3PITA

Crystal structure of m-rasd41e in complex with gppnhp (type 2)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
168
Chain Sequence
LPTYKLVVVGDGGVGKSALTIQFFQKIFVPEYDPTIEDSYLKHTEIDNQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of M-RasD41E in complex with GppNHp (type 2)
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein M-Ras
total genus 59
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2010-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pitA00
1JEDA 3H2YA 1MABB 4TMVA 1U90A 3PFIA 4PPFA 3KQHA 1N25A 2D2FA 2IS1A 2AK3A 1NRJB 2V1UA 4L4UA 2FSIA 1R10A 3K0AB 3O8DA 5EXTA 2V6JA 3THWA 4MH0R 1M8PA 1R8SA 1XZQA 4LHVA 2DWOA 1PV4A 2FSFA 2BBWA 3K09A 4M9SA 4ERNA 3BH7A 4K81B 2WZQA 4BEBA 3PG5A 5J4VA 4DDTA 3DMNA 3EWAA 4EJSC 1XFAA 1KI9A 3WYGA 4U5XA 3R8CA 3RSOA 2ECKA 2Q6TA 3P26A 3TSZA 3FFAA 1Q0UA 1Z29A 2ZI5A 2FX3A 4FN5A 5KHOC 2WWFA 5CLLA 1W4AA 2OESA 5KSZA 1V5WA 2ATXA 2IXFA 4LJ9A 5FOSA 1MT0A 4V0KA 3Q8XB 4RSGA 2A3RA 3LDAA 2A2ZA 1ZIOA 3OEEA 1DE0A 4KU4A 3QXSA 4UXJA 4G5SA 4LC1A 1P2SA 4NYMR 3I8SA 1QG2A 1ZUHA 3RLFA 1OE0A 1E79D 1G3IA 3ZD7A 4JZKA 2XXAA 4DC9A 1QHHA 2ZPTX 3ZZTA 5CDFA 3V9PA 1GL7A 3UPUA 2I4IA 1CR0A 1DVRA 4MYHA 3K0CA 4TYWA 1CR2A 3ZIAD 3IDQA 4DCSA 3RAPR 1DAHA 2ANCA 4IFEA 4IHQA 2YOFA 3NH6A 4JSTA 5IDVA 1NMXA 2QTFA 2ATVA 1QHYA 3CWQA 4NCKA 3CWZA 2VPPA 4PC2A 3C16C 4GBMA 4Q00A 1KK2A 1N6LA 1NI3A 1OJLA 2H92A 1YZQA 1G5TA 4JJKA 5FPTA 4D80A 4NKRA 3BB1A 1O87A 3A1UA 3RWOA 4GOXA 4XD7D 2G1KA 4QBHA 1N0VC 3K0FA 5SZJA 4F93B 5FH9A 2OG2A 5CJPA 2C9YA 4XH9B 3KQNA 1O3YA 1TEXA 3FFBA 3QBVA 5KYKA 1R5BA 2ZI3A 2RGDA 4OJKA 4OK6A 2EW1A 2GBLA 2V6IA 4MGIR 4TLBA 4TZ0A 3HU3A 3CRW1 2ZI6A 1SGWA 2RGCA 5JBQA 3QNUA 3T61A 4C0AC 1E2PA 3QPUA 2XZLA 2BCGY 3DM5A 1OH7A 2G88A 1OH8A 2WJGA 3QENA 2HF9A 4ON9A 1N3BA 4GOJA 5DIFA 4AG5A 1E96A 3AKEA 3FTQA 4DSTA 1XTRA 2XEXA 1VCNA 3AP1A 5IF9A 1AS3A 3C41J 1KSFX 2ZU6A 4F4IA 2OZEA 4TL6A 3SNHA 4DLSA 4C7OB 3GLFA 3SS8A 4PC6A 3UIEA 1BS1A 1OH5A 3AVUA 2WMOB 3TSWA 2P6RA 3CO5A 4A1FA 2D3WA 2XTZA 2QM8A 2YOGA 2JLRA 4D0NA 4DLYA 5KNCA 4HDQB 2O0HA 2YNMA 3T35A 3U3OA 4N1AA 2ORVA 3W9YA 1CP2A 5H68A 1BKDR 2RGEA 1OFUX 4IVPA 4O25A 5FL7D 2NMVA 3HWSA 8OHMA 2IW3A 4QM6A 4OHXA 4PZLA 4W5JA 5JS8A 1CRPA 5FTLA 5IT5A 4TZ6A 4AD8A 2BM0A 4EJSA 4R2HA 2IYLD 1YZNA 3CUEF 4GMDA 2JGNA 3SFZA 4F4JA 3L0PA 1SVSA 3GLGA 5GVRA 5IHPA 1E9RA 2BEJA 1KOFA 3WMFA 4UKDA 1W48A 4DXAA 4D4KA 4B2IA 4RKEA 1F5NA 1HV8A 2LKDA 4HLQB 3EA0A 3EZFA 1JXOA 4LSGA 4PQFA 5FUXA 1SXJB 2Z5FA 2FZ4A 1KSGA 1RC8A 3W3AA 4HYYA 2CL0X 3H0KA 4XD7A 2OAP1 3QJYA 1S96A 1RRPA 1L8QA 2VHQA 3OIWA 2CVHA 1NVVQ 3TLXA 2J59A 2QPAA 1L2TA 4JJZA 4MDEA 1TAGA 4FCTA 3SFVA 5B58C 3BERA 2DR3A 5KDDA 2IYVA 4ASUA 2GILA 3ONWA 3NDBB 3PEUA 3U7FB 3TR5A 1G1MA 1RJ9B 4GSYA 3TBKA 4S35A 4CT5A 1P4SA 1FFHA 4D82A 3AP2A 4Q01A 4CW7A 3I61A 1NVUQ 4IDHA 4O2RA 1UDXA 2BWJA 4FCWA 4MRNA 1N5KA 4ACBA 3DM9B 4ZV4A 2WWGA 5BWMA 3EPKA 5DI3B 1NVVR 3ETLA 2B6HA 2VP9A 4NCNA 1DAIA 3W6NA 3IO5A 1OYYA 1UAAA 2ZETA 3EC1A 1Q57A 2ODEA 2GCOB 1E1RA 4I1UA 4DSOA 1VYTA 2RH5A 3B7GA 5HE9A 2O8CB 3GLHE 2FOLA 1RRCA 1T4GA 2NPIA 4HLUA 1OB2A 4B3CA 2J3EA 3DEFA 3UK6A 3OEHD 2J0UB 2NO1A 2VP0A 2ZJ5A 5E4FA 2VEDA 3DOFA 3MWLA 3U61B 2VP4A 2BKEA 1NNEA 4U00A 1GAJA 1NL3A 4MGKR 2A5JA 2J7PD 3X2SA 3AVTA 4A6XA 1JPJA 3X1YA 1P75A 2WOOA 4BECA 1KYIA 1OW3B 2FFAA 3CKLA 4KAXA 4TYQA 4BLPA 4EQ6B 4US2R 1OF1A 1KHTA 1UKVY 4X8OA 2CJWA 4JBXA 1DAMA 2WWWA 3TNFA 1P5ZB 2DWPA 3RC8A 4BLRA 3O8RA 1G20E 1RW4A 2W6JD 3CX8A 4Q1FA 3CIOA 1ZM3A 5EP3A 2JLYA 1AN0A 4IEIA 4IXNA 3U4QA 1YZLA 2CK3A 2GWHA 5FOXA 1IM2A 2QM7A 4YLGA 1SXJD 2BM1A 3NWJA 2Z0MA 3ZQJA 3GLIB 2ZROA 3T1QA 2YKGA 4MRPA 1WMSA 3HP1A 2R2AA 3QUSA 3DZDA 1UJ2A 3KX2A 4R7ZA 4UJ3A 2B8WA 1U99A 1FNNA 1AKYA 3UWKA 2YOHA 2ZM5A 1WB9A 1PJRA 2YHSA 3KFXA 2QORA 2VHUA 5E7IA 2F1HA 4LHXA 2ZQ5A 3A8TA 3THWB 1E99A 1XMIA 1N5LA 1VPLA 3VHXA 2GZAA 3K0SA 3GLHA 4GDFA 2XOKA 3Q72A 3CRRA 4RZXA 1QHIA 3B13B 4H1VA 4Q1CA 3AVWA 2NG1A 4G5QA 2X8AA 3CX7A 1AQYA 3FHCB 2YZ2A 2J1LA 2ZRNA 4Q4HA 1CR1A 5K8UA 1EGAA 1KO4A 4PAOA 4P4UA 2Q9BA 3EWSA 2ONKA 3VFDA 2QN6A 5EP1A 4HAYA 4PO8A 1QF9A 4DUGA 4C3ZA 1XWIA 2L0XA 1E9BA 1SVKA 4HLDA 1NSTA 1GSIA 5DN6A 3D7MA 5FL3A 1FTNA 1TL7C 1R7RA 3ASZA 4V0MA 1H65A 2H18A 2XNSA 5FUWA 4P4SA 4BLQA 4URXR 2XJ9A 1SVIA 4RCZA 3ADCA 3GPLA 2GZHA 2A5FA 3LA6A 3MMPA 3K70B 3C4JA 2FV8A 2C8VA 1J70A 2BEKA 2D74A 3QKRB 4IDNA 3KB2A 1R0ZA 3LLMA 3F5FA 4EUNA 5IK2D 3PUZA 2YWGA 4FXPA 1G8GA 4ZDIA 5TV2A 4A0FA 2EWVA 2GJKA 3P4XA 2AK2A 4IVRA 1M6NA 3QOFA 2CLCX 3QF4B 2R62A 3AVQA 1P61B 2DFKB 4OQXA 4II7A 2ZVQX 1I2MA 3SDZA 3P32A 1W46A 4MGYR 2IS2A 1K5GA 1LW7A 1FNMA 2QSYA 3AKYA 5JMTA 4UNPA 4ZCLA 5AUPB 5KSOA 1U94A 2CCKA 1LS6A 2I1VB 1RKBA 2OO7A 3T12A 2QUZA 1EFTA 1UKZA 3V4FA 3IIMA 1X3SA 4IVQA 4PZYA 3AVXA 1WP9A 5EP4A 5LD2C 1FPMA 3KDSE 4TMKA 2JJ2A 2ZRLA 3PVSA 5KOYA 4OQFA 2CK3D 1CJVC 1ZCBA 2Q21A 1KI6A 4L9SA 5FBWB 2XITA 1XB2A 2BMDA 4P3YA 3WHLA 4KLZA 3H84A 4JLDA 4QBFA 2XZOA 4LBZA 1K6MA 2QSZA 2X1VA 2CNWA 1BOFA 1CRQA 2Z43A 3U3KA 3QVVA 2ZJ8A 2ZRHA 1IN7A 2AR7A 1H8HA 3D3QA 2BBTA 4JVMA 4NMMA 4RFVA 4PAMA 1LTQA 4DDWA 5JZVA 1J8MF 1KAOA 5AJYA 5B57C 2OFOA 3NVAA 2W6ID 4ZPXA 3I4LA 3I3SR 1R5NA 1PLKA 2ZYTX 3IEUA 2QA5A 4Q4LA 5LBIA 3LBHA 5CB8A 5DYGA 1GNRA 1D2MA 4LRWA 1GFIA 5AJVB 4HAUA 2F1JA 4D4JA 5JSZA 5IK2A 2AWNA 2QMOA 3GFTA 2UVQA 5JLJA 1ONBA 3QKSA 1KK0A 3QIAA 4D25A 4YONB 4G0NA 1P9WA 3U7HB 1E9AA 4BGDA 3CBQA 2CCGA 3QXHA 3ND8A 5H8WA 3NBFA 2JLVA 4DLRA 4HAWA 4PXAA 1KIMA 3TJZA 1Z8FA 4LCBA 3A4NA 1XJQA 4KFUA 2ZRFA 2WPDD 3ADBA 2OAQ1 3WRXC 4EPRA 4I1VA 5KO2A 4EQ6A 5L8VA 3FHTA 1HQYE 2P3SA 4CF7A 4FMDB 2GJAA 2AN9A 2ZR7A 3NHAA 4JVNA 1NVWQ 3GLGE 1KAGA 1W47A 4HB2A 2G1JA 1SVMA 3KJGA 4C0QC 4CIDA 1G7CA 3F0TA 4RZ2A 3VAAA 1CIPA 4QFMA 3LBIA 4TLCA 2A30A 3SC3A 1E4YA 1KDTA 1A2KC 4B2LA 1JAHA 1YR6A 3L0SA 4G5RA 4XTCS 5EZ6B 3DHWC 1KO7A 2X2EA 1XNJA 4YMVA 2X19A 3GP8A 1Z83A 4OI2A 4LJ6A 1G6HA 3TH5A 3B85A 2AKAB 3W90A 2LWIA 1YZUA 4M9XA 4A92A 1SKYB 5CITA 1W36C 2AL7A 1S8FA 4HATA 1TTTA 1G6OA 2O8FB 1OIWA 4ILEA 3QKRA 4BFXA 1DAFA 5DISB 2RGXA 1F2TA 4PHFA 4M4SA 5AK0A 1XJ0A 4N0EA 1JB1A 2D7CA 3X1ZA 4DWJA 721PA 2XZPA 1XMJA 5BYKA 3QF7A 2WWIA 4TYNA 4KV9A 5CLQA 3GEEA 3SYNA 1UBCA 2NIPA 1D6JA 2IC5A 3LW8A 5LD2B 1B0UA 1HURA 3NC0C 1VG9B 4Q5IA 2C96A 1R2QA 2FSHA 4WA7A 2MSEB 2OFXA 4RZUA 3ZYCA 1TEVA 1ZNZA 4HLUC 2GXQA 4FWIB 5E95A 3UXMA 4GZLA 2MSDB 2RMKA 2ZJ2A 3ND9A 3ZD6A 5AR1A 3LO5A 4ARZB 4TN1A 2J45A 2PT7A 2HV8A 1D2NA 3R7WB 4FI3C 3OF5A 4RVCA 2AD1A 1S3SA 1W1WA 5L3QB 4UNSA 4OHYA 5SZHB 4KO8A 2CVFA 2W0SA 4LJ7A 1DARA 2R6GA 2CXXA 2GK6A 4D4LA 3RRZA 1NN5A 4CYMA 2Z4RA 4BFVA 2GCPA 3EPJA 2HUPA 4G01B 1E9DA 4HEJA 5CIWA 1G291 2AFIE 1HT2E 2ZYVX 2KSQA 3AVVA 1EK0A 1A7JA 1C4OA 2R6FA 2W2XA 2J7PA 1VCIA 4TQ9A 3UKDA 3IEVA 1BMFA 2NPFA 2WKQA 1CTQA 3LX5A 2B7BA 3VNUA 4IOJA 2WICA 4B32A 2F3TA 1IY0A 2W6IA 2ZXUA 3LBNA 3CW2A 3EG5A 3AV0B 4PX9A 5J4KA 2Z4SA 2V1XA 3J81k 3I62A 1U8YA 3A1VA 1YZTA 5JJKA 3REGA 4XIGS 5CK5A 4TL8A 1E6CA 1P7CA 3B78A 3THOA 2YWEA 1AK2A 2JJ1A 5AUQA 2G9NA 1XTQA 4E07A 1KMQA 2IS4A 3THXB 2CDNA 4ACAA 1QBKC 3LV8A 3TUZC 2O8EB 4AYTA 5JCZA 4TTPA 1OHHD 2ZI7A 3SYLA 1G8YA 4JBWA 4WXRA 4WXPA 4EIWA 3GJ7A 3KKOA 2DCUA 4M22A 1XD2B 2PJZA 3TUIC 2YJTD 4N0DA 4MYCA 3VR6A 3I92A 2IEYA 3FGNA 1KI2A 4BLSA 1N6NA 1OXTA 1SKQA 4MKHA 3VTKA 121PA 1IONA 3BJIC 4BRUA 1P9RA 4TL7A 2CBZA 1Z06A 4KXFB 4D26A 1AS0A 3NG1A 2IUSA 4TT3A 621PA 4DRZA 5JFGA 1D8TA 1JXMA 4Q9LA 1OXSC 4GP7A 2QP9X 1U0LA 4QOSA 1ELOA 3IO3A 3PEYA 4KCGA 3T06B 2LKCA 3B1WA 5C4GB 5GJWC 5A4JA 5A0FA 5TXGA 1GILA 4OI0A 2HT1A 1G7TA 3WY9A 1KJZA 2IWHA 4YMWA 2W83A 4B73A 4PR0A 1NVXQ 4DIDA 5JSZB 4C0BA 1E4VA 4MYUA 4YMSA 3WNBA 4L16A 4PC3A 3OIYA 3BH6A 3QKSB 1A2BA 4KJZA 4DUGD 3PUWA 1DTSA 5BXQC 2JLZA 4MRRA 1Q1ZA 1S1CA 1GM5A 1LS1A 1LNZA 4ASUD 3N2EA 4U7DA 3M1IA 3MCAA 1J2JA 1YJ5A 4L5BA 2FPMA 1PZNA 4HAXA 4KBFA 1Z2CA 4P4SB 3QSYA 3PJRA 2OBLA 3V00A 5BW8A 1COWD 2C9OA 2HT6A 3TR0A 3A1WA 4P33A 4V0NA 2RGAA 4ZI2A 1H8HD 4PO9A 1KKMA 4JL6A 4LJ4A 5EXPA 3HU2A 1ZD1A 4LHYA 1RZ3A 3G0HA 1NBMA 3CPHA 1ZC3A 5JHGB 2Q3MA 3EZ2A 1XEXA 1H8ED 4OBEA 5G3ZA 1AZSC 2FPLA 1RVDA 1XX6A 3FKQA 3OIVA 1M7BA 3L2OB 1LV7A 3P1JA 3CF6R 1E9EA 3B1ZA 3KTAA 1X8LA 1EFUA 1G3MA 1ZD8A 1ZP6A 3KL4A 5BN5A 3NBXX 3TK1A 1EFRA 4Z1MD 1I4DD 5DLQC 2KBEA 2ZU0C 4Q1AA 1OSNA 2RHDA 2ZRMA 4TL9A 5F2EA 2GVDC 2ZS8A 3EC2A 2FMXA 5FTMA 2KWIA 1Z0FA 3IPYA 3QQ5A 2NOAA 1MR3F 2MMCA 2PCJA 4K46A 1K8RA 1U0JA 1Z0JA 4C0LA 4HZIA 3LLUA 4KBGA 1YE8A 3THYB 2VA8A 2AD5A 4G5GA 2CEAA 5FPYA 1XD9A 1XD8A 3I8XA 3VQTA 1ZU4A 4GL2A 3AGQA 4BFWA 2VP6A 3MFYA 4CEJA 1VECA 1Z0DA 3BFXA 2G77B 3QPVA 1COWA 1G4UR 3QG1A 1QZXA 1IXZA 2BJVA 3LVRE 2GCNA 1FX0B 3W6PA 2XSZD 2AFHE 1CEEA 3TUJC 1YZGA 1Z6AA 3X1XA 1VMAA 2IT1A 4RCYA 3OE7A 3ZZ0A 2FE4A 2ODBA 2ZRAA 4NYJQ 5HCIA 1ZNYA 2QENA 2R8RA 3CH5A 4GRAA 1N2CE 2O8DA 2VSXA 1GNQA 3EZ7A 3U2QA 2F9LA 4RD3A 3FDIA 2A7QA 4EFLA 4Q02A 2XGJA 5FR1A 3TVTA 1EX7A 3PENA 4H9GA 4LV8B 5FPHA 2FF7A 3THXA 1W4RA 3TQCA 2WAXA 2ZREA 3A58B 2JLUA 2FFQA 4TQAA 2W58A 2J87A 4OK3A 5KNDA 4TSFA 4AURA 4M1SA 3QG5A 821PA 3QXXA 3L8ZA 4BWYA 4JLMA 4UNQA 3VKGA 2R6CA 4B44A 2ZS9A 4PC7A 4BRWA 2WSSA 1IN4A 2DFLA 1VG0B 2WWXA 1ETUA 3GD7A 4EKDA 1PLJA 3VKWA 2CLDX 4IOLA 1E9CA 2IHBA 2Z83A 4EPVA 2QNRA 5F98A 3JZAA 4QHTA 3IPXA 3EXAA 2OHFA 3C5HA 3MWYW 3PXGA 1US8A 4Q1BA 3BC1A 2VLIA 3GEIA 3RVBA 4WBSA 3TQFA 4C0JA 1AGPA 1FL9A 3OHMA 2IWRA 2IK8A 1HH4A 1Q21A 1T8UA 4LJ5A 2ZS7A 5K8IA 3O8CA 5J4YA 1MO6A 3KJIA 3AH8A 3K8YA 4PSVA 1E69A 4Q1EA 3Q7QA 4TYYA 3LVQE 2W2VA 4FIDA 2H5EA 2BMEA 4DLVA 3P27A 2ZUBA 3B9QA 1HTWA 4HUQB 1FQKA 2IUTA 1YKSA 1HA3A 1U9IA 2BMFA 2CL7X 2CCJA 2H1LA 2ZI4A 3Q3JB 1LVGA 1Z07A 2WJJA 2XJ4A 3SEAA 2OILA 1MKYA 1Q1QA 2RGGA 3SE0A 5LPNA 5DSZA 1EXMA 2QTHA 3TSOA 4HDCA 1IXSB 1ZM2A 4FMCF 2A78A 3E5HA 3IIJA 4LC0A 5DO9A 5ELXA 1ZAKA 3BBPA 4C7OA 5CIQA 4DT1A 2GXAA 2I1QA 2WJHA 4QBGB 2R44A 3VKHA 5L3SB 3UMFA 4GOKA 1RRGA 4QNRA 2HF8A 3TGPA 2P2LA 5DE3A 2WHXA 1NIPA 1OKKD 1NJFA 1X1RA 1XEWX 4A6PA 3RANA 5JJIA 1E2MA 2A5GA 4DSNA 4KFRA 2D06A 1XCPA 5G3YA 1UDWA 1YQTA 4IXMA 4A4DA 2DFNA 2J9RA 3EARA 2WAYA 4NPHA 4B43A 1KY3A 4EJSB 4P31A 1CBUA 1DAGA 1Z3IX 2CHVA 2RKOA 2IA5A 1R4AA 4LJ8A 3GLGB 1NLZA 2ZRGA 1OV4A 3CZQA 3VX4A 3NDPA 1OFIA 4OQNA 4ZI3A 1RIFA 5KSYA 4M1MA 3AF2A 2Z6VA 1ZNWA 2EU8A 5FTKA 3W5IA 1DO2A 2G0NA 3JZMA 3G82C 4JL8A 2F6RA 4EFNA 1C1YA 5DI9A 1QDEA 3AB3A 3EPHA 2QAGC 5C1BA 3CB4A 2ZIAA 3IQXA 2EFDB 1RE0A 1JR3A 1TF5A 1JECA 2YC4C 4W5HA 2ZRIA 4JBYA 3U6KA 2C98A 3LY5A 1R5OA 3MGCA 4Q4AB 2EQBA 4IW3B 5BN3A 1TU4A 2ORWA 3ZIAA 4QM7A 4CVNA 421PA 1P3JA 4R9UC 1RJ9A 2ZR9A 3ICEA 1XEWY 2QG6A 5HKKA 1OYWA 4CEHB 3K0CC 2VSOA 2WJYA 4E09A 5K8LA 2Q9CA 2O8BA 2REOA 4Q9JA 1GITA 5KDLA 3X1WA 2P5SA 3C5CA 3KUCA 2DYKA 1IBRA 2GETA 3RS2A 5DH9A 1Z0KA 2IYUA 3KQKA 3G5UA 3MJHA 1QRAA 1YRBA 3UANA 2J5XA 2WIBA 1XTSA 3K0FB 1N6PA 5JWRA 3FMFA 1P72A 2RHMA 1E2DA 3B1VA 5FBRB 4TLEA 4JYBA 1VHLA 2GDJA 1MH1A 4ZKDA 3HR7A 1W44A 2FFBA 4JMPA 3WXMA 1VKJA 3PCRB 3SJBA 1E0AA 4EFMA 1GZSA 2PJRA 4BFUA 1M34E 5AWFC 4B34A 3HDTA 3N2IA 1M7GA 3Q5EA 3FMIA 1WXQA 4RD0A 3ZS9A 3RRMA 1HE8B 4GPTA 1E79A 3LFUA 1GUAA 1U81A 1ZM9A 1KZGB 1XPOA 3IUYA 1MV5A 2IBMA 1AA9A 3JVVA 3MUFA 4DKXA 5KDOA 2CNWD 1ZD9A 4AYWA 3UATA 1Z5ZA 1X6VA 4C0KA 4PTLA 3RABA 1G5PA 3AF3A 3U6BA 4EPYA 1X86B 1SXJA 4XVRA 1G41A 3ZS8A 4W9MC 1T3SA 1VHTA 2XTMA 3FE2A 3IBYA 2B8TA 2ZUCA 2QPTA 2VF8A 4OL0A 3BWDD 1OT3A 2AWOA 2FG5A 2EFEB 3NEJA 3PR1A 3W3ZB 3VU9A 2E9SA 3HU1A 2RAPA 4LBYA 4LYAA 2WWHA 4QJ4A 2BV3A 2PX0A 4GNKA 4FINA 2GJ8A 4URZR 2CMKA 1LFDB 2WKPA 3GLIA 1DELA 2NQ2C 1T9HA 1GG2A 3TMKA 1S0UA 2NO7A 2FN4A 3DZ8A 2J0VA 4BEJA 4RZ3A 4QJ5A 1N6KA 4BFTA 4OQLA 3W6OA 1CJUC 4HAVA 2VF7A 1Q3HA 4NHOA 3ZVRA 2OV2A 5JCPA 4IOKA 1AM4D 3BGWA 2ONJA 2XX3A 5J4LA 3K70D 4FW9A 3T34A 4CT4B 2GKSA 2WVJA 1LF5A 1TF2A 2PX3A 3R9WA 4Q21A 3GLIE 3LQRA 2GCOA 3A6PC 1W49A 2HXSA 3RC3A 4NYIQ 4B3BA 2BKUA 2IYSA 3Q5DA 5EJEA 1OXUA 5D3QA 3LX8A 2XNDA 3M4YA 2ZYWX 3OIUA 3QF4A 4HLCA 4LY6A 5CM8B 3WMEA 3CNNA 2FPKA 1Q44A 4PHTA 4IDOA 2ERYA 2V3CC 1DO0A 3FMOB 1JEEA 3NHBA 1P2TA 3BAFA 3U3MA 3VR4A 2IS6A 4P32A 1JBKA 1OIVA 1YU9A 3KZ1E 3K1JA 5KSPA 4A8JA 4DCUA 4JLAA 1JPNA 4OI4A 3SI7A 1L7VC 1TQDA 1M2OB 4BUJA 3BORA 4IFBA 4LYHA 3DDCA 1ZM7A 1BO6A 3E2IA 2CL6X 2JEOA 1P2VA 3B2EA 1GL9B 1AGRA 4ZO4A 4AKEA 4EPWA 1NY5A 4NP6A 2FU5C 4GT1A 1WA5A 4L15A 4I99A 4BQSA 4YMUA 4TSFD 1QHSA 1FW6A 2ZRKA 2PH1A 2VO1A 5F3WB 1IAQA 2GXUA 5F9FA 4PZZA 2ERXA 1Q1EA 3FWYA 1OHHA 4X8HA 1UBFA 4KFSA 3ZVMA 3VNVA 3B82A 3OFND 1OXXK 4BE7B 1T3LA 3ZVNA 1QVAA 2UKDA 1L4YA 5TDHA 3DVLA 2GTPA 4KVGA 3CF0A 1U9IC 2F1IA 1Z6YA 2PLRA 1CKEA 4PSAA 1G21E 1TQ2A 3W8RA 4B2PA 4B6FA 3EZ9A 4Q9IA 2WIAA 4BLTA 4Z1MA 2BHRA 4DLZA 1J90A 4FMDF 4WAUA 4HB0A 4NCHA 4MRVA 2QTVB 3D31A 5LB2A 5EQTA 2XOKD 2GAOA 1F60A 2IEZA 2JATA 1TQ6A 4TYPA 4Q18A 4KVAA 2YINC 1XZPA 1AIPA 4XVQA 1D9XA 1D9ZA 3K09C 4RFSA 4M8NE 4OYHA 4MKGA 4AIIA 2FZLA 1E2KA 1VYUA 2KBFA 4PPGA 3TAHA 1XBTA 3CF2A 1GRRA 2REXB 2HEIA 3K70C 3EZ6A 3F3YA 3LQQA 4GFDA 4ZDJA 3I1FA 3B1XA 1U98A 2GJ9A 4HZUA 4URYR 1WE2A 4GI7A 3VR5A 1EG7A 1JR6A 3L0OA 2IF0A 1DG3A 1XPUA 4QRHA 2N1BA 4KFTA 1N0WA 2F3RA 5LDDC 2JASA 4QC2A 1KNQA 2QQ0A 1R0WA 3NH9A 2O8BB 2JLQA 1WDTA 3K9HA 1BH2A 3OAAD 4DT1B 1Q12A 5TMPA 1QHXA 2PCLA 1HUQA 2J7KA 4JVLA 1W5SA 3PUXA 4HDOB 2R6DA 1NN0A 4UQOA 1Q1BA 5HPYB 3CX6A 3DKVA 4TLAA 1W4CA 3KKMA 2N42A 4JLNA 4M2LA 2ZRCA 2FDCA 3SN6A 1P73A 4IDQA 3EIQA 4DB2A 2OE2A 1M74A 4AC9A 1DS6A 1E3MA 2BMJA 1OFHA 1XRJA 2DY1A 2ZSDA 1Z0AA 4JSYA 5KPDA 2QP4A 4KI0A 1F2UB 1TUEA 1I4TD 3TW8B 3MRSA 4IRUB 4NL4H 1FP7A 2QT0A 4LPSA 2RGNA 2F43A 3FOZA 2ZSAA 4A0GA 2JIZD 4HSEA 1F2TB 1J99A 1ZUIA 3HPRA 1E1QD 2UZIR 1ZC4A 4LGMA 2VTKA 5C4MA 1WQ1R 5JRZA 1EESA 2C03A 2IX3A 1GKIA 4NH0A 3V4RA 2BCJQ 3OESA 3NXSA 4C2UA 5FI1B 4E03A 5BQ5A 3VU9B 2OCYC 1IN8A 2ZUDA 1YHNA 4A2QA 3PIRA 3CONA 1PUIA 4XWOA 3QEOA 1XU4A 4IJMA 3MWKA 5E7MA 3CRVA 2H57A 3MWJA 1KI4A 1TMKA 4M0LA 2CE2X 3L43A 2TMKA 1DPFA 1X8JA 4CDGA 5L3RA 1G4AE 5K8TA 1E2EA 4Q7MB 1NSFA 2V9PA 3LAWA 1XXHA 1JQJC 1ZBDA 3KB1A 3LWNA 3IIKA 4ZIRB 4PSKA 1UADA 1J8YF 2IF2A 1GWNA 5EXSA 2C2HA 3CH4B 4YDHB 5FOVA 3EIHA 4XSHA 2UZ3A 1JAIA 3PQCA 4MUBA 2BOVA 1S9DA 2QAGA 2VQSA 4JKYA 4URUR 5EE0A 4OI1A 2OCBA 3EA5A 2FFHA 2G83A 4I81A 3AM1A 3KKNA 4Q7JB 2YWHA 3GJ8A 4C0HA 5BYJA 2IUUA 2HLDA 2ZEJA 4W5WA 2RB4A 1IXRC 4FMCB 5AUOB 3NTUA 4B3DA 2V54A 3N5CA 2DPXA 3SJZA 1SKYE 1I2DA 3H86A 4NE2A 3ZDQA 2IYTA 2WMNB 1R6BX 5EE1A 2PMKA 3CNLA 3BFVA 3K9NA 3RYTC 2VP2A 1CS4C 3UMSA 5JI2E 2WWYA 1VDZA 2YYZA 5M04A 3PUYA 4CEHA 2OT3B 3S1AB 5EUQB 3AVYA 3RDPA 1OIXA 3K9GA 2FGJA 3WYAA 3WMGA 1W7AA 2H8KA 2RGBA 3U44A 4CEIB 4XOIA 1N6IA 2JLWA 1UBEA 1NN1A 2QROA 1ODFA 4QL3A 1VG8A 1QHGA 4US0R 1G64A 2XXAB 2CHGA 4KITB 2MMGA 5L3QA 1NMZA 3ZJYA 2ZE8A 2A5YB 2F1RA 1ZUNB 3AKCA 4NTZA 2CHQA 4E22A 4AG6A 2WBLC 1VTKA 1KY2A 2ZRJA 3ICQB 2HCBA 1OB5A 3GJ0A 4LYJA 5C18A 2HCJB 3U7EB 1G18A 2B21A 3QPWA 2YC2C 1KO1A 4JKIA 2V7QD 4B48A 1G7SA 4QNMA 2HDNB 4WOPA 2C04A 4Q66C 3GFOA 5AJXA 4ZDWA 1GP2A 2ZITA 1UM8A 3GLFB 3Q85A 1XDBA 4F7WA 5KTYA 2RCNA 3EIEA 5D3MB 3M0EA 4BLOA 4WZAE 1Q22A 1FP6A 3UMRA 4BFZA 2OUKA 2ZJZA 1IN5A 3SHFA 2VP5A 4LX0A 5G40A 1CULC 1ZYUA 3BB4A 3BH0A 2O8EA 1KO8A 4C2TA 4PQRA 2D4HA 2QRZA 2OXCA 2BBSA 3RS0A 1QVRA 5C2JB 2BVNA 4S2EA 4L9WA 1JR3E 2OEPA 1FQJA 1RYHA 2FH5B 2HLDD 2GXSA 1W5TA 2O5VA 4Q4JA 1ANKA 4Y0AA 1MO4A 2J46A 2P6UA 3NC1C 3CPJB 1ZU5A 3GJ3A 4R98A 3WP0A 3B60A 5A5GA 5FUVA 3BXZA 4TLDA 4B75A 2GA8A 4M9ZA 4JLKA 1W4BA 3H1TA 5G53C 3W8NA 4RD1A 1KTVA 2QPOA 3KFVA 5DHFA 2FA9A 1KMHA 1QHHB 1NIJA 1R0XA 2IYRA 2VHJA 2ZJBA 1Y63A 4ITRC 5HZKA 4B76A 5EUMA 3OEED 1XTJA 1ZCAA 4JYCA 3RWMB 5TY0A 4QGAA 4MRSA 1E0JA 2OCPA 5H70A 3QXCA 1XJCA 5GVSA 1W0KA 2JJ8A 3HYRA 1M7HA 2FNAA 1TF7A 4IEEA 1HT1E 2QY9A 3WP1B 1WRBA 4PC1A 4POAA 4HI0E 4LHWA 1F2UA 3N70A 4IKEA 1F48A 5CJ2A 4B71A 2OLKA 2ZANA 2IL1A 1UKYA 2REBA 1E9SA 1OXVA 1XXHE 3RRNA 4XWAA 4DVGA 5FPSA 3CRQA 4KYUA 4TMWA 1FOEB 2QAGB 3MLEA 1AS2A 4RY2A 4EPXA 3TAUA 4RD6A 3KXLA 2OCAA 3IHLA 4JT4A 3AF1A 4Z8YA 3ZQ6A 1G8PA 2B7CA 5KPJA 4UXIA 5HR5A 1XPRA 4MGZR 2QMEA 1D2EA 2W6JA 3CRMA 2FJUA 4LBVA 5FL7A 4JLJA 1AKEA 2XAUA 5DGXA 4LHZA 1W0JA 1T8TA 2ZJOA 4GMXA 1DADA 1HEIA 1MO3A 1T0JB 4QG7A 4A0HA 1ESNA 2JJ1D 3DOEA 1N5JA 3CR7A 5AJZA 1RPZA 2FEMA 4G1UC 2QT1A 4BZPA 5TVKA 4YXWD 1U2RA 2VL7A 3QKTA 2PZGA 1UFQA 1TNDA 1ZNXA 2XB4A 2WJIA 1FTSA 2FEOA 1X1SA 2P0EA 3DO6A 4N3NA 1IQPA 1GOTA 1XCMA 3SBDA 2QZ4A 5SZIA 5FOWA 3A4LA 4XSGA 4FMBB 1Y3AA 4NYIR 2AXPA 4CRWB 3EPLA 4LUCA 4M9QA 1KO5A 4Q7KA 2KI5A 1UBGA 4NYMQ 3FKSD 2ZSEA 3P20A 2V55B 2G0TA 2IYQA 4PHGA 5FR2A 1QHNA 1AQUA 5KNBA 1S9HA 1TADA 2ZRPA 4J0QA 4LDJA 4EDHA 1KZ7B 1N6OA 4UXHA 2P5TB 2GAAA 4PANA 5E7JA 4I4LA 5EZ5A 5CDFE 1E0SA 4JLBA 5ANRB 1YR9A 4LBWA 1NKTA 2VRWA 5C46F 3R9XA 2ZJYA 1IY2A 1VG1A 3B1YA 3HYTA 2FWRA 1HY3A 1KGDA 1T3HA 1XTIA 5D3MA 3K9LA 3FYHA 1W2GA 3LW7A 3SQWA 1XCGB 4IDPA 3REFA 4X8LA 4C4PA 1UEIA 1L4UA 1PLLA 4NONA 1KI1A 4L8GA 4F92B 1E98A 3U4QB 1EFCA 1GKYA 3MJRA 2C99A 4V0ME 5J40A 1WBDA 4F38A 3T5GA 4DEXA 1KDRA 1E2LA 1ZW6A 3W34A 3TIFA 4LOAA 1Z6GA 4QHYA 3U3JA 2AX4A 2D62A 3FHOA 1MRNA 1TUIA 5H1YA 2PZFA 3ZLJA 5JI3E 2SHKA 1CR4A 1HYQA 1S3GA 1TX4B 2QGNA 4NCIA 4US1R 5FOTA 2BIFA 1KJYA 2WV9A 2W2TA 1NLFA 3MG9A 3H4MA 1JQLB 5CYOA 1S2MA 5J4HA 5FBLB 1MO5A 4WZ6A 1NY6A 4PFSA 1AZTA 4HUTA 1I4LD 3UWOA 1DAEA 2B92A 2C9CA 5L3SA 4H1UA 3T1TA 1ZMXA 4QGFA 2P65A 1NG9A 4LV5B 1SHKA 3W5JA 3AF0A 3VMFA 3TE6A 3MAAC 1GL6A 2R6AA 4ESVA 1KK3A 1AJEA 2JDID 3ZGXA 1Z6TA 1YR7A 1A4RA 3BOSA 2IHYA 4U02A 4F91B 2BC9A 2ZAOA 5KUTA 3IBGA 4M1YA 1SVOA 2O0JA 1U8AA 1NG1A 3A1TA 1P2UA 3KTAB 4V02A 1NBME 3TW4A 3B5JA 3L8YA 3B9PA 2ZRDA 2O8DB 2WTUA 4IOMA 4ZCMA 1Z0IA 4OKSA 4X8MA 2XSZA 2K5UA 1II0A 2NGRA 2OFWA 1ZM4A 2YWFA 3GFPA 4TTQA 3UG6A 3FMPB 2Q9AA 1XXHB 3BE4A 4ZIRA 3LXRA 2BJWA 3SZRA 4K8OA 3OEHA 2C77A 2WKRA 1DOAA 3R9IA 3TVDA 4R71A 2QMHA 1FUKA 2VHCA 3IHWA 4A36A 5JJLA 3TKLA 1SXJE 3AGPA 1GKUB 2PZEA 3KJEA 3PUVA 2X2FA 1G7RA 4AK9A 1E1RD 1WCV1 4V03A 3FKSA 3DL0A 1J7KA 3PEWA 4NDZA 3RRYA 1S1MA 1CU1A 5UKDA 3ZH9B 1KSHA 3L0IB 3K0EA 1JJVA 1XMVA 2BBOA 4GZMA 4AY2A 2WOJA 2ZSFA 5JS7A 2VSFA 3K53A 1BYIA 6Q21A 3KUDA 5E3HA 1ZRHA 2PBRA 4QBIA 5GJCA 2Q0HA 1NF3A 5JWOA 1A82A 3D6TB 4WVFA 1E2GA 1Z08A 3S1AA 4XTRA 3I5XA 4JL5A 3D8BA 1UEJA 2N46A 1VCMA 2QL6A 2GEVA 4QGGA 5FI0B 3RS3A 4YC7A 5DNYB 1Z22A 2JLSA 4R2IA 3OFNA 4BASA 3KXKA 2IXEA 1B23P 3GJ6A 4P4TA 5B64A 3GLFE 3NIBA 2OSBA 4LV6A 2C5LA 1XTKA 1JALA 2AXNA 2H17A 4KHZA 2DBYA 2QE7D 3GQBA 1OPXA 1E1QA 2GESA 3AF4A 4LJAA 2XNDD 2OBNA 4Q4JB 2WSSD 2JIZA 4Q4AA 2EYUA 2JCSA 1Z47A 4DCNA 2GRJA 4QJ3A 2P6NA 4B47A 4UNRA 1DEKA 4KLNA 4D4MA 4C0SA 3VX3A 3ZVLA 3ADKA 3KKPA 4A2WA 5GADl 3IKJA 3O47A 5FTJA 2F55A 3I32A 1F3OA 5HTKA 4B33A 2WJVA 1CJTC 1U0HC 1US8B 4DLXA 5J47A 4Q48A 4LI0A 1G16A 4FCVA 1N6RA 2OXRA 3T1VA 1E9FA 2PLFA 1JI0A 4I1SA 2GVZC 4D0GA 1A5TA 4OHVA 4OJQA 3BK7A 2QEQA 4QHSA 4RJLA 4B3FX 1W36D 4Q4HB 1Z63A 4DDUA 1PVOA 5DN6D 1ESMA 1IY1A 3BD9A 4A9AA 1Q3TA 2W0MA 3SQXA 3T1OA 4BZXA 2W00A 4PPQA 4D0LB 2ZR0A 4PQYA 4Q03A 4M1OA 1VIAA 3AEZA 3DKPA 4XJXA 2ZE5A 2ZAMA 4BPBA 3O8BA 3RS7A 3BIFA 3GJ4A 1EFRD 4TWZA 2D7DA 1U8ZA 2HXYA 1G17A 3IILA 1IJEA 2Q3HA 2NZJA 1JJ7A 1VYVA 1NP6A 4LJYA 2O8FA 2ASEA 2ODWA 5JEEA 2KE5A 4G5OA 2F9MA 1H8EA 4B35A 1DBSA 2DFTA 1CLUA 3AUYA 4PAQA 5JRJA 1KMHB 4TQUS 1G19A 4UNNA 5FFMA 3C7KA 3RNLA 5TARA 1T5LA 2QU8A 3GEHA 3FPAA 1OFTA 3NBZC 1BIFA 1E2IA 4Z51A 5KU1A 1NKSA 1LB1B 3RS5A 3B8HA 4Q9KA 3AQ4A 1XEFA 4AYXA 1IHUA 2OLJA 2ZVPX 2QI9C 1G5RA 4JLPA 3C15C 1GTVA 3WBJA 4DCVA 4OK5A 1BMFD 1FMLA 1KSJA 4M53A 2WSMA 5DYIA 3UG7A 3X1DA 4FWTA 2GNOA 4MQBA 4B74A 1GVNB 4DLUA 3I5YA 4URWR 5FBVB 2VHTA 1UF9A 3EAQA 4I1OA 4XWKA 1V43A 3E70C 2HJVA 2EVWX 2ZYUX 2QBYA 3BB3A 1NBMD 4V0OA 4EAQA 3A1SA 4PPNA 4WZBE 3WRYC 2JDIA 3SOPA 2V8OA 3QVUA 4DB4A 1D5CA 1P9NA 2IXGA 3DMDA 4D6PA 2VH5R 4B3XA 2PEZA 3I72A 2OM2A 3CNOA 4C9BA 3M6AA 4ZCIA 1E2QA 3NBYC 1A1VA 5HCNA 2CE7A 4A0RA 4Y0VA 5IRCD 3CR8A 3KXIA 5CK4A 5EE5B 1KI6B 1XMSA 1E32A 1C9KA 5FOUA 3GMTA 4GP6A 3SJAA 4HB4A 2GBLC 4A8JC 4QXAA 4KSCA 2ZRBA 1TPZA 1FMJA 5GJBA 1II8A 4NYJR 4MYTA 4A8JB 1LF0A 2IYXA 5LB4A 3AP3A 4PHHA 4AKIA 3EASA 3PEVA 4O2LA 3SYKA 4KSBA 4ABYA 1P6XA 2EWWA 3QEJA 4DCTA 5HKKD 2DHRA 2WPDA 1SVWA 3LXXA 4DLWA 1CJMA 4DLTA 2JAQA 2H7VA 2QE7A 1ZIPA 5HE8A 4ARZA 4DBLC 3VR3A 3PITA 4URVR 3LD9A 2DB3A 1Z6XA 2NZ8A 1YR8A 1XF9A 2I3BA 4JLVA 2RGNC 2NO6A 1KDOA 2E87A 1KKLA 1RYFA 1MOZA 1YZKA 1R0YA 3CZPA 4TT3D 5JEDA 1HE1C 1KI3A 2HYDA 2PEYA 3AVOA 4RFSB 1LY1A 2QGZA 4B6EA 4DSUA 5JECA 4LYFA 5JHHB 1CF4A 4JS0A 3A4MA 1ZINA 1SHZA 1Z28A 1CJKC 1VCOA 1UPTA 3NKVA 4M1TA 5EP2A 3SR0A 1NMYA 3CLVA 2PT5A 4M1KA 1IN6A 4LWZA 1MABA 1W2HA 4BFYA 2QMUA 1CXZA 4F4CA 2C78A 3DPUA 1G3RA 1KI8A 5BN4A 2Q3FA 3ECCA 3KQLA 4DHEA 2WM9B 3PV0A 4FD2A 2IYZA 4AKHA 4YXWA 1GIAA 1K5DA 5HZHA 1GNPA 1VIYA 4OHWA 2QP3A 1P60A 4PO1A 2NO9A 4V0LA 2A5DA 3RHFA 1P62B 3VR1A 4UJ5A 3SBEA 1KI7A 5JWHA 4Q7LA 4Z54A 1EX6A 1G8HA 1MRSA 3GJ5A 4ESHA 2AKYA 1E94E 2ZTSA 3OE7D 4AWXA 2R9VA 4M21A 4DZZA 2IYYA 1GRQA 3B6EA 1KNXA 2Y8EA 2JLXA 4BFSA 4A2PA 4AI6A 4WW0A 4D81A 1S4QA 1XD2A 3RSLA 2BDTA 4JLOA 3A36A 1T6NA 2ZJAA 5AJWA 4TTRA 3SU8A 3E1SA 3IGFA 4MDFA 3Q7PA 2EFHB 3I73A 1G3UA 3LNCA 1E2JA 2ZSBA 4NU0A 3Q9LA 4B3GA 2DWQA 3QI2A 4Q19A 3OZXA 5DHAA 3R7WA 4QGHA 5AUNB 3OAAA 3K0AA 4RD4A 3T5DA 2E1RA 2PL3A 3JVUA 4DDVA 5CM9C 4MKIA 5P21A 1N6HA 5CYPA 3QKUA 2VYFA 3P4YA 1W0KD 3QE0A 4QKQA 3RS4A 4OQMA 3SHWA 1HQCA 3U5ZB 1KDPA 1GDDA 4Q47A 5F9HA 1W36B 4NCJA 5J5CA 5FPKA 2KJQA 4DEYA 2GF9A 2GEUA 2F7SA 4MUAA 1IOZA 2CLSA 2ZE6A 4NZYA 3C8UA 4A15A 1EWQA 4YDSA 3F8TA 4M1WA 4DIEA 2ZE7A 4E5UA 3HJNA 4JT2A 4BZQA 3U3RA 4NBSA 1G9XA 1WF3A 4OHZA 4MKFA 5DI3A 5SZKB 3FVQA 2C95A 5B30A 2R65A 4KYIB 2QBYB 3BRWD 2F43B 2VIIA 2J41A 1DAKA 4G3XA 1TU3A 4LK2A 3AVPA 1FUUA 4JIMA 3C14C 2X77A 2GHIA 1SQ5A 1E2HA 5CB6A 4O0MA 3ASYA 2P67A 3BFKA 221PA 1FX0A 1WBBA 3VR2A 4YQFA 3CM0A 5EXXA 1KJWA 1XEXB 1F6BA 3R20A 1GRNA 3FB4A 4TMZA 3HPQA 2O0KA 2A9KA 1RRFA 1DG1G 3AKDA 4CGZA 2NO0A 1E0KA 5EE3A 1IJFA 1II8B 1NN3A 1NLYA 1E2NA 4HB3A 4HZUB 2GJSA 2ORIA 1TQ4A 4MITA 2PMDA 3WYFA 4YMTA 1ZVQA 1E2FA 2MSCB 2YVUA 1T5IA 3BS4A 2G3YA 3U7GA 4HAZA 5EE9A 1II9A 3IQWA 3U60B 2OBMA 3GJXC 1R8QA 3EX7C 4DJTA 3U44B 4CEIA 3QXJA 2ANBA 3A37A 3QBTA 5FBQB 3CPEA 1G8FA 521PA 3THYA 2QRNA 4ZDKA 5B2ZA 2G6BA 4MA4A 2J0SA 1T91A 4CEJB 2GZDA 1XP8A 4WIAA 1BYUA 1SVLA 2D2EA 3SJCA 2FSGA 2YV5A 3WNCA 1T0HB 2NTYC 2O8CA 4CZ2A 1SXJC 1OLOA 4JVSB 1KK1A 2EFGA 2VBCA 2ODNA 3NEYA 3KKQA 3ZZUA 1UKEA 2EYQA 1N5IA 2HYIC 1Z2AA 1Q20A 2J0UA 4LPKA 1PUJA 4W7SA 3LH5A 1G3QA 4Q9HA 4A82A 3ADDA 1SULA 4RD2A 5FUYA 2GF0A 2ZI9A 2GEDA 1JR3D 1ZJ6A 2O52A 4TMXA 1EFHA 4D2IA 4P0TA 4KODA 4RKFA 1W0JD 2HJGA 3GCGA 1OKKA 4Z8XA 1FZQA 3MD0A 3WBKA 3GLHB 2AHOA 5L3VA 3L82B 4AKGA 3HR8A 1JNYA 2IYWA 5GJVC 2QQEA 5TB5A 2XB2A 2CJWB 4C30A 4XVUA 3QY0A 3KQUA 3AUXA 3LRPA 2V4ZA 4TMTA 2FGKA 1N0UA 1YRAA 4EPTA 2JJ2D 2H16A 3WNDA 3MSXA 1SZPA 3KJHA 3VHLB 3R8FA 2EFCB 4ZKEA 2J0QA 2LCFA 1NJGA 3WHKA 5G41A 4Q1DA 4LZZA 5FTNA 2V7QA 2QAJA 2XTNA 1OH6A 1EWRA 4O3MA 2GK7A 3TRFA 1M1YE 1QG4A 2KB0A 3T15A 2JA1A 1RFLA 4HUQA 1X8KA 1YVDA 3EW9A
chains in the Genus database with same CATH superfamily
1JEDA 2R1TA 3ENNA 3GELA 2RG1A 1QO0D 1U90A 2Q6VA 3TCNA 4RTOA 5L7WA 3GEMA 1PR2A 4TXNA 1N25A 2IS1A 3G7SA 1RMYA 2I6SA 3NIGB 2E4ZA 4J4HA 3RSHA 4ALIA 2BKLA 4Q37A 2NSLA 1HETA 3U9SA 1EE1A 1H2XA 1KY4A 2V6JA 1VP3A 1M8PA 2Z09A 4LHVA 3UHFA 5KMGB 3K09A 5I9TA 2PWBA 3GA0A 3BH7A 2H1IA 4YEDA 4AAYA 3PG5A 3TLZA 3FCSB 3EWAA 2H0RA 4QBTA 2XRMA 4O4JF 3VPCA 5J1TB 1D5WA 5JNVA 4EMBA 3PE6A 4XIYA 1UMKA 1F4PA 2Q6TA 5DHUA 4BX0A 4KR3A 2YDYA 1X1EA 4BQQA 1Q0UA 3ENKA 2C3OA 3L9XA 5KHOC 2YBEA 1BROA 5CLLA 4B3MB 5F9MA 2EKZA 4RTKA 2GJ4A 3I28A 4X92A 2A4KA 2IXFA 4LJ9A 3DS8A 1P31A 2W8BA 1YCHA 4IGFA 4ITVA 4JC5A 2UUOA 5ES4B 3DEYX 3LDAA 3Q40A 3FOEC 2ZYIA 5BRAA 2A2ZA 3EXEA 5EKDA 2YJ4A 1NDHA 1ZIOA 1C0PA 4LG1A 1R6UA 1Q15A 4UXJA 4KU4A 5TQ2B 1RABA 4YRQA 1RM0A 3S99A 4K9QA 4FNAA 2IUEA 1ZUHA 3I8SA 5KYWA 3S4YA 2PRIA 3HCEA 3PR2B 3PZRA 3HHPA 1NAIA 5K51A 4PZPA 2V45A 1XI2A 1VMEA 4P5EA 5DNEA 1QHHA 1Z37A 4IX1A 2UZ1B 2QTMA 1K8XB 3WOHA 1SVNA 3ZZTA 1VI5A 3C3YA 2O3SA 2IEDA 1GL7A 1GPKA 4BCCA 1ENOA 2I4IA 3CFYA 1QMGA 5D7BA 1NXOA 4E51A 2EZUA 4JFRA 4U1RA 3JYQA 1PKEA 3VH2A 4S0XA 2LDXA 3RAPR 3IQFA 2ANCA 3GFBA 4U9HS 3NH6A 4OU5A 4JSTA 6REQB 4EYQA 4IJWA 1CLEA 2HGZA 5CFZA 2VPPA 1NW7A 3DULA 4XQCA 1DTWA 2OQVA 5EGSA 1DBPA 4YCBA 4R05A 1D2RA 2CV1A 2PWYA 1BCSA 1KK2A 1MRZA 3KCNA 3NEAA 4Z7OB 2G1AA 1NI3A 4FYKA 3DBVO 4MP3A 5IYZA 3FX2A 3UPTA 2AG8A 5BVHA 4NKRA 3BB1A 4HQ0A 1TZCA 4YRDA 2K2QB 3ELBA 2MR5A 3ABQB 3A1UA 3OOSA 1W96A 4XD7D 2HFKA 1V25A 1A50B 1N0VC 3K0FA 4MI3A 4LRXA 2C9YA 4CTKA 1T26A 4BEVA 1MAAA 4AJEA 1EUDB 2GLXA 1RD4A 2QUAA 3GVCA 3HVHA 1L9KA 3QBVA 5KYKA 1UL1X 4EB8A 3A6LA 4GH5A 4OJKA 2OCLA 4JSRA 1XZDA 5G1OA 2GBLA 2V6IA 4MGIR 4MJLA 3OA2A 3WK9A 5T5QA 5KVCA 1NHWA 1SGWA 3VVBA 2RIPA 2YW2A 3SC2B 1JKJB 4C0AC 3FNIA 4OXXA 2WJGA 2HF9A 4DMFA 3EH1A 3AM3A 4QOEA 5DIFA 2F4NA 4X6XA 5I7VA 1PR5A 3BMNA 2VDQB 4DSTA 1WM1A 1DJNA 4EAAA 1A95A 2XEXA 5AK6A 1KZ1A 3F5QA 3RBXA 3UT0A 4F2DA 1H66A 1R66A 4AJ4A 3C41J 3T54A 3T7JA 4F4IA 3G7UA 3SNHA 3PCTA 4KQWA 1AKRA 5EWJA 3P9PA 2RAFA 2C4MA 3O4VA 3MBKA 4PC6A 4H7PA 4WKNA 3MQFA 4UTVA 5BR4A 2VWGA 5IKPA 2Q5CA 2WMOB 2BGLA 2X4IA 4JJGA 4PCLA 5HRCA 2P6RA 2D3WA 2XTZA 4IIXA 1IN1A 3HV2A 5JH7A 2YOGA 3TCXB 5KNCA 1RBMA 3U09A 2O0HA 5JV5A 4FFPA 2A3NA 2E4AA 2Q5QA 1SKAA 3BWMA 3R3SA 3T35A 4EQZA 5BW6B 4DA4A 4N1AA 2ORVA 1EXDA 1K9VF 1XOIA 1BKDR 4MIOA 1NP3A 3K3PA 2JGLA 2TMGA 4J16A 3B6KA 3DYIA 2GMWA 4C7MA 1KTIA 1F7UA 3CUSA 3L77A 2Y27A 1G6KA 5DHSA 4W5JA 3BXXA 5JS8A 5FTLA 5IT5A 2PGJA 2XDWA 2Q29A 4TZ6A 2YMMA 2XCIA 3NCTA 1GNSA 1Q19A 4ITUA 1TM3E 1YSCA 2F67A 3WTCA 2DUWA 2MJLA 2XUFA 1JSLA 2RHJA 4P83A 3WYEA 5MFZA 3GLGA 5GVRA 4H0CA 3UF0A 4UKDA 1VE6A 1W48A 2NV0A 4DXAA 5AVRA 1J24A 3QUTA 1TRHA 3JYHA 1BWPA 2I7CA 1CY1A 2Q9UA 1F5NA 2LKDA 2V7UA 2JZOA 3I01A 1FJHA 2H07A 3EZFA 4HLQB 4K87A 4N3BA 1M54A 1SXJB 4BVBA 2AZTA 4R31A 4EUKA 5C7IO 5LP6B 3BM5A 4HYYA 1S4MA 2CL0X 3EGDA 3H0KA 3NVDA 3UENA 3LP6A 1CF9A 3UAGA 1DLIA 3D3KA 4BNMA 2VHQA 2CVHA 3RK0A 2CXUA 4ZOCA 1NVVQ 3GYBA 2QPAA 3WFIA 4NAHA 5LSAA 1TAHA 3EXHC 4G2TA 1E4OA 4QGBA 1RADA 5AKGA 3TQIA 4BV8A 4C6TB 1L7RA 1ZGJA 3VR6A 5B58C 8AT1A 4LQLA 4Z0PA 5JCJD 2EKDA 2VYNA 3EFOB 2I1WA 3ZX5A 1JB9A 4DMKA 1E1CB 3U7FB 3S29A 5A5FA 5AVXA 1UFVA 4CT5A 5MGBA 5L6LB 4MQ4A 3LDHA 4D82A 1O4WA 1RQNA 2PM8A 3AP2A 1ZCZA 3BMOA 4C2AA 4CW7A 3I61A 1NVUQ 2V6GA 3ZTYA 4O2RA 5DYTA 1JVNA 1UDXA 2AFRA 4FCWA 4MRNA 4ZV4A 3DM9B 2D54A 4UHFA 4DWWA 3EPKA 2QF7A 1NVVR 2C94A 1T4CA 3RUEA 1I36A 2ZCUA 4EX7A 1PI3A 2W2LD 3HQ4O 3IO5A 3RSSA 1ST3A 5HKKD 1Z2OX 4XYGA 3ZJTA 4H18A 3EC1A 3P0FA 1N1GA 1QR2A 1XQYA 2EARA 2YUTA 2WM3A 2ZDQA 4IQGA 5JISA 5DNVA 3GYGA 1E1RA 3ONVA 4DSOA 3G6WA 3JALB 4R8SA 4G07A 1VZ3A 3AIMA 5HE9A 5HIKA 3WIDA 3GLHE 2FOLA 3OHPA 3DHNA 1RRCA 2HRRA 2NPIA 1BE0A 1A8IA 3N75A 3JD1A 4E5VA 1M2EA 4WX2B 1CUAA 2NO1A 2OLEA 2H4JA 2Q8QA 2VEDA 2CZCA 3ESXA 3SBXA 3TDNA 3V7WA 3ZLUA 1RYZA 3DOFA 4FR2A 5DHPA 4B4KA 2AH5A 1J22A 2ZBFA 4U00A 1GAJA 3EXFA 2HY7A 2P9TA 2H2FA 4GVLA 1TA9A 4NY1A 2PS9A 1Q7EA 1P0CA 3ZDXB 4ZEVA 4XUCA 2WT8A 5AD1A 5BSMA 5JO9A 1CB0A 1RACA 1H1LA 4RHCA 1P75A 4COOA 3RIEA 1QVVA 5CXQA 5LJLA 5IJXA 2OQIA 1OAAA 4JYMA 1NXXA 4AM8A 3CKLA 4KAXA 4TYQA 5D1NA 5J5AA 2H08A 1OF1A 3V7FA 5I4CA 4LSWA 3DCJA 2QLNA 4RPKA 4NEQA 1NQAO 5DJ5A 5A4KA 4E5DA 2YZGA 4WJKB 5KJ6A 4BY9E 1RW4A 3CX8A 3DMGA 3N3AC 2XODA 1Z5OA 4UUOA 1AN0A 4IXNA 2CNBA 3FXAA 1YZLA 2GWHA 2P78A 2WAMA 3SLGA 1R8YA 2WPNA 1OBFO 4J9VA 5E8JA 3UW1A 2ZM6B 4RK7A 4EKGA 3ZQJA 1YACA 2ZROA 4KPGA 4D8VA 2YKGA 1SU6A 3HP1A 4KN5A 1P1IA 3O0TA 5FTWA 1DCMA 2MWMA 3QUSA 3STWA 3T9DA 1C8VB 2WJAA 2C8JA 2L42A 3JY6A 3DAFA 4RPIA 3ZXXA 3BSSA 5AM2A 4BCBA 4BRSA 3RK4A 2NXCA 1QIIA 3L7DA 1PJRA 2PMBA 5HTOA 1F3LA 2V7BA 2GAIA 2QORA 3U4AA 5BMVB 4YIHA 2FQYA 1GDHA 3L7IA 5E7IA 2F1HA 1Q0ZA 5CVJA 3HM2A 1S3IA 1SXHA 1E99A 1XMIA 2ZTHA 2GZAA 3KOMA 2XYGA 4KX3A 4V3BA 3DCNA 2X0IA 2DTXA 3P2OA 1NT4A 4N65A 4LXIA 3GBVA 3AVWA 4Q1CA 1SBQA 5DYNA 2YJZA 2IKSA 3AR2A 2X8AA 1JDVA 2ZZKA 4DLKA 2ZRNA 4Q4HA 1CR1A 1KO4A 1V5EA 3U39A 1DPGA 1OZFA 4GPBA 5B4VA 2ONKA 3L6EA 4GKBA 1FMTA 3VFDA 4I4TB 5EP1A 1EP9A 4RADA 2P6OA 5KWSA 1SY7A 5CNMA 4BP3A 2J31A 5A05A 1V35A 1E1MA 2ERCA 4G0WA 2QTTA 1IWOA 3FCEA 5AHWA 4HLDA 5DGIA 1TL7C 4V0MA 2ID7A 3VTFA 4C04A 1U28A 4W1SA 4E33A 1H6BA 4HMPA 1L7NA 3EXEB 4O2BA 1PHPA 2D59A 1U7ZA 1L5WA 5TLSA 5B6PA 3ADCA 4MI1A 3GPLA 2WTNA 1X80A 3GR6A 3MMPA 2FV8A 1UINA 2C8VA 1J70A 4V24A 5FPQA 3WWYA 4AF6A 4YRBA 3ORYA 2D74A 1QE5A 1E2BA 4AULA 1XRQA 2R1VB 2HRBA 2CF5A 3QKRB 2XF2A 5C3MA 3KB2A 3HNOA 1SNYA 2NXNA 4EUNA 1U6JA 4JXJA 3CU5A 4W8HA 3T0GA 4LZAA 4QT4A 5IK2D 2BHNA 3Q3HA 3LYUA 5HG0A 2G09A 4J94A 1WB6A 2Z3WA 2NTNA 4UCWA 5TV2A 4A0FA 3P4XA 4ZDIA 5ICCA 4IVRA 3H1FA 1M6NA 1T1GA 4DRYA 1QYCA 1D2AA 5LQNA 3MGBA 2C7VA 3MELA 3KLMX 1XGKA 5LCXA 4CKBA 4LTDA 4XR4A 3P32A 4ROSA 1GUDA 1UC9A 2PZMA 1W46A 4PVCA 2WIKA 1O7JA 4DLNA 2LXNA 4OYLA 4E5PA 2YRFA 4TLLB 3JQRA 4N41A 1QG6A 5AUPB 4G0PA 4EW2A 4AMBA 4EX6A 2C4UA 5HM8A 1IK4A 1QPBA 3LOPA 4JLWA 2OO7A 3OPNA 4D5EA 4IJVA 5FDFA 5JFOA 1TW3A 3V4FA 3FUUA 1G2PA 1JA9A 3DL4A 3TPZA 1QIJA 3QFRA 3AVXA 1WP9A 3DBIA 4RYLA 4MWZA 3BE6A 5LD2C 4Y9RA 1W581 3TZKA 5BR8B 3P5SA 2RAUA 1FYFA 5CD9A 2GD0A 3OUUA 1E63A 1X42A 2ES4A 3L06A 1OI2A 2FHPA 3ESRA 4HRVA 4WZBA 5JBNA 2CK3D 2BUBA 4MEAA 5LQDA 4G09A 4L9SA 1MJNA 2J3HA 1XB2A 4N7JA 3KBOA 2B4TO 3LFHA 3M6MD 3C6YA 3H6GA 1VCHA 1K6MA 3DNMA 4JLDA 4NIMA 2P40A 4PSDA 2X1VA 1X9IA 1CRQA 1YDMA 2Z43A 4G36A 2IP2A 4X6YA 3ZGNA 3R0XA 3RSFA 3QVVA 1RKVA 3ELYA 2CL5A 1YVEI 3H4VA 5ARCA 4ROTA 4NMMA 3M9LA 3Q7RA 3UWSA 1JPUA 4W1RA 5F5XA 3C3MA 3K71B 3U13A 4MIEA 1NXVA 1V6AA 4I5EA 2EFYA 1HQKA 4BWFB 2Q99A 4CDRA 5KINB 2XI4A 5B57C 3FWHA 3PFWO 3FSGD 2VJBA 3RT1A 4BX3A 2W6ID 4DIUA 4ZPXA 4RNCA 5JJ5A 5T57A 4CKCA 1I2BA 3A6FA 3I3SR 4LNHA 1I0LA 3HCWA 1THMA 4M37A 4U3JB 2HTEA 2I3DA 4H35A 3LBHA 2OKGA 2YTZA 2H1WA 5DYGA 2RGRA 1GNRA 1Y7TA 4R54A 4JWKA 5MDHA 4DE5A 5AJVB 3DEIA 3GRVA 3LK6A 4KO3S 3I3OA 4MV7A 3ZXIA 2HADA 5JSZA 1Z0UA 5C3UA 1Y4AE 3K9WA 4MS1A 3R7NA 3TLMA 4J7CA 3C1AA 2XHEA 3NHKA 4BNVA 4BNIA 2DR2A 5FCDA 1HSZA 4CKZA 4P3XA 1Z2DA 1BHJA 3VSEA 1D6MA 1XAJA 3M81A 4G0NA 4YONB 2B2CA 1Y48E 3U7HB 4DJFC 3L1IA 1E9AA 3PUKA 3KAJA 4V2UA 4B3JA 3BRSA 3I42A 4HVCA 4HDMB 1G66A 1ADFA 1D6NA 2OXEA 2GO7A 1EUZA 2Q3LA 3A4NA 4X1YB 2XNCA 2Q4DA 5FI5A 2W48A 4HEQA 1L8AA 3WRXC 5IT0A 1K7FB 3B70A 4I46A 2XXJA 1BMDA 1V7CA 4JUBA 3DDNA 3LXUX 3GNTA 5SY6A 4P7JA 4EQ6A 1GCUA 4O4LF 1HQYE 4DLBA 2P9JA 4CF7A 3KVYA 1Z4JA 4LYGA 4OLJA 4UU8A 4RCVA 2RSLA 2Z98A 4H17A 2WU3A 3GLGE 5HJ7A 4ZO9A 4P92A 3VOAA 2ZTMA 1SVMA 3EGVA 1G20B 3GRFA 4RZ2A 2YJNA 1PBTA 3JQPA 4UPVA 2O7SA 1L7PA 2VAMA 4GKJB 1XG5A 1Q7TA 2E18A 3SC3A 1D4FA 1VRVA 2JFUA 4QUBA 1PFWA 1SN7A 5DBGA 4B2LA 4AXBA 4CU2A 1Y1RA 3THSA 4L3VA 3JARB 4P84A 3EWIA 1X2BA 1M8FA 1YR6A 3DBRB 5B55A 3D1JA 3P19A 5D3ZA 3WJ7A 5CCEA 3LGXA 4FR0A 1Z83A 2VUIB 3FJYA 3DLCA 2I3ZA 2D0DA 2X1LA 3IEPA 4GQBA 1V48A 2P90A 2Q1WA 3WWOA 4DRXB 5JXIA 2H85A 2OPBA 1SKYB 4YTEA 2GOYA 2AL7A 3DE2X 4MQLA 8GPBA 2ZP1A 2QS9A 4RV5A 2CBXA 3C7AA 1BXGB 3HJUA 1OIWA 4ILEA 3ORRA 2Q4OA 4K5QA 1GCAA 3TB6A 3V1UA 4BFXA 2RGXA 4PHFA 4QVKA 5AK0A 1JB1A 2JLAA 1FA9A 3HA7A 3S27A 2J6CA 2D7CA 1MJ5A 2QM3A 3V1YA 3X1ZA 1LPAB 3RCBA 1KJJA 4WCFC 3IS3A 1XMJA 3H19A 3OG9A 2PZLA 2QE6A 5BYKA 4EO7A 1GQOA 2BUCA 1FQWA 3AB8A 3CUVA 4FQ8A 1R0CA 4IDGA 3O7WA 3SYNA 1QCDA 4EB6B 1UBCA 3GAMA 5GIOE 4F2PA 4H27A 2EHDA 2RBKA 3BK1A 1USGA 1FS6A 4H0NA 4TYMA 4WA7A 4F3KA 1EE9A 3IEMA 5B12A 1DRUA 2OFXA 2GCIA 4B09A 2C82A 3DTTA 4GWKA 2ZK7A 1TEVA 2YXBA 4FYPA 4HLUC 3ZYCA 2DLCX 5KCMA 3UXMA 2R4UA 4FNOA 5C8XA 2FR8C 4GZLA 2MSDB 3ZD6A 1YRWA 3SS7X 2ZUTA 1HFJA 1ORTA 5DW0A 3KSDO 2SKDA 1P17A 2PT7A 1S89A 4TN1A 4S04A 1D2NA 3SDZA 3HCPA 1SUPA 2X7HA 2BFDA 3TXAA 3UBMA 5CVVA 1GUYA 3NOVA 2B7LA 5IKXA 3IV6A 3G9QA 4KEAA 5HJ2A 3JZIA 5SZHB 2PXCA 4FPXA 4X3PA 4OX9Y 3F6SA 1DARA 1ZH6A 3G13A 5FA8A 5DSTA 4D4LA 1S3FA 3RRZA 4CYMA 4XYBA 3L8DA 4UQLA 4G01B 1WMEA 5FP0A 3H9EO 3R9KA 1B8UA 5B7PA 2RHHA 2WV7A 3AVVA 3MJEA 2FZCA 2J7PA 1VCIA 1C7ZA 2FOIA 3RJZA 5LDGA 1KETA 1KMIY 1U3UA 3KZNA 2B7BA 2CJYA 5EEHA 1ZBQA 1U2GC 4B32A 1XK6A 1IY0A 2Y0BA 5DCUA 3LBNA 3CW2A 4EY3A 5J4KA 4WV3A 5I45A 1X39A 4G1EB 1HOXA 4YMIA 3ISJA 3E7XA 3TLGB 4DNXA 5CLJA 1EB8A 3D81A 3KKEA 2WQ7A 1UBTS 5K3EA 4UVDA 4D9GA 1E6CA 1L4FA 1PJSA 3ZNNA 5AUQA 1AK2A 2JJ1A 3ED5A 2C59A 2IVFA 3IFSA 3DTVD 2IS4A 1NU8A 4DBVO 3RAJA 3THXB 1W87A 3N2KA 4NFLA 1ZD4A 2O8EB 1HZZA 3LKZA 3R74A 1UDBA 4UHBA 3PXDA 2ZI7A 2EIXA 5K0JA 4QFCA 1RIIA 1Y6GA 4KQEA 1QDLB 5C1IA 4R68A 5IH3A 1CC1S 5AKLA 3KKOA 3R3UA 4PIPA 3AHEA 4LMAA 4XJVA 2P9CA 3S7TA 4TVKA 5J2UA 5T4EA 2H48A 4LFAB 2XXBA 5L4LA 4WN9B 3W1EA 4NZ9A 3WS7A 4YAGA 4JQSA 1KAQA 5DHTA 1SKQA 4BRUA 1Q0LA 3NCHA 4F56A 2D5LA 1P9RA 2OC9A 2ZSHA 4HBZA 5BMVA 1Z06A 4KXFB 1FSGA 5AI5A 1B8OA 5AYVA 1I7DA 4AY4A 3LS2A 1H22A 5C8ZA 4FYYA 1NI5A 2Y1WA 2ZKIA 2PSSA 1JXMA 4Q9LA 4BO7A 1OXSC 4GP7A 1VSQA 6LDHA 5ITVA 3P97A 3H11A 3T3EA 5COAA 4QPCA 3S2GA 2DT5A 4ZU3A 2LKCA 3ANXA 5A4JA 1C3JA 4QE3A 1OLXA 4HQ6A 5A0FA 1GILA 4JODA 1XU7A 2VYQA 3EOZA 2IWHA 4PR0A 3K2QA 4FEEA 4G41A 3TW0A 3V8NA 1SG6A 4EECA 1E4VA 1WR8A 3P9CA 2PKYX 2ZBUA 3NT2A 4PC3A 3U48A 5DZSA 3OIYA 4KJZA 4N82A 1A2BA 1BAPA 4HCJA 4GDMA 1DTSA 5HDQA 1P81A 3CJQA 1S1CA 3G2JA 1P2FA 3KOUA 3ZV7A 1LS1A 5B4UA 1LNZA 3BF8A 3N2EA 5BXYA 2F8SA 3GV0A 5CHYA 3CVVA 2NZ2A 3FR8A 3AW9A 3NRBA 1PZNA 4HAXA 3ESBA 3KD3A 3UNXA 4XFKA 2FETA 2I2WA 2O6HA 4PBTA 4WFIA 3PJRA 2OBLA 1B2RA 5BUQA 3V00A 2AZDA 3W6ZA 4X62B 3LUDA 5L3ZA 1VL0A 1GQSA 1R9NA 2JH9A 4KMRA 4J1QA 4PO9A 3GBSA 1MNQA 3IVXA 1E8MA 2SNIE 4X3OA 4LHYA 1ZD1A 1UFKA 2AOTB 3FOCA 4MUYA 3VZQA 4MVWA 5CTAA 2BMWA 3G0HA 2BFOA 4D6YA 1YVRA 3FZQA 4RIGA 3UV6A 3FCOA 1ZC3A 3QI7A 2VT2A 2Q3MA 3EZ2A 2COEA 4UTXA 1XEXA 4PG5A 4XD2A 4OBEA 1AZSC 2VOJA 5F76A 4AF8A 2YV3A 3P1JA 4ZQEA 1A8UA 3KWFA 5EWMA 1XA0A 1V5GA 1ZP6A 1TM5E 5JNLA 3NBXX 1RDFA 2PDAA 2GAFA 3TK1A 1EFRA 1EWVA 2HD4A 5DLQC 3UGQA 3NAMA 3AM4A 4IZHA 4Q1AA 2W8BB 1GFSA 4IGAA 1XJWA 1MB2A 3VUEA 1A97A 3GFRA 3EC2A 3KIPA 4G1CA 1SIBE 4I9NA 4U6SA 2FMXA 3VAZA 4YFVA 3JVIA 1Z0FA 1Z45A 2QWXA 1Z4NA 2ZBRA 2NOAA 1X7YB 3HDJA 3V1MA 1MR3F 4C5AA 5AO9A 2PCJA 4C88A 1XRRA 2C2ZA 1U0JA 1B93A 1RWBA 4FZRA 2ID4A 5C32A 3PWSA 4FOTA 4HZIA 5JD5A 1XLUA 2CV2A 1WCXA 2CMHA 2AD5A 2BL4A 2XA2A 3AUJB 3R0IA 4AZ3A 1XD8A 2HHLA 4YUAA 3H17A 5JXWA 1ONNA 1U02A 2X8JB 3E27A 2F00A 3PNKA 5K4AA 3AETB 3MFYA 3V8BA 1O95D 1EFVB 3QPVA 2GHQA 1H0SA 2XWSA 2IH5A 1COWA 4DG9A 1IEWA 5BR1A 2ZCVA 3EG9A 3VH1A 2GCNA 1FX0B 3W6PA 2VHVA 2B4AA 2XSZD 4ZODA 2AFHE 4R5HA 4N18A 1YZGA 3MWFA 4KUGA 1ICEA 1PR6A 2KHZA 3AL2A 1Z38A 1XEAA 3O21A 2NVBA 2YHUA 3OE7A 3S2SA 4EI9A 2H2HA 3BRCA 4MVJG 1ILEA 2P6MA 3WLHA 1ZNYA 4ZJYA 3TQOA 1I9CA 3CH5A 4UUPA 4L2IA 1GNQA 1G5FA 1K6XA 2F9LA 4OP3A 4RD3A 1ZSYA 5D2CA 1UAAA 5HS4A 2WP8J 1BC5A 3LY7A 4CDMA 4WDRA 1EX7A 1SC9A 2JEYA 2GNAA 3DHEA 4LV8B 5ETJA 5HDBB 4OD0A 5JOQA 1J49A 3U17A 1W4RA 1KWKA 4JQCA 1BFUA 2WAXA 5CX1B 4ME6A 1QE3A 3RS9A 5K0CA 1QU3A 2FFQA 4MQ5A 4TQAA 4JI5B 1I2AA 2W58A 5KNDA 1QPZA 2TECE 4OFXA 4M1SA 2HSWA 4AJJA 2QZZA 4HQKA 3L8ZA 3KNZA 4P3NA 5F51A 3O26A 1DWPA 4D45A 3HBAA 4OV6B 2DSTA 5BV7A 3UHJA 3QX8A 5AP9A 4RKRA 1ZRSA 5F64A 1RAFA 1G8AA 3G02A 3GA7A 3DV2A 4PC7A 3QH4A 3M1LA 4DV4B 1DQPA 1XDZA 1ETUA 3GD7A 4NNOA 5EHQA 1PLJA 2NU7B 3VKWA 5BV2P 3D0RA 1A5BB 5E2AA 3AEQA 3GF4A 4EPVA 1LQUA 4CJXA 1EK6A 3DFMA 3ZZ1A 4D57A 5J43A 1XL0A 3A2LA 5E6RB 3R5HA 2IYFA 2XCTB 1XUOA 4QHTA 3CEPB 4YAWA 1DC4A 2G40A 1C4XA 1VSVA 4B6PA 1P8AA 4CBVA 1W5BA 4HFJA 1IB0A 4Q1BA 3G5MA 3WSWA 7YASA 4TLMB 1WWKA 2ISQA 2JFYA 3PFFA 4BNDA 4D9CA 3PYLA 5TJHA 3OHMA 4LJ5A 1TMGE 4P53A 4YA6A 1JIUA 4ZEOA 5J4YA 3UMCA 2RH9B 4C78A 3GC6A 4OB6A 5EKXA 3AH8A 3K8YA 2HO5A 1PR4A 4PSVA 1E69A 1SQ0A 2LUOA 5A9SB 5D3KA 5CDHA 2W2VA 2DM6A 3TG8A 3CCCA 2GZRA 4OSEA 3T7SA 4DLVA 4J0CA 3LC0A 4PN7A 5CB4F 1NBEA 2BKVA 4I8IA 4IIDA 3RKSA 3P27A 1Z36A 2ZYGA 5AM3A 4TVOA 2D0IA 3H9QA 1OILA 3F3MA 1U9IA 2Q3BA 2TS1A 3LQYA 2DECA 2DHQA 3X1YA 3Q3JB 2WJJA 2XJ4A 1YIAA 2OILA 1A7KA 1MKYA 1UJMA 2NW6A 4RDXA 1DBRA 1GGFA 2I54A 2XDQB 3GRZA 5FNVA 4QXQA 1EXMA 1JZTA 5DSZA 4HDCA 1V1JA 1JTFA 4CPDA 1ZAKA 3BBPA 4KLRA 4YJ3A 2H5IA 4Y2SA 5CIQA 1JXAA 2XUIA 5DNDA 3W7BA 5CFNA 4HR7A 2I1QA 2IQ5A 2WJHA 4EL5A 1HX7A 2WE8A 5IJ9B 4FDVA 2B25A 3KG2A 1OWLA 1RRGA 1H2EA 5EHXA 5KTSA 4QNRA 1A5AB 1WOYA 2HF8A 3T5AA 5FV7A 2H2AA 1K7CA 2JLCA 2VHYA 1X1RA 4RVSA 4OMUA 2BFFA 2OK7A 5ICMA 4QVIA 3U37A 4BVFA 1UXJA 4KFRA 1V71A 2AJDA 4GLJA 4OFWA 5G3YA 4B7UA 2E21A 4I2VA 4IXMA 4K9MA 4P36A 1NYQA 3ENVA 3O73A 3Q0EA 1KY3A 3IEIA 4G0ZA 3DYBA 1A5ZA 3HY3A 1LNSA 4D9JA 3SMVA 2IA5A 1R4AA 2DH5A 4MO9A 3AXSA 1K75A 1GXSA 1OV4A 2RHWA 3NBAA 3OIFA 3L8HA 4RELA 3ZHRA 4OQNA 5FD8A 1Y3BE 2ASVA 1LI5A 5A3JA 3PK0A 2EU8A 4G5XA 5FTKA 4J1NA 2HWWA 3G82C 1RBZA 5BQFA 2AG6A 5B3AA 3RJTA 1SXGA 2G4VA 1OGYA 2EFDB 2R8XA 2IJGX 3T7TA 3ISTA 3U6KA 2R7AA 4J6EA 1NBAA 4JWTA 5HMMA 1QFZA 2PGLA 2XKAA 3UOWA 4HNSA 4Q4DA 4RH3A 4CVNA 4L7QA 4R9UC 4QASA 2WJZB 3ORFA 2VJOA 1EP1B 1VGQA 3T3PB 5HKKA 2R6JA 3GZJA 4RULA 3P71T 1NW6A 2OGTA 4AJ9A 3L8EA 4Q3DA 1F0PA 2O4UX 1E9VA 2Q9CA 4AN0A 2NU8A 5K3FA 3ZCQA 1E5VA 4LXYA 3TTUA 4GR4A 1IBRA 1KVQA 2GETA 3K4HA 4QDOA 5DH9A 5BWCA 1Z0KA 3IMFA 3AI7A 2IDMA 1UKBA 4CFZA 2NWQA 1SIOA 2AB0A 3DTYA 1P72A 3ZHUA 3U3XA 2ZG6A 3KLNA 4J1SA 4MUXA 2QVBA 4ZVNA 3JRXA 1MH1A 3A4VA 3HR7A 2FR8A 4XDHA 1A96A 1HKUA 3PCRB 4OUKX 4R84A 4YB8A 1SZJG 4CQMB 2AYXA 4IXDA 5B2EA 4EGQA 3EEIA 3N2IA 1M7GA 2F2TA 4U4AA 1KQFA 1JSZA 1JX6A 2IITA 4FEGA 1Q77A 5I9MA 4G67A 4HXGA 4B80A 1X3LA 3CINA 1PQYA 2VNAA 1HRKA 1ZM9A 4C22A 4DGQA 1DRVA 4DXDA 4LJRA 1YJXA 3T7AA 3ABSB 5FWYB 2PIDA 2IBMA 3MYYA 1AA9A 1TYDE 2Y92A 3H7IA 4Y9UA 3L92A 2CNWD 3QYFA 3UFBA 5EPUA 1ODIA 4AYWA 1Z5ZA 1TIKA 1X6VA 2C3PA 4DLLA 1W88B 3HXQA 1ONPA 4PTLA 5DK4A 1JGTA 2G5TA 1X86B 3ZUPA 3UK1A 1G41A 5GONF 3ZS8A 4W9MC 1PJ8A 3G85A 3R3XA 3FE2A 3IBYA 3ZDEA 3RJMA 3DWFA 4E2WA 2QPTA 2QZSA 1AV7A 1LSJA 4QDJA 3KQSA 3A05A 2B4RO 2I6FA 4B6JA 3PGVA 4LDQA 1SHLA 5ALNA 4AN1A 3OQNA 3GOHA 3TTXA 1LI4A 4KL8S 2RAPA 3IAEA 4MVJP 4QJ4A 2BV3A 2HA3A 3PE3A 4NCBA 2WKPA 1LFDB 1C9EA 1DELA 1T9HA 2VDJA 3HADA 3V32A 3I39X 3LC2O 4PBRA 4YJ2B 7AT1A 4JDPA 3PFBA 5HMLA 2EP7A 2IZ0A 3HSYA 3TG2A 1JG1A 4ZT7A 4BEJA 1L6IA 1HL7A 4XJSA 2BI4A 2NP7A 1DZIA 4OQLA 3REOA 3PX2A 3ZI7A 4CDNA 5HX7A 1VJCA 3MJFA 3QW2A 1FXWA 4IOKA 3BGWA 2GBFA 2ZDGA 2XX3A 2ONJA 1DKLA 2JBHA 2X22A 3KD2A 3PVZA 5CEFA 1L4KA 2XR1A 3WB9A 1ADBA 4JASB 3RVJA 3ZWWA 3F6BX 2Z58A 3PNLA 1EBUA 1TF2A 1H93A 3PRYA 2NU6A 1N5OX 1DINA 4F5WA 4UFPA 3R9WA 1EKXA 2EZ4A 3NLLA 3A6PC 2Q62A 1W49A 2FRXA 2HXSA 2W6OA 1NUUA 1YKFA 4B3BA 2BKUA 4P6VF 1MH9A 4TMYA 5IZCA 1U0TA 1OH6A 1G5QA 3LX8A 4RHEA 3QF4A 1S2NA 3OIUA 4LY6A 2P9YA 1P1CA 2IXBA 4OQZA 4PLTA 2X9LA 2I80A 4ZVPA 5EFOA 2R6R1 3TPFA 1UBKS 1YBMA 4OMFG 5EYPB 1WHSB 4ZFNA 1JBKA 3TLBA 4Z49A 2HMYB 2JIOA 1OIVA 1XYYA 4GG1A 5AM1A 1GTSA 4JLAA 3SDBA 5EIOA 1G98A 3P8ZA 3QTLA 3TLCA 4BUJA 1EM8A 3GVXA 4EARA 3TKYA 1U2SA 4LYHA 1FX1A 4BXOB 1ZM7A 1I10A 2ZSKA 4YY3B 2CL6X 3CEHA 1P2VA 4NJEB 2X9VA 3KLOA 4QPJC 5JD6A 3H9BA 3DZHA 1GCGA 1UXOA 3EUWA 4KE6A 1GZDA 4OIFA 1NY5A 4RL4A 4NP6A 2FU5C 3W1WA 4D42A 1R0LA 3ME5A 3HSKA 3IOYA 4R0NA 4XFDA 3TFWA 2Q6KA 4L6IA 4I99A 3TLYA 3JRWA 1NVDA 3E3MA 4RL6A 5DT9A 4OFBA 1R9JA 1LJLA 4LDZA 1Y1SA 3FVWA 2PH1A 1VGRA 2VO1A 3RIYA 1IAQA 2GXUA 3AR9A 5F9FA 4YJFA 4QUHA 3TZBA 5HUJA 3FWYA 1DEAA 1OHHA 5K6AA 1MD9A 4ZU6X 3EYWA 3ILVA 2FUG1 1KBZA 1J6UA 3B82A 4OHPA 2NUAB 4C2BA 4D3XA 4F0JA 3F8SA 5IJAA 1VHQA 4NMLA 4RVUA 3I09A 1FSSA 4EG3A 1R8XA 4WCDA 4CLXA 5ICEA 4KQGA 2UKDA 5A3SA 1DDOA 3NRCA 3R7FA 3N8HA 3DCYA 1RWWA 1DEHA 1VMKA 4EB3A 2UZ0A 2Y6UA 3VV2A 3G23A 2F1IA 4BP9A 1Z6YA 1FVHA 2PLRA 3BWCA 1G21E 1TQ2A 3QFSA 4B6FA 3EZ9A 3G2NA 4Q9IA 1EJ2A 5DSXA 1NXPA 3AJDA 4YDQA 2AKEA 1NVTA 3P45A 1YONA 4HB0A 4WAUA 3W5CA 4FNMA 4MRVA 4RKQA 1MX1A 2LIVA 1EGVB 3ZOKA 5DKFA 4E2YA 3L79A 2XOKD 1TCUA 2GAOA 3O3CA 4ND1A 3RB8A 3S28A 3VYUB 3LBFA 1F60A 2CUZA 3A06A 4NESA 4TYPA 1NJ1A 5EJGA 5FLEX 3LX4A 5IAKA 3DT8A 5JASA 3GGSA 4XVQA 2XUQA 4L22A 5TPWB 2XF8A 1D9ZA 4D0GA 3CLSC 2JC3A 4CQMA 2IH2A 1A9SA 2Y2UA 2V65A 4IX9A 1UXGA 4U9IS 5DGCA 3DD1A 3H5RA 1IVSA 4FDMA 1T0UA 4MYRA 4O4IB 5CTJA 3UKJA 3SVTA 3LWZA 3KUKA 2P2NA 3ZXYA 3KVRA 1U98A 4HZUA 2HOQA 4URYR 4F4DA 4GI7A 3T9CA 4C6RA 1SA0B 2BGIA 4A73A 2IF0A 3MPUA 2A88A 3F4BA 2N1BA 5B5SA 2W2KB 2V4MA 3I52A 4OA5A 4BO0A 2F3RA 2I78A 2JASA 3REQB 2AF3C 5KYTA 3IIEA 3HCOA 2FQ1A 1FRQA 1TLLA 3AT1A 4JU9A 1RRKA 2JIMA 3WR5A 2Q2QA 2DPYA 5BV0A 4H2DA 2ARKA 3WGHA 2PCLA 3ICCA 2YWDA 3FETA 3QV2A 1PGNA 2R8BA 1Q1BA 5HPYB 3DSRA 4ZT5A 1D2GA 4PYJA 5BUSA 1Y7IA 3PD1A 5FBZA 2FDCA 5ARBA 1P73A 3FTCA 4IICA 3JQAD 3I76A 1L4EA 1GQYA 2YUIA 4PX3A 4AC9A 5CH8A 1DSSG 3QIVA 4M98A 1U1EA 2HIHA 3W9UA 5CW2A 3M6WA 1XC7A 2HMUA 3X2FA 1Z0AA 3HKDB 3W3AH 2ZPAA 3HEBA 4IV0A 2GVNA 1U4SA 3O92A 3TW8B 4FYWA 4NL4H 4PYIA 2A0FA 3IYLW 3UQYS 3V3KA 4LPSA 2RGNA 1N2EA 1NVGA 1R0KA 2G9RA 3PQ3A 1Y33E 4YLEA 4HDKA 2O19A 4MHOA 4C43A 5C0OE 3Q2KA 1Z5UA 2IDKA 3P96A 4UAUA 2G4CA 4F5YA 2AZXA 5D86A 1KRHA 3DZKA 4JV5B 2WDZA 3A27A 1VZ2A 1QVWA 5B1HA