3PITA

Crystal structure of m-rasd41e in complex with gppnhp (type 2)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
168
Chain Sequence
LPTYKLVVVGDGGVGKSALTIQFFQKIFVPEYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of M-RasD41E in complex with GppNHp (type 2)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein M-Ras
total genus 59
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pitA00
4Q66C 4HI0E 4MRNA 4A0GA 4A92A 1SVWA 3EAQA 1E69A 1RJ9B 2BBOA 2J1LA 2YC2C 5D3MB 1DAKA 1MR3F 4NCKA 2RGAA 4OHXA 2WWXA 3BE4A 1S2MA 2ZJYA 1AK2A 3T1OA 1HEIA 2ZRJA 4A1FA 4F7WA 4CRWB 4B74A 1M2OB 3PUXA 3TNFA 2NO0A 2G1JA 1WBBA 2A5JA 3EXAA 2XNSA 1AZSC 2IXEA 1GAJA 2W83A 4BWYA 3IPYA 4DSUA 1OHHD 1L4YA 1YVDA 4GPTA 3ZVMA 4Q9HA 2ZRMA 3ZJYA 4IOMA 4QNRA 5TVKA 4KVGA 1SVLA 2WJVA 3TSOA 1RRPA 1ZYUA 3W8RA 1NMYA 4P0TA 2AR7A 3MWLA 3ZZTA 1XWIA 2WV9A 4OKSA 3THYA 3U7EB 1ZC3A 3ICEA 1HV8A 1G7RA 2CLSA 4M1TA 1GZSA 4HB3A 4ZO4A 1NN5A 1G6OA 3CRMA 5J47A 4A2QA 1IAQA 2FPKA 2GESA 3GJ8A 1P9NA 4QGGA 1Q1QA 4A6PA 3VKHA 3U5ZB 1GL7A 2N46A 3FMPB 4TQ9A 2JJ8A 3W6NA 4B48A 2ZE5A 1YZUA 4MDEA 4LPSA 1E2QA 5KSPA 2OT3B 4WAUA 3LBNA 4FMDF 3R9WA 1NLZA 1W36D 2C2HA 3IBGA 2ZRFA 2GDJA 3CO5A 4PC2A 1R0YA 4NCIA 2CNWA 2QQEA 2WMNB 3EA5A 3IHWA 2R62A 4ACBA 3DZDA 1N0VC 1JAIA 1TQ2A 1GP2A 2Q9AA 1DO2A 2MMCA 2QQ0A 2D2FA 4MA4A 4DDUA 2PT5A 5CM8B 2WOOA 3LAWA 2KE5A 4RD0A 1B0UA 2QAJA 3U4QB 3EX7C 2NMVA 4PAOA 1VKJA 4MH0R 1E9FA 4DUGD 4GNKA 4BEJA 4I4LA 4FCWA 4GMXA 1BO6A 2KBEA 2EWWA 3OE7A 2WWHA 1G17A 4EKDA 1M7BA 1F5NA 4M1OA 3KL4A 3FYHA 2XXAB 3DHWC 3EIQA 4W5HA 1W46A 3K09C 3NG1A 4V0MA 3DMDA 3QOFA 3LDAA 2WWGA 3OIWA 1W0JA 2C98A 2C9YA 2CVHA 3EPHA 2WPDD 2B92A 4EJSC 1CR1A 2B7BA 3MUFA 4Z1MD 3IPXA 4F93B 3N70A 4NMMA 1W5SA 2REXB 4P4TA 1EX6A 2CE2X 4V0LA 3QXCA 1N2CE 3FHOA 3ND8A 5L3SA 2BBTA 2TMKA 2QP3A 2GA8A 5EXTA 1G7SA 4JS0A 1G4UR 5EZ5A 3UG7A 4A2WA 4PC7A 4KJZA 4ZKEA 1ZNXA 1OF1A 2R6GA 4B33A 4LHVA 4F4IA 3CF0A 1TTTA 1AZTA 1S96A 4FMDB 4KBFA 1KI8A 2V6IA 1MO6A 3KUDA 3WBJA 2QPAA 1F2UB 3AVTA 4JZKA 4N3NA 5A4JA 1KK2A 4NKRA 3CWQA 1R6BX 1V43A 3FGNA 1Y63A 1LF5A 3MG9A 4HAUA 5FTKA 2X1VA 4PO9A 3SYNA 5HKKA 1XMJA 3WMEA 1LNZA 1AQYA 1OV4A 2HYIC 1S0UA 4M1KA 2QAGC 1A5TA 1QDEA 1O87A 2IUSA 2IXGA 4LC1A 1PUJA 5L8VA 2J0UA 3TAHA 1DARA 5JWOA 2AXPA 1KKMA 3DOFA 1W7AA 2HJGA 4D4JA 2BMJA 2ZVPX 1JPNA 1E0SA 2CL7X 4ZCMA 1W0JD 2C04A 3GMTA 1X6VA 1KIMA 2F1JA 5C4GB 4NU0A 3RSOA 4RSGA 3VMFA 4RZ2A 5DI9A 2XSZA 3O8BA 3A37A 5EE9A 4BRUA 2ZRCA 3N2IA 2PEZA 1XBTA 2J46A 3PQCA 2W2XA 4R9UC 3FWYA 4B3DA 4MUAA 4URWR 1N6PA 2PJZA 2C5LA 4TT3D 1MT0A 2GAOA 5FPKA 1W0KD 3GPLA 3RAPR 3AVWA 3A8TA 1G16A 3AP3A 1G64A 1G8PA 2FEOA 2O5VA 3M6AA 2O8DA 4RZUA 2ZJBA 2FGJA 1GKUB 2GEVA 5J4LA 2WKPA 4PTLA 2YV5A 5DISB 1GRNA 3LD9A 5IDVA 3A6PC 3FHTA 2AK3A 2YNMA 1O3YA 5IF9A 3A1UA 4K8OA 1W5TA 1KO1A 2CL0X 3D3QA 4HDQB 4TMVA 2RCNA 2VL7A 5DYGA 4DCTA 2IYXA 5EXPA 8OHMA 2V4ZA 5CIWA 1XU4A 4QFMA 2F1IA 4XSGA 4GBMA 2EQBA 1HE8B 1UPTA 1IY1A 2OE2A 4LCBA 4OK3A 2JDIA 1YZTA 4WIAA 3MCAA 3B1WA 3K9LA 1K5GA 4JVMA 4B6EA 2FNAA 4HYYA 2ZE6A 2QPOA 2AFHE 2REBA 4DDWA 3GLHB 5A5GA 2A2ZA 3WHKA 1EG7A 1JNYA 2QROA 3BH0A 2WIAA 2B6HA 4MYCA 4PO8A 4DWJA 1KZ7B 4YLGA 2A5DA 1FUKA 1F3OA 1KY2A 4CGZA 4KODA 1UKEA 2BMEA 3OFNA 1QHHB 1CP2A 2PMDA 3I92A 3OEEA 3VR1A 3ZH9B 2G0NA 3PUVA 1JR6A 2FN4A 4B43A 3TIFA 3FDIA 1SXJB 1E9DA 5JSZB 5KOYA 3FKQA 3TUJC 1UBEA 3AKCA 3K0SA 2JIZD 3I73A 3R20A 5JS7A 3NDPA 2IT1A 4G5GA 1E2EA 1N5IA 4JYBA 3CZQA 3PEYA 1IONA 4B71A 1KSJA 3QXSA 4DB4A 4HDOB 3VQTA 2HDNB 3VNUA 3L0PA 5CDFE 5JLJA 3W3AA 2V1UA 3SJAA 4BPBA 2I1QA 2ATVA 5AK0A 3KKQA 5H8WA 1XXHB 1XJ0A 3U4QA 4P3YA 1DTSA 4POAA 1RKBA 1A4RA 3ADCA 4E22A 1OIXA 1P9RA 3W3ZB 4XD7A 1KNXA 2AKAB 2V1XA 3S1AA 1P75A 5JS8A 2IWRA 3I5YA 3GLFA 3EIEA 1W47A 4BUJA 3C14C 4P31A 4B2LA 5K8UA 3Q5DA 1L4UA 4LYJA 1KDOA 4LV8B 2OV2A 3KTAA 1KI4A 4TQAA 2J87A 2IYVA 1UAAA 1UEJA 4DSTA 4OBEA 2PCJA 5KSYA 4B3BA 5CITA 4KYUA 2MSDB 3RNLA 1VCOA 4KO8A 4QHTA 5EJEA 2NZ8A 2ATXA 2ORWA 3GFPA 4TN1A 1XNJA 3BH7A 3MMPA 2QENA 5JHGB 1E98A 1JI0A 2V54A 2GJKA 2ZSAA 5FPYA 3RWMB 2W00A 2BHRA 1DAFA 1XEWX 2H18A 2NGRA 3DKVA 4DUGA 5LD2C 4RFSA 3TW4A 3TW8B 4HB4A 4MGYR 4A6XA 2GKSA 1E2IA 4KSCA 1ESNA 1CS4C 2VF8A 4JBYA 2XTMA 3UMRA 5BW8A 3O47A 2P6NA 3MFYA 3NXSA 4JLDA 1VG0B 5EP1A 1CJTC 5JWRA 5IRCD 2P67A 3LLMA 3L0IB 5DN6A 2A3RA 1YQTA 4HEJA 3IEUA 1I4LD 3U3RA 3ZQ6A 2O0HA 4OQLA 4L16A 1GL6A 2CDNA 2D62A 4XOIA 1N6NA 2H5EA 1TADA 3NWJA 5CDFA 4HLUC 4NCJA 4R2HA 2ZRLA 2NTYC 1G5PA 1N0WA 3NEYA 4HLCA 1T3HA 4XWKA 5JCZA 1CR0A 3DKPA 4RFSB 1FMLA 2ZJOA 4I81A 2A5FA 1XRJA 1XEXB 4LJYA 2ZROA 1CIPA 5E4FA 3EWSA 2DHRA 1X8JA 2BM1A 3T5DA 1XDBA 1W48A 1X3SA 1JR3D 5AJYA 4ZCLA 1U0LA 5FR2A 4FWIB 3NHAA 2RKOA 3QF4B 4DEXA 2VHUA 1KO7A 3WXMA 3KQUA 4HDCA 4LBWA 2BJVA 2H16A 4KXFB 1I4TD 3M0EA 4G1UC 3AEZA 4I1VA 2FSGA 5DI3A 4F38A 1Z83A 3K70B 1SVKA 2DFTA 5EE0A 2DFNA 1W4AA 2MSCB 3Q7PA 4IXMA 3REFA 2NZJA 1HUQA 5SZJA 4I99A 1X1RA 1VCMA 5G3ZA 1KTVA 2XSZD 4LPKA 4JSTA 3ZIAA 3EA0A 1LW7A 2JJ2A 4KFRA 5GADl 4B32A 5AUNB 1GUAA 3B1ZA 1X8KA 1CRPA 1E2PA 4F92B 2G88A 2QM7A 5HE9A 3QF4A 4I1OA 3ZLJA 1WP9A 3N2EA 5FUVA 2E9SA 1GFIA 2LWIA 2F55A 2CHVA 1Z0IA 3EW9A 3CRQA 3GFTA 3NKVA 3PUYA 4PZYA 1NSFA 2NO1A 2BC9A 2OM2A 1FTSA 2XEXA 3FFBA 4UXHA 2JLWA 3K1JA 3NBXX 2F6RA 1H8ED 4OI1A 3FTQA 4Q4AA 1NBMA 3AB3A 2RGEA 2WMOB 3K0EA 1U9IA 3RS7A 1XX6A 3QEJA 2V3CC 1P60A 1Z3IX 4TTQA 3ZVRA 3C5HA 2R6CA 1E2LA 3V00A 3SQXA 1P7CA 2IK8A 5BYJA 4Q9LA 1AIPA 2ANBA 1W36B 3UIEA 3RS2A 1XEXA 1BYUA 1OJLA 1QHYA 1ZNZA 3P4YA 3K70D 1E9CA 2A30A 3MGCA 4GZMA 1MRNA 5H70A 5JJIA 2QE7A 2XJ4A 2JCSA 1Y3AA 5AUQA 3TK1A 1GKIA 5K8LA 3O8RA 4US0R 4FWTA 1KO8A 3KJEA 1OW3B 3CLVA 3LXXA 4JL6A 4Q9IA 1P2SA 4DHEA 5UKDA 3TLXA 4GT1A 2ZITA 4ZCIA 1J2JA 1G20E 2IHYA 3KKMA 2ZRNA 4Z1MA 5CJ2A 2IX3A 1HT2E 2BIFA 1NNEA 2GXSA 2QTVB 4LRWA 1DEKA 5JMTA 1T4GA 1U9IC 1H8HA 3QKUA 5DH9A 4JLPA 2GJ8A 2ZANA 4H1UA 1G19A 4TL6A 2QI9C 2FWRA 4ARZB 1RW4A 4DCNA 2WJJA 3OIYA 3A4LA 4EFMA 4DRZA 3EZFA 3VU9B 2B8TA 5HPYB 1IN6A 1II8A 1UBFA 2F9MA 3HP1A 4MYHA 4EUNA 1G3UA 3QG5A 4DC9A 2VP5A 1MH1A 4JT4A 2Q3MA 1J70A 4QJ4A 2BKEA 1DG1G 5EXSA 3SR0A 3CM0A 3HR7A 2FA9A 2NQ2C 3JVUA 3WRXC 1E96A 1T0JB 3VR5A 2KB0A 4DVGA 1ZD9A 5J40A 2JA1A 1Q20A 3SZRA 3B7GA 5EE5B 3Q3JB 1IN7A 3GLIA 4LYHA 1EX7A 1SXJA 5J4VA 3Q85A 3IUYA 3KB1A 4MGZR 1IY2A 1E4YA 3IGFA 3DVLA 4HUQA 4TLCA 4X8LA 5KDLA 1KK3A 3LWNA 3OIVA 3BJIC 3AF4A 3RS5A 3X1DA 5KNCA 1UKZA 1G8GA 1P2UA 5DSZA 2E87A 2FF7A 3BAFA 3AH8A 3PV0A 1HQYE 4IDQA 1G9XA 1N5LA 2D74A 2HXSA 4Q4JB 5DYIA 2AXNA 1I2MA 2RGDA 4WW0A 4BFVA 2FJUA 2N42A 5CLLA 4M9QA 4V03A 5A0FA 3LV8A 4A0RA 2QP9X 4RZXA 4DLSA 2YZ2A 2JJ1A 3T15A 2FFHA 5KNDA 1JQLB 4C0BA 1TEXA 3VR3A 2CLDX 3K53A 1Z28A 3VFDA 4NCNA 2QTFA 4G0NA 2QM8A 1N25A 4UJ5A 1WCV1 1SXJC 3SI7A 3CNNA 3SN6A 3E70C 3CRRA 4P32A 4PZZA 3RRZA 4MRVA 2IS2A 4F91B 4LYAA 1P6XA 2GRJA 4EFLA 2FGKA 3LNCA 3GCGA 3AF3A 5J4YA 4G5OA 4PHFA 3IQXA 3H4MA 1UF9A 1XB2A 1TL7C 1SULA 3P27A 2O8BB 5GJBA 3QBTA 5JBQA 1CULC 1CJVC 3AVPA 4LJ4A 1Q21A 1Z08A 5EP4A 3G82C 1E0JA 2VP0A 4UQOA 5TARA 2CK3D 4TSFD 5KYKA 2ASEA 2GCOA 1A2KC 2C95A 3KXIA 4RZ3A 4UJ3A 3RANA 1MRSA 2WKQA 1TF2A 1U94A 2GETA 4RKFA 2PX0A 4CEIB 2XZLA 2YWFA 3AP1A 3R9IA 2QBYA 1VMAA 1ZD8A 1N6RA 2HCBA 2ZJZA 4HUQB 5AJWA 1XD8A 1OXTA 4P4SB 4DDTA 4U02A 3T1QA 2QA5A 2DCUA 4TMTA 3DEFA 3PG5A 5F98A 4ESHA 2IYTA 2IC5A 1DAEA 3CPEA 5DHFA 4M2LA 2F7SA 2ZSFA 5G53C 5JI2E 1D2NA 1KHTA 4TMWA 3OFND 2P3SA 1WRBA 2VHTA 3X1YA 1XFAA 2O8EA 4FI3C 2EU8A 1YZQA 2A78A 2XTNA 3GJ6A 3ZVLA 4CIDA 3AVXA 2JJ1D 2ZYUX 2H8KA 3U61B 2W2TA 2FU5C 5JI3E 1FFHA 1WB9A 3DM5A 1VIYA 4U7DA 1CBUA 3ZZ0A 1NVXQ 4A36A 4W5JA 2GZDA 1KDTA 4Q7KA 1C4OA 2J0QA 1NRJB 1Q3HA 1UJ2A 2ECKA 2R6FA 2XNDA 4PPGA 2JDID 1FUUA 4DIDA 1SKQA 1G8FA 1Z6XA 2ZAOA 4JLJA 1ANKA 4CEHA 4PANA 3NVAA 4RCYA 4QBFA 4EDHA 2D06A 1K6MA 1SVOA 2QUZA 2WJYA 3RRMA 2LKCA 1SXJD 3LBHA 1GL9B 4IXNA 4EQ6A 5E7JA 5FTNA 4QGFA 1KOFA 2IEZA 2ZRHA 2W58A 2Z4RA 1AQUA 2ZS8A 1OIVA 2P65A 4Q02A 2AL7A 4QHSA 4RD6A 2ORVA 1J8YF 2J0VA 3FE2A 2D7CA 4URUR 3GFOA 4KBGA 1ZU5A 3TJZA 1Z0FA 1EFRA 4TT3A 5FOUA 2PZEA 4AYTA 3KQHA 4IOKA 2NG1A 4LY6A 4II7A 4F4JA 3NHBA 1L8QA 4TL8A 3I61A 3QBVA 4A0HA 2EFEB 4PPFA 3CIOA 4B2IA 1K5DA 1CU1A 2WICA 2X8AA 4OI0A 4JT2A 2AHOA 3AGPA 2ORIA 3JVVA 2RHMA 2DFLA 3RVBA 1KI3A 1EFUA 1N6OA 4N1AA 2GVZC 1S3SA 4DSNA 1NY5A 5DHAA 3OF5A 4A9AA 3VKWA 4LDJA 5G3YA 1W36C 5LB2A 2IEYA 4GMDA 1I2DA 1KMHB 3WMGA 4M1SA 3NDBB 1L2TA 3D6TB 3QVUA 4ZI2A 5AWFC 1VHTA 2V7QA 4Z51A 1W44A 2HYDA 4MITA 2IUUA 4TLEA 2W6JD 3B1XA 3Q5EA 5KDOA 2WZQA 4LV6A 4LI0A 4US2R 3KFVA 2O52A 3T12A 3LW8A 4M9XA 2ZSEA 4V0NA 1NSTA 5EQTA 1E1QD 5FL7D 4DLWA 3QY0A 1RPZA 1ZNWA 3BB1A 2VEDA 2WVJA 4LC0A 3W5IA 4WA7A 3P20A 1KYIA 4MGIR 2P6RA 1P2TA 2IWHA 2CMKA 3C41J 3RWOA 1FNNA 4YMSA 5HR5A 3GJ3A 4EPVA 4DLZA 1HYQA 2VYFA 3AVVA 1ZMXA 3GEEA 4A8JC 3TGPA 4NCHA 1JR3E 3A4NA 2PLFA 3SBEA 1IHUA 4D0NA 1E4VA 4C30A 2JAQA 3B13B 2GK6A 2YWEA 1XCPA 1C1YA 4BFUA 3THWA 3ADBA 4EPTA 2GXQA 1E9RA 2HEIA 3U3JA 4TMXA 3U7GA 3L2OB 1U81A 4BECA 3H84A 1ZNYA 2G1KA 1NN1A 1XTRA 2ZRBA 3P32A 3B8HA 5B30A 3Q9LA 2EFHB 1S3GA 1XMVA 3N5CA 1NIPA 1G1MA 4HSEA 4KU4A 3ZIAD 2DWOA 1HURA 4QL3A 3RRNA 3ZS9A 5DNYB 5J5CA 4A82A 1KI9A 1C9KA 4PC6A 4A8JA 4DDVA 2KJQA 3THYB 1IN4A 5BQ5A 2XGJA 1YRAA 4HLUA 4KFTA 1ZUNB 1KMHA 2YOGA 4B75A 3TMKA 4FIDA 1FL9A 4RD2A 3QKRA 2QG6A 5LBIA 2VRWA 4HLQB 4C0LA 2N1BA 1ZUHA 3L0SA 2BCGY 1M74A 2AN9A 4AYWA 4YMUA 1Z0KA 3CRW1 3MAAC 3FMOB 2IBMA 1CEEA 2MSEB 1G18A 1NN0A 1Z47A 5FPTA 2UVQA 2ZS7A 4MKIA 3IIKA 3WNCA 4L4UA 5ELXA 4PC1A 4ZPXA 1RYHA 3A4MA 4FW9A 4EIWA 2IXFA 1S1MA 1F2TB 1TF5A 1YJ5A 4HAZA 5FPHA 2Q3FA 2QNRA 4JLAA 2QRNA 4R2IA 4PZLA 1JXOA 2FFQA 5FUYA 1E2DA 2FZLA 4ZDWA 4OK5A 4BASA 4S35A 1IJEA 2FSIA 5LB4A 4Z8XA 1OYYA 2O8EB 3AVYA 2VP6A 1QZXA 3HWSA 4IFEA 3RS3A 1ZU4A 3EPJA 3NC0C 1RIFA 3EC1A 1P73A 5AR1A 3OEHD 4JSYA 2GJAA 4KFSA 1M34E 1NKTA 3NH9A 4KSBA 4KV9A 3SE0A 3KUCA 1VECA 1XEWY 1G41A 4ABYA 3UWKA 3MJHA 4NZYA 1R2QA 2VQSA 3GLIE 1KZGB 2FE4A 4PX9A 3QSYA 1CJKC 2GZAA 5L3QA 1PV4A 1XJQA 4FXPA 1BMFA 4B34A 4OL0A 3I3SR 3W6PA 5D3QA 4NTZA 2OFOA 1GVNB 1PJRA 1WE2A 3LX8A 4TTPA 1EFHA 5TXGA 4G5SA 3W5JA 621PA 1E94E 4C4PA 5M04A 2ZE8A 4B44A 3NTUA 2IYLD 2CJWB 3MSXA 2JASA 4G01B 5JECA 2R6AA 2IS6A 4RFVA 3OZXA 5KNBA 5F9FA 4M4SA 2WJIA 2ZVQX 3AP2A 1E3MA 2WTUA 2G6BA 2HCJB 4IEEA 1W2HA 4Q18A 1CR4A 4NYIQ 4I1SA 4MKGA 1MABB 2NO6A 4DKXA 5J4KA 4QXAA 1GG2A 1XCMA 1XTIA 4P4UA 1HTWA 1ZJ6A 3M1IA 2H57A 4BLOA 2HLDD 4IW3B 1U0JA 4LBZA 2FH5B 4BFYA 1IXSB 1AJEA 4D26A 4HLDA 2GBLC 1GOTA 3K0AB 1TQ6A 3TAUA 2GCOB 2JLSA 4PHTA 4H9GA 1T8UA 3C8UA 1EWRA 1GWNA 1FX0A 2D3WA 2ZXUA 2ZSBA 2WWYA 3WP1B 3QEOA 4RD1A 5B2ZA 1GRRA 3TSZA 1VG1A 3ZDQA 2I4IA 4TL7A 2EYQA 1Q44A 1LB1B 2ZIAA 1CXZA 3C15C 2GF9A 4NDZA 4URZR 4Q03A 3V4RA 2RGXA 4CDGA 2EYUA 2O0JA 3RABA 1FP6A 1ZP6A 2ANCA 4DLRA 2QY9A 2J7PA 4RJLA 1T6NA 1YZNA 2GCPA 2PZGA 1X86B 4OQXA 4BLPA 5B64A 1YE8A 3K0FA 2ZI3A 4LJ7A 2WHXA 3KFXA 3OEED 3HU1A 1DS6A 3SNHA 3UG6A 4YMTA 3H86A 1D9ZA 3ASYA 2PL3A 2XOKD 3DZ8A 2ZYWX 2VSOA 1YZLA 2EWVA 3TBKA 1RC8A 4JLMA 4QGHA 1GNQA 4IHQA 3CH4B 3UXMA 4BFTA 2QMOA 1QVRA 4MUBA 1Z07A 2BJWA 4TMKA 1KI2A 4Q9JA 5P21A 5DO9A 1ZCAA 1RJ9A 3PITA 1E9BA 4TYPA 4D2IA 3UKDA 3CUEF 3B6EA 3Q8XB 4HZUA 3GJ0A 3HR8A 1IY0A 4LBYA 5FBRB 2LCFA 221PA 3B1VA 1JECA 2CE7A 3QG1A 3QKSA 1MO3A 1Z0AA 1JPJA 2IUTA 5FPSA 4BFXA 3FKSA 3B9PA 4NL4H 3E1SA 3UMSA 2QN6A 4ERNA 1ZRHA 1Z06A 3VNVA 3ZYCA 4UNSA 4JLVA 1FPMA 1W2GA 4D4LA 4BEBA 1S8FA 5FOTA 4YONB 2IF2A 3G5UA 3B5JA 3KXKA 4JVNA 3L82B 1T0HB 3OIUA 1E0AA 3BOSA 4LWZA 2GHIA 3ZD6A 2OG2A 4QHYA 3SHWA 1QRAA 3MRSA 3V4FA 5L3SB 1KI6B 1NJGA 1IM2A 3B60A 1D2MA 4C2UA 3KB2A 3C5CA 2A7QA 3NH6A 4LHXA 3SC3A 3CNOA 4ZDKA 4W5WA 2J0SA 4RCZA 3B85A 3MWJA 3JZMA 3O8CA 1NG9A 2R6DA 2C78A 5FR1A 5FUWA 2GEDA 1G5RA 4JVLA 3EARA 4Q7JB 1Q3TA 2CBZA 1DOAA 3PFIA 4CEJA 3H1TA 1VCIA 2KSQA 2OESA 4FMBB 4Z8YA 2ZI7A 3ZZUA 4EPRA 3VHLB 3AGQA 1OPXA 1AM4D 3UMFA 5FBVB 1GTVA 2FFBA 5CB6A 2ZI4A 2D4HA 2HV8A 5AJZA 5HCNA 5KTYA 2EFGA 4JLKA 1ZD1A 3PR1A 4QG7A 4OJQA 1NKSA 1COWA 4PHHA 1E2KA 3BERA 3K0CC 1OLOA 5HKKD 4PC3A 5SZHB 4E03A 4OQNA 1E79D 5FOWA 1E6CA 1G7CA 4M8NE 3R7WB 1T91A 3CRVA 3TUIC 4QGAA 4BE7B 4L8GA 4GFDA 2W0SA 5FH9A 4B2PA 5FUXA 1XP8A 2ZU0C 1BH2A 3BXZA 2BCJQ 4DLVA 1KO5A 3FVQA 4DXAA 1T5LA 4PQRA 1DAIA 2V55B 1OXSC 3TRFA 3THXB 3GLHE 2RGNC 5CM9C 1W49A 4CYMA 4JBWA 3HU2A 2L0XA 5FTLA 1Z29A 5E7IA 1ZIPA 1YZKA 2FFAA 4Q4HA 1H8HD 3GJ7A 2WAXA 1PLLA 1ZIOA 2DWQA 2ERYA 2WPDA 4LBVA 2O8DB 3TR0A 1XZPA 1D8TA 2YOFA 3GLFE 3GLIB 3QPVA 4BRWA 1E1RA 1VG8A 3U6BA 1MO4A 2I1VB 3OE7D 4KITB 1NVWQ 2OCYC 2F43B 3B2EA 3LO5A 2O8CB 1KJYA 1XTJA 1G4AE 2QMHA 3RDPA 1IXRC 3RS0A 5JZVA 4D81A 1Z6TA 2RGNA 1LVGA 4MRSA 4CT5A 3GJ5A 4GOXA 4DLTA 2C9OA 4LHWA 1P72A 4XVQA 4AKIA 1ELOA 2ZR7A 1KJZA 3CF2A 4NBSA 2JLYA 4RKEA 3AKEA 1EXMA 4YMWA 2GF0A 3CR8A 2ZRDA 1AS0A 2F3TA 1GKYA 3U3OA 1OXUA 2B21A 2WSSD 4LHZA 4W7SA 1I4DD 5DE3A 3LFUA 4QBIA 2YYZA 3KX2A 1KJWA 4LUCA 2RMKA 5IK2D 2VHQA 4M1MA 1D2EA 5K8TA 3QIAA 2C9CA 1VG9B 2CXXA 2RGGA 4PSAA 4BFWA 4FN5A 1UBCA 2B7CA 2RAPA 1B23P 4PPQA 4KVAA 1YU9A 4JKIA 4LJAA 1R4AA 2VF7A 3GLGB 2OLJA 1FX0B 3PEUA 4AYXA 3LRPA 1EGAA 1G3RA 4L9SA 2JJ2D 3CPHA 1E0KA 1UKVY 3I8SA 1Q0UA 4LGMA 3T5GA 1R7RA 2RH5A 1D6JA 4IKEA 4DLUA 1Q1ZA 3CH5A 5FL7A 4TTRA 1KK1A 4FCTA 4GOKA 4IEIA 2NPFA 1BYIA 4OHZA 2OEPA 2HT1A 1OHHA 2EFCB 3MWYW 3LW7A 3BB4A 3TQCA 4Q7LA 3WYFA 5AJVB 3AVQA 3H2YA 4YC7A 3WP0A 1Q1EA 2ZSDA 3A58B 1WBDA 5FL3A 2K5UA 1U99A 1Z6GA 2BBWA 4KYIB 3RLFA 2OAP1 2F1RA 4B35A 4B6FA 2ZS9A 4XVRA 1XMIA 3NEJA 4Z54A 4B3FX 3EG5A 2P6UA 2JLQA 5CB8A 3HDTA 3KQNA 3KKPA 4R98A 3U44B 1T9HA 1OH7A 5EE1A 5J4HA 5L3VA 1E99A 1RRFA 3SS8A 3I62A 1U8YA 1E2MA 2ODNA 1FOEB 1XJCA 1KSHA 3NIBA 5HTKA 2ZYVX 1SKYE 3CX8A 3BGWA 4TLDA 1LS1A 4BZQA 3U60B 1XXHA 4M21A 3EPLA 2NIPA 2W0MA 4IDNA 4N0DA 1FQKA 2PJRA 1KK0A 4P4SA 4AD8A 2ZUCA 1P9WA 3A36A 1EFRD 4B3XA 1ZUIA 4LJ5A 5IT5A 2QT1A 1TUEA 1LS6A 2QBYB 3NBYC 4G3XA 1US8B 3LVRE 4M22A 1G3MA 5JFGA 1OXVA 4JKYA 2BM0A 5SZIA 2ZE7A 4IJMA 3TR5A 2R2AA 2WSSA 1DAMA 1HE1C 3ZQJA 3PUWA 4M1YA 2OUKA 1P2VA 1Z63A 1YR8A 2JGNA 1CF4A 1W4BA 2Z4SA 4P33A 3PENA 1ZBDA 1M8PA 2JLXA 1MKYA 3CB4A 4QRHA 1DBSA 1N6HA 5KHOC 2QAGB 3F0TA 1QHIA 2IYUA 5GJCA 4G5RA 3ADKA 1WMSA 2G77B 5BN3A 3G0HA 4KI0A 4K46A 4BZPA 5LD2B 3R9XA 4OI4A 2IS4A 2J3EA 2ZI6A 1KGDA 1N6LA 2G83A 1E1RD 4BLRA 2GILA 5H68A 1JBKA 4Q5IA 1XD9A 3SDZA 1DPFA 1UADA 3KKOA 3WRYC 2VIIA 3SYLA 4A2PA 4LJ9A 1Z22A 4DCUA 4LJ6A 4KLZA 2AD1A 4Q00A 421PA 2FV8A 2NO7A 2QEQA 3M4YA 2ZM5A 2GJ9A 3WY9A 1CTQA 1TX4B 2EVWX 4DT1B 2V8OA 3AVOA 5EUMA 4L15A 3ADDA 4UKDA 3L8ZA 2X19A 4LK2A 3CWZA 1TNDA 2WJGA 3BH6A 1P61B 2KBFA 2OFXA 4PPNA 2QZ4A 2GNOA 4WZ6A 2XZOA 1UDWA 4MDFA 2VLIA 4TQUS 3EZ2A 3DOEA 2P2LA 2KI5A 2GCNA 4CT4B 3QVVA 4ARZA 2BKUA 2VH5R 4D0LB 1SVMA 3QPWA 1XTQA 3KJHA 4HAWA 3QF7A 3CBQA 3I5XA 1SGWA 1VCNA 1COWD 2IYRA 2Z83A 4UNNA 1SVSA 4URVR 2OHFA 2IYYA 2R44A 4G5QA 3TH5A 4JMPA 3BFVA 4US1R 3A1WA 3AVUA 2AKYA 2DR3A 2YWGA 1NMZA 4MKFA 1N0UA 4OI2A 3CX7A 3I4LA 1QHGA 3HPRA 4FMCF 1IXZA 4OHWA 1ETUA 1W4CA 3X1XA 2GBLA 4AI6A 2Q0HA 3IHLA 1GITA 1X8LA 2GZHA 3AQ4A 3BIFA 4B3CA 4C2TA 1E32A 1R8QA 4A15A 1R10A 3W34A 4A0FA 1OIWA 2DPXA 1OB5A 3DPUA 3KXLA 5F2EA 3KDSE 1SQ5A 4HB2A 2KWIA 1YHNA 2YINC 4CVNA 1TUIA 3HPQA 2IYWA 1T5IA 2ZRGA 1HQCA 4PSKA 1L7VC 3D7MA 2J9RA 1QG2A 1NLYA 4ILEA 1A1VA 1SKYB 1K8RA 2XJ9A 5BWMA 2IHBA 4FD2A 4FINA 5GVRA 5C46F 4DLXA 1SXJE 2VPPA 2ERXA 3QXXA 4WXRA 3FKSD 2VSXA 4C0JA 3U6KA 5C2JB 1NVVR 4O0MA 2GTPA 1RVDA 3MWKA 3ZGXA 4YQFA 4Q1CA 2ONJA 5JRZA 4NYJR 2WOJA 3GQBA 3D8BA 4B3GA 3L43A 1VYTA 4UNPA 5DLQC 4U00A 3CF6R 1E9SA 5GJWC 3IKJA 2A5YB 1IJFA 1ZCBA 2FPMA 2IF0A 2X2FA 1IN5A 2IS1A 4B47A 4TLAA 3AF1A 3U2QA 1NG1A 2ZETA 6Q21A 4GL2A 1G7TA 3EASA 1AN0A 3PJRA 1T3LA 4WOPA 1ZINA 1Z0JA 2OSBA 3WNBA 3BD9A 2F9LA 2ODEA 3GD7A 3IO3A 4FMCB 4D6PA 5GJVC 2XB2A 3A1VA 4QKQA 2PEYA 3X1ZA 1NVUQ 3CKLA 1Z2CA 1LF0A 4XSHA 1WQ1R 3HYTA 1G3QA 2BWJA 3DDCA 4YXWD 1BOFA 3WYAA 3AKDA 5JCPA 3U7HB 3NBZC 4HZIA 3EPKA 3B78A 2QSYA 4X8OA 1KI1A 3E2IA 1GIAA 4O2LA 4WZBE 3J81k 2D2EA 1NN3A 4JLNA 1X1SA 4A8JB 1F48A 1U2RA 2ZPTX 1Q57A 2ZRIA 1JAHA 2RHDA 3LY5A 1AKEA 2ZJAA 2CCJA 2VP2A 2GEUA 1ZC4A 3CPJB 3LA6A 2BVNA 4NPHA 5HCIA 4ACAA 1ESMA 1E79A 3OAAA 5TMPA 3FMIA 4X8MA 3TUZC 5JEEA 4Y0AA 2Q9CA 3K9HA 1LTQA 3RC3A 1LY1A 1G3IA 1DAGA 1H8EA 4XTRA 2WSMA 3B82A 1R5NA 3I8XA 4M0LA 2HLDA 2SHKA 1UBGA 3L8YA 4KLNA 1FQJA 1E2HA 3BC1A 1II9A 4R71A 2VA8A 3SJCA 5AUOB 4WZAE 2F1HA 3H0KA 3K8YA 1XMSA 3GP8A 1R0XA 5GVSA 3KTAB 3QXHA 3SFZA 4TZ6A 4U5XA 2AWOA 4QM7A 3CNLA 2CEAA 4IRUB 4URYR 4C0SA 3L0OA 4JIMA 1TEVA 1Z2AA 4EAQA 2ZJ5A 5CK4A 5FOXA 3K0CA 4KFUA 4AKHA 1D5CA 3FB4A 1E9EA 4QOSA 1EESA 1FNMA 4QNMA 1F2UA 1AS3A 2ZUBA 1P5ZB 2HT6A 1BMFD 1JXMA 5G40A 4B76A 3SQWA 5CYPA 4C7OB 3TE6A 2Z43A 3B9QA 3R7WA 4DJTA 4GP7A 2REOA 1ZM7A 5LPNA 1XTSA 4LZZA 4L9WA 4EPYA 4IFBA 4NYJQ 2OXRA 4LOAA 1JR3A 2AD5A 1KDPA 2IYQA 3OAAD 4LYFA 4OYHA 2WKRA 4AG6A 2NPIA 2O8FA 5HE8A 3SJZA 3K0AA 4URXR 2ZI5A 4JVSB 1NY6A 3GLHA 1H65A 4ESVA 4QBGB 2ZR0A 2ZQ5A 1NIJA 3MLEA 5F3WB 1UKYA 3W6OA 1XPRA 2XNDD 4Q1EA 1G21E 1TAGA 5BYKA 2WWIA 4DSOA 1D9XA 2FMXA 3F5FA 2AK2A 4Q4AB 3EZ9A 3WYGA 1P4SA 1MABA 3X1WA 1T3SA 1TPZA 1E2FA 4C7OA 3KJIA 1IQPA 4BFZA 4IOJA 4DCVA 5HZKA 5IK2A 1AKYA 2IL1A 3AUYA 4LJ8A 1S4QA 1QBKC 2ZYTX 3BB3A 5BXQC 4D4MA 3BORA 3VTKA 3SHFA 3QXJA 4LSGA 4PFSA 3P1JA 4Q4JA 3EIHA 4AG5A 2XOKA 1A82A 4D80A 1S9HA 4CF7A 3THWB 2FEMA 4Y0VA 5LDDC 4TYWA 1CJUC 1W1WA 5DI3B 4C0KA 1WA5A 2H7VA 3T1TA 4PR0A 4AURA 3C7KA 1Q1BA 4YDSA 1W4RA 1U90A 2Q6TA 2IYZA 4R7ZA 1N6IA 3F3YA 4JL8A 4IDHA 3ZS8A 3LQQA 1OFHA 3QKSB 2ZRAA 1BIFA 121PA 1U98A 4HZUB 1VYVA 1II0A 3ZVNA 2YOHA 3UATA 4QJ5A 2UZ3A 1II8B 2VHCA 1KAOA 1UEIA 5KSZA 4EFNA 4WVFA 3PVSA 3LH5A 3P4XA 3RSLA 4ZIRB 4EPWA 4BLQA 3P26A 2BBSA 2GAAA 1DADA 4DCSA 4HAXA 4TYYA 4IVQA 1E2GA 1CR2A 4AIIA 3CX6A 1DELA 2Z5FA 2FSFA 5JHHB 1TQDA 4RVCA 4IDPA 1KSFX 1VHLA 2ZTSA 4HATA 1CJMA 5JEDA 5KDDA 1Z6AA 2CHGA 1XPOA 1OKKA 2HF8A 3C16C 3SEAA 3PCRB 4C0QC 4JLBA 2UZIR 3BWDD 4YMVA 3D31A 2J45A 1SZPA 1ZAKA 3IDQA 2R65A 2GVDC 5FI1B 2PH1A 2NOAA 5EXXA 4N0EA 2OILA 2ZRKA 1F60A 4KCGA 4AY2A 1G8HA 5SZKB 2R9VA 1G6HA 1N5JA 3K9GA 1JALA 4GOJA 3ASZA 4XIGS 4TL9A 3AKYA 2WWFA 2QRZA 2W6JA 2JEOA 4ZIRA 2CCGA 1KAGA 4C0HA 2ZU6A 4DB2A 2V7QD 4Q1DA 4XVUA 5KSOA 4Q47A 5D3MA 2PLRA 4MYUA 4BQSA 1OT3A 2J0UB 3IQWA 2B8WA 4UNQA 1ONBA 1QHNA 3ICQB 3QNUA 2YHSA 3VAAA 3VR4A 4V02A 2Y8EA 3SOPA 3OEHA 1ZW6A 3QUSA 3W90A 3LBIA 1WDTA 1XZQA 1VTKA 2V9PA 4OQFA 3GLFB 2VP4A 4ZI3A 3QI2A 4ON9A 2HUPA 3T35A 2C96A 2F3RA 4PQYA 2RB4A 1R5BA 1OKKD 5AJXA 3VR6A 3HJNA 2P0EA 2QL6A 1EK0A 1JJ7A 3I72A 4GZLA 4Q19A 1FP7A 1GSIA 3RRYA 3VHXA 1KSGA 5JSZA 1U8AA 1S9DA 1IN8A 3UANA 2YC4C 4EPXA 5EP2A 2FOLA 3GJ4A 1Z8FA 2OBMA 2OZEA 1AS2A 821PA 3A1TA 2JATA 2VBCA 2PZFA 3UPUA 1NBME 1YR7A 1UFQA 2FDCA 2ZR9A 2LKDA 4DEYA 2G0TA 5CK5A 4TYNA 1R5OA 2OBNA 2I3BA 3DMNA 4FCVA 4CW7A 1ODFA 1QHHA 2BV3A 3KQLA 4Q01A 2ZEJA 3K0FB 3F8TA 4DBLC 4D0GA 2IYSA 1EWQA 2YJTD 1TQ4A 1E2JA 2UKDA 2DWPA 4PAMA 3KQKA 1G291 3CONA 2QMUA 3TQFA 4IVPA 1VPLA 2BEJA 1ZM3A 2QE7D 3EC2A 4AK9A 1HY3A 2FX3A 1PVOA 1WF3A 5C1BA 4Q1FA 3W8NA 1RFLA 1E2NA 1J90A 4PQFA 4XJXA 5FBQB 721PA 5B58C 2XX3A 3A1SA 2CCKA 1FMJA 2JLUA 1A2BA 2C8VA 1KNQA 3NC1C 4JYCA 4LV5B 1XCGB 2J7KA 1M7GA 2XXAA 3AM1A 5KO2A 1A7JA 1VIAA 1R8SA 1F6BA 2FSHA 2VP9A 3KJGA 1G5TA 3TVTA 4BFSA 5FI0B 4IOLA 3Q7QA 2RGBA 3QKTA 3PIRA 4OQMA 2C03A 4V0ME 2HF9A 4B73A 2XAUA 5TV2A 2DYKA 5BN5A 1Q12A 4J0QA 5ANRB 2VSFA 3FHCB 2ZAMA 3K09A 1IBRA 3KZ1E 4IDOA 5G41A 4C9BA 3IILA 4ZDIA 3K70C 1OFIA 1TF7A 2JLZA 2OCPA 2RGCA 2G9NA 5CYOA 2GXAA 4ITRC 1OSNA 3REGA 2AX4A 2YWHA 3WHLA 4EJSA 3GLGA 3PEVA 2CK3A 2Z0MA 2X77A 4TSFA 1KI6A 1HH4A 4ZKDA 1E1QA 3AF2A 4NH0A 2OFWA 1RYFA 2PX3A 5CIQA 2BOVA 1R0ZA 1KKLA 2XZPA 5KUTA 1XEFA 4TWZA 2WM9B 2PT7A 3TSWA 4D82A 5FFMA 1JEEA 4K81B 3GEIA 2F43A 2C99A 1Q22A 4AWXA 2CVFA 4C3ZA 2NO9A 3BFKA 3V9PA 4ASUD 1F2TA 5L3RA 1E9AA 1OH6A 4GSYA 4NP6A 2W6IA 3ZD7A 2OAQ1 1RZ3A 1N5KA 2IW3A 1M1YE 3FFAA 3K9NA 3R8CA 1OH8A 2XB4A 1RRCA 5CLQA 2OO7A 4C0AC 3R8FA 3QKRB 4H1VA 2QAGA 3DM9B 1XD2A 3ECCA 2C77A 2EW1A 4PHGA 4NHOA 4BLTA 1NF3A 1MOZA 3W9YA 5EUQB 1EFCA 2PCLA 3NBFA 4O3MA 1NJFA 5TDHA 5FBLB 4PSVA 2XITA 5C4MA 4UXJA 4KHZA 1AGPA 4BLSA 2DB3A 2CNWD 4BZXA 4TYQA 3LQRA 3LLUA 1QF9A 3U44A 1WXQA 4XWAA 1FZQA 1NP6A 1XF9A 5DN6D 1PZNA 4JBXA 3FOZA 4Q4HB 3T1VA 4D4KA 3AF0A 5KU1A 2V6JA 4MRRA 2OLKA 2H17A 2ZUDA 1P62B 4E07A 2PMKA 4DLYA 3BK7A 1AGRA 1JJVA 1P3JA 5F9HA 1PLKA 4ZV4A 1NL3A 2O0KA 2QP4A 2BDTA 1S1CA 3EWAA 2Q9BA 2DY1A 2QTHA 4YXWA 4QJ3A 1J7KA 5FTMA 5C18A 2O8BA 3SYKA 2QPTA 4NONA 1FTNA 2W6ID 5EZ6B 4YDHB 1ZM2A 2J5XA 1GRQA 5AUPB 3LXRA 1KDRA 4JJZA 4ASUA 4Q48A 3QENA 4HAYA 4D25A 1NLFA 1EFTA 4QC2A 4M9ZA 3JZAA 4XD7D 3BFXA 1MO5A 3HU3A 3KKNA 1PLJA 3OHMA 4KAXA 3BRWD 4PAQA 1QVAA 3QQ5A 3X2SA 2WWWA 3FPAA 1QHSA 4GP6A 4PXAA 1N6KA 4DZZA 2HJVA 5IHPA 3O8DA 3ONWA 3T34A 1VYUA 4OHVA 1AA9A 5E7MA 2WJHA 4TLBA 1DG3A 1XD2B 5H1YA 1HA3A 1TU4A 1KY3A 2YVUA 3ETLA 4CEHB 2P5TB 3QE0A 4LX0A 4L5BA 2VTKA 4DIEA 3RC8A 4XWOA 2ONKA 1NI3A 2A5GA 2Q3HA 5BN4A 3EZ6A 4O25A 5JJKA 2QU8A 1DVRA 2JIZA 1OB2A 4M9SA 4EQ6B 1GM5A 1HT1E 1DE0A 3CW2A 4XTCS 5TB5A 4Q1AA 1SHZA 1BS1A 3VKGA 1ZVQA 1OFUX 3RYTC 1G8YA 2E1RA 1ZM4A 1FW6A 3GEHA 4JLOA 1Z0DA 1OYWA 3GJXC 3IO5A 2QSZA 3LX5A 4I1UA 4Q7MB 4OJKA 1NMXA 3SBDA 3RS4A 1OH5A 1QHXA 3E5HA 1BKDR 2FPLA 2J41A 4MRPA 1GILA 4WXPA 3WBKA 1XPUA 1KI7A 2O8CA 2GJSA 1DAHA 2ZI9A 3VU9A 3I1FA 1J8MF 3HYRA 3QPUA 3S1AB 3UK6A 2H92A 4DT1A 1YRBA 5CJPA 1KO4A 5JWHA 5KPDA 1OFTA 4E09A 2ZJ2A 4NE2A 1M6NA 3Q72A 3VR2A 4CEIA 2GWHA 3BBPA 4RD3A 4TMZA 5JJLA 4JL5A 1OE0A 1M7HA 1YR9A 4V0KA 3U7FB 4WBSA 521PA 3VX3A 2ZREA 4GRAA 3UWOA 1NVVQ 1DO0A 2EFDB 4GI7A 4LHYA 3THOA 4MKHA 4IVRA 3AUXA 1CRQA 2DFKB 1GDDA 1W0KA 1Z5ZA 4Q4LA 4M53A 5HZHA 5K8IA 2WBLC 2IA5A 2WAYA 2ODWA 4X8HA 2GK7A 5TY0A 1GNRA 2AWNA 4MGKR 5E95A 2CHQA 1LV7A 1YZGA 4E5UA 3IEVA 4Q21A 4Q1BA 2MMGA 2CJWA 2H1LA 3T06B 5B57C 1XXHE 3MD0A 3DL0A 4QM6A 2G3YA 1U0HC 3T61A 3WNDA 3QJYA 2BMDA 4NYIR 5FOSA 2FG5A 3TVDA 4XH9B 5KPJA 3CR7A 3PUZA 2GXUA 2JLVA 4TZ0A 1SVIA 1SHKA 3ND9A 5EE3A 4HAVA 4UNRA 3C4JA 4AKEA 3SFVA 2Q21A 1RE0A 1US8A 2X2EA 4Q9KA 3CZPA 1U8ZA 2ZJ8A 3PXGA 1TU3A 1JB1A 1QG4A 2J59A 4NYMQ 1JEDA 5E3HA 2P5SA 3OESA 1CLUA 1R0WA 4BGDA 2OBLA 3DO6A 3IBYA 3IIJA 5FBWB 2J7PD 4UXIA 1Z6YA 2QORA 4M1WA 5L3QB 3THXA 2CL6X 1LFDB 1J99A 4CEJB 1RRGA 4A4DA 3FMFA 1MV5A 1TMKA 3VX4A 4JJKA 2W2VA 2ZRPA 1XTKA 2VHJA 5JRJA 1CKEA 1VDZA 2WIBA 2QT0A 5DIFA 3PEWA 1ZM9A 1UM8A 2BEKA 3SU8A 2CLCX 4HUTA 3TKLA 3U3MA 2BMFA 2HXYA 3WMFA 2QMEA 4W9MC 2QGZA 3BS4A 1IOZA 3EZ7A 1NBMD 2ODBA 1V5WA 3I32A 2OXCA 5EP3A 4V0OA 2OCAA 4RY2A 5FTJA 3SJBA 4ZDJA 1JQJC 3B1YA 4OHYA 4AKGA 1T8TA 2DBYA 1N3BA 2Z6VA 5DGXA 2JLRA 1YR6A 4OK6A 4S2EA 1KMQA 2R8RA 4MYTA 3RHFA 1UDXA 2A9KA 3IIMA 2OCBA 4PO1A 3U3KA 2D7DA 1YKSA 2AFIE 1OXXK 4CZ2A 3MJRA 3AV0B 3LVQE 3GLGE 4O2RA 4F4CA 1PUIA 4QBHA 4AC9A 2YKGA 5FOVA 4EJSB 2FZ4A 2VO1A 4RD4A 2O8FB 2XTZA 2QGNA 4GDFA 4NYMR 1GNPA 4HB0A 2PBRA 4MQBA
chains in the Genus database with same CATH superfamily
3FPLA 2QLBA 3ZOZA 2DBVO 1QRTA 3DC7A 3TRIA 4BLWA 1NE2A 3MWEB 1RJ9B 1FDOA 4MB0A 3FJ1A 4YRLA 3RIMA 1VLHA 1BU5A 1JJAA 4JHXA 4OHXA 4RM2A 5FJIA 3I8OA 3I37X 3ZWMA 5LCXA 1S2MA 4HDRA 2BKAA 2ZBEA 2XZDA 1PV1A 1SCUA 1RYEA 1WF6A 2ZRJA 2LP4Y 1CF2O 4FGZA 4NAVA 1H0SA 3REOA 3KKLA 4CRWB 1TYZA 4G9EA 3PUXA 1NAIA 3DSRA 4MR7A 3PDIB 4WFJA 4WV3A 2VZ0A 4MS3B 3URKA 4JP3A 3EXAA 1DDIA 1G8KA 2BUBA 2XNSA 4B6RA 1GAJA 4IX9A 4BWYA 4DG9A 4EFKA 3IPYA 1T2UA 1OHHD 4Q9AA 1P91A 5FT9A 1EFVA 1YVDA 5JTTA 3ZVMA 1EEHA 1G6Q1 2IYFA 2WK1A 4KVGA 2WJVA 3OCYA 1RM5A 5TS2A 3TSOA 4TV8F 4P84A 3EE6A 3MAJA 4P0TA 3BWMA 5KJFA 1A9YA 2AR7A 3ZZTA 3S68A 4OKSA 3U7EB 1ZC3A 2P3LA 1BXRA 1UPAA 1HV8A 2CLSA 3AXSA 3ENWA 3HN2A 1UT5A 2CUNA 1WPQA 4HX5A 3UNXA 4YAGA 1U7TA 4TV9B 1OGYA 1IAQA 1WOYA 4A2QA 2GESA 4P38A 4ESEA 5J47A 3OLYA 4B3IA 4B1FA 3DCIA 1I4WA 1DKQA 3C5VA 3V46A 3WLLA 1DL5A 3PGJA 3PDCA 3WGMA 4AO8A 3LPNA 5F3RA 2JJ8A 2ZE5A 3HZRA 4MDEA 4LPSA 3RQSA 5KSPA 1ZG3A 1ZN8A 1OI4A 2DR0A 3SVLA 2QMZA 2PH3A 1NLZA 4O2BA 5B6PA 4EG3A 1YCDA 4G8DA 1AXGA 5AIBA 3MYYA 3VI4B 2Y0DA 3HCBA 5LVAA 3L01A 3OEWA 4N5IX 4G81A 2ZCJA 5IBRA 5FAXA 3ZHZA 3EA5A 5E6RA 4YYZA 5I7HA 1GR1A 4ACBA 3B1JA 1UMDB 1K0UA 4GOMD 3GAMA 4BRZA 2FPUA 4O4LF 4MIKA 5FF9A 4D9GA 1NVKA 4LHSA 1HMYA 3ABSB 3IYLW 4JNKA 3ITEA 5CM8B 5KNDH 3L7DA 2WQ7A 3AQIA 3I2IA 4R2JA 5F64A 3SSAA 4CLHA 4HWTA 6ADHA 3H83A 1J22A 1E9FA 1DCKA 1NYRA 1ZHHA 2ZWMA 4X1YA 4L76A 3OI7A 3A3YA 4NU6A 4FCWA 1CQWA 4FFDA 3DFKA 3HDGA 2HJWA 2VLBA 2X0FA 5DFAA 1F5NA 3KL4A 1U4SA 1YRWA 2MSNA 3FYHA 1NZDA 4PSDA 1ZX1A 4TX1A 5G2OA 3EIQA 1W46A 2DBRA 3NG1A 1SXGA 2I8CA 3DMDA 4LTMA 5B7QA 5EHZA 4LZAA 5CIYA 1TO1E 2EJBA 1QWOA 4TPKA 4MUGA 1BA2A 3U3XA 3WGKA 4BO3A 4IAOA 1L4BA 4P36A 5E38A 4XFJA 2ZIUB 3BGIA 2A67A 4GLBA 2B92A 2R11A 3I2JA 4EJSC 3FYSA 2B7BA 1SXQA 1N32B 2OWDA 4KOAA 2CZQA 1W5SA 2G9QA 1B0PA 2VSQA 4GI2A 4OHUA 2PJDA 2R1TB 1EINA 1AXRA 2WF5A 4HX2A 4V0LA 4ZC1A 2PYZA 1B8PA 2R8EA 3FHOA 4WLNA 1ZHOA 3PYXA 2TMKA 4IQGA 4DRYA 1QMPA 2BSQA 1T6YA 1ZMOA 3TDKA 4HFNA 4AF8A 5CBKA 1HNXB 4JFRA 3QUTA 4PC7A 4J29A 4FCCA 2R6GA 4G9BA 3OCCA 1C7EA 1FXWA 3QY9A 3JSAA 4KBFA 3QWIA 4Y8VA 4F12A 4PGMA 2C7RA 2W2OA 3PD7A 2PT9A 4NXNB 4FSDA 1QTIA 3QA9A 1B93A 1Z6QA 5CD1A 5A4JA 4NKRA 4N03A 1WPGA 1MQAA 1R6BX 3T3HA 3ZE7A 1G55A 4D79A 3MG9A 4NMHA 4HAUA 1JLRA 2ZTLA 2X1VA 3NZEA 1XMJA 3DJYA 5CDGA 2GPTA 2VKTA 3JQFA 3NHUA 1WDLA 3OZIA 4PR3A 3TL6A 3FI9A 2VTVA 4IZIA 5CXXA 1CIJA 4RYDA 1T36B 5EKUA 1S0UA 1SCAA 3BXPA 4LC1A 5LJIA 1XHFA 4WNYA 4RPHA 1PUJA 2J0UA 3DB2A 4R9SA 5ECDA 1YQGA 3VKVA 2CJYA 1NMQA 1DARA 3H42B 4E08A 4G1CA 4EY4A 1E3WB 3G89A 4TV9F 3WGVA 5DX8A 1KH1A 3DOFA 2PZLA 4IH9A 2HJGA 4D4JA 3O84A 5LU8A 1NI4A 4O2AA 2NZXA 4FJ2A 1H3EA 2J3KA 1U2DA 3KEOA 4BVJA 1QH0A 2H6EA 2V6GA 1LSUA 3LDFA 4G1MB 5A06A 1CK4A 1BWQA 5AW0A 1KIMA 2PV0A 1NW5A 1Y3CE 2AOUA 4NU0A 4F2DA 1W88A 4QYMA 4WY5A 3HV0A 3RSOA 2EFJA 4RZ2A 1XRQA 2P90A 4BRUA 1FYDA 4GYYA 2PWPA 3N2IA 2J9FB 4AUNA 3P9CA 3BE8A 4XWYA 4GAEA 4DV6B 5EAIA 3BKWA 3O8QB 1P0MA 2QTCA 2YJNA 2YX1A 3FWPA 2A4KA 3D3JA 4R9UC 2ISSD 4MI6A 2Q1WA 4F5DA 2LBPA 3EIXA 2OG1A 1J8DA 1F0NA 1MT0A 1WXWA 1JZSA 4B6GA 4AJ1A 5L4SA 3A8TA 1G16A 4RA6A 1QYIA 5DW0A 1FFDA 4RZUA 4DY6A 4I1IA 1GKUB 1IDN1 2Z3VA 2GEVA 1C41A 1NP7A 2C7QA 3ABQB 3GD5A 3ZHTA 3HJFA 3FHTA 5D3ZA 1GRNA 3A6PC 1U1IA 1XPJA 3HHPA 5HK8A 1ZR2A 1T24A 2CL0X 1K7FB 4KQ6A 3U4HA 2C58A 2VL7A 5EPOA 2IOQA 1FMTA 2H4YA 1R50A 2O3RA 3FNHA 1IEVA 4I6EA 4ER7A 1DWPA 4EITA 1BEZA 4XSGA 1HE8B 3WL8A 2F4NA 1IY1A 3H99A 2ZP1A 3U4AA 3A04A 4XPZA 4WIAA 3MCAA 3B1WA 3W5VA 3AY6A 5FEUA 4J9VA 3VBCA 2FNAA 4PFQA 4HYYA 1YB5A 5JPCA 1KZ6A 4N5NA 5DW3A 5JD5A 5GIPE 4EY3A 1NF2A 4DAOA 5B55A 1EUDA 4S0ZA 4R1UA 5B58T 3NAQA 3AF5A 4JJ8A 1EJ6A 2QROA 1KZ9A 4GX0A 1A8HA 2FUG6 1CRLA 3GNLA 3BSSA 5E3JA 1CZRA 3FSRA 1I01A 3TQRA 2R5NA 3N39C 4BRSA 2FKAA 4DWJA 2ZUSA 2OPHA 4BXOA 1PQYA 4J2TA 1H1DA 2Z56A 3U7IA 1F3OA 2C31A 3CX4A 1VSTA 4YV0A 1UKEA 3OFNA 1O0CA 1K8XB 1QHHB 1DKPA 4BTVA 5T4EA 3NOVA 4K40A 3ZH9B 1OBFO 2DKOA 3ZK8A 5A62A 4FFWA 4B43A 1VZ3A 1EQAA 2SKCA 2YBEA 4JROA 4L0DA 2HDWA 1Z4IA 3FKQA 3O8OA 2H00A 3TUJC 1UBEA 5A03A 3I73A 1DKOA 1E8MA 2HHCA 2PLAA 2W8BB 3FW1A 4ID3A 1EI9A 1UBJS 1Z26A 2HSZA 2WVGA 3QHQA 4G5GA 4H3HB 4JYBA 5LQSA 5A1TA 3PEYA 1E7SA 3F7MA 5WRFA 1BE0A 1E7QA 1WMFA 4E5YA 3VQTA 3NLLA 1ZH6A 1GGVA 1U6KA 1BHSA 1PL6A 2RDMA 3CS3A 1YK1A 5ILQA 1DTWB 1RRVA 4OF4A 4ZICA 4GKBA 3FVRA 3UOAB 1VHDA 3B5IA 3L9XA 1PR9A 3ZZMA 1G6KA 1JFRA 4RTOA 1PL0A 4QDXA 4E22A 4Q9DA 5JJBA 2P4EA 3LM8A 3MWGA 4IUDS 1U2PA 5CHEA 4NY1A 5LP6A 3HK2A 3HVJA 1TLLA 3L46A 2CLLB 2EKQA 1KNXA 3L7JA 1ZCZA 3D3NA 2G5PA 4MX8A 5BSUA 2IWRA 2X6QA 4NZZA 5KYXA 3I5YA 1KP3A 3PNVA 3GLFA 3P19A 4D74A 4Y18A 1PJBA 3Q5DA 2Z04A 2VJKA 4LYJA 5FA8A 2Z9BA 4G4IA 4IIUA 1KDOA 4LV8B 3AHGA 3IT1A 4DLNA 3OX1A 4TQAA 1AB5A 1UEJA 2VEOA 4G23A 1VE7A 1W75A 4BNUA 4DSTA 5KNBD 1XAGA 2MSDB 3FMVA 3G3EA 4QHTA 5EJEA 1Y3HA 1V8FA 3G2MA 1NULA 2OBFA 4MW1A 1P4RA 3CNBA 2HHLA 2VCHA 3C7TA 1JTFA 5HDQA 2Y1LA 4CL3A 2TS1A 1NBIA 2F59A 2H18A 2NU9B 5K6AA 2QM3A 3SJUA 4LTDA 1EK2A 2BFEB 4RFSA 4A6XA 1L3IA 3DE4X 3W5HA 3DE3X 2P91A 1E2IA 1PK8A 3R1IA 4UVEA 5CNMA 1CS4C 1CUGA 4Y6PA 4BMZA 3O47A 4JKOA 4H16A 1JDVA 1QPBA 4QLAA 2P67A 3L0IB 5FFFA 3W1VA 1AA6A 1YQTA 3D1LA 4HEJA 1KDZA 3UCEA 5AVWA 1LWOA 2Q4RA 3H9JA 3N1UA 5IJAA 1I4LD 3UQYS 1WOMA 4WOCA 2AFIB 3BTVA 3E15A 3DPSA 3IP5A 1A8PA 1GL6A 3Q2KA 2D62A 1N9GB 1YNSA 4KWCA 3BCUA 4LE0A 1ZS9A 1G66A 1TADA 3CUUA 1KQPA 1PWZA 3D4LA 3JR7A 5IVDA 4ZVKA 4LVNA 2YZKA 5AKYA 3HN6A 5C5EA 5JJ5A 2QNBA 4FUTA 3GRCA 3PQ7A 3GJRA 1KBOA 3NT5A 2X15A 4UUNA 3I2KA 5E1BA 3TJMA 4GUDA 4IWYA 2ZJOA 4BNJA 4FDLA 1XRJA 2I3AA 3KR2A 2JD0A 1JDTA 4LJYA 5C35A 2ZROA 1CIPA 3DAFA 4JUCA 5FLEX 1X8JA 2J8ZA 2OK8A 5EQFA 4JI5B 1X3SA 4BMDA 3AY3A 3GUVA 4JOCA 4FTWA 4IIHA 3GVIA 2XMBA 4HEA1 4KQGA 1QU2A 4N54A 4KXWA 3NASA 1JQBA 1ORTA 3DKIA 1SUWA 1W6UA 1T8YA 4HDCA 2Z95A 2BJVA 4IGFA 3WVNA 3KQUA 3M0EA 4A26A 2FSGA 2H1RA 2JLXA 1SVKA 3NYIA 1J0DA 1R3DA 2B99A 4NFYA 1PT8A 1VKRA 4DVJA 1JH9A 1RZRD 2ONYA 3F8WA 1FFYA 1JBEA 3QXGA 2DFNA 2XB6A 3IRUA 2WVAA 3KYJB 3K9QO 1UZAA 4OXNA 4C5BA 3REFA 2BW0A 1OBHA 5ALOA 1JHDA 1HO3A 2X40A 4OKIA 3BXEA 1YO6A 3L6OO 2EDAA 4RKRA 4D8VA 1VCMA 1CEQA 1UBLS 2JGDA 2XSZD 4G63A 5AM5A 1OI2A 3VYTB 3ZIAA 4BVLA 4F3KA 4WZBA 2XUZA 4MQEB 1SC6A 1LW7A 5SYMA 1A4IA 3VR6H 4K6MA 4KFRA 4D9NA 3GBPA 5GADl 3PJDA 1XQ6A 1BFDA 1XA3A 2C83A 1THGA 3T3MB 1E2PA 3FCYA 3OCWA 1IQ0A 4FI3F 3VJLA 4F92B 3FCSB 3QF4A 3T5BA 1ZN2A 3U19A 4IJWA 4LDNA 5FUVA 1C1DA 2GZMA 3SDSA 1HWYA 2E9SA 4ILKA 1FP4B 2OGWA 1GFIA 2QN1A 2F55A 3D02A 4TRRA 3WBFA 4RVGA 3GN2A 1AG9A 1B76A 1R0SA 3UJPA 1UMCA 2F48A 2C4MA 1FTSA 2I34A 1PQWA 2RHWA 3FFBA 4UXHA 1Q74A 5CGQB 3ZJUA 3I9FA 2F6RA 5AKZA 4OI1A 1C80A 2CY0A 1OLSB 3TIXB 1CQJB 3AV3A 3KOOA 1UUFA 1CRWG 2YVLA 4JC8A 2JI6A 2FG7C 4R0VA 4EA7A 5BR4A 1P60A 2GKOA 5DLEA 4RESA 2FMUA 2R6CA 3C5HA 1L1RA 2BH9A 1P7CA 4I14A 3RSQA 1NMEA 2W4MA 1AIPA 2ANBA 2QTGA 3ILXA 4CM4B 3E3LA 4GBGA 2IOYA 3BMOA 4ITVA 1XEXA 2W6CX 3K70D 3EY4A 4FOOA 3ZTWA 5I48A 1GCOA 2WD8A 3PXCX 4KDCA 5H70A 3M33A 5HHTA 3VC3A 5AUQA 1VPEA 4YAWA 1OY1A 3MELA 1RZRA 3O8RA 1G8AA 1KO8A 1OW3B 4KWEA 4MW5A 4BGEA 4JB2A 1JRLA 2FWBA 1HFEL 2EKBA 4WOKA 3DLAA 4OAOA 1H5QA 4YAOA 4DHEA 4Y6QA 4PZDA 1X2EA 2AG8A 2YBDA 3DBRB 4Z1MA 4G4GA 4YR7A 2IX3A 4BTLA 5LN1A 1MEOA 5AOCA 2A8YA 4LRWA 3V97A 2I3GA 3CEJA 3WLAA 3I76A 1W4LA 3EFHA 4Y1RB 3R77A 4X6LA 3GIDA 1LK0A 3QKUA 2J07A 5DH9A 4JLPA 4BNGA 5JADA 1V1MA 1QS0A 2ZANA 1P1JA 2QI9C 2GO7A 2E82A 3D7LA 4DCNA 1PS8A 1E1KA 4L1KA 3KKEA 4UASA 4Z9BA 2VUHB 3AR8A 4W7IA 4YQYA 4EFMA 4B6PA 2NN3C 2JAXA 3HP1A 4ZO9A 1GU7A 2GD1O 4CLXA 4NJEB 2HWKA 4DTIA 4DY4A 3EBLA 3ADPA 3Q98A 3ER9A 1MH1A 2VC2B 1EAYA 4CMIA 1J70A 2VDJA 1HSOA 2H9IA 4YRDA 3BBLA 2YVKA 3HR7A 2FA9A 4XB6B 1KAQA 1E96A 2KB0A 3HBAA 3ITKA 4DVGA 1A5ZA 4ZYTA 3U48A 3C39A 3WK5A 4JB3A 1LEHA 1E66A 2DU8A 2VPQA 1UOQA 1JLSA 4CM1A 4KQJA 1GUYA 1RT9A 2TMGA 4LRXA 4E13A 3IUYA 1E5QA 4TLCA 4X8LA 1U0FA 3DVLA 1P1HA 2Z1DA 5KDLA 1KK3A 3GT4A 3K5IA 1I80A 1E58A 2QPLA 3SZUA 1QQ7A 1G8GA 1T4CB 1IH8A 3IBTA 1PJ3A 3JARB 2WYHA 3OPQA 4YT5A 3U9SA 1AKQA 4UUOA 4HVLA 5JRDS 3PV0A 2UUCB 4IDQA 1N5LA 1T43A 2D74A 5FA6A 4PCAA 4NXMB 1E4OA 2AXNA 1I2MA 2AZ4A 3CUKA 1TO6A 1DIBA 1MDBA 1Q7BA 2HF2A 2N42A 3LQFA 4MCHA 4UU8A 4ND6A 2R68A 4C4ZA 5A0FA 2QP9X 3N6RA 1NKVA 3QELA 4DHWA 3Q0IA 4UMDA 1L1FA 3AIMA 1U8EA 4FFMA 2I6GA 2XZTA 3PD0A 5J2UB 2JKVA 1A5AB 3FNGA 3GJTA 4NJMA 5DBEX 3AHHA 1L5NA 1YBVA 5ES3A 3RS8A 4EKYA 1RVV1 1IG0A 4HWRA 2QM8A 5E6SB 5B3JC 1ODJA 1SXJC 3SN6A 4P32A 4PZZA 3RRZA 1QE5A 4Z9FA 5MN5A 2IS2A 4BMVA 5J23A 4F91B 3EXFB 3O3OB 4LYAA 5CHYA 3KALA 2FGKA 2XMDA 3HWX1 4AP5A 3GCGA 5J4YA 1YI0A 5DX1A 3TZ6A 4EW2A 3RI3A 4RORA 3IQXA 4KIUA 2YHIA 1SULA 1XK6A 3AUTA 4GLFA 4UDYX 2D1FA 3L18A 5FI5A 4RHUA 2C4KA 3DONA 5IDWA 4EQZA 4R7TA 5JY6A 3G23A 1XQVA 1Z08A 4G1EB 1QX3A 4BLVA 1V16B 4S1WA 4NZMA 2VP0A 3UMJA 3HFJA 3IA2A 2ASEA 4X92A 1F1BA 5F4BA 1EJ2A 3HCRA 1A2KC 1SG9A 3FLBA 1ZGAA 4XR4A 2C4NA 3D8NA 1MRSA 2XF8A 3LHDA 4F4HA 4NDNE 5F9MA 3RFXA 1A8SA 1TF2A 3DOOA 4LNUA 3PFBA 3H9QA 4DXHA 2XZLA 1BDJA 1Z7EA 4PYMA 2PO7A 2XMPA 4Z4CA 5DK4A 3L6RA 3D2CA 1TVKB 3TOCA 2G63A 1ZD8A 3JU3A 1XD8A 3N5KA 5JAUA 3KQYA 3LECA 2A14A 3M3DA 4TMTA 1J4AA 3DEFA 2IYTA 2IY8A 3H16A 1H05A 2IC5A 1SRRA 1DAEA 1HLGA 1XP5A 3OA2A 3R7BA 3W5CA 5DHFA 3E8MA 1X39A 1QHEA 1FBTA 3TTUA 5JI2E 4YRNA 5TPZA 1SD5A 3ENZA 4P92A 3ISVA 5BRAA 3X1YA 1XFAA 3GEPA 4FI3C 4S2UA 3WX0A 3VVBA 5BQXA 3JS5A 2C4UA 3TQHA 3MGBA 2W2TA 4JAVC 3STXA 3UBMA 5JI3E 1QRSA 4HDAA 2WAAA 1ZJJA 1M83A 1VIYA 3WRWA 2AOTA 4YRBA 3LUPA 1WB9A 4B17A 4L07A 2YDXA 1NVXQ 4YJGB 3BQ9A 1T8RA 2IQ5A 3JXEA 1L5FA 5JCJD 3DT8A 3ZKAA 1P5RA 2O2DA 3OFSA 2J0QA 3W2FA 5DJ5A 1ODSA 3KWJA 5K7SA 1SCUB 1Q3HA 2XNDA 2ECKA 5ALNA 3GP8A 3L02A 1FUUA 1SKQA 1G8FA 3ZCUA 4PANA 3C4QA 4C6HA 3TQQA 3ON5A 5E2IA 2B9EA 2NACA 2VNHA 3HFSA 3OCXA 4MS3A 1C7QA 1TIKA 2VCEA 2R00A 3MXTA 4CWAA 2WJYA 5T8KA 4ERXA 5ICGA 1ZK0A 1RADA 1Y1RA 2QVGA 3LBHA 1TDJA 3ORFA 1F8YA 3CVWA 4WJZA 4REQA 2V45A 1TQHA 2XE7A 1RJFA 3PQ4A 2VYQA 4QODA 3R76A 3P0RA 2CXSA 1KOFA 8ATCA 4JUBA 4DSOA 1OC4A 2W58A 5E9JA 1T6XA 2JANA 2ZS8A 2WC1A 4Z7NB 1MDFA 1OIVA 3KOWA 1ZGCA 4Q02A 4RD6A 1WXGA 2PWBA 4XYBA 5EJ7A 4JWTA 4KBGA 4MWBA 4LS3A 2C5GA 5ISMA 2FRDC 2H06A 1Z2EA 3QNWA 4KMSA 5ALFA 4IOKA 2V97A 4II7A 3E6AA 5IJ9B 1L8QA 4TL8A 3I61A 3HEAA 4PYIA 2EFEB 4PPFA 4B2IA 2ZIXB 3L6BA 2W2KA 2WICA 1VLMA 4GQBA 5LQJA 3RVBA 2F9FA 2Q8PA 4YRZA 1YK0A 1S3SA 4FIZA 4CM4A 1W9MA 1L4EA 3LIPA 1W2WB 1A50B 1IHYA 1L6IA 4L51A 1TPYA 2GEJA 4LDJA 4AXXA 1I8TA 3AR6A 4E46A 2ZBFA 2FPRA 5K4GA 2G7ZA 4DADA 4M89A 4M1SA 4RS3A 3BM5A 1L2TA 4OGGA 1ESZA 4FB5A 1DIAA 4JC5A 4IPTA 3T7TA 3O1JC 4ZI2A 1VHTA 4FYXA 2HC9A 2V7QA 5K03A 3QEMB 3PPWA 3I9V1 1W44A 2HYDA 4IGIA 4AJPA 4DZRA 3EIOA 2JHPA 2NZWA 5KDOA 5TNXA 2GF2A 1NURA 2WLSA 3QHAA 3H0EA 4AWBA 4LV6A 1PZMA 5ALEA 1FFCA 4Z9YA 1JB9A 2WNHA 3KPJA 2UXDB 1KMNA 3GT7A 3KFVA 3MJVA 2ZSEA 3WDKA 2V96A 2OYSA 1W96A 3LT1A 4MQEA 1OV6A 2CSUA 2OVFA 3CB2A 3MGGA 5DYWA 1RDFA 3VDRA 3JSXA 2QYSA 1ZNWA 2W4QA 4LC0A 4FFRA 2QZPA 4CJXA 1NTRA 1M6VA 1YD7A 5BPHA 1P2TA 5KAMA 2IWHA 4QT0A 4IIBA 5ALMA 1ZD3A 1FNNA 2KHZA 3F49S 4EPVA 1ZMXA 4KB5A 3TGPA 4P22A 1KFKB 2PR2A 2QY6A 3GGOA 4QYWA 1EDDA 1YE5A 5CVCA 3FIJA 1N8NA 1E4VA 1PO7A 3H2IA 1HFJA 2QUJA 4C30A 1CZKA 1X80B 5HIKA 1I36A 2XQJA 1N2CB 5K6AC 1MAWA 3ADBA 3PUHA 2HEIA 3WWDA 3IELA 3U3JA 3SEQA 1QGOA 3PLAE 3U7GA 1W35A 3IMKA 1T5BA 5DBFA 1GN8A 4MGEA 3WR5A 1EB8A 5BSFA 1U81A 5EJ6A 1FU7A 2NPOA 4UE6A 3JD0A 5YASA 4DQXA 2P4HX 1XTRA 3P32A 4NSNA 1W93A 1QMGA 5JVDF 3H5LA 3WB1A 1Y7HA 2Q3DA 1WY5A 1S3GA 3IV6A 4HSEA 1G1MA 4KU4A 1Y81A 2P1ZA 3LE8A 5TF0A 3JQQA 4IQ8A 5DNYB 3HI6A 3CLTC 3RG2A 4A82A 2P2GA 3BJEA 4UTZA 1P7WA 3IA7A 4ZA2A 4E5DA 4PC6A 1HDEA 4M8IA 4CKBB 2FSVA 1I7DA 3P9XA 3NIGB 3ZQUA 1E7MA 2VPZA 5H7XA 2KJQA 1MIOA 3K2IA 3PU6A 4KZPA 1XZ8A 1NOKA 4AF6A 1FE8A 2Z5LA 1ZUNB 1KMHA 2B3TA 5CX1B 5BR7A 2EGUA 2RH4A 1T2DA 1PSZA 2FEAA 3V48A 1H2XA 1Q91A 2QG6A 3I2HA 4MXDA 1JHUA 2ISQA 3CZAA 4EGQA 2L69A 2BCGY 3AJDA 1L9KA 3I52A 3OCJA 1D4ZA 4IGKA 4LJLA 4O63O 5H59A 2H1OA 1CZLA 4GEGA 5DTEA 3HKEA 1CEEA 5LP1A 5MN6A 1NN0A 1ZVKA 2O2CA 2ZS7A 3LHFA 5F3DA 5GQSA 3O75A 2ZR8A 1UBTS 2QMYA 3WNCA 4L4UA 5ELXA 4HK4A 4PC1A 4ZPXA 2FRVA 1V8ZA 3H2ZA 1YJ5A 3P9SA 4MLCA 2HNKA 2QNRA 4JLAA 1P1IA 1I1NA 1DEXA 3O8QA 4PZLA 4FFLA 3S5UA 1JXOA 3LYAA 1F9EA 2E85A 3JZIA 5FUYA 2RI0A 4CN8A 3TPCA 3LUHA 4YO7A 3MRVA 3I2YX 2IV3A 5KHAA 5LB4A 4DMFA 4F6RB 2NVOA 5C8XA 1P0IA 3S99A 4XJVA 4F8JA 1IULA 1M76A 2Z1NA 3AVYA 3MCWA 2W6MA 5ALHA 3RS3A 5HKLA 1Q7CA 2UZ1A 3EC1A 3LPLA 4U8GA 2BI8A 3CRNA 5JJCA 2RD2A 3SKVA 1NW6A 3QTLA 3JWHA 4HMQA 1T9GR 4K8RB 3CINA 4M0KA 4QUDA 4XPIB 4CF5A 3KHUA 4ABTA 2QL7A 1M34E 1NKTA 3DZJA 3N8HA 3SE0A 4MUYA 3T1OA 3TSAA 3D8UA 1PVDA 3KUCA 3ZHQA 1NXXA 1XEWY 3D4OA 4KQ9A 3AUJB 4BPRA 4BBPA 2GPYA 4PICA 2VN8A 5EFOA 3A70A 1YQDA 4FU0A 1R2QA 2VQSA 4PX9A 2GZAA 2D2VA 4ND3A 1SBTA 2A0WA 5ENVA 4GM4A 3PCTA 1JA9A 2OV8A 2ZCUA 3V8VA 1NWCA 5CP8A 3AHFA 3IUQA 1VB3A 1KRHA 5D3QA 2XRMA 3OZCA 2ACVA 3LX8A 1PD1A 4TKZA 5TXGA 3LT2A 3HXPA 4J91A 4CKEA 3EEIA 2ZE8A 2RAUA 2QVXX 1TAUA 1UBKS 1S8OA 2JASA 2ODAA 1NUPA 4WCDA 4HWGA 3NFRA 2IZZA 4RFVA 3OZXA 3KQVA 2FTKE 2AFRA 1O8BA 3KYBA 1YJXA 3AFHA 4M4SA 3ZZ1A 3RVLA 1S2OA 5HQTA 2BGUA 2HSEA 2W8ZA 3MF4A 3GNSA 5EEGA 2B34A 4MAFA 1THTA 4QEZA 3VYUB 1UJ6A 3C70A 2R5FA 2NXJA 4QECA 4UM8B 1MABB 4GU5A 4D44A 4CF4A 1GG2A 1K5HA 3MA0A 1XCMA 1V8DA 2H0RA 1UMBA 3M6IA 2ZIWB 1V7CA 1XZJA 1C0PA 3M1IA 3SLRA 5JDCA 2B5VA 1DJPA 2FH5B 3VKFA 4BFYA 4J0KA 2NVWA 2GBLC 2HREA 3LNTA 4OSOA 3INTA 3U1TA 3JQEA 3WL7A 3SG0A 2JLSA 1XLTA 1VSUA 4COOA 1T8UA 1FVXA 1EWRA 1GWNA 2ZTUA 3C8UA 3NHPA 1FX0A 4A0QA 4R01A 1FDSA 4HYTA 5I6DA 2JFXA 3D6UA 1LDGA 1VG1A 3OQJA 2I4IA 4LKRA 2AFVA 4PXSA 2EYQA 4OHPA 2H1FA 1LB1B 2M32A 1ECGA 4C88A 4URZR 5CPFA 4CDGA 2FPPA 3CVJA 2O0JA 3PNOA 1LI5A 3RABA 1B8NA 4TS9A 3M3HA 4DLRA 3HYLA 2J7PA 1T6NA 1TKRA 4OQXA 3LOQA 2BJHA 1YE8A 2AF4C 4OMCA 2O2EA 2YJ3A 4C7XA 1EX1A 1YZVA 4YP0A 3OEED 2ONCA 2Y66A 3HU1A 3IR7A 3Q6MA 1V3UA 4RGYA 2GVNA 4F21A 3VSAA 4JHLA 3K9FC 3ID6C 3U7RA 2O2HA 1VBNA 2YN2A 4PINA 2DWCA 3ANNA 5A71A 3QFTA 1FUIA 1AVTA 2HA0A 8ABPA 4IHQA 5E8RA 3CH4B 3EQZA 4BFTA 1K97A 2P9CA 3TLBA 3GRZA 1JMVA 1DINA 5REQB 1BMQA 3VV2A 5P21A 5HNKA 4YAUA 1RJ9A 4LKOA 5DF1A 3KWFA 4NQRA 1SQFA 1IXKA 2YUIA 4JI0B 3HS3A 3UKDA 3T4EA 3Q8XB 9MHTA 1CF9A 4ZOEA 2H54A 1USIA 3HR8A 1FVHA 4PZCA 5HF8A 1IY0A 4OEHA 3ENNA 4M46A 221PA 2CD9A 3B1VA 1V1RB 4G36A 3ZDYB 1JPJA 2TMYA 1VLLA 1EU1A 1MG5A 4AMZA 3E1SA 3ZD9A 2QN6A 2PFGA 1HZJA 4ERNA 3UJ7A 3AUFA 2FDXA 4ZEWA 5BT8A 2ET6A 1ID1A 4X63A 3GFVA 4ZTBA 3WSTA 4TXNA 2IXAA 3ZLTA 4BO4A 1S8FA 1XT6A 4JGIA 5FOTA 3G5UA 2Q6VA 1IB0A 3B5JA 3KXKA 4JVNA 4TKVA 5AKLA 3OIUA 2FP3A 4KPUB 4JOBA 2QL5A 5B3JA 4A10A 3ZD6A 1U0OC 4QHYA 4WT7A 4HNRA 1QRAA 3SHWA 3BXOA 2ZJ0A 3DVAB 4QUKA 1AGYA 1IM2A 3B60A 2OAEA 4RVNA 4BQPA 4R69A 1J2RA 3C5CA 2A7QA 3SC3A 1MAAA 3O2SB 1U0TA 1LRJA 2HRBA 3C3MA 3CNOA 3LQ2A 1FY2A 4ZT5A 1RXWA 4RCZA 3B85A 5GGYA 1M6EX 2HA2A 2PG3A 3BWEA 1SHUX 3MWJA 4W5QA 5D7NA 1NG9A 5DRYA 3CF4A 1GPWB 1Z73A 4JVLA 1G5RA 3PFFA 1QANA 2WM8A 3EARA 5KVQA 1HPLA 4M36A 4NENA 4CUJA 3I6BA 1BN7A 3WK4A 1W8IA 2X0JA 2H1SA 4QBTA 5LC1A 3SR3A 4DBVO 4ZZIA 4O4JA 3AUKA 3VHLB 1AUQA 3AGQA 1JP7A 3MPOA 1GTVA 1XVVA 2FFBA 2JBAA 5CFZA 5CB6A 4J16A 1P2DA 1ZK1A 4IDGA 1O96A 5EL0A 5G1PA 2PDAA 3UFXB 3DE5X 2P4UA 5SY4A 3I64A 1QPZA 1C29B 1Y8RA 1SCBA 1ZD1A 2HO4A 4G2TA 1W29A 4OJQA 4PHHA 1DQSA 3OSUA 2NU7A 3LGSA 4BP1A 4DUPA 1PDVA 5HKKD 5KWSA 5SZHB 5HCUA 3PNBA 4LVCA 4PLZA 4N8DA 4RY0A 2JGDB 2ZT8A 3R7WB 4BE7B 4D46A 4QGAA 4QSHA 2OC4A 4WFIA 5KYNA 1ZSNA 2JHFA 2W0SA 3NWEA 4HNAB 4B2PA 4HTFB 5FUXA 1XP8A 2MDTA 3EUAA 1HBJA 2BCJQ 4DWVA 2GFHA 2P4SA 1TTHA 3K32A 1Y42X 4Y2QA 4H3SA 3CT4A 4TV8A 3S8MA 4PLWA 5AW2A 1SBIA 3BRWA 3MLBA 5CM9C 4YLEA 4CYMA 4JBWA 4C1BA 1NVMB 4KGZA 1ZICA 2B1JA 1ADGA 5ALXA 4XIIA 5E7IA 3DVSX 4KXYA 3E22A 3TCKA 3CVYA 4F97A 3ZD8A 1H8HD 1PT5A 5BV7A 4N3GA 2PD3A 4PEVA 2D0DA 2TRSB 4QDJA 3HDJA 1DBVO 5LZ8A 1VOTA 3HCCA 3KM0A 4L8WB 4BRWA 1YBHA 3NONA 3H4IA 3O8LA 2PZKA 3F9RA 3DOJA 1FEZA 2AEFA 3H5OA 3HGTA 2QS9A 3GFSA 5K0NA 4R16A 1E1RA 2X0RA 3IMFA 1W88B 3U6BA 4NEQA 2E55A 1X7HA 2RHOA 3BXFA 4KSYA 4LSWA 1MF7A 3VHXB 4KITB 1V9LA 5HKBA 2WZDA 3OZEA 4F9GA 3B2EA 3O4FA 4OX9Y 3LO5A 1G4AE 1YR2A 3RU7A 3ORSA 2YRWA 3GJ5A 3MT0A 2YJGA 3EDMA 1RJWA 5C7IO 1P72A 4LW8A 2R85A 2BR4A 1YCFA 1ELOA 1LX6A 5GY7A 1KJZA 2VT7A 1Q95A 3LI2A 4MS4B 3I09A 1E3LA 4FGJA 3RS9A 5IH3A 5ITZA 4PWZA 2PSSA 2IKQA 3AKEA 1DT3A 1EXMA 2GF0A 3E18A 3R5XA 4IGAA 5TQ0A 1KS2A 3CR8A 3VM6A 1AS0A 4IZOA 1Y4DE 3K1YA 3U3OA 3KOXA 4BNDA 3UMMA 4LHZA 2D54A 4C20A 2H65A 5BV2P 4JGGA 4I5FA 1I4DD 4UHKA 3H9BA 3OZTA 4EKEA 3CTPA 4FHFA 4Y6GB 1L5OA 3ACCA 3EDOA 4G85A 4LUCA 5K8TA 1PWXA 2BELA 3QIAA 1PR1A 1ULZA 2C9CA 4GWGA 2CXXA 1BXGB 4QU5A 2AFIA 3GWGA 2FXVA 5TMEA 5ADHA 4PX2A 2J9FA 2XQIA 4YUXA 4CMEC 1PG0A 3FVTA 3DEJA 2WAMA 3VSEA 3GLGB 3FOWA 3PEUA 1FX0B 4GE3A 3LRPA 3RRXA 1XOIA 4Z1OA 2J9YB 3A4TA 4L9SA 1RPJA 1BCSA 3CPHA 4QREA 3I8SA 4TMYA 4LGMA 1WLSA 5DEIA 2E4VA 1ZRNA 1XNQB 1J5PA 2GCGA 1R7RA 3OWXA 3T5GA 1O9GA 2VYND 4DLUA 2JEZA 1U3FA 4RNCA 1KK1A 2FSSA 3GGSA 4GX2A 9ATCA 5ALQA 1M1XB 2P9TA 3GGPA 3PPXA 4BGUA 1RHJA 1BW9B 5IKXA 1HF3A 3MWYW 2Z3WA 4RJJA 3K2EA 3V8BA 3O31A 3WYFA 5C8YB 3L0DA 4M7RA 3WP0A 1Y9ZA 1UP6A 2ZSDA 5TVGA 2P77A 1WBDA 5KI6A 2QN2A 1ZDMA 2K5UA 5EWMB 2BBWA 3RLFA 2CKMA 3MJ4A 4B35A 3HR4A 5I5GA 3S2IA 1XDWA 1XMIA 3AM5A 3HI4A 1XQWA 2H7CA 2IY9A 2I29A 1BQ3A 2P6UA 3EK2A 3HH8A 5KYYA 3G2HA 2F2TA 2C3UA 5HIJA 3KKPA 4TRJA 3U44B 1NBOA 5EE1A 3VDNB 1IK6A 1P9LA 4NV1A 3HM9A 4FFVA 4RGBA 3I62A 4D3FA 4DNOA 4OJNA 2F90A 1F0PA 3U9TA 3CX8A 2R97A 1WHTA 3QNMA 3C98A 4C4SA 2VDMB 3E84A 3I53A 4TLDA 1L8OA 3PRYA 1AV7A 5P8WA 1NFRA 3BEDA 4M21A 2NIPA 5TSDA 4A2CA 3EPLA 2D59A 3E82A 4FYMA 5FHRA 1L4HA 3PNQA 1DFHA 4UOZA 2ZUCA 1P9WA 3A36A 4B3XA 2BKLA 4UBJA 4UOEA 2PE5A 3CSUA 4DM3A 4RDXA 4FNMA 2P5YA 5JFGA 1KVTA 3WRYA 4JKYA 2BM0A 4MAMA 5ER9A 3NT2A 3L0CA 3TR5A 4G41A 2WSSA