3PITA

Crystal structure of m-rasd41e in complex with gppnhp (type 2)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
168
Chain Sequence
LPTYKLVVVGDGGVGKSALTIQFFQKIFVPEYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein M-Ras
publication title Crystal structure of M-RasD41E in complex with GppNHp (type 2)
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 59
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pitA00
4QGAA 2JATA 4KV9A 2BMDA 1ODFA 5EZ6B 4CEIB 4P31A 2VQSA 2RB4A 4PC1A 4X8HA 3U61B 1OT3A 3O8RA 1TF5A 1XMVA 3NC1C 1TPZA 1JI0A 1KO8A 4LC0A 2QGNA 3U60B 5FBVB 1OH5A 1JNYA 2IUTA 3PVSA 1SVLA 2W6IA 1TNDA 5AR1A 4NYMQ 2QL6A 4B74A 1J90A 3VHXA 1H8EA 5JSZB 1R4AA 5AUOB 2X2FA 3HJNA 3MAAC 5E4FA 1EX6A 2QEQA 1PVOA 3ZJYA 4URXR 2DFLA 4TLEA 4E09A 3O8CA 1CR4A 3ZD7A 3VR2A 5DIFA 4TYQA 4ZI2A 4MRNA 2GWHA 3AP2A 4ASUD 4BLQA 5CITA 1II8B 3H0KA 2VH5R 2C5LA 3KB1A 3WHLA 3F3YA 3QQ5A 3NBZC 2QPTA 1U0HC 2WJVA 4G3XA 1YU9A 2FMXA 4E03A 4K46A 3FKSD 3CR8A 4GDFA 2DWPA 5TMPA 2ONKA 4BEBA 4M1WA 4GT1A 3M6AA 4P4TA 4HAZA 4Q5IA 3RS5A 2EFCB 1AA9A 1OPXA 3WP1B 5CDFE 2ZE6A 4B44A 2VHTA 2ZQ5A 3DKVA 4KCGA 3TBKA 5A5GA 4BZPA 3I5XA 2YWGA 3FMOB 3RRNA 1N5LA 5FUYA 3B82A 3ZS8A 4BRWA 1NSTA 2WSSA 4CEJA 1KKMA 4ZI3A 3MLEA 4NU0A 4NYMR 4HYYA 5CK5A 1F48A 1T0HB 2XJ4A 5FR1A 4PAOA 2W0MA 5G40A 2ATXA 2WM9B 3B13B 2GXQA 4WXPA 2VO1A 1Z6XA 1W36C 1E2GA 1R7RA 3ETLA 1AS3A 3R9WA 5GADl 1T9HA 1E99A 4CEJB 2O8BA 1AN0A 1GRQA 1E2JA 1YJ5A 1RKBA 4P4SB 1Q3HA 3D7MA 2DY1A 1F6BA 1NG1A 4Q1FA 3UG6A 2D7CA 3LD9A 5DGXA 3HYTA 4QBGB 3SYKA 2C96A 1IY0A 4HB0A 1T4GA 2CCJA 2O8BB 2ZAOA 4M4SA 2WWWA 4QOSA 2ZRFA 1EFHA 1FFHA 4JLVA 1N2CE 1VHLA 1ZUIA 1RJ9A 4O0MA 1KDOA 1ZM7A 5FUXA 4B3CA 2GKSA 4TL6A 4UNPA 5BWMA 4RD4A 4TYNA 3CM0A 4BLRA 3THWA 1ZD8A 4TTRA 1M8PA 1N0VC 1OLOA 3QG1A 4R2HA 3NBYC 4LX0A 1KI2A 3LVRE 2O8FA 3CPHA 4IDPA 3QKRB 2B6HA 5EUMA 1A7JA 1MO5A 4QGGA 3WXMA 1P2VA 1RJ9B 3BC1A 4LV8B 521PA 1GKYA 3C5HA 1E9RA 2GEVA 2VPPA 1E2DA 2RGGA 2QMOA 1P9WA 2QPAA 2YC2C 3IQWA 4O2RA 4QJ3A 4MKGA 3GLIA 2YWHA 721PA 2QAGC 2XOKD 1K6MA 4DC9A 2O8FB 2RGBA 3ZQ6A 2VP6A 5E3HA 4B2LA 1XTQA 1CJTC 5G3ZA 2IYUA 3GEEA 4GBMA 1ZNWA 2QUZA 1E2PA 1UKVY 2L0XA 1II9A 3K0FB 3VAAA 4MUBA 3EAQA 5H68A 2FZ4A 2E87A 1QHHA 2GCOA 4QBIA 2EQBA 3T35A 1W7AA 4MYTA 4KBGA 4URWR 3RLFA 5EE3A 1G5TA 4G5GA 4AD8A 1W5SA 1VDZA 1XMJA 5HKKD 4RCYA 4ESHA 5JCPA 1COWA 3KQLA 1Z22A 1RVDA 3LAWA 4AIIA 1U9IC 5FOSA 4H1VA 3NH9A 1Q1EA 1QRAA 2J0SA 1QHHB 4PHFA 3FKQA 2GCOB 3IKJA 5BN4A 1FQKA 1E2QA 1OSNA 3DZDA 1MKYA 2AX4A 3GJ6A 2IWRA 3WNDA 3TUZC 1E9BA 3P32A 3P20A 2V3CC 3QIAA 1M7HA 1Z0DA 1JEDA 1EX7A 3RVBA 3WBKA 5LD2B 1SHKA 2VLIA 5KSZA 1P9NA 1AZTA 3LO5A 2B8WA 2P65A 1W48A 3EZ6A 2XJ9A 3HU2A 5DI9A 5HCNA 2P6NA 2BMEA 1H8ED 1IY2A 1E9AA 1ESNA 3PCRB 4LUCA 2QBYA 4OHWA 4UNRA 3VMFA 4GP6A 1G41A 4C0BA 1E2FA 3W5JA 1LFDB 1XZQA 4KFSA 2Q3HA 2ZUCA 3QE0A 3WRXC 1RRPA 3IUYA 3I8XA 3MD0A 2ZREA 2GZAA 4B43A 3SDZA 4IDNA 1IN6A 2JJ8A 3E1SA 3FMFA 3AQ4A 3MG9A 4Q18A 2QBYB 3EARA 1R2QA 3SI7A 4QBHA 1WF3A 1U2RA 4AY2A 4LCBA 3DHWC 1EGAA 4PPQA 4JKIA 1KYIA 2EWVA 3SBEA 3T1VA 3SJAA 4EFNA 1JQJC 2E9SA 4WVFA 2O8CA 3GLFB 4WA7A 3CNNA 3UK6A 2PJZA 1CF4A 2RAPA 3X1YA 5J4VA 1T8UA 2WKQA 4A4DA 1T3SA 2A5FA 1XNJA 4Q7MB 1ZUNB 1QVAA 4OJKA 1KK0A 4V0LA 1S1MA 3DZ8A 1Q1QA 2XAUA 4A2QA 1XEXA 1XRJA 3QI2A 2J0UA 3M4YA 1R6BX 3THYA 2WJIA 3P1JA 1WE2A 1FMLA 5LB2A 2F9LA 4QKQA 1Z07A 3DM5A 2VSXA 4OI1A 1ZM2A 2BEKA 4LBVA 3OEHA 3OEEA 1YZUA 1QHGA 4XD7D 3B8HA 5JJIA 1XEXB 2CHGA 5HE8A 4TQ9A 4DZZA 2J0UB 3X1WA 3KKMA 3DL0A 4XVQA 1E69A 2KBFA 4KYIB 2TMKA 2KBEA 1L2TA 3KFXA 4ZDIA 3AKDA 4F91B 2CBZA 2QORA 3T15A 4UNQA 1G4UR 2YC4C 3UPUA 4Q1CA 3CX8A 1HT1E 4B2IA 2CE2X 5F9HA 3REFA 2H92A 3TIFA 1GILA 2HLDD 3IDQA 3TJZA 4JLBA 1PV4A 3GFOA 3NDBB 3MFYA 4BUJA 1CBUA 1XD8A 3ADCA 1U90A 2AWNA 3CPJB 4A2PA 1VMAA 4QM7A 2ZRCA 5J5CA 2IYYA 4HDCA 1SGWA 4US1R 1UBGA 4JIMA 3U6KA 1SVSA 1MH1A 4DLWA 2IS2A 1D2EA 5CK4A 2QQEA 2XTNA 3TQFA 4D82A 1HURA 4QM6A 4MGKR 2WWFA 4OBEA 3T06B 3TGPA 3R8CA 3RAPR 1MT0A 1O87A 2WMOB 2JJ1A 3LVQE 1SVMA 4PAMA 5DO9A 1WP9A 1X86B 5LBIA 2G3YA 3OE7A 4LJ9A 2DFNA 4Y0VA 1RC8A 4KVGA 3U7FB 3W8RA 1IXSB 2H1LA 1XJ0A 2ZRLA 1L4YA 1VG9B 1S8FA 4IVPA 4ARZA 2SHKA 4FWTA 3GLFE 5H8WA 1T6NA 3B1ZA 4NYJQ 3ZVLA 5B30A 1G17A 3SJBA 2Z43A 4OYHA 4PZZA 2ORIA 2PH1A 2KE5A 4LBYA 5TV2A 1OKKA 5M04A 3ZZTA 4B73A 5KNDA 1JAIA 2DYKA 1G20E 2REXB 1N6RA 2QN6A 3AVQA 3OIYA 3QG5A 3CRW1 3J81k 1MRSA 2C2HA 2GHIA 4FWIB 4FXPA 4NL4H 4ARZB 5A4JA 5DN6D 5CM8B 2JLYA 4GPTA 3A1SA 2GTPA 1VYUA 1WDTA 4Z8YA 3RWOA 5DHFA 5FUVA 2ZYTX 3U4QB 4PZLA 1Y63A 3L8YA 1JALA 4EJSA 1NY6A 3QXSA 3VNVA 2J1LA 2G83A 2YINC 3GMTA 4NCJA 4EQ6A 3NKVA 4QHYA 1G3UA 1NP6A 3ZVMA 2ZRNA 3CF6R 5AJWA 1IAQA 1XEWX 2O0KA 3GD7A 5FOXA 5KSOA 4B3GA 5TVKA 4JZKA 1NJGA 1Q44A 4UNNA 3WP0A 3ONWA 1E4YA 5IDVA 2ZR7A 5FOUA 2YHSA 2F6RA 3VX4A 4A8JB 4DLTA 4EJSB 2KI5A 2IYXA 3REGA 4EQ6B 5LPNA 2CLCX 2KJQA 4TT3A 4NYJR 4Q03A 4JLOA 3CWZA 4BFVA 2IXFA 2VSOA 1K5DA 4TLCA 4CDGA 1TQ4A 3D6TB 2ZAMA 1X8LA 2OEPA 3I4LA 4UQOA 4NONA 3MGCA 3SQXA 1LF5A 2MMGA 4DIDA 3AVUA 4RFVA 3K9LA 4O3MA 1RPZA 3BOSA 1AM4D 1YRBA 1MRNA 3H4MA 4M22A 4MDFA 1G7TA 5JRZA 2PEYA 2VHQA 5KYKA 4RZXA 3AVWA 2HJGA 3MJHA 1ANKA 3PQCA 4JYBA 5K8TA 4M1TA 1TUEA 3KQKA 4YONB 1Z06A 5FOVA 1G3RA 3B2EA 1KDRA 3KB2A 5J47A 1U8ZA 4FMCF 3SE0A 5EXTA 2ZRPA 2P3SA 3FPAA 3KFVA 1KI9A 1RFLA 2YOGA 2E1RA 1ZBDA 3KXLA 2XGJA 1V43A 1NLFA 1M2OB 1KSJA 4G01B 221PA 1BO6A 4KSCA 3KKNA 4GFDA 4TWZA 4YMSA 4Z1MA 1AGPA 2QT1A 4W5HA 1DO0A 2ZM5A 1IQPA 1CR0A 2ZRBA 1GM5A 3K0CC 4D4KA 3OEHD 2WTUA 5JHHB 3K09C 4DXAA 5FBLB 2VSFA 1U0JA 3V00A 2Q0HA 3N2EA 1VYTA 5FBQB 1GAJA 4F38A 4P32A 4PHTA 1VIAA 6Q21A 4BGDA 1MO6A 1G8FA 2ZVQX 3K0EA 2VTKA 3LBNA 1US8A 2ZANA 4RCZA 4V02A 4M21A 4XWOA 1GNRA 2FX3A 4Q9LA 3HYRA 1ZINA 4LWZA 3BE4A 3CBQA 4YMUA 1XCGB 3U3MA 2QZ4A 4NTZA 1OH6A 1IOZA 5GJVC 4U7DA 4BZQA 5EE1A 4Q9IA 5FPTA 4LYHA 3T61A 2AXPA 4JLMA 4OHVA 3F5FA 2IUUA 4H1UA 1GIAA 3ZVRA 1US8B 2P67A 3RC3A 3EG5A 2CVHA 1OH7A 2ZI3A 3TVDA 4D0GA 2ODEA 1N0UA 3SN6A 5SZIA 4TMKA 3JZAA 3HPQA 1I2DA 4HUTA 1Z08A 3LRPA 1OHHA 4JJZA 2AK3A 1UPTA 1XWIA 4QBFA 3UWOA 2PZFA 3TKLA 4ASUA 3GLHA 2VHUA 2YZ2A 2ZROA 4AC9A 4PAQA 1G4AE 3OAAD 4A1FA 2F1JA 4V0ME 3U3RA 1Z28A 3FKSA 1Z0FA 3C7KA 3B5JA 4NP6A 3LW8A 2MSCB 3CWQA 3K09A 5FBWB 1W2GA 5JFGA 4II7A 1GUAA 1UDWA 2FJUA 2YOFA 4IEEA 1E2HA 5AJYA 1G7CA 3VU9A 1TF7A 2ZUBA 3GLHB 4B48A 2GJAA 4DCUA 2D3WA 2ZJAA 3D8BA 1SKYB 1GOTA 2ECKA 3FFBA 2OFWA 1PZNA 5FTKA 5FPKA 5TB5A 2AWOA 1DAGA 4D0NA 4DWJA 3TMKA 3BB3A 3OIUA 3NG1A 3V4FA 1OKKD 1Q22A 1TQDA 4V0OA 3OIVA 3VU9B 2GVDC 4I1VA 1Z0KA 1G9XA 4XIGS 1W4BA 2D74A 5AWFC 3ZZ0A 4W5WA 2WAXA 1KGDA 4LGMA 3Q72A 3TAUA 2ZJYA 1WBDA 3UMSA 3AH8A 3QEJA 2O52A 3QKUA 4TMZA 3QXCA 3SBDA 2C04A 1NRJB 3G82C 4WZ6A 5FPYA 4Q9HA 4MKFA 1GRRA 1GKUB 4HB2A 1KNXA 1QVRA 4JSYA 4YMTA 5E7IA 1NL3A 4KFRA 2GXSA 2QE7D 2Z4SA 4R2IA 2WAYA 2YV5A 3FHOA 1KAGA 4MYHA 2GBLC 5ELXA 2ATVA 4ZO4A 5FTLA 4RFSA 2C9YA 5EP2A 1N5JA 3EIEA 5EP4A 3IQXA 1SHZA 1Q0UA 4F4JA 2RHMA 2BJWA 2IEYA 1II0A 2OSBA 2P6RA 4MRVA 1NF3A 1ZM4A 1MR3F 1TEXA 2R62A 4HAUA 1KK3A 3NWJA 1PUIA 3LX5A 4M1KA 5GJBA 1WRBA 2BEJA 1YE8A 4AKHA 4RFSB 1WMSA 3UG7A 3UANA 4LV6A 1Z5ZA 1I4TD 1W4CA 1Z8FA 1CULC 3E70C 1Q12A 5DYGA 4FI3C 2ZRIA 3CPEA 3U3KA 2F7SA 4M9XA 4DLRA 4YXWD 2O8DA 5E95A 4HLDA 4RD0A 1E0AA 1W4AA 121PA 2IEZA 1NMXA 1KSFX 1UKZA 3TK1A 2QROA 3GLGA 2BIFA 4JVNA 2X19A 4G5RA 4IW3B 3UMRA 2V8OA 4R7ZA 4PTLA 3K70B 4IDHA 2VHCA 3KQUA 1ZVQA 3NDPA 2PMDA 2O8DB 3DEFA 4R9UC 1WBBA 3GLHE 2GBLA 2OLJA 4KJZA 1SKYE 3LW7A 2FV8A 3GLGB 1P2UA 2FFAA 1D2NA 1Z6GA 3C14C 5HKKA 2VF8A 3PV0A 1VG0B 4AKIA 4TTPA 2ANCA 3EC2A 1EWRA 3W90A 3I73A 2QA5A 5L8VA 1VYVA 1EFTA 2OILA 2NO6A 1E2LA 5JCZA 3HU3A 3Q7QA 2A9KA 1FUKA 3KZ1E 3F0TA 1KMHB 2OAP1 4MGYR 1Z83A 1JR3D 4PXAA 1P62B 1ZD1A 3QEOA 4CT4B 2F55A 1RIFA 5FBRB 3PEYA 2JLRA 4PPGA 4URVR 5F9FA 1EG7A 1ZU5A 4AK9A 2QU8A 2GZHA 4WIAA 3S1AB 4NHOA 2EYQA 4LJYA 1II8A 4DHEA 3DO6A 2OZEA 3ZZUA 2ZRGA 5JRJA 2QP4A 4OJQA 4UJ3A 4PC2A 4X8OA 3H1TA 3QPUA 4OQNA 5CB6A 3THOA 1KI1A 4PQYA 5HTKA 3CZPA 1OHHD 2P5TB 3PEVA 1KSHA 1LVGA 2QTVB 4IXNA 1T0JB 3Q85A 2CL6X 4W9MC 2YWFA 1N6IA 3JZMA 2G9NA 2VEDA 3AP3A 4I99A 5DHAA 3W3ZB 3U2QA 1E9FA 4EPRA 1OFTA 3CNOA 3PEWA 3W34A 4F7WA 3NC0C 4D4LA 2W83A 5EE0A 4HZUA 1TQ6A 2O5VA 3LQQA 1D2MA 2IYSA 5FTNA 3A36A 1UJ2A 4GI7A 3GJ5A 2FU5C 5C18A 1Z47A 5LDDC 4KO8A 4C2UA 3BK7A 1X8KA 5CM9C 1D6JA 4D6PA 4EPWA 1DAEA 5EXXA 4JLJA 1QG4A 2RGNA 4CZ2A 1M74A 3EWAA 2FSGA 2H5EA 2OBNA 2GK6A 3RYTC 3UATA 2ORVA 3U7EB 4HZUB 2BWJA 1GFIA 2PLRA 1IXRC 3MWLA 2J45A 2CXXA 2OXCA 2QTFA 2WKRA 1G6HA 3D3QA 2RCNA 3QXXA 4C0LA 2V1UA 4QNMA 4PHGA 1SVWA 2W2VA 5JI3E 1G21E 2MMCA 2OESA 2EFHB 3KKQA 2V55B 4OK5A 4RKEA 2GETA 3LA6A 2HXSA 1U94A 3GPLA 3AGQA 3SQWA 4G5QA 2F1RA 4XD7A 2BDTA 2IYLD 2VRWA 2ZTSA 3OFND 1NKSA 3K9GA 3GLGE 1CXZA 2BJVA 3I3SR 1GZSA 2IHBA 1NJFA 3KL4A 2HCBA 1E0SA 4DSTA 4XSHA 2IF0A 4IOJA 3MJRA 2ZRKA 3QOFA 2QT0A 1G18A 3IIKA 1VCNA 1J99A 3X1XA 1CS4C 2D62A 3K8YA 2JLUA 2RGXA 1YZGA 2CDNA 4CYMA 4QHTA 2CK3D 4BLPA 2IW3A 1ZAKA 3C4JA 3QKRA 2ZJOA 2XB2A 1S0UA 2HLDA 3LBIA 3MRSA 4FMDF 5LD2C 4ZCMA 5AK0A 2BVNA 3PUVA 1AJEA 5GVSA 1IM2A 3B9QA 4LBZA 3KQNA 1VECA 2FN4A 3A6PC 4G1UC 2ZS9A 3AEZA 2QENA 4RSGA 1TMKA 1G16A 3MWJA 2AHOA 3K0SA 4WZAE 3VR6A 1P60A 3RRYA 2B21A 4MYCA 5FI1B 1NMZA 3K0FA 4A92A 3K70D 4LPSA 4JLDA 3K0AA 5FH9A 3WMEA 1XF9A 1YZLA 1AIPA 2IYZA 4ZPXA 1S3GA 2ZRDA 2DFKB 4PSAA 1R5NA 3CH5A 1LTQA 4LY6A 4OI0A 4C30A 2JEOA 3W6PA 3O47A 4TMWA 3W3AA 1TU4A 1UBFA 4Q66C 4A6PA 2HT1A 1Z0JA 1ZNXA 1HY3A 2QY9A 4JLAA 2O8EA 3VNUA 3K0AB 4G5OA 1ZMXA 1P73A 1TL7C 2A7QA 3T1TA 3BB4A 2ZJZA 1GNPA 1YZNA 1LB1B 1KO5A 3B7GA 4V0KA 4OI4A 1KTVA 4Q19A 4QL3A 4TYWA 3FWYA 4HLQB 4Q4JB 2DB3A 3AB3A 3EZ9A 1VCMA 2GEUA 2PLFA 2ZRHA 5DN6A 1S2MA 2O8EB 3RHFA 2IXEA 1F5NA 1BMFA 4LDJA 1RZ3A 1NSFA 1G291 1OH8A 2GJ8A 4LYAA 1NG9A 5KO2A 3IGFA 2QSYA 1CP2A 5J4LA 3CIOA 1XB2A 2UKDA 3PUZA 1E2IA 2HV8A 4KFUA 4M9SA 1Z0IA 1W1WA 1Y3AA 3CO5A 1UEIA 3FDIA 5G3YA 1AQYA 3L0PA 2JASA 1G3MA 3AVVA 1A2BA 1J8MF 2F43B 3I62A 3BWDD 4A0RA 1ZIOA 1W46A 2FOLA 2H18A 3ECCA 2PCJA 1HA3A 2FFHA 3RANA 3RSLA 1N6HA 4CRWB 1NN5A 2C78A 5D3MB 4BE7B 3TAHA 2WWXA 2GVZC 2B7CA 3W9YA 5JI2E 3TVTA 3ICQB 2ERXA 3GLFA 1EFRD 3A8TA 3B78A 1OXUA 1W5TA 4RY2A 4B47A 1H65A 1N6PA 1P5ZB 1IY1A 3THWB 3RS4A 5FL7D 4KSBA 4ACBA 3TSZA 2QGZA 4L4UA 2QRZA 2FFBA 4LI0A 5DH9A 1GL7A 1LS1A 1NVVQ 3B1XA 3FTQA 2FGKA 1Q57A 2REOA 3DMDA 3K53A 3G0HA 4M9QA 4XVUA 1KOFA 5FR2A 4D26A 3WMGA 2LKDA 1R0ZA 4LYFA 4QJ4A 2UZ3A 4DB2A 4M1MA 3T1QA 4OQXA 4EIWA 1FOEB 4R71A 2CEAA 4IFBA 1Z29A 3NBXX 4JL6A 1G7SA 4JMPA 2EU8A 1VG8A 4B3BA 1A2KC 2I4IA 2R8RA 4L5BA 3CW2A 4OHXA 3SHWA 1DE0A 1CR2A 4WAUA 4I4LA 1OXVA 2FPKA 3I92A 2RMKA 4LJ5A 2Z83A 1ZC4A 1XTSA 1GSIA 1N3BA 3LV8A 5K8UA 1SXJB 2XNSA 3AKCA 3DKPA 1GTVA 1QBKC 5E7MA 1DG1G 3L43A 1B0UA 3KJGA 2ZI4A 1U98A 4B35A 2OT3B 2Q9BA 4ACAA 4HUQB 1NVXQ 2OUKA 4HAVA 5BXQC 1TTTA 3FHTA 1XXHA 2V54A 3TW8B 5FL3A 5JJKA 1NVVR 2WPDD 4CW7A 5HZKA 4JS0A 3ZYCA 3N5CA 2ZPTX 3L0SA 5DISB 2J5XA 4X8MA 4M1OA 2G6BA 2I3BA 2VF7A 1IHUA 1L8QA 1KO1A 4W7SA 2IYRA 4BEJA 3CLVA 3P4XA 5H70A 1OW3B 1G64A 3FGNA 4RZ3A 3FMPB 2PJRA 1LNZA 4PSVA 4YMVA 1XXHB 1JR6A 4LJ4A 4JLNA 2C99A 4RZ2A 2VBCA 2ZUDA 3TSOA 2PBRA 3RS0A 4E22A 1TAGA 2ZE8A 2GK7A 4A8JC 2A5JA 4EJSC 3FHCB 2CLSA 2UVQA 5CYPA 1GRNA 1XX6A 2KB0A 2WIBA 2ONJA 2RGCA 2BM0A 4POAA 2JLVA 4AURA 1OXSC 4ESVA 2VHJA 3OAAA 1WB9A 4JKYA 3I5YA 1R0WA 1DAFA 1QF9A 2FGJA 3KUCA 4OL0A 4BFXA 4HB4A 5HZHA 1DG3A 1UFQA 2XTZA 4CEHB 3SR0A 3ADDA 2ZE7A 4TMTA 1JECA 2P6UA 2UZIR 2IL1A 821PA 3FOZA 1R10A 4IRUB 3U5ZB 1XTKA 4N1AA 4QNRA 1LV7A 4AI6A 3ZIAD 1NVUQ 2J87A 1IONA 1KY2A 4RJLA 4PHHA 1W36D 3U4QA 3VR4A 4BFTA 4EPVA 1AZSC 4QC2A 5KPJA 3W5IA 1UADA 4BRUA 3CX6A 3TE6A 4D81A 1JEEA 1W47A 5CJPA 5EUQB 4NE2A 4MA4A 2HF8A 1CKEA 4FINA 2PZEA 2C77A 4GOXA 1E9SA 4D80A 1BMFD 4TL9A 1X6VA 1JBKA 2AKAB 1BYIA 4PO8A 3W8NA 4A8JA 2W6JD 4FD2A 1SXJE 4P4UA 2J0QA 1G8GA 1CJUC 5DI3A 1UAAA 1OXXK 1R0XA 2QE7A 4V0MA 1H8HD 4PC3A 1UF9A 1X8JA 2V9PA 1QHIA 2FE4A 2OBLA 3LQRA 4TSFD 3A1WA 1E1QD 4HZIA 2ZEJA 3GQBA 5L3SB 4MGIR 1QHXA 2WZQA 5DI3B 2BKEA 2CVFA 4ZDJA 2BOVA 5JHGB 3FFAA 2WOOA 4PC6A 1U8YA 1DEKA 5CIQA 4L8GA 1HT2E 1KJWA 1NVWQ 3VX3A 2OLKA 2KWIA 3RDPA 5HPYB 5TDHA 1XPUA 3D31A 4TQAA 2V4ZA 1XXHE 3AVPA 3GJ7A 3B1YA 3NHAA 3Q8XB 1ZYUA 1XCPA 4XSGA 1SULA 4OQLA 1G7RA 5B64A 3EWSA 5CLLA 1U0LA 1IXZA 4PC7A 4URYR 2IX3A 1RYHA 1NMYA 4YXWA 3PXGA 5AUNB 4LHZA 2Q21A 3B6EA 1UKYA 1GVNB 5JWOA 4UXHA 3LXXA 2J59A 4RZUA 2IS1A 3VHLB 4B3XA 3SJCA 1CJVC 4PPNA 2CL7X 1SXJD 4AYTA 4EUNA 3HU1A 1EFCA 4YDSA 1P9RA 1YR6A 2XB4A 1NN0A 4V03A 2IHYA 2C9OA 1XD9A 5JMTA 4JSTA 3CRQA 1DAMA 4BFSA 4QXAA 5JBQA 3AUXA 4L16A 4M1SA 1G6OA 2CE7A 1UBCA 3FMIA 4OKSA 3ZLJA 2VA8A 4WZBE 3L8ZA 1P2TA 3K9NA 2EFEB 2ORWA 1TU3A 1P2SA 1SVKA 1Z6AA 3AKYA 2Q6TA 1T91A 3QKTA 1TF2A 2PEZA 2GJSA 4MITA 4PR0A 1YR9A 2HT6A 3SOPA 4GRAA 1G8PA 4DSUA 2ZU6A 4OHZA 2QP9X 1DVRA 3WHKA 4DDVA 2JDID 3PITA 1JJ7A 1JR3A 2CMKA 2FSIA 2ZYVX 3GJ4A 4U02A 3RS7A 1E2EA 1OFIA 1D5CA 1M7BA 4AWXA 3I1FA 3ZQJA 5JEDA 2AD1A 4A9AA 4AG6A 1JQLB 1WQ1R 2DWOA 5SZJA 1TEVA 3M1IA 1N25A 2I1QA 2QRNA 2IXGA 2AD5A 5J4KA 4FN5A 1RRFA 1G5RA 2FWRA 3U7HB 2ZI9A 2GF9A 1NIPA 2A2ZA 1G3QA 1ZW6A 2FFQA 3EZ2A 4PX9A 4TLDA 4E5UA 8OHMA 5C2JB 1CIPA 2HDNB 2N42A 2NG1A 1GL6A 1PUJA 1R0YA 3CRVA 4CT5A 1Z63A 1ZD9A 1MOZA 2AKYA 2AN9A 4A0GA 1OV4A 1V5WA 2J7KA 3RS3A 2G0NA 3TRFA 4B33A 2AXNA 4I1UA 3RS2A 5EJEA 5FI0B 4PO1A 5AJZA 1VPLA 1FPMA 1SZPA 3T1OA 2ZR9A 1VIYA 1KI7A 4IOLA 2BM1A 3CX7A 5EP1A 3I32A 4HLUC 2J46A 3ICEA 2F1IA 4DSOA 1Z6YA 3ASYA 3K1JA 4QJ5A 4ZCIA 5KTYA 5BQ5A 2O0JA 1S9HA 3QY0A 4XH9B 1C9KA 3B1WA 5F98A 2BBOA 3CRRA 4OI2A 1DTSA 4F92B 3DOEA 4UXIA 2O0HA 2BKUA 2GJ9A 4IEIA 4ZDWA 3R8FA 4BFYA 4N0DA 1DOAA 3QENA 4TTQA 2J41A 3IEUA 4PQFA 3QJYA 2NO0A 1GG2A 4IDQA 4MKHA 1QZXA 4U00A 4B32A 3SEAA 1E2NA 2GDJA 2W0SA 1E94E 4FMCB 1A5TA 2VP9A 3K70C 3OF5A 3DMNA 4A82A 1UM8A 1W49A 1ZU4A 4DLZA 2IYQA 2BHRA 4Q47A 5BN3A 4DBLC 4HDQB 2OFOA 1KK2A 3QPWA 2XZOA 3OFNA 1YR8A 3IBYA 3A58B 3ADKA 2ERYA 2ZU0C 3SZRA 1BYUA 1E79A 1T8TA 1UKEA 3PENA 1NIJA 4TMXA 4UJ5A 2REBA 4NCIA 1KKLA 4M0LA 1N5KA 2ZSEA 1J7KA 1GITA 2A5DA 4Q48A 5TARA 4AG5A 5JEEA 2J0VA 3TUIC 2NO9A 2CK3A 4DRZA 4HAWA 4F4IA 4KHZA 3W6NA 1AKYA 1DS6A 1OIXA 4HLUA 3CUEF 4A6XA 2J7PD 3AV0B 5GVRA 1FX0A 1I4DD 1EXMA 1SVOA 2CNWD 4NBSA 1ZJ6A 4DLUA 3AVTA 3LNCA 3KJEA 2YYZA 4M9ZA 3R7WA 4IKEA 2FEOA 3EA0A 4B34A 1ETUA 1LY1A 1GP2A 4DLVA 3JVUA 2WWHA 3THXA 3QKSA 2ZJBA 4DDUA 4PO9A 4TQUS 4HDOB 3O8BA 3I8SA 3A1UA 3AGPA 1FX0B 4OQMA 2ZJ5A 1JR3E 1HE1C 3QXJA 1KO4A 4MGZR 2XSZD 2G1KA 4OQFA 4DLSA 3CH4B 1P6XA 4HB3A 3R7WB 2R2AA 2JLSA 3PUXA 5ANRB 3GP8A 3MUFA 2F9MA 4MRSA 1NN1A 3TR5A 1RW4A 3X2SA 3THXB 1LS6A 3QKSB 4P0TA 5J4YA 2NZ8A 3KDSE 1W0KD 2Z0MA 1FTNA 3Q7PA 4Q7KA 3WMFA 4JBWA 4BLSA 3BRWD 2A5YB 1E32A 2IA5A 4PANA 4PZYA 4KI0A 1F60A 4XJXA 2IYVA 2WWGA 2FF7A 4L9WA 2QM8A 3IO3A 2IC5A 1N0WA 1Q21A 1J2JA 2A30A 1KMHA 1XDBA 2W58A 1KI4A 3IHLA 3K9HA 3VR3A 1NN3A 2Q9CA 3ZD6A 4UXJA 4TMVA 1XMSA 3PR1A 2R6GA 1AKEA 5AJVB 1EESA 2VP0A 2ZRAA 4HLCA 5JECA 5BYJA 3U3JA 3H84A 2ZYWX 3S1AA 3ZGXA 3MCAA 4C7OA 2Q3FA 5EQTA 1A4RA 2ZRMA 4HEJA 4NZYA 5AJXA 4DDWA 1CJKC 2RGNC 1TADA 4C0SA 4QRHA 3A4MA 3BJIC 5FUWA 2HCJB 4EFLA 3EPKA 5JJLA 3HDTA 1LF0A 4G5SA 5J4HA 3DVLA 5F3WB 1Q20A 1KAOA 1ZIPA 4DT1A 4TYPA 1XD2A 2WMNB 3CONA 4US0R 4L15A 5EZ5A 4M2LA 4Q9KA 1RRCA 3I61A 2DPXA 1BIFA 1B23P 4C7OB 1IN7A 3ZS9A 2D4HA 4ILEA 4C0JA 1XBTA 4Q4HA 1FZQA 1XZPA 4LHXA 4Q4AA 4US2R 1SVIA 2DCUA 2GZDA 1ZNZA 4NCNA 4NKRA 2ODWA 5JS8A 4DT1B 1AQUA 1XJQA 1XD2B 1EFRA 1T3LA 2ZE5A 3LLMA 4C4PA 4HATA 3T12A 1GKIA 3U3OA 3NEYA 4ZV4A 5AUPB 5FL7A 4Q4HB 1R5OA 2CHQA 3KKOA 4Q4AB 4D4JA 3FE2A 1E2KA 4IDOA 4C0QC 1NLZA 5KSYA 4CGZA 3RC8A 1IN4A 1E1RD 3GFTA 4NCHA 4PFSA 4GL2A 5FFMA 2ANBA 4DCSA 4B76A 1Q1ZA 3I72A 1R8QA 4Q4LA 4CF7A 2G88A 1W0JD 3QVUA 1NBME 2CHVA 3EZFA 5FPHA 3Q3JB 4TYYA 2GEDA 3PG5A 1VHTA 4C2TA 3EPHA 5BYKA 3PIRA 1HE8B 3NIBA 2HEIA 2ZI5A 4AKEA 4I81A 3U7GA 4KVAA 4XVRA 4YDHB 2DWQA 3SU8A 4K8OA 4YMWA 2R6DA 2QM7A 3NBFA 4DDTA 3EIQA 3LDAA 4JL8A 4YC7A 4IFEA 3PEUA 2ODNA 4YQFA 3ZVNA 2FNAA 2WBLC 4C0HA 3OESA 3QVVA 1Z3IX 2PCLA 1PLLA 1YZKA 1CR1A 1RYFA 4FCTA 5JLJA 1JPJA 3ASZA 5CB8A 3QF4A 2ZSBA 1GWNA 3WBJA 1YRAA 1E79D 2H8KA 2RH5A 4G0NA 3KKPA 3SJZA 1XMIA 4EFMA 2BBTA 2NOAA 3BBPA 3VR5A 4ABYA 1JXMA 2WPDA 1P72A 5IK2D 1ZP6A 5L3VA 2JJ2A 3KXKA 1FP7A 5EP3A 4KLZA 1E96A 2ODBA 2Z6VA 3QSYA 4KFTA 3UXMA 1IBRA 1E4VA 4DKXA 4AKGA 2PX3A 3QF4B 1K8RA 4QHSA 4I1OA 4RKFA 3AF2A 2BBWA 2DBYA 1JXOA 2X77A 4JL5A 1MV5A 1NBMD 2GCPA 4HSEA 4M8NE 3BFXA 2KSQA 5L3RA 4DEXA 3GJ0A 2C03A 3PUWA 1PLKA 5GJCA 4OHYA 1N6KA 1U99A 1KI8A 1ZNYA 4TLBA 3OIWA 4ZKEA 4LC1A 4M1YA 2OCYC 5KPDA 3L0OA 4HAXA 5F2EA 1C1YA 1XEWY 5DE3A 4BFZA 2JAQA 2NPFA 5KUTA 1VCOA 4MDEA 1XJCA 4L9SA 1D9XA 4W5JA 1DARA 3L2OB 1KZGB 3HR8A 3AF1A 3N2IA 4ON9A 2D7DA 2QTHA 1NNEA 2K5UA 3ND9A 2ZIAA 3PFIA 4Q4JA 1XCMA 4GOKA 4YLGA 2OCAA 1XPOA 2C8VA 1XEFA 2QPOA 2EW1A 3ZIAA 5D3QA 3H86A 2NZJA 2ZSFA 1TUIA 2CCKA 4XWKA 4BASA 2JLXA 3WRYC 4CVNA 4DLXA 1G5PA 2IK8A 2NO1A 2AL7A 4S2EA 2F1HA 2PX0A 4S35A 5EE9A 5DNYB 2PZGA 3CB4A 1S9DA 5FOTA 3VR1A 3IIMA 3IPYA 1ELOA 3NEJA 4DIEA 1KK1A 1VKJA 4GNKA 5K8LA 4BWYA 1HV8A 2NIPA 3B1VA 2F43A 2NGRA 3QBVA 2QI9C 1W36B 2X8AA 4H9GA 1XTJA 1OB2A 3GLIB 5DLQC 3BFVA 2LKCA 1QHYA 2W6JA 4D0LB 2IYWA 4EAQA 1SXJC 4LJ8A 3HP1A 3LXRA 4GZLA 1OFHA 1KMQA 5D3MA 2DFTA 2R65A 3A4LA 1Z0AA 3LWNA 4LHVA 1FP6A 3KXIA 5KOYA 4QG7A 3RNLA 4URUR 1H8HA 1SKQA 3P4YA 2JLQA 3T34A 2OAQ1 1KJYA 3TQCA 4RD3A 3BERA 3EIHA 4TN1A 2CCGA 3VKWA 4TSFA 2GRJA 4Q02A 1E1QA 5L3QA 4MUAA 1ZCAA 4ZDKA 4MYUA 4JBYA 1OYYA 1HUQA 1F2UA 1R5BA 3EPLA 2V7QA 4ERNA 3RRMA 2YOHA 4FMDB 3NH6A 5FOWA 2A5GA 4LJ6A 4X8LA 3C16C 1F2TA 4XWAA 1ZCBA 5KSPA 1EWQA 2GA8A 3AP1A 4RD6A 2W6ID 5G53C 2D2EA 2QAGA 3DDCA 4TLAA 5L3QB 3IHWA 3O8DA 3TW4A 3UMFA 1A1VA 1L4UA 4Q7JB 2PT7A 1F2UB 4DVGA 2NTYC 1JJVA 4IVQA 4GOJA 3GJ8A 1L7VC 4ZIRA 1CLUA 3IO5A 3P26A 1HQYE 2ASEA 2ZYUX 4JT4A 4B3FX 2H16A 2ZJ2A 2GXAA 1G1MA 2ZSAA 1F2TB 1WA5A 4PPFA 1CEEA 4NYIQ 4QGFA 3BS4A 2QAGB 1K5GA 4GZMA 2IS6A 4LJAA 4J0QA 1SXJA 2YVUA 2OV2A 4UKDA 3V9PA 5GJWC 4EPYA 2B92A 2D06A 2V6IA 1QHNA 3FYHA 2QNRA 5HE9A 1KSGA 4ZIRB 1YZTA 3BH7A 4HUQA 3SC3A 3SFZA 2AR7A 1U9IA 5KNBA 4Q7LA 5EXSA 2XTMA 1RE0A 4KITB 4DEYA 3WNCA 5TY0A 5TXGA 1U81A 5E7JA 2WJJA 2NPIA 5CLQA 4DB4A 5J40A 1M34E 1BOFA 3GJXC 1M7GA 1IN8A 1JPNA 2VIIA 2WSSD 3EX7C 2NMVA 5JWRA 3BH0A 3C5CA 2O8CB 3BAFA 3GEIA 1HQCA 4PQRA 3CR7A 1P3JA 2WV9A 3NTUA 3T5DA 2JDIA 3SNHA 2WJGA 1OE0A 2JJ2D 1YVDA 3TNFA 4E07A 3GLIE 2FEMA 2H7VA 4MH0R 4KU4A 3BORA 3PUYA 3CKLA 3LH5A 2Z5FA 1FTSA 4NYIR 3KJHA 4IOMA 4ZCLA 4B2PA 1T3HA 1WXQA 2R6FA 3MWYW 2MSEB 2A78A 4XTRA 4GMDA 3R9XA 1E3MA 1DADA 2H17A 3GFPA 3THYB 3H2YA 3EW9A 1Z2AA 2YJTD 4AYXA 5B58C 2W2TA 3V4RA 3AUYA 2RGAA 2EVWX 1W44A 3NHBA 4KXFB 5JS7A 4DUGA 4CEHA 1KZ7B 3T5GA 2QQ0A 4NPHA 2OHFA 4IJMA 2BMFA 3IBGA 4WW0A 3A1VA 1KHTA 1P7CA 2OCPA 5AUQA 2YNMA 1KI3A 2B7BA 4XOIA 2N46A 2QMEA 5FTMA 3ZH9B 3VKHA 1J70A 1Z6TA 4LJ7A 1OYWA 4OK6A 2RGDA 4JLPA 2GCNA 3VFDA 1OFUX 4NCKA 2FPLA 4BECA 3TR0A 4LPKA 2X2EA 3WYAA 2DHRA 3NXSA 3C41J 1Q3TA 2A3RA 4LBWA 5FTJA 3WNBA 2CL0X 3DPUA 1E98A 4BFWA 1KDTA 2IBMA 1OIVA 5KDLA 1FMJA 1G19A 2BC9A 1E0KA 3B85A 2WSMA 2XZPA 3ND8A 4IXMA 3KQHA 1FL9A 2WOJA 4F4CA 4TL7A 2OFXA 2GILA 1KY3A 2R44A 3HPRA 3U44A 5K8IA 1G3IA 1NLYA 1CTQA 2BCGY 3LBHA 1DPFA 4ITRC 1R8SA 4B3DA 3EZ7A 2YKGA 4C0AC 4DCTA 1XFAA 4KYUA 2Q9AA 2W00A 3KJIA 4Y0AA 4FIDA 3AVOA 4LHYA 4A0FA 1MO4A 3QXHA 1ZM3A 4QGHA 4Q9JA 1E6CA 3X1DA 5L3SA 1X1RA 3U44B 3GJ3A 4NH0A 1BS1A 2HUPA 3CF2A 4TZ0A 2BCJQ 3RABA 1IJFA 1JB1A 1COWD 4KLNA 1I2MA 5HCIA 3TSWA 4F93B 1TX4B 2XXAA 1P61B 4V0NA 2OXRA 2J7PA 5DYIA 5KHOC 3RWMB 2ZETA 3PJRA 1T5IA 2WICA 4Q00A 3BH6A 4OK3A 2CNWA 2PL3A 2WIAA 3QBTA 2HJVA 1A82A 1PJRA 4PSKA 4EDHA 1PLJA 1S96A 3EXAA 1E9CA 2V7QD 1XTIA 5CYOA 4R98A 3A4NA 5IF9A 1OB5A 4K81B 1X3SA 2IUSA 5IHPA 1DAHA 4P4SA 2HYDA 2XXAB 1KI6A 4GMXA 5EE5B 2V1XA 4DSNA 2R9VA 4EPTA 4JBXA 1N6OA 2F3TA 2OO7A 4B6EA 5C1BA 5UKDA 1P75A 4KODA 1U8AA 1W4RA 3E2IA 2XSZA 2FA9A 4Q1BA 2EFDB 1FUUA 3CZQA 4EPXA 3OHMA 5C4GB 3EPJA 4BPBA 4B71A 2R6AA 3EASA 3LX8A 1IJEA 2XEXA 5SZKB 4Q01A 1KI6B 1CJMA 1W0KA 3HWSA 4MKIA 1KIMA 1XTRA 2AK2A 5G41A 1O3YA 1NI3A 1NKTA 3C15C 3N70A 2I1VB 5H1YA 2OCBA 2PT5A 2Z4RA 1TQ2A 5HR5A 2J9RA 3AF0A 1N5IA 4QFMA 2C95A 3L82B 4LOAA 4D4MA 4DLYA 1E2MA 4DCNA 3AM1A 2LCFA 2OE2A 3A37A 3BFKA 1S1CA 2BMJA 2HXYA 3ZDQA 4C0KA 4D2IA 5BW8A 3KX2A 5CIWA 4LYJA 5KDDA 3IIJA 3ADBA 1GDDA 3IILA 1NY5A 1N6NA 3TLXA 2EYUA 1HH4A 3M0EA 2H57A 3U6BA 1EFUA 1E9EA 1OJLA 2Q3MA 4NDZA 1XP8A 1M6NA 2VP4A 2FDCA 1KJZA 2W2XA 1YQTA 3QNUA 2C98A 4A0HA 2XNDA 1UBEA 1FNMA 2WHXA 1P4SA 4P33A 2MSDB 3Q9LA 4JYCA 3R20A 1OF1A 2ZS8A 1CRQA 1S3SA 3OEED 4JVLA 4MQBA 4Z54A 2QMHA 2JIZA 1MABA 3B60A 1YR7A 2P2LA 1W2HA 4FCVA 2X1VA 3VQTA 2XZLA 1CRPA 2FSFA 4Q1AA 1E0JA 3CNLA 5EXPA 2WVJA 1ONBA 5KNCA 4BFUA 3UWKA 4Q21A 4DJTA 2FSHA 5DSZA 4DUGD 4BQSA 2OG2A 2V6JA 4HI0E 3GEHA 4JT2A 3AVXA 1MABB 2FPMA 2JLWA 2EWWA 2AFIE 3AVYA 1UEJA 1YHNA 3QPVA 2GJKA 2RGEA 1DAIA 2PMKA 4IOKA 2GAAA 5LB4A 4A36A 1AGRA 1GNQA 2AFHE 3Q5EA 2FH5B 5IT5A 1MO3A 3DOFA 4IHQA 1E1RA 4LHWA 3BGWA 4C3ZA 2P5SA 2G1JA 4URZR 1VG1A 4MRRA 1ZM9A 3KTAA 2ZSDA 1I4LD 1W0JA 5JWHA 1FQJA 4RD1A 1QDEA 4BZXA 1UDXA 2Y8EA 4A15A 2IWHA 1XPRA 1ZRHA 4AYWA 4NMMA 2ZR0A 2JJ1D 3K0CA 2LWIA 1C4OA 3TH5A 1LW7A 3KTAB 3MSXA 3QUSA 4JVSB 2WJHA 1VCIA 3OE7D 3AKEA 2OBMA 5P21A 3BIFA 2QMUA 2ZS7A 2J3EA 1DBSA 2DR3A 2NO7A 2ZRJA 4CIDA 2VYFA 1HEIA 1D8TA 3WYFA 3P27A 421PA 5KU1A 1CU1A 1RRGA 4GP7A 4M53A 3UIEA 4JJKA 2IYTA 2ZI7A 4DCVA 1E9DA 2IT1A 3G5UA 1ZC3A 3KUDA 4Q1EA 5C4MA 2IF2A 2QP3A 4EKDA 1DAKA 3WY9A 1ESMA 1OXTA 2QSZA 3LFUA 3WYGA 5IK2A 2ZI6A 3SFVA 2WKPA 4ZKDA 2XITA 1BH2A 2JCSA 3F8TA 1M1YE 2B8TA 4IVRA 1JAHA 1OIWA 2D2FA 4LSGA 2OM2A 4LRWA 3X1ZA 3LLUA 2GAOA 2N1BA 1NBMA 5FPSA 3E5HA 1S4QA 4MRPA 4WBSA 5BN5A 2C9CA 4I1SA 3SS8A 4FW9A 4JVMA 4RD2A 2IS4A 1G8HA 3R9IA 4TL8A 2ZITA 2HF9A 4O25A 5A0FA 1YZQA 2ZXUA 3SHFA 2VP5A 4P3YA 2BBSA 1DELA 3Q5DA 1KO7A 3EA5A 2RKOA 1BKDR 1G8YA 4UNSA 1KNQA 3VTKA 4BLOA 1DO2A 2CLDX 3AF3A 3SYLA 2CJWA 2GF0A 5CDFA 4N3NA 4KBFA 2VP2A 4TT3D 5B57C 1AS2A 3JVVA 1FNNA 4Q1DA 2FG5A 5IRCD 4Z8XA 2F3RA 3FVQA 2FZLA 2EFGA 4JLKA 3NVAA 3QF7A 4FMBB 4RVCA 2NQ2C 3A1TA 3CRMA 4U5XA 1SQ5A 2JA1A 2BV3A 3BB1A 2CJWB 3MMPA 1J8YF 3AF4A 2GESA 2GXUA 1WCV1 2VL7A 4C9BA 1F3OA 4WXRA 2JGNA 3FB4A 2YWEA 4Z51A 3W6OA 2XOKA 2ZJ8A 1QG2A 2P0EA 2XX3A 3BXZA 1IN5A 2QAJA 2QG6A 3L0IB 4D25A 1ZUHA 1D9ZA 2ZVPX 1GL9B 2G0TA 3IPXA 3VKGA 1VTKA 3BD9A 3UKDA 3C8UA 1AS0A 4KAXA 3MWKA 3TUJC 5SZHB 2GNOA 1N6LA 621PA 3SYNA 3EC1A 4A2WA 3CF0A 3OZXA 2JLZA 1HYQA 5C46F 2HYIC 2R6CA 1FW6A 4TZ6A 4WOPA 3IEVA 2RHDA 3RRZA 1KDPA 3LY5A 1XU4A 1HTWA 4CEIA 1Z2CA 2XNDD 5JZVA 5CJ2A 4Z1MD 3DM9B 3RSOA 4B6FA 1X1SA 5B2ZA 3GCGA 4FCWA 1EK0A 4LK2A 1Q1BA 1YKSA 3HR7A 1T5LA 4LV5B 2G77B 3B9PA 4HAYA 2JIZD 2WWIA 1QHSA 4GSYA 4XTCS 5KDOA 4LZZA 4B75A 1AK2A 4BLTA 2WWYA 2WJYA 5JSZA 4O2LA 4N0EA
chains in the Genus database with same CATH superfamily
4QGAA 2BDUA 2JATA 2PG3A 1MPTA 2Y0PA 1ODFA 4JB8A 5EZ6B 4CEIB 1W2WB 3HYLA 3O8RA 3K0HA 3LDHA 2RI6A 3E0QA 1N2CB 1V7CA 2ZIUB 4TUYA 4DNQA 4IDCA 1KO8A 5LQMA 3U0BA 4NJEA 4BWGA 4H17A 1YSCA 3SC6A 1GD1O 2OORA 3B1KA 4DW8A 1B74A 2Z6QA 5H0IA 1J90A 2BONA 4YUAA 2XQJA 3PIDA 2V7UA 4NIMA 4JI3B 1XZIA 3TINA 1NJ8A 3FZQA 3QVLA 1A9TA 3ESBA 2I9KA 3M6FA 4LFAB 1QV7A 2EG9A 3LMKA 4B9AA 1NC3A 5ICMA 4MS4A 1QPZA 2XI4A 1PSZA 4NJEB 4W1PA 1PI3A 1QLWA 4RXTA 4L3WA 4YPFA 3RS8A 4TYQA 1L0BA 4TS9A 1B0PA 4E11A 4MRNA 2YQZA 4WOJA 5BNIA 4LRQA 4ZCTA 3MLBA 2PZLA 3PJEA 4QXPA 4DBVO 3E1KA 1YOBA 2VDMB 1G5IA 5CPBA 4BLQA 4M55A 5CITA 2ZIVB 1SC4A 1GL3A 3NWEA 1JDPA 3F3YA 3QQ5A 1DRVA 3NBZC 2QPTA 3CT6A 2FMXA 4E03A 4M8SA 3FKSD 2E49A 2JLCA 3HP4A 3PIIA 2ONKA 2PKQO 4C07A 6PFKA 4MS4B 3B36A 1GNLA 2IUFA 3M6AA 3R3SA 1PJZA 3ZE7A 5JXGA 4Q5IA 2WI8A 2YZMA 1YE5A 2HBQA 4ZRMA 5KX5F 3CA8A 3I42A 4LDPA 1AA9A 3TQTA 4BNVA 4YCCA 3ZTYA 4H0CA 5E6RA 1LDBA 1FCJA 2PKRA 3I5XA 5B5SA 2YWGA 4N7JA 1FSZA 1UWVA 4Q6BA 5FUYA 3B82A 2PGXA 2HK9A 3ZS8A 3T5MA 3ZCRA 2WSSA 4CEJA 3KB6A 3MLEA 4RNCA 5HKBA 4B87A 3N8IA 4QASA 4PCLA 3QVOA 4FYHA 3KALA 5G40A 3E7FA 1T1RA 2WM9B 4JFAA 3RTEA 4ZYUA 5SY4A 4ZYWA 2ILTA 1V7ZA 1A2QA 3OCWA 2VO1A 7GPBA 5E6RB 1M67A 1Z6XA 1DBWA 1E2GA 1WXHA 2QJFA 4HADA 3KKEA 1YF3A 3FSRA 4FFWA 2JFUA 4Q6WA 2V0GA 5BUCA 1AS3A 3OJCA 3R9WA 5CFOA 2FR8C 4X1KA 5GADl 4CEJB 3EVFA 4MGHA 3TFOA 3ZBQA 1ZRSA 4U7WA 1F8FA 2WD8A 4DOMA 1F6BA 3PX2A 1NG1A 1SUCA 4Q1FA 1L7QA 1RM5A 3G6WA 3HYTA 1Z6QA 3GRUA 4IH1A 4KIJA 4LQLA 5JISA 1GPMA 1CB7A 1DBPA 3CGGA 2WUFA 1IJKA 1N5MA 1IY0A 2ZP1A 4JGGA 1IBCA 5LZ4A 2PUAA 2CCJA 3R44A 1U65A 4PWYA 4X1KB 2ZAOA 2WUWE 5GY7A 2TECE 1NP3A 5DGTA 1EFHA 2XT6A 4Z3OA 1YK1A 2NPOA 4LVOA 5FUXA 1RJ9A 1ZM7A 2O48X 2VCEA 1LRJA 2GKSA 3HBAA 4UNPA 3TD2A 3HY3A 1VJ0A 1PL6A 4RD4A 3I64A 4BLRA 4C0XA 5HWSA 4D97A 4OYYA 4UDYX 1ZD8A 4TTRA 1DFGA 1N0VC 3LTEA 1ZH6A 4LZLA 4GGPA 1A8HA 1O95D 2QN8A 2O8FA 3P0FA 5K0EA 2R68A 1TRKA 5HOEA 4EECA 4FDTA 4EVSA 5EUMA 2I8AA 4V0QA 4A8PA 4YRPA 4EHAA 3HL4A 4R9RA 5IMSA 1RJ9B 3EH1A 2EV9A 521PA 3KXDA 5JXWA 1PL0A 1HLDA 3FOWA 1GKYA 3PJFA 2GEVA 2XAAA 2YC2C 2RGGA 2QMOA 3SMQA 2Y2VA 4N48A 2BW0A 5EL0A 3IH5A 3GLIA 3K16A 3FTEA 2O8FB 3QWAA 4NBRA 4PINA 4QE3A 4LX8A 2QVXX 3GAFA 3JZIA 5E3HA 1XZFA 3VKVA 2DHQA 1CJTC 1FFEA 2VJNA 3PK0A 2Q5IA 2F8MA 2QUZA 1KP9A 1UANA 3JW8A 3O8OB 4Q24A 3VUEA 5AVYA 3N7AA 2QI9F 1Y3IA 2CNOA 3ILXA 1QYIA 4RK5A 2PUTA 1XQ6A 4IXDA 5H68A 5LA6F 5E8RA 5ALIA 3COZA 3TOSA 3GBPA 5LQSA 1ISPA 3O3CA 4WJLA 4MYTA 5DBOA 3OBBA 3ABSB 3CZ9A 1QO9A 2ORYA 2XRYA 3DD5A 5B7GA 4G5GA 3LOQA 2Z1MA 2C9DA 3O83A 4PLCA 4RCYA 5HKKD 5JCPA 1COWA 1PE0A 3JD1A 1U3UA 3CH6A 3CU5A 5FOSA 1Q1EA 1QRAA 2VQ3A 4LMRA 2J0SA 1JU3A 1U8FO 1YJBA 4Q3EA 1FQKA 3VR4H 1OSNA 3DZDA 1MKYA 4NVRA 5F23A 2FWJA 3I45A 4E32A 3TUZC 3HZHA 1ECCA 2O2EA 1RWXA 3IMFA 3P20A 1I0LA 1J49A 3DZIA 2VLIA 5KSZA 5JZ9A 1P9NA 1CZOA 1FUEA 1G4HA 4IIEA 8ATCA 1N78A 2B8WA 4XLLA 2ZBEA 3TECE 5HCNA 3GRCA 4RV5A 4J9VA 2P6NA 4KE8A 4E13A 2BMEA 3BMNA 1H8ED 3PCRB 3WB1A 1SU8A 5F3RA 4PLZA 1MNQA 5BP7A 4GL4A 4MEJA 5MFZA 2K7ZA 4IG9A 4M0PA 5HZGA 4C0BA 4YJ2F 4EO9A 2ZIGA 2WM3A 2Q29A 3TTXA 2ZUCA 1WUYA 3OM8A 4JITA 3WRXC 1HLPA 1R9MA 4NNOA 3KPWA 2QX7A 1DXOA 4EHHA 4N3GA 4D74A 1ESDA 4H4EA 1J97A 1Y5NA 2X0IA 1Q1GA 3TFWA 5E38A 3BMNB 4GECA 1OC2A 3V46A 3V4FA 3AQ4A 2O4UX 5FP0A 3SF8A 2V6FA 2UU9B 3N7TA 4QBHA 3SI7A 2VTEA 4CM3A 4OTZA 3D8SA 4LCBA 5FYDA 5BNFA 1CZRA 4AY2A 4G9EA 2D13A 3P9CA 3HU5A 4TT8A 3D8RA 3CMCO 4LHSA 4M1QA 3V1NA 1BEZA 5IASA 2E9SA 4CLHA 4HWOA 4FDAA 5BMVF 1O94D 4HQKA 2GYWA 3V2IA 4DQ0A 5HRCA 3GLFB 4C7XA 2O8CA 1DRKA 1Z3CA 3CV3A 2B4YA 4FDMA 4Q3KA 5J4VA 3FI0A 2DHDA 2FW0A 3SF8B 3H16A 3EODA 3KQVA 1PTJC 4BO7A 4E46A 5AW2A 3O26A 2YJZA 3AR5A 3AY0A 4OJKA 3I2JA 1K6XA 1IQRA 4PRLA 5FO1A 3DZ8A 2DQSA 2MIIA 2POCA 1RT9A 3LX4A 2XAUA 3DDNA 1GEEA 5K4AA 4JENA 4RKQA 1N7HA 4BGVA 4DQVA 2B83A 4PYQA 1FU7A 3X0DA 5HM6A 3K5WA 4YUWA 2P6MA 3JR3A 3BM5A 3KYJB 4J1NA 3THYA 2QOEA 1JSCA 2NQTA 3ABRB 3H3FA 1D6NA 3H8WA 3NU1A 2XCIA 1Z6PA 2F9LA 3TD6A 2EW8A 3ZK9A 3K6KA 1T2CA 3ZEAA 4DYHA 2VSXA 3FTPA 4QKQA 4JOBA 2BFCB 1NPDA 4E5KA 1ILWA 2BMAA 1QHGA 2H1FA 1X87A 2HQOA 1GG5A 5DCWA 1JSZA 2ENUA 3GGGA 3JQEA 3WRXA 1JGTA 1JJIA 3EIWA 3TRIA 2JNWA 5HE8A 3OQBA 4GYWA 4FUTA 4ZGGA 5A2GA 3OZDA 4NPCA 1SBCA 2CGEA 1AQIA 1CUJA 2KBEA 1K08A 2FPIA 4OHUA 4QREA 4ZICA 2BSQA 1QV9A 4F91B 3ESZA 4TTSA 2CBZA 4TV8A 1QIDA 4L5IA 4EOGA 1U1FA 1PGNA 1U2GA 1U28A 2JZCA 3RUIA 2UXBB 3CX8A 4AQDA 2ETVA 5ALLA 2CE2X 3L18A 4CUKA 2QTRA 1B8VA 2HQSA 1GILA 1N4DA 4S24A 2ID4A 3T5AA 5CVVA 3A4VA 1LWNA 4ARVA 2VZ9A 2F8TA 1SA0A 3PD7A 1IEQA 2GMWA 2YJGA 3HXPA 1JVSA 1J0BA 3AK4A 2FPIB 1OXMA 3W06A 4U7JA 3GJSA 4DPMA 1XD8A 1DLJA 2AC7A 2GN8A 2DKOA 1QAQA 4TV8B 3T3MB 3VO8A 3GN2A 4AMBA 2GVNA 2Y0EA 4QXRA 4B6PA 3F6BX 1DIOB 1JXQA 4UE3S 3BD8A 1E63A 1B6RA 1KGSA 3WGLA 1KU6A 4YNBA 1P8AA 2ZIEA 4JIMA 2IS2A 5EFOA 2V3WA 2C1EA 3G9XA 5CK4A 1VGQA 3UAXA 1SA0B 2PRZA 2R8PA 1R8YA 3VZDA 2EBHX 4BVGA 4D82A 1DQYA 4BNJA 1F14A 3IP3A 5IT4A 4YJFB 1UT5A 4MPRA 2XNHA 4O2BF 3EZNA 4H1HA 3ACDA 5FQNA 3CIFA 1H1DA 2XY4A 3NIGB 3LVQE 1K68A 4DABA 2FG7C 4ZU1X 4PAMA 3OF3A 4UBNA 3ZOZA 1Y5RA 1X86B 4NK5A 4FFSA 5LBIA 2MTBA 1RC8A 1EFAA 2OOKA 4P5DA 2ZRLA 2C0QA 1S8FA 3TX2A 1HFKA 4ZVLA 2ZTUA 4BTEA 1Y7LA 4FWTA 1GGKA 3H6KA 4J16C 3EQ9A 5EZSA 1KEEA 2A0FA 2FUG1 3EK2A 3BEOA 5J9FA 3SJBA 2P7HA 2Z43A 4RPCA 2ORIA 4YH1A 1QQ5A 4LBYA 4BNNA 1D8AA 3D54D 4EH1A 4EK9A 5M04A 1NMQA 3BFPA 4KQMA 3D0RA 2GOYA 4FLFA 4NX2A 4D5GA 3VA7A 1G8KA 4FGJA 3J81k 1MRSA 2GHIA 4N5NA 1CDZA 4MMYB 4NL4H 5A4JA 4F3CA 1PX0A 2VUIB 2BZGA 1KEEB 4GPTA 2YZ7A 3BMOA 2GTPA 3E7DA 1VYUA 1WDTA 2DM6A 3JQ6A 3R5TA 3I76A 5DHFA 5DULA 2Q5EA 2V9ZA 2QUBA 5FUVA 3U4QB 1T8RA 3L6EA 3CE6A 1JALA 4XR9A 2PAAA 3K8OE 3ADOA 3VZSA 1JBQA 3NV9A 1NY6A 3G02A 3QXSA 1N77A 2PL9A 2VAXA 2BZ0A 2ECOA 1GEGA 3GMTA 5E9QA 1T34A 5A9SA 3PVCA 5IVHA 2GARA 9ABPA 2ZRNA 4DAEA 1XEWX 4C29A 3I1JA 2ZBGA 4WLUA 2RKBA 2NT3A 3LVBA 3SX4A 4EL5A 3BMOB 3II6X 4J7XA 4CNQA 2V7VA 4O4IA 1EJ6A 4FB5A 3WP0A 4PYLA 3QE3A 1OCEA 1ZOPA 4ZQGA 3MERA 3VX4A 5I9IA 4HD8A 1Z5PA 4HV4A 2YQ4A 2CLCX 4I08A 4HOYA 4J49A 3FETA 3KOOA 2RHHA 5A9SB 4BFVA 1XMPA 4J7AA 2O2CA 2YCBA 5IJAA 2PWAA 3ETJA 5IAOA 4ZI5A 2FRDA 1VMEA 3OO1A 1T1GA 4TLCA 2Q50A 1QZZA 3WZMA 2I0FA 4S04A 4LF4B 4P4GA 2ZAMA 3A10A 1X8LA 4Q3OA 4XCQA 3VJLA 3SS9X 3GQBB 1HR0B 4UQOA 2WU0A 3MGCA 1FRZA 2C0CA 2DFPA 3ODPA 1U7HA 3AEXA 4RFVA 3DEZA 2P62A 4PS0A 3F5SA 3WB9A 4KUHA 3CSSA 4G84A 1DBIA 2BE9A 2Y71A 3H7IA 1C1XB 4G5YA 3Q7IA 5CMLA 5JRZA 3S8YA 5KYKA 4YO7A 3LFHA 2OWDA 5IFKA 3Q2IA 2Y0BA 2C2MA 2Q3LA 1NJSA 4OFBA 3UWPA 4BP8A 1QCCA 3BJRA 3H7AA 2RK6A 2YN2A 4YASA 1SPBS 3BCUA 1Y8QA 1CB0A 2MYPA 1KDRA 1OR8A 1MC1A 1YJXA 2PH3A 3KB2A 4R1UA 5CW2A 3TQHA 3ZHYA 3QEAZ 4E70A 2XCRB 3ZWYA 3ZWPA 1TJ3A 4BNWA 3VDQA 1HYHA 2W6CX 4P54A 3SE0A 4UZEA 1O97C 5EXTA 2ZRPA 1CSEE 3FPAA 1KFBB 5EZQA 4CKWA 1M6HA 1ZBDA 1Z62A 4DG5A 4EGCB 1NLFA 3EY9A 2C4HA 4Z1MA 3T99A 3GG2A 1AGPA 1Y8QB 2QT1A 3PQDA 1OBHA 2DJIA 1ZQ9A 2AG1A 3TWOA 3WNQA 4CHTA 3T3OA 1OOEA 3HEBA 1RWQA 5JCOA 5DLDA 2WTUA 4D9HA 3GA7A 3HLYA 3K09C 3W5CA 2OFPA 1JVBA 3PXEA 5AKYA 5FBLB 1U4OA 2CHFA 2H1HA 4UU0A 4F4DA 1MVNA 3C6YA 1VYTA 3WB0A 2YXEA 1P0PA 1PO7A 2YXPX 3HB4X 4P32A 4OIMA 4PHTA 4CKWB 1VIAA 5JANA 2VJAA 1MO6A 4CMCA 1Y9AA 3K0EA 3CINA 4YBRA 5WRFA 3SZUA 3G0BA 4XWOA 2FX3A 3IV6A 4PICA 4AQYB 5CFMA 1P6QA 1UM9B 4DUYB 2AN5A 3CBQA 1XCGB 1EJ0A 3U3MA 1GUBA 3EZYA 1CDEA 4NTZA 1CYDA 1ILEA 1OH6A 3R5HA 2ZXFA 4U7DA 2R8YA 1U8XX 2VT3A 4Q9IA 3A26A 3T61A 1ZVKA 2F90A 2FWAA 4H1UA 2RARA 1GIAA 1EH5A 4Q3BA 3D4BA 3F78A 3OECA 4MJLA 2HTEA 4BQOA 2BGRA 4GUDA 3TEJA 3JQGA 2XCSB 4D6YA 1D07A 1Y8CA 2Q2VA 4D0GA 5GIPE 1N0UA 1I94B 3JZAA 3TXXA 2EFYA 3HPQA 1VJDA 3S2FA 4B1FA 4RHFA 5JSKA 1D7OA 4JJZA 2XUAA 4KIUA 1XWIA 1UP7A 1NVGA 1EQAA 1NTOA 3TKLA 3UB4A 1NQOA 4QIHA 4OU4A 4ZI7B 2WINI 1G4AE 2QD5A 2F1JA 4DR4B 4HH0A 5E0KB 3JQGB 3MJVA 1E1DA 3BHNA 3FKSA 3FMVA 2GA9A 4NP6A 2PPVA 3LW8A 2MSCB 3CWQA 3K09A 3AJDA 5JAIA 2EEZA 5JFGA 4II7A 1BWQA 3L79A 4XR4A 1G7CA 2DETA 5TQ0B 5LP6F 4RK7A 5H5JA 2OYSA 2GJAA 3SM3A 3SQDA 4WN9B 4DCUA 1RD4A 4O4LA 3FFBA 1GOTA 1I5OA 2TS1A 4RKYA 5JNUA 4NBVA 3RRJA 1H6CA 2ZYIA 4RA9A 4YRRA 3BTVA 4D0NA 4KR3A 3OZFA 1QORA 1H6BA 4ONEA 2FWBA 3BB3A 3NG1A 4P1ZA 1OKKD 4HY3A 1QANA 2AUTA 3EBLA 5C1PA 1EX1A 4XWTA 3NKLA 4Z4HA 4V0OA 3FNEA 2EKPA 1ECPA 3R0ZA 4YGYA 1PKEA 4I1VA 4Z9BA 1L6RA 2YY7A 2A86A 2QRKA 2I4LA 2O5CA 2GPNA 1W4BA 2GBIA 2VXOA 3RYHA 3ZW9A 1FS5A 3K71B 4ND8A 3TYXA 3LPLA 3ZDDA 1B6GA 3GY0A 4OU5A 2WTNA 1T5SA 3QKUA 5A6SA 3QXCA 3CVXA 1NRJB 2HDWA 2I2XB 3LDUA 3N0RA 3L4KA 5CA0F 3MAGA 1GKUB 4MICA 4B3MB 2HA3A 1VLQA 4KRFA 3RYFA 5DFAA 2GXSA 2OHXA 2QE7D 1M75A 3CFYA 3P8ZA 4G0QA 4Z9FA 3RYHB 4OB7A 3HV2A 1AU9A 2PH5A 2DBVO 2HU7A 2XUOA 3I6YA 4HTAA 4MYHA 4WLOA 4MDFA 4ZO4A 4TWAA 5F2KA 5A6SB 1G5QA 2OZKA 1IL0A 1HE2A 1GFWA 4XSVA 1NGSA 2QL7A 3IQXA 1TW3A 5C8YA 4FUQA 1O4WA 4L51A 1C7ZA 2HREA 2TYSB 4F4JA 1QCDA 2AG0A 1H0RA 1TAHA 3A1NA 2IEYA 2OSBA 3C8DA 4IYJA 4KUGA 1JQEA 3BJEA 1TLFA 1W6RA 2HNKA 3NI2A 2HV9A 1D2GA 1NF3A 4Y0NA 3RYFB 4DKJA 2FMKA 1KK3A 1O95A 4M1KA 5D51S 3Q2KA 1TK9A 3V8BA 1XP5A 1YE8A 1V7PC 4KPGA 1JEAA 1PJ4A 2BHTA 3LA8A 2G9VA 3ODGA 4MZXA 3QYFA 2VPIA 3QE9Y 1GZHB 5C8YB 2J08A 5E6SA 5TVGA 2NSDA 3F96A 3RVPA 4JV5B 1XKLA 1VPDA 4CKYA 4FI3C 4GX0A 4QUDA 3T4EA 1G21A 2OD9A 3R0VA 3U3KA 3T1YB 1U04A 1PK9A 4W9RA 4U2BA 3LT5A 4I1IA 4J2OA 4WXYB 4TVBA 5E95A 2I65A 5KJFA 1YBHA 2PZJA 4JC8A 3W7VA 1UKZA 5KI6A 4FT2A 1PGQA 2X19A 5E6SB 4DJJA 4G8DA 3C1UA 3NBAA 4O6VA 4PX2A 4QECA 4PN7A 4R6WA 3R2JA 3ETGA 4LNAA 4EJ0A 1N92A 1G21B 2WHRA 4N0QA 3RG8A 3K70B 4BBAA 3VYSB 1Q50A 3A9SA 1G42A 1V5GA 1ND5A 4RL6A 4BX8A 1V1RA 3DEFA 2IX9A 4R9UC 4XUGB 2H29A 1MX1A 3L77A 3QPBA 4W8HA 2OLJA 3EMVA 4KJZA 2EQ5A 4J0HA 1C3JA 3LNTA 3D5QA 2JFGA 4H6XA 3AERA 1L7NA 3PC7A 5HKKA 3ZWCA 1GCUA 2BF7A 4L8FA 2EP7A 2Q2QA 1QH9A 3EC2A 1O94C 1QGUA 3GLKA 4R16A 1L5MA 2WAAA 3D9QX 1YIDA 2VJOA 2QA5A 4G2NA 1Y37A 2VNJA 1V1RB 1VYVA 2X0JA 1Q6YA 4O5AA 1Z17A 2NO6A 2MINA 5MF6A 2QRMA 1KA9H 3O2NA 3K72B 2L19A 3DO8A 2A9KA 4I46A 4W4TA 4BYGA 2UUBB 1QDUA 3A70A 3CCBA 4MGYR 2B8NA 1HNZB 5ISMA 2RJ3A 3PTAA 1K4MA 2JRCA 3KOZA 3UAZA 4RK0A 1QGUB 5EY5B 1EG7A 3ROEA 3AETA 3ZGNA 4DLBA 5F9FA 1FDIA 2QU8A 5MN4A 5HILA 2GZHA 1SBHA 4RV9A 2EYQA 2Q5CA 3FNFA 4PSCA 3DO6A 2OZEA 4FFRA 1R8JA 5KJ6A 2I4TA 2L82A 2QP4A 3QVTA 1Z13A 1TRHA 4X8OA 2CZQA 3QPUA 5FWYB 4Y1GA 2YV4A 4HWRA 4R3WA 4EEKA 5HTKA 1DQPA 4NMXB 3L7AA 1BWPA 4GO1A 4X24A 1RACA 1OHHD 2PKYX 5BN1A 4ZHQF 1ZOSA 3AETB 5EHZA 1YIAA 4ZC1A 4JT8A 3DVQX 5AW9A 3W1EA 2QRGA 2X8WA 4B7XA 1XA3A 3JZMA 4PYOA 3W2HA 4ZTZB 3VPXA 3AEUB 1U0GA 2R8BA 3G8DA 3AP3A 3IR6A 5DHAA 4I50F 3W3ZB 1JG6A 1E9FA 1C7JA 3PEWA 1Z45A 4XPZA 2W83A 1A7UA 4R1PA 2AZXA 4UPDA 4X7RA 1FY2A 1O94A 2B4QA 5C18A 2JFPA 4OOFA 4QLAA 2BD0A 3SKVA 4P7GA 1FFDA 3ANYB 4FSXA 4KO8A 4RTQA 4C2UA 4NBLA 1C3OA 1CRZA 1NV8A 2HO4A 4W6QA 4ZVVA 3T94A 4B4UA 4JLJA 1GNTA 1FQOA 1ZKMA 4LZJA 3T7TA 3UATA 3CF4G 2ORVA 1IPHA 2HB6A 5TLSA 1GFIA 1WCYA 2G9QA 2AXEA 2J45A 2CXXA 2PLRA 3D3QA 3MWLA 1G6HA 4C0LA 2RCNA 4HNTA 3CVYA 2Y4NA 4ZAZA 3TXAA 1QQTA 4ZANA 4E4YA 2X86A 4POOA 4BRZA 4JI2B 1RTKA 3I01A 1YS9A 1K7SN 3DBRA 1C3OB 2MMCA 3KKQA 4WT7A 4OK5A 4RKEA 5HQTA 2GETA 4ZT3A 4BQRA 3I9OA 3NJ4A 1TIPA 2ACKA 3TGLA 4MVJG 1U2TA 4RZSA 3SHVA 2IYLD 2VRWA 4RVHA 5EIOA 1TIKA 2ZTSA 1NKSA 3L04A 1P0MA 3PKZA 1A5BB 2BJVA 3CSDA 4FP9A 3GGDA 3KL4A 2FOIA 3IHTA 2OXIA 1XRRA 3TG2A 2PE5A 3PJDA 4TYMA 4CBVA 2GRAA 2HCBA 2W6ZA 5K3BA 2ZRKA 4MV3A 3WLIA 1G18A 4NOLA 1ECFA 1YS6A 1CS4C 1ORDA 3BF7A 2AE2A 3TOZA 4CYMA 1SCUA 4G85A 3L4JA 2Y77A 1EAYA 3AFNA 3C4JA 1LJUA 2WU8A 3QIVA 2ZJOA 3QKRA 1SD5A 3BREA 2RGUA 3P52A 4YJ3F 5F33A 3PVZA 1JWLA 2XB2A 3MB5A 4YJDA 4FMDF 1B15A 1QVZA 2D00A 3O3OB 3LZ6A 1E59A 2XMGA 3KZXA 1JS1X 2BVNA 1ONNA 3A25A 5A5DA 7AT1A 2AUMA 4U2EA 2XNCA 4ZT4A 2YMQA 4I3GA 2LXNA 1SCUB 2HC9A 4G1UC 5I3CA 3CUVA 1TC1A 1G16A 3EBOA 2J5RA 1QKKA 3DAYA 3MWJA 2HL6A 2A8YA 4WZAE 3K0SA 1P60A 2B21A 3U26A 5A0VA 2BGNA 1ZONA 4O0LA 3PHHA 1NMZA 1W75A 1ZSVA 2H11A 3A6FA 3G0OA 3C7TA 4TKLA 1NYLA 4A92A 5F1KA 2V7TA 4LPSA 5FPPA 5IEBA 1WMDA 4X66B 1EI9A 2HGZA 2JFBA 4ZZIA 1YZLA 2AFVA 2IYZA 2HJRA 3GFFA 1S3GA 1DC6A 1GLVA 1OYOA 3BL6A 2VR1A 2DFKB 1EDOA 3O8NA 1PQUA 4RESA 1UXHA 4A03A 3A31A 1W52X 3ZX4A 2JEOA 1NYTA 1ZMOA 5FNVB 4NWIA 4I4TF 4TMWA 3OWOA 1TU4A 3VVCA 2PWPA 1ZNXA 2Z8YM 3C3AA 4LG1A 2DT5A 4JLAA 1SO8A 4B84A 1MB0A 1T4CA 4RH3A 1ZMXA 1P73A 3L5OA 1RBZA 1GRVA 4LOKA 4R8MA 4CKBA 1QG6A 3T1TA 2ZJZA 2H2HA 1LB1B 1KO5A 3B7GA 5JG7A 3M89A 1UXIA 2PM8A 4P4LA 4V0KA 4HGOA 1YRYE 2Y6VA 1Y1RA 3NXKA 3VC3A 1T0UA 5L53A 4TYWA 1Y1SA 2FPUA 3VR3D 1SC9A 3AY7A 2DB3A 5BVGA 1JEQB 3L01A 1MOSA 2BH9A 4FONA 2GEUA 3O8QA 4RDHA 4F5WA 3G2KA 3R5JA 4XQGA 2C2BA 3NYQA 1W4LA 3CNBA 1GPKA 4KN5A 1IK6A 1RQLA 3M9XA 2NXJA 3UT6A 4CKBB 3VXKA 1X38A 5EUCA 1H94A 2BFAA 3IEIA 3P9NA 4LJSA 2BCEA 2GJ8A 3I8OA 4LYAA 5KO2A 2QSYA 3WYCA 2KYRA 5DNVA 4OQYA 3CIOA 2IUEA 3HVIA 1RQGA 4PLWA 2KQUA 2HV8A 3AEKA 1RZVA 1W8DA 4UMEA 3ZXYA 4Z7NB 5DXFA 3O8QB 1P91A 2I62A 2ODAA 2NVWA 4GSLA 5AKXA 3I62A 5AVSA 3AVVA 2P4QA 3JQ9C 1I3NA 2X7JA 4FJ0A 4WASA 4A0RA 4PEVA 5DXJA 4PVCA 2NYVA 3TNYA 4V39A 1MB3A 2BJHA 3USES 1OT5A 3D8UA 3LGAA 1YD7A 4DR6B 2ZIZA 1MG5A 1XNHA 5C7OO 2C78A 3AEKB 4MVXA 2E4YA 2WWXA 1X1AA 3UAYA 2RGWA 3VSCA 4EW1A 3UUGA 2BSXA 5HXAA 2FZEA 3B78A 1OXUA 3FGZA 3OEWA 1NI4A 4B47A 3OCCA 1N6PA 1P5ZB 3UJDA 1IY1A 5AM1A 1E3IA 3K4QA 1GQOA 5J5VA 4KSBA 1I9CA 1SQSA 1URPA 1WVGA 2EDAA 3MGBA 4HNAA 4HPJB 5CX1A 1ECJA 2JKVA 2HJSA 2O3QA 4L4UA 5CVJA 1Y8RA 4CMJA 4UBMA 1NVVQ 2WQ6A 1RBYA 4CF5A 2Q99A 3EDMA 1SCJA 2XUZA 3NALA 5BRNA 2F67A 2PO5A 3TCNA 4M9QA 4DY4A 2W2KA 3I9LA 4D26A 3WMGA 1R0ZA 4LYFA 4QJ4A 2P9EA 2VJYA 3NHZA 5CX1B 3TLJA 4HNAB 4WMLA 2CEAA 3KD3A 1NXVA 4EIWA 1K97A 3NBXX 4JL6A 3MRVA 5TPZA 4OX9B 3DFZA 2A7XA 1V95A 5L45A 1EXWA 2I4IA 2WTAA 4KGXA 4S12A 3UUFA 2W90A 4Y9UA 1DE0A 3SHWA 2JI4A 1CR2A 2YXLA 2JH8A 1WHSA 4EJMA 4WAUA 5CT4A 3ZHOA 3EPRA 2W2KB 4NF2A 3E5RA 3VM6A 5JFTA 4LJ5A 3RUFA 5LOVF 3VYWA 2Z83A 1ZC4A 3KDAA 1XTSA 1GSIA 1SIUA 3DL7A 4JXKA 3LOUA 3LV8A 4KRXA 3T4XA 1DQNA 3AKCA 3HCEA 5E7MA 2WAMA 4WRRA 4ENSA 2IU3A 1CEQA 1G55A 4M7PA 3NHYA 3UJHA 2CVPA 4B35A 2K4MA 4MHTA 1XQ1A 2OT3B 2D5LA 3M5WA 4HUQB 4HAVA 1TTTA 2E18A 3FRJA 2IZ1A 5DHUA 3NHJA 5CLHA 1YBAA 3NRCA 3B3QA 3VR5D 5K0BA 1INLA 4QVKA 3THRA 1M3SA 4CW7A 3ZHVA 2QTLA 5JT1A 4NE7A 1LDEA 2J5XA 3RRBA 2VF7A 1IHUA 1E66A 3F9CA 5J2TF 3SS7X 1CZNA 1KO1A 3PA6A 4W7SA 3GH3A 2G5TA 2QTMA 3PHLA 3P4XA 3W2IA 4LQCA 1K3UB 4RZ3A 4V2IA 2IKQA 3C39A 3MINB 3NM6B 2FUG6 1JLSA 4FB4A 4O02B 4C7BA 4F86A 3HFJA 4PSVA 4WESB 3IJRA 1GXSA 1W5AA 3S68A 3WLQA 9LDBA 3OOWA 3DCNA 2L17A 3D8NA 4LJ4A 3GCWA 2VBCA 1QH0A 3C3PA 3GGPA 1EZZA 3MTDA 1DEAA 4PS1A 1FU8A 3FUWA 2G09A 3UHOA 4A8JC 4EJSC 3ER8A 4J90A 1GUDA 5CYPA 2KB0A 2WIBA 4B8ZA 1Z7YA 2XGGA 1COZA 4IQFA 2RGCA 4B40A 2P8JA 2JLVA 4Z4CA 1T5TA 1R16A 2O3JA 2QQFA 2VHJA 5K20A 4COKA 4NSNA 2BP7B 4ID3A 4M9UA 5C5IA 2FGJA 4TRNA 3KUCA 1KYZA 4B6RA 1MW8X 4BFXA 3GVXA 2QSJA 3T3PB 2X76A 4RIHA 3NYRA 3DO5A 3WLFA 2UXCB 1L7AA 2YRWA 4YXFA 4F3RA 5L7TA 5DVZA 1O2DA 1S3FA 4CXMA 1P1FA 3DT6A 4IRUB 1JMVA 2IDKA 3W3AD 1GPAA 2R4QA 3PT5A 1LC0A 4LE0A 1XTKA 3C3MA 4N1AA 4P82A 2AVNA 4JBLA 5U4QA 5BSTA 3V4SA 3LWZA 3ZIAD 4LJKA 2J87A 3H1PA 3VOAA 2V5AA 2J4DA 4RJLA 4PHHA 2VAVA 1NW8A 3REQA 5LWHA 2HIMA 2JRLA 1WVMA 3QOXA 5AW5A 5KINB 2A14A 1PL7A 5JZMA 2YFYA 5ALWA 1EWTA 5JS2A 5LLTA 2IFTA 3ESQA 4NI5A 1R6TA 3BX1A 4QC2A 4BRUA 4GR9A 3COVA 4IYRA 4KW7A 1W47A 3COWA 4RWEA 4ZU6X 3TM4A 1M83A 1JZQA 1JEJA 2WMYA 3HDQA 5ALGA 3NP7A 4RO0A 2C77A 4WKNA 1TYBE 4TLMB 4BPRA 4BV3A 2PT6A 2IDJA 3OQIA 4TL9A 3REQB 1X6VA 2EHJA 3CEHA 1JBKA 1NW4A 2AKAB 2PZAA 4D3SA 4A8JA 4PLHA 3EEQA 1IXYA 4H1TA 2W6JD 3F1KA 4IS2A 1SXJE 1L5LA 1M2HA 3ZEIA 2G7ZA 1ISHA 3WZ2A 1UAAA 2O2ZA 2D59A 3WMWA 3WFZA 3H3JA 2QE7A 4FYMA 3GCDA 1T9GR 2V45A 4V0MA 5K51A 2VK2A 1R6DA 1UF9A 4XB1A 1Q7EA 1USVA 2FZVA 4HFMA 4S1WA 1IWPB 3OQIB 3PFBA 2ZJ6A 3VKFA 3LQRA 3NC4A 1I0ZA 2AEMA 2C58A 3DC7A 2J3KA 3HB1A 4FOLA 4HZIA 5L3SB 1I7QB 4L02A 4CGYA 4GXRA 3D6NB 3KQQA 1I6MA 2WZQA 3P5BA 5HA5A 2CVFA 5BWLA 4DA9A 4HH4A 1U9ZA 1VSBA 5EWLA 1Q2UA 1CY2A 1WY5A 4C2AA 4WERA 1QRDA 1U8YA 4G0PA 5CIQA 3QGMA 1NVWQ 2OLKA 1QHEA 3FRIA 2KWIA 1XPUA 1PCXA 3O2QB 1W87A 4TQAA 1TD9A 2HX1A 3RJMA 4AJEA 2EG5A 3GJ7A 5CRIA 4Z5XA 4DDMA 5JZOA 2F1OA 3NMUF 1J1UA 1CZKA 3HS3A 2C4MA 4XSGA 3ZE2B 3RUDA 1WMAA 1SULA 3GLVA 1T0IA 5B64A 5JXJA 3EWSA 5CLLA 5EWLB 3ZY3A 2IX3A 1RS0A 3D43A 4YCBA 4R2MA 4BLVA 3UM9A 3TRJA 4CI9A 3U49A 3OJ0A 1UKYA 1BW9A 4B80A 4PN3A 4RDXA 4BNKA 1G6KA 4UXHA 1BN7A 2PLAA 3I5AA 4N6NA 2V7BA 4OMDA 4EA6A 1MJFA 1ZGAA 1NNI1 3QFSA 5AI0A 5FDFA 1KY4A 4AYTA 2NVOA 4EUNA 1CETA 4H7DA 4OGWA 2Q0XA 4OHPA 4YDSA 4BCDA 2YXBA 1YR6A 2XB4A 1ULBA 4V03A 3JQ8A 1PRYA 1L5FA 3W6ZA 2DQYA 2DMRA 5CPFA 3CBGA 3GOQA 3PL5A 1T8WA 1BW9B 4ES6A 1DMRA 1XL1A 3A3KA 2OPHA 5KNBD 5KWSA 4L16A 1GTG1 4OKSA 1DJQA 1UBCA 2HA7A 3R5XA 1XDUA 4WZBE 3L8ZA 1P2TA 1RYNA 1XKTA 3K9NA 2ORWA 4KWTA 4NMHA 3MHTA 2BKXA 3WA7A 1TU3A 3CUUA 1P2SA 3SC2B 1Z6AA 4Z0HO 3UN1A 2EX4A 3W78A 3QKTA 1TF2A 1LDYA 2DJ5A 2PEZA 3JQ8B 4DARA 2YWCA 4U2FA 3T7KA 3T9EA 4GC9A 2XRFA 5M5BA 1HLFA 3U3DA 1F6DA 1HSZA 3EQZA 3HRIA 4A7PA 4OHZA 5KNCD 1OI7A 3WLLA 3ZWMA 1JJ7A 2FSIA 1WZNA 4PZCA 1K3TA 2Y1OA 4H4DA 2WJWA 3SLRA 1M7BA 3KO8A 1T2UA 2PS3A 2K6GA 4KMSA 4KNVA 4NJOA 5JEDA 4A9AA 2VUTA 3S2IA 3I2YX 4D9KA 2ZZNA 4IKOA 5AO9A 3UKOA 4NICA 3M1IA 2IIVA 4OP3A 1T13A 4RGYA 1PUXA 4JJ6A 1ZN8A 2P2YA 1W6UA 4FKMA 4I3FA 4D7AA 3AO0B 2F8SA 2I2WA 1TAQA 2OM6A 3KNZA 4DMHA 4HMPA 1RRFA 3FTDA 1SEPA 2PMFA 3U7HB 5HDQA 4BVHA 3EIXA 1WV0A 4RTLA 4EARA 5F4ZA 2VBIA 2HDNB 1JWAB 4UEQA 2FRXA 3LL7A 5DGCA 1LQUA 2MSNA 3G5LA 4C08A 1GT91 3UBTA 1ZD9A 2IEDA 2AN9A 4MP3A 4B33A 1YUBA 1A98A 4I1UA 1C2YA 2WB2A 1GQRA 1EVZA 5AJZA 2I7CA 1VPLA 5FI0B 1CS0B 2YNMD 3OZWA 1SZPA 3H13A 3UWSA 5A05A 1VIYA 5HIAA 1LPSA 4IOLA 4MPJA 2BM1A 4QAJA 5EP1A 2L42A 2W7TA 1RAEA 4RLFA 1SQFA 3WRWA 2JHFA 4W9NA 3W5BA 3L4BA 3M2PA 4OJMX 3RU3A 3L9WA 4G1EB 3M9WA