3PIPQ

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords RIBOSOMAL 23S RNA
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pipQ00
1HD0A 2E5JA 5CXTA 3Q2SC 2CPFA 1X5PA 3UCZP 2LXIA 2DISA 5JVHQ 2FY1A 5GVQA 1U1MA 3DLLQ 1M5OC 3G8SA 1X4HA 1VQ9S 1X5TA 2HYIB 1VQPS 3MI7X 3NNCA 1R8PA 2FHOB 1KOHA 2CJKA 2X1FA 4OZ0A 1Q7YT 1WWHA 3Q2TC 1U1RA 1K8AT 3S01A 1X4CA 3THPA 4ERDA 2MB0B 2DH7A 2LKZA 4Y0FA 3CMAS 4TU9A 2DGSA 1WF2A 2XNRA 2VOPA 2RS8A 2N3OA 5IQQA 2DNMA 2DHXA 3SDEB 2YTCA 3RW7A 4J5OA 2MZTA 1PO6A 5DDOC 2RS2A 1B7FA 2DGTA 2DGXA 1VQOS 2MGZB 2MQNA 3H2VE 2CQGA 2G0CA 2DGVA 5LSOA 2DNPA 2M2BA 4CH0S 2LQ5A 1U1QA 2PE8A 1DBDA 3VALA 3NMRA 4IOAQ 2M7SA 3BO4A 2DO0A 3BS9A 1L3KA 3H2UB 2L08A 5CYJA 1X5OA 1SJ3P 1KC8T 2CPDA 4WFNQ 3P49B 1X4FA 2JWNA 3UWTA 1Q81T 3CCSS 3G9CA 5GADU 1VQMS 1XN9A 2FPHX 3R27A 2SXLA 3OW2R 1U1LA 1WI6A 1VQ5S 3I56S 1DRZA 2QFJA 5DDPC 3N9UC 5LJ3Y 2MQPA 3RW6A 2MZQA 2RQCA 5GAEU 5GAHU 5DM7Q 4Z2XA 2RRAA 3EGZA 2XS5A 1WI8A 2BOPA 4WFBQ 1RKJA 2A3JA 3MOJB 2CPJA 4C0OC 2M8DB 3IRWP 2LEBA 2LCWA 2RRBA 1WEYA 2CQ3A 1X4GA 2X1BA 2BZ2A 1M5VC 2CQ1A 3CULA 3FEXB 2F9JA 2U2FA 2DNLA 3TP2A 3EGNA 4CH1A 1YITS 2B0GA 5D78A 4EGLA 1O0PA 3SMZA 2LECA 3DXBA 1A7GE 2KXHA 5D77A 4PR6A 3S8SA 3CC7S 1UFWA 3NS6A 1JJ4A 1PGZA 3ZZZA 2M9KA 2KXNB 1F9FA 2JX2A 4LJMA 3K0JA 2DNZA 3P5TL 2CPIA 4QU7A 2E5IA 2MKKA 1IQTA 3JB9k 2MQMA 2MXYA 1OIAA 1WHYA 2LXUA 3G96A 3CXCR 2MQQA 5HO4A 1WELA 1VC0A 4RU2A 2J76E 4QU6A 2DGQA 1WF1A 2DNYA 4QQBA 2D9OA 4QPTA 4TU8A 2D3OR 3EX7B 3MURP 2CQIA 2CPEA 3S7RA 2DH9A 1JJ2R 2XB2D 3HHNB 3G4SS 5LXYA 4IOCQ 1ZZNA 2V94A 2GHPA 5HL7Q 1YHQS 3MD3A 2MKHA 3D2WA 2ADCA 4FXWA 2HGNA 1YJWS 2DO4A 1WHXA 2LYVA 1YWXA 2GO9A 1UP1A 2KM8B 3CCUS 2VOOA 1VQ7S 3VAKA 1WF0A 4BS2A 1D9AA 2NLWA 3B4MA 1KQSR 1FNXH 2L41A 3CCQS 2XS7A 2MKSA 4WFAQ 1N8RT 1QVFR 2AYGA 4FXVA 2LMIA 2DGWA 2MJNA 1YI2S 2E44A 1S72S 3P6YC 3MD1A 4YOEA 2OTJS 4WIIA 3VAIA 3U1LA 5DM6Q 2KG1A 2U1AA 2RT3A 2WBRA 4WKRA 5JVGQ 2MPUA 3CCVS 1NJIT 1ZH5A 1U2FA 3PIPQ 3L3CA 1NU4A 2RU3A 2OJ3A 2JVOA 2M8HA 1U6FA 3G71S 1X4DA 1SXLA 1YJNS 3P3DA 2MZRA 4UQTA 1HA1A 2KG0A 2M4MA 4OZ1A 4W92B 3ZZYA 3J7ZT 1CVJA 2KFYA 3CPWR 2YH0A 1FJCA 2MZ1A 2EK6A 2JRSA 2DNNA 3R1LA 2UP1A 1K73T 4A8XA 2O3DA 1VC5A 4TU7A 5IM0B 2K8GA 1K9MT 2DIVA 2DB1A 2E5HA 1UAWA 2N7CA 2OIHA 1OO0B 4CQ1A 2KI2A 2FC8A 4C4WA 3CC4S 3SXLA 1WHVA 1U1PA 1WG4A 2DNRA 2MZJA 1HL6A 3I55S 2QEXS 2DNOA 3VAFA 2KH9A 3NS5A 2DHSA 4UY8T 2XSFA 2RQ4A 2CQDA 1U1OA 1VQ4S 2RUGA 2PEHA 2M70A 4CIOA 5DETA 5LSLA 1VQNS 1N54B 3MUVP 1FT8A 4F02A 4M5DB 2LA6A 2MKJA 2DIUA 3HI9A 1WG5A 2CQPA 3CTRA 2MJUA 3UCGA 3G6ES 4F25A 1H2TZ 1VQ6S 2DK2A 2LA4A 4IO9Q 3NNAA 5GAGU 2YH1A 3MXHP 2AYBA 4PRFA 2DNHA 1S79A 2AYEA 2HGMA 2OSRA 3MUMP 1X4AA 2YWKA 4LMZA 2MQOA 2MY8A 2ERRA 2RVJA 3UCUP 1VBXA 2CPZA 2OTLS 2KYXA 1FJEB 2VONA 1H2VZ 3VAJA 2CPXA 3FEYB 2AD9A 2DNQA 3VF0B 5FJ4A 2M52A 2KXFA 2I2YA 2KU7A 2DITA 2DH8A 2KVIA 2DHGA 2E5GA 1U1NA 2KRBA 1VC6A 5LXRA 5GMKa 2KRRA 5EN1A 3CC2S 2JVRA 5IFMA 3BO3A 1KOOA 3B4DA 2KT5A 1RK8A 3IWNC 3THTA 3CCJS 3CUNA 3BEGB 1JJHA 1FHTA 2CQ0A 2EK1A 2G1DA 3US5A 1Q82T 4TLQA 3UD4P 5LJ5Y 1M5PC 1U6BA 3VAMA 1OWXA 1WHWA 2XS2A 1AUDA 1QVGR 4WCEQ 2DGOA 4Y00A 2MKIA 3CCES 3PIOQ 3CF5Q 2KHCA 2N82B 3MDFA 3UE2A 1M90T 3G8TA 1X5SA 1SJQA 2QA4S 2HZCA 3SDEA 2XNQA 1X4EA 2ZJQQ 1YTYA 1URNA 2G4BA 1OPIA 1R8HA 3CCLS 1WEXA 1DHMA 2MYFA 1VQLS 2D9PA 4F26A 5IM0A 2MSSA 1M5KC 1QM9A 1ZZFA 2VODA 2DNGA 3J7YU 1A9NB 1VBYA 4IUFA 2MHNA 1FO1A 2CQ4A 1X4BA 2MMYA 3U1MA 2HGLA 2X1AA 1HD1A 4U67Q 2DNKA 3CCMS 2DHAA 2MKCA 2CQBA 5MLCV 2NZ4A 1JMTA 2ADBA 5CA5A 2ZJRQ 2MZSA 3BO2A 1N88A 2CQHA 1KD1T 3MUTP 1X0FA 1VQKS 4PKDB 1WEZA 1FJ7A 1VQ8S 3VAGA 3LPYA 2LEAA 2N3LA 2M0GB 2MQLA 2MY7A 2J0SD 2CPHA 2ZJPQ 1YJ9S 1P1TA 1M1KT 2RNEA 3TYTA 1WG1A 1BY9A 2Q79A 1SJ4P 1Q86T 1VBZA 2CQ2A 2J0QD 2M88A 4W90B 3V4MA 2CPYA 2F9DA 4WF9Q 4LIRA 4ED5A 3VAHA 3CCRS 2OSQA 3CD6S 3UD3P 3LQVA 1H6KX 2F3JA 1U1KA 2DGUA 2HVZA 1NO8A 2EVZA 3S6EA 1SJRA 1H2UX 2I38A 5DDQC 2CQCA 1WTBA 4V19X 2X1GA 3TO8A 4ZKAA 1FXLA 1P27B 2KM8C 4YUDA 2AYMA 3ULHA 3CMES 2MSTA 2J8AA 5BJRA 5H1SV 5DDRC 2YKAA 2MGZA 4C7QA 1UW4A 4P6QA 2FC9A 1YIJS 2L9WA 1SJFA 1DZ5A 3NNHA 1W2BR 1D8ZA 2K3KA 3R1HA 1G2EA 4YB1P 5ITHA 2KN4A 1N52B
chains in the Genus database with same CATH superfamily
1N36J 1HD0A 3FSXA 3QLHB 3SFUA 2ZH2A 1QSSA 1XNRF 3Q2SC 2CPFA 1X5PA 3MWBA 2YY3A 5KFMA 2JDJA 2LXIA 2KKHA 4CLFA 1BWEA 4LREA 1RT7B 4DU8A 4NLDA 2Z58B 1M5OC 3RBEA 2D7SA 1IWGA 1Z2ZA 4DOZA 1EQ0A 3D0HE 2BR0A 3RBXA 3CE8A 3N79A 5I4MA 2D41A 4WZMA 3QMQA 1NZAA 1PYSB 1U2CA 1TP7A 1RT1B 1LXJA 2CNLB 2P8IA 2VG7B 3A8IA 4KO0B 5DZ6A 4CLLA 4YHHJ 4AQYJ 5KFTA 1SPBP 3HXMA 2XMKA 3CD7A 3W5XA 3BJYA 3PYGA 1C0UA 5F8IA 2X1FA 4OZ0A 3RB3A 3Q2TC 1U1RA 5ETNA 5M2RA 4X4NA 4FF2A 1X4CA 4DR4J 3LAMA 2VC1A 4BLGA 2FGCA 2QC3A 4DPUA 2KDOA 3GWCA 5J2MA 3HKZD 4DWIA 4GKKJ 3MECB 1OQ6A 4JI0F 2DR9A 1JWWA 1FF2A 4TU9A 1AZSB 2L48A 3MPVA 2WONB 5L9XA 3BDPA 4Y2IA 4ED6A 2HK3A 3OLBA 4LF5J 4UOGA 1FK9A 2ABYA 2RS8A 2N3OA 3K89A 1B64A 1K1SA 2DNMA 3IBWA 3TANA 4QWDA 2ZOMA 3K17A 3SDEB 3GYNA 2BOAA 3G87A 4K2JA 2AJ0A 2MZTA 1H74A 4DFPA 5T14A 4KV8A 4UQGA 2DGTA 2RS2A 1UWAA 2DGXA 1NRKA 2V2VA 5KFGA 5IZHA 4DR3F 2F8MA 2EFVA 4ER8A 3VV2B 2UUTA 2W7OA 4KH1B 2C28A 2IYIA 3BR8A 2AEMA 1LFWA 3H2VE 1C1CA 5C2CA 8ATCB 5DLGA 2C2DA 4V19J 4N5SA 2G0CA 1UVNA 5LSOA 3HHDA 1T05B 5KFWA 3PKMA 3NCPA 3ZZOA 1FA0A 5DS7A 4DR6J 2XCAA 2PE8A 3GPAA 4K4ZA 1S1XA 3UD5A 1NSKL 1RHQB 2DO0A 2WSCC 2W2OP 2NR0A 3DXSX 4Y2KA 1IKVA 3TZWA 3DYAA 2L08A 4B17A 2EC0A 1KHWA 5CYJA 1JLCA 3UR0A 2R7WA 1KC8T 2XMJA 5HMZA 3MR5A 1JLGA 1FDDA 1WACA 4IYQA 3WIUA 2A6MA 4WFNQ 2W7AA 4MYTA 2KJWA 1GTHA 2CJXB 4X4SA 4DL5A 4DSKA 4QIFA 4KFBB 1UEVA 2VF3A 3CJRA 3OV7A 2FVPA 3G9CA 3J7A1 5GADU 3OJUA 5J1EA 1WUUA 1N0UA 3OW2R 1WI6A 1U1LA 4QIEA 1RBAA 3OBIA 1HBNA 4DBQA 4XIUA 1CSJA 1XWLA 3OR1B 4JI8F 5L39A 3I56S 3MR3A 2DD8S 2GAGC 5A8KA 2QFJA 1X9SA 2IM3A 2AJ2A 1UA0A 3TAMB 2MZQA 1S9EB 1WOSA 4I1TA 3PW5A 1S48A 3AFGA 3DMJB 4ID5B 3SIPB 4Z2XA 4CZCA 4DR2F 2MLZA 2FLLA 2CXEA 3QRPA 3QWPA 2BOPA 5ETSA 1GXUA 1HNZJ 1HWIA 1XQIA 2A3JA 5HJYA 3HHKA 4KPYA 3MOJB 2ZNZA 4J7CA 4J9PA 1SI9A 3IRWP 3AJ2A 3DLHA 2LDIA 4JI6F 1FK9B 5SZTA 3G2XA 3KXDA 1XMQF 2ZKUA 1JJCB 1RYSA 2BJ3A 3N01A 1UZHA 1TVRA 3UI3A 1MSWD 4NPOA 2XG8A 2R8KA 4DDFA 2IM1A 1CJKB 3GSIA 1RAEB 4Y2MA 1CULB 2X1BA 2F40A 2YWEA 3I32A 2B3TB 1JNZB 1JLQA 4KGKA 2IJNA 4RL1A 3ISND 1C0TA 3MMCB 2V0NA 4K2XA 1SQGA 3PX4A 3QZ7A 5ETRA 4YR3A 3GILA 2JLFA 3EGNA 1T9TA 3G8QA 3H7HB 3MM5A 1O0PA 4CCHA 1HNZF 4OL8A 4K8RA 2KZMA 3DXBA 1A7GE 2KXHA 2P9EA 2YVSA 4WXOA 1MU2B 5AXMA 5HROB 3LGMA 2HRTA 2CVEA 1RT7A 1XEZA 2AEJA 3LTOA 1VRTA 2CG4A 1PCAA 4I2PA 2A2DA 4U8YA 5KFXA 3ZZZA 1PGZA 2A1BA 3FEZA 2KXNB 4TQSA 2JOQA 3DMJA 4ID5A 1IXKA 2HBRB 4YB7A 3W66A 3NAIA 3MM7A 4QU7A 1OS5A 2V4QA 4QCLA 1XK8A 3HX9A 3RU0A 3JB9k 4PG6A 3TUJC 3OR1A 3Q89A 4RW6A 1GMUA 2AX0A 1H7XA 2LXUA 2J9CA 3KUEA 3ONQA 2MQQA 1FX4A 1WELA 4RU2A 3NS7B 4L3NA 1NH7A 3HDSA 3OR2A 3PDNA 4ZIWA 2XLJA 4JV5F 1JQGA 1S6OA 5G0RA 2Q6CA 2YBVA 3TVZA 3BBFA 1KTVA 4F0KA 1VI7A 3M8YA 4X62F 2ZH8A 3EX7B 4CO5A 4DL3A 4PG5A 3S7RA 1YKWA 3JYTB 3BB5A 4EYHB 2XBPA 4BWMA 5LXYA 2WBMA 3M2RA 4IOCQ 5GAHI 1NJZA 2FHKA 1GXTA 2N4CA 2BVZA 2V94A 4CO3A 3K5PA 2E7VA 4DV6J 2OELA 5AJ3J 2LQBA 1CJTA 1WC4A 2YNGB 4H4MA 2R9LA 3PX0A 1WHXA 1C1CB 4AQYF 2HNDB 5B0EA 1YWXA 3CCUS 2VFTA 3MFIA 1KR4A 1D9AA 1SIWB 1W2IA 1WC6A 3B4MA 5AE3A 3ETOA 1F3FA 2ZEJA 3VHQA 3CCQS 3WC0A 4CTAA 4PXCA 4U7UK 2XS7A 2EFNA 3HSGA 4EO6A 2BKOA 5F8JA 5KG5A 4JI0J 1QDUB 2APOA 4G65A 5DQGA 2CJBA 2YNGA 3R5AA 1N8RT 4IQXA 1QVFR 1JLQB 4H4OB 2ZH5A 2V2ZA 2WB1D 3BZQA 5FDLA 3NGKA 4EZ9A 5CHCB 2J7WA 2DGWA 1UA1A 4KTQA 4NLGA 2HHSA 3OL9A 1R3NA 2ZHAA 2E44A 1Q5VA 2RKIB 3MEGA 2IJRA 5C7PA 5JJBA 2JHEA 3NAHA 3G86A 3HD1A 1RTIB 2V67A 4LSLB 2V9KA 2D69A 4WKRA 2WBRA 4K4UA 5JVGQ 4M5KA 2MPUA 2FJXA 3CCVS 2Z0GA 1X9MA 1QTNB 5HN0A 1U2FA 4PYAA 2KO1A 3PIPQ 2W9AA 5BR8F 4KGMA 1QE1A 3GFXA 2PFDA 5DO2A 4EFAC 4RBUA 1UTAA 1YZ7A 2R2SA 1FNMA 1KNZA 1HA1A 1MWYA 4IO1A 3H90A 4DL2A 2M4MA 1KLMA 4O0NA 1NMEB 5AXKA 4ZHRA 3HVRA 1L3TA 1KN6A 2CAJA 3GFHA 3CEDA 3GV5B 4A4JA 4CO4A 1TKZB 1VDHA 5E3CA 5CYQA 3Q0AA 1NPPA 2KFYA 4KT0C 3CPWR 1FRXA 2YX4A 4G1IA 1HBUB 1RWXB 5L1KA 1FJCA 3W9JA 2EK6A 1YGYA 1X7VA 3E01B 1SV5A 4PYDA 2NPIA 3DRSA 4RW7A 1JK9B 4DMZA 3R1LA 4P74A 4JI1J 1RZMA 1GFWB 3WBZA 2AKWB 1Y0HA 3OLAA 2E5LF 2PEBA 5J2PB 1BUXA 1WSVA 1NKEA 3UDEA 1Q95G 2DKOB 3J81Y 3I96A 3R7SB 4N76A 3C46A 2R7TA 1HMVA 1RCXB 3GB0A 2IAJB 1HWLA 4NZ6A 2E5HA 2VG6A 1UAWA 3M6WA 4NA1A 2FHMA 2UZAA 4PXEA 4ALZA 2N7CA 3BSOA 2C2RA 4JI1F 1VRTB 4NCBA 4X4UA 2FC8A 2Y1JA 4C4WA 1FD8A 2W2QP 1NPKA 2HVIA 1RBOB 1QUVA 4J9RA 2BRKA 1Q16B 3MM8A 1HL6A 4WP9A 5KFLA 1X9WA 2ZDPA 1WJ9A 2XYGB 4HI1A 1CJVB 3MEEB 5CCMA 5KFHA 4C0BA 5ETKA 5HMYA 3KLFA 2ZH3A 3CJSA 3MCSA 2XSFA 1Y11A 3CGIA 3D1OA 2AEFA 2E7WA 2C3PA 1U1OA 1U48A 4O3RA 5BXIA 4XDCA 2WVDA 1KVIA 3EYZA 1SKWA 1I5OB 3MECA 2DCUB 3JAMY 5LSLA 1V3ZA 4MIWA 3MF5A 1VQNS 5IC4B 3BM7A 2HWIA 4LSZB 4NCGB 3SSSA 2DXDA 3EVOA 3BQ1A 2JEFA 1C4CA 3WIVA 1CQMA 5THWA 4NA3A 2LA6A 4YY3J 3I5BA 4AL7A 3CJ5A 1N6QB 5KFPA 2MKJA 4K4VA 1HHQA 3VWSA 3G82B 3GG0A 3NG8A 2H4YB 5E0OA 3TVYA 3ZFVA 2CQPA 3M6XA 4RNFA 2LA4A 4FS2A 1HBUA 2M3DA 3NNAA 2H54B 2DR7A 1Y00A 2A6OA 5GAGU 2HNZA 4NEZA 4R8UB 2I9SA 3MXHP 1TTHB 4N8OA 2PO4A 1SUQA 2VFRA 2RF2A 2XCPA 2VFUA 2FD2A 3PTWA 1S79A 1WC1A 4RUBA 5KFYA 3KK2A 2ZH7A 3U27A 3GCXP 1T05A 4E0DA 3HHLA 4QYRA 5FLXY 4ECRA 3I4PA 2MQOA 4DV5F 1HYSB 3OTOF 2GMJA 2YNFA 4ZN1A 2JEJA 3HJFA 2PDAA 3PYDA 1F9EB 1MU2A 1ICEB 3ZTPA 4ES1A 5HROA 1VBXA 1IKXB 1I1GA 3PEJA 3A8EA 5KT2A 1T94A 2OTLS 1P9YA 2BW7A 4JI6J 1IBCB 1S6UA 2VB6A 3VAJA 1NUEA 1E6VA 2FY8A 5K20B 2CPXA 5EHHA 3EGWB 1E6YB 1PAUB 2PT0A 5KG2A 4BWJA 3H20A 1HW8A 2ZITA 2GMHA 4USKA 4IFVB 3DI6A 1URRA 2DRBA 5K14A 3W2VA 1JX4A 1I94F 2KXFA 4CYUA 1CQNA 2DITA 2KU7A 2I2YA 3JQJA 2E5GA 3C19A 4HH0A 1C2PA 1V5VA 2EG1A 2QX0A 4X66F 1T3OA 5LXRA 1AB8A 4B3TF 2PI5A 2F1FA 1FWPA 4DR7F 1VQMS 2JVRA 5CZXA 5IFMA 1E6YA 1KOOA 1LW0A 3KLFB 2FLPA 3CCJS 4YFUA 2VASA 4OYBA 3JXOA 2G13A 4QIWD 1OY6A 4FYDA 1FTCA 2CQ0A 5DG8A 2BQ3A 2NXJA 1U7LA 5C24B 1Q82T 3EE3A 4WTOB 2LEPA 3LAKA 1MROA 2PMZD 1RSCA 1WTFA 1K47A 4WYWA 2P6TA 3TA2A 4IRDA 3HJVA 2IYGA 4P2XA 4RO0A 2XQCA 4NRUA 4ZLPA 1R6YA 4JBCA 1KQKA 3Q22A 1S77D 2Y1LB 1SUQB 3CO9A 3KWMA 5J2PA 1DURA 2GFFA 3KKFA 3QIPB 5MAOA 4LF9J 5D3GB 3TEGA 1N33J 2H5JB 3GFYA 4NLOA 2IPOB 2HRYA 2X3GA 1TZ0A 3IG1B 4Q2LA 3DU5A 3MDFA 3QBCA 5F9LA 4QBUA 4X62J 1IKWB 4QWBA 1FI4A 3T5KA 1M90T 3QGGA 4ZITA 4B3RF 2ZJQQ 2G4BA 1YTYA 1G4CA 1R8HA 4O44A 1RHJB 3PCOB 1DHMA 4ZVPB 3IR6B 4L76A 4M5HA 4DV3F 2D9PA 4W4MA 3A1YG 4ZPVR 4DPXA 5A76A 2MSSA 3NL0A 1M5KC 2NZCA 2VODA 1RLDA 4ZCIA 3TZYA 5GAEI 2PD1A 1VBYA 3VQTA 4C8LA 4DV2F 1VLOA 2HQCA 2NQPA 1FO1A 2MMYA 1BWVA 2WVBA 3J80Y 1HD1A 2GHWA 4C6AA 3EPGA 4RWXA 4DU7A 1BLUA 5D4OA 2BE2A 3LANA 1KVKA 3T6BA 3WX8A 1G3OA 1NHUA 5ETPA 4MFBA 5HBMA 3I31A 2KTQA 2HFUA 1HBMA 1RADB 3FGVA 4X4RA 1N48A 1DARA 1RLCL 2FIUA 5ETMA 1RT2A 2RHSB 3OTDA 5MLCV 1N36F 3BBBA 2C3YA 3D1QA 3LA0A 4X65F 3IN5A 3TAQA 4I0WA 1UVMA 2MZSA 4C2MA 4HKQA 3RRGA 3BO2A 2YNHA 2CQHA 2OPQA 1KD1T 1F6TA 4BCAA 3R2CJ 1AROP 3EDQB 1U0HA 4IH5A 4KGZB 1HMVB 3W9HA 3CW2C 1SQEA 1WEZA 2YQ1A 4NLSA 3KHHA 3DRRB 5C5JA 1H0HB 3VAGA 1HR0J 4A8FA 2R7SA 1KFSA 4EBEA 1GEHA 1F1BB 2MQLA 2MY7A 1EP4B 3A8KA 4PG8A 3LALA 3WHIA 3N6MA 1L3UA 4PUOA 3HO1A 1YJ9S 1P1TA 4U7UD 4Q2MA 1F9HA 2RDDA 2UUWA 1RWWB 4F2RA 3C8YA 1WG1A 2PMWA 5E3RA 1EX8A 3J81U 2RU9A 4FNIA 4Q43A 2CQ2A 1VBZA 2JEGA 3WC2A 2MKYA 1HYSA 1TKZA 3AT1B 4ES2A 2CYYA 2V6AA 2ZC4A 1JLAB 4M5MA 4OZ5A 1DQAA 1JXVA 1MLAA 4GVBB 1QLNA 2EBGA 2VC0A 1S0NA 3CCRS 3IFEA 3KK1A 3OUYB 2Z56B 4JV1A 1BMQB 4N47A 5GMEA 2R8HA 2ZH6A 2BACA 5CD4A 3D5MA 2H9ZA 3O5TB 3KMQA 4NYPA 3SBMA 1NO8A 2VD3A 3GTYX 3AODA 3Q8SB 3BQ2A 1UPPA 5EWFA 5H9FK 3ZNJ1 3W60A 4DV0J 3CB4A 4LRCA 3UW1A 1D9FA 1JLGB 2EVZA 2A18A 4OYZA 1LWFB 1ZAXA 2E7XA 3OL6A 2EBEA 3NGUA 1H2UX 4I2QB 2I38A 4NX9A 4WE1B 4PG4A 4RPFA 3K5MA 2OPSB 1R6VA 3HFVA 3M8RA 2BQRA 3QO9B 4DEZA 2OLWA 2XI3A 1WTBA 1PYTA 3RR7A 4JP8A 4YR0A 4KHPF 1TL3A 1RUSA 2HMIA 3NEKA 4ILMA 2HG4A 3NRBA 3GV7B 4H54A 1P27B 2DYAA 3DOLB 2CRLA 3CDEA 2EC2A 4F4KA 4LFAF 3EXCX 3LP2A 1K0VA 3BKUA 5A8WB 1B99A 2YKAA 5CZVA 4JI2F 4DR5J 2Z2MA 2CUYA 3HHEA 3EGVA 2V4JB 3SSQA 1YIJS 2ZC3A 4PWDB 1IWAA 4LF7J 2IDEA 2OH2A 1S5ZA 3VZHA 1S57A 4HDGA 4G1PA 3FBCA 2K3KA 3R1HA 3RUBL 2UUBJ 2BKNA 4LRFA 5ITHA 1C1BB 2KN4A 3CMQA 2A10A 2HPUA 1N5QA 3P96A 4F36A 5F8LA 1KVJA 2MLYA 5CXTA 3GMGA 1VRQC 4KHPJ 2BANB 3M1VA 4WU3A 3ZXWA 4ECZA 3BYRA 3UCZP 5C25B 1U1MA 4C48A 3DLLQ 4KAIA 3C14B 1X4HA 3HHLD 3K7RA 4PWWA 4ZVTB 1NPRA 4EEYA 1H7WA 1YRXA 3RB6A 2W2NP 2AGOA 2GJ2A 2CG8A 3NMAA 4Z7CA 1ZS6A 4HL9A 3MI7X 2FJVA 2HNYB 2IBKA 2FHOB 1OMSA 1KOHA 4DX8H 1N0VC 1TV6B 1T02A 2KYZA 2C42A 4O3SA 5CYMA 3CDUA 3THPA 4ERDA 4LR8A 2BEFA 2MB0B 1TR0A 2DH7A 4K59A 2Z2ZA 4KH0B 4ZK7M 5J1PA 2HS0A 5EWGA 3PJXA 2ATCB 3QLHA 2I0XA 4NCAA 1GNKA 1HQEA 3H42A 2R7QA 5E33A 1RHUB 2VKRA 1R27B 4OX7A 1YRUA 1NSAA 2DHXA 4LR7A 4B9LA 2BM1A 1A6LA 3IM8A 3R5GA 4J5OA 3ZZTA 1PO6A 5KG6A 1HI8A 1KRPA 3F56A 4HH1A 1B7FA 3GSDA 3W61A 5F8HA 3CO0P 2W2MP 4DR7J 3PY8A 3TJ9A 4MK8A 4UW2A 9RUBA 2CQGA 1IBKF 1Q78A 2DNPA 1WOPA 2B56A 5KFEA 2UUCF 1FJGJ 4LF8J 1NK0A 5KT3A 1U1QA 1LK7A 5HLFB 1CJKA 3J7Z5 2BE9B 4DR6F 3BS9A 4K7QA 1L3KA 2E9RX 1SCJB 2G1HA 2VBXA 3AD8C 3L4BC 4KHMA 4GC6A 3M8WA 4F3OA 1KFDA 2QLBB 2CPDA 5KFBA 2JWNA 4I68A 5AT1B 5RUBA 3RGIA 2ZZNA 2YWFA 3SEOA 2NSCA 4DR3J 1RYRA 1VCTA 2YXLA 3GLJA 4UZCA 2AF6A 4WTYA 3D4JA 2FPHX 3D6HB 3JTOA 4HACB 4HHHA 2W9CA 2FVSA 3D6FB 1VQ5S 2UVUA 1Y5IB 4MH8A 3MZIA 2WW4A 3DRXA 2L3MA 4LVOP 3R97A 1M1HA 3AH6A 3V6KA 1HR0F 5A8KB 2MQPA 3PXGa 1RTJB 4QWEA 4BDPA 5GAEU 3TA0A 2ACMA 4KJIA 4LR9A 4NEYA 1HI0P 3ZC4A 3T9NA 1WI8A 2VPZB 1I51B 4C3LA 1KQGB 1W7WA 2WCXA 3PYFA 4WFBQ 3G6XA 1DAXA 1S10A 3J7AN 2IMOA 3QSIA 3TJ8A 2Y0BB 1LWXA 2W4PA 3TJAA 3T1HF 1CC8A 3UPFA 3PVXA 4DUYJ 2BDPA 4OYPA 1S9GA 4UUXA 1HQ2A 4DV1F 2FZCB 3O6QA 1S9EA 4OZNA 3W2WB 4I67A 3FRZA 4DZ6A 4G1QA 1CG2A 2CZVC 2NCKL 4OHZA 1OY8A 1GMVA 2J9EA 2Y1RI 4FPIA 3QYYA 4U9RA 1AW0A 4PEOA 2NXUA 1IQZA 4NYZA 2BZ2A 1ZAVA 1M5VC 5IOLA 1Z4UA 2BRLA 2VUGA 5F0WA 3FEXB 5LJ5Y 4UY85 3CULA 1ACMB 2DNLA 5J1NA 3BGUA 5KAKA 2AJ1A 3M8PB 3TP2A 1YJ7A 3F44A 1YITS 2VA3A 2BKPA 5D78A 4NCGA 3R5CA 3ET6B 5ETLA 1EHWA 3NXZA 1LWEA 1TL7A 4PR6A 3LP0A 3CC7S 3GJSB 4F4ZA 3MR7A 2C3MA 1UFWA 2W2PP 4TQRA 3M05A 4DQIA 2JFDA 5D8HB 4IQMA 4DV1J 2M9KA 5DG7A 3C6UA 2CIMA 2Z30B 3R6GB 5A0YA 1HHTP 3A3PB 3HVWA 1N34J 2HVDA 4URSA 1MN9A 1Q0NA 3KLVA 1C1BA 3P5TL 5T7LA 4DZDA 4LF6J 2FZGB 4MKBA 2HHWA 1IQTA 1YJRA 2UXCJ 1YG0A 2MQMA 2MXYA 1RA7A 3BSCA 2WB4A 3NBPB 3P8BB 3WX4A 3BREA 4LF1A 2GMLA 1N5YB 1SKRA 4DL0C 4QU6A 5H9FJ 1IVZA 5KFVA 2FVQA 4QQBA 2J0WA 3KLHA 2D3OR 3KLHB 1LW2B 2OGUA 4PRFA 1RT1A 1DTTA 1NSPA 3AD7C 1NK9A 4Q0BA 4NWBA 4XPEA 2DH9A 3D3BJ 4KIAA 2P2CB 1RP5A 3KLIB 7AT1B 3IA0A 2R8JA 3HHNB 4U96A 2D74B 5B7WA 1VQSA 5EGYA 4EZ6A 4WK3A 4K0KJ 3DLKA 3QRRA 4HYKA 2XO6A 2JJ4D 1NDLA 2GHPA 4TVAB 5M2UA 2R7RA 5CABA 1XERA 1RAFB 1U24A 1EIYB 3KHLA 2R2RA 1JIHA 1FKOB 2DO4A 2LYVA 2OD4A 2POKA 5HMWA 4Q45A 2JH3A 3H4DA 2VG5B 3NP5A 4DSJA 4TYBA 1RTHA 2BA9A 2DHHA 3M2VA 2PMHA 3OTCA 1SV5B 4BS2A 3VAKA 3OTEA 3HFZB 4OI2A 3OSNA 4ELTA 4EUVA 4YP3A 4F4YA 2XWYA 3HSDA 3D1HA 1ZM4A 4PPDA 4CT9A 2DRAA 3DLGA 4X84A 3W5ZA 2IC3A 2MKSA 3PW7A 4ZCKA 3L95X 2BM0A 3QQCD 1HLWA 3Q8UA 1WORA 4XTTA 4GVBA 1KP6A 2GQQA 2LMIA 1RHKB 3M30A 3P5BP 1EJ7L 4F2SA 2DXEA 2GNKA 5L1JA 3MM9B 3ISZA 1NSQA 5BYSA 2W9CB 1S72S 4NXMF 2OEJA 5B08A 3W62A 2GS8A 4M5GA 1S99A 2V8GA 4CO0A 4ZLJA 5DM6Q 5KG1A 5KFRA 3ENVA 4NLPA 3GIIA 4FXDA 1LNQA 2RT3A 2VBYA 4C0HA 4ED0A 2BJ7A 2EG2A 1NJIT 2YX1A 1RAOA 2WOMB 3A3NB 3FZBA 3MM8B 1ZH5A 2R2TA 2RU3A 1XR7A 1DY3A 2JVOA 4IG0A 1J2VA 2KL8A 1QJHA 4F4WA 1SXLA 2GZOA 1XIQA 3H5XA 2X7IA 2O5DA 2MZRA 3P3DA 4LF4F 4K50A 2H3EB 2F8HA 2HWHA 2KJVA 2W1BA 3PYEA 3T41A 3IXQA 3OHBA 4W92B 1UVIA 1UFLA 3TUZC 3ZZYA 4XAKA 3FUYA 1S0VA 3J7ZT 1OYDA 2DJWA 4NMXA 4CDIA 2HLUA 3VGVA 5DQIA 1PIEA 4F67A 3SI8A 4LT6A 3FQLA 2JNJA 3AB2B 1JLBA 1RWNB 1S1VB 3EJMA 4KRWA 3UDVA 3V4IA 3HT0A 4ZVRB 2UXDJ 2YH0A 1HNWJ 2MZ1A 4DV2J 3HZEA 3KOAA 4I64A 2JRSA 1APSA 2BABA 5F41A 3D67A 4QZVB 5A8RB 4DR1J 4B3OB 4OX6A 1ZBTA 4A8XA 1ZM2A 2O3DA 2Q3PA 5GADI 3I6PA 3IGVA 1QUPA 4L3KA 2K8GA 1CJUA 1CJTB 1Q8IA 1DTQA 1MWZA 3CCTA 2DBBA 1LKZA 2VPXB 3CVKA 3QT7A 4KGXB 4ANCA 5HVGA 3OL8A 2OIHA 3SCLE 3HK2A 3GJQB 4CQ1A 3F41A 4OIXA 4QPXA 1LOUA 3CCWA 3T1HJ 3M7VA 2ZBQA 2EFPA 1FFWB 2ACYA 2GJIA 3D68A 3Q8QB 3RAMA 1RWVB 4ECTA 3KG0A 1U8SA 1WG4A 1ZAWA 2DNRA 2G0JA 3DLEA 3IG1A 3BYPA 5K8NA 3I55S 2QEXS 2HHVA 4NE9C 2ZKTA 4ENOA 1OSCA 1UFKA 2B51A 1NKCA 5IT9Y 2Y9HA 2WTFA 2KH9A 1RTIA 4IDKB 2FGOA 2OPPA 3FJ2A 1RHMB 3HVTA 2YKOA 2DHSA 3FCWA 4USIA 4DUTA 4JI4F 5T41A 1SC3B 3HVAA 1VQ4S 4MJKA 4C8YA 2IRUA 5HATA 3GZ7A 1PYOB 3FCHA 2PEHA 2GVZB 1FKPB 2HSEB 1RTZA 2EW9A 2WK4A 2B7CB 1NLKL 4LQ9A 2BJEA 2QE5A 1N54B 1Q4RA 2QSWA 3KLIA 4HACA 2CNNB 2M5YA 4B9VA 2Q66A 1NKBA 5K8OA 3QSYB 2OEMA 1U25A 3M2UB 4PABA 3Q24A 3CJ4A 1V9OA 3GU0A 1TMJA 2PC6A 1RKIA 3EMTA 5DQHA 2XZTB 5J2QA 3RYLA 4Y65A 3CTRA 4XK8C 1IBLF 3UCGA 3G6ES 2AIRB 3L7OA 1RWKB 3T1YJ 2UVVA 1FRLA 1FESA 1M5SA 1JLBB 1HI1A 2FVRA 2B8PA 2XGQA 1IBKJ 1VJWA 1NCLA 2Q1LA 1SH3A 4DR5F 3ZZUA 3JAMU 3M6UA 4LF2A 3K8VA 4KKOB 2PIIA 5B0DA 4OJ1A 1X4AA 1G7CB 2F5GA 1U0HB 3PFEA 4LSNA 3RBDA 4FBUA 2PGCA 4MK7A 5D15A 1T03A 4AL5A 3FBBA 4B08A 2DCLA 2LLZA 2MY8A 1RT3A 4B3RJ 4HR2A 4J9KA 3H0PA 1BQMB 2RVJA 4Y28C 5I3QA 2CNKB 3LP0B 1UVLA 3BDEA 2QG9B 2CPZA 1NK6A 5ETVA 2O01C 3N4WA 5HK4A 2J5AA 1T9WA 2A2CA 1FJEB 2VONA 4TY8B 1TL4A 3K5NA 1JNRB 2B9XA 3IWXA 3QGIA 1UWBA 3MMBA 3IBCB 3FEYB 4RBTA 2XHWA 4RW9B 2AD9A 5HLFA 2DY1A 4YN3B 1HPZB 4H4MB 4DPOA 2XLKA 3VF0B 4GMKA 3KJQB 4OI4A 5FJ4A 3IO1A 3JQMA 1AXQA 3AD9C 2VL1A 2DH8A 4M95A 4UZBA 3H59A 3W63A 2GW8A 4EI2A 4GKJF 3FRYA 3Q8VA 1YX2A 3FCVA 2KRRA 5EN1A 3CC2S 1RT6B 4K5RA 2VIHA 1I6JA 3CJKB 1RWMB 4JI3J 2IFXA 1NZ8A 3M6VA 1K1QA 1JB0C 2HNYA 2UV8G 3ZZRA 3IWNC 4DL6A 5KFSA 2AQ4A 3BKFA 3N28A 4M1KA 4JB8B 1Q5YA 2QSFA 1J5OB 4Y2CA 3MEGB 4I56A 2ZZTA 4AE5A 1PBAA 1GQEA 3L9ZA 4PPZA 2EFOA 3UD4P 2QLJB 3AAWB 3CJQA 2VU5A 3IM9A 3LP1A 2B8QA 1U6BA 1F3VA 3T5LA 1WKJA 4ZIVA 1W26A 1OWXA 1WHWA 2NUHA 2VDIA 4TN2A 2HHPA 4ZVFA 4DN9A 1QVGR 4NXMJ 2F4VF 2OI2A 4OJHA 4Y00A 3DLKB 3DRYA 4NMLA 3VVUA 4ECVA 2DPIA 3KYLA 2XULA 2J9DE 1QAJA 4JI3F 4YDXA 3T9ZA 2RD5C 3KMSA 4DLEA 2KFZA 2Y8YA 2PSZA 2V4JA 1Z1ZA 2QL7B 3UE2A 2BJ8A 3V4IB 5HVHA 1L5UA 1OYEA 2QA4S 3D28A 2HZCA 3K5OA 5KOWA 3SDEA 3QNWB 5K8MA 3CCLS 5SUHA 4FP9A 4P72A 2IVMA 4LSNB 1JLFB 2RDJA 3KG4A 2BBEA 3DC2A 2UXCF 3UN2A 4OMFG 1F2HA 1YBTA 1J5EF 5KFNA 3OVAA 1QM9A 4GO5X 1KTQA 2DNGA 1RHRB 2WZ1A 4ZPWR 3RZAA 3TEHB 4IFYB 4ZLNA 5A2QU 5HANA 1FDBA 4DV0F 1T0TV 4YQWA 2C1EB 3H8YA 4Y34A 4Z7YA 5DG9A 1X4BA 3NGDA 2UUAJ 2HGLA 1RU1A 1S6QA 1S76D 4CLWA 1YZ6A 3CJ3A 1BQNA 3D6MB 2VJVA 1OQ3A 2VQFJ 2GIQA 3QFWA 1TL1A 2B43A 2VQEJ 3TAPA 3RR8A 1S4EA 4ED4A 2VFVA 3MAHA 1R0CB 5AE1A 2IM2A 5E3QA 4AFFA 2HZVA 3ET6A 5EX3A 1LK5A 2BW2A 1RABB 1U2RA 2ALYB 2BYCA 2DR6A 1TL3B 3DYAB 4CLZA 2HMIB 4Q8EA 2NZ4A 2C3UA 3R6LB 3QGPA 5B0CA 3Q8RB 5KFFA 4HTIA 1JXLA 1H73A 2CVIA 5HQMA 4A46A 1X0FA 1S7IA 4PKDB 4I2QA 5E2QA 1UW9A 2XYPB 1IM6A 4WXWA 3KLEB 1FJ7A 1ZPWX 2K1RB 1SH2A 4R8UA 2NXCA 4DI6A 1TKTB 4NLWA 4OHVA 1DQ9A 2CJQA 3E3XA 1VBKA 2CKWA 2N3LA 1MWQA 4UOFA 2ZJPQ 1S9GB 2QL9B 3T6JA 3PM9A 4DCJB 1M1KT 2R8GA 2RNEA 5HQLA 4JI7F 3L09A 2QLWA 4F3QA 3HHLC 1SJ4P 1S7HA 4HHJA 5D3GA 4X2BA 2MDAA 4EBCA 3DGVA 1LW0B 2M88A 3H25A 3DRRA 4W90B 5L1LA 5CCLA 2VBWA 1TKXB 2F9DA 2CJ9A 4CNZA 1IBMF 4LRAA 1Q8BA 1RBLA 4MKAA 4WIQA 1TFWA 3M8QB 4UTGA 4C9DA 1Q8LA 3ZO7A 5JXSA 5JUMA 2H5EA 2HS3A 2F8EX 4ITSA 2FLNA 3KJVB 1H6KX 4DSLA 1B0TA 5B0BA 4B9MA 3C6TB 3E8OA 2Z8QA 7FDRA 3HT3A 1N34F 1FD2A 2BQUA 2EKNA 2QIFA 4CP5A 4RU9A 2GCFA 5LL6d 4EMDA 2ZNYA 2AMCB 1TELA 2I5JA 4CO2A 5FLXU 3H4BA 5J2QB 2GHVC 3SYZA 3QGHA 1NM2A 3NLCA 3N5FA 4KQZA 1X8DA 3D54A 2HS4A 1GTEA 1OJ4A 2HLTA 3KJVA 2GX8A 2V5HG 3DDIA 5DDQC 1V3SA 2CQCA 4V19X 1P1LA 1ZETA 3F0NA 4FKXA 3TO8A 1HBNB 3WZ0A 3EM1A 3AOAA 2ROGA 2DY9A 1U45A 2QZ8A 4EWTA 1SKSA 1XTZA 2AYMA 3ULHA 3PNIA 4IG3B 3CMES 2MSTA 3ENQA 3D66A 4I6YA 5H1SV 4MFBB 4ILRA 3PO4A 2PA3A 5HVFA 4JV2A 3RTVA 3VQSA 4DLGA 1HNXJ 3POTA 1UW4A 4C7QA 2FC9A 2HQDA 2ZD1B 2L9WA 2UXBJ 5U47A 2IVFB 4FVCA 2OFHX 2IJFA 5DGAA 3G82A 1DZ5A 5HAOA 1IBLJ 1GMWD 3DNCA 3IR5B 1Y3JA 4R5PA 3IWLA 1G2EA 3ILIA 1ZM9A 4D3HA 3ENAA 2IM0A 4B9UA 4DX5A 3RW6A 4ZS6A 2D3ZA 4YOEA 3VGUA 2E5JA 4NLYA 1JKHB 1SJ1A 1JLAA 3AA8A 1ZTTA 3HM9A 2H51B 4NRTA 1FWKA 3U02A 4OZLA 2XLIA 1RWUA 4WP8A 3G8SA 2LU2A 3BH7B 3OVBA 1S0MA 2RHQB 1VQ9S 2XY5A 2XZDB 1FRJA 1X5TA 2NSBA 3UFCX 2HYIB 5K5MA 4JI2J 4P52A 4EK2A 4CT8A 2LP4A 4DG1A 1Y5LB 1HQUB 2CNOB 3ADAC 3ILOA 3QRQA 4DR4F 2OPRA 2F4VJ 1SC6A 2FZKB 2VBZA 1WWHA 3NBPA 2HQ3A 4MYUA 1Q7YT 3M9MB 3C14A 4DFKA 4OX8A 1K8AT 5E3PA 2AHOB 2DEJA 4UF4A 2LKZA 4HTJA 4KYZA 3DHWC 2HBYB 1NHVA 2E1MC 3MOZA 3OXGA 3J81j 1YQHA 3CMAS 3W2VB 4WBFA 1NK4A 3DGPB 2DGSA 3KJFB 2UXDF 1WF2A 2XO7A 4GO7X 2XNRA 3PFOA 2VOPA 1HQUA 3SQGA 1RISA 3D0IE 4NI2B 4P7TA 3T1YF 4JYAJ 1DFDA 4LF5F 1E6VB 2GAHC 4ZPCA 2ZM6F 4N41A 1T95A 2W01A 4R25A 5DRKA 1GAOA 3IS9B 3PW4A 4JI5J 3ICLA 1N32J 5BYQA 2ZZMA 1VK3A 2MGZB 1NDCA 1HIYA 1OY9A 1OPZA 3GJTB 2FJBB 4L74A 4E2FB 3ETMA 4DUZF 1UKUA 3SV4A 3GYGA 5CQGA 2DGVA 3HD2A 3HCXA 4ZHRB 4Q5VA 2UUAF 4NXNJ 3MPDA 5HJXA 2V8HA 2F4FA 2ZOFA 3VALA 4DJBA 3K57A 3NMRA 2HIYA 4IOAQ 2M7SA 3BO4A 5HP1B 4Y6IA 4I69A 1Q79A 4MTPA 3B8HA 4DL7A 4CNYA 5IV3A 2J6TA 2BJ1A 1RCOB 2CWKA 4ZJOA 1LWEB 1TL7B 1X5OA 3JS9A 4ZP6A 3VR1A 4DSFA 2F63A 2GVDA 3C15A 2HK2A 1YBAA 1UCNA 3M2VB 3P4UB 3QT6A 4KGVB 3UWTA 2Y1IA 1NB2A 3M8PA 1TK0A 1Q81T 2LDYA 2HQIA 5HP1A 4QWAA 3MFHA 2O1PA 4OI3A 4OFZA 4KHRA 4P9SA 4O4GB 5IT0A 2DEIA 3R27A 4MIBA 3BR9A 4A8SA 3BH6B 3BSNA 2KB2A 3E2EA 1DRZA 4M5LA 3N9UC 5LJ3Y 2K7JA 5DDPC 4J9UE 2E9ZA 3T19A 5CYMB 1IJFB 2QFIA 4AYBD 1RDRA 5DM7Q 2CDQA 4PZVA 1JLFA 6FDRA 4LF9F 2WSFC 3EGZA 3H5UA 3K2YA 3BGOP 3O1LA 1F5AA 3I4HX 4FF4A 1RKJA 1CJVA 4MIAA 2CPJA 2NUUG 4TXSA 3W5YA 1RWOB 2YKNA 3KG1A 4NI2A 4C0OC 1PJ5A 4M5DA 1S1TB 4LSLA 3DN9A 2LEBA 2D1CA 3JTNA 3AXKA 4ELUA 4ZLLA 3R5JB 2RRBA 3TWZA 2AT1B 4P2MA 3N6NA 3CT9A 2VV5A 1AFJA 5F3ZA 2CQ3A 1KHVA 2YKPA 3CJ2A 3P45B 4P73A 5KFKA 5IV4A 4A8YA 1B7YB 1TK8A 4TYAA 2CJYB 2RRNA 1X4GA 2JZ5A 2W9BA 2VG6B 2HFVA 2LQ8A 5K14B 3DI6B 1A0OB 1XR6A 5IXUA 3DLJA 4O3PA 1R8AA 2AJ4A 2RSQA 5FIIA 3TNVA 3TUIC 1WC3A 2F9JA 2U2FA 4FYYB 4FYXB 3ITHA 4AT1B 4QIVA 3HFKA 4NOHA 1TVRB 2QA2A 3KFWX 1ULRA 2GGPB 2IA0A 4C97A 4EGLA 3SMZA 3VTIA 2B7BB 1XNQJ 5D77A 3OFFA 5KT6A 1OSDA 2IIHA 1FEHA 2MHEA 4ZVSB 3W7BA 3S8SA 2L9DA 2ZH1A 1AT1B 5A6WA 1RGVA 3W3SA 3NS6A 2ZE2B 2CZ9A 1KDNA 1P9QC 4OJ3A 3OR2B 2I8EA 4EO8A 2EWHA 2JX2A 3D7SB 3HULA 1SC1B 4LVNP 3C3LA 5J2NA 1KSPA 1S59A 1FRHA 1SL0A 4RZRA 1K0TA 2FYXA 2OHDA 2IDLA 3R5BA 2HHHF 4J9MA 1FXRA 1WHYA 3PKYA 2XI2A 3CXCR 1YJTA 3DRSB 1EAYC 3E01A 1PKUA 3EDRB 4RW7B 1HWJA 4ZPDA 4ZVHA 1DLOB 2J76E 2YWHA 4ZJLA 1VC0A 3IBFB 4Q7AA 4ZPBA 2DGQA 1TQLA 1SB6A 2ZBPA 4OI0A 2XWXA 2ZWPA 1GX6A 3MMBB 1VJQA 2JFKA 4QPTA 1FE4A 4PXBA 1D8YA 3PR4A 2CQIA 3GP9A 2V63A 4QIGA 5KG7A 2XB2D 3G4SS 5GAGI 4GRSA 1WC0A 1QD1A 1RTJA 1ZPVA 3LH2S 4B02A 1Q53A 5JMNA 2E1CA 3KK1B 4ATNA 2B9WA 2FTRA 3RRKA 2G9OA 1ZZNA 4QR2A 5HL7Q 1YHQS 4R0JA 2B9EA 5KFZA 4Z37A 2BX6A 2YKMB 2ADCA 3JSMB 2HGNA 4G6VB 1O6XA 3BSAA 5LMNF 2HFNA 4B3OA 3EUNA 1UP1A 2OMOA 3AY0A 3TRGA 5D0GA 3VZIA 2KM8B 3NOGA 1B3TA 2VOOA 2KZZA 2W8LA 1JLEA 3MTJA 1AYEA 3L7UA 1LFPA 2MEWA 1N5SA 1LWCA 5ADZA 2VPYB 4WU2A 2L41A 5DGBA 4GC7A 4B9SA 2FLOA 3HLUA 1J27A 1PJ7A 3BGRB 3GCWP 4DQQA 2OO4A 4AD6A 4WFAQ 2UV8A 3I0SB 4B3MJ 1TUVA 1LEOA 2WVCA 3AQOA 1TKXA 2G2YA 2EXUA 2AJFE 2QRRA 2E1RA 4FXVA 2OPQB 3KUGA 1F5CA 2YNHB 2IA6A 3UR3C 2FJWA 2YNIA 2G0IA 2JLEA 4OYAA 3VGTA 1LWCB 4YMEA 1KWMA 2V2QA 3P6YC 2QV6A 2OTJS 3OT9A 2QA4G 4WIIA 1RT4A 4WP3A 5E3AA 3U1LA 3VAIA 4PWDA 3V81B 4ZOSA 4PQUA 4ECWA 3GJRB 4ED8A 4P71A 1GK8A 4ZVGA 4JV0A 3GR0A 3L3CA 2OJ3A 2AP6A 3SV3A 2WAQD 2ATLA 1U6FA 2YNFB 3FQKA 1X4DA 2B6AA 2XMMA 4QOTA 1T9VA 2YQ0A 4ZCLA 3TZXA 4F50A 2LVWA 2DR5A 4UQTA 1ZM3A 1SH0A 4OZ1A 5B0FA 7FD1A 5A2QY 4OHYA 3KK2B 1LWFA 4O44B 4V1Ak 4M63A 1UZDA 4MK9A 4CI0B 4KFBA 4OZJA 4AXJA 1TL1B 3GR1A 1HFEL 4WWSA 4HT5A 1HWKA 4B3SJ 5AJ3F 2C3OA 1T9YA 2DNNA 3CIMA 4CM2A 2UP1A 1FERA 1BXNA 1K73T 4X64J 2RB7A 4J9NA 2OAUA 1VC5A 1GMWA 2C2NA 2HQGA 2QL5B 1WSRA 3UQSA 5LMUJ 3L7PA 3MM7B 2XGPA 5IM0B 2X51A 1FRKA 4NZ0A 3UNYA 1P8GA 4Y3CA 2DB1A 2ILYA 3O3LA 4CTAB 2V50A 3I9V9 3KNGA 1OO0B 1VS3A 3T1AA 2ZE2A 4ZA1A 1QAXA 4BBYA 4JI4J 3GFZA 4ELVA 2VHGA 2XY7A 5IC6B 3SXLA 4C98A 1WHVA 4KV8B 4RW8B 4UT4A 2V9WA 1I94J 3NGTA 3Q86A 2GGPA 1HW9A 3TW0A 3MCNA 3W8GA 5ETQA 5I3UB 3CWJA 2DNOA 3LP2B 3PG9A 4DF4A 5D0EA 5D6GA 5I3UA 1MNEA 2XC9A 2RE1A 3FBEA 3LO3A 1NBEB 3VAFA 1WDTA 1N5VA 5A6PA 4O3OA 1T7PA 4UY8T 2RQ4A 3BN4A 4L75A 3G6VA 4DV7F 4X4PA 2C2OB 2BJDA 2PA8D 3D9BA 5HSPA 1CBKA 1UJ4A 3HZGA 5EDWA 3ZZ0A 1V3RA 2R3VA 4NL5A 4DFMA 4L72B 4A8MP 1Y9OA 4LFBJ 3K8WA 1D9DA 3GE9A 2QTWA 3C2PA 3O44A 1GX5A 2OPRB 3MUVP 4IDKA 4M5DB 3OJSA 2K7KA 4FZVA 3JSYA 4NLTA 4USHA 2DIUA 3QWUA 4CLUA 3HI9A 3W9IA 2MJUA 4OI6A 1VQ6S 3N0VA 4YEAA 9ATCB 4EBDA 1RA6A 3B54A 3SSRA 4IO9Q 4KR0B 4FNHA 1SC4B 4XO0A 3RB4A 4UUWA 2HZAA 2R7VA 4NLXA 5KFQA 2CFXA 3FFIB 2HGMA 3MUMP 2YWKA 3O8WA 3HMJG 2DVIA 4FBTA 4FF3A 4J37A 2W7PA 2NREA 2ZBRA 1GH8A 4PWUA 1VMBA 2OMLA 3EWGA 4USUA 2ERRA 4OYXA 1TFYA 2XMTA 4QJVA 1F2GA 3HSZA 3I0RA 3UCUP 3C15B 2D3UA 5KFCA 2PN6A 4DPYA 3CJ8A 3GIJA 4DSEA 3ZZPA 2C22A 1H2VZ 3IGNA 4DV4J 1V6HA 2XHCA 3ZTSA 2IHR1 3ITHB 4QW9A 2C2EA 4CWBA 3GIKA 1IM4A 4A47A 3QJJA 2RJZA 1T03B 2C2KB 3H98A 3C16A 3DOKB 5I42B 3C6TA 1K44A 1Y7PA 1B4SA 1MG7A 1AZSA 1RJJA 5KG0A 3ZNUA 3MAQA 2M52A 2BUNA 1R8BA 1EETB 3UVJA 3R8YA 3UVJB 2J8SA 4CH7A 4LRDA 3BPDA 1B70B 3H40A 1U1NA 2KRBA 2H4WB 4K4TA 4ECQA 4LFBF 4UOCA 4WK1A 2ASYA 3NCRA 5KFAA 3JTPA 4DCPB 3C16B 3DOKA 3T5JA 3QZ8A 2NXNA 5I42A 3PW0A 1U6ZA 2KT5A 1D1UA 4LFCF 2YKNB 4RR5A 1NAQA 3IMQJ 1B0PA 1VISA 2FUG9 3BEGB 1IR0A 3CUNA 3SQGB 2DRDA 1L3SA 2EPIA 1JJHA 4DCOB 4B3MF 4IR9A 2JLGA 2F7VA 1FHTA 2GV1A 3MM9A 4I6WA 4USVA 3QJPA 4RW4B 1M5PC 3KHRA 2FHJD 2IY5B 3W64A 1CS4A 3KLEA 2IAJA 1N32F 4OYOA 2IRYA 1UETA 3FFIA 5J2MB 1YJVA 3HVTB 2DGOA 4WCEQ 4X4OA 3H2LA 2XYHB 3D6TB 1RTDB 3VGSA 1N33F 1NK8A 3CCES 2GIFA 1WKLA 2ILZA 3NY0A 5KTQA 4DR2J 1IR1A 2OUGA 3CD0A 2VG7A 3IAM9 4FPRA 4KO0A 2KHCA 2G2ZA 3CF5Q 2N82B 3JYTA 4MT1A 4WFZA 2CADA 3I0RB 2V69A 3MGJA 1R7IA 3G8TA 1HHSA 1RTHB 1SJQA 4P10A 4I4BA 1X4EA 3D0GE 3Q8PB 1URNA 2JSXA 4RNHA 1OPIA 1U02A 2KVQE 3HHLB 2P5VA 4DHVA 1VQLS 1RT5A 4CRJA 5C2GA 3TARA 1CJUB 1M1GA 2W4DA 5LOQA 1VHIA 2QYGA 2Y0SD 2W24A 1XBWA 3H5YA 4CLKA 3J7YU 1TL5A 1NJXA 1G6BA 2HNZB 2OP5A 4RJVA 8AT1B 4QW8A 4IUFA 1U4BA 2MHNA 5A8RA 3GIMA 2CQ4A 3A3OB 4IH7A 1O51A 1ZTWA 2UXBF 2X1AA 2AGQA 1FKAF 2AWZA 3DU6A 4U67Q 1EQMA 5IT4A 2CA9A 2DNKA 1NHKL 4XPCA 6FD1A 4FF1A 2XSJB 1X31C 1KONA 4FN5A 4RWWA 3CCMS 2MKCA 2ZBIA 4WZQA 2ZWOA 4UOHA 1RT4B 2RQMA 2NS1B 2QLXA 3DGPA 4K0KF 2WONA 1JMTA 5E5NA 4O23A 4H4KC 5CA5A 1X0PA 5C25A 5D4PA 4MKYA 3UNGC 1RU2A 3FMWA 5HI7A 5F8GA 2XEXA 4RLEA 5F0UA 5E41A 1Y5NB 3PRVA 4YB5A 3MUTP 1VQKS 2CJAA 1FFGB 4PCQA 4N56A 4F04B 2F65A 4NZ7A 1RXOB 2EEYA 4O0IA 1IJEB 1U26A 3MEEA 4N77A 4X4QA 2M0GB 5J2NB 1HBOB 2YPYA 2VZ9A 2J0SD 2CPHA 4B3TJ 1JLEB 1P6TA 1UVKA 4FDFA 4RW8A 3M9NB 4XDDA 3MHYA 2Z4PA 1BY9A 2Q79A 2HRUA 5LT5A 1Q86T 4LUBA 3QT5A 5CH7B 4CLTA 5A8WA 5F8MA 4PAAA 1U09A 2HFSA 1VLYA 3M4XA 2J0QD 2K1RA 3W65A 2P9GA 1HKAA 1JKHA 2Z2LA 4JOUA 2IBOA 5KFIA 2CPYA 3HKWA 1KLMB 4CLYA 1TUWA 3JQKA 2AV5A 3FMBA 4LBPA 4WYLA 3VAHA 3TAMA 3PZPA 1U0SA 5KFJA 4QR1A 3UD3P 3CD6S 4R5PB 2VFSA 2VICA 2ASLA 2F3JA 3H5SA 2K2PA 3PHTA 4NLUA 4O4GA 4USTA 5HQ8A 5J1EB 4JI5F 2DGUA 3QATA 1QSLA 3V6DB 5H9EK 3R3TA 1VGYA 2VG5A 4WFXA 5KFUA 5H9EJ 4PQUB 4DUZJ 2XZWA 3U1NA 3OFHA 4TY8A 2DXFA 2NPFA 1S1UA 3CD5A 4BC9A 2GA7A 3TQ1A 1RT6A 1QAYA 1SJRA 4ECSA 1ROFA 2RH3A 3TR5A 4ED2A 1U49A 5D4NA 2MTLA 1LXNA 2FJEB 3OFEA 4U6PA 1XNQF 4ZDNA 4CM0A 4IFYA 1RT3B 3R2DJ 2XM3A 2B6AB 2X1GA 1YLXA 4DF8A 2E1AA 3K59A 4ZKAA 1NK5A 1SL1A 1FXLA 3TZZA 5KT7A 2KM8C 1RACB 4YUDA 2PI4A 1WNEA 3MEDB 2ALZA 3I9ZA 3SZ2A 3QAEA 1LW2A 2AZ1A 2QA1A 3LWLA 2MGZA 3GIRA 3UO0A 4LQ3A 2KT2A 3TX0A 1S6PA 4P6QA 4RKUC 3CSKA 5KOXA 4C8OA 1F5BA 3BGLA 4NXNF 3RRHA 1FXDA 4P75A 5KT5A 3KHGA 3SCKE 1SJFA 2UUCJ 1FJGF 1HBOA 1RWPB 1SBRA 1SQFA 2KHDA 3SFGA 4ETZA 4F4AA 4IR1A 1M0SA 1D8ZA 3PACA 3N5BA 3IRXA 4GKKF 1VRUA 1XNRJ 1Y3KA 4M5JA 2UUBF 3OSPA 1R8CA 1YRTA 2HKEA 2FY1A 2DISA 5JVHQ 4X4VA 5GVQA 2IVYA 3RAQA 4ED1A 4ZN3A 1HWUA 3LW5C 1ZA2B 1S0OA 2FQQB 3LUYA 4DPTA 2FVCA 3RB0A 1FEEA 4OLPA 4W98A 5CYQB 3CCZA 5HBMB 5LMNJ 1VQPS 3KTQA 1R8PA 3NNCA 1NH8A 3LGHA 4B9NA 2CJKA 5K8PA 4B9TA 2DR8A 2EFGA 5KG3A 4H4KA 3S01A 1KQFB 1ZOTA 3T3FA 4N7TA 3VVTA 3FSYA 4Y0FA 4A8WA 5LSRA 3W2WA 2CZ4A 2HHQA 1DTQB 3V6JA 3NKYA 1HNVA 5IWAF 1MN7A 2IC3B 5IQQA 2HVHA 4ANEA 2LQ9A 4I2PB 2DT9A 3FK4A 1SL2A 3ISNC 1NDKA 4OX9J 2YTCA 3RW7A 4A8OA 5L38A 4F8RA 3DLEB 5DDOC 2D3O1 2UVRA 3EICA 1UVJA 3I87A 4KBIA 3MM5B 2J7UA 3TI0A 1VQOS 1IKVB 1BC6A 2MQNA 4RW6B 4USMA 1R89A 1C4AA 3UN3A 2BANA 3AQPA 1KS2A 5FDLB 1RTDA 4ECUA 3LPEA 4ECXA 4CH0S 2M2BA 4D3GA 4LF7F 2LQ5A 4C3KA 3B6BA 1O8BA 2ZDOA 2X3DA 4KC5A 1DBDA 3IRXB 1FVSA 1ZA1B 1S1WA 3KK3A 4TKTA 2EFQA 2ZVSA 1FTRA 2AW0A 2GQ2A 3H2UB 3JSRA 4DV4F 1RQ0A 5HMXA 1RT2B 4DV3J 1SJ3P 2BE7D 1QY7A 2EKYA 4ZJQA 1NDPA 3EVMA 1VHFA 1S1TA 1FCAA 3A13A 1X4FA 5DLFA 1TK5A 2HHHJ 2YKQA 1VFJA 3CCSS 1REGX 2ZH9A 4M94A 3AJ1A 2ZHOA 1XN9A 4ZCMA 2HIQA 2RUSA 1LV5A 2SXLA 2IRXA 4NLVA 1SVDA 4JUZA 3LF0A 2W9BB 2Q43A 4USWA 1WOOA 3MPYA 2G2OA 3QO9A 3PX6A 1CPZA 1EETA 2JC1A 2CDRB 2B9YA 3M2RB 1IUJA 2A0FB 3U7JA 2RQCA 2KFNA 1N4LA 4OV1A 5GAHU 2FB0A 3M32B 4IH6A 2JC0A 1RAAB 4FYVB 2RRAA 3G6YA 2XS5A 4USJC 2HW3A 4DG1B 3NWGA 3Q23A 4NYOA 2YWGA 4CLPA 1R0BG 4ZP7A 4DQRA 5C42A 2M8DB 2QYCA 1RI7A 1S12A 5L46A 2LCWA 3OL7A 3FVYA 1WEYA 2HAIA 3PRDA 1EZZB 2VKZG 2ASDA 4NLQA 4DUYF 3OUYA 2GVZA 1S1XB 1BHNA 4HLBA 2UVWA 2BJ9A 4EU0A 1MMNA 4I6AA 3KLGA 4K4WA 1J5EJ 3N6LA 1TAQA 3LGNA 2CQ1A 1ELOA 3NGRA 3V5RA 5EWEA 1TV6A 1ZYQA 2RAQA 2OPPB 2R7XA 4Q44A 4DQSA 4FVMA 1L3VA 4CH1A 1IKYB 3RJMB 2B0GA 3ENWA 3QJLA 2LECA 4ZP8A 5AXNA 4LIWA 1EARA 3V6HA 1DTTB 3POTB 1S1VA 1RAGB 3BPSP 4IOBA 2GIRA 3BQ0A 1JJ4A 1DQ8A 3DOMA 2HWTA 2LU1A 2HFZA 2XMWA 1BD6A 5EUHA 5K9FA 1N5YA 1R0AB 2Y8WA 3PEHA 1F9FA 3KUHA 3M32A 2VH7A 2AJQA 4LJMA 1QSYA 2GQCA 1VRUB 2DNZA 1CULA 4WKYA 2CPIA 4C8NA 3K0JA 1MROB 2E5IA 4A48A 2WVFA 4RW4A 4F0MA 2MKKA 3MAAA 3FSIA 1OIAA 3PJWA 3OQ2A 3MPWA 1VIOA 3A12A 3G96A 1HNWF 3R5DA 4MKVA 2Z2YB 5HO4A 5CAAA 3PR5B 1QTMA 2HEKA 1M5HA 4B3SF 4KB7A 4LF8F 5LM7E 1Q1KA 4L73A 5AE2A 2B5JB 1FWLA 4DQPA 1WF1A 2DNYA 3ILJA 4LBHA 2D9OA 4TU8A 3MR6A 1YSJA 5LMUF 4URGA 1WD6A 3NGSA 2CPEA 3MURP 5B0GA 3A8JA 4RNOA 1JJ2R 1PSDA 3FKBA 1F0XA 4RUAA 3BKTA 1REVB 5L1IA 4C8MA 5BYRA 3UDLA 1R31A 1MW7A 3IC1A 4X65J 4ES3A 3X1LB 4OV6A 1HARA 3P49B 3MD3A 1RT5B 4MAKA 1VR6A 4IFVA 2MKHA 1XMBA 3D2WA 4FXWA 1TMMA 2COLA 2J0XA 2ROEA 1KEKA 3KJNB 4YHHF 1YJWS 4DSIA 3R7BB 2AX1A 2HQFA 2QN6B 2H65B 4HEA9 5L8RC 2GO9A 4YDDB 4A8QA 3I5CA 3X3UA 1VQ7S 1WF0A 1SIZA 5F3TA 1LQ9A 2NLWA 4TNOA 4OI1A 2AU0A 2ZOGA 1FNXH 1KQSR 3I82A 2E9TA 2OEKA 3KNAA 1NJYA 1VIXA 3EPIA 3OVSA 1HNIA 3CJKA 3CDWA 2AYGA 3QPIA 2ZH4A 1VYAA 3TUPA 2Y3YA 3O2IA 4WPAA 3QT8A 3ZTRA 4K4SA 4ZVQB 4C8KA 2MJNA 1PG5B 4J90A 1YI2S 1QE1B 5C24A 2V4RA 3Q8YA 4HDHA 3IS9A 3MD1A 4C11B 4K4XA 2ZD1A 4DV7J 1D0EA 2DTJA 1HNXF 1H3DA 3CJTA 4HT7A 2R2UA 4M8LA 4PG7A 2V8VA 2U1AA 4ZPTR 2KG1A 4U95A 2B4UA 2QMWA 5BR8J 3OXFA 5CD4H 4J9LA 1CC7A 1NU4A 3BBCA 4FKYA 4ZVOB 1XMOJ 2UU9J 2W4CA 2YNIB 1KBRA 2M8HA 4PXDA 3UN5A 3OXLA 4M5NA 3G71S 2VQFF 4OHXA 4E8UA 2OD6A 4IRKA 5KFDA 4F4XA 1YJNS 3QFHA 2ASJA 4RNMA 4L6V3 1UJ6A 1REVA 3SQOP 2KG0A 1H38A 4J9SA 4IRCA 1T3NA 2CWXA 2LFVA 3C6UB 2PFFB 2B4OA 4DXLA 1PJ6A 4DFJA 1S49A 2K06A 3QAUA 4HHUA 2QGFB 2XSJA 3MMAA 1CVJA 5D0RA 4ICLB 2RILA 4LFAJ 3BN7A 1Y4ZB 3MCOA 4ZMMA 3EZOA 5KG4A 2V68A 3FBFA 3MEDA 2K3IA 4TU7A 5T7LB 4OYMA 3KK3B 2LXFA 3JSMA 4OZ2A 3NCQA 2YKMA 4PQAA 3FZ2A 3PHEA 2EI5A 1HQEB 3E51A 1K9MT 4QYZK 2DIVA 4P2SA 3KLGB 5GMDA 1T11A 1HNIB 3DOMB 2KI2A 4Y2AA 4CO1A 2OKQA 4OHWA 4Q8FA 4YY3F 1J5OA 3CC4S 3ZTOA 1XMQJ 1U1PA 4DV6F 2RQKA 2MZJA 2V2KA 3AXMA 4DX7A 3W1YC 4DX6A 2ZM6J 4GVLA 2E66A 5DZ7A 2E1PA 4RNNA 1UMJA 2WVEA 4ED3A 4NLRA 1AUSL 1TKTA 4LBIA 5M2PA 1RE1B 1FKOA 3AB4B 3NS5A 3MCMA 1XJWB 2QMXA 3PJ9A 2OFGX 1O5JA 4KSEB 1DLOA 3DDNA 3IR7B 4ETXA 1RAIB 3DM2B 1XC9A 4LF6F 2CQDA 3W8PA 1EKRA 1WC5A 2FDNA 2ZUAA 4NA2A 3C66A 1FFSB 2ROPA 3R7NB 1W25A 2RUGA 3J80U 1S4FA 1V5IB 2M70A 4G1QB 4E98A 5KFOA 4CIOA 5DETA 2VJUA 5L9NA 2VA2A 3UDCA 4ZPAA 4P2FA 3M8SA 3I0SA 1FT8A 3AA9A 3CNQP 6AT1B 1KLNA 4F02A 2KT3A 5ETOA 1RB0A 2I5JB 4URQU 2HFOA 4LF4J 2B5JA 1U47A 1CEZA 1BQNB 1WG5A 4K4YA 4OJGA 4F25A 1H2TZ 4N8NA 2DK2A 2HURA 2WW8A 1XR5A 2ZFHA 3CDBA 3OPKA 4ICLA 4KE5A 1BQMA 4R0EA 2FHJA 3MMAB 4CLSA 4DS4A 2BXJA 3MR2A 2HNDA 2I6WA 2YH1A 4U7CA 1G1XA 5D4LA 4I7FB 2HHXA 1C0TB 1FE0A 1PC5A 2DNHA 2AYEA 3MMCA 4DL4A 2OSRA 4KY3A 5A0YB 4YS2A 1WKKA 2R4FA 2Z57B 1BGXT 3CIZA 8RUCA 4QWCA 4LMZA 1EB0A 2GO8A 3BGRA 3LP1B 1AA1B 2VQEF 4J9OA 1UL3A 2LQJA 3BF4A 3B78A 4J9VA 4WE1A 5DJBA 2IMWP 3RG6A 2P6SA 2V34A 2KYXA 1UJ5A 1VK8A 2WOMA 4ANDA 5IS2A 3GV8B 1IKYA 2V8DA 2R42A 3MM6A 1PAEX 4WFYA 4OLOA 1S1WB 5I3PA 3TOQA 3F73A 4C11A 2DNQA 2YWWA 5ETTA 4G3IA 2ZUGA 2QT7A 4P7VA 3T5HA 4X66J 2B4VA 1GXLA 2RF2B 4ZP9A 4A8KA 2E5LJ 5D0HA 1NXIA 2B4PA 2DHGA 2KVIA 2JL9A 2VPWB 4ID8A 1VC6A 2YQ3A 5B0AA 2W8KA 1QAIA 5GMKa 3FC9A 2HHUA 2MQ8A 4WJBA 5IQ6A 1Y10A 3JSBA 3HP6A 1HPZA 4MMOA 4U8VA 3B4DA 1RAJA 3TX8A 1RK8A 4O4RA 3BO3A 1IR2A 3MMJA 5C42B 4OZ3A 3THTA 3M8ZA 4FYWB 1D09B 4ZVEA 4ZVUB 2ZBCA 4O3QA 4DPWA 3V6DA 1N6QA 2BV3A 3V81A 5F8NA 2GVDB 1S6QB 4BHQA 4DS5A 1IBMJ 2RMLA 2EK1A 1MMLA 2G1DA 3SCIE 4RUHA 3AOBA 3SCJE 4PUOB 3US5A 2BMBA 4AUKA 3PRBA 4TLQA 3Q83A 3QIPA 5G4DA 2L9NA 2NXEA 3EXYA 1R43A 4AL6A 2XMAA 3VAMA 2R7OA 3B82A 3AJDA 2XS2A 4ILLA 1TUGB 1YVFA 3GYXB 1DJ0A 4H4OA 1U8WA 1AUDA 3BV8A 4I7FA 2MKIA 2HBQB 1T9UA 1CLFA 1X60A 3MM6B 1UWBB 4RW9A 3PIOQ 1T8EA 1T9XA 4S0MA 4HVZA 1UPMB 4LFCJ 1BQXA 1XMOF 4QYZJ 2R7UA 1HBMB 2UU9F 2H48B 1X5SA 2XY6A 4DV5J 2XNQA 3IAS9 3M2UA 4LRBA 3M1VB 5B09A 3EZ5A 1FRMA 2QLFB 1PBUA 3CDAA 1KKHA 3HSJA 1YDLA 3S1TA 1WEXA 2MYFA 4ED7A 3HF5A 4HI2A 4F26A 1EKSA 5IM0A 3KDNA 1FKPA 1ZZFA 2O66A 3MAAB 3OHAA 4C3MA 1FRIA 4F7VA 3LWMA 1TKDA 2HBZB 4CYUB 4OYIA 4EYIB 2AGPA 1A9NB 1NB7A 1YBUA 1MMDA 2Q6BA 3U1MA 2C2ZB 1C0UB 2WRMA 1R0AA 3DLBA 4TY9A 3PO5A 3A4TA 1YK9A 4AXIA 3V2UC 2YX7A 2C2MB 2DHAA 5G0RB 2N7YA 5E7OB 1IN0A 1IKWA 4NASA 3OD2A 4X4TA 1RAHB 3K58A 2ZHBA 2GJFA 3OTBA 3MEKA 1F60B 2CQBA 3WDOA 1HNVB 2R8IA 2ADBA 3WQPA 2QMUB 2XMUA 3K5LA 2ZJRQ 2YPZA 3PW2A 1N88A 1H98A 3GG1A 3MPUB 4O3NA 3TA1A 5IT9U 4M5IA 3QIDA 4DN0A 2MLXA 2AZ3A 2RDIA 3HPOA 1VOMA 1BE4A 1D3WA 1I3OB 1CS4B 2H5IB 4FS1A 3FDSA 3DLGB 4KPCA 1VQ8S 2JEIA 4JI8J 3LPYA 2E29A 2LEAA 3BGFA 2J9DA 2P9CA 5F9NA 4JV5J 4GKJJ 1FDAA 1NEEA 3R9LA 5EX0A 3TYTA 2VDHA 3DDKA 2RKIA 4J91A 1PC4A 1NNDA 1WDDA 2J6SA 1JXEA 2N4DA 1N56A 3V4MA 4WF9Q 5IWAJ 4LIRA 4RBVA 4ED5A 4KKOA 3EZUA 2FJAB 5AXLA 2OSQA 4IKAA 1Q7LB 2HAFA 3LQVA 4YR2A 1PILA 2XMVA 4IG0B 2FJDB 3D3CJ 1FX2A 4ECYA 3LOUA 1YJUA 1U1KA 2W25A 4Q0BB 3FNNA 4OQJA 2HVZA 1S6PB 2HHTA 1EP4A 3ILLA 4K5SA 1H72C 4J9QA 2AYBA 1TAUA 4OYWA 2BE2B 3RBZA 1NK7A 3KDOA 3DOLA 3S6EA 2I1RA 5FD1A 4X64F 1FDNA 1Q8KA 3M9OB 1S9FA 1UEUA 3DKDA 3NOCA 3TQEA 2NYIA 1AFIA 3VCDA 1FVQA 2RIJA 3I5AA 4JYAF 4F0HA 3GQCA 4C8ZA 2OPSA 3OTOJ 1ITPA 1GT8A 4OX9F 1SKUB 3NWRA 3M8QA 4RUCA 1N5TA 2DPJA 3J7YI 3DM2A 3AOCA 4BC7A 3GONA 3IP0A 1S1UB 4QR0A 2H1YA 2J8AA 5BJRA 3ZTQA 3AHPA 3OFGA 1VQYA 3PV8A 3RAXA 2WHOA 5DDRC 1Z2LA 2WSEC 1S97A 4RX6A 1FNOA 3TVKA 2J6UA 3DFEA 3DRPB 2ZVIA 1IKXA 3CJ0A 1B0VA 1JLCB 3DHXA 3DRPA 3THVA 2V8PA 2QJ3A 4TLRA 4F3MA 3DCAA 3NNHA 3EVWA 2J7KA 1W2BR 2GC8A 4YB6A 2XTJP 1NJWA 2HVEA 3ELHA 2QO3A 3M30B 4IG3A 4YB1P 2NYHA 2O67A 4DR1F 5KT4A 1TU0B 4JI7J 1UEKA 3MTKA 1N52B
chains in the Genus database with same CATH topology
1HD0A 3FSXA 3QLHB 3SFUA 2ZH2A 1QSSA 1XNRF 3Q2SC 2CPFA 1X5PA 3MWBA 2YY3A 5KFMA 2JDJA 2LXIA 2KKHA 1BWEA 1RT7B 4NLDA 1M5OC 3RBEA 2D7SA 4DOZA 1Z2ZA 3D0HE 2BR0A 5I4MA 3CE8A 3N79A 4WZMA 2D41A 3QMQA 1NZAA 3KNGA 1TP7A 1RT1B 1LXJA 2VG7B 4KO0B 5KFTA 3HXMA 2XMKA 3CD7A 3BJYA 1C0UA 5F8IA 2X1FA 4OZ0A 3RB3A 3Q2TC 1U1RA 5M2RA 4X4NA 4FF2A 1X4CA 3LAMA 2VC1A 4DWIA 2FGCA 2KDOA 3GWCA 5J2MA 3HKZD 3MECB 1OQ6A 4JI0F 1JWWA 1FF2A 4TU9A 2L48A 3MPVA 2WONB 5L9XA 3BDPA 4Y2IA 4ED6A 3OLBA 1B64A 1FK9A 2ABYA 2RS8A 2N3OA 1K1SA 2DNMA 3IBWA 3TANA 4QWDA 2ZOMA 3SDEB 3GYNA 2AJ0A 2MZTA 4DFPA 5T14A 4KV8A 4UQGA 2DGTA 2RS2A 5KFGA 2DGXA 1NRKA 5IZHA 2DR7A 4DR3F 2F8MA 2EFVA 2HHXA 2W7OA 2UUTA 2C28A 2IYIA 3BR8A 1LFWA 3H2VE 1C1CA 5DLGA 2C2DA 4V19J 4N5SA 2G0CA 1UVNA 5LSOA 3HHDA 1T05B 5KFWA 3PKMA 3NCPA 3ZZOA 1FA0A 5DS7A 4K4ZA 2XCAA 2PE8A 1S1XA 2DO0A 2WSCC 3DXSX 4Y2KA 1IKVA 2EC0A 3DYAA 2L08A 4B17A 1KHWA 5CYJA 1JLCA 3UR0A 2R7WA 1KC8T 2XMJA 5HMZA 3MR5A 1JLGA 1FDDA 1WACA 4IYQA 4WFNQ 3P49B 2W7AA 4MYTA 2KJWA 1GTHA 4X4SA 4DL5A 4DSKA 4QIFA 4KFBB 1UEVA 3OV7A 2FVPA 3G9CA 3J7A1 5GADU 3OJUA 5J1EA 3OW2R 1N0UA 1U1LA 1WI6A 4QIEA 4XIUA 3OBIA 1HBNA 4DBQA 1CSJA 1XWLA 3OR1B 4JI8F 5L39A 3I56S 3MR3A 2DD8S 2QFJA 5A8KA 1X9SA 2IM3A 1UA0A 3TAMB 2MZQA 1S9EB 4I1TA 3PW5A 1S48A 3DMJB 4ID5B 4CZCA 4Z2XA 4DR2F 2FLLA 3QWPA 2BOPA 1GXUA 1HWIA 4KPYA 2A3JA 3MOJB 3HHKA 2ZNZA 4J9PA 1SI9A 3IRWP 3AJ2A 3DLHA 2LDIA 4JI6F 1FK9B 5SZTA 1XMQF 2ZKUA 1RYSA 3N01A 1TVRA 1MSWD 4NPOA 2XG8A 2R8KA 4DDFA 2IM1A 4Y2MA 2X1BA 2F40A 2YWEA 3I32A 2B3TB 1JNZB 1JLQA 4KGKA 2IJNA 3ISND 1C0TA 3MMCB 2V0NA 4K2XA 3PX4A 3QZ7A 3GILA 4YR3A 2JLFA 3EGNA 3G8QA 3MM5A 1O0PA 4CCHA 1HNZF 4OL8A 2KZMA 3DXBA 1A7GE 2KXHA 2P9EA 2YVSA 4WXOA 1MU2B 5AXMA 5HROB 3LGMA 2CVEA 1RT7A 1XEZA 1VRTA 2CG4A 4I2PA 5KFXA 2A2DA 1PGZA 3ZZZA 2BDPA 2A1BA 3FEZA 2KXNB 4TQSA 2JOQA 3DMJA 4ID5A 1IXKA 4YB7A 3NAIA 3MM7A 4QU7A 1OS5A 2V4QA 4QCLA 1XK8A 3HX9A 3RU0A 3JB9k 4PG6A 3TUJC 3OR1A 4RW6A 2AX0A 2LXUA 1H7XA 2J9CA 2MQQA 3ONQA 1WELA 4RU2A 4L3NA 1NH7A 3HDSA 3OR2A 3PDNA 2XLJA 4JV5F 1S6OA 5G0RA 2Q6CA 3TVZA 1KTVA 1VI7A 4X62F 2ZH8A 3EX7B 4CO5A 4DL3A 4PG5A 3S7RA 3JYTB 4EYHB 3BB5A 2XBPA 4BWMA 5LXYA 2WBMA 3M2RA 4IOCQ 5GAHI 1NJZA 2FHKA 1GXTA 2N4CA 2BVZA 2V94A 4CO3A 3K5PA 2LQBA 2YNGB 4H4MA 2R9LA 3PX0A 1WHXA 1C1CB 4AQYF 2HNDB 5B0EA 1YWXA 3CCUS 2VFTA 3MFIA 1KR4A 1D9AA 1SIWB 1W2IA 3B4MA 5AE3A 3ETOA 3CCQS 3WC0A 2XS7A 4PXCA 4U7UK 2EFNA 4EO6A 5F8JA 5KG5A 4IQXA 2APOA 5DQGA 2CJBA 2YNGA 3R5AA 1N8RT 1QVFR 1JLQB 4H4OB 2ZH5A 2WB1D 3BZQA 5FDLA 3NGKA 4EZ9A 5CHCB 2J7WA 2DGWA 1UA1A 4KTQA 4NLGA 2HHSA 3OL9A 1R3NA 2ZHAA 2E44A 2RKIB 3MEGA 5JJBA 2JHEA 3NAHA 3G86A 1RTIB 4LSLB 2V9KA 4WKRA 2WBRA 4K4UA 5JVGQ 2FJXA 2MPUA 3CCVS 2Z0GA 1X9MA 5HN0A 1U2FA 2KO1A 3PIPQ 2W9AA 5BR8F 4KGMA 1QE1A 3GFXA 5DO2A 4EFAC 4RBUA 2R2SA 1FNMA 1KNZA 1HA1A 1MWYA 4IO1A 4DL2A 2M4MA 1KLMA 5AXKA 4ZHRA 3HVRA 1KN6A 1L3TA 3GFHA 3CEDA 3GV5B 4A4JA 4CO4A 1TKZB 3Q0AA 5E3CA 5CYQA 2KFYA 3CPWR 4KT0C 5L1KA 1FRXA 2YX4A 4G1IA 1HBUB 1FJCA 2EK6A 1YGYA 1X7VA 3E01B 1SV5A 4RW7A 2NPIA 3DRSA 4DMZA 1JK9B 3R1LA 4G3IA 3WBZA 2E5LF 1Y0HA 3OLAA 5J2PB 1NKEA 3J81Y 4N76A 3I96A 3C46A 2R7TA 1HMVA 3GB0A 2IAJB 1HWLA 4NZ6A 2E5HA 2VG6A 1UAWA 3M6WA 4NA1A 2FHMA 2UZAA 4PXEA 4ALZA 2N7CA 3BSOA 2C2RA 4JI1F 1VRTB 4NCBA 4X4UA 2FC8A 2Y1JA 4C4WA 1FD8A 2HVIA 4J9RA 1QUVA 2BRKA 1Q16B 3MM8A 1HL6A 5KFLA 1X9WA 2ZDPA 4HI1A 5KFHA 3MEEB 5CCMA 3KLFA 4C0BA 5HMYA 2ZH3A 3MCSA 2XSFA 3CGIA 3D1OA 2E7WA 1U1OA 2C3PA 1U48A 4O3RA 1KVIA 4XDCA 3EYZA 1SKWA 3MECA 2DCUB 3JAMY 5LSLA 1V3ZA 4MIWA 3MF5A 1VQNS 3BM7A 2HWIA 4NCGB 3BQ1A 3SSSA 2JEFA 1C4CA 1CQMA 5THWA 4NA3A 2LA6A 4AL7A 3I5BA 1N6QB 3CJ5A 5KFPA 2MKJA 4K4VA 3VWSA 3GG0A 3NG8A 5E0OA 3TVYA 3ZFVA 2CQPA 3M6XA 4RNFA 2LA4A 4FS2A 1HBUA 2M3DA 3NNAA 1Y00A 5GAGU 2HNZA 4R8UB 2I9SA 3MXHP 4N8OA 2PO4A 1SUQA 2VFRA 2RF2A 2XCPA 2VFUA 2FD2A 3KK2A 1S79A 2ZH7A 4PRFA 5KFYA 3U27A 1T05A 4E0DA 3HHLA 4QYRA 5FLXY 4ECRA 3I4PA 2MQOA 4DV5F 1HYSB 3OTOF 2GMJA 2YNFA 2JEJA 3HJFA 2PDAA 1MU2A 5HROA 4ES1A 1VBXA 1IKXB 1I1GA 3PEJA 3A8EA 5KT2A 1T94A 2OTLS 1S6UA 2VB6A 3VAJA 1E6VA 2CPXA 5EHHA 3EGWB 1E6YB 2PT0A 5KG2A 4BWJA 3H20A 1HW8A 2ZITA 2GMHA 4IFVB 3DI6A 1URRA 2DRBA 5K14A 3W2VA 1JX4A 1I94F 2KXFA 2I2YA 1CQNA 2DITA 2KU7A 2E5GA 4HH0A 1C2PA 2EG1A 4X66F 1T3OA 5LXRA 4B3TF 2PI5A 2F1FA 2JVRA 5CZXA 5IFMA 1E6YA 1KOOA 1LW0A 3KLFB 2FLPA 3CCJS 4YFUA 2VASA 2G13A 4QIWD 4FYDA 1FTCA 2CQ0A 5DG8A 2BQ3A 1U7LA 5C24B 1Q82T 2LEPA 3LAKA 1MROA 2PMZD 5J2MB 1WTFA 4WYWA 3TA2A 2P6TA 5LJ5Y 4IRDA 2IYGA 1S77D 4NRUA 4ZLPA 1R6YA 4JBCA 1KQKA 3Q22A 1SUQB 3CO9A 3KWMA 5J2PA 1DURA 2GFFA 3KKFA 3QIPB 5MAOA 5D3GB 3GFYA 4NLOA 2HRYA 2X3GA 1TZ0A 3IG1B 4Q2LA 3DU5A 3MDFA 5F9LA 4QBUA 3T5KA 1IKWB 4QWBA 1M90T 3QGGA