3PJLA

The crystal structure of tp34 bound to co (ii) ion at ph 7.5
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
157
structure length
157
Chain Sequence
DEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 34 kDa membrane antigen
publication title Characterization of the Tp34 lipoprotein from Treponema pallidum suggests a role in transition metal homeostasis
rcsb
source organism Treponema pallidum
molecule tags Membrane protein
total genus 30
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pjlA00
5I0YA 3LZQA 3PJLA 5I0VA 3LZOA 3LZRA 2O6DA 3LZPA 2O6CA 3LZNA 3NRPA 3PJNA 5I0XA 2O6EA 5I0WA 2O6FA 3LZLA 3NRQA
chains in the Genus database with same CATH superfamily
1I7UB 4QCIA 2J6EA 4EI5A 3HC3L 4PTUB 1IKFH 3ME0A 3ZHKA 3US9A 3ULUD 2JKXA 1QRNA 4OFVA 4X5RA 4Z3FA 4GJTB 3G5VB 1KBPA 4U49A 4IMKC 3K6FA 5KTEL 4UDTA 3VDBA 4AUYA 1TCRB 1DVYA 3MRQA 3EO0B 1JCVA 4HH9B 4ZW8A 5K9KA 4AYBA 1LD9A 4GIPD 2C4FU 1UOVA 2QMKA 5F7UA 1MPAL 4JG0H 1UM4H 4GY4A 3Q01A 3HUJF 3EJZD 3CZEA 5EUOF 1DBAH 5AWNL 2Y69B 3VG9C 5KVEH 3DIDA 4LEXL 1JPSH 1YYMH 4M6NL 4GUPB 3ZYOA 1JGDA 2Z7ZA 4P4KC 3WEOA 4NAJA 1EUUA 2NQDA 3M1BA 3MR9A 2FZ3A 1UJTA 1DBBH 3A23A 4PVNA 5FO8B 2IANA 2QHRL 4I3RL 1ZE3H 2IOIA 2V0AA 4NRYB 4P3WA 1YEIH 2OULB 5DD0L 3OKOA 3BD5A 3OKKB 3ZL2A 4M43L 1AMYA 1EZUA 1DZBA 3QEUA 3LY6A 4M3JA 3FONA 2Z4TA 3GC3A 1KCVH 2Y4SA 2BOLA 4ZMOA 5ERWA 1RY7B 2F0CA 2LE9A 4L4TD 1GTFA 1YNKL 2D73A 4L5FH 4YS4A 3JV4B 3MUY1 4LSPH 4CMMA 1FV1A 4X7CC 5AAMC 1S9XB 2J8UA 2YAFA 5C09E 4FABL 2VZ3A 4RAVB 1H6TA 1PZSA 4NT6A 4D8OA 2G5UA 1E4WH 1JNLL 2E5EA 5A7EA 1TU2A 3O4OC 2R59A 3FTGA 4X6FB 1EHKB 3U7YH 1I3VA 3ZPDA 4R96B 2EXSA 2EYSB 4WI2A 2YKLH 3PXLA 3CU7A 4GRLB 3BIAX 4O2CA 3BW9B 4HIXH 1RP9A 3IFPB 4K23L 3V0VA 1QA9B 3N43B 1NMCB 4FTVD 3SDAC 3NA9H 4PJCB 4F58L 3WNJA 4YLBA 2Y6SC 2DWDA 4PJAF 2W95A 1J05B 5IHBA 3FKUS 4XNBA 4FNPA 2EDJA 3AY4A 4XI5D 1XB6A 1Q0YL 1UXLA 3MLTA 43C9A 1J5OH 1ZLEA 3CZSA 1G7LB 3L9RB 4FFZH 4FHKA 3Q44A 2BSSA 4LLQA 1CWVA 2E47A 1OP3H 1ZPLA 4ZX5A 3DJRA 4LCIH 1J11A 3C60B 5FK9A 1UFUA 3V4LA 4KKAD 2RFXA 1J9QA 1MEXL 2NNAB 3MFFA 1OAQL 3QRLA 5IVOA 1L7IH 1AKJB 3PGCA 4P49A 4Y4FB 1GSKA 3ULUF 4MZRA 3FO9B 4P2QA 2IPKA 2D0FA 4DSYA 3WFEH 1LWHA 3QPXL 5C0AE 2FLMA 4K94C 5IESL 1IFHL 2FB4L 5E1GA 2XT1B 4PGDA 3OKNA 4LZKA 3ARBD 4RMBA 5ESAB 3HFFA 4I48B 1J9CT 4X6CA 4RGNE 3O4LD 3BSZL 3WJMA 1EAQA 4OCRL 3NP4A 4FQLH 4L4VA 4M8UA 3IU3A 1LEGA 3FPYA 4PRNA 1FH2A 5DVLA 2EQDA 1NCHA 3KXFA 2HLFC 1A14L 1KXQA 2EINB 4IRJC 5CZKA 3WXWL 2JKRM 2R29H 1N7MH 3UAEA 7CGTA 3PWPE 4J8RB 2F08A 4NN7C 1M1XB 2GIYA 1RU9L 3RZCB 4G6KL 1CLZL 3HG4A 1EX0A 2AFNA 4JHAL 1DE4A 3GXMA 4M5ZL 4LBAA 2Z9TA 3TBTA 4CSPA 2CNYA 4MCNA 1RHHB 3HHMA 4XZUA 3BUIA 3PAYA 4QRBA 1A2YB 2OMVA 3QJZA 2YJLA 2I9LB 3IDYB 4XO4A 4NIYE 4YDVA 1OCWH 1J9RA 3LPGA 3IPBA 4U05A 4XOEA 3F7YB 2YD8A 4KKBD 1XMWA 3QPQC 4L4TB 5IUSA 4OLXH 4HWBL 3VU2A 4AE1A 1R34A 2UY7A 5IFHH 4GG6A 5B3SB 4HPYH 3K4ZA 1P2CA 3OX8A 2J1WA 2VN6A 2DMGA 5T5FA 1KJMA 1C08A 3GZKA 2LU7A 4MDJB 4PW3A 4JFSA 1G7JB 1H9VA 2H0FA 4F24A 2Z8VC 2J5WA 2W0LA 2MCPL 2XRAH 3VFTA 4XMLL 5GZOA 3HZKA 3BKJH 4LCUB 1EGJL 1VDGA 1TSRA 3ELAT 3P4OA 4KHTL 2H9GA 1AJ7L 3BPNB 3TT1H 1W91A 2ZYHA 3RWDA 2CJ3A 4FLQA 1ECYA 1ZV5A 4I85A 4ABUA 2HT2C 3RVXC 5FCSH 1G7HA 1WFJA 2P8LA 2CDFB 1T5XA 3DIVA 5F0PB 3QUYB 1JRHI 2FUQA 4JNXA 4FFTA 2BRRL 5TGBA 1NIAA 5IBUG 4RLDA 3AREC 1YEKL 2ICCA 3F7VA 1E9OB 2W1NA 5I6LA 3FSWA 4J4PC 5EOTB 3WHE1 1P7QD 1TITA 4JPQA 4GP8B 5F1IB 2GSMB 5FM5M 4RMSA 4KQ4H 4ZO7A 3TEUA 4LKCB 1YY9D 2MTAA 2XWXA 5D7SL 4CN1A 4E0RA 1A65A 4X6BB 5IWLA 3M86A 5SX5H 5D1ZI 1JZIA 2WLIA 3NJKA 3TO2A 1UB5B 2X10A 3ARBB 4H88L 3KPPB 5CS7A 2JKWA 1OGAD 3C6LA 1MRCL 2P44B 2YQ3A 3K1KC 1IAKA 2V2TB 4DW2L 2V9QA 3EBGA 4NOFA 4UIKL 1HJCA 2Y7QB 1A1OA 4X5QA 2A74A 2FSEB 2J2ZB 4Y19A 2Y5TB 2F5AL 2WCPA 4KMTL 1D3CA 4XNAA 4G82A 4FHJA 1KGWA 3QORD 1YUKB 1LO0L 1BQKA 2XWTA 4QXTA 4LL1A 2D9CA 2ZSWA 2CM5A 3VSVA 1EWHA 1FVEA 3K2IA 1UXWA 1MW3A 2WOBA 4M3KB 1WD8A 5CEYB 3UZVA 3J8F7 2DQUH 4JRLA 4WJG3 1UFGA 4RFNB 4NZDA 3T2LA 3G08B 2NR6D 3ULVC 1VKXB 5CEZD 1U91A 4BUGA 3T08A 3UAFA 2YD0A 1J12A 2QZQA 4HEPG 4PHZA 4JM2B 5AW5B 1OAKL 4O2FA 1GC1C 1PW3A 4PCSA 1KF9B 4DKFL 1RSYA 2BNRB 1H8NA 2UWEA 3N42F 4WZ9A 4WSJA 4A37A 1GL4B 1Y1UA 5BUPA 1XAKA 3BT2L 5DRXB 4M03A 4Y16D 5DFAA 4L8CB 4ONFL 4ZO8A 3LB6D 1Z3GL 3N42B 3TWCH 1H3PL 1AANA 5JUEL 4UZGA 1LO3L 4AK1A 1JGIA 2OMXB 1E8YA 5DEGB 4E42A 3ET9F 1F4HA 5GGVH 1QRKA 2XVKA 4XCEA 4UT9A 1RZ8B 5IFJA 5BPPA 3GBNH 3BUTA 2SEBA 3GUTB 2B59B 2F6AA 5KJRH 2VDMH 3MCLL 4HDIB 1EEZA 1TEFA 1MCWW 4QUOA 2MKLC 5JXAH 1BVKA 1NFKA 1XF3A 5AOJA 4NAMA 2ZKHL 5BZWA 3NCYP 5ID1B 3ETSA 3UC2A 3DMMA 1N18A 5E94B 1QSFE 5FGBC 2Q7YA 1R3IL 3JWNE 3VFNB 4EMZA 4B27A 2O6DA 3OKEA 2OYMA 3UACA 5EEUA 1NWOA 4ERSH 2NYZA 3D1MC 4W9FC 3TH3T 1AZVA 2A6IB 4P23A 5E03A 4JLRA 2VMFA 3TM6A 1CZ8H 1U21A 4Z3IA 5FGCB 1PZCA 2XTJE 2I7OA 1P7QB 1QRNE 2IH1A 3UJIL 5BZXA 1UG9A 5G5DB 3MRRA 1XSKA 1NM9A 4G6JH 1ZT7B 1TUPA 4TSCL 4K15A 1VCAA 1Z7JA 2W0PA 3POHA 1SUHA 4RRPA 4BSVA 4Y1AA 1EHNA 2WIMA 3ZT5A 5IHHA 3VWJB 2OI9C 4IIZA 4PUBH 3FQTB 4ZTOL 3V0JA 1ZAGA 5ITBH 3EYFA 3R19A 1IC0A 4L1BA 1MCNA 1CDGA 2ZE0A 2ZUSA 3OV6A 5IB1A 4LLMA 2O5YH 4B5EA 3A0OA 1C5DB 1ZT1B 1FYTA 1P6AB 1XF4B 2CO4A 4FQCL 1JJUA 2QVFB 1H0DB 4JFXB 4UQ9A 1YNTF 5CJOH 3RL2B 2AEIT 1RJYA 1TIUA 4XWGL 1A6ZA 3VTMA 2BNUA 4I18C 1YNTB 3KJ4C 1P9MC 1ID2A 4GQRA 5E5RB 4AKOA 3D85D 2CPUA 3LAFA 3MJ7A 5HI3D 2IANE 2CJSA 2D03H 4LLYA 5DRZB 1KCWA 1U2YA 2X7LA 1PG7H 2MQ3A 3FTVA 3K3QA 4GXUN 3CFCL 3JTSA 3ARGA 1FFPB 2MCMA 1KJ3L 1AXTH 4XN4A 1DEEA 5LXVA 3BSZA 4PS4L 1W0VA 2Y9RT 1M42A 5BUAA 4DEUA 4U2YA 2VR7A 4P46B 3O41B 3ZKNC 4L1DA 4LSRL 4ZOBA 1YEEH 2J8UE 3SCMA 2C4XA 4IBYA 3WUWB 1GGCH 5K9QI 1SBSH 5ALCL 4C83A 2WUBL 5JQ6L 4UM9A 2VM4A 1DQQB 2C3VB 1FG9C 2JCCF 3QQNA 5ACMA 5I1LA 4KJQC 1TZHB 3A4FA 3MYJB 4GRWF 4K94H 4PG2C 4XNUH 2EXYC 4MJIA 3H2QA 5C0FA 3D4YA 2JCCB 1OTSC 3J2PA 4D2NA 5EIIA 1J5HA 3L6FB 1VZGA 3ZUCA 3DNKA 4JY4B 5BCAA 5KYUA 4KRMB 4UINH 1QO3B 4LLUB 4TQ8A 3U2JA 5D96C 5IUCA 2N0KA 3L48A 3F7PC 3WAKA 3JQOB 1UYWH 3VFRB 4ABWA 2XICA 1FLTX 1TT6A 4F8TA 1KC5H 3OVUB 3S8FB 3R4DA 3MGTB 3L81A 4FG4A 4DFIA 2X1WL 1QLRB 3NIDF 3ZQWA 1FZOA 1RSFA 2YK1H 1RIUL 4AW7A 5TF1H 2DYRB 2HFFA 4OD3H 5DD3L 2I69A 2BS9A 3ZIMA 3MNWB 4FQ1L 2ITCB 4I0PA 4B0MB 2GKIA 4P2QE 2VO8A 5D55A 5AVWB 1WBYB 1MFVA 2MJWA 5IJCC 2TSBA 4JB9L 3FXIC 1QEWB 2NLJB 3NJGA 1EGJA 3VU1A 2ZPKH 5DZPA 2O5NA 1IO4C 2J71A 4ZAKA 3B2DC 3DVGB 3ILEA 1SYSA 2O6EA 2NTFA 1JDDA 4X6CE 1KENH 1JV2A 3AS2A 3GDCA 4L4VE 4CDHA 1T2JA 3HC2A 2X4QB 4R7XA 1BM3L 1RIHL 5D93B 2QR0A 1MRDH 3KXFE 4JMXA 2HTLC 4AQ1C 4WHDA 3LRGA 1S7XA 3FMGL 1UUNA 3HI6H 2XVGA 4JO2H 5EF2A 3HC4L 4EDWL 4N1CA 1CD8A 5T8IA 2ESVD 1FNLA 1J8KA 4ONGH 3N1FC 4ZOCA 1P4BH 2DLHA 2OJEB 2VR8A 3R7RA 1XGPB 2I24N 5E00B 1J5DA 1GS8A 3CFBA 4LSTL 4UU9A 3H8NA 2Y23A 4PG2A 2RA1A 1WFNA 3A6BH 5AUMB 2VJ0A 2ZUQC 4KKCD 2Q8AL 4MMZA 5B3NA 3KDMB 4KNQA 1QUNA 5EU3B 1UD4A 2C1PB 3WY2A 4LHUD 4N85A 2R4SH 1X5XA 1L3WA 4Z3GA 5D4JA 4Y4HD 4IJ3B 4GG6E 4MFHA 2K4WA 3BUPA 4Z0BH 3T0EC 4YSRA 4X8JB 3IF1A 1XV8A 5DJ2B 3RPBA 3RNQA 4IK6A 2AJSL 2F74A 3CZNA 3IFOB 4LGRB 3VX0A 3CHRA 1UT1A 3PABA 3GB7A 3A5VA 4WJ5B 1FZKB 1KIRA 5KYYB 3KZ8A 4OM0L 1VEPA 3T2NH 2JI1A 1CTMA 2G9KA 3WENA 1HINH 4XC3H 2Q2EB 4BK5C 3D0LB 4NUJB 5HYQA 4TNEA 4Y8AA 2R27A 3VB8A 4GYBA 4ZMTA 4G80B 3E8VA 3TYGL 2XN9A 3V7AE 1HI6B 3FQWA 4J6IA 2YGOA 3D8MA 1NGQL 1NLDH 1JWUA 2Z7WA 4TSBL 2DQIL 1OALA 1G5GA 4PEEA 3CBRA 5CP3H 1I8IA 1ORQB 1XBRA 2AABH 1D5IL 2I26N 1LK3H 4XR8C 3Q9QA 3HS0B 2WJ7A 2BS71 4HJTA 3ABZA 4NI3A 5AQ0A 5GS2H 3GRWL 2VB5A 2L7QA 1TTUA 2LTQC 1D5XA 3H9HA 3ESMA 5I8EA 5KJ4A 1ED3B 3HAEH 3H9YA 1ZSHA 1JGLL 3ULVH 2VLKD 3QS2A 1F3JB 1BIHA 4WUKH 5KSVA 2YBRA 2ICWI 4GKSB 1S7UA 2LV4A 3GBEA 5DWPA 5E2JA 3QJXA 2A0LD 5ESQA 3U6XA 3L4CA 2A9AA 4A2GA 2X2UA 4MCMA 1USZA 3GSUA 4KJPD 1Z9OA 2WQXA 2Y0SA 3D25B 3VXOA 2VDNB 3MACL 1YN7A 2BCKB 4ES9A 2OK0H 3N9GL 4ABQA 2EEXA 3QYNA 3LSOB 4Q6YA 4Y19E 3ESUF 3TJPA 3P2TA 4BZ1A 1FVDB 3NN8B 3LQAL 1T03L 3Q1SH 4AM0A 2HRHA 2HWZL 4HD9A 5FGRA 5D7IB 3QIUA 4YUEH 2H2SC 4PTTA 4HK3N 3DK0A 1MKFA 3LN4B 1BQHG 2V8LA 3NABH 3PWUB 5DEJA 5DHDA 2CDGA 5F96H 3R8BB 5F3BA 4R7DB 4PJ6A 4HBQA 2VDPL 3P1VA 3EH3B 1CICA 4KBPA 3NSXA 4PCYA 4Z95H 3DROB 3I9IA 3WFZA 3QFDB 1MAKA 1IGML 3X14A 1WWWX 1KELH 2YEZB 3FQRB 2AQRA 2K45A 4FL4C 5DJAA 5F7EH 3VI3F 3WI9A 2UWEE 1RUAH 3SKJL 4JJ5B 1IFGA 1XVSA 3QUML 5IOPA 2ZOLA 4JY6A 1GKEA 4ATWA 1A5FL 4GLRI 4IIQA 5C0EB 2X4TA 3I6KA 5G4OA 3ZDXE 4ZMQA 4MAUL 2UXGA 2WUCH 5LDSA 5IW1B 4NQXB 1ROCA 3DHPA 3QJSB 2PYEA 2YSTA 5TE6H 1FH5H 1RUQL 3ARFD 3QWRA 3EUDA 3DLQR 4HKBA 2KZWA 4JFPB 1ZA6A 4QT5A 1AQHA 4UBDC 2YXMA 1WRFA 1XO8A 4XP1L 4ANXA 2DD8L 2ZNWA 3VTAA 2KZKA 5FX3A 4PRID 2GY5A 2O4EA 3ORJA 4NUGH 3W2DL 5CCHE 4NFDA 2OYPA 3H53A 3GSVA 2ZKMX 3O2VH 1E40A 3L1EA 3SODB 4WWOA 3MBEC 5CUSH 3UYRL 1OGTB 2YGVA 3GO1H 3QCVL 5BNXD 3LZFH 3MBWB 3PIQB 1GIGH 3HS8A 4YX2H 3QUHA 4R2GC 1KB5H 3QHZL 1BFSA 2EDDA 4XBPB 3IKCA 4J3SA 2GTZA 4YAQB 1AGDB 4R8WH 1A1MA 5FYKL 3PWJB 1HK6A 2QV4A 3MV11 5EBLB 2PTTB 1PLCA 4AX3A 3I50L 5JXEC 1WP6A 4Y1AE 1VZHA 2OQJA 4W9HC 2BOCA 4XX1G 5HI4D 5HI5D 3S4SG 2V2WB 1N59B 1MQ8A 3D18A 4KROD 3U9PL 4B97A 1BX2A 4PJFA 4PLOB 2WBJA 1FYTE 3GLZA 3B7SA 1T20B 1HXKA 2D3JA 3CSYA 1UASA 1H9DA 3LRHA 1A3QA 4X7DC 3VVVA 4YNYB 3ESOA 3LXUX 4LPWA 4MA1B 2R51A 3ARDA 3LX9A 4NQVA 4NQSA 3SKMA 3UTSA 1KXTA 4DN3H 2JLLA 5C0BA 4A7GA 4JRWA 1Y6KR 3PP4H 3L13A 2HMID 3A6CH 1EVTC 2AXFA 2P8PA 3CVHL 4XNDA 4OI9A 1EANA 4HWZA 4DVBB 1WVZA 3AG2B 3QR0A 3C5XA 5IR1B 3UZQB 3JV0A 2NY7H 4H25A 2WKOA 3T77A 1S8DA 3MOAL 5E8PA 3IJYA 2EDYA 3F01A 1DVXA 2QEJA 2WVUA 3FQUA 2WTPA 1NUGA 3VJ6B 5PCYA 2IAAC 2XG4B 1DFBL 4HQQH 3U30C 4BFEA 3G04B 5FA4A 3ZJAA 1MVUA 1T04B 2W65B 1NUNB 3LRMA 4Y5XB 5IHLB 5IROD 3KBFA 3QQ4A 4XP5L 1NGYA 1HXYA 4MJIE 5KSBF 3GSXB 4XVUD 1SXSA 4EN3A 1S78D 2X4SB 1OZUA 4FXGB 5C9KA 2W81C 3MJ9A 2CR3A 5AG8A 3CLFH 5AYTA 1OPGL 1MLCB 3ARFB 2H32B 3RDJA 3FCTA 1ZD6A 1J0JA 3K8MA 4CL7A 2ICEC 5L2JA 3VXPA 3UP6A 5KSAD 5AYUL 1MW0A 3ECBB 2QELA 1IKFL 5GRVK 3ZKQD 4F7PB 2GTWB 4ZUUB 3RGBA 4QPEA 3AUVA 3I85A 1P4LB 4MQXD 1A6TB 1PKOA 3L5JA 5C97A 3AVEA 3ZRSA 1UGNA 1AZUA 4ZSOA 1UENA 4WFEE 3KGSA 4LLDA 2DTSA 3IMRA 3DO7B 4XAWH 3ZHFA 2YAOA 1YZZA 5CNHA 3OMIB 1HH9A 1X5JA 4R4FH 5DQJB 2X4NA 5IMLB 2YD1A 4JG0L 1UM4L 2BOBB 4YSSA 4NQQA 1DBAL 5CP7B 1X44A 1JSYA 4MA7H 5KVEL 1MUJB 1ZY9A 4BE6A 1JPSL 1YYML 4HZLA 1E2VA 2F53A 3RGVB 1NGZA 4GQZA 2PCYA 1DBBL 4KROB 1NOAA 3HZYA 4Z1PA 2HJFA 1P5UC 3QUXB 2NUPA 1YEIL 3U6RB 1ZHKA 1NQBA 2VDOH 4J3XA 4WTZA 2ARJB 1D9KC 3L45A 4X9HA 5FYJH 4OD2B 1AD9A 2WN3A 4DQOH 1AQDA 1KCVL 4EKXA 4LCCC 4LSVH 1QR1B 4L5FL 3DJ9A 4LSPL 4YL9A 4DCQB 3TEXA 3NRPA 5C09D 1CE6B 1E4WL 4IGBA 4CRPA 1NEZG 5EO1B 4OGXH 3MO1A 5IEKB 3U7YL 5DK2B 3TYFB 4NO2A 2EVGA 2YKLL 3RX7A 5B4MC 3TNMB 3W0WA 3ARUA 1DSYA 4HIXL 3OLEA 4HIQA 1N0LB 4FG2A 3NA9L 2UVEA 2OZNA 4KK5C 1IQWH 3JUZA 3WGUB 5J7CC 3F6IA 1J5OL 3QH3A 2VDPB 1OLLA 4FFZL 3K8LA 3U0PA 3QWOA 4LCIL 1SMOA 2E7DA 1U8KA 4NIKB 4YDIH 2XN9E 5LVEA 4GAGH 3MLVH 5HYSA 1L7IL 5LAXA 3MTXA 3OG4B 1NC2D 1WH0A 2RR3A 1XCQB 1S3KH 4M7KH 3WFEL 3F00A 3MOQA 3OB0K 2NY6C 3UMNA 2LLLA 1MVFA 4J8QA 1A6WH 5E9AA 3CDYA 5C0AD 2ATPB 3L7FB 3RNKA 3MQIA 2WXMA 5EBWA 1DQDH 5JDSB 2WLNA 3BZ4B 4YC2B 2KUTA 4FQLL 4RGND 3RY6C 2BZ7A 2KERA 3LZPA 2V5SA 4PBDA 1TTFA 4P3CH 3RFZB 2X2HA 2JKIS 3KPLB 1O7DC 3QI9C 4JZOB 5D7JD 3SE3A 1SJXA 2G0LA 3U36B 3PDOB 2OCCB 2Z4QB 4MAYC 3OMZA 4Z8FH 1B9ZA 1N7ML 2R29L 3S3DB 5J89A 4YO0A 5EV7A 1GZQB 4PV9A 3PWPD 2VSKB 3MRMA 1A6VH 4G42B 1MHEB 2CO7B 1AYRA 3B6SB 3US0A 2HX8A 1OV8A 3KPRB 2OSLB 3G5ZA 3RZWA 2CA4A 3MREB 2IBBA 3Q5OA 3EYOA 2QSCH 3NCBB 2IDUA 1IL1A 4YHIB 1ULVA 3SGDI 1FO0A 2EH7H 1INEH 1OCWL 4KXDA 1CFSA 3JT0A 1REIA 1WGVA 3KPSA 3RWFA 4OLXL 3ZR6A 4JKWA 5IFHL 5KYWA 2MQ0A 4HPYL 5LCVA 3FHAA 4U4BA 3EBAA 5D1QA 4P9HC 4L0YA 2FEJA 5I0DA 4IBTA 4A38A 2OP4H 4UF7C 4GG8A 5TF0A 1QD0A 3T9WA 3QYCA 1IV8A 2CK0L 1FCGA 2JTDA 2XRAL 3I9GH 4LOEA 3BKJL 1KYFA 3V4VA 2CDEA 5A2AA 1GGUA 3QHTC 4X5PA 4CDGC 3F65A 4W9EC 4QJ5B 2DWSA 3U7WH 1SBBA 3VFUB 4DEWA 5IVZB 4P05A 3TT1L 1PZ2A 2BVOB 5IZ7A 1LO2H 1NCGA 2QT6A 2I85A 2ZCZA 4ANKA 3BEWA 3CVHA 4F33B 2XVBA 2YPLA 5BVPH 2PYEE 1N0XH 1MJJA 3ARWA 3NYKA 2Y5QA 3FK3A 4XWOD 3T4AC 1MFBH 1OAJA 3SKNB 5JMRA 3GMQA 3VCLA 1I8KB 3LIZA 1XR8B 3FFCA 3RY6A 4AQAB 4BFNA 3VQMA 1BZDA 4OZHA 4HS3A 1DYZA 3ZRFC 4E9TA 5GRJL 1HNYA 3EJRA 2ENPA 1TCMA 5BZDB 4LVHC 2ADYA 2CG9X 5TDPA 5C0IA 2XFGB 2ATKA 4UWQB 5IVNA 4DWHA 3EZ8A 5KSUB 5DMJB 4YOKA 2Z31C 4KQ4L 1EDQA 3UAJC 1IGTA 3CIQA 3GMRB 1FIGH 2W9EH 3D0VB 1W0YT 2XDHA 1JXDA 2VZVA 2XUWA 3VGHA 1S7TB 3RAJH 2W88A 2ZSVB 3DRTA 4LRNH 3WLBA 5FPIA 1A9EA 1TTRA 3AMLA 3DUSB 4APQB 3LHAA 4TTDD 2BJMH 2Y6TE 3F5WA 5D7JB 3TN0A 2JB6A 1ZA3A 4XNQB 4YSEA 1M7DB 3MGAA 5E8NA 3DX8B 3GXTA 5HVHC 4HA1A 4GRMA 4C4BA 3HB3D 3CN1A 3PWPB 1YDPB 3DO4A 3SO3B 4DJMA 5ID0A 2FSDA 5H2BA 4PJFE 2VDRH 3HPLB 4Z7VA 2FJGB 3QIWB 1E9QA 3QZBA 5DHVH 1JF5A 1D5BB 2OTPA 3BC9A 3QNYB 5HHVH 2DQUL 1ETA1 3T8XB 4H0HB 3UTSE 5E56A 4JDVB 4NQCA 5C0BE 2BCMA 4M61A 4HMEA 2IFFH 5D2NA 2E7LA 1IM9A 1CDIA 4TNWF 4PPTA 3BLPX 4JFZH 4RX4A 3MV9A 4MDIB 1EPFA 1GVIA 3IM1A 3PPEA 3K91A 1RLBA 1ZJBA 5TQ2H 1ETB1 5TD4A 5AEAA 3TWCL 1F18A 3CX5K 1IUZA 4F7TB 1H3GA 1IAOB 3OAZK 3U9UB 5I8CA 4LCYA 1OTUD 3A4DA 3BP6A 5C3LD 3DYMA 1HXMA 5D1ZC 3FH5A 4O02A 1F6FB 4NEHB 3P4LA 3FS9A 4KO9A 2J4WH 3GBNL 4M3HA 5IB4A 3KYMA 5KJRL 4U3SB 2VDML 4XXCC 3U46B 1IEBA 4QXWA 5JXAL 1KGCE 1GMIA 4LQ1A 5C0GA 3RWCA 1NMAH 3TO4A 1U3HC 4MS6A 1UWFA 3KL5A 4YJZL 4ZQKA 3ARRA 5FAAA 1YLBB 1K85A 1KY6A 4U7SA 3CDCA 5I19H 2DQFA 2L7JA 4AIEA 1XGTA 4ERSL 4HKZB 1KIUA 4MAZA 2EICA 1JWSB 4AI7A 1FL5B 2C7UB 4WJKB 5C6WH 1E27B 2D9QB 1CZ8L 1HN1A 1XH2A 3EGXA 4ZUTB 3AS1A 2IH9A 1N12A 3BDXA 5LGJA 1EEYA 2XTJD 5ANHA 5TFSH 1QRND 4G6JL 1SOKA 3PWNB 3O3DB 3U4BH 2J55A 3CXFA 3EDDA 4ZSOE 2YD6A 2EXWC 2ZG1A 3MJGX 2WVVB 2E27H 3QNZA 4L9DA 4PUBL 2VZTA 4GBXA 4ODUA 3T4YB 5ITBL 2GJZA 1GCYA 4OJDH 4Z7NB 5FFGA 3JWOC 4AUJA 2O5YL 1PX3A 2QGBA 1I7TB 3CUPA 1C16B 4KK8D 3X11B 5CJOL 1AIZA 2QZ5A 3ZHDA 4UM8A 3PNRB 3WS6A 1ASOA 5E8DH 3BJLA 3PE9A 4JHBA 2D8KA 5CSZA 1Z9MA 2FJHA 3UCQA 1ZGLP 2F53E 2YAMA 2NY3B 3HB3B 1X9QA 2H4EA 4EEEA 2D03L 4EIGB 4QDGA 1PG7L 2O1AA 2IAND 2EYRA 3HE7A 4JY5H 2E7CA 1JI1A 3KH4A 1X5LA 4UZSA 5HHOA 5HDWA 1DQIA 4HIJA 4DERA 1AXTL 3L54A 1J1PH 5HDLA 2KLRA 2JSFA 3G9AB 4Y9CA 4JANB 4E5XB 4TUKH 2WAHA 5HVGB 1YEEL 3WFDH 1AQKH 5C0JB 1GGCL 3QB7C 4LSQH 2X1OA 1YMHB 1JHLH 1GAFH 3S5LB 1PZ5B 4OSUH 4EUPH 4CVWA 5I28A 4K94L 2JQAA 4XNUL 1I9RH 5EEWA 2FWLB 5E4IA 5A2JH 4O51B 1YRKA 5BXFA 2NYKA 1VJSA 3W0WE 5IREA 1P5VA 1IZJA 4TVPH 4BKTC 4YLCA 3HZMA 3ZDYE 1F4WH 1PJ9A 3SGEH 4UINL 2VAAB 4MX7B 4O00A 1N5AB 3DGGA 5IHZB 1JE6A 1SJEA 2A4EA 1WQVT 3HJ0A 3E6HA 3IS0X 4P8QA 3V6OC 1JGVH 3P4NB 1UYWL 5FF6B 3UEQA 5DA4A 4P48A 4KNUA 4J3UA 3J07A 4JPWH 1QLEH 4GFTB 3VFOA 5CD5C 3MLSH 1ASQA 1KC5L 1QHPA 4XMPH 5DS8A 1JGUH 3X1GA 3V9FA 5AD0A 4N9GA 4ZDHB 4YDMA 2ZJSH 2A9CA 2YK1L 1BYNA 4BCXA 5TF1L 4OD3L 1TQSA 3OHXC 2YOCA 2CIKA 5BQDA 2OXGA 3L5WA 4YPJA 1DSFH 5DC4B 3ZKXC 5F6IB 1P1ZB 4P2QD 3KBPA 3DOHA 3KL3A 2COQA 2ZPKL 1IVLA 2UXFA 5H4YA 5HJ3A 5IHWA 2XTJB 2NX5D 1QRNB 2XXCB 2FLBT 4PGEA 2WINA 2Y7LA 1ZIAA 1G7MA 3CFKA 2A73A 4P9HH 4Q56A 1B2WH 3FU3A 4XH2A 3DX7B 1KENL 1KBWA 3FH7A 4NN6C 4NS0A 3ZTJG 3BWUF 1CYXA 1K8IA 4L4VD 1T83C 4RQQA 3ZTCC 5K9KB 1MRDL 5E2VH 4BH7A 1B88A 3MRPA 4TYUA 3KXFD 4TN9A 3HI6L 3MRJB 4PYHA 1O6SB 4JO2L 1A8ZA 2H2PC 3ZKMC 2YD3A 3S3SA 5HGAB 3SDDB 1U41A 4M29A 4ONGL 3GSNA 5B39G 1P4BL 3DBXA 3EJUA 1HFUA 4Q58C 4YR6B 4X98B 5DVPA 3MR9B 5I74B 4HFUL 1ASPA 4KFZC 3A6BL 3B43A 1W8NA 2IANB 2C26A 2XWDA 3B2UC 4TUOA 1Q1JH 2BP0A 1UWYA 2FO4B 4LVEA 4ZUVB 2EADA 1BFTA 4FCHA 1QZNA 2PYFA 2R4SL 3KPSE 1H8SA 4WI0A 5IB5B 1LK2A 2MCAA 4FQHB 3U4EA 2J8UF 3L95A 4PS3A 1ZVYA 2X38A 3HCVA 4PBWD 4Z0BL 5D1QE 5A3IC 4WKXA 3T1WA 1HCVA 3BXNA 3KE0A 1FV1B 3OLGA 4J7RA 3VXUE 5BOJA 2VN7A 1MFCH 4QGYA 4XCNA 4ZUWA 3WNPA 1DBJH 3CVBA 3MRIB 1OB1A 5DZAA 3WIAA 1HCZA 4LOFA 3T2NL 4Z7QE 3NJHA 4AMKL 2Z91A 4P5KA 5GZOD 1BVNP 5C7XH 4KY2A 2OSXA 1MZZA 1NEUA 4BFRA 1IZKA 1T4KB 1HU8A 3K2KA 3LYRA 4BWUA 2AKRA 3AABA 3PUCA 4JZJC 1NLDL 1DJZA 2AAAA 2DWDB 2BIQA 1U36A 2YPLE 3QK0A 2AABL 5LN8A 3QEQD 2ZP9A 1LK3L 3E1ZA 5LO7A 3MLTB 3FPXA 2WKLA 1QNZH 3DVNA 3V5KB 2G5BB 1O9VA 3QJTB 5A7BA 3T5WA 1C5BH 4LLQB 4F7CB 1JF6A 3VUAA 1AHKA 3CC5A 3FFCE 3FOMA 3M17B 4OZHE 3P11H 4EVNA 2ENQA 4KTDH 3B3IA 1CJYA 2MNJB 3BH9B 1CGXA 1ES0A 1QKZH 3WIFA 1E9PB 4MWFB 3ULVL 1JRHH 4IRJD 4WUKL 2P43B 2OL3A 5KVFE 2IPKB 5KJ7E 3BGAA 3VG9B 1XFPA 3RVUC 4X4YA 2NX5B 4R0LC 4P4KB 3LNGA 4X6CF 3B7RL 5DO2D 3WE6B 1YO4A 4YQXH 4NGHH 2K1MA 3NJVA 4FG0A 2B3RA 3X12B 4R5VA 1TQUA 3WJMB 4RA3A 5JHDA 3C6LD 4L4VB 3IU3B 1PIGA 4GXUM 4PRNB 4DGIH 2QFRA 1NIEA 1NH6A 4FYQA 2EDQA 4H44C 4X0KB 4ZS7H 4HXBH 4N3UA 4Y19D 5ILTH 2MMXA 5LUMA 4O4YH 3Q1SL 2Y1YA 3BP7A 3DSNA 3UPRB 1S5IH 3TV3H 5CU9A 1IAMA 1KTRL 2ADJA 1XR9A 5F7YC 4LRIA 5B38A 4YUEL 4Z7VE 1XT5A 2P28B 3NABL 4LPCA 1KJ2A 2XX0A 4OLVH 1NKRA 5F96L 1QW9A 5I16A 1NCIA 5MEQA 12E8H 5JLZA 3RP1A 3O4OB 4XZUB 1VHPA 4NDMA 3VD4A 4GEJA 4NQCE 4Z95L 3UCRA 4ETQB 1A64A 4X8CA 5D2NE 4GG6F 1KELL 1R5WB 1G9MC 1X5KA 1XD1A 2OMYB 4IDLA 4BZ2H 1BMWA 4KGJA 3MV9E 4FD0A 5F7EL 2P45B 2VQ4A 4HCRA 2EIKB 2PCXA 2UY7B 4YHOH 5F9OH 1RUAL 4GG6B 3J7HA 3AY2A 5J6SA 1FRGH 3RKPA 3JV6A 3OX8B 4GT0A 1FHGA 2WIIA 1FNEB 3QZWG 2R1YA 2VAJA 1WCBB 4UCFA 1CD0A 1Q0XH 3QSKB 3TA3C 2HT2D 2JQZA 1C08B 3DX9A 4DZBA 3HLAA 1MOEA 4QAWA 2WUCL 4GEIA 2JLPA 2HP4A 5MEPA 3O45A 1ZHLA 5TE6L 1FH5L 2A6KA 5PAZA 4XMXA 3VFTB 4XMUA 3JWOH 1ZRUA 1TMQA 7PAZA 3IDMA 4Z7OE 3FT2A 3R06A 3QGVA 4IHOA 4ABVA 1OAZH 2OXHB 1I3GH 5DHXB 5EBGA 4L5FE 1LEKA 2AQPA 2H9GB 1AGCB 4XRCA 1A4AA 4NUGL 4WWKC 5ABZA 1OB0A 3VD3A 3O2VL 1GR7A 3P2BA 3QEQB 3DMMD 1WAAA 4FYTA 3IN2A 2P8LB 3F12B 4MXVF 1C5CH 2N1KA 5CUSL 2BP8A 1QTPA 3GO1L 2F54A 1OE1A 3TPUA 3ZE0F 3EDJA 4B96A 3LZFL 4HJ0D 1GIGL 2EE3A 3BDBA 4YX2L 3SDCC 4F37F 2XXFA 3Q2CA 4P23D 1KB5L 2BVQB 2IV8A 3ZE0B 2IG2H 4C56A 2VSDA 4R8WL 4IRJB 2ZX8A 3I75B 1KTLB 4WKZA 2XSKA 3L3KA 4GKZA 3W57A 5I1JH 4OF5A 3BKYH 3LEYH 3B7YA 2OMZA 2WKGA 1E2WA 5KN5A 4X7TA 1F1DA 2A6DB 5DLLA 3RB5A 5C71A 5I24A 1QG3A 1GY2A 3QWNA 2VXSH 3O3BB 2KLSA 1JK9A 1LJMA 1ONQB 3OKDA 4ZFQA 4QKXB 3SE6A 4S0SD 1HOCA 4ENED 4P3DA 1A1OB 5K9OB 4DN3L 1U92B 4FADA 4R7VA 3PP4L 5GISH 2NY1D 1RZQA 3MC0A 5D6CB 4XXWC 2HLAB 3A6CL 4NNYB 4QXTB 2ZSWB 5GGSY 2IAMC 3QUZC 1FZMA 1QSEA 1UXWB 5HHOE 2NY7L 4Y1SA 1BLNA 4YBLC 1T0OA 2D7PA 2Y24A 1J9TA 1PF3A 3ARGD 3UZVB 4C8XA 3UBXI 3LKPB 3PJLA 1U91B 3RVTD 2VZUA 4HQQL 1T1WA 2UWEF 3PCYA 3IDJA 3OBAA 2FECL 5CXPA 5GSRB 1R4XA 3DHUA 3D3VA 5DMIH 3X13B 4UM9D 3CNKA 2P8MB 6PAZA 1K6QH 1YY8A 3QEHB 2Y72A 1DHKA 2PTUA 4MJID 4PP2B 3AQXA 2CUMA 1P4UA 2DH3A 4G1MA 3GRGA 3T71A 1GZPA 4GMSH 4HGMA 2EDHA 3H42H 3SE4A 3CLFL 4MZIA 4DPRA 3D48R 4HKJB 2H26B 1YNLH 3O3AA 3LRSA 3AREB 4R26H 4TXVB 4XCEB 4ZX6A 3V7MA 3ZK0A 1OK0A 5IFJB 3PP3H 4BFJA 3NACH 4WI7A 3O6FC 5GGQH 1BZOA 5FIEA 4TULH 4U3HA 4HHGA 4L1TA 5BZWB 1BBDH 3OB0H 4XPFH 1P6WA 1RUPH 1Z0NA 3TP4A 1ZXQA 5FKPA 2IVFC 2ZWLT 4L8SA 4PGCA 5DYFA 1VIWA 2Q7YB 4OF8A 4OUOA 3OAWA 2Y3NA 4D8PA 4XAWL 4WFED 2J1ZA 2MPVA 5I76A 4A1RA 4R4FL 2NT0A 4I0PD 1W9XA 3BPLC 2PO6C 1R3LB 1UOWA 2AMGA 2XV2A 4P23B 3EFDH 3QDMB 4LGPB 4U6YA 2JKJA 1KULA 3FFOA 5DQ9B 5EDSA 3OKMA 4MA7L 4ECNA 2MIZA 3HI5H 3CZLA 3LKRA 3IJHA 5BO0D 3GEFA 3LD8C 3BEVB 2Y25A 3I3EA 1CCZA 5ALBH 3Q13A 5K9JL 3WYRA 3N1PC 3UTTA 4PLJC 3FCGA 5A1AA 2YZ1A 3IMUA 3FQXA 4NOBA 4OJAA 1U2HA 5DMGD 4DQOL 1QPPA 1WIPA 1ACXA 5DS2A 3TZVC 4JX0A 3HAEA 4LSVL 5CJXC 4OGQC 2APFA 1R6VA 2ILLA 4YDJB 5EZPA 1ZIBA 4NC0B 5EUKB 3RKDD 4ODVH 3ZE1F 3PDDA 4TRPH 3DBSA 3TVMC 2GFBA 3BZFA 1OTSD 4OGXL 3JTSB 4BXVA 3ARGB 7TAAA 3WL9A 3ZE1B 3SPHA 4U1LA 5BO1H 3MV7A 1ZLDA 4X4XB 5CN2A 1ND0A 4G7QB 3NZ8B 3EO9H 5DUMH 1B3IA 1NCBH 1TVBA 2VLRA 4U2ZA 5J9PB 1HYRC 5CCKH 3HR5A 1IC1A 1IQWL 1OAXH 3FTWA 4RZKA 4CSSA 4UM9B 3LJ3A 5C8JB 3WKNA 3KHQA 1F0LA 3UJTH 3ARXA 4MDRA 4NKQB 1ZTXH 3QQDB 3GMMB 3MJ8A 4TLSA 5CR8A 4TUJB 4R4ND 4UT7H 3G6JA 5KVGH 2BSTB 1ZK5A 4YDIL 3LVEA 3LN9A 3VVWA 3UX9B 1FNSH 1JYNA 2PO6A 3MLVL 4W9KC 3GI8H 4NO5A 1ETZB 4LNRB 4M7KL 1S3KL 1OHQA 1H6UA 2X4OA 5EU6A 5ISZA 5BQ7B 1S4IA 1HH6B 3GXUB 4HS6A 1VB9A 3A67H 1RULH 4PVLA 3VQLA 3OAUH 1RJCA 1A6WL 2W91A 5F9JA 2HH0H 1SEBA 2K0RA 2OI9B 1ID5I 3MNDA 1DQDL 1KBBA 3V52H 2HPOA 1Q9WA 1MNUH 4AVHA 2F5BH 1FZOB 3MRLA 1QQDA 5IQ9B 3T6XA 2DEWX 1JDCA 5CEXB 1OANA 4JDZB 4P3CL 1PD1A 4H4NA 2APXA 3N55A 1WF5A 2CSPA 2VL5B 3SE9H 4DP4X 3US1A 3STLA 3H85A 4L8DA 1G9MH 3TZVA 1F2XK 3DHMA 4RFEB 1IEAA 2N01B 3UOAB 4I18B 4NJAH 4WI9A 2HVJA 1TQTA 3BJ91 3KJ4B 2XTSA 1U95B 2FR4A 4JFHE 4GAYA 3A22A 3G5YA 2GW5A 2NTFB 1A6VL 1CI5A 1CXEA 3B7UX 3WMPA 5JHDE 3GSWB 1NAKH 1SHXA 1F56A 2OS7A 5CKGA 4HPHA 3EH2A 5L8KB 3C6SB 4MA8H 4OF6A 4WVRA 3SQOH 3V0WH 2EP6A 2QR0B 3MX0A 1V3KA 2QSCL 2NUTA 1KB5B 3KLAB 5FOBA 2EH7L 3W39A 3MRFB 1INEL 1FVCB 5DD5H 3JV5A 4LMQE 5I6PA 5I73B 3UG5A 3VYNA 1JNHB 2R2EB 3A21A 3WN5C 5FCUH 3QIUD 5IF0A 2PPAA 2VDQH 5JPMC 2PWEA 3ZMNA 3LEXA 2DB8A 2OP4L 5J57B 4P2RD 3BVXA 4JK0D 2W92A 1KB3A 1CICD 3QQXA 4WU5A 3VFPB 1E3FA 4G7RB 4ODTH 3BO8B 1TVHA 3KVPA 2BWQA 5IK3A 2Q76B 3OAZH 4KX8A 3VTTA 3I9GL 2K4AA 3O3EB 3PFUA 3QC5X 2M2DA 2XXGA 1EDYA 1I9EA 25C8H 5D96B 4N8VG 3U7WL 1UM6H 4WSGA 3IF1B 2WQRA 1UACH 1LO2L 1KMGA 2GSGB 3L17A 4CBPA 5BVPL 4UOW1 5LNEA 4ZZKA 1KIPA 5LAPA 1N0XL 3ZTEA 3IAPA 5F7MC 2BSEA 3X17A 2PYED 1MFBL 1V05A 3ROOA 1KCBA 4R3SA 3QWRD 5HYQB 2V3EA 1CFBA 1IBDA 2BNQB 3CFQA 4ADJA 1EFXB 1F8TH 1PYWB 1UD5A 3C09C 5CLWA 5I1KH 1CG9A 4YHLH 1KCSH 4OBRA 4PJ9A 1NGXB 1U8OA 4K8RD 2VW4A 2BMKA 1KCLA 4QRUA 1LE5A 1S9VB 1WAAE 3WEXA 4NXSA 4GB9A 1FIGL 2F54E 1JGEB 2P46B 2W9EL 3P3TA 1J0YA 4Z78B 4NFBA 3KWTA 2YJQA 3RAJL 3WUZA 1D5XB 3NTCH 4CW1A 4LRNL 3E38A 2BINA 5I8EB 4C56E 4AQ1B 1P4IH 3F6LA 2ZXEB 2BJML 2BIOA 1NICA 4PJHB 5FKAA 4WQOA 4L9LC 1BZ7A 3RDTC 2EC9U 1WC7B 5ESQB 2E9GA 1LXMA 4JR9H 4K7PH 2YD7A 2R1XB 3HMXA 1DFXA 3IJSA 3N0PB 5C2UB 2VDRL 5FW7A 4MZ2A 3C5ZA 3GQFA 3AB0C 4M56A 4IOSA 5EC2A 2ZUQB 1K8DA 1YN7B 1R5VB 5IKCA 5E51A 4OCMC 2BHYA 4WEEA 3U1PA 4WF7A 2YARA 4YIQB 3ARDD 5K39A 1DDHB 3UTSD 5KYXB 1F2QA 3WUWG 4GOSA 5C0BD 4HJUA 2IFFL 1AHWA 4AM0B 5J6GA 1WAEA 4GINA 4JFZL 1JHTB 4MVBC 1TO4A 3D4CA 1QSEE 2VISB 5C07A 5TQ2L 3QZOA 1URLA 1A21A 1NC4D 3QZNA 4P2RB 3AWEA 1J18A 1MCOH 2ZOWA 4NLHA 3KHOA 3Q2LA 3Q5YA 3P54A 4DO5A 4BSWB 1NM4A 2YA0A 3NSJA 3OXSB 2X4UB 4Y2DA 2J4WL 4MJ6B 2VDLH 5DJAB 3INOA 3D3VE 3FU8A 3RJQB 4FMKA 4HGWA 1G5AA 2W9DH 1NMAL 4KV5E 2K78A 1JXKA 5IOPB 1IBBA 4JY6B 1KGCD 1GJIA 5E5UB 4EN3D 2NSQA 2X4TB 3I6KB 3MCG1 5EO9A 5BV7C 2FO1A 2GAZA 5A6IA 3KPNA 1J5CA 3GWJA 3S34H 5I19L 1THCA 5CGTA 5AOKA 4LPXA 1DUYB 4NX0A 2LTQB 3LDBC 1GRWA 5GRUH 3UTOA 4S1RH 4ZT1A 5HGBB 4ZNCD 2HJKB 1ZA6B 3VXRA 2VUYA 3OXRB 4MXWH 1JZFA 1QFWI 3Q3GA 1I1YA 3SY6A 2K3TA 3VRLE 4ZZFA 3TURA 3CBKB 3GGWA 5TFSL 3UL4A 2R23B 4CA4A 3U4BL 2ADGB 4K71C 2XIIA 2BFVH 2E27L 4U1SB 5E99H 4LPVA 5CLXA 1EAOA 3SY0A 2PPEA 1NMCC 4NENB 4UTAH 4ZMWA 2DWEA 4EXPX 5F89B 2DMHA 1E4XI 2F7OA 4KFMA 5IM7B 4Z7UA 3CG8A 3ML8A 4RETB 1CN4A 1SYVB 2MOVA 4K4KA 3BP5A 4H0GA 5E8DL 3OLIA 1OPOA 4D0BB 5EN2B 1LMKA 3L5XL 4NLAA 5DK0A 4PJFF 1TJXA 5I5JA 4HOXA 4UV7H 5IQOA 2UUDK 3UTTE 3S9DB 4XVJH 4W4NA 2YFOA 3V6FA 3D18B 1A4KB 3AQZA 3CDGA 3KJ6H 4JY5L 3T65A 4OF7A 3ZTJH 1I3RA 1SLUA 4F91B 4WAFA 2DKUA 3H3BC 2ADIA 1J1PL 4UQIM 3UTSB 4NQSB 3KM2A 4TUKL 1KXTB 3K1DA 4WNSA 1QYGH 5E70A 5C0BB 4FL4B 3UBXG 3ULUC 5HY9B 5JORA 1K5NA 3WFDL 4XNYL 5CMAA 1TENA 2GG1A 1QPXA 2P8PB 4LSQL 2WKOF 1JHLL 1GAFL 4OSUL 4HWZB 4LEOB 2F1BA 2WLJA 3ARYA 1N2RB 1OWWA 2YRPA 3GK8H 3HN5A 4IGBD 5T3XE 1GS6X 1I9RL 1NC4B 3T77B 5AVRB 2WZ5A 1XIWC 2MCG1 2FEDD 3FB8B 2CGRH 3MV7E 2ED8A 4EDXA 4TVPL 2YAQA 4FQXC 3W0WD 4F2EA 1F4WL 2ZKYA 1WZKA 4HJSA 4XMZA 2VLRE 2OTUA 3WD5H 4WI5A 2L3BA 3FU7B 1IKNA 1Z9SB 2Z92B 2JI3A 1JGVL 3DA0A 4Q2ZA 3QJQB 3POCA 3PAUA 3QQ4B 4JPWL 1QLEL 3QISA 3BP4B 3MLSL 4XMPL 1A7RH 1JGUL 1C9SA 3ILPA 4JKPH 2BWIA 1ZKAA 4AZ8B 3VGAC 4ZX4A 3CH1A 3G6JE 1HKLH 1A02N 2ZJSL 1J0KA 1IGJB 1T1XA 2F8IA 3G5WA 4LL4A 1UM5H 2BFGA 1LVEA 4YDLB 1JAEA 4R2GB 2R2BB 3VXPB 1DSFL 3GBMH 5EU6E 5ISZE 4LE8A 4PJEB 4WFGE 1NBCA 4YBQC 1HZLA 2M8XA 4X9BA 1KPUA 2V17H 5E2TH 3VD9A 1X7SA 3KLDA 5C08A 4P9HL 4FEMA 3OR6A 5EU4A 1B2WL 1YCSA 3K0WA 5C0CA 1YG9A 4LKXB 1JXGA 3FB5A 3N1GC 2R0WH 4GSUA 4HHWA 1WEJH 4W6XB 4ZSOB 3FB6A 2WAQA 2IH3A 5T1KA 2W0FB 2ALWA 1HH9B 5E2VL 3NJIA 5GZNA 1ZLWK 2W60A 2PCFA 3GF8A 3TASA 2X4PB 3F62A 1HAWA 3EJPA 1B6DA 3AT8A 2UZXA 4AH2B 5EU5A 1KTCA 4OD1L 2X0VA 1NFIA 2N7AA 4NHUB 2R2HA 4FLOA 1IBGH 4J1UA 3SIKA 3HZYB 2ZXWB 2AJZB 4LHUG 4ZK8A 2FYYB 2UZYA 1Q1JL 5EC1B 1ZHKB 1S7QB 3HPJA 2X88A 5EO0B 4ATTA 5DVKA 3JVGA 3GLAA 4NPYA 4U1JB 2WYZA 1HHHB 4GW5A 1BXAA 1FGNH 1L5GA 2IXQA 3KPSD 4MQ7A 3UMTA 3AGVA 1Z5LA 4XO9A 3ROLA 3INUH 4JHUA 4FQPA 4A6YH 3SGDH 5D1QD 3TBVA 3P9LA 4JFDA 2Y36H 3SN6N 1PLGH 1MFCL 3ARBC 1SDDB 3VXUD 3HRZA 2NYYC 4JFTA 1JZHA 2VDRB 1DBJL 1TXKA 1KTDB 4TQHA 4I0CC 5I6KA 4OKVA 2W80C 2WBKA 1AG0A 2Q0ZX 4HK3J 5DEFA 3ZDYF 1D5ZA 5C7XL 3P3SA 1CXKA 3T0XA 3Q43A 4HCGA 4NM8H 1GYCA 3QXDB 4XBGB 4XMKH 1SF3A 1ZHBA 5LNGA 1UJ3A 2R69A 2YGNA 3EFOA 3QG6B 4JRXD 4QTIH 1T3FA 4IU2A 4BD4A 1INDH 4LASH 1ZSDB 2J88H 2CO2A 5F7FA 3W3BA 4JQXA 3MKGA 3K6OA 3H7BA 2YPLD 4FJZA 5EZJA 1QNZL 1GW0A 3RWIA 3QH3B 4B9FA 3C8HA 4W4OA 5HHQB 1C5BL 1MHPH 1H5BC 2OMUA 1U8QB 3QWOB 3S96B 5I9QC 1GXEA 1A25A 1NCTA 3WNOA 4QTHA 3P11L 3SBWC 1OLZA 3FFCD 5I82A 4KTDL 2EEAA 4KKBC 3S37H 2AP2A 4UILH 3LNHA 1F11B 1DN0A 1QKZL 2XQYA 4J3WA 5IJDC 3D6GA 4GW1B 1JRHL 4V1DA 5INDB 1XGYH 2P5EA 2YSSB 1JUFA 1FFQA 3CN0A 2HFEA 3BFQG 3TFKC 4G8EA 1HL4A 2DKMA 1AS6A 1GYWA 3TCLA 1ZGLM 1FFOB 4LK4A 4YQXL 1PNCA 4HETA 4NGHL 1TLMA 5EBWB 4IRSA 1P5UB 3L1FA 3RVWD 3V6BR 2VN5A 5GS1A 5I1HH 4DGIL 3Q8EA 4XN7A 3SPGA 3UROR 4M6MH 3TN0D 4ZS7L 4A55A 4HXBL 3W81A 2V3DA 3MLZH 4LCCB 5ILTL 3REWB 3U6XS 2XWEA 4ZMLA 2AHIA 4O4YL 3NCFB 2V5MA 4J6RH 5IG7A 5DC0A 2EZ0D 2ENJA 1S5IL 3TV3L 3D2TA 3VFSB 5JOFB 4OLVL 5CSGA 2F2HA 3VI4B 2EE2A 3QIBA 2ENSA 12E8L 5BV7H 1U93B 4ZPTA 2PP8A 4NQCD 3UP1A 1TFPA 5HGDB 3ZT7A 1Q94A 1CFSB 4BZ2L 5BS0B 1BF8A 4OU3A 3KAAA 3DRQB 1IM9D 2Q9OA 3OC5A 1YY9C 4RX4D 4YHOL 5F9OL 5KYWB 4WEUD 5C07E 1UWGH 4H2CA 1FRGL 4UYQA 5D1QB 1A4CA 1FCCA 1LM8V 3BSGA 1Q0XL 3VXUB 1IAII 2FE0A 4BH8A 1JZ6A 2YPKA 4E36A 4Z7QF 1D7DA 1KXVC 3V95A 2VRKA 1ZS8B 5GHWH 1YAZA 2MEJB 3CXHK 4Z7QB 2N3JA 5FYJE 4K5OA 4PRHB 3JWOL 1NIFA 2ROXA 3V4VB 2CDEB 2WLMA 4FLRA 3QORC 2LHAA 1OAZL 1I3GL 1NFDA 1DJSA 2A83A 2XOTA 4NZUL 4DTGH 2YRZA 4JRXB 4GPVA 3CGTA 5GRVL 1F90L 3BEWB 3P9MA 4OJEH 3AG3B 2FT7A 5D9SA 1C5CL 4MNHA 4EUPA 1NDMB 4MCZA 1T0MB 4OZHF 5L88L 1G7PB 1L0YA 2X89D 2ZAGA 4RIRB 3VCLB 3VXRE 2YA2A 3FFCB 4PRAA 4S2SB 4KDTC 4CILA 1E4KC 4HIHA 4HS3B 1NGWA 3HG5A 1KLFB 1I1AA 2DMCA 5B3JF 3CZGA 2IG2L 3B9KA 3QI9B 4UNUA 3Q2WA 4WNQA 2AV7A 1TMCB 3K71A 1DUZB 3T3MF 4JFOB 5C0IB 3MAWA 3ULUH 2VQUA 4MAYB 4QRRA 4Y16C 2R8SL 3RURA 5JW5A 3IWUA 5I1JL 1KACB 4M93C 5IQ7H 3T3MB 3BKYL 3CSFA 3LEYL 2VR9A 3C2AH 1Q9OB 1IGCH 1FLRH 5EA0H 4GBXD 3MODH 2E86A 3L4ZA 1HL9A 2EO1A 4MJ5A 2WPGA 3KLKA 3LXBA 4H1LA 4OLEA 4C4UA 2VXSL 2GCYA 1Z9PA 2CO1A 4L3EA 3UH8A 3D33A 1HHIB 3PAVA 3EGSB 3GJEA 4LLVA 4Z7UE 5E6ZA 1BW8A 5K1NA 3TNNB 1GA2A 2ICWJ 4CMHC 1OAYH 1I1FA 4EOWH 5GISL 1D6VH 1QBLH 1AZCA 4W9CC 1TVDA 4ZFZB 3I74A 4ZW7A 1MDAA 4Z7VF 3U1SH 4GRMB 3RTQA 1XSOA 5EWIH 3AU1B 4HWEH 3V0IA 1SXCA 4Z7VB 3BDYH 3CFTA 3A6OA 1E9QB 1I8UA 5HHOD 3PHQB 3PS6A 4KDWA 1HZHH 4F27A 1XXDC 4FA8A 2WP3O 1U3ZA 2K6WA 1CXLA 4BM7A 5TDNB 1RLWA 5KYNA 4QRQB 5IB2A 2PETA 1AGEA 1IM9B 4K07A 1DQTA 3CX5J 5DMIL 1XCTB 3E6FB 3CDZB 1MCSA 1K6QL 5FB8B 3O6LH 5BUGA 3RY5A 3EUUA 2GY7B 1XSIA 4MCYA 3F8UB 4N0UA 5HHPA 1W0WA 4GMSL 5I8CB 1ACCA 3WMQA 2WM0A 3H42L 3T4AB 3VA2C 3Q8BA 2VOTA 4CVZA 3L9EA 1YNLL 4XXDA 3T0VA 2A5UA 2BIHA 1S5HB 4DZ8A 4PWKA 1T89A 1TOXA 5A2KH 1GGIH 3KYMB 3NACL 1SUJA 5GGQL 4LVHB 2V9RA 4XAKE 5HYJA 1IEBB 4TULL 2VABA 3MSPA 5HI3C 2GT9B 3MXWH 3GMLA 4PWEA 3HE6C 1BBDL 3LKOA 2G30A 1VPOH 2KQNA 2Z31B 4XPFL 3V0FA 1RUPL 4YDZA 3RUGA 1XGQB 4LBEA 1HWHB 2A9MH 4OZFG 6CGTA 1L6PA 2EIZB 3MCKA 4YHPB 1ZLSH 3QZMA 1WWBX 3VB9A 4FA6A 3IDGB 4JAMA 2XZZA 3EO1A 1HVXA 1G7QA 4JO4H 1XHHA 3EFDL 5DUPH 2HTKD 4JQIH 4AQEB 1JTTA 4XN2A 2E6PA 4F15C 4DGVH 3KCPB 3ZE2F 3HI5L 3BFWA 5DU7A 5C08E 4F80A 5HVHB 2G60H 5C0CE 1A7QH 4ZUSA 1T5WB 3ZE2B 1NDTA 1NINA 2YS4A 5ALBL 1SOQA 1B0WA 1MREH 2B5IB 4WNJA 1X3DA 3JWDC 1KLUA 3QQ9C 1EJ8A 1J88A 3GSQB 4OZ4B 1G7IA 3IPFA 4OCWH 2F7IA 1WFOA 2A4ZA 3VE0A 4H8WC 5GGSB 3UBGA 4JFYB 4UQDA 5L7XH 3U2SB 3BISA 3OWRA 3R7QA 4AEEA 2FJHB 3VD0A 2XIDA 1J0IA 4OF0A 4WHYG 2ZOKB 3LOWA 1FJ1B 4ODVL 1SY6H 4HXAH 4PJGA 5EPMA 4D9QE 4TRPL 4NPKA 1CD1B 2CLRA 1T1ZA 5JOEA 5HP5A 4KKZA 2I32A 2RIKA 3K7UA 4HIJB 1JVKA 2J7LA 5D1ZB 3U82B 1ESOA 2UY6B 3IDUA 5BO1L 3RIAF 3FRPA 3HTLX 3KM1A 3LVTA 4FN0A 3OGCB 4CSZA 3P30H 3EO9L 2YQBA 4I5BA 4M6NH 5DUML 2GEQA 1NCBL 4LPYA 4JFDE 1QSVA 3IRZA 5CCKL 3IJ8A 5I0WA 4HIIB 5SWSA 1O7VA 4AL8H 2FATH 1OAXL 1EQWA 3LKSB 3N06B 5E0FA 4JKKA 3PU7A 1YUHA 2QHRH 3ABGA 4N20A 4RSVA 3NDYE 3WS3A 2I9TA 3S4SB 1DJHA 3UJTL 2B0SH 1OW0C 1BV8A 5E1AB 4HFWA 2DLFH 4IK7A 1DJXA 4UT7L 5KVGL 3F85A 4W9DC 5KVDH 1X5IA 2X2JA 1FNSL 3EH4B 3TIDB 1I7ZA 3DGGB 3GI8L 1OZTG 3LRLA 1SXBA 2A7BA 3VXSB 1I8LC 4QO1A 3MLXH 4JM4H 5AKSA 1Z9NA 1U8NB 1NIBA 5D4IA 3A67L 1RULL 2DWXA 3AXIA 3FQ1A 3OAUL 4KKCC 1HNGA 4UQAA 6FABH 1GY1A 4N2LA 2HH0L 5H94A 4N9GB 5HHXH 5E6IA 1CDHA 2DICA 3V52L 2BSRA 1MNUL 1ZDSA 3H3KA 1AD0A 2F5BL 4OCLC 5MERA 4Y4HC 2FVNA 5I8OH 1SFDA 2Y7OA 4V1DE 2P5EE 4F58H 3EYQD 3FT1A 3SE9L 5GRZA 3EOBB 2K8MA 1PSKH 4DPAX 4ZBJA 1G9ML 2H2PD 1BVLA 1FF5A 4HYTB 4K7FA 3KPMB 2ITDA 4NJAL 3FCSB 1Q38A 3BSHA 4HUNB 2F7QA 3PFQA 5IJKA 2WINB 4N25A 3T1FA 1RZJC 4XTRD 4JFHD 4Y4KA 3QNXA 3KYOB 4HUWA 3IJ9A 1AO7D 1NAKL 2YWZA 5BW7A 5JHDD 3SQOL 4MA8L 3V0WL 1DANT 1IBFA 3QJHA 3HI1A 4BH7B 1NJ9B 2RBLA 2YMOA 1DQLH 1A7PH 2EIMB 1YMMB 2IO5A 2QTVA 1G1KA 4PJDA 5D7LA 5DD5L 2XKSA 2GC4C 1QWNA 2GJ6B 1NBQA 4UT6A 5IESH 5FC9A 2C9VA 2FB4H 2HSIA 3CFMA 5FCUL 1UT2A 3NK3A 3DBXB 2VDQL 4GKOA 1X6LA 4YPGA 5CBEB 4AVKA 5C6PB 5IMOA 2VLLA 1U8PA 2XWJA 3RWEB 3UDWC 2FL5B 2BSBA 4PGBB 1IFRA 4GUOA 4FI8A 3WGVB 3BWAB 2BP0B 4ODTL 1RZGB 2C1OB 1WGOA 4IBLT 1INQA 1CFMA 1KGYE 4PD4J 5GPRA 3CX2A 4QTFA 5CEZH 2WMPA 4F92B 4W9GC 2PYFB 1GZHA 2ZWSA 1JPGA 2IDCA 2KKQA 2AITA 2Q1EA 5T1MB 3KPQB 25C8L 2A0LC 3RILA 3HCVB 2JFCA 1CXIA 4M9OA 4PG9B 1UM6L 4TNWK 1CLZH 3RIKA 2K9UA 1MFMA 1UACL 3K2MC 2KDYA 4M5ZH 1G6RH 3MXVH 1MELA 4KJPC 4QKTA 2HRGA 4GS7C 4ZUWB 4Z23A 1OQOA 1PLBA 1OB1B 4GRWH 4HAFA 3O2DA 2CBPA 1CGWA 1ZWIB 4Z5RA 3BQVA 4UANA 1XL4A 2SODB 3GMNB 3HKFA 1NOFA 1F8TL 2OR9H 3OHXB 4HWBH 1ZT4A 1NFDE 5I1KL 2BWDA 3P4MA 4YHLL 1KCSL 3ZKXB 2AKRB 1WT5A 4Q97A 4QEGA 2F8VA 3DX3A 1EHXA 1RK1B 5FOJA 4U6XA 3RVUD 1IVTA 1TR7A 4X8XA 4GI9A 4PMFA 2FIRT 4XCFH 4J39A 4U7MA 5C0DA 3NIGE 1NEZB 5FUCC 1U8HB 2F54D 4NN6B 2VYRE 1UCBH 3FOMB 4HIEA 5JR1H 1KJVA 3NTCL 2DY2A 4BJLA 4X4ZA 2QKSA 4P5TC 2IIJA 1P4IL 4PAZA 3DOSA 1LL1A 2BH0A 3F84A 3LS5H 4JVWA 1PCXA 4QRRE 5IFAH 2HKHH 2OL3B 3ECVA 3KNBA 1GOFA 1FYHB 5TH2A 3CQPA 4P59H 4W93A 4Q4IA 1PZ3A 4K7PL 1A4JA 3ESNA 4JRYA 4TTGA 1NCCH 1U30A 2WYTA 3ARFC 4L3EE 1AO7B 4TV3A 4JKLA 4E5XG 1VFBA 1HNFA 3ML9A 4HUUA 4LDCA 3SGJA 1UZ8A 4MMXA 2LT9A 3W9EA 1BAFH 3FNKA 4U7KA 1HSAA 1U8LA 3ULSB 4WW2A 2QKIA 3VWKA 4AGOA 2XCMC 4IU3B 4S11A 5AOLA 4Y9FA 1SVBA 4FULA 2DBJA 3II1A 3AAZB 3E1F1 1BG1A 1NAMH 5IVXB 1IGFH 3E3QE 2YAHA 4BQ9A 4H88H 1KJ2B 2VWEC 3KBEA 1ZTMA 2F8XC 5FECA 4AVJA 1HQRB 5FHAH 4Z0XA 1MCOL 4XNZC 3QHFL 4LF3B 2NZIA 3JTTB 5AVXB 5A16A 3GPEA 5DJ0A 3LNFA 2XYCA 2VITA 4JMNA 5AW9B 2XWBB 3TLRA 2GUOA 3G9VA 3MRKA 4NKOB 4FLSA 1NBVH 2PN5A 4OGAD 3W1ZA 4OF3A 2VDLL 3QFJB 1EK3A 4LLWA 3BIBX 4B0MM 1E8WA 2H6OA 3DK2A 1UCTA 2UXTA 3D3VD 2W9DL 4PRPB 4CN4A 4NSKA 3JV6B 3VXQA 1WISA 5HI5C 4P2OC 3N6YA 4PN6A 5CF3A 4XPHL 4YN3A 4ZODA 1UB6B 5HDBE 2OZ4A 3ZT6A 4N0UE 1EDHA 3JWNG 3OF6D 3EG9A 3AJ7A 3Q48A 1JPTH 3WDJA 3S34L 3UTQB 5GRUL 2RCSH 2DZEA 3NIFE 4S1RL 2DM3A 3HJEA 3J27A 1HSBB 4FYSA 5F7DB 4HOWA 5I6MA 4MXWL 5HYJE 3RA7H 3CFDB 2NXZD 4BHUA 4IHOB 2ID5A 1QTYT 3T3PE 1XEDA 1LEKB 4H8WH 4OQTA 3C5JA 5FUZH 1WAAF 4FOMA 3V0GA 2YAPA 3RUGE 3VRJA 4R0LB 1KWGA 4M7LH 2RQEA 4YSPA 4NN5C 1LO3H 2H7WA 2CUIA 2MQCA 2VJXA 2BFVL 4XZ4A 5E99L 4EZKA 3TBYB 2XNAB 3GSOB 4X99B 3G6AA 1BF2A 4ZTEA 2BC4A 2X2YA 3DX2A 3GJFK 1EXHA 1AQ8A 3FU0A 4TVUA 3D2UA 5DC2A 3WIHH 4KZ0A 2WVSA 4UTAL 3K6SB 1BFOB 1NBZB 4N5ED 3A4AA 1ZLWH 3G7TA 5IROC 1K4DB 3MU3A 1BBJB 4KO7A 2EDEA 1NFAA 1RP8A 2FHBA 3L3KB 2CLZA 5GGTH 3NFNA 1BYOA 1DSWA 4KI5E 2KPWA 2IAMD 3STZB 3V5DB 2PR4H 2FEEI 4UV7L 3VQ2C 1S7VB 1S7RB 3K80A 3P73B 4XVJL 3H0TA 5FHBH 3CZUB 5CHNA 2VMJA 2VDNH 3KJ6L 5ADOH 2IQAA 1TSHA 2J3SA 4L8BA 4I4WA 1A6AB 1CLCA 3OKDB 3TEWA 5KSAC 1NCWH 2WTRA 2P3YA 3NA4A 4APXB 2DYPA 3IMWA 1MIMH 1OKEA 3X3GL 2WLLA 3AC0A 4YSOA 3WEAA 1ADQA 1CMOA 1QYGL 3C75A 1WCQA 3P77A 4IRZH 4X6EB 4QXUH 4PJGE 5I1EH 2ZAIA 5GSVA 3MRGA 1UD8A 3ZOAA 4PVMA 2IALB 1FZMB 3GK8L 4S1SH 5T3XD 5E9NA 4DQAA 3GM0A 4PP1D 3RFZC 3EGDA 1BIIA 1DO5A 1FAIH 3KPOB 1R24A 5FM8A 4WTWA 2BK8A 2NW2A 3LPPA 3UO8B 3BKMH 3MV7D 4AQ8C 2QADD 1SHSA 4GAJL 4HZAA 3ASNB 1HHJA 4QHLB 4XNXH 1T1WB 2DQTH 5AVSB 4ALAC 3WD5L 4LIQH 1BQRA 2VLRD 1VFAA 1OL0A 5SWSE 2QMJA 4MNQA 1YEGH 1SF5A 4KAQH 1D7BA 2AV1A 4UZUA 3C08H 3W11D 1U8MA 4JFFA 5JNYA 1A7RL 1JWMB 1HWWA 5KOVC 3BUQA 3JTBA 4JKPL 1RZJH 2FGWH 1TJHH 3HG1A 3NOIA 1GZPB 3O9WA 3DTUB 4X4KA 1HKLL 2D31B 3WKMH 5LKNA 5IIEB 3LRSB 1UM5L 2BY0A 3FZUD 2PO6D 1OIOA 3SDCB 2E8ZA 5ANMA 3GBML 1YECH 5ECJE 3O8XC 2XTLA 3VRLF 4OFDA 5EU6D 5ISZD 3K46A 3NH7H 4WFGD 3K8KA 4CADB 4EIUA 2V17L 3HIZA 4JO5A 5E2TL 4DGWC 2FK9A 2CCWA 5HJBA 4ZI8A 4ODWB 1L3NA 1VGKA 4L8SB 2AJ3A 4PGCB 4YHNA 5KG9A 2D3VA 5B1AB 1WEJL 5DRWA 5L4JA 3MKKA 2DQHH 2DS4A 2R9HD 4AXWA 5DDHB 1JBJA 2YLHA 3RVVD 4Z7AA 4F7MA 4H8UA 4WI6A 4WUUA 1BJ8A 4QXGH 3B3BA 4U3CA 2DW5A 5GIRA 4U6YB 2IJ0C 3TZVD 1ZCRA 4D3CH 4PLKD 4G1EA 5DJYB 2UXVA 1CFQA 5DO8A 5I1DB 4U1HA 5K1JA 5BVJB 2ATAA 3U48A 4JPKH 1UQSB 4Q74A 2IAMB 3QUZB 4MA3B 3ZHNA 4YHZH 3FAXA 5F8RC 1M6OA 1IBGL 2H6PB 4QHMB 4LDOB 1KIQB 4YBLB 1O6TA 4HG4K 5CN1A 2HKFH 2ZXAA 4R83A 3FQXB 5FYLE 1KEGH 4PJDE 5D7LE 3D69A 5JO5B 4ICWA 3SJVA 3NSFA 5EORH 1AS8A 4GAFB 4BA0A 1JYWA 5B8CC 1FGNL 1RCYA 4QRTA 3AM8C 1E43A 3INUL 2N1TE 3KGUA 3PJSB 2F19L 4WO4A 4Y2LA 2Q6WA 2Q86A 2C9SA 3C5SA 2HUHA 4M48H 1RUKH 2Y36L 1PLGL 3B9AA 1QAWA 3L7EA 1HCFX 3L4WA 4K73A 4U1MA 2CO6B 3P0VH 4RGNC 2IC2A 2AJXH 3CN3A 4UNIA 4WWPA 1KT2B 1KBGH 5D7JC 8FABA 4BQ8A 1I75A 2OMNA 3E9UA 2EDMA 2LFEA 1D2PA 4TL4A 3PL6A 5D6DA 4NM8L 3V7AG 4ZMYA 5E8EA 4GP4B 4L0PB 2JJWA 4XMKL 5LBVA 3O8XA 3O6FB 1IGIH 4XNMA 2BRQA 2N59A 4QTIL 1S9YA 4CN6A 4JGNA 1INDL 4PWGA 2IDTA 2J88L 4LASL 3EXLA 4P57A 1DVQA 4MLIA 1MG2C 4NRXA 3BQUA 3G6JF 3IGAA 2BSED 2JKLA 3V5HA 1MHPL 1MZYA 2GBTA 3NJJA 4HZ1A 3VDAA 4EN2A 5I0VA 2GVYA 2H32H 4OZIA 2L04A 1CR9H 3VDCA 3S37L 3GS4A 4UILL 1T4WA 3FN3A 5E7FA 3BPLB 2PO6B 4HK0A 1KGJA 1OE3A 2VDLB 2OCJA 3CDFA 3PWLA 1IX2A 4PJ9D 5ITFB 5DJDA 1XGYL 1AR1D 2DL2A 3OJVC 1QR4A 3GXDA 4NNPH 1MCLA 4AYFB 5HJGA 3SPVB 3CIAA 4ZMAT 2OKMA 3GMOA 4PREB 1U42A 2VCOA 4PWIA 1FL6A 3QCTH 3S98A 2WQ8A 2NXYD 5F9JB 3RTLA 4AIXA 4X5LA 1J10A 4JREC 1W72A 4BIKA 2A77H 15C8H 5IJVA 3TIEA 5D1XA 4E41B 3IYLW 5I1HL 4WV1C 1TZIA 4PS8A 4L29A 4M6ML 3STLB 4HLJA 5CIPA 3MLZL 4MD5B 3TZVB 5I66A 3ZTNH 4GFXA 1XCXA 4MSWB 4N0YH 4YVNA 4J6RL 1PQZA 4H5SB 1F42A 5FO7A 1CXHA 4K5LA 2FR4B 3D12B 4JRYE 3G5YB 1O9WA 3L3JB 4I9WD 2QVKA 4XWOC 1QABA 2DQMA 1HHGB 1Q9KB 1UKTA 2E59A 3C5ZD 4QRFA 4IOSD 5GGUA 3TVMB 5BV7L 2Y7NA 2CKBA 4UMGA 5GXBB 3C8KA 2EUXA 1H8LA 4ZTPL 3IU4H 1G9NH 3BD4A 3I3DA 3W39B 1O7SA 2AERT 3B56A 3OZ9H 2XWCA 2AEPH 1OK8A 1GGTA 2AEQH 1UWGL 2D4FA 1QLFA 4IMLB 5IF0B 5ICZA 3MV01 3LEXB 1TQCB 1ZVHA 2Y06H 3EBHA 4J28A 1T6VN 2CIIA 4QHUB 1BPVA 3BFOA 2BHZA 5IMKA 4G9FB 3UZEA 3ERXA 1TETH 3V4PB 4XPGH 1E6JH 1U0QA 4TTDC 4KC3B 5GHWL 1W15A 3TC9A 1PEZA 3RWGA 2AANA 2VR3A 3FOLB 4URKA 3QC6X 5FYJD 2BW5A 3ZYJA 2LR4A 3AZUA 5ETUA 5I6XC 3BZEA 4AUUA 5I30L 1GJWA 3PV6B 4Y0GA 4PJ8A 3GBDA 1PZAA 3HB3C 4K5MA 3S3JA 4DTGL 3BHBA 3BUDA 4IS6B 4PR5B 3B2PA 5AYQA 3ZZSA 5B39B 3NRFA 1OF2A 4X83A 3GHBH 2VDPH 4FG6C 4Q6KA 1H15A 3QO0A 3KPTA 4QOKA 2FIKA 4ES8A 1TTAA 2WZ6A 5L4IA 3VFMB 3F2LA 4DIXA 1F6AB 1R5IA 3AG4B 3ROOB 4HUXA 5AKVA 4R3SB 4Z7WA 3L4YA 4M1DH 3VXRD 4Q6IA 4D9LH 3DX6A 1M71B 1WIOA 2VLJA 2EC9T 4FQQA 3F7RA 5DHMC 3TXAA 2XI9A 4PW4A 4MRBA 2J1YA 4AKQA 1AR1B 2BMKB 3QP3A 3ULUL 4UQBA 4RRPG 2HUEA 4MNGB 4QRUB 3MMEB 2JE8A 1KBVA 5IEHB 5IQ7L 1YQ2A 2EO7A 3C2AL 1QFWH 1IGCL 4NC1E 1FLRL 5EA0L 4ZXBA 1OTUC 3MODL 4HWUA 3DUHA 3L4XA 5DT1H 2XFXA 2HJLA 4BRVA 4HUVB 1ZTXE 3B83A 5E8OA 5GS0D 1ZXKA 2EDNA 4OZFH 4IOIA 1TKWB 5L2KE 4X9IA 4G71B 3T6ZA 4ALAH 1OAYL 5AVTB 4EOWL 1WA2X 2OMWB 1O5PA 1E8XA 1D6VL 1PX8A 3HMWH 4GKLA 1QBLL 5J1AB 2J8OA 2XWRA 2JIXA 2WB7A 1YC7A 1P7HL 2G75A 3WN5B 1JERA 2B14A 4AIZB 2HRPH 2VWEE 3FSVA 3U1SL 2MSPA 5JPMB 2Q5BA 4HWEL 5EWIL 4G8IA 4KXCA 4AKPA 3QDGA 3JWNC 2LAGB 2Z8RA 2CR0A 3BDYL 3C5ZB 3HHRB 1HEZB 5EC2B 2VL4A 4AT6B 3KLHD 5ACLA 1HZHL 1PKQA 3HW7A 3IDIA 1BXXA 1AS7A 5K39B 4AGNA 4EI5C 3GSRB 2X9XA 3FCBA 1BQSA 4BFIB 1USQA 1I85A 5F88B 4DPCX 5J6GB 2GIMA 4A63A 3IT8D 3UBFA 5BJTA 2BZCA 1AZRA 3RWHA 1P7BA 1P1VA 2FQFA 3AACA 3O6LL 4PJ7B 3B5GA 3QA3A 2DMKA 2QSQA 4WHYH 5EIIG 2P24A 1MWAA 3F58H 4ZO9A 3D0AA 2YPVA 2R83A 4POYA 5DHYB 4S1QH 1T1YA 1OVZA 3QZPA 3BWUC 4OUUA 3VH8A 4X5XA 3BMVA 1QFWM 3WJJA 4JHWH 4R4BA 1BZEA 1J1XH 1XGRA 2EKJA 5J13C 2HVKB 3C09B 4F8PA 4FFVD 2VQ1A 1GGIL 3GFUA 4MNQE 4L3AA 1VEOA 3IFLH 3C9NA 1JS4A 4IHBA 1X4XA 4JFFE 4R7NB 4XAKD 3MXWL 4PJ5D 3S36H 1VPOL 4A6YA 1JD7A 4PJIA 5DSCB 3HG1E 4ORGB 4TUUA 4NZ8A 1E7VA 2JXMA 1XGUB 2GAZB 2O5XH 5CBAB 2X05A 5L4MA 5IJBC 1Z1WA 2A9ML 4XCCH 5M94B 5IT2H 4BA8A 3ISRA 3WEMA 1ZLSL 2H3NA 3B7TA 4W9LC 2O61A 3TH4T 4NAQA 5E9DD 3VXRB 1B0RB 4JO4L 5DUPL 3HHSB 1T2QH 2CQVA 2DKSA 1I1YB 2DM7A 1R3KA 32C2A 4JQIL 1W6LA 2D7QA 4V2BA 4L9LB 4DGVL 5D2LA 4Y5YA 5ENWB 4Y2OB 3RDTB 4TKWA 5I17B 5L2JB 4QRPB 3V6ZB 1WIUA 1NDGB 3BH8A 5F0LB 2G60L 3QBTB 3WFBH 1A7QL 1BDYA 1UKSA 3QZWB 5C08D 3WFHB 5IB3B 1J5IA 2BX5A 3LH8A 2AJYH 5C0CD 3VSTA 3VM5A 1CUOA 1YQVH 3DUUB 1VGEH 4F8OA 1MREL 1N6UA 3AB0B 2X3AA 5T1KD 5H35B 3ZIYA 4WUUE 3CSBA 1Q72H 5DI8B 1EVUA 4AYSA 4Z7UF 2FJFA 1AMXA 2NNCA 3VMOA 2OAAA 4YSTA 4OCWL 1ZANH 1ECZA 1NSNH 4FZEH 4Z7UB 1I7UA 3SGKA 5L7XL 3AY4C 2ZUWA 3FHQA 1JZDC 1KN2H 3K5RA 4U6HA 1CDJA 3G5VA 3ZYIA 1SY6L 3EF4A 4HXAL 5JHAA 1TCRA 3CDGB 3EO0A 3T65B 1XIWD 4D9QD 1W80A 4HH9A 4RGOH 3FTZA 2Q10A 4FQXD 2JQMA 3FFDB 5DMYA 5I1CH 4LL9A 2XZAH 3P30L 3HUJB 2PPDA 4JBSA 4PCTA 5JORB 1K5NB 5EUOB 2I60H 4E2OA 4ILDA 4EO5A 1FC1A 2WNWA 4AL8L 2FATL 1KPVB 4JFDD 3V9CA 4BBWA 4GUPA 5J6HA 2DQCH 1I7RB 3CU1A 5BV7B 2B0SL 1F4XH 5FO8A 4BCZA 1EXUB 2DEXX 4CNIB 3H3PH 1MW1A 4NRYA 2DLFL 4EDXB 2DTMH 2F9BT 5KZCD 3OKKA 3LDBB 5DRNA 2D2OA 5KVDL 1X5FA 2CCVA 4AENB 1GYAA 4XOBA 1MCHA 2OTUB 2DLEA 4HVBA 2X1QA 3BAWA 1J8HB 1M05B 3MLXL 5DCCA 1WUNT 4XE0A 4YBQD 3DYOA 4JM4L 4DP5X 3X1EA 3FQ4A 4PJ5B 4XC1H 2CM6A 4FXKC 4NERA 4RAVA 4K71B 3SBQA 4B7IA 2ZTBA 3ILPB 4OZIE 1N6VA 4P2AA 6FABL 3QDJB 1DDTA 5HHXL 1Z2KA 3D39B 3BRFA 2YEQA 3PV7A 5J11C 1ZEAH 4R96A 2EYSA 4G8GB 5I8OL 4GRLA 3BW9A 3GI9H 4CC4A 5E9DB 3LZNA 1WFIA 3LMJH 4V1DD 4BZYA 1QA9A 1PSKL 2P5ED 3PG2A 3WIIH 4PJCA 1ITCA 2B2XH 3NP3A 2X12A 4PJAB 2J43A 2ZX5A 3MNVB 3V55A 3QXVA 4YE4H 5C08B 4AJ0A 5DVOA 2Z0UA 3NZUA 5GZOC 1BQ5A 3L9RA 3OZKA 4IRSD 2KHAA 2WSKA 5D1XE 1BD2B 2WXPA 1RJZA 3QAZC 4DOHE 1OT4A 4TMPA 3C60A 1WS7A 2NNAA 4UIMA 4YK4C 1DQLL 1A7PL 1OSZB 4M00A 2J6WA 1AKJA 4Y4FA 2WXIA 1A7BA 1AAJA 3FO9A 1T22B 1LO4H 1FGVH 4UTBH 3NESA 1A3ZA 3NCXA 4ISVA 4PWJA 1NFIB 3CMGA 4EZJA 2NYYD 2FNBA 1UKQA 3QIBD 4HAGA 2UZYB 4I48A 1XIWB 5ESAA 4L3FA 1J7VR 5CZVH 1ZHNB 1K9TA 4FQXB 5CEZL 2AS5M 3BGMB 1RZKC 3BWZA 4ETYA 2AXHA 1AI1H 3LCYA 5IBLD 3CSGA 1L5GB 4XPBH 4UOJA 4KJWD 4MQ7B 4XHJD 3QQ3B 5IWLC 5D5MF 4CSTA 5DO2C 4LNVA 2OX5B 4IBVA 3ETBF 3P9LB 4J8RA 4XBEH 3RWJB 3RX5A 1G6RL 3MXVL 5JW4M 1M1XA 4F2MB 3RZCA 4JM0A 4MJHA 2VE6A 4FXKA 4L37A 5D5MB 3TGXA 2WLYA 4DUVA 3RPIA 1CYWA 3C6LC 4O5LH 3VGAB 4OKVB 5CD3B 5FYJU 3FHEA 4FGMA 4H0LC 5DEFB 1ILSA 3THMH 2A74C 1IAIH 5HGHB 1WHOA 4WGVB 3SD5A 2OR9L 5I1GH 2BY1A 2I9LA 5E5LA 1XB3A 2XU9A 4B95C 1NPNA 2BVPB 3EJQA 2P49B 1U33A 1U3YA 3MGOB 4L4TA 2UVFA 3FUFA 3RGHA 3EFOB 1SM3H 3TFKD 2BIIA 1Z5HA 4HS8H 4QOKE 4E9QA 1B4JL 2LAAA 3H7BB 2Z1KA 3RWIB 1R3HB 2CK0H 2WB1A 3BN3B 4XCFL 4CGUB 4Z7WE 3JWNH 2OMUB 5F7BA 2X4RA 4MDJA 1UCBL 5JR1L 1G7JA 3D9AH 1WDAA 2VLJE 3BE1H 3GJFH 4FTVB 2ODIA 4CU7A 2OYKA 3LS5L 3B9KD 4LCUA 1SOSA 3B5TA 5IFAL 3VGGA 1JUFB 2HKHL 4QRRD 5DQDH 2C9UA 1N3NB 1WS8A 4P59L 3CZFB 1T7YA 5T3ZE 2Y5EA 1E5ZA 3DX4A 1WHPA 4CKQA 4EJ1C 1DJIA 4RDBA 2XV3A 2WWKT 1NCCL 2CDFA 3QUYA 4FAAB 4L3ED 1CF8H 1ACZA 2BIMA 2MPAH 3FU5A 5GRJH 5I8KH 1CFNB 1V54B 5I1AA 2HT3D 1BAFL 1EJOH 4P5RA 5EOTA 4AITA 5DUBB 5DYOA 2H1XA 3ISWA 1FN4A 1KUMA 3MROB 5F1IA 4U6VH 2ERJC 3DMMC 5I6OA 3RTQD 1NAML 4LB8A 1WFTA 1IGFL 2PWFA 4LKCA 4X6BA 3L3HB 4TNGA 1FG2B 4EF3A 1A9BB 3O4LB 5FHAL 4H2AA 4G3YH 4HJ0C 5F6HI 2CLVB 2J20A 1UB5A 4GSDH 1B2YA 1E5AA 1PKQE 3KPPA 4P23C 3BI9X 4Q9BA 1T66D 3SDXA 5E0QA 2V2TA 1D6EB 1NBVL