3PIPQ

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
SHYDILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGRFIGQRNDRKKAIVRLAEGQSIEALAGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pipQ00
2CQDA 4RU2A 3FEXB 1NJIT 5MLCV 3UWTA 2NLWA 2MY8A 2LQ5A 3ZZZA 1U1LA 1HD0A 3CUNA 4LMZA 2DH8A 5CYJA 1VBZA 1OPIA 4IOAQ 2DGVA 2MKKA 2OTLS 5CXTA 1WEXA 2G0CA 1WG4A 1KQSR 1VQ5S 3S8SA 3PIPQ 4CQ1A 2MQLA 3NS5A 2DNOA 2N82B 3CXCR 2FPHX 4YOEA 2RT3A 2D9OA 1L3KA 1VQ8S 2CQBA 1VQMS 2HGMA 1BY9A 3B4DA 2U2FA 3SXLA 2F3JA 2DGOA 2JRSA 4C7QA 2RUGA 2V94A 3RW7A 3CC7S 3MUVP 2MQMA 1K9MT 2KVIA 3VAIA 2ADCA 2U1AA 1DHMA 1WF1A 2KG0A 2ZJQQ 2I38A 2VOOA 2LA6A 2MZ1A 1VQPS 2MPUA 1FJ7A 3CD6S 5LSLA 1DRZA 2M52A 1VC5A 1A9NB 5JVHQ 1FXLA 5DDQC 2LEBA 2CQ0A 1YJNS 2FC9A 2M70A 1VBYA 3EGNA 1R8HA 3EGZA 2QA4S 1XN9A 2HGNA 2X1AA 2MGZB 2CQHA 2ZJPQ 1WG1A 4BS2A 3G8SA 1X4FA 3CCUS 2J76E 1SJ4P 2LECA 2MQNA 3L3CA 3CPWR 4C4WA 2RU3A 2DNLA 4WIIA 1VQLS 1N52B 5GADU 1RK8A 1FT8A 1WEYA 3HI9A 2G4BA 3TP2A 3R27A 3UD3P 1FNXH 2LYVA 1P27B 2DGWA 4OZ0A 2F9DA 2F9JA 2DHXA 2MKCA 3I55S 2LMIA 2KYXA 2KM8B 3NNCA 2MQQA 2CJKA 2LEAA 2LA4A 3SDEA 3DXBA 3P3DA 2RS2A 3R1LA 1M5VC 1OO0B 1YJ9S 1VQ4S 1WF2A 1JMTA 2MMYA 3NMRA 3VAGA 1U1QA 3VALA 3MD3A 3OW2R 1NO8A 2KXNB 1SJQA 4C0OC 4QU7A 1M90T 1WHXA 2CPYA 2DGTA 2MZQA 3THPA 3MUMP 3CMES 1SXLA 1K73T 2LXIA 3LPYA 1WI6A 3BS9A 3S01A 4V19X 1VC6A 3CCRS 2AYEA 1H2TZ 3R1HA 2CQ3A 2CQCA 2KXHA 1WEZA 2RQ4A 5DDOC 3CF5Q 4Y00A 4CH0S 4M5DB 2DNHA 1HA1A 1FO1A 2XB2D 4WCEQ 2KFYA 2XS7A 2M4MA 4FXWA 2MSTA 2B0GA 2HYIB 5LJ3Y 2RS8A 5H1SV 1M5OC 1JJ2R 3TYTA 2A3JA 1U2FA 2E44A 3DLLQ 1DBDA 2M7SA 1U1PA 1N88A 4TLQA 4F02A 4TU9A 3VAHA 5CA5A 2FC8A 3US5A 3ULHA 2MZSA 2MZJA 1YHQS 2ADBA 1X4AA 4YUDA 4LIRA 4CH1A 2HVZA 2FHOB 2L9WA 2MZRA 4PR6A 2LXUA 5LXYA 4IOCQ 2DGXA 4QPTA 3TO8A 2L08A 2OSRA 2O3DA 2UP1A 2DHAA 1U1RA 3P5TL 2K3KA 5GAHU 1KC8T 3BO4A 2AYMA 1UW4A 2DNGA 2DNPA 2JX2A 5ITHA 1FJEB 5IM0B 1QM9A 4Y0FA 1U6FA 1UP1A 2CQGA 2NZ4A 1X4HA 2M8HA 1YWXA 2KRBA 1R8PA 3IRWP 2CPZA 5IQQA 1FHTA 1FJCA 1ZZFA 2XSFA 5BJRA 4J5OA 2DNMA 3MD1A 3THTA 1ZZNA 4WKRA 2CPHA 1UFWA 1DZ5A 1OWXA 3V4MA 3JB9k 3CCLS 2XNRA 3EX7B 3CCSS 2RNEA 1WHVA 2D9PA 3S7RA 1A7GE 4WFNQ 5GMKa 1D8ZA 2DO0A 1NU4A 1U1NA 3VF0B 2RRBA 3CTRA 2JVOA 3MXHP 3CMAS 4W92B 2OTJS 3VAJA 4IUFA 2HZCA 2DNYA 3UE2A 2CPDA 3BEGB 3SMZA 2YH0A 1F9FA 4Z2XA 5IFMA 2E5HA 2MHNA 1VQ6S 2CQ1A 2GHPA 2CQIA 3CCES 3HHNB 2MXYA 1U1MA 3CULA 2DNKA 2RQCA 5HL7Q 2ERRA 5LSOA 2AYGA 2RVJA 5DM7Q 1X5SA 4CIOA 1P1TA 2DO4A 1WG5A 2E5IA 2MSSA 1X5PA 1M1KT 1CVJA 4F25A 1SJ3P 2M88A 1D9AA 1YTYA 1WI8A 2CPIA 3H2UB 2KT5A 2N7CA 2G1DA 3D2WA 1WF0A 2MKHA 4ZKAA 2AD9A 1VQKS 2XNQA 2I2YA 2MGZA 3UCGA 3MI7X 3G71S 1QVGR 2M9KA 3MUTP 2DH9A 2JVRA 3NS6A 2LKZA 2DGSA 4P6QA 5HO4A 1YJWS 3PIOQ 2DITA 1W2BR 1H2VZ 2EK1A 1Q7YT 2J0SD 2MQPA 1U6BA 2FY1A 3Q2TC 3J7ZT 2LCWA 1O0PA 2YKAA 3B4MA 1M5KC 1WWHA 2DB1A 2QFJA 2DISA 3CCJS 1Q86T 2OSQA 2DNRA 5DDPC 2KU7A 2N3OA 3RW6A 1IQTA 3CCQS 2MB0B 5GAGU 4FXVA 4A8XA 4WFAQ 2DIUA 3G4SS 1X0FA 3G9CA 2CPFA 3U1MA 2JWNA 5EN1A 1X4BA 3H2VE 5DDRC 3NNAA 2DK2A 1SJFA 5D77A 2VOPA 1X4CA 2DHSA 4U67Q 4IO9Q 4UY8T 4F26A 4W90B 1VC0A 3CC2S 1VQNS 3UCZP 3VAKA 4ED5A 2DNZA 1PO6A 2J8AA 2M0GB 3ZZYA 2OIHA 1U1OA 2KHCA 2DHGA 2Q79A 4TU7A 2MKSA 1JJ4A 2KN4A 5LXRA 1B7FA 3UD4P 2MJNA 2BOPA 4EGLA 3SDEB 3U1LA 4ERDA 2CPJA 3BO3A 3BO2A 2X1GA 2DGQA 2VONA 1YI2S 1VQ9S 4WFBQ 2K8GA 4TU8A 3G8TA 2HGLA 3P49B 3LQVA 2N3LA 5JVGQ 3N9UC 3VAMA 3NNHA 5FJ4A 1QVFR 1KOHA 2KG1A 2EK6A 1X5OA 5GVQA 2E5GA 2WBRA 1HD1A 2CQ2A 2DGUA 1KD1T 2MY7A 1U1KA 1YITS 2BZ2A 2CPEA 2VODA 2DNQA 1UAWA 3CCMS 2D3OR 5LJ5Y 1YIJS 1S79A 2CPXA 1AUDA 3K0JA 3G6ES 3Q2SC 3UCUP 1H2UX 2GO9A 5DETA 1S72S 2MKIA 3CC4S 2PEHA 2MKJA 2SXLA 1HL6A 1VQOS 2KH9A 3I56S 4LJMA 2CQPA 4UQTA 2L41A 3G96A 1SJRA 2YTCA 3P6YC 2EVZA 1G2EA 5IM0A 2X1BA 2KRRA 2OJ3A 4PRFA 1Q81T 3MURP 2XS2A 2J0QD 3IWNC 4YB1P 1URNA 1N54B 1X4EA 2M8DB 2DIVA 2YWKA 2MJUA 2MYFA 1K8AT 3J7YU 2MQOA 2DNNA 5GAEU 1H6KX 3MDFA 1X4DA 1Q82T 2AYBA 1M5PC 1VBXA 2E5JA 4OZ1A 1X5TA 2KXFA 1WELA 1X4GA 3CCVS 2XS5A 3FEYB 1PGZA 1WHYA 2KM8C 1VQ7S 2RRAA 1JJHA 2QEXS 4QU6A 1WTBA 2DH7A 2ZJRQ 2X1FA 1KOOA 2KI2A 4QQBA 3MOJB 1WHWA 2YH1A 4WF9Q 1N8RT 1ZH5A 3VAFA 5DM6Q 1OIAA 2MZTA 2M2BA 1RKJA 4PKDB 3S6EA 2PE8A 2CQ4A 5D78A
chains in the Genus database with same CATH superfamily
2ILZA 2CQDA 4HT7A 1HBMA 1NJIT 1FKOA 1U1LA 2A6MA 3NY0A 2XLJA 3PYEA 2OTLS 3HT0A 3HHLD 1VR6A 2ZKUA 4HHHA 5IV3A 2L9NA 1JLEB 4EI2A 1U09A 1Z2ZA 1CULA 2QX0A 3D54A 3W63A 4DQRA 2U2FA 5J2PA 3FMBA 2BE9B 3CC7S 4BC9A 3QJPA 3MM7A 4I0WA 4KSEB 4CT9A 2UUWA 3BJYA 3A4TA 1N5TA 6FDRA 5JVHQ 4ZLLA 3LAMA 1CG2A 1CEZA 1IBKJ 1H38A 4I64A 3EGNA 4ID5A 2ZZNA 2DY9A 2E1AA 3VHQA 3KLIA 4FXDA 2XY5A 3UDLA 2VJUA 2HWTA 1FRMA 2YWGA 4ELUA 5AJ3J 1LW0A 4L3NA 2LA4A 4OYIA 2QG9B 1SQFA 1U0HA 3P3DA 4CO3A 1FRKA 2Y1JA 2G13A 3CB4A 1SH3A 2C2NA 2VUGA 2ABYA 3UN3A 2QA4G 1K73T 3FQLA 3MWBA 4I1TA 1WC4A 4FYVB 3SQGA 5LT5A 4NA1A 4LF8F 3V6DA 4CLTA 3UR3C 4RNFA 3M8SA 3M8RA 3PG9A 4I2PB 2WRMA 1VMBA 4DQIA 3R7BB 1MLAA 4IRKA 4CWBA 3QJJA 4ZLJA 3OTBA 3L9ZA 1N0VC 1YHQS 3K5LA 3A8KA 1P1LA 3RRGA 1U1RA 1VRTA 3T1AA 5C2CA 4FKYA 3BV8A 3IM9A 1L3UA 2YKNB 5IC6B 4DN0A 1FRLA 2HHTA 3IBWA 1B64A 2BJ9A 4R8UB 2P5VA 1ZZNA 4O4GB 1FD2A 1ZM2A 2AEFA 1TL3B 3D4JA 1ZA2B 1YRUA 1JIHA 2OTJS 1WKLA 1CC8A 5KAKA 4ZVEA 4DLGA 2VC0A 5U47A 3ELHA 2YH0A 1EP4B 1RZMA 2EKYA 4JB8B 1U1MA 3J7A1 3RJMB 2ERRA 2NYIA 5DM7Q 2E7VA 1VRQC 1X5PA 3I87A 5ETMA 4GVBA 1CVJA 1DARA 4NPOA 2YNGA 1YTYA 1S1XB 2P6TA 1WF0A 4AE5A 2AD9A 4X66F 1VQKS 2JHEA 1KTQA 1ITPA 1DQ9A 1V3ZA 1HWIA 2MGZA 2J7WA 1QAXA 4UUWA 3PIOQ 2FJVA 4CDIA 1S1UB 4R25A 1Y3JA 5KG2A 2LCWA 1X9SA 4B3OA 4Q44A 1CPZA 1NK4A 4C0BA 4I56A 2HFSA 4OZ3A 4WFAQ 1B99A 3DNCA 2AKWB 3GCXP 2G2ZA 1UMJA 4DL2A 1VC0A 4YDDB 1TV6B 1KVIA 5EGYA 2HIYA 2H3EB 5CCLA 3ZZYA 1JJ4A 4ZVFA 4PWUA 3GPAA 3LP2A 3G82A 1T95A 1VHFA 5HVFA 2VONA 1VQ9S 2YX1A 5HJXA 4Y2CA 2B4OA 1U4BA 2BKNA 1SUQB 2LLZA 5FJ4A 2EK6A 4MJKA 2B51A 1UJ6A 1HNVA 4DR7J 3QAEA 1HHTP 3GYNA 2ZM6F 2AGQA 5IT4A 2OD6A 3O8WA 3CC4S 4FKXA 4LJMA 1HFEL 1S9GB 4Q0BB 5A2QU 1HMVB 4C9DA 1U45A 4WXWA 1X4EA 2LXFA 4F4WA 1DQ8A 2VICA 2R8HA 3GMGA 2IA6A 2LP4A 3CJSA 1Q1KA 4F2SA 4ZHRA 3KUGA 4XPCA 4ZK7M 3LPEA 2B4UA 2HHPA 3MMAA 1PYTA 2KI2A 4N8OA 2A6OA 3NOCA 2O01C 3I96A 2M2BA 2PDAA 1KLMB 1RKJA 5HMWA 5D78A 4F67A 3OHBA 3U7JA 3H25A 2DH8A 1RWKB 4MH8A 2R2TA 5KFEA 4NE9C 1RHQB 4UOCA 3ZNUA 4V19J 5HMXA 2B9EA 1U7LA 2FLPA 2N82B 3CXCR 1PJ5A 4USMA 2IJRA 1TK0A 4PPDA 4G6VB 2R7TA 3TANA 2IM3A 1EKSA 2DGOA 4I69A 1N6QA 2VHGA 1VIXA 1UL3A 1T11A 2VZ9A 4I6YA 1IXKA 3HSZA 2KG0A 3R7NB 4OJ3A 2BE2A 2Z56B 1VQPS 3ISND 1C1CB 1DJ0A 3FSYA 4IQMA 3CWJA 4KKOA 1TKZB 3M32B 2M70A 3DLKA 5B0AA 2HGNA 5A8RB 3KUHA 3X1LB 2ZJPQ 3AH6A 2J76E 3O6QA 2XCAA 2DRAA 3H59A 1WKKA 2CYYA 2B6AA 4J9PA 4CO5A 2H5IB 4X4RA 2FB0A 5K9FA 4R0JA 4JI7F 4G1IA 3F56A 4ZVGA 3NWRA 4C8KA 2MMYA 5KOXA 5F8GA 3H5SA 1T9VA 1VQSA 4AQYJ 4I67A 1WHXA 2IC3A 5KFSA 1S99A 3W1YC 2V4JB 3BREA 2ASLA 4Y00A 2EFNA 4M5DB 1PIEA 4OHZA 2XB2D 4DG1B 1ZAWA 2FVCA 2HWHA 2K7JA 2E44A 3CJRA 4TLQA 5K5MA 4LREA 4LF8J 1SH2A 1X4AA 2CDRB 2HVZA 4P71A 4PR6A 1G4CA 4DZ6A 3W64A 4DFKA 4USHA 1MU2A 1FE4A 1XMBA 5AE3A 2GQQA 1SV5B 2M8HA 4JI1F 3IRWP 1FHTA 2DNMA 4OI6A 1RHKB 3NBPA 3RR8A 3FCWA 2PMWA 4EO8A 1WHVA 3WIUA 3SFGA 5CZXA 4WFNQ 5KFPA 2W9CB 1FNMA 2HZCA 1HR0F 1F0XA 1R31A 2BBEA 4M5GA 3W62A 3CCES 4FYYB 3HHNB 1RTIA 5F8IA 3VGUA 3KNAA 1P1TA 3DU6A 2WTFA 4RW7B 4F25A 1OQ3A 2M88A 3OVAA 2KT5A 2ALZA 3DGPA 1ICEB 4DV1F 1NK6A 2OP5A 2M9KA 3AD8C 2W24A 1ZPVA 1QSLA 4HVZA 4QIEA 1R6VA 1I3OB 1VI7A 1Y5IB 4YHHF 4ZP6A 2YKAA 1IN0A 1IBLF 4X66J 4A8YA 2RILA 4LSLA 1HW8A 1LXJA 4WU3A 4U7UD 2OLWA 1S59A 4JI8F 3IGVA 3JQJA 3ZZRA 2DIUA 2XYGB 4RX6A 4Q2LA 2CPFA 2BDPA 3RGIA 2VOPA 2NYHA 1SC1B 3RG6A 4OYOA 4U67Q 1NDCA 4O3SA 2Q6BA 2YVSA 4ZPTR 1TKDA 3CC2S 3Q89A 3AOCA 3BZQA 2CG8A 2VA3A 4DPXA 2VG5A 2C2OB 3RB0A 2QMUB 2KHDA 3QPIA 2NCKL 3ZTSA 1Q8LA 5F0UA 1N4LA 4CTAA 4X64F 4AL5A 5KFGA 2K8GA 4M5LA 2N3LA 3RBZA 3MCSA 3CD7A 5GVQA 2CUYA 1W25A 3I32A 1JKHA 1GNKA 2C2KB 1YIJS 3K0JA 3TA1A 2J6TA 2K3IA 5A0YA 3PHTA 2PEHA 2MKJA 3AFGA 3DRSB 3HSGA 5L1KA 3AT1B 4P73A 3HFZB 3KJFB 1XIQA 3MURP 1URNA 1HHQA 4EK2A 2ZM6J 2Y0BB 4G1QA 1RCXB 1VBXA 4A8MP 1X5TA 1FX2A 2QE5A 5IT9U 1RT4B 1HNZF 1SH0A 2H65B 4ED1A 3NGTA 1VQ7S 3R2DJ 2F65A 1JJHA 3A3NB 4DI6A 3BBBA 2W9AA 3MOJB 4WF9Q 3N6NA 2FLLA 1RAIB 2DHHA 1FKPB 3SV3A 4NL5A 3R5BA 2JEFA 3W3SA 2CVIA 4FYXB 3M2RA 4O44B 3C14B 5AT1B 2RT3A 2ZE2A 5DZ6A 2CQBA 1UEKA 4ZJOA 4NLTA 3ZO7A 3MUVP 4TVAB 4DUYF 4KTQA 2V5HG 4USVA 1R0BG 2PFDA 3CIZA 4H4MA 3TARA 4I2QA 1RLCL 1CLFA 5EUHA 1MSWD 2IHR1 4CI0B 1VGYA 1XN9A 5J2QA 3G8SA 4B3MF 2LECA 2YNFA 1LWXA 2IMOA 3HSDA 4CLZA 4HACB 4G3IA 3KJVB 4TYBA 3N0VA 3BSOA 4ECZA 2KYXA 2MEWA 2IAJA 3PJXA 4ECRA 2AHOB 4RUHA 2QO3A 1BQXA 1YZ6A 1LWCB 2CXEA 3CSKA 5K8NA 5IQ6A 2CFXA 1JMTA 4KO0A 3PR5B 4TNOA 3IG1B 2GMJA 1IBMF 2HVHA 3CMES 3H4BA 4JI7J 3RBDA 4QZVB 2GFFA 2HNZB 3HVTB 4UZCA 4PG6A 3PXGa 1F1BB 4KR0B 3TQ1A 3CF5Q 5DG7A 1RXOB 1FK9B 5T7LA 3GFXA 4HT5A 2MSTA 2B0GA 3V6JA 1VRUB 1I51B 1Y7PA 3LANA 2KT2A 4X2BA 3H5UA 4USJC 2QLWA 4J37A 1IUJA 3AOAA 3OFFA 4NCGB 1BXNA 2XSJA 4W4MA 2F63A 2Z30B 1QY7A 2XHCA 1R8CA 4JI0J 1E6VA 2UP1A 2YXLA 2DCLA 5KFXA 1BHNA 4GC6A 2ZH7A 4IFVB 2E7WA 1H7WA 4DF8A 4EMDA 4NEZA 5LM7E 1RYSA 5KFUA 2IVFB 1KRPA 2C22A 3K5NA 2XSFA 3R5GA 2RMLA 3VQTA 1EJ7L 4J9SA 4EBEA 1KEKA 4WKRA 1UPMB 4RW6B 1F2HA 1TAQA 1OWXA 4JI2F 3CO9A 1P9QC 2VG6A 3RYLA 1OSCA 2OD4A 2JVOA 4JI1J 3FQKA 1YX2A 3HZEA 3EVWA 2HNYB 1XTZA 1U8SA 2W8KA 3G6XA 1OY9A 1FWLA 3IR7B 5HL7Q 3UVJA 1R0CB 1GMWD 2E5IA 3ETOA 1HNIB 2F5GA 4ILMA 3I9V9 1FWKA 3FRYA 3PW7A 3M9OB 2ROPA 3JSYA 3JQKA 2UXCF 2UVRA 1VYAA 2DH9A 3CJTA 4K2JA 3TEHB 3JSMA 3LH2S 2DXFA 4LRFA 3CD0A 2E9TA 1JLCA 1TKXB 3K7RA 1LXNA 2XG8A 2OSQA 5F8MA 3OV7A 1X9WA 3WX8A 4FVCA 4P7TA 3E01B 2HHUA 2VPYB 2IM0A 2OPRB 4KT0C 2OFHX 4B9MA 4X4NA 3U1MA 4YHHJ 2P2CB 2WZ1A 3PV8A 1IBLJ 2H48B 3CJ8A 1IJEB 4QWBA 2K2PA 3AA9A 3CE8A 1SBRA 4OHVA 1FJGF 3QLHA 4NLSA 1S6PB 3OR2B 3IC1A 1U0SA 5GMEA 1IR1A 1MWZA 3KLEB 1B7FA 3DLGB 1Q79A 4A8WA 4KGVB 2C3UA 4KHRA 3CMQA 4LF7F 1Y5NB 4TY8B 1HD1A 1NNDA 1UAWA 4C3KA 2GMLA 3BDPA 1PSDA 5DETA 4X64J 2XWYA 3FNNA 2CQPA 4DV0F 1NSPA 2V2VA 3UDEA 1QAJA 1K1QA 1QTMA 4B3RF 2CNLB 1RWVB 1Q81T 1A0OB 1VS3A 4FPRA 2YWKA 3OT9A 2IA0A 4MFBB 5L1JA 1H6KX 1Q82T 1X4DA 3D0IE 1YJRA 1NK7A 1HQUB 1X4GA 4OL8A 2FQQB 1NK8A 3HXMA 3C15B 3GILA 1I6JA 1HYSA 2VFUA 4M1KA 2CJQA 4XDCA 3MMBA 4OYZA 4X4UA 2FJBB 1HNZJ 1HQ2A 5MLCV 2B9XA 2ASYA 4MIWA 3R5AA 3PRDA 1QJHA 1KBRA 1QAIA 3E51A 3MECA 2DNOA 3NAIA 1MG7A 4PPZA 2A2CA 4KV8B 1SI9A 4DL6A 2OEKA 1DTTB 1PCAA 2OPPA 3QGHA 1V5IB 4CNZA 2U1AA 1CJKB 5HJYA 2LA6A 2DTJA 5A6WA 2V8VA 1PAEX 2D1CA 1TUVA 1KDNA 1IKWA 2VPZB 4DR6F 3N4WA 4PXDA 5M2PA 4QR0A 3M1VA 4DUYJ 2WBMA 1C1BA 2FHMA 1VOMA 4OX6A 3W9HA 3PKMA 2KZZA 2V8HA 3BF4A 3HZGA 3KOAA 1NZ8A 2DNLA 3BPDA 2ATLA 3OXFA 4P72A 3TUJC 4A48A 1JLBA 2B7BB 2DR7A 1RBOB 2R7SA 4D3HA 1JLAB 4M5NA 3PO5A 1D9DA 2HEKA 2D74B 2HFZA 1BWVA 2YX4A 3A3PB 2A1BA 2RS2A 1RT3A 1YSJA 1M5VC 1VQ4S 2HS3A 4WK1A 1YG0A 1HPZB 4P2XA 2HKEA 1WI6A 4WP9A 3HDSA 5B0DA 4X4VA 1HA1A 2CIMA 1E6YA 5ETTA 4QCLA 3LWMA 5H1SV 2MLZA 4YR2A 3LUYA 2WOMA 3TEGA 2GAGC 3MCMA 1IKYB 1SQEA 3FBFA 3BGLA 4HI2A 3M30B 4WBFA 2VBWA 4DZDA 1REGX 5JJBA 4EZ9A 2DNGA 2HRUA 5KFZA 2MQ8A 3D1OA 5IM0B 2WSFC 2JFDA 4KRWA 1HNXF 1KN6A 1WOSA 1WUUA 3DHXA 1TL1A 4MIAA 3TJAA 1TVRB 1GXTA 3M8PB 1AW0A 1LV5A 1JXVA 1S0VA 1HWKA 2D9PA 4HHJA 1RT5A 3M8YA 4IUFA 2IJNA 2PT0A 2Y1LB 4JI2J 2DJWA 4LT6A 2IMWP 1EZZB 5K14B 3A8IA 2VKRA 2R42A 3GZ7A 2YKQA 2ZC3A 1WI8A 3GWCA 4P52A 4LBIA 2EKNA 2AV5A 5IT0A 2W2OP 1XEZA 3QO9B 2EC0A 2ZKTA 1UZHA 3FZBA 4P6QA 5HO4A 4C8NA 4RBTA 3G6VA 2MQPA 1O0PA 3RR7A 3M6XA 1TTHB 1AZSB 2HBZB 3CCJS 3L7UA 5AXNA 4E2FB 2DNRA 2EFOA 4DFMA 5J1NA 4FXVA 3E8OA 4DOZA 1F3VA 4MAKA 1GTEA 4DL5A 5KFYA 3NRBA 4DF4A 1EQMA 1TL7A 2XWXA 1JLFA 2GCFA 2HS4A 1S1WA 4BLGA 5L1LA 2DHGA 5F0WA 3Q86A 3X3UA 5D3GB 4LR7A 4U96A 4MK7A 2YQ0A 1WDTA 3NAHA 4O23A 1SC4B 4NLWA 1FJGJ 2N7YA 4NYOA 1KOHA 1X5OA 1KD1T 3MPDA 5B09A 1TMMA 5KFRA 5F3TA 3TA2A 2G1HA 3OD2A 2HRTA 4USIA 2J7UA 1S76D 2SXLA 3QGGA 2A18A 1HKAA 5GADI 2YTCA 3ZFVA 2HQFA 4QIWD 4PG5A 2KRRA 2Z2YB 4PRFA 4PUOA 1B7YB 4CP5A 4DV5F 3PZPA 2WONB 2BMBA 4H4KC 1REVA 3B78A 4DV0J 4IRDA 3CCVS 2UUBF 4B3RJ 3CJ0A 3QT6A 3GG0A 4IG0B 4UZBA 3ILOA 4IDKA 2IBKA 2LKZA 2R7RA 5ETOA 3BBFA 5A8WB 3GG1A 1NUEA 1DURA 3C66A 4KGZB 2ASDA 2HNDB 4F4YA 1NJYA 2GVDA 2RQKA 2OPSA 2VPXB 2BJ3A 2W2MP 3KLHB 3B4DA 4C7QA 3RW7A 4NI2A 1UVLA 4NZ0A 3EGVA 1MWYA 4ZDNA 4DFPA 1F2GA 1R0AB 2H54B 4WKYA 2M52A 1VC5A 3SCKE 2GJ2A 4EBDA 2KT3A 1DTQA 3Q8UA 1VQYA 3D6FB 4OI3A 3T19A 4NWBA 1XC9A 1R8HA 3HHLC 4JI4F 3BSCA 2UVWA 4ZVPB 4F4KA 5DGBA 4FNIA 3KK3B 2HFUA 3UFCX 1LFWA 3EZUA 3KK2B 3K8VA 4DR6J 3HI9A 3UD3P 4DR4F 2NPFA 4DQSA 4K2XA 5M2RA 4J9RA 4WP3A 4HH1A 1EB0A 4DJBA 1OO0B 4PZVA 3V4IB 2ZFHA 4R5PB 1NK5A 1SJQA 4QU7A 3W2VB 1YBUA 1TZ0A 1VC6A 2XM3A 1IR0A 2RF2A 3QNWB 1UVMA 2DBBA 2DNHA 3DRPB 2H9ZA 4J9OA 2M4MA 2UXDF 5SZTA 1WTFA 1NDKA 3LGHA 4DV2F 2R8GA 2RKIB 1S1XA 3SV4A 4F02A 2B43A 3VVUA 1TP7A 4DS5A 1HI1A 2L9WA 2MZRA 4YQWA 4QPXA 2DR8A 3MM8B 1R8BA 1JX4A 2Y1IA 1T05B 1RWXB 4RWWA 4ZIWA 2AYMA 3TVZA 1ZBTA 3MHYA 4D3GA 3ETMA 2FJXA 3SSQA 1Y9OA 5BJRA 2V2KA 4DQPA 5ETSA 3OHAA 1YZ7A 2CPHA 2VF3A 1UVKA 2AWZA 4OZ5A 2PC6A 4KPCA 2ZC4A 4KH0B 4L74A 2G9OA 5GMKa 2ZZTA 2R2UA 4AUKA 3D6HB 3VF0B 1HNXJ 3MXHP 3PTWA 2DNYA 4EYHB 4X62F 3FEZA 1JJCB 1AFJA 2AEJA 5HN0A 3TUPA 2CAJA 2MXYA 4XDDA 1WC6A 1ZTTA 1S0NA 3HVWA 4EFAC 2HURA 3LP1A 1HI8A 1M1KT 4MT1A 3SQOP 1CJTB 5HLFA 4CNYA 4F8RA 2AJ0A 4ED2A 5J1EB 2HQCA 3ICLA 2KTQA 2VV5A 2QL9B 3FCHA 2EK1A 2FY1A 4ZMMA 3GCWP 1M5KC 3IR6B 1JLGB 2HMIB 3AJ1A 3BSNA 1NSQA 5KT5A 3EWGA 2IPOB 3CNQP 5KFKA 1GQEA 3BGRA 4Q8EA 2NQPA 1RTDA 4KC5A 4F50A 3MFHA 4C98A 5A8KB 3DRYA 3UCZP 3NL0A 1P8GA 3FUYA 5FDLB 2XMMA 4FDFA 1Z4UA 1MN7A 3NEKA 5EDWA 3EDQB 3T41A 2X1GA 2C3YA 3LQVA 5CYMB 5K8MA 1N34J 3Q8RB 5J2MA 2D3OR 4JV1A 2IYGA 2VB6A 1SQGA 1Y0HA 2QFIA 1HBNB 1XMQF 2UUTA 4TKTA 4U7UK 2GGPB 2KH9A 1RCOB 3WBZA 3BSAA 5F9LA 2E1RA 2EFVA 1C1CA 1TKZA 2IVYA 3BDEA 4YB5A 2XLIA 4PABA 1NHKL 3MEEB 3DC2A 4PG4A 4UUXA 3E3XA 3KMSA 4XIUA 3C16B 1X7VA 1OYDA 5C24A 4ELTA 4JV2A 2FDNA 3OPKA 4KFBB 4K4WA 2KM8C 2B4PA 2HIQA 2GQCA 1UEUA 1F9EB 2DH7A 4DV5J 4B3TF 3ZTRA 3TR5A 3LA0A 2CDQA 2LEPA 3CJ4A 1AYEA 3VAFA 1RWWB 1IKVA 2PE8A 2UUBJ 1WOPA 5K20B 5KTQA 2NLWA 2EFGA 4KPYA 1LNQA 5EWGA 1Y00A 1Y11A 4WK3A 3ET6B 3IR5B 4UOFA 1DFDA 4LQ3A 2NUUG 3VV2B 9ATCB 2HGMA 5E3RA 4QYZJ 4ZPCA 1EHWA 2MQMA 3UD5A 3IO1A 3CEDA 3I0SA 5HQMA 2AGOA 5AXLA 2QA1A 3KJQB 4K4UA 4X4PA 2I5JA 1X8DA 1NDPA 1C4CA 3M8QB 3GE9A 4JP8A 1DLOA 1RT2B 4ECYA 2CWKA 5L8RC 2JEGA 5CCMA 3HKWA 2POKA 3M2UB 2IM2A 1GMUA 1SV5A 3OXLA 4OI0A 4MKBA 4JI4J 5J2NA 1NH8A 2BRKA 3O1LA 2G2OA 2LVWA 2XI2A 8RUCA 1EETA 1N5SA 4RO0A 1FNOA 4DR4J 2KXNB 4LFAF 2B5JB 2QN6B 2ZHBA 1YQHA 1C0TA 3IWXA 3MAQA 3F0NA 1H2TZ 1XR5A 3GIIA 3DLEA 1WEZA 3PJ9A 4ZVQB 4WCEQ 3K58A 3ISZA 1S77D 5LJ3Y 1C2PA 2HHXA 1KTVA 4O0NA 4LF9F 2XBPA 2FC8A 1TKTB 2KZMA 3B82A 2GHVC 2MZSA 4ZS6A 5JXSA 3GR0A 3R97A 2ADBA 4HEA9 2UXDJ 4A8FA 3I5CA 2XMWA 3LP0B 2OSRA 2DHAA 4DV2J 1F5CA 3H8YA 3MEGB 3ENWA 2ASJA 2AJFE 1AA1B 1RTJA 3D6TB 1AT1B 2ZD1B 2RU9A 5KFCA 2EI5A 4USKA 1UW9A 3CCLS 1EKRA 4OYAA 2AJ4A 1S5ZA 3AD9C 1D8ZA 4U9RA 2DO0A 1KQFB 1MMNA 3KDNA 2YKOA 2WB4A 5ETNA 4W92B 3W2WA 2JLFA 2KB2A 4AD6A 3LGMA 4DLEA 3DM2B 7FD1A 3KHHA 2J0XA 3NG8A 3I4HX 2RVJA 1HBMB 1FKOB 4ECXA 5C25A 2GV1A 4AYBD 4HTIA 2D3UA 4H4OA 3H2UB 1XNRF 4X62J 4CO4A 3I9ZA 4ZKAA 5HAOA 3PCOB 1CULB 3TJ9A 3Q8YA 3BM7A 2JC1A 1YJWS 1KQKA 3DRSA 5J2PB 4KBIA 4YR3A 4ILLA 4J9QA 2BABA 2WVBA 5CABA 2WVEA 4AXJA 3HHEA 5DDPC 1RHMB 4QWAA 3RRHA 1IQTA 1R8AA 3CJ5A 1FESA 1S6UA 1RT4A 3KLVA 5DDRC 2NZCA 3T5LA 3CGIA 4NOHA 3QIDA 3QT8A 5KFMA 4OJHA 2ATCB 3R2CJ 1RKIA 3HFKA 2FYXA 1YK9A 1PO6A 2ZBQA 3QGPA 4E8UA 5CH7B 2OIHA 1FKPA 2C3OA 1LW0B 1TL5A 2BX6A 2HLTA 3MM6A 4ZN1A 1QSSA 1U0HB 2P8IA 1YI2S 4FNHA 1S1TA 2CJAA 2KG1A 3EXCX 3D1HA 2IM1A 3H4DA 4LF5F 3T1HJ 2QMXA 3WC0A 5AJ3F 2VJVA 5AE1A 4USWA 2CADA 4CLKA 5D4PA 3UCUP 3SQGB 1I94F 4F04B 3V6DB 2ZVSA 3G96A 5HP1A 1SJRA 3A13A 3AAWB 3KG1A 1G2EA 3EICA 1W26A 2ROGA 2LU1A 2PSZA 4O3RA 4Y28C 5B0EA 2QLFB 2DIVA 4CLYA 2MQOA 2DNNA 4PQUA 4E0DA 5HROA 2BM1A 2EFQA 2MHEA 1J5EF 4DU8A 2IRUA 1ELOA 3OTOF 3GJRB 4DPOA 1PGZA 4CM2A 1XR7A 4DL0C 1VRTB 3RAXA 3SSSA 3TRGA 4MTPA 1WHWA 1PBAA 3HD1A 4OI4A 3HVAA 3Q23A 3MM5A 4RU2A 1XBWA 3ZZZA 1VBZA 3AXMA 3EZOA 3IG1A 4B3TJ 4OX7A 2V4RA 2ZH1A 3PIPQ 2MQLA 1IQZA 3IBCB 3W9IA 1UFKA 2HNZA 1ZAVA 4DN9A 4S0MA 3SXLA 5KFOA 4LRBA 1I1GA 2W8LA 4LFCF 5ETLA 1VRUA 4N8NA 3LF0A 1T3NA 1WJ9A 5JMNA 3PEHA 3DFEA 4OYMA 3MAAA 4GVBB 1TMJA 2Q66A 5KT2A 3KHGA 1RAFB 1VBYA 1T94A 1JWWA 4LRDA 3G2XA 2MGZB 2ZDOA 3PDNA 4LIWA 4IFVA 1FT8A 3TW0A 3TZWA 2AW0A 4K4TA 4OZ0A 2LDIA 4B3OB 2LMIA 2HQGA 4F3QA 3GIMA 5AXKA 3DMJA 2E5LF 3N5BA 3QMQA 4WP8A 4DPUA 4F7VA 5CAAA 4RW6A 1NSAA 4MYUA 3UR0A 3OW2R 1FFSB 4ZPVR 4ECQA 1RSCA 2Q1LA 1SXLA 2HS0A 4ZVUB 2RSQA 2XLKA 4KY3A 4FF2A 2HFVA 2FJAB 1FO1A 3LP2B 2UZAA 4CYUA 1LWFA 4FXWA 4WWSA 2HYIB 4LFAJ 4EWTA 3I5BA 2OEMA 2MZJA 3A3OB 3ZZTA 4YUDA 4NLYA 1HNVB 3M8ZA 1LKZA 4IOCQ 4USUA 4LF9J 1RWMB 2O3DA 1WD6A 1QTNB 2R8JA 5FD1A 4ZPAA 5IZHA 1UP1A 4RNNA 4OJ1A 2AQ4A 5EX3A 4ES3A 2CPZA 2I8EA 3N28A 4PXEA 3T6JA 3PO4A 2B9WA 5LOQA 3G87A 3V4MA 2NXEA 4ZHRB 3CCSS 3UDCA 2V68A 1H98A 4ILRA 2JOQA 3M6WA 1KQGB 3EPIA 5KG5A 3MMAB 3OR2A 5ETQA 4QBUA 3SMZA 2ZOGA 4RL1A 4DV7F 2DPJA 1X5SA 1VISA 2MSSA 4M63A 3VCDA 2XMJA 3VVTA 4TY8A 5L39A 2HHWA 4RR5A 4Z7CA 3CD5A 4RUCA 2IRXA 2RIJA 2OI2A 4DQQA 2R3VA 4OZ2A 1PAUB 1L3TA 5E3QA 3DI6A 3UCGA 3G71S 5ETKA 4HR2A 5D0EA 3UNGC 2PD1A 3MPYA 2YKPA 1B0TA 1U2CA 1N6QB 5IV4A 4ER8A 1XNRJ 3NOGA 2D7SA 5KFBA 2PI5A 1WWHA 1UCNA 2BE2B 1RP5A 2DPIA 3OVBA 1GXUA 2DR6A 4FS1A 3W5YA 4J9KA 4NZ6A 2B8PA 1Q8KA 4KKOB 1FXRA 3G4SS 3DLKB 2C42A 5EN1A 2DK2A 4ANEA 1SJFA 2V9WA 2Y8YA 4WE1A 3TQEA 1S6OA 2V0NA 4M8LA 3FZ2A 3GONA 2GHWA 4Y34A 2DNZA 2B6AB 1WKJA 3KG0A 2CJXB 1U1OA 3UO0A 1FRHA 3UD4P 2HHVA 2HWIA 1JLQA 5D4LA 2N4CA 3DLBA 1WORA 1UWAA 5EWEA 1KHVA 4BWMA 1O8BA 3P5BP 3K8WA 5LJ5Y 2RRNA 4DS4A 2IC3B 4DUTA 5E5NA 3ITHA 4ZLPA 5DZ7A 5E0OA 1LWEA 5SUHA 4LF5J 1R27B 4AQYF 2XS2A 3W65A 4ICLA 2RHQB 2AYBA 1I94J 1FF2A 3P96A 2XC9A 1QE1A 4QW8A 4ZVOB 3OXGA 3QRQA 3A1YG 2HQIA 2QTWA 3WQPA 1WTBA 2ZJRQ 2CZ4A 1MU2B 4ZVTB 4PCQA 3ILIA 1C4AA 5ETPA 4FYWB 1JLAA 1J5EJ 3H5XA 4PKDB 3OTOJ 3D5MA 3WIVA 3CJ2A 2MDAA 1RT6A 1OPIA 1S49A 4U8YA 1WEXA 3NBPB 2Z0GA 1VFJA 3BB5A 5FLXU 5IC4B 4DXLA 4NCBA 2NXNA 3EVMA 4TYAA 3Q24A 3IS9A 2Y1RI 1Q4RA 8ATCB 4DR2F 3TUIC 3D0GE 3TWZA 4A8KA 1PILA 1RTIB 5I3UA 1S57A 2EG2A 3BKUA 1AXQA 5DDQC 1IKYA 3DGPB 3BQ2A 4WZQA 4LFCJ 2W25A 5C42A 2R2SA 4CO2A 1N5YA 4M94A 4N47A 4QJVA 4BHQA 3CJKA 2UUCF 2M5YA 2F9DA 2F9JA 2DHXA 4UOGA 3I55S 1YBAA 2WVCA 4LSLB 2MQQA 4IR9A 3SDEA 4NXMJ 1TVRA 2I0XA 1M5HA 4KGKA 1NHUA 4ED8A 1IKXB 2HRYA 1SCJB 3MMCA 1T03A 2HQ3A 1HLWA 1M90T 4NLRA 4J9LA 3GFHA 2QC3A 2E5LJ 1S7IA 3ZTPA 2UVUA 4NLDA 2YBVA 2R7WA 3DDIA 2VG5B 2CQCA 4LR9A 4B9LA 5DDOC 4JV5F 2KFYA 3DOLA 3O5TB 3U27A 4RU9A 1KWMA 3QQCD 2A3JA 2M7SA 2AGPA 3RAMA 3TZZA 4ZA1A 2NXUA 1TQLA 3RTVA 4I4BA 3OL8A 5H9EK 3BKFA 1T9WA 1JKHB 1FFWB 4N77A 2LXUA 5LXYA 3NWGA 3TO8A 5A0YB 2GA7A 5KFQA 1HWLA 5GAHU 3L09A 2ZWOA 4F4ZA 2X3GA 4I6WA 1J2VA 4H54A 1X4HA 3GSDA 3KYLA 4UQGA 1ZZFA 4G1QB 4JI6F 5CHCB 4LBHA 4OHXA 4NLGA 1S0OA 1A7GE 3J80Y 1RAJA 3IGNA 3KHRA 3VAJA 3V81A 3DRRA 3ENVA 2E5HA 5D3GA 4OV6A 2DNKA 4J9UE 3C3LA 5LSOA 2OGUA 1UEVA 1NBEB 1NK0A 2VIHA 4KB7A 2K1RB 5KFAA 2W7OA 1D9AA 1B0PA 2LQJA 3M2RB 1S12A 3MCNA 2G1DA 4TN2A 5D15A 2ZE2B 2I2YA 2IBOA 1RTHA 4DV7J 2QJ3A 1PKUA 3J81j 4DL7A 1MROA 3DOKA 5KFJA 2DITA 1V6HA 2L48A 5E2QA 1W2BR 2P9CA 3C6UA 1KSPA 4ATNA 4QYZK 3SIPB 3L7PA 3OTEA 4Q43A 4FVMA 4H4MB 4I2QB 3H98A 4WTOB 3SCIE 2D69A 3RAQA 4JBCA 1N48A 3P4UB 1JK9B 1Y10A 5J2QB 3GQCA 2UXBF 1URRA 3R9LA 3OVSA 4FYDA 2OHDA 3VGVA 1C0UA 3HT3A 2CG4A 5D4OA 1Q53A 2AX0A 3JTNA 4DMZA 4AXIA 2IAJB 5A8WA 4ZOSA 3CDAA 3UNYA 4QW9A 2H1YA 3N6LA 1S48A 4KO0B 1LW2A 4RPFA 2PA3A 2R4FA 4I7FA 2QSFA 3FDSA 1YITS 1RQ0A 3G6ES 1B4SA 3DU5A 4P74A 1K47A 4NASA 5F8HA 3K5PA 5T7LB 3TAPA 5CD4A 5IS2A 3J7YU 5B0BA 1W2IA 4PYAA 2QLXA 5F8LA 2XZTB 2KL8A 2XSJB 1OY6A 2QGFB 4ES2A 5DO2A 3WDOA 2C28A 2YNHA 2XO6A 2W9BA 3QSYB 2X1FA 3RU0A 5B0GA 2YH1A 1HBOA 2AJ1A 5KG0A 4B3SF 3CDWA 5ADZA 2CQ4A 1Q78A 3FEXB 1RT7A 4LMZA 3T1YF 1CJUB 1S4FA 5HBMA 4JI0F 1CS4A 4J9NA 4R5PA 3W8PA 3OFEA 2VG6B 1FDDA 4L3KA 2QYCA 1VQ8S 3LWLA 4WFXA 4X4SA 3EMTA 1XJWB 1U24A 2V94A 2IDLA 3AY0A 4FF3A 1RAHB 4FBTA 2XGPA 3CW2C 3UVJB 1SIZA 3QWPA 1WC0A 1J27A 4K4SA 1U26A 2RDDA 2HPUA 2C2ZB 1PYSB 4I68A 1Y5LB 4DR2J 1FXLA 4PAAA 3TX8A 1H7XA 2QLBB 4UW2A 2JC0A 3T9NA 3TAMA 3ENQA 3DYAB 2UUAF 4PG8A 1S10A 4NEYA 5DQHA 3JTPA 1RHRB 3JSMB 1OY8A 2FLNA 1VQLS 1RWNB 1TU0B 3B6BA 3PVXA 3AJ2A 3TP2A 1JLCB 2XZDB 5L46A 4IH7A 4NXNJ 1R3NA 1U47A 2BW2A 1Q16B 3THVA 1WF2A 3RB4A 2UUCJ 5D0GA 3G8QA 2CPYA 1SKWA 1RBLA 3BS9A 4V19X 5LMNF 1LK5A 3QLHB 1QSYA 3R1HA 2CQ3A 2L9DA 4JI5F 4A46A 2GMHA 3NGUA 5L9XA 2IYIA 1LFPA 3MMJA 2W4DA 3TYTA 1IVZA 1U2FA 3DLLQ 3QRPA 1DBDA 1Q95G 2PEBA 5CA5A 2LQ8A 3JTOA 1HBUA 3BGFA 4LIRA 2NSBA 3PRBA 1RABB 5D0HA 4JV5J 3OSNA 2RH3A 3HF5A 2L08A 4C11A 5L38A 2JX2A 5ITHA 3H2LA 2FZKB 3ZZOA 1YWXA 1BQMB 1JQGA 4A47A 4ALZA 2EC2A 3F44A 4WZMA 1JXLA 4TLRA 5M2UA 1UFWA 5CYQB 4DFJA 3PW4A 3T6BA 1BQNA 2J6SA 3KTQA 3PM9A 1RISA 4OZLA 4DL4A 1HYSB 3CJ3A 4JI6J 1J5OA 3MMBB 1T9TA 5KFHA 3LAKA 3KLFA 4ED6A 1FE0A 5E3CA 1R43A 3POTA 4B08A 4K4ZA 3IFEA 1WDDA 2B7CB 4F0MA 5ETRA 4ZVRB 1DY3A 5HATA 1D1UA 3MECB 4P9SA 4AT1B 1T9UA 4YB7A 2RB7A 3GU0A 3W8GA 4OZJA 4IG3A 4K4XA 2OPPB 4H4KA 2C2RA 1VCTA 4PYDA 2QFJA 2BJ7A 3HVRA 5J1PA 5IOLA 1IKWB 4DV3F 2ILYA 2JWNA 1X4BA 2WAQD 1C1BB 3AOBA 1G7CB 1T0TV 1T8EA 3VWSA 2QYGA 3L95X 2NUHA 1VQNS 2X51A 5BR8F 1D09B 5HQ8A 1S6QA 4N76A 3H0PA 1JLBB 1SKRA 1RAAB 2MJNA 4EGLA 5KG1A 2UXBJ 2Z57B 3EYZA 3OUYA 2UU9F 5T14A 2P6SA 5DGAA 1RT3B 1XNQJ 3Q83A 2HGLA 3Q8QB 1JXEA 2F4FA 3NNHA 3NMAA 4JYAF 3KMQA 2FLOA 2CPEA 1Q5VA 2VODA 2CPXA 2MKIA 1S97A 4CLLA 3F73A 3HHLA 3UN5A 1BD6A 3QIPB 4LBPA 1E6YB 1IR2A 2IVMA 2OJ3A 3R7SB 5DLGA 3GJQB 4C48A 5DG8A 1Q7LB 3M8QA 2E1CA 3OTDA 2WOMB 1FVQA 2QV6A 3WHIA 3RZAA 2YPZA 5CZVA 2IIHA 2DXDA 2OKQA 2GJIA 1DQAA 3SYZA 1ZAXA 3BPSP 2B9YA 1LEOA 4WXOA 1MMDA 4DSLA 5BYQA 1LQ9A 2FGCA 2GX8A 4GC7A 1HARA 1MN9A 1TL1B 2FY8A 5DQGA 5CYJA 1T02A 1PJ7A 4Q7AA 2CWXA 5A2QY 1WG4A 1X9MA 4N41A 1B3TA 1VQ5S 1S7HA 4B3SJ 5G0RA 1VIOA 1RT5B 3BH6B 2BUNA 4KE5A 4ECTA 3SFUA 2QSWA 3D66A 3T1YJ 2G2YA 2EWHA 1RHUB 3J7Z5 4WJBA 1WF1A 3HJVA 1MWQA 4XPEA 2I38A 1SC3B 2AP6A 3CD6S 2VG7B 5B0FA 2R8IA 3G86A 4Z7YA 4ETXA 3FJ2A 2XMTA 5F41A 1WC5A 2CQHA 1YVFA 2PA8D 1WG1A 3DOMA 2CKWA 2ZWPA 3QYYA 3ONQA 1RK8A 3R8YA 1RDRA 5LMUF 3R27A 2LYVA 3AA8A 4RNHA 5K8PA 2ZH6A 2DR9A 3B54A 3NNCA 2CJKA 4YN3B 3MM9B 2VFVA 2UUAJ 1RAOA 4OLOA 3PFOA 3BBCA 1BUXA 1OMSA 3VGSA 2PN6A 2JLGA 1MW7A 4NA3A 4DX7A 1MNEA 4RW4B 3HFVA 1TL7B 1SIWB 1GX6A 1FX4A 3S01A 3MEDA 3DM2A 3S1TA 1N32F 3NGDA 4M5MA 1S1WB 4DPTA 1X31C 2E7XA 4X4OA 4LRCA 5I42A 3CVKA 3KWMA 1XR6A 2JSXA 3HK2A 3FC9A 5LMNJ 3RBEA 4QIGA 4JI5J 2APOA 2R7VA 4CH1A 2ZBIA 1WSRA 1ULRA 4N7TA 3V2UC 3P5TL 4OX8A 2K3KA 1KC8T 3EZ5A 3SSRA 4GKJF 1UW4A 3ZXWA 2BV3A 2OPQA 3TX0A 1V5VA 1SB6A 3Q8PB 2LQBA 2Y8WA 2CQGA 4PUOB 1R8PA 3BKTA 4U8VA 3TAQA 3GTYX 2W4PA 3MTJA 3D68A 1REVB 2BANA 3KNGA 2YNIA 1FVSA 4PXBA 2ZDPA 1APSA 5DQIA 5EWFA 2A0FB 1SVDA 4IDKB 2GVZA 3JQMA 4CIOA 4W98A 1O5JA 2J9DA 1WSVA 1Q8BA 2JLEA 2FZCB 2XNQA 2JL9A 4TQSA 1FKAF 2GVDB 3MI7X 1RBAA 2OPSB 3MUTP 2FVQA 4URGA 3JYTB 3SZ2A 2Y0SD 2XMVA 4EZ6A 4MK8A 3D6MB 2J0SD 4IFYA 3Q2TC 3I0RA 3RB6A 2DKOB 4NI2B 1UA1A 3C46A 3D3BJ 6AT1B 5DS7A 1HW9A 1RHJB 2KU7A 4C3MA 4RKUC 3PHEA 5F8JA 1DTQB 4DSKA 5GAGU 2V50A 3L4BC 3O3LA 1X4CA 4M95A 1YBTA 4O3OA 3QZ8A 2HK2A 2UVVA 2ZHOA 3GR1A 2DY1A 4DV6F 4HI1A 4DV3J 2ZBRA 2JEJA 5LXRA 4K7QA 2CRLA 3ZTQA 4ERDA 2ZH5A 4WPAA 3R5JB 2AF6A 5H9FJ 2GIQA 2R7OA 1PBUA 1F3FA 1V9OA 5BR8J 2AZ1A 3P49B 3GP9A 3VAMA 1NKCA 2WBRA 2BACA 2DGUA 2J9EA 3U02A 3BQ1A 1U1KA 2DYAA 4ED7A 2BW7A 1ROFA 3H90A 2GO9A 2UU9J 2EW9A 2RF2B 4NA2A 1BC6A 4EUVA 3MR2A 2L41A 1NXIA 3ZZPA 2EVZA 4JYAJ 1KVJA 3PFEA 1I5OB 2IJFA 3CCWA 1OQ6A 3IWNC 3EUNA 1Z1ZA 2MJUA 1CJVA 2B3TB 1JNZB 4DV4J 1HNWF 5EHHA 3OR1B 2HBRB 5C7PA 1ZPWX 2XS5A 4OYWA 1CBKA 2RRAA 4QU6A 3KK1A 2K06A 1N8RT 2E29A 1OIAA 2MZTA 4K5SA 4L73A 1U25A 5KT6A 4ID8A 2MY8A 4ZJLA 1RTZA 1T3OA 2ZOFA 2XY7A 2Q43A 1K0TA 2G0CA 4A8OA 2CVEA 4NMLA 1GEHA 9RUBA 5C2GA 4LR8A 3HPOA 1YJUA 3UN2A 4K8RA 3GIRA 3CJQA 5IT9Y 2F3JA 3NCQA 2W7PA 3VAIA 4X4QA 3KDOA 2A2DA 2HQDA 3FFIB 2MPUA 5LSLA 3FBBA 1CQMA 3LP1B 2G0JA 2XYHB 4FN5A 1UWBA 5HLFB 3EGZA 2ZH9A 2QA4S 2CZVC 4J9MA 3JS9A 3IXQA 4C0HA 2J7KA 1F60B 3PX6A 4BS2A 2A10A 1X4FA 1LOUA 1SJ4P 3M2VA 1P9YA 4OX9F 4WIIA 4PEOA 3NGKA 2G4BA 3PRVA 4CLWA 2B56A 5A6PA 3SCJE 4LSZB 2EPIA 1HWUA 3OFHA 1QLNA 4CZCA 4F4AA 1U6ZA 4KQZA 3MFIA 3IRXA 3TJ8A 3BGRB 3NKYA 1RTDB 4LSNB 5KG3A 5LMUJ 2ZH4A 2BOAA 3LGNA 3EPGA 3T5HA 4RWXA 1FRIA 1S1VA 4RW9A 5LL6d 1ZETA 3GV7B 3HM9A 2DVIA 3GLJA 2WVDA 2H5JB 2HAIA 1N32J 1N33F 3UDVA 2KFZA 3KLGA 3ULHA 4P75A 3GYXB 4GO7X 5J2MB 1XQIA 3WX4A 2AJ2A 2C2DA 4A4JA 1RB0A 3C6TA 1YLXA 3FK4A 4PWDA 2W2NP 1FD8A 2RJZA 2DNPA 2BE7D 4KH1B 1QM9A 4CLUA 4ZCLA 3T5JA 1N34F 2COLA 2YKMB 4OHYA 3BN7A 5IQQA 2BXJA 4ECSA 4OLPA 3MD1A 3NCPA 3AQOA 1DZ5A 4GKJJ 2VKZG 1O51A 3M6VA 2RNEA 5C24B 1JLEA 2GO8A 2BVZA 3I31A 3W60A 3KJNB 1YGYA 2C2MB 4RLEA 2VDHA 1IKVB 1IBCB 4EEYA 1U02A 2AYGA 2BM0A 4F36A 4BCAA 3IAM9 3QT5A 4DWIA 2J6UA 4P2MA 4MK9A 2MKHA 1TFWA 1UJ5A 3SBMA 2MTLA 3AJDA 4A8QA 4X65F 2OUGA 3B8HA 1Q7YT 3I0SB 3EJMA 3J7ZT 4FF1A 1FERA 4UOHA 4GMKA 2OELA 2R9LA 2I5JB 3NGRA 3PKYA 4ED3A 3D7SB 3FBEA 3G9CA 2QMWA 3GV8B 1DLOB 1YJVA 5D77A 4NLUA 2ZBPA 2C2EA 1M5SA 4QIVA 2R7UA 4UY8T 4ES1A 4F26A 4W90B 3F41A 2Z2MA 3D9BA 2M0GB 1OYEA 1ZTWA 1RT1B 1NHVA 2X3DA 2V6AA 5J2NB 2Q79A 1AUSL 3IWLA 4MMOA 4R0EA 3C19A 3U1LA 4I2PA 1EETB 4QR2A 3MEKA 2VFTA 1T7PA 1EQ0A 4C97A 5F9NA 4DV6J 4XTTA 3N9UC 4ETZA 4CO0A 2OMLA 3K2YA 1U49A 2BJ8A 3D28A 2JDJA 1S79A 2I9SA 4ZP8A 1C0TB 4Q2MA 1N5QA 4PG7A 4XK8C 1X0PA 3DLEB 2CNKB 1FEHA 1NSKL 4B02A 1EIYB 3K57A 3ZZUA 3EVOA 2YKNA 3R5CA 5KG6A 1M0SA 4YB1P 2M8DB 4DR1F 1F9HA 1XK8A 2AEMA 4R8UA 4DPYA 4O4GA 2ACMA 3Q22A 2DRBA 1TL3A 2W1BA 3FEYB 4AL6A 2CJYB 2HBQB 2ZUAA 2M3DA 3HJFA 4QQBA 1HQEB 1EP4A 1YJTA 1HNWJ 1FRJA 1FCAA 1RTJB 1GXLA 4ZP9A 2X7IA 4LF4F 3CCMS 4Y2KA 2QL5B 2LQ5A 1HD0A 2V34A 4IOAQ 3MGJA 2DGVA 5CXTA 1IKXA 5I3PA 1VJQA 3NS5A 4LFBF 4O0IA 1PG5B 4ZN3A 3DRXA 3PYDA 3W2WB 1TK5A 2F1FA 1S1UA 5DG9A 2XZWA 3ZTOA 2ZVIA 1G6BA 2IFXA 3H42A 4RBVA 2MZ1A 3V5RA 2Q6CA 5C25B 1NCLA 4H4OB 2O1PA 1H73A 2AJQA 5MAOA 2MQNA 5EX0A 3CPWR 5KG7A 2RU3A 3PY8A 1TV6A 4OV1A 4DHVA 1OSDA 1WEYA 1SL0A 3H5YA 1Z2LA 2W4CA 4P10A 1KVKA 3ILLA 1B0VA 4C8OA 5A76A 4LVNP 1MMLA 5HMYA 3DDKA 4RUAA 3T3FA 4OX9J 3JSRA 1H0HB 4J90A 1KFSA 1SUQA 1FWPA 2VPWB 2ZNYA 1HWJA 4FPIA 2BKPA 2MZQA 3THPA 3PX4A 5BYSA 1PYOB 4O4RA 2V8DA 3ZNJ1 3LALA 2B8QA 1S9GA 3MM6B 2WB1D 2XS7A 4Q0BA 1HMVA 3MPUB 4URQU 2K1RA 2RS8A 2FJDB 3W66A 2HZVA 1S1TB 2V9KA 4C3LA 6FD1A 1OJ4A 3CT9A 2FHOB 3R6LB 3PW2A 2YWWA 2W01A 4O3QA 2PMZD 2QL7B 1GMWA 1EX8A 2H4WB 2JZ5A 5HP1B 1N33J 1TL4A 4Y0FA 4DCJB 3HD2A 1KLMA 5L9NA 3N01A 3PW0A 4IYQA 3T1HF 2ZNZA 4PQUB 5HROB 1UA0A 2OEJA 4WYWA 5H9EJ 4LQ9A 3S7RA 2Y9HA 1U1NA 2H5EA 2RRBA 5F3ZA 3QT7A 5JUMA 1FDBA 4Y6IA 2CPDA 2MLXA 2L3MA 3QBCA 1G3OA 2VBZA 3MM5B 3UQSA 4NRTA 2EG1A 3GIKA 4PXCA 4DX5A 3AB2B 1RA7A 1GK8A 2CJBA 2E9ZA 1SJ3P 2MLYA 3M32A 3M9MB 1KS2A 1N0UA 2KKHA 4JI3F 4C8YA 5A8RA 1ZM4A 1NDLA 4AL7A 2BQRA 1SPBP 1RWPB 4K59A 2VH7A 2OO4A 1VHIA 4OYXA 1TR0A 1NH7A 1U6BA 2VBXA 2AIRB 3MAAB 3CCTA 4X65J 3A8JA 2F4VF 3MR7A 1VK3A 3U1NA 1HI0P 1NKBA 3FMWA 5KG4A 3D3CJ 5KFIA 1R7IA 2IDEA 2Z58B 1UVNA 2BQ3A 4ED5A 5KFTA 2GJFA 2V4JA 2Z2ZA 3G6YA 5KT4A 4M5DA 1A6LA 2KYZA 3DMJB 4JUZA 4DG1A 1CJUA 2CPJA 2DGQA 3CIMA 2HHSA 1QVFR 1KONA 4QYRA 3RRKA 4DSIA 1VLOA 1CSJA 2VDIA 2J9CA 4CYUB 1LWFB 3QFHA 1SKSA 3CDBA 5E33A 1HR0J 4WFZA 4P2SA 4YEAA 2MYFA 2WCXA 1RU2A 3ISNC 1ACMB 1WELA 3DYAA 3M05A 3HX9A 1WHYA 3DGVA 4NYZA 3KXDA 1NLKL 4DR1J 2W9CA 2HG4A 2O5DA 2GS8A 4DV1J 1K44A 1UTAA 4RW8B 1RU1A 3UWTA 1FA0A 4OI2A 4RW7A 2DEJA 4DEZA 3N6MA 3TA0A 1M1HA 2DCUB 1VLYA 3JAMY 4LF4J 4JI8J 4FS2A 3IN5A 4X4TA 4DCOB 2VQFF 2GW8A 1S9FA 4OQJA 1S9EB 3UW1A 4F0HA 4NLVA 3I4PA 4LFBJ 3GIJA 2VOOA 3BQ0A 5HQLA 2P9EA 2WSCC 4ZP7A 3QJLA 2BQUA 3P45B 1ZS6A 3DI6B 4A8SA 3OJUA 2NSCA 4C4WA 3ADAC 3CO0P 1RE1B 3EE3A 2FTRA 1BQMA 4N56A 3KUEA 3L7OA 4EYIB 5IWAF 3BGUA 5CYQA 1F5AA 3R1LA 4Q8FA 2AU0A 4UT4A 3BYPA 3I5AA 5GAEI 5D0RA 1V3RA 2YY3A 4ZIVA 4WE1B 2J8SA 3TZXA 4IOBA 2LXIA 4TY9A 1D8YA 4DUZF 3NP5A 2ZBCA 1M1GA 3C2PA 1F5BA 2GAHC 3OBIA 1XMOF 4CH0S 3LW5C 4U7CA 2WK4A 3MM7B 1JJ2R 3GB0A 2W2PP 2XO7A 1JLQB 4J91A 1LK7A 3T9ZA 3VAHA 2G0IA 3US5A 1NPPA 1UFLA 5H9FK 4EO6A 4RJVA 3MZIA 4KHMA 4ID5B 3HHKA 2DGXA 4QPTA 2I6WA 2PFFB 3BGOP 1NPKA 4Z37A 1R6YA 3KLIB 1KHWA 3ITHB 1RA6A 2HVEA 4C6AA 1LWEB 4OYPA 2KRBA 5HI7A 4F4XA 4J5OA 4ICLB 2KDOA 3EXYA 2LFVA 2AX1A 4ELVA 3JB9k 2AMCB 5KOWA 5D8HB 1QE1B 4O44A 3TOQA 4B9VA 3C14A 2FHJA 2IRYA 2V69A 4KGXB 1NU4A 5ETVA 2WSEC 5FIIA 3QZ7A 3BEGB 4USTA 3DLHA 1Q8IA 1F9FA 1WC3A 1TAUA 5D6GA 4B3MJ 1RAGB 2EEYA 1RT6B 3KG4A 3CDUA 2WVFA 4NLPA 2N7CA 3VZHA 1S0MA 5KT3A 3IS9B 1QVGR 1AROP 2JVRA 3P8BB 4Q5VA 4HACA 2UV8A 2VA2A 3QIPA 3KJVA 4HDGA 3TZYA 4GRSA 1IBMJ 4M5KA 5I3UB 4JI3J 3WZ0A 1IWGA 3GJSB 2XMAA 2N3OA 4DCPB 1LWCA 3CCQS 4FBUA 1X0FA 1NPRA 4DR5F 2F8HA 3H2VE 3HKZD 5C42B 3JSBA 5KT7A 3OLAA 1N5YB 5DLFA 3CJKB 2J8AA 4LF1A 2F4VJ 3Q0AA 3HVTA 4NRUA 1T9YA 3DN9A 1QDUB 2KHCA 4J9VA 1FK9A 1FXDA 4XO0A 4TU7A 2KN4A 2BOPA 2H4YB 3SDEB 2AT1B 3FBCA 3KKFA 4ZJQA 4Y3CA 3BO2A 2YWFA 3LOUA 5C5JA 2OMOA 4TU8A 3AXKA 3G8TA 3M9NB 5JVGQ 4L75A 2R8KA 1HHSA 2YNGB 3MMCB 1T03B 2O66A 4NCGA 2DNQA 4CLFA 4TQRA 3Q2SC 2RAQA 4C2MA 5GMDA 1H2UX 5E3AA 4NXMF 3I56S 4UTGA 3H20A 1UJ4A 1G1XA 3OJSA 3DOLB 4ZCKA 2VBYA 2VG7A 3W7BA 2J0QD 4ANDA 3GJTB 4DBQA 1GH8A 4QWDA 2JEIA 2E5JA 3OL6A 4GKKF 1RWUA 3J7AN 1FEEA 4IKAA 1UZDA 2QEXS 2NXJA 1DAXA 2JFKA 3GV5B 2HNYA 3MCOA 2FHJD 1NMEB 1ZH5A 2VFSA 2UXCJ 3MM9A 3MR3A 3PYGA 4KHPF 3V6KA 2LQ9A 1HNIA 3G82B 2MKKA 4NZ7A 3PACA 3J81Y 4RW4A 1PJ6A 2ACYA 4YS2A 4JV0A 2D41A 4YDXA 2H51B 3V81B 1RJJA 3DRRB 5GAHI 2YX7A 1TKXA 2MKYA 4JOUA 2ZJQQ 2BJEA 4B9TA 2CNOB 3E01A 2OPRA 2NS1B 2CQ0A 3O2IA 2QT7A 3QWUA 2VQFJ 4F0KA 1RTHB 3CCUS 2JJ4D 1MROB 3L3CA 3DOKB 5HK4A 4LF7J 1N52B 4ITSA 2CNNB 1L3VA 1VBKA 1KNZA 2EFPA 1S6PA 3AHPA 3C6UB 1FNXH 1SKUB 4HLBA 3N79A 3O44A 1RYRA 2RD5C 3KLEA 1YRXA 4ZCMA 3DLGA 3JAMU 3IP0A 1TK8A 4GVLA 1RGVA 4URSA 4DSJA 2DXEA 3VALA 3MD3A 3C8YA 1NO8A 5D4NA 1FFGB 3QAUA 2DGTA 3MUMP 4ZVSB 3LPYA 4YR0A 1C0UB 1F6TA 5IWAJ 2BRLA 4UF4A 5E7OB 2FJEB 2VASA 2HW3A 2PI4A 1ZM9A 3BYRA 2GZOA 4EBCA 4Y2MA 3QFWA 4U6PA 1UVJA 4DX6A 3A12A 4LF2A 4K5RA 2PO4A 2R7XA 4K0KF 4MFBA 4DUZJ 4TU9A 1LW2B 3PYFA 5AXMA 4I7FB 1IM4A 1HQUA 1XMOJ 1OS5A 2EBGA 4IQXA 3GFYA 3JYTA 4DL3A 2GIFA 4HTJA 3C15A 1NM2A 4F2RA 3BO4A 4BWJA 1FJEB 4RNOA 3K89A 1UPPA 3I82A 2DT9A 4ECVA 1B70B 3THTA 4F3MA 2F8MA 4ECWA 3AD7C 1RADB 2XNRA 5B7WA 3EX7B 1KP6A 3R5DA 1UKUA 3CTRA 3HHDA 2YNHB 4C8MA 3R6GB 3HP6A 4KV8A 2W9BB 3VZIA 1XERA 2Z2LA 3UE2A 1K1SA 1DTTA 1SJ1A 3HLUA 4ZVHA 4NLQA 5IFMA 1HBOB 2FD2A 2CQIA 5AE2A 3AODA 3H40A 4YP3A 1CJKA 2RQCA 1D0EA 4LVOP 1RT7B 1WG5A 5HBMB 4OJGA 2VL1A 3J7YI 2F8EX 1CS4B 2CPIA 2Q3PA 2ZZMA 3D2WA 2XI3A 4BDPA 1H72C 2XMKA 3GSIA 4LF6F 2OAUA 3RBXA 5BXIA 3MR6A 2DGSA 2E66A 1Q0NA 3HO1A 3B4MA 2DB1A 3PW5A 2FIUA 4DR3F 1TELA 3RW6A 3OR1A 2XGQA 5L1IA 4QOTA 2JNJA 3NNAA 3TAMB 2BR0A 4P7VA 3W61A 1HPZA 2J0WA 2HK3A 2B4VA 1H74A 5RUBA 1HIYA 4DR5J 2XQCA 2HFNA 2FVPA 5IXUA 2KJVA 4CM0A 5KFWA 3TI0A 3NLCA 3BO3A 1BWEA 4ZPDA 4WFBQ 2UV8G 5HANA 2E5GA 4CO1A 2CQ2A 1YJ7A 2BZ2A 4B17A 1AFIA 3R3TA 2V63A 1AUDA 4B9SA 2YWHA 3RB3A 1U8WA 4NXNF 3M30A 1HL6A 4V1Ak 1N36F 3W5ZA 2Y3YA 3FFIA 5IM0A 4HHUA 2HZAA 3KHLA 1K8AT 3MDFA 2FZGB 4NLXA 3K5OA 3M8PA 1HBUB 3AB4B 1EARA 3QRRA 1BGXT 4C11B 2CA9A 2ZOMA 2RDJA 4QIFA 1XWLA 3PEJA 5DM6Q 2Z8QA 4GKKJ 4YY3F 3S6EA 2QA2A 5K14A 2J9DE 3HMJG 3T5KA 2HBYB 3BR8A 4LSNA 3K17A 4NX9A 1FDAA 2F7VA 4CTAB 5I4MA 1KQSR 3S8SA 1OPZA 3DKDA 1VK8A 4CQ1A 2RHSB 2GC8A 3IBFB 1BQNB 4YOEA 3QO9A 4KHPJ 2V2ZA 1BMQB 1VQMS 4B9NA 1BY9A 3W9JA 4F3OA 2JRSA 1J5OB 1RACB 2FVSA 2KVIA 3MPWA 3I6PA 2ADCA 1UVIA 1DHMA 4ZITA 3KLFB 7FDRA 1AZSA 1N5VA 3OQ2A 4OHWA 2HHHF 1GX5A 1FJ7A 4OIXA 5KFVA 1DRZA 4DSEA 3POTB 4DSFA 2LEBA 2FC9A 4YMEA 4DPWA 4IO1A 1U2RA 4HYKA 3SCLE 2KJWA 2LU2A 1FI4A 4Y2AA 2WW4A 1NJXA 4IG3B 4GO5X 3IMQJ 5GADU 2NPIA 1GMVA 4CRJA 2YKMA 1P27B 3PR4A 3J81U 2LEAA 3HULA 2BEFA 4YB6A 2OFGX 1FTRA 2GQ2A 4FF4A 3K5MA 1PC4A 3NMRA 3OL7A 4MYTA 4DU7A 2GNKA 3HSJA 3CCRS 2V2QA 2VC1A 2AYEA 1S6QB 4KYZA 2RQ4A 3NXZA 1H3DA 1NAQA 2Z4PA 4QWCA 3M7VA 4ECUA 1L5UA 3OUYB 1U1PA 2BJDA 1N88A 5HSPA 2HAFA 2WONA 1CC7A 4FP9A 3LTOA 4ED0A 4MKVA 3OTCA 3FCVA 3M4XA 3FVYA 2YNFB 2XYPB 4K0KJ 4IG0A 3HHLB 5HVHA 3MF5A 1XNQF 3K59A 2QIFA 2V67A 4WYLA 4OZNA 1FTCA 2F40A 1WACA 1FJCA 2PIIA 4OMFG 3DXSX 3PJWA 4PQAA 3GFZA 2HNDA 2BKOA 4NMXA 3Q8VA 3Q8SB 1V3SA 3N5FA 2R2RA 2FHKA 4G65A 4ED4A 7AT1B 1TUGB 3D1QA 3CMAS 2DEIA 4YFUA 1RT1A 2WHOA 3KLHA 2JH3A 2MHNA 2CQ1A 5CD4H 4HKQA 4HH0A 4CT8A 3CULA 4Y65A 2R7QA 4ANCA 1R0AA 2DO4A 2C1EB 4MIBA 2DR5A 3LO3A 5G0RB 1NB7A 3KK3A 2KO1A 4M5JA 3KK2A 3ENAA 1E6VB 2FJWA 2DRDA 2DD8S 5THWA 1CQNA 4LF6J 1Q86T 2D3O1 3WC2A 2VQEF 3BN4A 3MTKA 2ZH8A 2MB0B 3UPFA 4L6V3 3V4IA 4ZPWR 2VFRA 4TXSA 4O3NA 1SL1A 3MAHA 2HLUA 1NJWA 2DHSA 1JB0C 4IO9Q 3W2VA 3DOMB 4KJIA 1QUPA 2I1RA 1HQEA 3RUBL 3VAKA 4DR3J 4OYBA 3EDRB 2XY6A 2MKSA 3DRPA 5K8OA 2E1MC 2VD3A 5KFDA 4BC7A 1ZA1B 2RKIA 1TFYA 4K4YA 3AQPA 4XAKA 1ZYQA 2FUG9 3NS7B 3TNVA 2RUSA 2YPYA 4DX8H 3MM8A 3MEDB 1T05A 1S72S 2XHWA 4RNMA 1VQOS 1PC5A 4WU2A 2RE1A 4NYPA 5I42B 5G4DA 2ALYB 5HMZA 3FRZA 4AFFA 1FDNA 4CH7A 4IH6A 1N36J 4ENOA 1ZOTA 4L72B 3FKBA 1WOOA 2RDIA 2V8PA 4RZRA 1EAYC 3CCZA 3JXOA 4NCAA 2PGCA 3VTIA 1KOOA 3H7HB 3HCXA 4WTYA 1YDLA 1KLNA 2OPQB 3D0HE 1YKWA 3OL9A 1P6TA 4I6AA 2RQMA 2W7AA 2V4QA 4FZVA 1VJWA 1T9XA 3CUNA 2EBEA 4N5SA 3UI3A 4ZPBA 2BANB 3QGIA 1CJTA 2YNIB 3IM8A 5BYRA 3QSIA 2FPHX 4YY3J 4RUBA 4NLOA 1NRKA 2D9OA 1L3KA 2LDYA 5J1EA 3M8WA 4WIQA 1WC1A 1D9FA 2V8GA 1W7WA 1IBKF 2RUGA 1KFDA 1K9MT 3BR9A 2HVDA 3FGVA 2GVZB 3GYGA 1JLGA 4Q45A 2HMIA 3OFGA 3OLBA 2YWEA 4P2FA 1NB2A 2D3ZA 1A9NB 3MOZA 1TUWA 2QRRA 1YJNS 1FRXA 2VU5A 2X1AA 4EU0A 2ROEA 3CDEA 4M5IA 2XCPA 5A8KA 5F8NA 2XMUA 3EGWB 2HHHJ 5FLXY 4RBUA 5KFFA 4CLSA 4IFYB 1Q5YA 2NREA 3I0RB 1KR4A 5FDLA 3VGTA 2DGWA 2BJ1A 2MKCA 4KAIA 4PWWA 2KM8B 1N56A 1BLUA 1XMQJ 1IWAA 4X84A 4HL9A 4LRAA 3DXBA 4B9UA 1Y3KA 4ZCIA 2FGOA 4G1PA 4M5HA 1YJ9S 5CYMA 3VAGA 1U1QA 5E41A 2YQ3A 2W2QP 1QD1A 4C0OC 3DCAA 4IRCA 3VQSA 2P9GA 2HFOA 1HBNA 1GAOA 2GGPA 2KXHA 4U95A 3TVKA 3OSPA 2E1PA 4KIAA 4MKYA 2WW8A 2O67A 1M5OC 2QLJB 2K7KA 2NXCA 3FSXA 2BA9A 3MPVA 3MR5A 1QUVA 3NGSA 3J80U 2HSEB 3MEEA 5GAGI 2ZITA 3C16A 1YRTA 2HVIA 4J7CA 3M1VB 4KFBA 3ZZ0A 5DRKA 2BYCA 3NCRA 3A8EA 3V6HA 3DHWC 4CCHA 1NK9A 4O3PA 4CLPA 3PNIA 1NEEA 4WFYA 1U6FA 2CZ9A 1U48A 2NZ4A 3SI8A 2ZHAA 1IM6A 1CJVB 1ZM3A 1X60A 1S4EA 2ZUGA 3ET6A 5T41A 1Y4ZB 1SC6A 3ILJA 3W5XA 3KK1B 2XULA 1RUSA 1WNEA 1D3WA 4IR1A 1SL2A 5B0CA 4Z2XA 4DV4F 2OH2A 1VQ6S 5I3QA 2GHPA 3TVYA 4BBYA 5LSRA 4L76A 1K0VA 1GT8A 2ZH2A 2IY5B 1BE4A 3KFWX 2KFNA 8AT1B 1O6XA 5HVGA 2HHQA 5DJBA 1RT2A 1JNRB 2E9RX 2XEXA 2FVRA 2C3PA 2QZ8A 3M6UA 3NS6A 1NJZA 4OFZA 4E98A 2KVQE 1NKEA 4K4VA 3M2UA 4KGMA 1H2VZ 2CJ9A 2J5AA 2N4DA 2ZEJA 2DISA 1GTHA 1GFWB 1IJFB 3FSIA 3PX0A 4A8XA 1NZAA 1UWBB 2EXUA 5KFLA 2C3MA 2XTJP 1RLDA 3BH7B 1RAEB 2B5JA 3M2VB 5B08A 2VQEJ 3VR1A 4OI1A 4RW8A 3E2EA 1RWOB 1UETA 4DR7F 4ZLNA 3DLJA 4HDHA 1VDHA 4LUBA 4MKAA 3IRXB 4QWEA 1R89A 4K50A 3ZC4A 1TKTA 4QR1A 4Y2IA 3IA0A 3SEOA 3DDNA 2MY7A 5KFNA 2NR0A 4C8LA 3LP0A 5E3PA 3TUZC 1S1VB 4RW9B 4UY85 1S9EA 3MEGA 4UQTA 3P6YC 3IAS9 2X1BA 4IH5A 1L3SA 2ZD1A 3EM1A 1N54B 4DDFA 3QATA 5GAEU 1M5PC 1QAYA 3KLGB 1AB8A 4OZ1A 3D67A 2KXFA 1KKHA 5CQGA 2AZ3A 2YQ1A 3C6TB 4PWDB 1RI7A 1JLFB 2GIRA 4C8ZA 2ZH3A 2PMHA
chains in the Genus database with same CATH topology
2ILZA 1Q78A 2CQDA 2R7RA 4HT7A 3FEXB 1HBMA 1NJIT 3UWTA 1FA0A 1FKOA 1U1LA 1RT7A 4OI2A 4LMZA 4RW7A 3T1YF 5A8WB 3GG1A 2XLJA 2OTLS 1S4FA 5HBMA 4JI0F 4DEZA 3HHLD 4J9NA 3N6MA 4R5PA 1DURA 2ZKUA 3C66A 3TA0A 2ASDA 2HNDB 2L9NA 4F4YA 1JLEB 3OFEA 2VG6B 1FDDA 2QYCA 1NJYA 1U09A 2DCUB 1Z2ZA 1VLYA 3JAMY 2RQKA 2OPSA 1VQ8S 2VPXB 4FS2A 3LWLA 3IN5A 3D54A 4WFXA 3KLHB 4X4SA 3B4DA 4DQRA 2U2FA 4X4TA 5J2PA 3FMBA 4C7QA 1U24A 2V94A 3RW7A 1JJ2R 3AY0A 3CC7S 2VQFF 4BC9A 2GW8A 1S9FA 4FF3A 3MM7A 3QJPA 4OQJA 1S9EB 4FBTA 4I0WA 3UW1A 2XGPA 1UVLA 4NZ0A 4KSEB 4NLVA 3I4PA 1MWYA 4ZDNA 4CT9A 1SIZA 3QWPA 3GIJA 2VOOA 4DFPA 2UUWA 3BJYA 1R0AB 1F2GA 4WKYA 4K4SA 1U26A 2HPUA 2M52A 1VC5A 3SCKE 2GJ2A 1N5TA 6FDRA 5JVHQ 3BQ0A 4EBDA 2P9EA 2WSCC 1Y5LB 2KT3A 3LAMA 4I68A 4ZP7A 1DTQA 4OI3A 1VQYA 1FXLA 1CG2A 1CEZA 3T19A 4NWBA 1H38A 3QJLA 1XC9A 4I64A 3EGNA 1R8HA 3HHLC 2BQUA 4JI4F 3BSCA 1H7XA 4ID5A 4UW2A 2JC0A 3T9NA 3TX8A 2UVWA 2ZZNA 2E1AA 3TAMA 3DI6B 3ENQA 4F4KA 3DYAB 5DGBA 4A8SA 4FNIA 3KK3B 3OJUA 4PG8A 3KLIA 3UFCX 1S10A 2UUAF 5DQHA 3JTPA 1LFWA 4FXDA 3JSMB 2NSCA 2XY5A 4C4WA 3UDLA 3EZUA 2HWTA 1FRMA 2FLNA 3KK2B 3K8VA 1VQLS 3PVXA 3HI9A 2YWGA 3AJ2A 3TP2A 1JLCB 3UD3P 4DR4F 4ELUA 2FTRA 1BQMA 4N56A 1LW0A 2NPFA 4DQSA 4L3NA 3L7OA 4K2XA 4EYIB 4IH7A 2LA4A 5M2RA 1R3NA 4J9RA 1U47A 2BW2A 5IWAF 1Q16B 3BGUA 3P3DA 4HH1A 5CYQA 1F5AA 3THVA 3R1LA 4Q8FA 4DJBA 1OO0B 2AU0A 1WF2A 3RB4A 3V4IB 4CO3A 1FRKA 2ZFHA 2Y1JA 3I5AA 5GAEI 4R5PB 2G13A 1NK5A 3CB4A 1V3RA 1SJQA 1SH3A 2YY3A 3G8QA 4WE1B 2VUGA 4QU7A 2ABYA 3W2VB 2CPYA 2QA4G 1SKWA 4IOBA 1K73T 3FQLA 2LXIA 3MWBA 4TY9A 4I1TA 1D8YA 3BS9A 4V19X 1TZ0A 4DUZF 1VC6A 3NP5A 5LMNF 2ZBCA 3SQGA 5LT5A 4NA1A 3C2PA 1LK5A 3QLHB 1F5BA 1QSYA 1IR0A 2RF2A 3R1HA 2CQ3A 4LF8F 1UVMA 2L9DA 4JI5F 3V6DA 3OBIA 2DBBA 1XMOF 4CH0S 2DNHA 4A46A 2GMHA 3LW5C 4U7CA 3DRPB 3UR3C 2H9ZA 2WK4A 4J9OA 2M4MA 2UXDF 4RNFA 3MM7B 3M8SA 5L9XA 2IYIA 3M8RA 1LFPA 4I2PB 3MMJA 2WRMA 1VMBA 2W4DA 3TYTA 5SZTA 1WTFA 3GB0A 2XO7A 1JLQB 4DQIA 1U2FA 3DLLQ 1DBDA 4IRKA 4DV2F 2R8GA 2RKIB 1S1XA 3SV4A 1LK7A 4F02A 3T9ZA 3VAHA 5CA5A 2B43A 3QJJA 3US5A 3OTBA 1N0VC 1UFLA 3JTOA 1HBUA 1YHQS 3K5LA 1TP7A 3BGFA 4EO6A 4LIRA 4DS5A 2NSBA 3PRBA 3MZIA 1P1LA 1HI1A 3OSNA 4KHMA 2L9WA 2MZRA 4ID5B 2RH3A 4YQWA 4QPXA 2DR8A 3HHKA 2DGXA 3MM8B 3HF5A 4QPTA 2PFFB 1R8BA 1JX4A 3RRGA 2Y1IA 2L08A 1T05B 4C11A 4Z37A 1R6YA 1U1RA 3KLIB 1VRTA 3T1AA 5L38A 4RWWA 2AYMA 3TVZA 1KHWA 3ITHB 1RA6A 2JX2A 5ITHA 3H2LA 1LWEB 1ZBTA 3MHYA 4D3GA 1L3UA 2YKNB 3ZZOA 4DN0A 1FRLA 1BQMB 1YWXA 2KRBA 5HI7A 4F4XA 4A47A 2FJXA 2HHTA 3IBWA 3SSQA 1Y9OA 1B64A 4ALZA 5BJRA 4J5OA 2V2KA 4ICLB 2KDOA 2P5VA 3EXYA 4R8UB 3F44A 4DQPA 4WZMA 3OHAA 4TLRA 1ZZNA 1JXLA 4O4GB 5M2UA 2CPHA 2AX1A 1FD2A 1UFWA 1UVKA 2AWZA 5CYQB 4OZ5A 4ELVA 1ZM2A 2PC6A 3JB9k 4DFJA 5KOWA 3PW4A 5D8HB 1QE1B 1TL3B 2ZC4A 4O44A 3TOQA 3T6BA 1BQNA 4B9VA 2IRYA 1YRUA 2FHJA 2G9OA 5GMKa 1NU4A 2R2UA 2J6SA 4AUKA 1JIHA 3VF0B 3KTQA 3PM9A 3MXHP 1RISA 2OTJS 4OZLA 1CC8A 5KAKA 4DL4A 4ZVEA 4DLGA 2VC0A 5U47A 2DNYA 2WSEC 4EYHB 5FIIA 1HYSB 3QZ7A 3CJ3A 3BEGB 4X62F 2YH0A 1Q8IA 3DLHA 1EP4B 1F9FA 1J5OA 3FEZA 1TAUA 5D6GA 3MMBB 2EKYA 1AFJA 5HN0A 2MXYA 4XDDA 1U1MA 3J7A1 1ZTTA 5KFHA 3LAKA 3KLFA 4ED6A 2ERRA 1S0NA 2NYIA 5DM7Q 1RT6B 1FE0A 3HVWA 3KG4A 5E3CA 3CDUA 4EFAC 1R43A 1X5PA 3POTA 3LP1A 1HI8A 3I87A 1M1KT 4B08A 1CVJA 4K4ZA 3IFEA 1DARA 4NPOA 2YNGA 1YTYA 2B7CB 4NLPA 2N7CA 1S1XB 2P6TA 1WF0A 3VZHA 4AE5A 5HLFA 4CNYA 4F8RA 2AJ0A 2AD9A 4X66F 1D1UA 1VQKS 2JHEA 1KTQA 3MECB 1DQ9A 1S0MA 1V3ZA 4YB7A 4ED2A 2RB7A 1HWIA 5KT3A 2MGZA 3IS9B 1QVGR 5J1EB 2J7WA 3ICLA 1AROP 2JVRA 4OZJA 1QAXA 2KTQA 4UUWA 2VV5A 3PIOQ 4IG3A 2FJVA 4Q5VA 4K4XA 2OPPB 2UV8A 4H4KA 1S1UB 3FCHA 4R25A 2VA2A 1Y3JA 2EK1A 3QIPA 5KG2A 3KJVA 4HDGA 2FY1A 2C2RA 4ZMMA 2LCWA 1M5KC 5I3UB 3IR6B 1X9SA 1JLGB 4B3OA 2HMIB 3AJ1A 4Q44A 1CPZA 1NK4A 2QFJA 3HVRA 3BSNA 3WZ0A 5J1PA 4C0BA 5KT5A 5KFKA 4I56A 2N3OA 1IKWB 1LWCA 3CCQS 1GQEA 4FBUA 4WFAQ 4DV3F 1X0FA 3BGRA 2ILYA 2JWNA 1X4BA 4DR5F 2F8HA 3H2VE 4Q8EA 1RTDA 3DNCA 4KC5A 4F50A 3HKZD 2NQPA 2WAQD 5C42B 1C1BB 3MFHA 3JSBA 5KT7A 4C98A 1G7CB 5A8KB 3OLAA 1N5YB 1T8EA 3DRYA 3VWSA 5DLFA 1UMJA 3L95X 4DL2A 1VC0A 2NUHA 4YDDB 1VQNS 3UCZP 3CJKB 1TV6B 1KVIA 2X51A 3NL0A 5BR8F 2J8AA 1P8GA 5EGYA 5HQ8A 3Q0AA 3HVTA 1S6QA 4NRUA 4N76A 3DN9A 5FDLB 1JLBB 5CCLA 3ZZYA 2XMMA 2KHCA 1FK9A 1FXDA 4XO0A 4TU7A 1SKRA 1JJ4A 1Z4UA 2KN4A 4ZVFA 4PWUA 2MJNA 3LP2A 2BOPA 4EGLA 3SDEB 1T95A 5KG1A 5EDWA 3KKFA 1VHFA 3EYZA 4Y3CA 3BO2A 2X1GA 3OUYA 2C3YA 2UU9F 2VONA 2YWFA 5T14A 2YX1A 1VQ9S 3LOUA 2P6SA 5DGAA 1RT3B 5C5JA 2OMOA 4Y2CA 4TU8A 3G8TA 2HGLA 2B4OA 3LQVA 5CYMB 5K8MA 3Q8QB 3M9NB 1U4BA 5JVGQ 1JXEA 1SUQB 2R8KA 3NNHA 2LLZA 5FJ4A 3NMAA 4JYAF 2EK6A 3KMQA 4MJKA 1HHSA 2YNGB 3Q8RB 3MMCB 1T03B