4JV5L 1WOCA 4ILWA 3G4SA 3CCMA 5M5YB 2E8GA 4BY7G 4NXNQ 5A2QE 4JI4Q 2JA6B 4K2LA 1TS3A 1J9OA 1HA6A 5T1IA 2DJFC 4C3HB 1LT3D 2MO0A 2N3SA 5KYIA 5DM73 1TWCH 1KAWA 2D0OA 1VQGA 1EIGA 1EEFD 4GN5A 2O5JC 2RHQB 4RFBA 3MZ5A 3NUCA 5GAHC 2QKIC 1Y69U 4FXDA 4UHVA 1ZEQX 2NVXB 3Q23A 1EY4A 2PMZB 2YYZA 1AEXA 1VQ9A 4DXFA 4RKLA 5IGGA 4LW1A 3WWVA 2M2LA 1OTCA 1TR5A 3M4OH 2MNAA 3MXUA 5AFWA 1IKMA 5LMNL 3GTKB 4NPSA 3T16A 3S1RH 3TSSA 1O7IA 2B2WA 1BUVT 1CKOA 3TQYA 3GV3A 1QB5D 2OXPA 4IN3A 4P2CB 1VQBA 4POFA 1JICA 2H5XA 1BQQT 3UE0A 2OF1A 3D6WA 4CKEA 1J5EQ 4DAYA 3F2DA 1HNWQ 3EVQA 1TU2B 1I4RA 2NTSA 3KK7A 1XPOA 1SFOH 4DR6L 1TS5A 3UI2A 5BR8Q 4K5XA 4DR3L 2OEOA 4JPBW 2UUBQ 5M9OA 1MJCA 2B8FA 1BCPB 4RA8A 4YHHQ 2RCFA 3CRKC 3D4DA 3I55A 2D0PA 1RDPD 3U50C 2I07B 2IPKD 1TY0A 4A3BH 2KHSA 3TS0A 1ASYA 2VQEQ 1F2LA 2VL6A 4ZAIA 5LMNW 3HOYG 3LNNA 1UUPA 4X3TA 2EOTA 4B3RQ 1I50B 1SMYD 1Y8NB 3FKIG 2JA5B 1D5MC 3BG3A 1GUGA 3HOUB 2Z0SA 4OELB 4OGQC 5C4JB 4X3KA 4PV1C 3FDTA 1Z7TA 2AUKA 1NR4A 4GOPA 2EY6A 1RCVD 4HJ7A 5E1FA 4XQJA 1K8MA 3NPPA 2K03A 4UP7A 1B3QA 3MFYA 1QZGA 1GJXA 1CT1D 1O78A 1A2UA 1A3VA 2X69A 4JI8Q 4F87A 2HHHL 1WD1A 4A3KB 4HR7B 2PZTA 2DJGC 2VB3X 3TN2A 1UAPA 3VYSA 4YCWA 3DXJC 1KRTA 1U4LA 4KMUC 5CGKA 1CUKA 5DLQE 3G48A 1YHQA 3KF6A 2A1AA 1V8QA 3F2BA 2A68C 4S3SA 1CZWA 3NENA 4RHSA 2B39A 4A93G 4LFCL 4DGZA 1F77A 1IBLL 3GTQB 4B08A 1PRTD 3DLLA 2L11A 1RJTA 3C3LA 2KCTA 5CV7A 1WVLA 4A93H 4JOIA 5CV6A 4GS3A 1WCMB 5EKIA 1HNZQ 2B3GA 2FMMA 4QF4A 3HOZH 4JOIC 3MAQA 3RZOH 3FEWX 2AMCB 3UDXA 2LSSA 1EIFA 3TS2A 5D3IB 4TSSA 1V9PA 2ES2A 4HJAA 2PW7A 5CMDA 1OXSC 1H9SA 2NYZD 3V96A 2BH2A 3PO2H 3H15A 1D8LA 1O7LA 4K8JA 1I4XA 3HOZB 4EQ5A 5IGBA 4Y52H 2L15A 3CPFA 1I4GA 5EPJA 5ELCA 4Y7NH 3S1NB 3OSOA 1VQKA 1F9QA 3TDQA 3KJOA 1AH9A 4DUZQ 2K5WA 3AEVA 3PO2B 2OCEA 2X6LA 2UXBL 2EE1A 3AFQA 5H1SE 4LFBL 2LS01 1DCZA 2XRSD 3GTOB 4BBSH 5IYDH 1E7ZA 1PLFA 4QB4A 2G5DA 1JE5A 1VQLA 2NWGA 3PO2G 2LXJA 3UDFA 2SEBD 1E2VA 2CWPA 2FINB 5M3FB 4A3BG 2K14A 4XXEA 4K0KL 4DUYL 2E2JH 1QVCA 3A7AB 3HOZG 3S2DH 1SMXA 2UXDQ 4YWKA 3VA5A 4FNFA 1YNJC 3AFPA 2B2VA 2Z6BA 3C1FA 3N6RA 4OWXB 1ONLA 5CBEE 1I4QA 1VQOA 5COYA 1N8RC 4O1NA 2G9DA 2QF7A 3ZJYC 3PO3B 5HY6A 2IW3A 5JJZA 5C4JH 1ET9A 2V1CC 1N34L 3CQZB 4PQXA 4DAPA 1II3A 1LT4D 3ULPA 5EQ0A 5IWAL 3OWEB 4GNXC 2K01A 4KKUA 3R8BA 4XIGS 4TKOB 1R9TH 2K5QA 4ME5A 2YTYA 3BZKA 1YNXA 2M9VA 5KNDA 1F9PA 4IPCA 3TMEA 3GQBA 5JJLA 1CQVA 2A19A 1BDOA 1Q1BA 2IX0A 4JI5Q 5K5PA 2E2JB 3C2PA 2BH8A 4JG2A 4YY3L 3KLSA 1Y8PB 4PMBA 1VQJA 1C7YA 5IY0A 5CC4A 2Z1CA 3ICEA 3T51B 1KDCA 2NBFA 1U5KA 4HN7A 4CDEC 4LF9L 4GLAC 3CPWA 1PFNA 1SJHD 2AWOA 5GQOA 4JBJA 1N33L 1H9MA 3LWEA 4X65Q 1W6KA 4GLXA 1VQ5A 4A93B 4WJ4A 2V4DA 1Q90A 4A4IA 2F4VL 2MPMA 1MBYA 5AJ3Q 4RGMA 4A3EB 2WAQG 4XT1B 5C3EH 3IFTA 1LT5D 3VR5A 1ESRA 5E4WC 4PNYA 4KD3A 3TP8A 1EFID 1PDQA 1CK1A 4B3SL 3DMUA 2RF4A 2Z6KA 4DV6Q 1IBLQ 1X3PA 2B2YA 5D65A 1QUQB 3FP9A 4HIOA 1FVIA 4R8IA 3GTGB 1HFGA 2GA4B 2E2DC 2XRQD 5DM63 2NVQH 1EY7A 1BCPC 1S4ZA 1EYAA 5IP7G 1MIUA 1GUOA 2EJMA 4K14A 4IO9A 4A3IG 5C44H 1IL8A 1A3UA 2EIFA 1KL9A 3PF4A 4DV2Q 3SDZA 4BY7B 3U58A 1G2TA 5EPLA 2N78A 4DUZL 2JP1A 1EOVA 2M00A 1KRSA 3KUPA 2ZJPA 2NVYB 4C3HG 1YVCA 4JI0L 2Z8LA 4BS9A 4FP5D 1YNJD 1BBUA 4KY7A 1QE6A 4DFAA 5HGQA 3NBIA 2XTIA 2EYFA 4DU9A 1SE3A 3CP0A 2VB2X 2D62A 2F52A 1L2FA 4KK7A 4PZ7A 1D1IA 1WYDA 4ZLTF 1I4PA 1FJGQ 3K0YA 4XYOA 1W6JA 1TVXA 1DM0B 3WOEA 5FLMG 3H0GH 2A69D 2J4XA 5KRUA 1VQPA 3PO3H 3K81C 3CU7A 2IL8A 5C4HA 4JYAL 1SE8A 3I70A 3DUZA 4ODGA 1HUNA 5J22A 1XTDA 4KHPL 1TWGH 4A3BB 3HKZE 5IYBH 3S14H 3T53B 3NQTA 1OXVA 1NMGA 1X3EA 2PPBC 4IUTA 1G2SA 1IYUA 1U4PA 1VQEA 2WFWA 1ASZA 4IFDJ 2NVQB 1A6XA 3RUZA 4GZYC 2AUJD 3EN2A 3A5ZB 3HKZG 4X66Q 3CRLC 1HFNA 2Z4IA 4L5RC 2F3WA 1HNXL 3RN2A 4LJZC 4A3GG 2NTTA 3HOWG 3D8GA 1L0WA 2D9UA 4K0KQ 3F1ZA 3K80C 1LACA 2K04A 4A3EH 1DD2A 2BCOA 1XJVA 1Q12A 4AYBE 4A3FG 1HPCA 1QNKA 2WINB 2PQEA 2FHTA 4M8AA 3P75A 2CW0D 3MC0B 1RD9D 3GTKH 2A6EC 1JORA 4YY3Q 5C5MA 5KNCA 1E1OA 1B9NA 4FO2A 3BYTB 3I4NG 1VQIA 4B9WA 3I8ZA 4G7ZC 3A7LA 3VYTA 4K6LA 5G3LF 1YJWA 3HOVH 4P74A 3K7UC 2IWHA 5EKLA 3VR6A 4IFDH 3M7GA 3UDGA 1JOOA 1N36L 1QWYA 1CKNA 5EGTA 4JI7Q 4J15A 3CMAA 4ZUIA 1FJGL 5LL6S 4EQOA 3HOXG 1HR0L 3NK9A 4JVZA 3A74A
chains in the Genus database with same CATH topology
2KA7A 1JWMD 1STHA 1CHPD 5CV9A 5DAUA 5HGTA 4PMWA 4OO1G 1HHVA 4U68A 1BF4A 3MA2B 1FR3A 2KCNA 1ENFA 1D6EC 3QOJA 3H3VC 1LTID 4KI0A 1R9TB 2RDFA 3OOCA 2ICEC 4RH6A 1TS4A 1BO0A 3P20A 3MXPA 5I2YA 5E4XA 4Q5VA 3R3OA 1K83B 2EYMA 3ONAB 4HSVA 1I3QB 4BY1B 1O7ZA 5EPKA 2RA4A 2C5CA 1CA5A 3MXNA 1XTCD 1EY8A 4CKCA 2SNMA 2EYOA 1IW7D 1GUNA 2LKVA 3IKJA 3NBHA 5ELEA 1JQYD 1STEA 1SYCA 2RBMA 1KNAA 3SK8A 1NR2A 2KVMA 3I3CA 2Y0SB 1JWSD 1H9SB 3MTSA 1CTMA 3EROA 3AB9A 1FGBD 1NAPA 4C3JB 3M4YA 4ZKBB 2F1MA 1F9RA 1VF7A 1KDAA 3PUWA 1O80A 1ILQA 4F88A 2VUMB 3FVQA 4JK1C 1V1PB 1OO9B 1GHKA 1SEBD 2CW0C 1B44D 1Q8IA 1ZXTA 1ENCA 1DZ1A 1OXUA 1WTOA 3QB3A 1H9JA 1PZJD 1PFMA 4O42A 1B53A 4RHRA 2J0TD 3HZXA 1DJRD 3DEOA 1Q3LA 1DOLA 5BN5A 2KEEA 3O13A 5I4DA 3SEBA 5FOBB 1IKLA 4C3JG 5ELFA 2BOSA 4KY5A 3NQIA 3QG1A 1T5EA 3FMCA 1EQVA 3PUZA 4NW2A 1SNCA 1RKNA 1SYDA 4FYDA 3V2TA 3QWNA 1DYQA 1DOMA 2EJFC 2DY8A 2F4IA 2PYKA 2ZT9C 3S9WA 1A3TA 1JC7A 2XNAC 1B9MA 3WOFA 3D4RA 1S5FD 3NSWA 4FXKC 3I4NB 1HRJA 1EU4A 2F0GA 5C0XJ 4WFN3 1QCBD 5JEAG 1SNPA 3L7ZC 1SFOB 4IFDI 3Q24A 1IW7C 3DM1A 5BN4A 4FXGC 1STGA 4NDXA 1Y8OB 2R6GA 4C2MB 3HOXB 2LFNA 4G7OC 2RVLA 4R9WA 2F0NA 3E5SA 4TQUS 4XT3B 3S16B 5IGFA 1EWHA 2MGSA 3HGBA 4ULLA 5I6WA 4OO1H 2F03A 1XX8A 1EL0A 1KDBA 4KKSA 1WTQA 1B2TA 2IX1A 4QMGA 3GP7A 5EBDA 2K05A 3IFDA 2H4OA 2CQAA 3CKIB 3MHBA 3X3NA 5G3LD 1BR9A 4HEDA 2K28A 4IFDG 2KCCA 5EJWA 3VYRA 1SNMA 3VR4A 4X3SA 3A8JE 1XXGA 1VMCA 4XQQA 1D1KA 2XWJB 2Z4HA 1C4QA 4XYQA 5KYLA 1MI2A 2MJ8A 2SOBA 3A8KE 2AQ3B 4DK0A 4NMZA 2JEBI 2R92B 4MHEA 4KHZA 3D4WA 5FO8B 4DNTB 5FO7B 2DNCA 1PRTF 4K5WA 3OIQA 2RSNA 2Q8IB 3VYUA 2O2LD 1F2ZA 4JBWA 4BA1I 4I7ZC 1TQOA 2HCIA 3S1MB 1VDZA 2K33A 2KOLA 3NWSA 2E2HB 5DEHA 1K8OA 4IUNA 4FF2A 5KGUA 1E0BA 3I4LA 3W2DA 3HP3A 2F0OA 4KN4C 3H0GB 4OL7A 2F0FA 2FFKB 3SXHA 2F0HA 2IJ0A 1EYCA 1UEAB 4KKTA 1B3AA 2E2IB 2HDMA 1I6VC 4L63B 1M4VA 1EY5A 5A35A 1KAAA 1YNND 1Y1WB 5JAVA 3M4OB 3EJIA 2F3VA 1FNUA 5NUCA 4RGNA 4FF4A 2QDBA 1WTWA 4FF1A 1R4PB 2A74C 1CZGA 1JE4A 4WRDA 2BDOA 4DXGA 3NTHA 3HS0C 4IURA 3TBIB 5I9PA 2L4NA 4XTCS 4M1UB 3R93A 5J1ZA 2F0DA 5KIXA 2PCFB 2H1EA 2BE5C 3I72A 2LMCB 2EY2A 3NXWA 3J7YW 4J8QA 4IUPA 3HG9A 3RMHA 3QIAA 4LMQD 4RWSC 4MN3A 3GTLB 1ET6A 4RGTA 1NCVA 1TY2A 1PZID 1JWUD 1SSOA 4QUCA 1STAA 4KN7C 1QJOA 3MVVA 2L5TA 1I6HB 2PZUA 1O7YA 5ELBA 5M5WB 5C4XB 1HTPA 1IYVA 5JEAJ 3Q6SA 1VMPA 5JVH3 5CV8A 1LTSD 1FD7D 4L8JA 2B8GA 3HOWB 4OO1I 1SMYC 1B1ZA 4H7BA 5IGDA 1TS2A 3NWTA 2R93B 4DK1A 1HTLD 4RAUC 1HCZA 4QCLA 2KUMA 2NUCA 4KHVA 1LO5D 3HOVB 4ZK9B 4G57A 5EKKA 3S2HB 2PW5A 4C3IG 5C0XG 5C0XI 1L0XB 1AP0A 2EZVA 3RLFA 2RDHA 3TZDA 1U9RA 4YIJA 1B4OA 3SK5A 3D6CA 2A68D 3J7AF 4BBSB 1YNNC 3T56B 2DN8A 3DHQA 1ILPA 4XDXA 4OHJA 4DAVA 2RQXA 3K5OA 4CBVA 2XSCA 5EBCA 3NE5B 5IT9E 1X3QA 4K5VA 1SE2A 1RODA 1SYFA 3QOLA 1RTNA 1ZKOA 4Y7NB 1PFBA 1GUSA 5CBAE 3ITPA 3OMGA 5ELDA 2ICIA 3HRZC 2F0LA 1WD0A 2ZXOA 2KECA 3LX0A 1BCPF 4F8MA 4H0LC 2XIWA 1QOHA 5FK9C 3FKIB 3A56A 1SNQA 4HMJA 4F7XA 3HOYB 2EYPA 2HCCA 2NVTB 4HMIA 4DN4M 3HKZB 4RCOA 1DXMA 3S2DB 4A3MB 1LTGD 2JE6I 4HCEA 2VXWA 4BBRB 4V190 2C9OA 2D2CC 4ABNA 1KLUD 4QIWB 2QCPX 2Q8TA 1MSGA 3P1HA 2ZXRA 1EQTA 4K6DA 2BA0A 2JA7B 3J81E 1STNA 4KJOA 5M3MB 1RTOA 2WKDA 2B2UA 3L9AX 1U4RA 3D3RA 1MGSA 3A54A 1BOSA 2XVSA 5JPNC 2EYHA 1PRTC 1GUTA 1J8IA 5C3EB 4DNRB 1QG7A 3J7AV 1TWHB 2K6AA 2PNRC 5I2XA 5C0XH 4ZQ3A 2BA1A 3FPPA 3X3MA 5ISRA 3Q22A 4ZKCB 3SVMA 1KNEA 1L0YB 4H13C 2ID0A 2E76C 1KLGD 1EOTA 2KJXA 3BDOA 3A55A 5E3FA 1GHJA 1NUCA 2O4XA 1SNOA 1CA6A 3J81L 3S14B 3ND9A 5I9OA 3QO2A 5JVG3 3OHXC 2G9HD 3KF8A 3G6JB 2NB0A 1EYDA 3ND8A 1EEID 1FNVA 2L55A 2Q8RE 2WAQB 4WORA 2JSOA 1WTXA 3T4AC 3DEPA 5CORA 4IQZA 2BDNA 1SBBB 5D3DA 3MXGA 3P7JA 1HA5A 1ICWA 1C48A 4MIUA 5KNBA 2N55A 5FO9B 3DWQA 1BCPD 1WTPA 2L9HA 2DNEA 3GV6A 5T1GA 1V1PA 2MHVA 4ZUJA 2XWBB 1Z47A 4R8NA 1ESFA 2OT2A 4TRDA 2KEDA 2WV6D 1D5ZC 1PRTB 2NN6G 3H94A 4J1MA 3KBGA 4RCNA 4KD4A 1VF5C 4C56C 2B2TC 3PIO3 1UNSA 5LHY1 1SYBA 4NP5A 5KEEA 1STYA 3EFXD 4X3UA 3FRPB 4HAEA 1SXTA 5JPMC 1PTOF 3Q0AA 1ZYRC 3E0JA 2PO4A 2A6HD 1AZQA 1AW7A 1V43A 3J80L 4N9TA 5CV5A 2B2VC 2MP1A 4KTAA 3BVGA 1HQRD 1TWAB 4ZRZA 1U4MA 5CV4A 2TMPA 1WTVA 3TP6A 1JR0D 3SE0A 3K7AB 3G7LA 1G291 3EA6A 5C4ZA 2F0MA 3FPUB 2R7ZB 2B2UC 2R3ZA 3OW7A 1LTRD 1B50A 4PMCA 3C1EA 4XQNA 2L0CA 4CGYB 1XYIA 2K32A 4BWGB 1G8ZD 3K5MA 1EWCA 2K1BA 3A8IE 3VR3A 5BN3A 2EDGA 2O5IC 2F0JA 4I65A 4CHTB 1M8AA 1AN8A 1JB3A 3WDNA 3PMFA 1PTOB 3BZDB 1GOZA 2EY1A 1RF2D 1AZPA 4KY6A 2B2TA 1GXDC 3I4MB 3KBXA 3BDLA 4K8IA 4A3IB 5A2QL 2E74C 3AU7A 3D31A 5IODA 5C44B 3SR1A 2HQEA 1LABA 1ENAA 5CR3A 5FLXL 2A69C 1STBA 1AFPA 4Q0FA 2LY7A 2ZXPA 1R4QB 3I73A 1ML0D 4EQPA 5M5XB 4NKLA 2TSSA 2CHBD 1H9KA 2K7VA 1ZYRD 2A6HC 3NTKA 5C5LA 4C1NI 1G6ZA 3I91A 3IL8A 3V05A 4UAIA 2A6ED 2WKCA 1CM9A 1EY0A 4A3GB 5FLXE 5K36H 4KJNA 3TZUA 2KQ3A 1LLRD 4B9XA 3S17B 1S5DD 4OIJA 3SK6A 5HURA 1PTOD 1JCKB 3QJYA 1S5BD 4G7HC 1DOKA 3RD4A 1F9SA 1KABA 3MFGA 1TIID 2N88A 2SNSA 2XN9C 4N9PA 1OXTA 2CVRA 3K57A 3GD7A 3OMCA 1OXXK 1DONA 1EY9A 1SNDA 3OIPA 2AQ2B 2A5HA 3NP8A 1T5XD 1SYGA 3PUVA 2VNUD 1XWEA 2PZWA 1NSNS 2J7ZA 4U673 1C8CA 4LAAA 2F0UA 3J80E 1E2WA 4ID6A 2MUYA 3H91A 1V1OA 3RZDB 2WB1B 1A15A 2ENBA 3T13A 1S5ED 3DWAA 4IUVA 4RKBA 5JEAH 2EYJA 3JAML 1TKWB 2FMCA 2L12A 5IGEA 5IOCA 1HUMA 2AWNA 2EXZA 2RSOA 1X32A 3MEHA 3H6MA 2L1BA 4FF3A 3TP7A 5IGCA 4HSPA 1LTBD 1Y1VB 4C3IB 1EZ6A 4CKBA 2YU9B 4A3DB 3GTPB 3LWUA 3N52A 1CHQD 1EY6A 2RDGA 3I90A 1G91A 1SE4A 1JOKA 3PUXA 1BNZA 3SK4A 1HXYD 4V0BA 1TWCB 2WACA 1MD2D 3S1RB 2I46A 1SYEA 2NZ1D 3KLSX 4LK1C 5CYUA 2QEJC 1D2BA 1S5CD 3S1QB 3W3AA 1EZ8A 2HDLA 1RHPA 1VCIA 4IUQA 1GUWA 1PTOC 1TWFB 1FNWA 1TWGB 1BXTA 3EQLC 5K36G 3U9SA 2EPBA 4E6IA 5J39A 1Q1EA 1PZKD 1PYWD 4HTHA 2F0PA 5JOBA 4G4KA 3VA7A 3NTIA 3ZYYX 2JYOA 2JEAI 2B2YC 1F2MA 1CFMA 2A73B 3OWFA 3K58A 5IT9L 2B2WC 2RKSA 2JXMB 1EU3A 4K2KA 3U9OA 4Z9CB 3BVZA 5C3WA 3HEJA 2F0QA 2QILA 3GO5A 3R2IA 4DA2A 1TT2A 3GTJB 3L3OC 1SDFA 3PIP3 1FYCA 2AQ1B 2F0TA 2X6GA 4QUFA 3K5NA 1D5XC 1QILA 3BS1A 5FKAC 1CI3M 4C1NK 3SHLA 2WIIB 3NHHA 2B63B 3BYYB 1BBXC 2DY7A 1LT6D 2WP8J 3GTMB 2NN6I 2EJGC 2EVBA 4J6HA 3M7NA 2EY5A 4EVOA 4CJ2C 1LTAD 1IHZA 3TP5A 3CHBD 3S15B 3PUYA 4FVMA 3URYA 2SDFA 3PV0A 3M85A 1QNUA 4H44C 1SAPA 2FJ2A 1LTTD 3MWYW 4HCSA 2F0VA 1PXUA 4AYBB 2R61A 5C6AA 5DNFA 2JA8B 3ERQA 1KTKA 3DWPA 4IZ8A 2BE5D 4WJWA 2F0KA 1E2ZA 4BA2I 1LV9A 4CJ1B 5I6YA 3F2UA 5F2DA 1EIHA 1PMRA 5TSSA 2F0SA 1MSHA 3RZOB 4DF7A 4UDUC 4EGVA 3K59A 2EYLA 2IT1A 4A3FB 3JAME 2IX3A 3K6OA 1Z6HA 1SJED 4OIKA 5IIFA 4IUUA 2HUGA 3OPOA 2F0IA 4EQNA 4CJ0B 3H09A 4ZYSA 1WTRA 1I4HA 3IAYA 3M3YB 1F2YA 2K5DA 4L6TB 3VR2A 1H9RA 4RGOS 3R2TA 4KV6A 3E6ZX 3KLRA 5LL6X 3K5LA 4A3JB 2F0EA 1HQMC 3AMUA 3BDCA 1A2TA 3C46A 3BVMA 2NN6H 2E75C 4IALA 5D14A 2D5DA 1PTOH 2F0WA 5C3XA 1CQFA 4ILWA 5M5YB 5A2QE 2JA6B 4K2LA 1TS3A 1J9OA 1HA6A 5T1IA 4C3HB 1LT3D 5KYIA 5DM73 1EIGA 1EEFD 2O5JC 4RFBA 3MZ5A 3NUCA 2QKIC 1Y69U 4FXDA 1ZEQX 2NVXB 3Q23A 1EY4A 2PMZB 2YYZA 1AEXA 4DXFA 4RKLA 5IGGA 2M2LA 1TR5A 3MXUA 5AFWA 1IKMA 3GTKB 3T16A 3TSSA 2B2WA 1BUVT 3GV3A 1QB5D 2OXPA 4IN3A 4P2CB 1JICA 1BQQT 2OF1A 3D6WA 4CKEA 4DAYA 3EVQA 1TU2B 1I4RA 2NTSA 3KK7A 1TS5A 3UI2A 4K5XA 2OEOA 5M9OA 2B8FA 1BCPB 4RA8A 3CRKC 3D4DA 1RDPD 2I07B 2IPKD 1TY0A 2KHSA 1F2LA 4ZAIA 3LNNA 1UUPA 4X3TA 2EOTA 1I50B 1SMYD 1Y8NB 2JA5B 1D5MC 3BG3A 1GUGA 3HOUB 4OGQC 5C4JB 4X3KA 4PV1C 3FDTA 1Z7TA 2AUKA 1NR4A 2EY6A 1RCVD 5E1FA 4XQJA 1K8MA 3NPPA 2K03A 3MFYA 1GJXA 1CT1D 1O78A 1A2UA 1A3VA 2X69A 4F87A 1WD1A 4A3KB 4HR7B 2PZTA 2VB3X 3TN2A 1UAPA 3VYSA 3DXJC 1U4LA 4KMUC 5CGKA 1V8QA 2A68C 4S3SA 1CZWA 4RHSA 2B39A 4DGZA 1F77A 3GTQB 4B08A 1PRTD 2L11A 1RJTA 3C3LA 1WVLA 5CV7A 5CV6A 1WCMB 5EKIA 2FMMA 4QF4A 3MAQA 3FEWX 5D3IB 4TSSA 2PW7A 5CMDA 3V96A 1OXSC 1H9SA 2NYZD 4K8JA 1O7LA 1I4XA 3HOZB 5IGBA 1I4GA 5EPJA 5ELCA 3S1NB 3OSOA 1F9QA 3TDQA 2K5WA 3PO2B 2X6LA 2EE1A 2LS01 1DCZA 2XRSD 3GTOB 1PLFA 4QB4A 2NWGA 2SEBD 1E2VA 2FINB 5M3FB 4XXEA 3A7AB 3VA5A 4FNFA 1YNJC 2B2VA 3C1FA 3N6RA 1ONLA 5CBEE 1I4QA 5COYA 4O1NA 2G9DA 2QF7A 3PO3B 2IW3A 5JJZA 1ET9A 3CQZB 4PQXA 4DAPA 1II3A 1LT4D 5EQ0A 3OWEB 2K01A 4KKUA 3R8BA 4XIGS 4TKOB 2K5QA 4ME5A 2M9VA 5KNDA 1F9PA 3TMEA 3GQBA 1CQVA 1BDOA 1Q1BA 2IX0A 5K5PA 2E2JB 3C2PA 3KLSA 1Y8PB 4PMBA 5CC4A 2Z1CA 3T51B 1KDCA 2NBFA 4HN7A 1PFNA 1SJHD 2AWOA 1H9MA 3LWEA 4A93B 1W6KA 2V4DA 1Q90A 2MPMA 1MBYA 4RGMA 4A3EB 4XT1B 3IFTA 1LT5D 3VR5A 1ESRA 5E4WC 4PNYA 4KD3A 3TP8A 1EFID 1PDQA 1CK1A 3DMUA 1X3PA 2B2YA 5D65A 4R8IA 3GTGB 1HFGA 2GA4B 2E2DC 2XRQD 5DM63 1EY7A 1BCPC 1S4ZA 1EYAA 1GUOA 2EJMA 4K14A 1IL8A 1A3UA 3SDZA 4BY7B 1G2TA 5EPLA 2JP1A 2M00A 3KUPA 2NVYB 4C3HG 2Z8LA 4BS9A 4FP5D 1YNJD 4KY7A 1QE6A 4DFAA 3NBIA 2EYFA 4DU9A 1SE3A 2VB2X 2D62A 4KK7A 1D1IA 4ZLTF 1I4PA 3K0YA 4XYOA 1W6JA 1TVXA 1DM0B 3WOEA 2A69D 2J4XA 5KRUA 3CU7A 2IL8A 5C4HA 3I70A 3DUZA 4ODGA 1HUNA 5J22A 4A3BB 3T53B 3NQTA 1OXVA 2PPBC 4IUTA 1G2SA 1IYUA 1U4PA 4IFDJ 2NVQB 1A6XA 3RUZA 4GZYC 2AUJD 3CRLC 1HFNA 2Z4IA 2F3WA 4LJZC 2NTTA 3D8GA 2D9UA 1LACA 2K04A 1DD2A 2BCOA 1Q12A 1HPCA 1QNKA 2WINB 2PQEA 2FHTA 4M8AA 3P75A 2CW0D 3MC0B 1RD9D 2A6EC 1JORA 5C5MA 5KNCA 1B9NA 4FO2A 3BYTB 4B9WA 3I8ZA 4G7ZC 3A7LA 3VYTA 4K6LA 5G3LF 2IWHA 5EKLA 3VR6A 4IFDH 3M7GA 1JOOA 1QWYA 5EGTA 4ZUIA 5LL6S 4EQOA 3NK9A 1JOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 3;  3PIO 3;  3PIP 3;  4WFN 3;  5JVG 3;  5DM7 3;  5JVH 3;  4U67 3; 
#chains in the Genus database with same CATH topology
 2KA7 A;  2I5L X;  1JWM D;  1STH A;  1CHP D;  5CV9 A;  4OON A;  4LF8 L;  3GTJ H;  1XNQ L;  3IRB A;  5DAU A;  4IPG A;  3EIV A;  1Y1V H;  2OQ0 A;  5HGT A;  4PMW A;  4OO1 G;  1HHV A;  4U68 A;  2R93 H;  1BF4 A;  4A3D H;  3MA2 B;  3NEM A;  1FR3 A;  2KCN A;  3CQZ H;  4UY8 C;  1ENF A;  1D6E C;  3QOJ A;  4HJ5 A;  1HNW L;  1VQ7 A;  3H3V C;  1LTI D;  4KI0 A;  1M90 C;  2UXC L;  1R9T B;  1FGU A;  1CSQ A;  1UE6 A;  2RDF A;  3OOC A;  4CDC C;  4ALP A;  2ICE C;  5M5W H;  4RH6 A;  1TS4 A;  1BO0 A;  4GN3 B;  3P20 A;  3MXP A;  3W1G A;  5FJ8 H;  4JI2 L;  4R4O A;  1EUJ A;  5I2Y A;  5E4X A;  2QA4 A;  2ZTD A;  3EBE A;  1HNX Q;  2QW7 A;  1AE3 A;  4Q5V A;  3R3O A;  1K83 B;  2EYM A;  3ONA B;  4HSV A;  1I3Q B;  4A76 A;  1O7Z A;  3K0X A;  4BY1 B;  5EPK A;  4JI8 L;  2R92 H;  1UE5 A;  2RA4 A;  2C5C A;  3I4M H;  1CA5 A;  1CKN B;  2OQK A;  3MXN A;  1XTC D;  1EY8 A;  2CH4 W;  2R7D A;  2SNM A;  4CKC A;  2EYO A;  1IW7 D;  1GUN A;  2WB1 G;  2LKV A;  2FXQ A;  3JAM c;  3IKJ A;  3NBH A;  5ELE A;  1JQY D;  4DPG A;  2JA8 H;  1BBW A;  1STE A;  1SYC A;  2RBM A;  1KNA A;  3SK8 A;  1NR2 A;  3B6Y A;  2KVM A;  3I3C A;  2Y0S B;  1JWS D;  1H9S B;  1Z9F A;  1CTM A;  3MTS A;  2JA7 G;  4LNQ A;  3ERO A;  1GM5 A;  3AB9 A;  1K8A C;  1FGB D;  1EYG A;  1NAP A;  4C3J B;  3M4Y A;  1AE2 A;  1K3R A;  4JI6 Q;  4ZKB B;  2F1M A;  4JCV E;  1F9R A;  4AIM A;  5IP9 H;  1VF7 A;  1KDA A;  3PUW A;  2NZO A;  1O80 A;  5BR8 L;  1ILQ A;  4F88 A;  1XMQ L;  2VUM B;  4NXN L;  3FVQ A;  4JK1 C;  1PH2 A;  1V1P B;  4YHH L;  1MKH A;  4YWM A;  1OO9 B;  1GHK A;  1SEB D;  4JW0 A;  2K5V A;  1XPR A;  2CW0 C;  4B3T Q;  1B44 D;  1Q8I A;  1ZXT A;  1ENC A;  4B3T L;  1DZ1 A;  1X6O A;  1OXU A;  1WTO A;  3QB3 A;  3GDE A;  1H9J A;  1PZJ D;  1PFM A;  4O42 A;  4N8X 1;  1B53 A;  4RHR A;  2J0T D;  3HZX A;  1DJR D;  3DEO A;  3E3X A;  4A75 A;  1Q3L A;  3OW2 A;  1DOL A;  5BN5 A;  4GN4 B;  2KEE A;  3O13 A;  4BY1 G;  3CCV A;  2JA6 H;  5I4D A;  3BU2 A;  3SEB A;  5FOB B;  1IKL A;  4C3J G;  1YZ6 A;  5ELF A;  2BOS A;  3AQQ A;  4KY5 A;  3NQI A;  1RIP A;  3QG1 A;  1T5E A;  3FMC A;  1EQV A;  3PUZ A;  2XGT A;  4NW2 A;  3UE1 A;  1A8V A;  1SNC A;  1RKN A;  1PA6 A;  1SYD A;  4A3L G;  4FYD A;  3V2T A;  3QWN A;  4L5T A;  3KDF B;  1EFW A;  4N8F A;  5IE8 A;  1ICF B;  3J81 j;  1DYQ A;  2JA7 H;  1DOM A;  2EJF C;  1YHB A;  2DY8 A;  2F4I A;  1HZA A;  2PYK A;  2ZT9 C;  3OYY A;  3D0F A;  3S9W A;  1JJC B;  2I5M X;  1IBM Q;  1A3T A;  4LFA Q;  1YI2 A;  1JC7 A;  2XNA C;  1B9M A;  3OTO L;  3WOF A;  3I4M G;  3D4R A;  1S5F D;  2JA6 G;  2E2H H;  3NSW A;  4FXK C;  3I4N B;  3JAM i;  3J81 c;  1HRJ A;  1EU4 A;  2F0G A;  3CC2 A;  5C0X J;  4WFN 3;  1QCB D;  5JEA G;  5L37 A;  4YWL A;  1SNP A;  3L7Z C;  1SFO B;  4IFD I;  1I6H H;  3Q24 A;  1IW7 C;  3DM1 A;  5BN4 A;  2IY5 B;  2PI2 A;  4JBM A;  5C4X G;  4FXG C;  1STG A;  2Q2T A;  3TRZ A;  4NDX A;  3S1Q H;  1Y8O B;  4AH6 A;  4B3S Q;  2JJQ A;  2R6G A;  4C2M B;  2Q2U A;  2LFN A;  3HOX B;  2RVL A;  4G7O C;  4R9W A;  2F0N A;  3E5S A;  4TQU S;  4R4T A;  4XT3 B;  3S16 B;  2RCN A;  1J6Q A;  5IGF A;  1EWH A;  2MGS A;  2Y0S G;  3HGB A;  4ULL A;  3KJP A;  4DV0 Q;  2R93 G;  5I6W A;  4OO1 H;  4DV3 L;  2DUD A;  2F03 A;  1XX8 A;  1EL0 A;  1Y1V G;  2B29 A;  1KDB A;  4KKS A;  1WTQ A;  3BZC A;  1B2T A;  3J7A 5;  2IX1 A;  4QMG A;  5GAD C;  3GP7 A;  1YHA A;  2UXB Q;  2N49 A;  3W5O A;  4JI0 Q;  3RLO A;  3DM3 A;  4PZ6 A;  2K05 A;  5EBD A;  4GNX A;  3IFD A;  2H4O A;  2CQA A;  3CKI B;  3MHB A;  4AQY Q;  3S2H H;  2RHS B;  1VQH A;  1KQS A;  3X3N A;  5G3L D;  1BR9 A;  4HED A;  2K28 A;  4IFD G;  2KCC A;  5EJW A;  3VYR A;  1SNM A;  3VR4 A;  4X3S A;  3A8J E;  3M9B A;  3RN5 A;  1XXG A;  1VMC A;  4A3K H;  2KBN A;  4XQQ A;  3I4N H;  1D1K A;  2CH4 A;  2XWJ B;  2Z4H A;  4DR1 L;  1C4Q A;  4XYQ A;  2GN5 A;  5KYL A;  1MI2 A;  1SRU A;  2MJ8 A;  2SOB A;  3A8K E;  3Q8D A;  2AQ3 B;  4DK0 A;  4NMZ A;  2JEB I;  2R92 B;  4MHE A;  4KHZ A;  3D4W A;  5ELO A;  5FO8 B;  4A3J H;  4DNT B;  1Y1W H;  5FO7 B;  2DNC A;  1PRT F;  4K5W A;  3OIQ A;  2RSN A;  2Q8I B;  1Q82 C;  3VYU A;  4NB3 A;  4R4I A;  2UUB L;  2O2L D;  1F2Z A;  4JBW A;  2HD3 A;  4BA1 I;  4I7Z C;  1TQO A;  5M3F G;  1XNR L;  1B8A A;  2HCI A;  1N32 L;  4DR6 Q;  3S1M B;  1K8G A;  1VDZ A;  2K33 A;  2KOL A;  3NWS A;  2E2H B;  4DK6 C;  5DEH A;  4B3M L;  3CCJ A;  3RLN A;  5IYB G;  4DR1 Q;  4DR4 L;  1K8O A;  4IUN A;  1CSP A;  4FF2 A;  5KGU A;  1E0B A;  1PH1 A;  3I4L A;  3W2D A;  1Y14 B;  1JJ2 A;  3HP3 A;  4JI3 L;  2F0O A;  4KN4 C;  3H0G B;  1IBK Q;  4OL7 A;  1K83 H;  2F0F A;  2FFK B;  1S72 A;  1IL2 A;  4HJ9 A;  1XMQ Q;  3NEL A;  3SXH A;  4LFA L;  4IOA A;  2PQA A;  2F0H A;  2IJ0 A;  2K52 A;  1EYC A;  1UEA B;  4X6A H;  4KKT A;  1B3A A;  2E2I B;  5GAE C;  4QL5 A;  4LWC A;  2HDM A;  1I6V C;  4L63 B;  1M4V A;  1VQA A;  1EY5 A;  5A35 A;  4JI3 Q;  3GTL H;  3HKS A;  3CCQ A;  4GOP B;  1KAA A;  1YNN D;  1Y1W B;  5JAV A;  3M4O B;  4X64 L;  5E7N A;  3S17 H;  5IP7 H;  3EJI A;  2F3V A;  1FNU A;  5NUC A;  1XNR Q;  2UUA L;  1FL0 A;  4RGN A;  4A3E G;  4FF4 A;  4DV4 Q;  2QDB A;  4P71 A;  1TXY A;  1HR0 W;  1E22 A;  1WTW A;  4FF1 A;  1R4P B;  2A74 C;  4DK3 C;  1CZG A;  3KF6 B;  4APV A;  4EX5 A;  1JE4 A;  4WRD A;  2BDO A;  4DXG A;  1QZH A;  4LF5 L;  3NTH A;  4ME3 A;  1WJJ A;  3HS0 C;  4IUR A;  3TBI B;  5I9P A;  2L4N A;  4XTC S;  4M1U B;  2UUC L;  3R93 A;  5J1Z A;  2F0D A;  5KIX A;  2PCF B;  4DNI A;  2VQF L;  2H1E A;  4HID A;  1K3B C;  2BE5 C;  3I72 A;  2HIX A;  2LMC B;  1GO3 E;  2EY2 A;  3NXW A;  3J7Y W;  4J8Q A;  1VQN A;  4IUP A;  3HG9 A;  1KXL A;  5C3E G;  5LMU Q;  3RMH A;  3QIA A;  1QVF A;  4LMQ D;  4RWS C;  5ELN A;  1VS0 A;  1KC8 C;  4LUV A;  4MN3 A;  3GTL B;  3H0G G;  1ET6 A;  5FLM H;  3KF8 B;  1I94 L;  1VQC A;  2YU9 H;  1WTH A;  4RGT A;  1NCV A;  1TY2 A;  3T1H Q;  1PZI D;  1JWU D;  1SSO A;  1UE1 A;  4JYA Q;  3S15 H;  4QUC A;  1STA A;  4KN7 C;  1Q81 C;  2HHH Q;  1WCM H;  3TRE A;  1QJO A;  3MVV A;  3SGI A;  2L5T A;  1I6H B;  2PZU A;  1O7Y A;  5ELB A;  5M5W B;  5C4X B;  4HIK A;  1I50 H;  1HTP A;  1IYV A;  3T1Y L;  3HOU H;  1N36 Q;  5JEA J;  3Q6S A;  1VMP A;  5JVH 3;  1HZC A;  4A3I H;  5CV8 A;  1LTS D;  1FD7 D;  2NVT H;  4L8J A;  2B8G A;  4L5S A;  3HOW B;  4OO1 I;  1SMY C;  1B1Z A;  4H7B A;  5IGD A;  2VZA A;  1TS2 A;  3NWT A;  2R93 B;  1X9N A;  4POG A;  4DK1 A;  1HTL D;  1PH6 A;  3ULJ A;  2VQF Q;  4RAU C;  4OWW B;  1HCZ A;  4QCL A;  2KUM A;  2AKW B;  1PH4 A;  2NUC A;  1B70 B;  4KHV A;  1L1O C;  1LO5 D;  3PQI A;  4ZK9 B;  3HOV B;  4G57 A;  5EKK A;  2LXK A;  3S2H B;  2PW5 A;  4C3I G;  3CCR A;  4JI1 L;  5C0X G;  3S1N H;  4X66 L;  5C0X I;  2JA9 A;  1L0X B;  1K0S A;  1DGS A;  2UUA Q;  1AP0 A;  3CCU A;  1HZ9 A;  2JN4 A;  3RLF A;  2EZV A;  2VS1 A;  2RDH A;  3TZD A;  1U9R A;  4YIJ A;  3I56 A;  1B4O A;  3SK5 A;  3D6C A;  4HIM A;  2A68 D;  3GTO H;  3J7A F;  1YNN C;  4BBS B;  3T56 B;  3U4Z A;  4IJH A;  2DN8 A;  3DHQ A;  1ILP A;  4XDX A;  1S3O A;  2YV5 A;  4OHJ A;  4DAV A;  3G71 A;  2ZTC A;  1BVS A;  2RQX A;  4BBS G;  3K5O A;  4GKJ L;  4CBV A;  4GKJ Q;  2XSC A;  2NVX H;  1N33 Q;  5EBC A;  3NE5 B;  1YJN A;  5IT9 E;  1X3Q A;  4K5V A;  1SE2 A;  1ROD A;  1SYF A;  3QOL A;  1RTN A;  3I7F A;  1ZKO A;  4Y7N B;  1VQM A;  1PFB A;  1GUS A;  4OX9 L;  5CBA E;  3ITP A;  3OMG A;  3MXN B;  2DGY A;  4CDF C;  5ELD A;  5M3M H;  2ICI A;  4HJ8 A;  3HRZ C;  4JI5 L;  5LMU L;  2F0L A;  2WAQ E;  2GVA A;  1WD0 A;  4IPD A;  2ZXO A;  2KEC A;  3LX0 A;  1UEB A;  1BCP F;  4F8M A;  4H0L C;  2CCZ A;  1PYS B;  2UUC Q;  4DR3 Q;  4DV6 L;  1W2B A;  5GAG C;  2XIW A;  2ASB A;  1QOH A;  5FK9 C;  1X3G A;  3FKI B;  1PYB A;  3A56 A;  1SNQ A;  4HMJ A;  1VQF A;  2PNH A;  4F7X A;  2KEN A;  3HOY B;  3L2P A;  2EYP A;  2K50 A;  2HCC A;  2NVT B;  4HMI A;  4DR7 Q;  2A8V A;  3GTM H;  4I7A A;  4DN4 M;  3HKZ B;  3JC6 6;  4RCO A;  3H3V I;  1DXM A;  3J7Z C;  3M4Q A;  3S2D B;  3KOJ A;  1G6P A;  4A3M B;  1LTG D;  2JE6 I;  4HCE A;  3UDI A;  4CDD C;  2VXW A;  4BBR B;  4V19 0;  2C9O A;  2D2C C;  4RMF A;  2ZM6 L;  4ABN A;  4GLV B;  3VDY A;  3G6E A;  3CXC A;  1KLU D;  4QIW B;  2QCP X;  5M3M G;  1SR3 A;  2Q8T A;  1MSG A;  3AYH B;  5IYD G;  3P1H A;  2ZXR A;  1EQT A;  4K6D A;  2BA0 A;  2JA7 B;  3J81 E;  2E5L Q;  1STN A;  2VY3 A;  4KJO A;  3RZD H;  5M3M B;  1RTO A;  2WKD A;  3H3V H;  2B2U A;  3L9A X;  1U4R A;  3FKI H;  3D3R A;  1MGS A;  3A54 A;  5FLX c;  1BOS A;  3HFZ B;  2XVS A;  5JPN C;  2EYH A;  4GOP C;  3HOY H;  1PRT C;  3E9H A;  1GUT A;  5IT9 c;  1J8I A;  5C3E B;  4DNR B;  4DR2 Q;  1QG7 A;  3J7A V;  4JV5 Q;  3CC7 A;  1TWH B;  3I4O A;  4DV3 Q;  2PI2 E;  2K6A A;  2PNR C;  3GTP H;  1NMF A;  2ZTE A;  5I2X A;  3KFU A;  5C0X H;  4C3I H;  4ZQ3 A;  2BA1 A;  3FPP A;  1Q86 C;  3X3M A;  5ISR A;  3Q22 A;  4ZKC B;  2KCM A;  3SVM A;  1KNE A;  1L0Y B;  4YCV A;  4H13 C;  2ID0 A;  4ZCK A;  4C2M H;  2E76 C;  3PIP A;  1N32 Q;  1KLG D;  1EOT A;  2KJX A;  3BDO A;  3A55 A;  5E3F A;  1GHJ A;  1PFS A;  2F4V Q;  1PV4 A;  1NUC A;  2O4X A;  1NE3 A;  1SNO A;  4FDB A;  1CA6 A;  3J81 L;  3S14 B;  3ND9 A;  2UXD L;  5I9O A;  3QO2 A;  1C0A A;  3K7A H;  1HR0 Q;  5JVG 3;  3OHX C;  1SLJ A;  2G9H D;  3KF8 A;  3G6J B;  2NB0 A;  1EYD A;  3ND8 A;  1EEI D;  1FNV A;  2L55 A;  2Q8R E;  2WAQ B;  4WOR A;  2JSO A;  4X65 L;  1WTX A;  3T4A C;  3DEP A;  4DAY B;  5COR A;  4IQZ A;  1JMC A;  2BDN A;  1SBB B;  5D3D A;  4QQB X;  3P7J A;  3MXG A;  1HA5 A;  1M1K C;  1ICW A;  1C48 A;  2CQO A;  4MIU A;  5KNB A;  2N55 A;  5FO9 B;  3DWQ A;  2K75 A;  1BCP D;  1WTP A;  2L9H A;  2NVY H;  1NTG A;  2DNE A;  3GV6 A;  1Q8K A;  5T1G A;  4LF4 L;  4BY7 H;  4DV2 L;  1VQD A;  1V1P A;  3J80 c;  2IHF A;  2MHV A;  4ZUJ A;  2XWB B;  1Z47 A;  1VQ8 A;  1X56 A;  4R8N A;  1ESF A;  2OT2 A;  4IJL A;  4TRD A;  2KED A;  2WV6 D;  5IWA Q;  1D5Z C;  1PRT B;  2NN6 G;  4BBR H;  1HH2 P;  3H94 A;  4J1M A;  4DR7 L;  3RNU A;  3KBG A;  4R4C A;  4RCN A;  4KD4 A;  2OTL A;  1VF5 C;  1YEZ A;  4C56 C;  4WJ3 M;  2B2T C;  3PIO 3;  1UNS A;  5LHY 1;  1SYB A;  3MEF A;  4NP5 A;  1IXR A;  4OWT B;  5KEE A;  3A5U A;  1STY A;  3EFX D;  2QDL A;  4X3U A;  1K73 C;  3FRP B;  3OTO Q;  4HAE A;  1SXT A;  2UU9 L;  5JPM C;  1J5E L;  1PTO F;  3Q0A A;  1IZ6 A;  1ZYR C;  3K8A A;  3E0J A;  2PO4 A;  1WFQ A;  2A6H D;  1LUZ A;  1GD7 A;  2QEX A;  3CD6 A;  1AZQ A;  1AW7 A;  1V43 A;  1KD1 C;  3J80 L;  4N9T A;  1CKM A;  5CV5 A;  1W3S A;  4LFB Q;  4MNO A;  2B2V C;  3HOU G;  2MP1 A;  4DR2 L;  4KTA A;  3BVG A;  1HQR D;  1TWA B;  4ZRZ A;  1U4M A;  5CV4 A;  1UWV A;  2TMP A;  1EIY B;  1WCM G;  1WTV A;  3TP6 A;  1JR0 D;  3SE0 A;  3F2C A;  3K7A B;  3G7L A;  4GKK L;  2CFM A;  1G29 1;  1E3P A;  2JK8 A;  3EA6 A;  3CCL A;  2F0M A;  5C4Z A;  3FPU B;  2R7Z B;  2B2U C;  1NBW A;  2R3Z A;  3OW7 A;  1LTR D;  1B50 A;  3E9I A;  4X62 L;  4LF6 L;  4PMC A;  3C1E A;  2Z9H A;  4PZ8 A;  4XQN A;  2L0C A;  4CGY B;  1XYI A;  2QGQ A;  2K32 A;  4BWG B;  1G8Z D;  4OXP A;  3K5M A;  2OWO A;  1EWC A;  2K5H A;  3GTQ H;  2K1B A;  3A8I E;  4AYB G;  1E1T A;  2EQS A;  3VR3 A;  5BN3 A;  2EDG A;  4PG3 A;  3LGJ A;  2O5I C;  1K28 A;  2F0J A;  4I65 A;  4CHT B;  2MO1 A;  1M8A A;  1XMO L;  4P73 A;  2K4K A;  1AN8 A;  1JB3 A;  3KLW A;  3WDN A;  3PMF A;  4DV7 Q;  1PTO B;  3BZD B;  1GOZ A;  2EY1 A;  3CCS A;  1RF2 D;  3ERS X;  4KY6 A;  1AZP A;  1IBM L;  1Y1W G;  4A3J G;  2B2T A;  1GXD C;  3I4M B;  3KBX A;  2VW9 A;  1VQ4 A;  3BDL A;  4K8I A;  4A3I B;  5M5Y H;  4DUY Q;  1GVP A;  5A2Q L;  2Q2H A;  2E74 C;  3AU7 A;  1KIX A;  3D31 A;  4AQY L;  5IOD A;  5C44 B;  3SR1 A;  2HQE A;  3T1Y Q;  1LAB A;  1ENA A;  5CR3 A;  5FLX L;  2A69 C;  4A3K G;  2Q2I A;  4A3M G;  3U4V A;  5JJI A;  1A0I A;  4LF8 Q;  3F8T A;  1XNQ Q;  1LTL A;  3KDF A;  2YTX A;  1STB A;  1AFP A;  4JI4 L;  4Q0F A;  2Y0S E;  2LY7 A;  2ZXP A;  1X55 A;  4IPH A;  1R4Q B;  3I73 A;  1ML0 D;  4EQP A;  5M5X B;  2I0Q A;  4NKL A;  1L1O B;  2TSS A;  3A0J A;  2CHB D;  3CCE A;  1H9K A;  4B3R L;  2K7V A;  2JA5 G;  4A3C H;  1ZYR D;  4GNX B;  2A6H C;  1XMO Q;  2I5H A;  3NTK A;  2GVB A;  5C5L A;  4C1N I;  1G6Z A;  3I91 A;  3IL8 A;  1KHI A;  5M3F H;  1GKH A;  3V05 A;  1K0R A;  4UAI A;  2HQL A;  2A6E D;  4DV7 L;  2WKC A;  4R1J A;  1PH9 A;  1CM9 A;  2KHJ A;  4B3M Q;  1EY0 A;  4A3G B;  2OTJ A;  5FLX E;  5K36 H;  4KJN A;  3TZU A;  4JI2 Q;  2KQ3 A;  2N8N A;  1LLR D;  4B9X A;  3S17 B;  3TEH B;  1S5D D;  4OIJ A;  3SK6 A;  5HUR A;  2UXC Q;  1PTO D;  1JCK B;  3QJY A;  1S5B D;  4G7H C;  1DOK A;  5LMN Q;  3RD4 A;  1F9S A;  1KAB A;  3MFG A;  1TII D;  3CME A;  2N88 A;  5AJ3 L;  2E2I H;  5M5X H;  4X62 Q;  2B63 G;  5JJK A;  4DKA C;  4DV1 L;  2SNS A;  3RR5 A;  3PCO B;  2XN9 C;  4MTN A;  1LYL A;  4TVA B;  1RL2 A;  1OXT A;  4N9P A;  4GKK Q;  2CVR A;  3K57 A;  3GD7 A;  3OMC A;  1OXX K;  2ZM6 Q;  1PH8 A;  4NXM Q;  1DON A;  1EY9 A;  5IYC G;  4A3L H;  1SND A;  3OIP A;  2AQ2 B;  2A5H A;  3W1B A;  3NP8 A;  1T5X D;  1SYG A;  3PUV A;  4UPA A;  2VNU D;  1VQ6 A;  1XWE A;  2YTV A;  1A63 A;  2PZW A;  1HNZ L;  1HJP A;  1NSN S;  5J3B A;  2J7Z A;  4U67 3;  3T1H L;  1C8C A;  3L0O A;  4LAA A;  2F0U A;  4IOC A;  3J80 E;  4RG1 A;  4JC0 A;  4BY1 H;  1E2W A;  1D7Q A;  4ID6 A;  1NJI C;  3CF5 A;  2MUY A;  3GTG H;  4DR4 Q;  3H91 A;  3ER0 A;  1V1O A;  4O0A A;  3RZD B;  4KLK A;  2WB1 B;  2K5N A;  5C4X H;  1A15 A;  1I3Q H;  2ENB A;  3T13 A;  1S5E D;  3DWA A;  4IUV A;  4BXX H;  2R7F A;  4RKB A;  5JEA H;  2EYJ A;  3JAM L;  1TKW B;  4LF6 Q;  4JBK A;  2FMC A;  4UP9 A;  2L12 A;  5IGE A;  4JI6 L;  1N9W A;  3S24 A;  5IOC A;  2R7Z G;  1HUM A;  2AWN A;  2EXZ A;  2RSO A;  1PHJ A;  4DV4 L;  1X32 A;  3MEH A;  4LUO A;  4R4Q A;  3H6M A;  2L1B A;  4FF3 A;  2ZJR A;  3TP7 A;  5IGC A;  4HSP A;  1LTB D;  1Y1V B;  5IP9 G;  2VUM G;  4C3I B;  1EZ6 A;  4CKB A;  2YU9 B;  4A3D B;  3GTP B;  3LWU A;  4LF9 Q;  2EXD A;  1X54 A;  3N52 A;  1CHQ D;  2MQH A;  1H95 A;  2VQE L;  1EY6 A;  2RDG A;  3I90 A;  1G91 A;  1C9O A;  1SE4 A;  1JOK A;  3PUX A;  1PH3 A;  3SK4 A;  1BNZ A;  4JI7 L;  1HXY D;  4V0B A;  1TWC B;  2WAC A;  1MD2 D;  4DAM A;  2VUM H;  2JA8 G;  3STB C;  1YJ9 A;  1E24 A;  2B63 H;  4QJF A;  3E0E A;  3PIO A;  2CWA A;  3S1R B;  2I46 A;  1SYE A;  1WI5 A;  2NZ1 D;  3KLS X;  2ATW A;  2R7Z H;  4LK1 C;  1YBY A;  5CYU A;  1I94 Q;  1EQR A;  2QEJ C;  4C3J H;  1D2B A;  1S5C D;  3S1Q B;  3W3A A;  1EZ8 A;  2HDL A;  1S40 A;  1B7Y B;  1RHP A;  4H02 A;  1VCI A;  1IBK L;  2R92 G;  4IUQ A;  1GUW A;  1EWI A;  1PTO C;  1NY4 A;  1TWF B;  1FNW A;  3NBH B;  1TWG B;  1BXT A;  2JQO A;  3EQL C;  2ZJQ A;  4BXX G;  4LF5 Q;  4P75 A;  1NNX A;  5K36 G;  1PH7 A;  3U9S A;  2EPB A;  4E6I A;  5J39 A;  4P72 A;  1Q1E A;  1PZK D;  1PYW D;  4HTH A;  2F0P A;  5JOB A;  4G4K A;  3VA7 A;  2F3I A;  3NTI A;  3ZYY X;  1JJG A;  2JYO A;  3CAM A;  2JEA I;  3FHW A;  1I5F A;  2B2Y C;  2KHI A;  1F2M A;  1CFM A;  1U0L A;  2A73 B;  4LFC Q;  4DR5 Q;  2JA5 H;  3OWF A;  3K58 A;  5IT9 L;  2B2W C;  4L5Q A;  4LUZ A;  1QVG A;  2RKS A;  2JXM B;  1EU3 A;  4K2K A;  3U9O A;  1JB7 A;  5IYC H;  2P5Z X;  4Z9C B;  1P8L A;  1X65 A;  3BVZ A;  5C3W A;  4LF4 Q;  4OEM B;  4LF7 L;  3HEJ A;  2F0Q A;  2QIL A;  5GRO A;  3GO5 A;  1SRO A;  3R2I A;  4DA2 A;  1TT2 A;  3M3Y H;  3PF5 A;  4DV5 Q;  3GTJ B;  4DV5 L;  3L3O C;  1MHW C;  3CC4 A;  3HOV G;  2WB1 E;  1YIJ A;  1HZB A;  2E5L L;  2PQA B;  4A3M H;  1SDF A;  1JOQ A;  4QGU A;  3PIP 3;  1FYC A;  4NXM L;  2AQ1 B;  2F0T A;  2X6G A;  4LF7 Q;  4QUF A;  1IYJ B;  3K5N A;  1D5X C;  1QIL A;  1PVO A;  3BS1 A;  5FKA C;  1CI3 M;  4C1N K;  3SHL A;  1K9M C;  2WII B;  4DV1 Q;  3KYH C;  3NHH A;  1L1O A;  2B63 B;  3BYY B;  1BBX C;  1V1Q A;  4A3F H;  2DY7 A;  1LT6 D;  2WP8 J;  3GTM B;  2NN6 I;  2EJG C;  2EVB A;  2UU9 Q;  4J6H A;  3M7N A;  1N34 Q;  2EY5 A;  4EVO A;  4CJ2 C;  1LTA D;  3CW2 C;  4A3G H;  1P16 A;  4MTK A;  1Q46 A;  4KHP Q;  5FJ8 G;  1Q7Y C;  2PMZ E;  1IHZ A;  3BJU A;  1JT8 A;  3PGZ A;  1TWF H;  3TP5 A;  3CHB D;  3S15 B;  3ULL A;  1UE7 A;  2C35 B;  3PUY A;  4X64 Q;  1BKB A;  4FVM A;  4YCU A;  3URY A;  4A3C G;  2SDF A;  3PV0 A;  5EAY A;  3M85 A;  1QNU A;  4H44 C;  1SAP A;  2FJ2 A;  4QY7 A;  3STB D;  4A3D G;  1LTT D;  1TWH H;  3MWY W;  4HCS A;  2F0V A;  1PXU A;  2IHE A;  4AYB B;  2R61 A;  5C6A A;  4OX9 Q;  2HT1 A;  5DNF A;  2CKZ B;  1PH5 A;  3ERQ A;  2JA8 B;  1KTK A;  4IZ8 A;  3DWP A;  2BE5 D;  4WJW A;  1MJE A;  2F0K A;  1E2Z A;  2HIV A;  4BA2 I;  2AHO B;  3HOX H;  1LV9 A;  3QR8 A;  4CJ1 B;  5I6Y A;  3F2U A;  5F2D A;  1EIH A;  1LM0 A;  1PMR A;  5TSS A;  2F0S A;  1G51 A;  4UP8 A;  1QUQ A;  3S16 H;  1TWA H;  2MFI A;  1MSH A;  2ALY B;  4QIW E;  4C3H H;  3RZO B;  4DF7 A;  4UDU C;  3PSI A;  4EGV A;  3K59 A;  1A62 A;  2EYL A;  2IT1 A;  2NZH A;  4A3F B;  3JAM E;  2IX3 A;  5C44 G;  3K6O A;  1EQQ A;  1Z6H A;  1SJE D;  4OIK A;  4IUU A;  5IIF A;  2HUG A;  3OPO A;  4DV0 L;  2F0I A;  3M4P A;  4EQN A;  4CJ0 B;  3J81 i;  1SN8 A;  4DR5 L;  3H09 A;  4ZYS A;  1WTR A;  1I4H A;  1XPU A;  4JI1 Q;  3J80 i;  3IAY A;  3M3Y B;  1F2Y A;  2K5D A;  3HOW H;  1T9H A;  4L6T B;  1X3F A;  3VR2 A;  1H9R A;  4RGO S;  4O2D A;  3R2T A;  4KV6 A;  3E6Z X;  3KLR A;  5LL6 X;  3K5L A;  4A3J B;  2F0E A;  1HQM C;  3AMU A;  3BDC A;  1A2T A;  3C46 A;  3BVM A;  3S1M H;  2Z6K C;  3I2Z A;  4BBR G;  2NN6 H;  2E75 C;  4IAL A;  5D14 A;  1YIT A;  2D5D A;  1PTO H;  3PO3 G;  2F0W A;  5C3X A;  1CQF A;  4MZ9 A;  4JV5 L;  1WOC A;  4ILW A;  3G4S A;  3CCM A;  5M5Y B;  2E8G A;  4BY7 G;  4NXN Q;  5A2Q E;  4JI4 Q;  2JA6 B;  4K2L A;  1TS3 A;  1J9O A;  1HA6 A;  5T1I A;  2DJF C;  4C3H B;  1LT3 D;  2MO0 A;  2N3S A;  5KYI A;  5DM7 3;  1TWC H;  1KAW A;  2D0O A;  1VQG A;  1EIG A;  1EEF D;  4GN5 A;  2O5J C;  2RHQ B;  4RFB A;  3MZ5 A;  3NUC A;  5GAH C;  2QKI C;  1Y69 U;  4FXD A;  4UHV A;  1ZEQ X;  2NVX B;  3Q23 A;  1EY4 A;  2PMZ B;  2YYZ A;  1AEX A;  1VQ9 A;  4DXF A;  4RKL A;  5IGG A;  4LW1 A;  3WWV A;  2M2L A;  1OTC A;  1TR5 A;  3M4O H;  2MNA A;  3MXU A;  5AFW A;  1IKM A;  5LMN L;  3GTK B;  4NPS A;  3T16 A;  3S1R H;  3TSS A;  1O7I A;  2B2W A;  1BUV T;  1CKO A;  3TQY A;  3GV3 A;  1QB5 D;  2OXP A;  4IN3 A;  4P2C B;  1VQB A;  4POF A;  1JIC A;  2H5X A;  1BQQ T;  3UE0 A;  2OF1 A;  3D6W A;  4CKE A;  1J5E Q;  4DAY A;  3F2D A;  1HNW Q;  3EVQ A;  1TU2 B;  1I4R A;  2NTS A;  3KK7 A;  1XPO A;  1SFO H;  4DR6 L;  1TS5 A;  3UI2 A;  5BR8 Q;  4K5X A;  4DR3 L;  2OEO A;  4JPB W;  2UUB Q;  5M9O A;  1MJC A;  2B8F A;  1BCP B;  4RA8 A;  4YHH Q;  2RCF A;  3CRK C;  3D4D A;  3I55 A;  2D0P A;  1RDP D;  3U50 C;  2I07 B;  2IPK D;  1TY0 A;  4A3B H;  2KHS A;  3TS0 A;  1ASY A;  2VQE Q;  1F2L A;  2VL6 A;  4ZAI A;  5LMN W;  3HOY G;  3LNN A;  1UUP A;  4X3T A;  2EOT A;  4B3R Q;  1I50 B;  1SMY D;  1Y8N B;  3FKI G;  2JA5 B;  1D5M C;  3BG3 A;  1GUG A;  3HOU B;  2Z0S A;  4OEL B;  4OGQ C;  5C4J B;  4X3K A;  4PV1 C;  3FDT A;  1Z7T A;  2AUK A;  1NR4 A;  4GOP A;  2EY6 A;  1RCV D;  4HJ7 A;  5E1F A;  4XQJ A;  1K8M A;  3NPP A;  2K03 A;  4UP7 A;  1B3Q A;  3MFY A;  1QZG A;  1GJX A;  1CT1 D;  1O78 A;  1A2U A;  1A3V A;  2X69 A;  4JI8 Q;  4F87 A;  2HHH L;  1WD1 A;  4A3K B;  4HR7 B;  2PZT A;  2DJG C;  2VB3 X;  3TN2 A;  1UAP A;  3VYS A;  4YCW A;  3DXJ C;  1KRT A;  1U4L A;  4KMU C;  5CGK A;  1CUK A;  5DLQ E;  3G48 A;  1YHQ A;  3KF6 A;  2A1A A;  1V8Q A;  3F2B A;  2A68 C;  4S3S A;  1CZW A;  3NEN A;  4RHS A;  2B39 A;  4A93 G;  4LFC L;  4DGZ A;  1F77 A;  1IBL L;  3GTQ B;  4B08 A;  1PRT D;  3DLL A;  2L11 A;  1RJT A;  3C3L A;  2KCT A;  5CV7 A;  1WVL A;  4A93 H;  4JOI A;  5CV6 A;  4GS3 A;  1WCM B;  5EKI A;  1HNZ Q;  2B3G A;  2FMM A;  4QF4 A;  3HOZ H;  4JOI C;  3MAQ A;  3RZO H;  3FEW X;  2AMC B;  3UDX A;  2LSS A;  1EIF A;  3TS2 A;  5D3I B;  4TSS A;  1V9P A;  2ES2 A;  4HJA A;  2PW7 A;  5CMD A;  1OXS C;  1H9S A;  2NYZ D;  3V96 A;  2BH2 A;  3PO2 H;  3H15 A;  1D8L A;  1O7L A;  4K8J A;  1I4X A;  3HOZ B;  4EQ5 A;  5IGB A;  4Y52 H;  2L15 A;  3CPF A;  1I4G A;  5EPJ A;  5ELC A;  4Y7N H;  3S1N B;  3OSO A;  1VQK A;  1F9Q A;  3TDQ A;  3KJO A;  1AH9 A;  4DUZ Q;  2K5W A;  3AEV A;  3PO2 B;  2OCE A;  2X6L A;  2UXB L;  2EE1 A;  3AFQ A;  5H1S E;  4LFB L;  2LS0 1;  1DCZ A;  2XRS D;  3GTO B;  4BBS H;  5IYD H;  1E7Z A;  1PLF A;  4QB4 A;  2G5D A;  1JE5 A;  1VQL A;  2NWG A;  3PO2 G;  2LXJ A;  3UDF A;  2SEB D;  1E2V A;  2CWP A;  2FIN B;  5M3F B;  4A3B G;  2K14 A;  4XXE A;  4K0K L;  4DUY L;  2E2J H;  1QVC A;  3A7A B;  3HOZ G;  3S2D H;  1SMX A;  2UXD Q;  4YWK A;  3VA5 A;  4FNF A;  1YNJ C;  3AFP A;  2B2V A;  2Z6B A;  3C1F A;  3N6R A;  4OWX B;  1ONL A;  5CBE E;  1I4Q A;  1VQO A;  5COY A;  1N8R C;  4O1N A;  2G9D A;  2QF7 A;  3ZJY C;  3PO3 B;  5HY6 A;  2IW3 A;  5JJZ A;  5C4J H;  1ET9 A;  2V1C C;  1N34 L;  3CQZ B;  4PQX A;  4DAP A;  1II3 A;  1LT4 D;  3ULP A;  5EQ0 A;  5IWA L;  3OWE B;  4GNX C;  2K01 A;  4KKU A;  3R8B A;  4XIG S;  4TKO B;  1R9T H;  2K5Q A;  4ME5 A;  2YTY A;  3BZK A;  1YNX A;  2M9V A;  5KND A;  1F9P A;  4IPC A;  3TME A;  3GQB A;  5JJL A;  1CQV A;  2A19 A;  1BDO A;  1Q1B A;  2IX0 A;  4JI5 Q;  5K5P A;  2E2J B;  3C2P A;  2BH8 A;  4JG2 A;  4YY3 L;  3KLS A;  1Y8P B;  4PMB A;  1VQJ A;  1C7Y A;  5IY0 A;  5CC4 A;  2Z1C A;  3ICE A;  3T51 B;  1KDC A;  2NBF A;  1U5K A;  4HN7 A;  4CDE C;  4LF9 L;  4GLA C;  3CPW A;  1PFN A;  1SJH D;  2AWO A;  5GQO A;  4JBJ A;  1N33 L;  1H9M A;  3LWE A;  4X65 Q;  1W6K A;  4GLX A;  1VQ5 A;  4A93 B;  4WJ4 A;  2V4D A;  1Q90 A;  4A4I A;  2F4V L;  2MPM A;  1MBY A;  5AJ3 Q;  4RGM A;  4A3E B;  2WAQ G;  4XT1 B;  5C3E H;  3IFT A;  1LT5 D;  3VR5 A;  1ESR A;  5E4W C;  4PNY A;  4KD3 A;  3TP8 A;  1EFI D;  1PDQ A;  1CK1 A;  4B3S L;  3DMU A;  2RF4 A;  2Z6K A;  4DV6 Q;  1IBL Q;  1X3P A;  2B2Y A;  5D65 A;  1QUQ B;  3FP9 A;  4HIO A;  1FVI A;  4R8I A;  3GTG B;  1HFG A;  2GA4 B;  2E2D C;  2XRQ D;  5DM6 3;  2NVQ H;  1EY7 A;  1BCP C;  1S4Z A;  1EYA A;  5IP7 G;  1MIU A;  1GUO A;  2EJM A;  4K14 A;  4IO9 A;  4A3I G;  5C44 H;  1IL8 A;  1A3U A;  2EIF A;  1KL9 A;  3PF4 A;  4DV2 Q;  3SDZ A;  4BY7 B;  3U58 A;  1G2T A;  5EPL A;  2N78 A;  4DUZ L;  2JP1 A;  1EOV A;  2M00 A;  1KRS A;  3KUP A;  2ZJP A;  2NVY B;  4C3H G;  1YVC A;  4JI0 L;  2Z8L A;  4BS9 A;  4FP5 D;  1YNJ D;  1BBU A;  4KY7 A;  1QE6 A;  4DFA A;  5HGQ A;  3NBI A;  2XTI A;  2EYF A;  4DU9 A;  1SE3 A;  3CP0 A;  2VB2 X;  2D62 A;  2F52 A;  1L2F A;  4KK7 A;  4PZ7 A;  1D1I A;  1WYD A;  4ZLT F;  1I4P A;  1FJG Q;  3K0Y A;  4XYO A;  1W6J A;  1TVX A;  1DM0 B;  3WOE A;  5FLM G;  3H0G H;  2A69 D;  2J4X A;  5KRU A;  1VQP A;  3PO3 H;  3K81 C;  3CU7 A;  2IL8 A;  5C4H A;  4JYA L;  1SE8 A;  3I70 A;  3DUZ A;  4ODG A;  1HUN A;  5J22 A;  1XTD A;  4KHP L;  1TWG H;  4A3B B;  3HKZ E;  5IYB H;  3S14 H;  3T53 B;  3NQT A;  1OXV A;  1NMG A;  1X3E A;  2PPB C;  4IUT A;  1G2S A;  1IYU A;  1U4P A;  1VQE A;  2WFW A;  1ASZ A;  4IFD J;  2NVQ B;  1A6X A;  3RUZ A;  4GZY C;  2AUJ D;  3EN2 A;  3A5Z B;  3HKZ G;  4X66 Q;  3CRL C;  1HFN A;  2Z4I A;  4L5R C;  2F3W A;  1HNX L;  3RN2 A;  4LJZ C;  4A3G G;  2NTT A;  3HOW G;  3D8G A;  1L0W A;  2D9U A;  4K0K Q;  3F1Z A;  3K80 C;  1LAC A;  2K04 A;  4A3E H;  1DD2 A;  2BCO A;  1XJV A;  1Q12 A;  4AYB E;  4A3F G;  1HPC A;  1QNK A;  2WIN B;  2PQE A;  2FHT A;  4M8A A;  3P75 A;  2CW0 D;  3MC0 B;  1RD9 D;  3GTK H;  2A6E C;  1JOR A;  4YY3 Q;  5C5M A;  5KNC A;  1E1O A;  1B9N A;  4FO2 A;  3BYT B;  3I4N G;  1VQI A;  4B9W A;  3I8Z A;  4G7Z C;  3A7L A;  3VYT A;  4K6L A;  5G3L F;  1YJW A;  3HOV H;  4P74 A;  3K7U C;  2IWH A;  5EKL A;  3VR6 A;  4IFD H;  3M7G A;  3UDG A;  1JOO A;  1N36 L;  1QWY A;  1CKN A;  5EGT A;  4JI7 Q;  4J15 A;  3CMA A;  4ZUI A;  1FJG L;  5LL6 S;  4EQO A;  3HOX G;  1HR0 L;  3NK9 A;  4JVZ A;  3A74 A; 
#chains in the Genus database with same CATH homology
 2KA7 A;  1JWM D;  1STH A;  1CHP D;  5CV9 A;  5DAU A;  5HGT A;  4PMW A;  4OO1 G;  1HHV A;  4U68 A;  1BF4 A;  3MA2 B;  1FR3 A;  2KCN A;  1ENF A;  1D6E C;  3QOJ A;  3H3V C;  1LTI D;  4KI0 A;  1R9T B;  2RDF A;  3OOC A;  2ICE C;  4RH6 A;  1TS4 A;  1BO0 A;  3P20 A;  3MXP A;  5I2Y A;  5E4X A;  4Q5V A;  3R3O A;  1K83 B;  2EYM A;  3ONA B;  4HSV A;  1I3Q B;  4BY1 B;  1O7Z A;  5EPK A;  2RA4 A;  2C5C A;  1CA5 A;  3MXN A;  1XTC D;  1EY8 A;  4CKC A;  2SNM A;  2EYO A;  1IW7 D;  1GUN A;  2LKV A;  3IKJ A;  3NBH A;  5ELE A;  1JQY D;  1STE A;  1SYC A;  2RBM A;  1KNA A;  3SK8 A;  1NR2 A;  2KVM A;  3I3C A;  2Y0S B;  1JWS D;  1H9S B;  3MTS A;  1CTM A;  3ERO A;  3AB9 A;  1FGB D;  1NAP A;  4C3J B;  3M4Y A;  4ZKB B;  2F1M A;  1F9R A;  1VF7 A;  1KDA A;  3PUW A;  1O80 A;  1ILQ A;  4F88 A;  2VUM B;  3FVQ A;  4JK1 C;  1V1P B;  1OO9 B;  1GHK A;  1SEB D;  2CW0 C;  1B44 D;  1Q8I A;  1ZXT A;  1ENC A;  1DZ1 A;  1OXU A;  1WTO A;  3QB3 A;  1H9J A;  1PZJ D;  1PFM A;  4O42 A;  1B53 A;  4RHR A;  2J0T D;  3HZX A;  1DJR D;  3DEO A;  1Q3L A;  1DOL A;  5BN5 A;  2KEE A;  3O13 A;  5I4D A;  3SEB A;  5FOB B;  1IKL A;  4C3J G;  5ELF A;  2BOS A;  4KY5 A;  3NQI A;  3QG1 A;  1T5E A;  3FMC A;  1EQV A;  3PUZ A;  4NW2 A;  1SNC A;  1RKN A;  1SYD A;  4FYD A;  3V2T A;  3QWN A;  1DYQ A;  1DOM A;  2EJF C;  2DY8 A;  2F4I A;  2PYK A;  2ZT9 C;  3S9W A;  1A3T A;  1JC7 A;  2XNA C;  1B9M A;  3WOF A;  3D4R A;  1S5F D;  3NSW A;  4FXK C;  3I4N B;  1HRJ A;  1EU4 A;  2F0G A;  5C0X J;  4WFN 3;  1QCB D;  5JEA G;  1SNP A;  3L7Z C;  1SFO B;  4IFD I;  3Q24 A;  1IW7 C;  3DM1 A;  5BN4 A;  4FXG C;  1STG A;  4NDX A;  1Y8O B;  2R6G A;  4C2M B;  3HOX B;  2LFN A;  4G7O C;  2RVL A;  4R9W A;  2F0N A;  3E5S A;  4TQU S;  4XT3 B;  3S16 B;  5IGF A;  1EWH A;  2MGS A;  3HGB A;  4ULL A;  5I6W A;  4OO1 H;  2F03 A;  1XX8 A;  1EL0 A;  1KDB A;  4KKS A;  1WTQ A;  1B2T A;  2IX1 A;  4QMG A;  3GP7 A;  5EBD A;  2K05 A;  3IFD A;  2H4O A;  2CQA A;  3CKI B;  3MHB A;  3X3N A;  5G3L D;  1BR9 A;  4HED A;  2K28 A;  4IFD G;  2KCC A;  5EJW A;  3VYR A;  1SNM A;  3VR4 A;  4X3S A;  3A8J E;  1XXG A;  1VMC A;  4XQQ A;  1D1K A;  2XWJ B;  2Z4H A;  1C4Q A;  4XYQ A;  5KYL A;  1MI2 A;  2MJ8 A;  2SOB A;  3A8K E;  2AQ3 B;  4DK0 A;  4NMZ A;  2JEB I;  2R92 B;  4MHE A;  4KHZ A;  3D4W A;  5FO8 B;  4DNT B;  5FO7 B;  2DNC A;  1PRT F;  4K5W A;  3OIQ A;  2RSN A;  2Q8I B;  3VYU A;  2O2L D;  1F2Z A;  4JBW A;  4BA1 I;  4I7Z C;  1TQO A;  2HCI A;  3S1M B;  1VDZ A;  2K33 A;  2KOL A;  3NWS A;  2E2H B;  5DEH A;  1K8O A;  4IUN A;  4FF2 A;  5KGU A;  1E0B A;  3I4L A;  3W2D A;  3HP3 A;  2F0O A;  4KN4 C;  3H0G B;  4OL7 A;  2F0F A;  2FFK B;  3SXH A;  2F0H A;  2IJ0 A;  1EYC A;  1UEA B;  4KKT A;  1B3A A;  2E2I B;  2HDM A;  1I6V C;  4L63 B;  1M4V A;  1EY5 A;  5A35 A;  1KAA A;  1YNN D;  1Y1W B;  5JAV A;  3M4O B;  3EJI A;  2F3V A;  1FNU A;  5NUC A;  4RGN A;  4FF4 A;  2QDB A;  1WTW A;  4FF1 A;  1R4P B;  2A74 C;  1CZG A;  1JE4 A;  4WRD A;  2BDO A;  4DXG A;  3NTH A;  3HS0 C;  4IUR A;  3TBI B;  5I9P A;  2L4N A;  4XTC S;  4M1U B;  3R93 A;  5J1Z A;  2F0D A;  5KIX A;  2PCF B;  2H1E A;  2BE5 C;  3I72 A;  2LMC B;  2EY2 A;  3NXW A;  3J7Y W;  4J8Q A;  4IUP A;  3HG9 A;  3RMH A;  3QIA A;  4LMQ D;  4RWS C;  4MN3 A;  3GTL B;  1ET6 A;  4RGT A;  1NCV A;  1TY2 A;  1PZI D;  1JWU D;  1SSO A;  4QUC A;  1STA A;  4KN7 C;  1QJO A;  3MVV A;  2L5T A;  1I6H B;  2PZU A;  1O7Y A;  5ELB A;  5M5W B;  5C4X B;  1HTP A;  1IYV A;  5JEA J;  3Q6S A;  1VMP A;  5JVH 3;  5CV8 A;  1LTS D;  1FD7 D;  4L8J A;  2B8G A;  3HOW B;  4OO1 I;  1SMY C;  1B1Z A;  4H7B A;  5IGD A;  1TS2 A;  3NWT A;  2R93 B;  4DK1 A;  1HTL D;  4RAU C;  1HCZ A;  4QCL A;  2KUM A;  2NUC A;  4KHV A;  1LO5 D;  3HOV B;  4ZK9 B;  4G57 A;  5EKK A;  3S2H B;  2PW5 A;  4C3I G;  5C0X G;  5C0X I;  1L0X B;  1AP0 A;  2EZV A;  3RLF A;  2RDH A;  3TZD A;  1U9R A;  4YIJ A;  1B4O A;  3SK5 A;  3D6C A;  2A68 D;  3J7A F;  4BBS B;  1YNN C;  3T56 B;  2DN8 A;  3DHQ A;  1ILP A;  4XDX A;  4OHJ A;  4DAV A;  2RQX A;  3K5O A;  4CBV A;  2XSC A;  5EBC A;  3NE5 B;  5IT9 E;  1X3Q A;  4K5V A;  1SE2 A;  1ROD A;  1SYF A;  3QOL A;  1RTN A;  1ZKO A;  4Y7N B;  1PFB A;  1GUS A;  5CBA E;  3ITP A;  3OMG A;  5ELD A;  2ICI A;  3HRZ C;  2F0L A;  1WD0 A;  2ZXO A;  2KEC A;  3LX0 A;  1BCP F;  4F8M A;  4H0L C;  2XIW A;  1QOH A;  5FK9 C;  3FKI B;  3A56 A;  1SNQ A;  4HMJ A;  4F7X A;  3HOY B;  2EYP A;  2HCC A;  2NVT B;  4HMI A;  4DN4 M;  3HKZ B;  4RCO A;  1DXM A;  3S2D B;  4A3M B;  1LTG D;  2JE6 I;  4HCE A;  2VXW A;  4BBR B;  4V19 0;  2C9O A;  2D2C C;  4ABN A;  1KLU D;  4QIW B;  2QCP X;  2Q8T A;  1MSG A;  3P1H A;  2ZXR A;  1EQT A;  4K6D A;  2BA0 A;  2JA7 B;  3J81 E;  1STN A;  4KJO A;  5M3M B;  1RTO A;  2WKD A;  2B2U A;  3L9A X;  1U4R A;  3D3R A;  1MGS A;  3A54 A;  1BOS A;  2XVS A;  5JPN C;  2EYH A;  1PRT C;  1GUT A;  1J8I A;  5C3E B;  4DNR B;  1QG7 A;  3J7A V;  1TWH B;  2K6A A;  2PNR C;  5I2X A;  5C0X H;  4ZQ3 A;  2BA1 A;  3FPP A;  3X3M A;  5ISR A;  3Q22 A;  4ZKC B;  3SVM A;  1KNE A;  1L0Y B;  4H13 C;  2ID0 A;  2E76 C;  1KLG D;  1EOT A;  2KJX A;  3BDO A;  3A55 A;  5E3F A;  1GHJ A;  1NUC A;  2O4X A;  1SNO A;  1CA6 A;  3J81 L;  3S14 B;  3ND9 A;  5I9O A;  3QO2 A;  5JVG 3;  3OHX C;  2G9H D;  3KF8 A;  3G6J B;  2NB0 A;  1EYD A;  3ND8 A;  1EEI D;  1FNV A;  2L55 A;  2Q8R E;  2WAQ B;  4WOR A;  2JSO A;  1WTX A;  3T4A C;  3DEP A;  5COR A;  4IQZ A;  2BDN A;  1SBB B;  5D3D A;  3MXG A;  3P7J A;  1HA5 A;  1ICW A;  1C48 A;  4MIU A;  5KNB A;  2N55 A;  5FO9 B;  3DWQ A;  1BCP D;  1WTP A;  2L9H A;  2DNE A;  3GV6 A;  5T1G A;  1V1P A;  2MHV A;  4ZUJ A;  2XWB B;  1Z47 A;  4R8N A;  1ESF A;  2OT2 A;  4TRD A;  2KED A;  2WV6 D;  1D5Z C;  1PRT B;  2NN6 G;  3H94 A;  4J1M A;  3KBG A;  4RCN A;  4KD4 A;  1VF5 C;  4C56 C;  2B2T C;  3PIO 3;  1UNS A;  5LHY 1;  1SYB A;  4NP5 A;  5KEE A;  1STY A;  3EFX D;  4X3U A;  3FRP B;  4HAE A;  1SXT A;  5JPM C;  1PTO F;  3Q0A A;  1ZYR C;  3E0J A;  2PO4 A;  2A6H D;  1AZQ A;  1AW7 A;  1V43 A;  3J80 L;  4N9T A;  5CV5 A;  2B2V C;  2MP1 A;  4KTA A;  3BVG A;  1HQR D;  1TWA B;  4ZRZ A;  1U4M A;  5CV4 A;  2TMP A;  1WTV A;  3TP6 A;  1JR0 D;  3SE0 A;  3K7A B;  3G7L A;  1G29 1;  3EA6 A;  5C4Z A;  2F0M A;  3FPU B;  2R7Z B;  2B2U C;  2R3Z A;  3OW7 A;  1LTR D;  1B50 A;  4PMC A;  3C1E A;  4XQN A;  2L0C A;  4CGY B;  1XYI A;  2K32 A;  4BWG B;  1G8Z D;  3K5M A;  1EWC A;  2K1B A;  3A8I E;  3VR3 A;  5BN3 A;  2EDG A;  2O5I C;  2F0J A;  4I65 A;  4CHT B;  1M8A A;  1AN8 A;  1JB3 A;  3WDN A;  3PMF A;  1PTO B;  3BZD B;  1GOZ A;  2EY1 A;  1RF2 D;  1AZP A;  4KY6 A;  2B2T A;  1GXD C;  3I4M B;  3KBX A;  3BDL A;  4K8I A;  4A3I B;  5A2Q L;  2E74 C;  3AU7 A;  3D31 A;  5IOD A;  5C44 B;  3SR1 A;  2HQE A;  1LAB A;  1ENA A;  5CR3 A;  5FLX L;  2A69 C;  1STB A;  1AFP A;  4Q0F A;  2LY7 A;  2ZXP A;  1R4Q B;  3I73 A;  1ML0 D;  4EQP A;  5M5X B;  4NKL A;  2TSS A;  2CHB D;  1H9K A;  2K7V A;  1ZYR D;  2A6H C;  3NTK A;  5C5L A;  4C1N I;  1G6Z A;  3I91 A;  3IL8 A;  3V05 A;  4UAI A;  2A6E D;  2WKC A;  1CM9 A;  1EY0 A;  4A3G B;  5FLX E;  5K36 H;  4KJN A;  3TZU A;  2KQ3 A;  1LLR D;  4B9X A;  3S17 B;  1S5D D;  4OIJ A;  3SK6 A;  5HUR A;  1PTO D;  1JCK B;  3QJY A;  1S5B D;  4G7H C;  1DOK A;  3RD4 A;  1F9S A;  1KAB A;  3MFG A;  1TII D;  2N88 A;  2SNS A;  2XN9 C;  4N9P A;  1OXT A;  2CVR A;  3K57 A;  3GD7 A;  3OMC A;  1OXX K;  1DON A;  1EY9 A;  1SND A;  3OIP A;  2AQ2 B;  2A5H A;  3NP8 A;  1T5X D;  1SYG A;  3PUV A;  2VNU D;  1XWE A;  2PZW A;  1NSN S;  2J7Z A;  4U67 3;  1C8C A;  4LAA A;  2F0U A;  3J80 E;  1E2W A;  4ID6 A;  2MUY A;  3H91 A;  1V1O A;  3RZD B;  2WB1 B;  1A15 A;  2ENB A;  3T13 A;  1S5E D;  3DWA A;  4IUV A;  4RKB A;  5JEA H;  2EYJ A;  3JAM L;  1TKW B;  2FMC A;  2L12 A;  5IGE A;  5IOC A;  1HUM A;  2AWN A;  2EXZ A;  2RSO A;  1X32 A;  3MEH A;  3H6M A;  2L1B A;  4FF3 A;  3TP7 A;  5IGC A;  4HSP A;  1LTB D;  1Y1V B;  4C3I B;  1EZ6 A;  4CKB A;  2YU9 B;  4A3D B;  3GTP B;  3LWU A;  3N52 A;  1CHQ D;  1EY6 A;  2RDG A;  3I90 A;  1G91 A;  1SE4 A;  1JOK A;  3PUX A;  1BNZ A;  3SK4 A;  1HXY D;  4V0B A;  1TWC B;  2WAC A;  1MD2 D;  3S1R B;  2I46 A;  1SYE A;  2NZ1 D;  3KLS X;  4LK1 C;  5CYU A;  2QEJ C;  1D2B A;  1S5C D;  3S1Q B;  3W3A A;  1EZ8 A;  2HDL A;  1RHP A;  1VCI A;  4IUQ A;  1GUW A;  1PTO C;  1TWF B;  1FNW A;  1TWG B;  1BXT A;  3EQL C;  5K36 G;  3U9S A;  2EPB A;  4E6I A;  5J39 A;  1Q1E A;  1PZK D;  1PYW D;  4HTH A;  2F0P A;  5JOB A;  4G4K A;  3VA7 A;  3NTI A;  3ZYY X;  2JYO A;  2JEA I;  2B2Y C;  1F2M A;  1CFM A;  2A73 B;  3OWF A;  3K58 A;  5IT9 L;  2B2W C;  2RKS A;  2JXM B;  1EU3 A;  4K2K A;  3U9O A;  4Z9C B;  3BVZ A;  5C3W A;  3HEJ A;  2F0Q A;  2QIL A;  3GO5 A;  3R2I A;  4DA2 A;  1TT2 A;  3GTJ B;  3L3O C;  1SDF A;  3PIP 3;  1FYC A;  2AQ1 B;  2F0T A;  2X6G A;  4QUF A;  3K5N A;  1D5X C;  1QIL A;  3BS1 A;  5FKA C;  1CI3 M;  4C1N K;  3SHL A;  2WII B;  3NHH A;  2B63 B;  3BYY B;  1BBX C;  2DY7 A;  1LT6 D;  2WP8 J;  3GTM B;  2NN6 I;  2EJG C;  2EVB A;  4J6H A;  3M7N A;  2EY5 A;  4EVO A;  4CJ2 C;  1LTA D;  1IHZ A;  3TP5 A;  3CHB D;  3S15 B;  3PUY A;  4FVM A;  3URY A;  2SDF A;  3PV0 A;  3M85 A;  1QNU A;  4H44 C;  1SAP A;  2FJ2 A;  1LTT D;  3MWY W;  4HCS A;  2F0V A;  1PXU A;  4AYB B;  2R61 A;  5C6A A;  5DNF A;  2JA8 B;  3ERQ A;  1KTK A;  3DWP A;  4IZ8 A;  2BE5 D;  4WJW A;  2F0K A;  1E2Z A;  4BA2 I;  1LV9 A;  4CJ1 B;  5I6Y A;  3F2U A;  5F2D A;  1EIH A;  1PMR A;  5TSS A;  2F0S A;  1MSH A;  3RZO B;  4DF7 A;  4UDU C;  4EGV A;  3K59 A;  2EYL A;  2IT1 A;  4A3F B;  3JAM E;  2IX3 A;  3K6O A;  1Z6H A;  1SJE D;  4OIK A;  5IIF A;  4IUU A;  2HUG A;  3OPO A;  2F0I A;  4EQN A;  4CJ0 B;  3H09 A;  4ZYS A;  1WTR A;  1I4H A;  3IAY A;  3M3Y B;  1F2Y A;  2K5D A;  4L6T B;  3VR2 A;  1H9R A;  4RGO S;  3R2T A;  4KV6 A;  3E6Z X;  3KLR A;  5LL6 X;  3K5L A;  4A3J B;  2F0E A;  1HQM C;  3AMU A;  3BDC A;  1A2T A;  3C46 A;  3BVM A;  2NN6 H;  2E75 C;  4IAL A;  5D14 A;  2D5D A;  1PTO H;  2F0W A;  5C3X A;  1CQF A;  4ILW A;  5M5Y B;  5A2Q E;  2JA6 B;  4K2L A;  1TS3 A;  1J9O A;  1HA6 A;  5T1I A;  4C3H B;  1LT3 D;  5KYI A;  5DM7 3;  1EIG A;  1EEF D;  2O5J C;  4RFB A;  3MZ5 A;  3NUC A;  2QKI C;  1Y69 U;  4FXD A;  1ZEQ X;  2NVX B;  3Q23 A;  1EY4 A;  2PMZ B;  2YYZ A;  1AEX A;  4DXF A;  4RKL A;  5IGG A;  2M2L A;  1TR5 A;  3MXU A;  5AFW A;  1IKM A;  3GTK B;  3T16 A;  3TSS A;  2B2W A;  1BUV T;  3GV3 A;  1QB5 D;  2OXP A;  4IN3 A;  4P2C B;  1JIC A;  1BQQ T;  2OF1 A;  3D6W A;  4CKE A;  4DAY A;  3EVQ A;  1TU2 B;  1I4R A;  2NTS A;  3KK7 A;  1TS5 A;  3UI2 A;  4K5X A;  2OEO A;  5M9O A;  2B8F A;  1BCP B;  4RA8 A;  3CRK C;  3D4D A;  1RDP D;  2I07 B;  2IPK D;  1TY0 A;  2KHS A;  1F2L A;  4ZAI A;  3LNN A;  1UUP A;  4X3T A;  2EOT A;  1I50 B;  1SMY D;  1Y8N B;  2JA5 B;  1D5M C;  3BG3 A;  1GUG A;  3HOU B;  4OGQ C;  5C4J B;  4X3K A;  4PV1 C;  3FDT A;  1Z7T A;  2AUK A;  1NR4 A;  2EY6 A;  1RCV D;  5E1F A;  4XQJ A;  1K8M A;  3NPP A;  2K03 A;  3MFY A;  1GJX A;  1CT1 D;  1O78 A;  1A2U A;  1A3V A;  2X69 A;  4F87 A;  1WD1 A;  4A3K B;  4HR7 B;  2PZT A;  2VB3 X;  3TN2 A;  1UAP A;  3VYS A;  3DXJ C;  1U4L A;  4KMU C;  5CGK A;  1V8Q A;  2A68 C;  4S3S A;  1CZW A;  4RHS A;  2B39 A;  4DGZ A;  1F77 A;  3GTQ B;  4B08 A;  1PRT D;  2L11 A;  1RJT A;  3C3L A;  1WVL A;  5CV7 A;  5CV6 A;  1WCM B;  5EKI A;  2FMM A;  4QF4 A;  3MAQ A;  3FEW X;  5D3I B;  4TSS A;  2PW7 A;  5CMD A;  3V96 A;  1OXS C;  1H9S A;  2NYZ D;  4K8J A;  1O7L A;  1I4X A;  3HOZ B;  5IGB A;  1I4G A;  5EPJ A;  5ELC A;  3S1N B;  3OSO A;  1F9Q A;  3TDQ A;  2K5W A;  3PO2 B;  2X6L A;  2EE1 A;  2LS0 1;  1DCZ A;  2XRS D;  3GTO B;  1PLF A;  4QB4 A;  2NWG A;  2SEB D;  1E2V A;  2FIN B;  5M3F B;  4XXE A;  3A7A B;  3VA5 A;  4FNF A;  1YNJ C;  2B2V A;  3C1F A;  3N6R A;  1ONL A;  5CBE E;  1I4Q A;  5COY A;  4O1N A;  2G9D A;  2QF7 A;  3PO3 B;  2IW3 A;  5JJZ A;  1ET9 A;  3CQZ B;  4PQX A;  4DAP A;  1II3 A;  1LT4 D;  5EQ0 A;  3OWE B;  2K01 A;  4KKU A;  3R8B A;  4XIG S;  4TKO B;  2K5Q A;  4ME5 A;  2M9V A;  5KND A;  1F9P A;  3TME A;  3GQB A;  1CQV A;  1BDO A;  1Q1B A;  2IX0 A;  5K5P A;  2E2J B;  3C2P A;  3KLS A;  1Y8P B;  4PMB A;  5CC4 A;  2Z1C A;  3T51 B;  1KDC A;  2NBF A;  4HN7 A;  1PFN A;  1SJH D;  2AWO A;  1H9M A;  3LWE A;  4A93 B;  1W6K A;  2V4D A;  1Q90 A;  2MPM A;  1MBY A;  4RGM A;  4A3E B;  4XT1 B;  3IFT A;  1LT5 D;  3VR5 A;  1ESR A;  5E4W C;  4PNY A;  4KD3 A;  3TP8 A;  1EFI D;  1PDQ A;  1CK1 A;  3DMU A;  1X3P A;  2B2Y A;  5D65 A;  4R8I A;  3GTG B;  1HFG A;  2GA4 B;  2E2D C;  2XRQ D;  5DM6 3;  1EY7 A;  1BCP C;  1S4Z A;  1EYA A;  1GUO A;  2EJM A;  4K14 A;  1IL8 A;  1A3U A;  3SDZ A;  4BY7 B;  1G2T A;  5EPL A;  2JP1 A;  2M00 A;  3KUP A;  2NVY B;  4C3H G;  2Z8L A;  4BS9 A;  4FP5 D;  1YNJ D;  4KY7 A;  1QE6 A;  4DFA A;  3NBI A;  2EYF A;  4DU9 A;  1SE3 A;  2VB2 X;  2D62 A;  4KK7 A;  1D1I A;  4ZLT F;  1I4P A;  3K0Y A;  4XYO A;  1W6J A;  1TVX A;  1DM0 B;  3WOE A;  2A69 D;  2J4X A;  5KRU A;  3CU7 A;  2IL8 A;  5C4H A;  3I70 A;  3DUZ A;  4ODG A;  1HUN A;  5J22 A;  4A3B B;  3T53 B;  3NQT A;  1OXV A;  2PPB C;  4IUT A;  1G2S A;  1IYU A;  1U4P A;  4IFD J;  2NVQ B;  1A6X A;  3RUZ A;  4GZY C;  2AUJ D;  3CRL C;  1HFN A;  2Z4I A;  2F3W A;  4LJZ C;  2NTT A;  3D8G A;  2D9U A;  1LAC A;  2K04 A;  1DD2 A;  2BCO A;  1Q12 A;  1HPC A;  1QNK A;  2WIN B;  2PQE A;  2FHT A;  4M8A A;  3P75 A;  2CW0 D;  3MC0 B;  1RD9 D;  2A6E C;  1JOR A;  5C5M A;  5KNC A;  1B9N A;  4FO2 A;  3BYT B;  4B9W A;  3I8Z A;  4G7Z C;  3A7L A;  3VYT A;  4K6L A;  5G3L F;  2IWH A;  5EKL A;  3VR6 A;  4IFD H;  3M7G A;  1JOO A;  1QWY A;  5EGT A;  4ZUI A;  5LL6 S;  4EQO A;  3NK9 A;  1JOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...