3PJWA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, i23
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 130
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjwA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjwA01
1TVRA 3Q8QB 4IG3A 5KG6A 2XI2A 4U6PA 4EBCA 5KFYA 3NMAA 4O3NA 3OLBA 3M8QB 3GIMA 4URSA 2WHOA 3G6YA 3BREA 5KFZA 5L1IA 1XR7A 4IG0B 4ED6A 4Y3CA 4H4MA 2HNYA 4O44B 5DQHA 4H4MB 2ASDA 3N3TA 1BQMB 4J9SA 3IS9B 5DGBA 4F4WA 1VRUB 2FVQA 1N56A 3G6VA 4IR1A 2XGQA 3LP1B 1LWFA 4LQ9A 4R5PB 2WRMA 5MKGB 4RUCA 5KFJA 3ISNC 5L1KA 1S1TB 2OPQA 3DOLB 4ECSA 3OHAA 3MECB 2ZE2B 4ECZA 2DPIA 2EC0A 1LW0B 4DL4A 1JLBA 3ITHB 4K4YA 2R8KA 4B3OA 4R0EA 3OL9A 2YKMA 3PW4A 3BR9A 4MKBA 4QPXA 3EPIA 4PUOB 3BGRB 5KT7A 4FOUA 4PUOA 4RW9B 4Y2CA 2HNZA 1N48A 4ECYA 2FVSA 2ATLA 5C42B 3KK1A 1JX4A 1GX5A 5KG3A 4QWEA 4RU9A 1HNVA 3KNAA 1FKPB 2E9RX 1C0UB 4WFXA 4J9LA 1TKZB 1RT2B 5FDLA 3C6UA 4ZVEA 2WTFA 3FSIA 5FDLB 1S9EA 1U09A 3CDWA 4NLPA 1JLEA 1C1BA 4J9QA 5I3UB 1HYSB 1S1XB 2VA2A 2WOMA 2HNYB 4ECQA 2UVRA 2UUTA 4NLTA 3MR2A 4KFBB 1XR6A 3IS9A 4Q0BA 3TAMA 4TYAA 1FK9A 2R2TA 4EO6A 1S49A 4NLRA 5KFHA 3M9NB 5C5JA 5KFRA 1NNDA 4J40A 2B5JB 2BE2B 3NAHA 3BSNA 4ECRA 1RYRA 2ALZA 1QE1A 2W9CB 1EETB 1TL1A 1QAIA 1S1TA 3DOLA 2XWYA 1ZETA 1MMLA 5L1LA 4ED0A 1K1SA 1RTIA 4JV0A 4WZQA 3EZUA 3H5UA 1SV5B 4LQ3A 3PHEA 4TQSA 3UPFA 4GC6A 2ILYA 2WK4A 2R8GA 3FFIA 5CYQA 4RW9A 3H4BA 3I5AA 4MIAA 1MU2A 5F8HA 5CYQB 2C2EA 1NHVA 3HV8A 4RNOA 3Q8PB 3PJWA 3QZ7A 1T03B 2I5JA 2R8IA 2JC1A 1S4FA 3ITHA 1JKHA 2ILZA 3DRPB 2VG5A 3GG1A 4ICLA 3TLQA 1TP7A 4O4GB 4YMEA 3KHLA 2R2SA 3QLHA 4NLXA 1LWCA 2FLLA 5EUHA 5CYMB 3QLHB 4I7FB 5KFLA 1S6PB 1JLEB 2YNHA 1N5YB 4TQRA 4WFZA 4MH8A 5C24A 3M9OB 5HROA 1HYSA 1Z4UA 4XPEA 4FBUA 2WOMB 1RA6A 5KG5A 5J2PA 4KV8B 3NL0A 4LSLA 3OSNA 4O3QA 4NLUA 5HP1B 5MF5A 4EBEA 3CDUA 5J2QB 4Y9NA 3M8QA 3MEEB 1RAJA 2OPPA 4I2PB 2HNDB 5M1TA 3CJ3A 2HNDA 2XGPA 1EETA 4PQUB 5L1JA 3NBPA 2J6UA 3QGIA 1BQMA 3N6LA 5EWFA 2OPRB 2YNGA 4QW8A 2W9BA 5DQGA 4O3RA 1N4LA 5L9XA 3PJXA 1TKXA 3N6NA 2ZD1B 3TAMB 3PZPA 4HU4A 3DYAA 4MIBA 3KLEA 3MFHA 4MK7A 4NLGA 5KFTA 4RNHA 2BRLA 3KLFA 4ZPDA 4Q8EA 3KLFB 5KFWA 3MECA 5DLFA 4K50A 3DI6B 3LAMA 1TVRB 4DL7A 1JLBB 3H5YA 4ED8A 3RB6A 2I5JB 3SFGA 2D3UA 5J2NB 3NAIA 1S10A 5F8LA 4QW9A 2W8KA 4M95A 3H5XA 4Y9PA 1REVB 3OSPA 4WFYA 2R8HA 1T94A 5CYMA 3I0SA 3DLKB 4NLYA 2GIQA 3NKYA 3KLVA 1HPZB 2IAJA 3JYTA 5KFBA 2V4RA 1HNVB 1FKPA 5KFAA 4EO8A 3NGDA 2GC8A 4NLDA 2W27A 1RT1A 1RTJB 4RW7A 2IM1A 1C1CA 4NLSA 1SH3A 4RW7B 3IG1B 3IGNA 3QO9B 1IKVA 4RUAA 4HJFA 4G1QB 3TVKA 1S97A 4NRUA 5F8IA 4WYWA 4PWDB 3T5KA 4HKQA 2AGQA 4KIEA 2YKMB 1SH2A 2XC9A 3PW5A 1N6QA 4MK9A 5F8NA 4RW4A 3ISND 4ZVHA 3KZPA 1DLOA 2BR0A 1DLOB 2IJNA 2BANA 4EYIB 5KFOA 3PFMA 1TL3B 1DTQB 4J9NA 2W7OA 4NZ0A 3V4IB 1RT3A 3MEEA 5EDWA 1HMVA 4IDKB 4ES4A 4KB7A 4NCGA 2QV6A 1TKZA 4ID5B 3CJ5A 4IDKA 2C2DA 1JLCA 4NLWA 3DI6A 2WONA 2VG7B 4NRTA 5JUMA 4O4RA 1XR5A 5KFQA 3RB0A 3V6KA 2JEIA 1UWBB 3H4DA 2W8LA 2BQUA 2YKNB 3GIJA 3DMJA 1RT5B 4TY8B 5DQIA 4F3HA 3H40A 3DLKA 2JEFA 2RF2B 4IH6A 4WYLA 2BRKA 3RBEA 4IFVB 2IC3B 3RAXA 3RB4A 1W25A 1JLAB 3GG0A 1JKHB 3DRPA 1JLQA 5F9NA 4U7CA 3QIPB 1RTHA 3OHBA 3V6JA 2UVWA 3EPGA 3KJVB 4RW6A 2OH2A 1IKVB 1LW0A 3JSMB 1KHVA 1C2PA 4B3OB 4ZVFA 4ZP7A 2B43A 1JLGA 3JSMA 4EYHB 2FJXA 1S9FA 2FVRA 4J9PA 4ZMMA 4Q43A 5F8JA 2AX1A 3LAKA 1S48A 4ZPBA 4O3PA 3PW2A 3KHGA 4ED2A 2FJWA 4NLOA 1EP4B 4KO0A 4Y8EA 5KFKA 3KLGB 4YP3A 4JV1A 1JLFB 4G1QA 1VRTB 4K4TA 2OPPB 2D41A 4I2PA 3QYYA 3Q8RB 5F8MA 2FJVA 4DEZA 1R0AA 2V4QA 5KFUA 3IGVA 3UDLA 1RTDB 3GV8B 2FLNA 4FOJA 4IH7A 2VG7A 3PVXA 5KG0A 3PR4A 1TKXB 4J9OA 3U2EA 4H54A 4IRKA 4IRCA 2F8EX 3HVWA 3DMJB 4TY8A 1RT3B 1C0UA 4LSNB 4TYBA 3IN5A 4F4ZA 3V81A 2C2RA 3MEDA 3RAQA 1S0OA 1LW2B 2ASJA 2JC0A 1JLCB 1S9EB 5J2QA 2R2UA 5DGAA 4ZPCA 5KFIA 1IKWA 5D3GB 1BQNA 1C0TB 2OPSB 2IM0A 1RYSA 3S83A 5HLFA 4NLVA 4LYKA 4KE5A 3HKWA 4RW6B 3MEGA 4R8UA 3HVTB 5KFCA 3HHKA 3FQLA 3MEGB 4O3OA 4R8UB 4X2BA 1J5OB 1S1VB 3DLEA 3QZ8A 3KMQA 4MFBB 4DL5A 1S9GA 2HAIA 1S1VA 3DLEB 5F9LA 2IBKA 1JIHA 5EWGA 2ZD1A 3BSCA 3LANA 4IRDA 3TQ1A 1RT1B 1LWFB 2YNIA 3DM2A 5MKGA 3DOKA 4KKOA 3KK3B 3DOKB 1CSJA 1EP4A 4DL2A 3I0RA 5J2NA 5C25B 4ZP9A 3GILA 4DG1A 1KHWA 5KFDA 3BGRA 5KFGA 4FBTA 1S0MA 1RTDA 5K14B 2I1RA 2R8JA 5K14A 3G6XA 3M8PB 2HNZB 2D3ZA 2JEJA 3DRSB 4IR9A 1FKOA 2J6TA 4KBIA 4YR0A 4Q6JA 1TL3A 3PR5B 2FVCA 3KLGA 1HPZA 1TKTB 4KHRA 3JYTB 3V4IA 1JLFA 2AGOA 4I2QA 1RT4B 2XCPA 3BQ1A 2VG6B 1RT2A 3I5BA 5F8GA 3HV9A 1LWEA 3BQ0A 2IJFA 3VQSA 5J2MA 5I42A 4IOBA 3GIIA 3KLHA 3PJUA 3V6HA 4Y34A 4M94A 4K4VA 1C0TA 2OPSA 4JV2A 4F4XA 2YKNA 1S1XA 3Q8SB 3GQCA 2BASA 4HU3A 1RT5A 5I3UA 4O44A 3OL6A 2OPRA 2YNGB 5J1EA 1TQLA 3MEDB 3MF5A 3PW0A 2IC3A 1HARA 5KT6A 4Q0BB 3HVAA 1JLAA 3FDSA 1RA7A 3DRRA 4LJ3A 1K1QA 1NHUA 3BJYA 3RBDA 3DRRB 2J6SA 1GX6A 2V9WA 3ICLA 1HMVB 4NCGB 4JUZA 3KK3A 2AWZA 2BE2A 1ZTWA 1QE1B 2W9CA 2ZE2A 2WONB 3QGHA 3IRXB 2W9BB 3T5JA 5KG7A 1S9GB 4J9MA 2HWHA 3CJ2A 2AX0A 1S1WB 3LP2A 4R5PA 2HMIA 4RW8A 4ZHRB 3D28A 3KMSA 1S1WA 3LP2B 3DLGA 3M8PA 2YNIB 3DM2B 3N6MA 3DRSA 3UQSA 1ZTTA 3DLGB 1DTTB 3BSOA 1MU2B 1JXLA 1S6QB 1SUQA 1IKXA 4RNFA 1QUVA 1VRTA 1YVFA 4H4OB 4K4UA 4ICLB 3I0RB 2ZKUA 4Y9MA 5C25A 5EWEA 3OL8A 1R0AB 1HQUB 2XI3A 1LWCB 2VG5B 3H59A 2YNFB 1LWEB 3C6UB 3FQKA 3KK2B 5KT5A 5J2MB 2IM3A 4FS1A 5JXSA 1N5YA 4WZMA 3SI8A 1JLGB 3V6DB 4RNJA 5KFSA 1T3NA 5KT2A 3V81B 4LSLB 4RZRA 2VG6A 1RTJA 5J2PB 5J1EB 3H98A 4IFYB 2RDIA 3CO9A 4WE1B 4URGA 3CVKA 4IFYA 3MR6A 4RNIA 1DTQA 2XCAA 3KHHA 3E51A 2AU0A 1IKWB 5D3GA 1BQNB 3E01B 4HYKA 2CJQA 3KOAA 2ASLA 3H2LA 4IG0A 4F4YA 1HQEA 1TL1B 4RW4B 4ECTA 2WCXA 4Y2AA 1J5OA 3M9MB 5KT4A 1RTIB 5T14A 2FVPA 3G86A 3GV5B 3KHRA 2BQ3A 3LP0B 4GC7A 1UWBA 1RT7A 1WNEA 5DG9A 2HMIB 3T5LA 2UVUA 3DYAB 3FFIB 3OL7A 4YR2A 4ZVGA 4KAIA 3QGGA 3KLIA 4QWCA 4Q8FA 1D0EA 3GFZA 2HWIA 2V0NA 4DG1B 1JLQB 2FLPA 2WB4A 1T05A 3KJVA 2YNFA 3KK2A 5HLFB 3OLAA 2B6AA 3I0SB 3MR3A 4RW8B 4NYZA 4ZHRA 2AQ4A 1T05B 5KFFA 3BSAA 4TLRA 3RB3A 2DPJA 2RKIA 3CDEA 1DTTA 2RKIB 4ECVA 4O3SA 5KFNA 1VRUA 3I5CA 1T03A 2QE5A 1TV6B 4ZPAA 4K4WA 3LP1A 4KSEB 2E9TA 4ECWA 4KV8A 4WXOA 3MFIA 2UUWA 1HNIA 4O4GA 5KT3A 3QO9A 5HP1A 4FOKA 4QWBA 4ECUA 4KO0B 2R6OA 1C1CB 4IKAA 4Q44A 4Q45A 5KFEA 5HBMB 3GV7B 4ED7A 1C1BB 2YNHB 3MR5A 2IA6A 3CJ4A 3T5HA 4ED3A 1HQEB 5KG2A 3UR0A 4Y9OA 4XO0A 2C28A 1OS5A 1IKYA 3LALA 1FKOB 4QWDA 4EBDA 1S0NA 4WE1A 4URQU 5C42A 3KK1B 3FRZA 1TKTA 3E01A 3T1AA 1RT4A 2CKWA 1D1UA 3GFYA 4TXSA 4ID5A 3KLIB 3NBPB 5DG8A 4TN2A 5I42B 4AFYA 1SV5A 5KG1A 3BQ2A 3LP0A 5KFXA 1S1UB 4TY9A 2IM2A 1RT7B 4RNMA 1I6JA 2B6AB 1RT6A 4LSNA 3C6TB 3GIKA 2C22A 4J9RA 4MFBA 1LW2A 2R2RA 4KFBA 4IFVA 1S6QA 1SUQB 4IG3B 2RF2A 4NLQA 1FK9B 1RTHB 1IM4A 4ECXA 5DG7A 1HQUA 4KKOB 1HNIB 2IMWP 2B5JA 3QIPA 2W9AA 2AGPA 1REVA 4K4XA 3IG1A 4I7FA 4KHMA 3HVTA 3T19A 4MKAA 4YR3A 2D7SA 2O5DA 3CWJA 3IRXA 5C24B 4F48A 3DDKA 5DLGA 5HROB 2IAJB 4RNNA 3D5MA 5KFVA 4IQXA 3SFUA 1TV6A 2RDJA 3GFXA 4G3IA 1IKYB 4QWAA 4YQWA 5KG4A 2OPQB 1RDRA 3CIZA 3PW7A 2BQRA 2JLEA 4ZP6A 5HBMA 1IKXB 4H4OA 4K4SA 2GIRA 2E9ZA 4PWDA 4DL6A 3QIDA 4FS2A 1KLMA 1QAJA 4PQUA 3SY8A 1N6QB 1KLMB 4DL3A 4EEYA 3H5SA 4K4ZA 3KLHB 2VA3A 4ZP8A 4MK8A 5KFPA 5KFMA 1S6PA 3MTKA 4XPCA 1SH0A 2BANB 4AG0A 4ED1A 3KLEB 1S1UA 2JEGA 4F50A 3V6DA 4IH5A 4J9KA 4I2QB 1RT6B 3GYNA 2W7PA 3PJTA 3C6TA 3CJ0A 2UVVA 4WXWA 4OL8A
chains in the Genus database with same CATH superfamily
1WUFA 4W89A 3ORWA 2Q6BA 3LPGA 3P61A 4M5DB 3INPA 2A1YA 3AICA 1W37A 2CZ9A 2EKGA 4UR7A 5I3HA 1HBNA 3GC5A 1YDLA 1UIPA 2W6RA 3RDKA 5A95A 2R7QA 2BXVA 2RRNA 1WQ5A 1WV2A 2FVQA 1H3GA 1PGZA 1PS9A 1XRTA 4B92A 4DR3F 2MUCA 5A3HA 1WTBA 1K8YA 2DNHA 1GTHA 2ZRVA 3M0VA 5B80A 1KLZA 4ZLPA 3L9ZA 4J90A 2HVOA 4V19J 3PWGA 4BWMA 1TK0A 3OL9A 3VM5A 1VQ9S 2Z7KA 4MVAA 1XIEA 4BF5A 4IIEA 5J1NA 4RW9B 4O0IA 2RRBA 2J4GA 3DFPA 2GWNA 3BWWA 4C48A 3HPZA 1L6SA 4JTTA 2DH8A 3WUFA 2E9RX 4FNIA 1AB8A 3VKDA 1JCTA 4C65A 1W8GA 1PIGA 4HA4A 3EZOA 3VVGA 1FX2A 3KRUA 1S9EA 3B8TA 3CDWA 4EACA 5CGMA 1W54A 1RWOB 2M88A 1M7PA 3CQKA 4J1OA 1C1BA 2R94A 4AL6A 1WHVA 1XSJA 5K2ZA 2VWTA 3ABRA 1XR6A 5C9UA 1R9XA 3AIWA 4R27A 3Q89A 2EFPA 1NP2A 2J74A 5C5JA 5DFAA 1R8HA 3MSRA 1MW2A 3RN6A 1VRDA 1FRXA 1UEUA 2PDIA 1IWAA 3IJ6A 4LC6A 4XDDA 2H9AA 5E3PA 3MP4A 2NXIA 1K1SA 1GXUA 1FHLA 1RTIA 3W1XA 2V5DA 3K8MA 4GC6A 1C93A 4Z2XA 3RW7A 1UA7A 4PRFA 2HEJA 1M1GA 1NHVA 3L4WA 3HFTA 3O2IA 5JU6A 3C15A 1EP1A 3VC6A 3DHUA 1LQAA 2VQUA 5LKYA 4QR0A 3HIJA 2EK1A 2XZDB 3UBPC 5H2ZA 1YRXA 4Q2MA 1VCFA 3U2ZA 2YNHA 3LXBA 4MH8A 5REQB 1YLXA 3GONA 3ARUA 3DG3A 4Q6XA 2P88A 3EA3A 2VR2A 3FSTA 4JEJA 5D09A 1VC6A 2ZA3A 3M8QA 2FHOB 3OGSA 5GNZA 3BKUA 3STPA 4UQAA 1L3VA 3CUZA 2W9BA 1EZ2A 1F6PA 2I9UA 2V8VA 3VD9A 2HQAA 5ADZA 4LRDA 2HE8A 3RTVA 4LUTA 2ACYA 1AA1B 1N55A 1YJRA 2ERRA 1S5MA 1I8JA 3IAM9 2YKAA 3MZ2A 4TVUA 3A4AA 4ACYA 4AH7A 3JB9k 1M0SA 3BBBA 4M95A 3SJ3A 4KF1A 1EDGA 1PJ9A 4KPYA 5BXSA 4XTDA 3D68A 2K7JA 3OSPA 5SWUA 5GJPA 1BQGA 3GXDA 3NKYA 3KLVA 5B09A 2HHVA 1JG9A 5A6BD 1PHQA 4K36A 5BRBA 3KCLA 3P5YA 3HSJA 2OJ3A 2VZSA 3K5PA 2QA4G 2ZRWA 4TX6A 1SH3A 3DFHA 4CNOA 3B8UA 5BXTA 2YKKA 1DHMA 3JSYA 3L5LA 1QHOA 2CLIA 4YN3B 3U4FA 4DX3A 4JNMA 2GJFA 1J8VA 4QIUA 3NGTA 4JTRA 1EZWA 4TKTA 3WIUA 2Y4SA 4LV9A 3HHEA 3EGNA 1SZEA 4J9NA 2P76A 4G8TA 1RT3A 4YY3J 1XGZA 2ZX7A 4D2JA 2O9TA 4IG2B 3CJ5A 4B3SF 2B4PA 4R9XA 5LYRA 3KG1A 2ZXQA 3N4EA 1VQYA 1B3WA 4G7EB 3K2GA 3T7VA 3CO4A 1XC9A 3L0GA 5K8OA 4DUVA 1R8BA 1VK8A 3J81U 3G8SA 4H2CA 3UG3A 5GAGI 3LTSA 3OLEA 3IC1A 2DW6A 1RP5A 3DRPA 2OUGA 3WJXA 4HCLA 3QGPA 3VF0B 1PJ7A 2EG2A 3GVQA 2QEZA 4IT1A 3JSMA 2FJXA 3NIYA 3LLFA 2BXZA 4G9PA 5CLWA 2VFGA 4J3XA 3SI9A 2AX1A 4OYIA 4YEAA 1EHAA 1S48A 2YBUA 1R3TA 3TTEA 1SZFA 2X2GA 1Y5IB 4F2BA 3UD4P 3A4WA 1EKRA 1B0IA 1GONA 5A0YA 3TUUA 4PG7A 1WP6A 2L08A 1D2KA 4H41A 1DFDA 2R4FA 5B0DA 4IH7A 1MW3A 3UXDA 3DXSX 3W2JA 3UZYA 4H54A 1Q7YT 1KFKA 1G3OA 2ZX6A 2D73A 4GBUA 2V6AA 4OX7A 4LREA 3BARA 2EC2A 2C2RA 3IN5A 2PB1A 3TROA 3N14A 2ISWA 2QMJA 3W26A 2CEQA 3CZEA 3AODA 2XFWA 1KDNA 4ZXOA 4RWWA 3BSMA 3MUY1 4BEQA 4ID8A 2VZOA 1W3IA 2VEMA 1F76A 4L61A 3CCWA 5AHIA 3AIVA 1DXFA 4X4SA 4C6EA 1BXBA 4UQDA 1B3XA 4H00A 1CTNA 4IRDA 4MB5A 2VGIA 2YNIA 3DM2A 1OEPA 4ZO7A 2J8GA 3DLHA 3RR4A 2E8YA 5U4NA 3DOKB 3MA8A 4DQSA 3WLMA 4C6JA 5J2NA 5C25B 3V1HA 2Q8ZA 1BD0A 5LIUX 2EJAA 5A8WB 3S8HA 3TV8A 1LQ9A 2YA0A 2CITA 3AXHA 3NQDA 2BVWA 5AC4A 3DGPA 3VX0A 2WC7A 2IXVA 3I96A 1TKTB 3V4IA 4NU7A 1DAXA 3BQ1A 4RK8A 1QW7A 1S57A 2LQ8A 1JNDA 3HD2A 1XFBA 2GQ3A 1KM3A 3SV4A 3S47A 3WQ5A 2C2OB 2OO0A 1SIZA 4DLFA 1Q65A 3H7UA 1T8QA 3W29A 3AFGA 2PFFB 3PKYA 4W93A 4YU1A 4IIBA 1FRLA 1BWLA 1TQLA 2HVEA 5HBFA 3B8HA 2IC3A 3OVQA 2C1GA 5KT6A 2ASYA 3DRRA 4N9DA 4Y0FA 3GCXP 3MR7A 4KWUA 3U2CA 3S3GA 4EZ6A 3USZA 4A21A 2BE2A 5JIWA 3TZYA 4AF0A 4HQVA 3O6QA 1O5JA 2QMKA 3AQOA 2AV5A 4DV7F 3DOPA 3PSVA 4QEHA 2WSPA 3B06A 2RUGA 1TCDA 2VZVA 2VJXA 1S6QB 4AY1A 4RNFA 4GH3A 1Q6QA 2VJUA 4ZCIA 1R0AB 3SY1A 1SR9A 1HQUB 3ONBA 3H59A 4R7JA 1P0EA 3THTA 3VAJA 4E2FB 3VFCA 3LTYA 2IM3A 5DEZA 3MCNA 3LPYA 1DKWA 1G9HA 2PDUA 3W2KA 1TWWA 1A3WA 3EWGA 3FKKA 2A3LA 2YWHA 2YB4A 3ZFHA 4X4RA 4KTQA 4RU2A 4D8AA 3KWMA 4KQNA 2NXHA 1QDSA 3VM7A 4M3PA 5G1YA 1SBRA 3H4WA 2VDGA 1C29A 1Q8JA 2QAFA 2ZFHA 2WCSA 3C16A 2L41A 2GK1A 3L7RA 4LFYA 3KL3A 3B78A 2B4UA 4OX9F 1XBWA 4O12A 3MO4A 1P7TA 3OTRA 3TONA 4U96A 4PB5A 4BEUA 2CBUA 2WNZA 3FA3A 2FPYA 1VLIA 3R13A 5GMKa 2BTMA 2AJ0A 2OLAA 2ZADA 4NJKA 1U5JA 1YGYA 1DARA 3SSJA 1DJWA 1T96A 3Q23A 4QIFA 2REQB 3QKEA 4MPQA 1N0VC 4JIPA 4LBSA 2AQ4A 1T05B 2HQCA 2MZTA 3W2VB 4XZ9A 1RKIA 4L9ZA 2J8TA 3R8GA 3WEZA 4IOTA 3WLKX 3QFEA 2HWTA 2QE5A 5CA5A 4ZO9A 3CC2S 1KTQA 1U02A 3MFIA 3R3TA 5HP1A 1YPIA 1VF8A 1CGWA 4ED7A 4B3TF 3PDNA 2CAJA 4U10A 1QHPA 3RCNA 4ED3A 1F61A 4XO0A 1R9YA 3LK6A 3R5DA 5DDQC 1N33J 3HHLA 4G56A 1N8IA 1XIQA 2VUGA 2X1FA 3H23A 3VCDA 1CT5A 4P8XA 5LA0A 4CM2A 3HHLD 2GHVC 3A8EA 3CUFA 1U2YA 5I3GA 3VMOA 3QR1A 4BF7A 3TWBA 3BLEA 2V2HA 1MMFA 4DNHA 3WJYA 3C6TB 3CW2C 3AMCA 3P4UB 4P7QA 1LUCB 4KH1B 2IMWP 2XIOA 2W9AA 1R38A 3RM8A 4AF0B 2MEWA 1GOWA 1RU2A 2GJNA 2WJDA 4IQXA 5KFVA 3QMQA 1W2VA 3PZOA 3PM6A 2WB1D 3KP1A 3GXNA 4YQWA 4A35A 2IBOA 3U7VA 4LT6A 1LXJA 3R89A 5DY2A 1H5YA 2KZZA 1WPCA 3GUGA 3SSRA 4KWOA 4CLKA 3BTNA 3NCRA 2ZYFA 4UIOA 3HJVA 4GNVA 1R9ZA 4AD5A 4PBEA 1KNWA 1W1TA 4G1PA 2EBNA 3NY0A 4QR1A 5KG6A 1DWFM 2HBZB 3GIMA 1SL0A 5KFZA 5DCBA 2VELA 4M24A 4IGNA 3R5CA 3SXLA 2UY5A 1TA3A 4JTSA 2VU5A 2B3TB 3CHVA 3OBAA 4PMZA 1ZJAA 3A9IA 4XKYB 3OIHA 2WMIB 4AMAA 1R30A 2JX2A 1I51B 3VDAA 3PJ9A 4AZCB 4PQAA 4WJXA 3WJSA 2DPIA 1K70A 4W85A 5AYXA 3VD7A 2VL4A 5J8LA 1U33A 4H8UA 3VQTA 3W2VA 4GUIA 5KZEA 3AJDA 2GJXA 4ZPWR 3YPIA 2HQFA 2CJYB 5E9AA 2V3FA 3V5RA 1B64A 1E43A 2IDEA 2E9MA 4N9EA 4NRSA 3U1LA 3C52A 2V3DA 1G4PA 1JLEA 1UH2A 5MAOA 1TJRA 4GNJA 1ME9A 1XPGA 5DLCA 1I5OB 2HNYB 2C1IA 2UUTA 2EFNA 3S1XA 2XMVA 3CIXA 1Y4ZB 1MWZA 4E6MA 1HIYA 2N7CA 2B5JB 4YDDB 2PF0A 3ILLA 3H2OA 1F60B 2VBWA 5D4OA 2JALA 9ATCB 2ZH4A 1BWKA 1UWIA 2P0OA 2ATMA 3M0ZA 3ARXA 3PX0A 1KFDA 2O0TA 3IJ9A 1OCNA 4BQ2A 4WIQA 3H20A 2XVNA 5G2WA 4RNOA 4H7CA 4YB7A 5B08A 3M8YA 4FP9A 2ILZA 1GOMA 1Y0EA 3MOJB 2ZHBA 3LTPA 2QUNA 5KFLA 1JLEB 3SCSA 2CNNB 2X1AA 2WOMB 1GTEA 3GNOA 1RCOB 4B9LA 4HN8A 5CGQA 3SCQA 2VCCA 2PRMA 4K2XA 1NDCA 4UOCA 5EBUA 1H11A 3CJ3A 5DS7A 1US3A 2IRYA 4N8OA 1EETA 3CJQA 3P14A 2OPRB 4HZ7A 4O3RA 2RVJA 1F3TA 4OZOA 2XDFA 2BEFA 5L9XA 4MLJA 2G95A 1GZGA 2W62A 2E66A 3WLSA 3TFXA 4KCTA 1EH9A 4RNHA 4E4UA 1HW9A 3UQNA 1R6YA 4Q8EA 3AO0A 5KFWA 2QJJA 3LAMA 3SFGA 4EKJA 3MBDA 4LYQA 3RO6A 1O51A 3SGZA 2D69A 1W32A 4YVPA 1JMTA 4QTGA 1K9EA 2FB0A 3PANA 4HP5A 1SFJA 4DCJB 4K39A 2E28A 4UNIA 2VQFF 4RW7B 2P3ZA 3VC5A 1LFWA 3IG1B 4PTWA 1U30A 1UD6A 2D3NA 3CJ8A 2KT3A 3W1LA 2AGQA 4POCA 1R3VA 1U1NA 4MZ1A 3S2JA 1EEXA 3SSZA 3WDJA 2OTLS 3BGLA 4FNQA 4QXIA 3G2GA 3HD1A 5DBUA 1Y3JA 2W4XA 3GYXB 4CN6A 4GCAA 1XNQF 2ZRYA 4H9YA 1V7AA 5HL7Q 2C2DA 5E6ZA 4IDKA 4UZBA 3WQOA 4LUBA 1LROA 1GMUA 3PX4A 3L2IA 1P43A 1L6FA 2KT5A 4WDTA 4B15A 3ELHA 2ALDA 3PP7A 4GJ1A 2E7XA 3VD5A 3K7RA 1S3HA 1T0OA 5EX0A 2D2JA 4LF1A 2NWRA 3K4WA 3G1VA 1W25A 1E6XM 2HROA 2O92A 2XWDA 4WF7A 4D6CA 3NZPA 4JIIX 3KJVB 1M68A 4WKYA 8AT1B 3L12A 3UWTA 4DJDA 1FX6A 3EWZA 1UWRA 3CB4A 2FVRA 2ZJQQ 1PX3A 3AQUA 5PTDA 4JQ1A 5F8JA 5HJLA 3WBWA 5FSEC 4WXYA 1BY9A 3AXMA 2PDJA 1E4MM 2B8PA 3WH6A 2D9PA 3KLGB 4G1QA 1DIKA 3NR0A 4HHLA 4KT2A 3VNKA 1XYZA 1G7VA 2XTKA 4LSZB 1UD8A 1KM5A 2ADAA 4ZO6A 3GV8B 5D4LA 4DV0F 3UY8A 3FEZA 3POTB 3HMCA 1T3OA 1KTCA 4QJ1A 2DXEA 2VOTA 1RXOB 4IICA 4UZUA 4LUTB 3VTIA 1WD6A 2YL8A 5BCAA 1YWXA 4Q8WA 3DC2A 4E8GA 1Y7PA 1EUNA 2VOMA 4TO8A 1HNXJ 1IT8A 4ZPCA 2YXLA 1NTHA 4PCSA 1IBKJ 4LAKA 3S83A 2ZRUA 2MZJA 4LYKA 1BSIA 4MYAA 3FQLA 2L3MA 4CU7A 3UW6A 1J5OB 2GUUA 1UJQA 4HK5A 1LFPA 2QCHA 3TQ1A 4JX5A 1ZS2A 2GSJA 1TTPA 2A3AA 4QGCA 2Y1IA 1UKTA 3T8LA 4QG6A 4OI0A 2X1RA 4AZBA 4MT1A 5CZTA 1Q16B 5KFDA 2Y0SD 1CULA 3SDEA 1YIXA 1XH1A 1QNOA 3AALA 1UW9A 1KD1T 4DV1J 3O15A 1JLFA 1J4EA 4HACB 3P67A 5A2BA 1WDWA 2GOKA 2BJEA 2F6UA 3CEPA 1QUMA 3VGDA 4EXAA 3V6HA 2CRLA 1MZHA 3E96A 3LS9A 3SUVA 3T6CA 2AL2A 3OIXA 1N5VA 3VGGA 3ZS4A 1OSCA 1M5VC 1VOMA 3HO8A 2YNGB 3PW0A 1MVYA 5T91A 4C3KA 4Q0BB 4J5NA 2J6SA 3DRRB 1Z42A 3BR8A 3GIRA 3OXGA 3N6QA 1CIUA 2VRQA 2ZBTA 1HBUB 3IRXB 4NXKA 1P0DA 2YWKA 1WHYA 3NA8A 4DPYA 2XY5A 4F0HA 2G3FA 1TVNA 3CL6A 4NJJA 1BLUA 4JP8A 2XMWA 3LP2B 3KMSA 1I6JA 2DHGA 3MAQA 4HD5A 1CJTB 1ZM3A 3UYCA 3BSOA 3LTOA 1FE4A 1UVJA 4DR4J 3E9AA 3KCOA 2FZDA 4FP1A 2BJ1A 1ECQA 3P74A 5D8WA 3QM3A 3WL1A 4FS1A 3H2VE 2PCQA 3QY7A 1R43A 2MSTA 3KNGA 2GZOA 3AMKA 2VG6A 2ACRA 3J7HA 4FO4A 3H98A 3S42A 4URGA 4C60A 4Y2KA 1BQNB 4HYKA 4KCVA 3IGXA 5T14A 1OFRA 1RTIB 1NK7A 4JHMA 2DT1A 1JJ4A 3DLLQ 2PO4A 1UWBA 2OAUA 4RE3A 2X16A 2DKOB 5D6GA 1U0HB 2F63A 1QTWA 2NXEA 3AHXA 3U0HA 4AHOA 4HU8A 2DHHA 3M6VA 4OYZA 3TYBA 2MKJA 1B54A 2ZCGA 2ZKTA 3UYIA 1H1NA 1PKUA 3ENLA 5KFFA 3H12A 3RB3A 4EPBC 3GTIA 5M2PA 4AQLA 3UZ5A 1YW1A 2C7FA 1T8XA 1V6VA 1W3LA 2FVMA 4GVBB 2R6OA 5AOUA 3SRFA 1OJ4A 3TRGA 3SUTA 2LQJA 3H4GA 2MNRA 2WB5A 3UDCA 3CD7A 3W62A 1U83A 4PSPA 5D9PA 2XMUA 4QYZK 1AD4A 2I57A 3C0SA 1S5NA 4PUNA 3W5YA 3KM8A 4AD1A 1HL8A 3S5SA 3HFKA 4DR2J 4ID5A 2HS4A 1JYXA 1B0PA 3EDQB 3E6EA 3NOEA 4DUWA 1S1UB 4EGLA 3S01A 3FZ2A 4L72B 1YTYA 3NVDA 1E56A 3CULA 4GXWA 1FDDA 1S6QA 1YRUA 3R6GB 3S9YA 1VEMA 3BG5A 3OXLA 2XO6A 2DGWA 3CB8A 2AOSA 1RTHB 3TOYA 5JXQA 1HQUA 1L3TA 2OTDA 3QIPA 3VIJA 3IG1A 1PYOB 2HIYA 2FJEB 4KIAA 4AYGA 3GSDA 3MI3A 4PA8A 4XZLX 5HNTA 4Q7NA 2UXBF 3RIKA 3TXVA 1TV5A 4IWWA 4Z1DA 3LQVA 2ZUVA 4USWA 5I24A 3GNNA 2Z2LA 4YDXA 3AXKA 4PUWA 2M2BA 4L64A 4RZBA 1IGSA 1SO6A 3CBWA 3LM3A 1QVGR 2HCVA 4HMNA 6TAAA 1UBPC 1K9MT 3L68A 2QF8A 1VQTA 1NQ6A 2K8GA 5KFPA 3IIXA 4XPCA 2QJGA 1UUMA 4Z2JA 2BANB 3SRKA 3I56S 3HPAA 4RXGA 2E5DA 3R4IA 3UP8A 2Z24A 3CJ0A 3OVRA 4GQ0A 3U1NA 4HOZA 3Q8QB 4P8UA 4Z2IA 3CXOA 1B0VA 3GDLA 4FNPA 4O3NA 3WHIA 2DJLA 3NZQA 1MUWA 1U22A 3RLUA 3NG8A 4DV7J 1KC8T 1FFGB 1NH6A 3UVJB 1C90A 3DKJA 5FF2A 1K44A 1XM3A 5G4WA 4KT0C 3OVPA 4C1NB 1S12A 3GXPA 3L5AA 1KTVA 4UT4A 3DOLB 4ECSA 4GNKB 2ZE2B 3BZGA 3MM5B 1VBYA 5I09A 3FYPA 3WBXA 1JNEA 4YFUA 4RLIA 3BAKA 3QZEA 2HNZA 2VYOA 1LZOA 3CWHA 3SCUA 3PWAA 1GX5A 4ZK7M 1EOMA 1GKRA 1TIWA 3KVKA 3C8NA 3AOAA 4WU2A 2DH9A 1UD5A 1TMJA 3W2UA 4PB4A 1XRSA 4XWUA 3D66A 2XGIA 4AW7A 1E73M 2RHSB 1K1DA 4GUFA 3UGVA 2FHJD 4J9QA 2ZZ1A 1UW4A 1OT2A 2PDWA 2WOMA 1OY9A 4B3ZA 4WJEA 5AN7A 2JVOA 1QRQA 2FZKB 3TVZA 1Z41A 4GKLA 3QZ6A 3VDCA 4ALDA 5KFHA 4QROA 3VOFA 1ZQ5A 3LCFA 1ZZFA 3IAQA 4GYJA 3A12A 1EETB 1UD2A 2QSFA 5B0GA 3UR2A 1HKJA 3KJFB 3LBCA 1IBMJ 1QAIA 3HJFA 4FF7A 3EZUA 3IM9A 2Q66A 1XUZA 1HJVA 1CX9A 3P93A 3MMUA 1CZ1A 3H4BA 3FEQA 3L2LA 4RR5A 5CYQB 4GUJA 2EHHA 1JDCA 1BQXA 4PEKA 1NQKA 3F7JA 4C6OA 2X09A 1I75A 4DR7J 3G8TA 3FJLA 4NNBA 4WOQA 3NQ8A 4CNUA 4H3DA 4OUEA 3LMYA 5FJRA 3LPPA 1L2QA 1VLYA 4RDYA 1SZRA 4Z2HA 1W0MA 4X66J 2F9JA 4QLJA 1RAIB 2PA6A 2HQIA 4L6V3 3TTQA 1UR0A 2PEHA 3LRMA 5JBFA 2EKYA 3MEEB 2VIHA 2CFXA 3VDHA 1V3SA 3ARZA 3EXCX 3MMCA 3NBPA 2HKEA 3JAMU 5A8PA 1X98A 5I3IA 4PXCA 3GW0A 1LG2A 1S2WA 1N8FA 3AIUA 5GVQA 3CXCR 5BYRA 1L0PA 3TI0A 3H5YA 3OVAA 1NB7A 2D3UA 4WY0F 9XIAA 2M3DA 4JL2A 4Y9PA 1YTDA 3JTNA 2JGQA 3BLKA 2YXGA 1KOOA 3EXYA 3BLLA 4PRWA 4RPQA 3W74A 3J7AN 3L23A 2BACA 4CLFA 4BFAA 1F3WA 2V4RA 3REQA 4DLGA 2HS0A 4X0VA 4NLDA 4PWWA 5AHEA 3L0NA 1NSJA 4NLSA 5E0KA 4QE5A 3P5TL 4Y8FA 3M0YA 4HJFA 3G1YA 2V8HA 4NRUA 3BV7A 2XWEA 3NQAA 2KXHA 4F0MA 1NO8A 4KIEA 2F40A 5LXXA 2DV0A 1FDZA 2OQHA 1UQYA 1ZJBA 5E41A 4LF9J 1KVIA 1YDYA 4MB1A 3PTDA 5HWNA 3J80U 1OGSA 1F5CA 3MHYA 2W0UA 3MI6A 1VQ5S 3UW1A 4RL3A 2E25A 1B4EA 2OZ3A 4NRTA 4BHQA 2HK0A 4CLUA 1ZYQA 3O5TB 5B0BA 1NKCA 2DZWA 1B57A 3M4HA 4MZYA 3M2UA 3LGEA 4DHVA 2JEIA 4CKQA 3EVMA 3TJ8A 4FF3A 3TKFA 5I00A 4I7WA 2QL7B 3W60A 3D1QA 1F74A 3W7MA 1MN9A 3RAXA 1L9WA 2G3JA 3EMTA 4OI2A 3L3CA 4Q8PA 4PSRA 1ICEB 2YL6A 3QC3A 4PGLA 1FXPA 1O1ZA 1IKVB 2FC8A 1GQLA 1AJZA 1G4EA 4RJVA 3FFSA 4LUSA 2HNHA 3CMFA 4K6AA 3W83A 2HS3A 4ED2A 4S3CA 3FBEA 4Z1BA 4M5MA 1IXOA 4K38A 1C8XA 3WD0A 5U47A 1XX1A 3QH2A 4I2PA 4K4TA 3CIWA 3I82A 1XYMA 1TRDA 3C19A 1BWVA 3PVXA 1G6CA 3CJKA 5E0OA 1KB3A 4O0QA 3PR4A 4B3RF 2Y7DA 2ALRA 1H72C 3URBA 4P7OA 4IRCA 1TTQA 4ICNA 1SXLA 3EKZA 4CNTA 1XBYA 4JTAA 3MEDA 3DCPA 1DXEA 4YHHJ 1S9EB 4DUYF 1UASA 2FLOA 4S3FA 4DUZJ 5D3GB 2ZH9A 1TWDA 2QLXA 2IM0A 1EWEA 4Y6GA 2QG9B 2I7GA 3IIZA 3AHPA 4IJRA 3MEGB 1Y0HA 4CQCA 4KFNA 4UFKA 2PU0A 3DERA 5IOBA 2ZITA 1WAUA 1XYCA 2QKFA 3FS2A 1SO5A 4TNOA 3B0XA 4JQ2A 2A6MA 4C97A 1OD8A 2O67A 3MJYA 3ZWTA 3MMAB 1AXQA 4K8RA 4GI4A 3FX4A 3EEGA 1W3HA 1YG0A 2BX6A 2DFAA 3R27A 4YR0A 2QCDB 5CPOA 2OSQA 1F1BB 2RQKA 3EPOA 3AA8A 2UV8A 4A8SA 5J2MA 4KCWA 3GIIA 1KBJA 1SKWA 4LUYA 3THPA 4C6DA 4TU8A 1S1PA 4MTPA 4JV2A 1JXJA 4YS1A 1TL7B 3EB4A 3WIVA 3DFQA 2DR9A 5E09A 2I5IA 3OL6A 1KXTA 3BF4A 3N12A 1VRXA 5D4PA 2C42A 1BC6A 1E40A 4Q5VA 4DR1J 5A6KA 1CJKB 3VOIA 4XZMX 2KB2A 3R97A 1HBUA 2UZAA 5KG7A 1ZSXA 1MN7A 1NHKL 2V2KA 4ZHRB 5XINA 4HSNA 4AUKA 5EHHA 3M64A 2QT3A 2QIFA 3WBEA 4ZSUA 4GVHA 3G82B 3K5XA 3UEQA 3KOXA 5HMZA 1RH9A 3KOZA 3MVTA 5I79A 2QT7A 1NJWA 1HHQA 1XW8A 2G13A 2VKRA 4NYYA 4NL5A 3TOPA 3AWOA 2VD3A 2DITA 3DGVA 3M0KA 4NEYA 1CC7A 3ITGA 1XBZA 4F40A 3FZBA 1K6AA 2ZNZA 1IXQA 1N5QA 3LI0A 1J93A 4JFUA 2GVJA 2EFGA 3W1PA 3NVTA 1B99A 3KBWA 3A3HA 2YBVA 2XSAA 4ZVGA 3PO4A 1QI2A 3QGGA 5H9FK 2DDXA 3QPYA 3G82A 2C91A 4XZHA 2V38A 1YDOA 2DGUA 5AHLA 1T0TV 5HLFB 4PTXA 4DPUA 2Z8QA 4CCZA 1KCLA 1SIWB 3PR2A 2H4WB 1E55A 4HACA 1ZJIA 2YCJA 5G0RA 1M3UA 4DRSA 3ARTA 2XSFA 4C6FA 3A13A 4KO0B 4F0KA 4AL7A 1UB3A 1RPXA 1XLKA 4GKJF 2JIEA 3WQ4A 3WNOA 1VQKS 4DR6J 2P6SA 2PDLA 3BW2A 3BLDA 5KG2A 5D0HA 4EWTA 3CPRA 3U8GA 2DIVA 4DL0C 3W27A 1FTXA 1YLVA 3PYEA 3D46A 1QWGA 1HQ2A 1Y11A 1V93A 5KZDA 4WU3A 5A8NA 3W1QA 5KZ6A 2GVDA 3FYYA 3KS6A 3GE7A 3ITYA 4X22A 2LA6A 3OHMB 3NURA 3TWZA 4I6WA 4OZ0A 1TUFA 4AFYA 3ZZYA 3KCJA 1LORA 3LP0A 3IJLA 5CC3A 2BVDA 4Y90A 1OX4A 3BPWA 2LEPA 3OEXA 1B90A 1JPMA 4PYAA 1JXVA 3EICA 1CJKA 2ZXDA 5E0CA 5JMUA 4CLWA 2JEQA 4MKAA 3PPCA 4ACZA 1FVSA 2LKZA 3JQMA 2YKOA 2Y70A 5D03A 3WMSA 4RNNA 1JD7A 4AZHA 1TL5A 3AHZA 4PRTA 1R3RA 4K0KF 2YFOA 4BBYA 5KG4A 1Q6LA 3G18A 1E6PA 2PGFA 4JGDA 4CD5A 1NJZA 2R1LA 3SAZA 2V81A 2WKJA 1EJUC 1JD9A 4K3ZA 5IDIA 2XVPA 4W5ZA 3SJNA 4UUXA 2VFEA 4WKFA 3A6OA 2CC0A 4HT3A 4JICA 4DX7A 1DZ5A 3U7BA 2I8EA 2GOUA 4QYZJ 5A6AA 2CQ2A 3QZAA 1X4FA 3NL5A 3L4ZA 2HHQA 5FJPA 5K3VA 1H74A 4LT9A 4EBCA 2YIHA 4CD6A 4WEVX 1E6NA 3U7JA 4PMJA 1HNZF 5A5WA 3WF2A 1FCUA 2DT9A 4KHPJ 4JNZA 2VGGA 1BQMB 1Q82T 2RNEA 4KRZA 4O52A 2ZHAA 4A4AA 4E0DA 2F7FA 2DR7A 4MKSA 3TJAA 3FXYA 3EWWA 4NA3A 4O18A 4GI8A 3CEUA 3OFHA 3TR5A 2FJUB 2PTZA 5FI8A 3M0JA 2ZRXA 4K7VA 3PW4A 2W92A 2INEA 4QPXA 1QBBA 2E9LA 3TK7A 3G1XA 1U0SA 1E5JA 3A3XA 3AB2B 5G5IA 3WK3A 4LF9F 1KQYA 4GFIA 1TPUA 3LZ3A 4ILSA 1J6PA 4DPQA 1SC3B 4X65F 3TE9A 1T9XA 2Q8LA 4URIA 5EMUA 1AG1O 3JUGA 4DSEA 3LGGA 1UBSA 3NMRA 3G1RA 3ANVA 2G3NA 3GIYA 4GIEA 1UEKA 2XLIA 3O05A 1HIZA 2VA2A 1P27B 3GFHA 4C7QA 1LLWA 2W66A 5ETQA 4DV5F 3K5MA 3IV8A 2Q1LA 3DI0A 1AH3A 3CPGA 1QE1A 3PUGA 3A1YG 2EPOA 4AUBA 4QBUA 5LMNJ 1V3RA 1ZETA 2BBEA 2X3DA 3ILOA 4N77A 2NR0A 4PTNA 4UTGA 3AAWB 2XM3A 3LPFA 4RW9A 1DORA 3QT7A 1VGYA 2IPJA 4JHOA 8CGTA 1UH4A 3FKBA 2KTQA 2R8IA 2HHWA 1BYBA 2XN0A 3OFEA 1TP7A 3ILIA 1ZZNA 4GC4A 4PPZA 5EUHA 2EG1A 1AW2A 7XIMA 2WM1A 2YWEA 1RI7A 3QHNA 4DX5A 3M9OB 4GVLA 4ZQNA 2G37A 4LSLA 4QIEA 4KR0B 4WK9A 1E51A 3CUXA 1WF1A 1VCVA 4Q4SA 5H9EJ 3PEHA 2HISA 3IGUA 3CT9A 3RYSA 3N9SA 2EBEA 1YJ9S 2A79A 3IANA 4I3GA 1TJPA 4RE4A 3GBEA 2XSJB 3MPGA 2TSYA 3DFYA 4JTHA 1GJPA 1E6ZA 3GNXA 4C0HA 3CUHA 2YCIX 1VC4A 3CO0P 4KPCA 5EFFA 1AMKA 4CO5A 2VXNA 4DR1F 1W3JA 4PPDA 4UMCA 3LRLA 3C15B 3BGJA 4HTJA 1VQ7S 3W3OA 1PO6A 2REQA 3MCOA 1VCGA 2WWCA 4FDFA 2CYGA 3W7QA 1IBLF 3RFAA 3NGJA 1NK5A 5ABGA 2EGZA 1HBOA 4PRRA 3N1AA 4DO5A 2HHHF 1EUAA 3S1VA 2WYSA 2IKIA 3I3EA 2ALYB 2FTYA 5F8IA 3LN3A 2ZJRQ 2YKMB 4ZIVA 5F8NA 5F4SA 4LYPA 4GISA 3RU6A 4DAFA 2IUZA 1POKA 4F0RA 2EK6A 3NG3A 3W84A 1QAPA 1DTQB 3UD6A 1NDYA 1XCXA 2CHRA 2DT2A 3IVSA 5K8MA 2QV6A 1Y3KA 1W1YA 2YZRA 5CZJA 4DO4A 5JUMA 3RB0A 8TIMA 2AJFE 1BD6A 1L3KA 4P6QA 3I3DA 5DQIA 2Z0IA 2XS5A 3H40A 4NKCA 1XLMA 5C71A 1CGUA 4N42A 4EAMA 1W2BR 4ZLNA 4QHRA 3WD1A 1HJSA 4BR1A 3PZIA 4PUDA 3WQGA 3NRBA 2VPZB 1KHVA 1AK5A 1RISA 4GXPA 1H09A 5LA2A 4Q43A 2BKNA 4DQPA 3KHGA 4KGLA 3T81A 3G4SS 1Q6OA 1O0PA 4N9CA 3PAOA 3F41A 1TR1A 2L9NA 4UUIA 2J76E 2V4QA 5KFUA 2V3EA 4KWVA 2GUBA 2GQ9A 4OZ2A 6AT1B 4O0KA 4NILA 3CIVA 4UQ9A 5M3WA 2FB3A 2CG4A 4H8HA 4H9ZA 3M43A 2AAAA 5F2LA 4C6QA 5DT7A 1RHUB 3UE2A 4L6OA 4K68A 2DP3A 4USIA 3B4YA 1FTRA 4NJIA 2JC0A 4P2MA 2KM8C 1AVAA 3COTA 1MW0A 3R8RA 2R2UA 4YB6A 3G1AA 2INZA 3AXXA 2OJPA 4HL9A 3BG9A 1XJBA 1E0UA 3BSHA 2V82A 1S1VA 2HAIA 2AYBA 2IBKA 2VCBA 3KOFA 2F1FA 5D33A 1D8WA 1G6BA 1AD1A 3A24A 4QSFA 1QO2A 3I0RA 3UVAA 5CEWA 2P6TA 4AEEA 1UCWA 3EXTA 3Q8YA 2ZH6A 2WSRA 4U2ZA 3QXBA 3PWIA 2RGLA 2MQMA 1XD1A 4IR9A 4XAPA 2PC4A 1YBQB 1P9YA 1VC0A 4M81A 1WXYA 3I5BA 1Q7LB 2GGEA 3KJNB 1IXKA 3RCMA 1ZCOA 3MC5A 4Y34A 4QLKA 5FKYA 1H61A 1X4DA 3PG9A 4F4XA 3BO3A 3VAMA 5I3FA 1VCTA 3FGCB 5HUOA 1VQNS 1ZPTA 1OB0A 3E2SA 4A2RA 4A3YA 2GGGA 3FA4A 3OHIA 2WSQA 5B7ZA 1EBHA 4F02A 1KFLA 3BJYA 3WQDA 2XULA 4U5IA 1VRQC 4WY0B 3KK3A 2A5HA 2HQDA 4E8DA 5C7HA 1RJQA 3DKDA 2WSFC 3W87A 1EPVA 5M5DA 2BNJA 3QSIA 4DV3F 4AD4A 2M0GB 3IBFB 3N6MA 3DLGB 1DTTB 5AJ3J 2B8QA 3S2CA 3LHUA 2Y88A 4B9MA 2IW0A 1WXJA 3CQJA 4CO0A 3TUIC 2OYKA 4Q22A 3VCRA 3VKKA 3Q8VA 1PZ1A 3VKAA 3QATA 4F66A 4S39A 2F7VA 3PB2A 1EC9A 1S6UA 5KFSA 1T3NA 3JVAA 3KUEA 1XD0A 1Q4NX 2PSNA 4Z08A 2ZJPQ 2XCAA 2J7BA 4M5IA 4BWLA 1FJGF 1FESA 1FWJC 1O5QA 1DY3A 4PUUA 4JX4A 3G86A 1YJUA 3KFWX 2WKLA 2BOEX 2RDXA 3HQPA 1CQMA 3VGEA 4Z1CA 1IBMF 4DV3J 2CBIA 4MWAC 2UVUA 4J9UE 4OJHA 3EX4A 2MKHA 3KXQA 2P9EA 2QGYA 4EWND 1KQSR 3THUA 1JLQB 1MRQA 4CRJA 4IJCA 4P7NA 1OCJA 1AT1B 3O6AA 3OU8A 4JI7J 3A3NB 4RW8B 1BYDA 2CIPA 3B8SA 3TUPA 1VB9A 1P6WA 4JOMA 4ZPAA 5KTLA 4ZS6A 2E9TA 5G0RB 5T41A 4HHJA 4O50A 3CCJS 2JEPA 1XUUA 2NW0A 5HBMB 3MI7X 4KWSA 5CJ5A 3JRKA 4H8NA 3NOGA 2ACUA 4ZR8A 4OYBA 1F8MA 7TAAA 5DO8A 3OLGA 2X1UA 1TV2A 1YDVA 3E01A 4ERAA 2V34A 1SSGA 2DGVA 4M29A 1LK5A 1L3UA 1XISA 5I42B 3RRKA 2D0GA 1S99A 4ZBCA 2VFFA 2E6DA 4D71A 1RT7B 5D9OA 4JIRA 3RCYA 3EDRB 4WSHA 1Q8LA 2XG9A 4XBKA 2DEJA 4HLBA 4TMCA 4MFBA 4RBVA 5F3TA 2A6LA 2X3GA 4M0XA 2BODX 4BI6A 1REVA 2KX9A 3M41A 3WF0A 3W7NA 4I7FA 3RRXA 5D2YA 1UVMA 1JDFA 3ABQA 2I14A 3DGRA 3GH5A 4F48A 4HNUA 2O7QA 2Y6ZA 2HVZA 1UP1A 3SFUA 4DWDA 2CETA 2QJMA 3W71A 4CQDA 2RDJA 1IKYB 4J9JA 2QSWA 4FHAA 1TQJA 5BXPA 2BQRA 1YIJS 3B97A 4N56A 1R31A 4PWDA 1K4HA 2CBVA 1VEOA 4K2JA 4L5ZA 3ANYA 1C8YA 3CUNA 3NGRA 3TEGA 3N28A 3KLHB 3BO4A 4GC3A 3MTKA 4K7QA 4ATNA 1ZNNA 3POTA 5A76A 5H9FJ 4IH5A 4FLQA 5JVHQ 2IVMA 5E0FA 3ITTA 3C6TA 4DZAA 4EX4A 4DM1A 3W70A 1PPIA 3BBFA 1VBXA 1YKWA 3RZAA 3OG3A 2C13A 2OSRA 3NZRA 3N4AA 1D9DA 2XB2D 2E6YA 2MZSA 2AL2B 1HL6A 3WNMA 1Q8BA 4S2CA 3BJSA 4F4WA 3OGVA 1X4BA 2M70A 3RLGA 2MQQA 2XGQA 1V6TA 4JKLA 4RBTA 3F5LA 1K9FA 2B9YA 2PMHA 3CZKA 2EC0A 2PWEA 3MECB 4DL4A 3NXLA 2GQ8A 4LW7A 3IM8A 3SFKA 1XLDA 5AYBA 4XIAA 4FOUA 4IIDA 3WBYA 4ZITA 4F67A 2D3LA 3C2OA 3AJ7A 5KG3A 5IXEA 1IR0A 2PI4A 3EKLA 1FH8A 2YPYA 4MWAD 4IPIA 3NNCA 1RT2B 1QDUB 4GY7A 3VNDA 3FSUA 2GX8A 4XAKA 4U28A 4DUXA 3CMJA 3OQ8A 4ONVA 3V35A 1Y5XA 3R1LA 1U5VA 2HRWA 1QWKA 5LHEA 2AQWA 1DJZA 2AGTA 1HWLA 4WCEQ 2W9MA 4REQB 2ZVRA 5D02A 5EY5A 4OX6A 2VEFA 1G01A 1IR1A 3NDYA 5HPCA 1UR3M 2IMOA 1IQZA 1S5TA 2W9CB 2EWHA 1QO5A 3ZVHB 2UUBJ 4DF8A 1NARA 3W7BA 3T2OA 2R8GA 3SY5A 4GIRA 1W1VA 3HV8A 5K9XA 3BN7A 2OEKA 3ARWA 3KWXA 2WKGA 2PD5A 4HNLA 2JEJA 4HVXA 7TIMA 1F2JA 1SUXA 1TG7A 3EWUA 4NYPA 3W63A 1VJIA 1ROFA 1PYTA 3WX8A 4P8VA 2FY1A 2V5KA 1XLFA 5CKSA 2PWDA 3UG8A 2Z4GA 2I1OA 3DOMB 3VUSA 2LDYA 3HHNB 4C8NA 1RAJA 2YH0A 1DQUA 3AS2A 4EXQA 4BHYA 1MROB 3MXHP 4TMBA 2BKOA 1RGVA 4PEEA 2W1BA 3O9NA 3NQ7A 3K46A 4HCHA 2QLFB 3K89A 3WH5A 5KFTA 3D9BA 4HTBA 3KBNA 1VFJA 1UKUA 1XMBA 5H8MA 4QU7A 3WD4A 4X4TA 1TUXA 1JLBB 5GNYA 1VP5A 5J2NB 2OXNA 4A05A 4F0LA 4NPOA 3AU2A 3MD1A 2CJXB 3ENAA 1E71M 2EAWA 5I3JA 4M6QA 3ZC4A 3SIZA 3FOKA 3CCES 9XIMA 4QCLA 3WNLA 3NS7B 2ZWZA 4NHVA 1MSWD 1RWMB 4JQ3A 2W27A 3HZ3A 5ABHA 4GA8A 1C1CA 3S5YA 1A0EA 3IGNA 4PODA 4H9TA 4K8GA 4PBFA 4Q2LA 4DWSC 1HI1A 4G1QB 2FUG9 3EXRA 2J8FA 4W7WA 3SECA 3M30B 3W7CA 2C79A 8A3HA 2XFRA 4J35A 1F7BA 4X4QA 3ZVIA 1XH2A 5IS2A 2BVZA 4DJFC 5EKYA 2BE7D 2FB2A 4NX9A 2AJQA 1MDRA 3OW2R 4QZVB 4YCPA 3T9ZA 1LKZA 3IO1A 2EG7A 3MWAA 1VQ4S 4DZ5A 1CBKA 2AQVA 2PSZA 4Y2WA 4NLWA 3QQCD 3WFZA 3OBIA 3GU2A 4I8DA 4HEA9 2J7WA 3GIJA 4TY8B 2CPYA 4JIQA 5G1MA 3JS9A 1V0NA 2VODA 1PX8A 4I9TA 2EG6A 3RB4A 3PTQA 2EKNA 1RAKA 1R8LA 2ROEA 1X8CA 1EQPA 3GY1A 3V6JA 5FIIA 3L95X 3QHOA 1LW0A 3BGAA 2B43A 4UFHA 1KFJA 1WSVA 1GH8A 1W31A 1DWIM 4CNPA 3M1VA 4ZCKA 4N4PA 2XSBA 2CPDA 1BF6A 1WKDA 1VISA 1YSJA 1TKKA 4Y8EA 4UTTA 4JV1A 4J28A 1JLFB 2DGOA 5DRKA 3FVDA 1N36F 4C6AA 1MEHA 3UDLA 1WUUA 2FLNA 4O1BA 3OOQA 1GQNA 3JW7A 4I9MA 1HVQA 3BAWA 4R7WA 4WLCA 1XQIA 4W8BA 5AYIA 3D54A 2Y1RI 2V94A 3VVTA 1X5SA 4LSNB 3DFSA 3V81A 2RJHA 3QQWA 2J47A 2OGJA 4U3AA 4CDIA 1JI1A 1LYXA 3E74A 1VJSA 2G0WA 4DCOB 1IKWA 2DRAA 4QAIA 2HLUA 3QJPA 2FFIA 2LP4A 1B3VA 4K2SA 4NLVA 3OV7A 4LS2A 1XJWB 3M6DA 3UVJA 2PRLA 4NSBA 4IPPA 1K6WA 2PGWA 3UXIA 2J6XA 4X3ZA 1LWFB 5MLCV 1JR1A 2NXNA 5JQ9A 4WY0A 2Z1SA 3KK3B 4JI1J 3ZT6A 2MJNA 2XNQA 3A5FA 1O60A 4HKPA 3GILA 3VDBA 2C1EB 2XYPB 1UUQA 4JI0F 2R8JA 5HMDA 2WLYA 2FZBA 4KBIA 3PG8A 2I6WA 1KTNA 3PS7A 3BURA 2HVNA 2JK2A 3E38A 2XCPA 4EANA 2X05A 5G2HA 1W5PA 5LL6d 2HHHJ 4WZHA 1E15A 4W87A 5HN0A 1BG9A 3AYVA 1IBLJ 2G96A 1TPFA 4NZ1A 4M94A 3R94A 3W5ZA 2K7KA 1KQKA 3H4XA 3V0SA 2YPZA 2GW8A 4OU1A 1HO4A 4PCQA 4QS6A 5I3UA 3EMZA 1WA3A 3GTFA 3TR2A 4BI7A 2AIRB 1D8YA 1MMDA 3OBKA 3KBVA 1GX6A 4DWSB 5HQMA 3MMCB 4NX0A 3MVIA 1NLKL 2QX0A 4I0WA 1MZRA 5A8RA 1VYPX 2HWHA 4W86A 1EF2A 1A7GE 1ZB5A 3D28A 2YR1A 3NSMA 2JEGA 4IRKA 3G1HA 1BUXA 1EA9C 4K4UA 1UJ6A 1VRTA 2Q6ZA 4ADUA 5EWEA 1UZ1A 5ETOA 4G7FA 1X9WA 3VNZA 2PUZA 4YTQA 1R0CB 2FPHX 3B82A 1N5YA 3L4VA 5JXSA 4WK3A 2LXUA 1ZPWX 1S0VA 3HT0A 2Y8YA 3WC0A 3PSWA 2V5LA 3ITXA 2DGSA 3CO9A 1X1NA 4WKAA 4NXMF 1XYLA 1F9CA 3M8ZA 4FR6A 3C0JA 2Q71A 4YYFA 2CJQA 2VFSA 2ASLA 1MWYA 2DSKA 1VYSX 3CT2A 4ECTA 2OT1A 2DSZA 4LY8A 2KRRA 4OYOA 2PI5A 5ETNA 3RXZA 4CLZA 1H63A 4RUBA 4C1NA 5CCLA 5IXUA 1GMVA 1QPNA 1RALA 2ZE3A 3MO7A 3BE7A 3OL7A 2X0SA 3OQ2A 1F6KA 2X40A 1RAFB 4QWCA 3T40A 3MU7A 1I94F 2RDTA 4HT5A 3BMXA 1R3YA 1QOPA 2F9DA 3OJUA 4ZVOB 1O1HA 4GINA 5JVLA 2DZSA 4O13A 4ECVA 5CBJA 1QPKA 1T03A 4O1FA 3GWQA 1GWJA 4IMCA 5ABTA 2UUWA 1ITXA 4C1KA 4F36A 5G4EA 2HGMA 4ECUA 3FJNA 1NPPA 2I38A 4C6CA 3ULHA 2B4VA 2YNHB 4TQTA 3VIGA 1EFZA 4USJC 3KL0A 3UFCX 2VFDA 2ZZ5A 4FXVA 1BVNP 1DJNA 2ABBA 1IKYA 3ONQA 2DXFA 2PODA 4U67Q 3M2VB 1FWAC 2J9CA 3GVGA 4IFOA 4C90A 1ADDA 1RWXB 3CCSS 1PAMA 2YLAA 3GFYA 3HA1A 5M2UA 2R1NA 4QSHA 3W8GA 4DQWA 4NZFA 5E70A 1TPVA 2CQ1A 2UUAJ 5CZXA 4D6JA 3FVYA 4DR5J 1OFBA 4ZIWA 1FWGC 3PEJA 2ZZ4A 3MMBA 3RJXA 4Y2MA 3ZYZA 1UC5A 3MAHA 4J91A 3M7WA 2POZA 3VA8A 2PDKA 1RWNB 4N7TA 2VOPA 2P9GA 1YJWS 4B91A 3MDUA 5AB3A 3RNDA 2XYGB 5F0WA 4GQRA 2JLEA 2MMYA 2E40A 3TTOA 1ZGDA 3RJMB 1YE4A 4MDPA 4F8XA 1Q2RA 1IUJA 5AE2A 4C8OA 4CH7A 3LQGA 4UQCA 3PY8A 4MK8A 3TVAA 3NCOA 3RILA 4DIAA 5BZAA 1S6PA 1GCYA 4FXWA 1DTUA 4ETZA 2Y3YA 2NSBA 3LHVA 4LAUA 5M17A 1RT6B 2R9LA 4B3KA 2MKSA 2GSEA 4C6PA 1KO0A 4WXWA 3IR7B 1T40A 2M5YA 1UVLA 4FNUA 2XN1A 4K8HA 1XRVA 3UI3A 3EAUA 5DBTA 2W4CA 1FE0A 5DANA 5L1IA 3GU0A 3W73A 2HNYA 3CH0A 1XN9A 3K2YA 4P72A 1SL2A 1JDAA 3CMAS 1UIOA 4WX2A 4JR5A 4LQ9A 1EJRC 2DT3A 1NFBA 5KFJA 5FEWA 3RX2A 5SZTA 5D37A 4BWJA 1LEOA 1WORA 3LGHA 3ITHB 1Y5VA 2WZIA 5IT9Y 3C0QA 4DLMA 2QUMA 2CLHA 2WNQA 4IIFA 1LF1A 1N48A 4V2XA 1S46A 3GH4A 3WQWA 4DXKA 2D3O1 4CLPA 1KV8A 3KNAA 3M0MA 2DJXA 1LOSA 1J11A 1OT1A 1TKZB 4N47A 4GG9A 3S6TA 3PBUA 3G24A 3R58A 4NIRA 3LA0A 3O6DA 4XZBA 3NNAA 5AZ0A 2D0FA 4F4AA 2BHZA 1X6NA 2PMQA 1C8VA 2PDYA 2RS2A 3BW3A 2VR5A 4UCFA 1XDJA 1Z6KA 1XIMA 3TAMA 1V7YA 1EF3A 1V3LA 3LXCA 3LBOA 1RD6A 4JTKA 3BSGA 2LQ9A 2R7VA 3M8SA 1RYRA 4YTUA 4Z1YA 2HK3A 3EWDA 4O53A 1GVYA 3DOLA 1RR2A 2B4GA 5L1LA 2G0IA 2PTWA 1VGAA 5IFPA 3QOKA 4JV0A 1KR1A 1EOKA 2GS8A 1V3JA 4MYXA 3T1GA 4XZWA 3H5UA 4OJYA 4E3VA 3UPFA 1HNWJ 2ILYA 1FCQA 3Q83A 1KQZA 1MU2A 2C2EA 1BWEA 2J7FA 3NUKA 3N2XA 4P7RA 2GFFA 5FJTA 4F2UA 3OJGA 1JKHA 1REGX 4WP9A 7PTDA 1P0KA 3W2LA 1GUVA 4Z42C 3K17A 4YS2A 4MWAE 1YK9A 4HR2A 1RA6A 1GGOA 3GLJA 4AZGA 1FX4A 1UTAA 1W3TA 4FXJA 4GI6A 1WCGA 4KKXA 2CERA 1ZZMA 2ZTKA 1JQXA 4AL5A 1KFCA 4TV6A 3C3NA 3GM8A 4A8FA 1XBVA 3MYOA 3PJXA 2XH0A 4GZEA 3DYAA 3HXMA 2D23A 3PZPA 1N88A 1GHRA 3KG0A 2Y1JA 1FEEA 2XEXA 3KLFA 1M65A 2EJ1A 4OV4A 5EMYA 3NZGA 5F2MA 3ET6B 3RB6A 1S10A 2AAMA 1VBZA 1RZMA 5F8LA 4JI2J 2NXJA 3WH9A 3ZFVA 4DV6F 2IYGA 1XYBA 3KG4A 2XS2A 1NM9A 3MM8A 3G96A 3AJXA 4MWAA 5HMXA 4CQ9A 5LIYX 1JJCB 1XNRJ 3O2LA 2HHPA 1JFHA 4WXZA 3ZLHA 3NGDA 1E6QM 5A8KA 4F2SA 2HK2A 1RLDA 2BGQA 2IM1A 2DB1A 2UV8G 3QRHA 4NE9C 3W53A 4N41A 2ZBPA 2NQPA 2XIBA 4M7SA 1TL7A 4V1XA 3MUZ1 4MK9A 2VRKA 3LQLA 2FTRA 3BC9A 3NM1A 3UWEA 2UZ9A 4UTMA 4LANA 1NY1A 1XICA 3PNUA 2YDAA 4Z2LA 2GGHA 1HMVA 3M05A 4ES4A 2D1CA 2ISSA 3DI6A 2WONA 4RZ6A 1TPEA 1YHTA 4UWMA 4P61A 3IXQA 2YCEA 1MQQA 2BQUA 2X7WA 1RT5B 4GY0A 5FLXY 1PKYA 1YXCA 4XTTA 4DUYJ 2RILA 4XKYA 1JLAB 3IR6B 3NQ2A 1ZS6A 5F9NA 3OHBA 3P82A 4O8RA 2PC6A 2Z2YB 3H2AA 3BO2A 4FI4A 3LNMA 1X5PA 5REQA 3V1PA 2BOPA 3HPSA 3WLNA 2X2YA 3LAKA 3W7PA 2FJWA 1XWLA 2UY2A 3JZEA 5CZSA 4DV4J 1KFSA 1O6XA 2VFRA 5G2IA 2EI5A 2Y5SA 4FOJA 2VG7A 2H3DA 5HVFA 1W5QA 5JBDA 2VUNA 1AFSA 1NFGA 4J9OA 1JNZB 5JUVA 4GJJA 1AFIA 4EI2A 1QPQA 1HNWF 2OYLA 3UETA 4TYBA 1FBAA 1X7VA 1TRIA 1LXNA 4ZN3A 1NK9A 2KG0A 2BJDA 2CHNA 3MP5A 3N01A 3EA1A 4KE5A 3RU8X 4K5RA 4HPHA 3EGJA 3ZSSA 1A0OB 2DUAA 1LV5A 4NZ7A 5AYYA 4ENLA 5EWGA 1HKIA 1KV5A 1LRTA 4ATWA 4J9VA 3AOFA 4OI6A 3T3FA 4DJEC 3EBVA 3SUSA 3BUVA 1TV8A 3N4FA 5BXIA 1N34F 1UJPA 3TX9A 3V36A 4WTOB 4J3UA 4RDWA 2DNNA 2FIUA 1P6CA 4GKKF 4FPSA 3VKBA 2D3ZA 2O9PA 3H70A 3MP3A 3LU2A 3DDIA 2J6TA 3BYPA 1IV8A 2Y62A 4M5HA 5HINA 1HPZA 1WG5A 4CO2A 3F4NA 1NJIT 4F2RA 3RPTA 3UNDA 2HTMA 4AC1X 4R5EA 3R25A 5H91A 2CLPA 3FAWA 3TUZC 2IJFA 2Z1VA 2ZH7A 3PZTA 4H6KA 4ZVRB 1XMOJ 2EPKX 2HPMA 5A6PA 1E4IA 2K1RB 3OUYB 3T0TA 2Y0BB 1A49A 4KGMA 2E4TA 3GAYA 1IT0A 3H55A 4U4MA 1RA7A 4HH1A 1KCZA 4QITA 3RBDA 2FHBA 1JXKA 1HMVB 1LOLA 1QE1B 5D15A 4UFJA 2WONB 3SFWA 5EFDA 5LHFA 3VAIA 3MKKA 5HANA 1OCBA 4I69A 2RH3A 5I5RA 4FSAA 3JQKA 1TPWA 3SBMA 2WHMA 1VJWA 5D30A 4RDZA 1KBBA 3LUYA 1IEWA 4NXSA 2N4CA 1YMYA 2Z1KA 1P9QC 3I4KA 3Q2DA 2WZ1A 1QVBA 2X1TA 5J2MB 3EVWA 5IC6B 3Q45A 4DS5A 3LXAA 3P6LA 4W84A 1UPMB 5IQQA 3OO2A 4QOTA 1NZAA 1D3WA 2DY1A 1UMJA 2DCUB 2ADBA 2WSYA 1QI3A 3TUJC 2D3OR 4WJ8A 3W1NA 3ARRA 2IRUA 3DRXA 1CCWB 2VWSA 3UT0A 4Y2AA 4FLSA 4CZCA 3DNCA 3LEPA 1HBMB 5B7YA 2PMWA 4DR5F 1XYAA 5I3KA 4L4MA 4PC8A 1JUEA 2IRXA 2M4MA 5C55A 4HNTA 3FGVA 2E77A 3QW4B 2OSXA 3URQA 2HBVA 2RJGA 1UFWA 3WLLA 1JQGA 5F1VA 1U2FA 2V2VA 2V67A 2QLYA 4WKHA 1ONRA 4JAWA 2VUYA 2DPJA 4DX8H 4USHA 3ME3A 1KRMA 3SBFA 1HWIA 1ME8A 1WKKA 3I5CA 5KFNA 4Q7BA 4OOZA 1EB0A 2FVLA 4PG5A 2PWGA 4O4GA 1AW0A 2QQ6A 3B8VA 4Q44A 4KWWA 4USKA 2E5LJ 1HJXA 3WNPA 4NOHA 2BFGA 4IPNB 3OXFA 1M90T 2ZE0A 3L67A 4GWEA 3W1MA 2OFHX 2RKXA 3UR0A 3BPSP 4DV1F 1IEIA 1RY0A 4N6EA 2D24A 4EBDA 2E1AA 2F3JA 3MMWA 5C42A 2CLFA 2FFCA 3FRZA 4HMEA 2JL9A 1PB0A 2WK2A 3VINA 4A3RA 1XCWA 3POCA 3T1YF 4OYPA 1UJ4A 3PVFA 1GYLA 1Q78A 2HYIB 1FJCA 5KFXA 4TY9A 1GJUA 2BGNE 3UR5A 2CZ4A 1KBLA 5FIPA 4TTUA 3IIOA 4M6PA 3DYMA 5DG7A 1G0CA 1HR0F 3VMPA 2RJZA 5GAHU 5EMKA 4DF2A 4E5TA 4X63A 1GNKA 1ZAXA 1RLCL 5HROB 1XERA 3LA4A 5CC5A 3W4RA 4ZVSB 1IWBA 3W64A 4WGHA 2X30A 1WBHA 1H73A 4PMNA 4ZP6A 1UETA 2NPFA 5FA5A 1F73A 3C16B 1Z48A 4CLYA 1B9ZA 3GHTA 4A22A 4DV4F 1J79A 2NX9A 3UXKA 5JH1A 4O8AA 3LCGA 2GVLA 1HW8A 1WX0A 2JLFA 4OZ5A 3T42A 5KAKA 2HFZA 4TXEA 4XAGA 1Z32X 5KEZA 4NXNJ 5KFYA 1E4LA 2IKGA 1NWUA 1VZWA 3WQEA 4NA1A 3OLBA 3GDKA 4M5KA 3G6YA 3R2CJ 1XR7A 1P6TA 2NCKL 4GABA 3K8VA 3RAOA 5E9XA 1NVMA 3T6JA 4J9SA 4IR1A 5ENLA 2JDJA 3KYLA 4NJGA 4GACA 1E6VB 2WQPA 3Q58A 2G0CA 2XLJA 1TPDA 4DFPA 4ECZA 1JPHA 4QLLA 4J3TA 4PTMA 4ERGA 5I78A 2R8KA 1LLOA 3L65A 1F3VA 4PUOA 1QK0A 4LIRA 3EKGA 3WF4A 4DJEA 3TSMA 3WDIA 1M6JA 3K59A 1FP8A 3VIMA 1HNVA 3AUJA 1XL9A 1CGXA 3C6UA 3FSIA 4ZCWA 2DUXA 2VEKA 2WHLA 5KSWA 3KL5A 3MOZA 2Y1HA 1W2IA 3ZNJ1 1S1XB 2E5HA 5EX3A 1A0DA 4YTTA 4NLTA 1I6NA 1EEPA 2RAGA 1IQTA 3FDGA 3G6MA 2EBGA 2W2MP 3M9NB 2ATSA 3EMCA 4J40A 4ECRA 5L6UA 5AHMA 4DZHA 3PTKA 3NEHA 1OBAA 1EP3A 1DTNA 2FZ8A 4FXDA 2I5GA 2DEPA 3DDMA 4NZ4A 3D1HA 4LQ3A 3PHEA 1R87A 4TQSA 4JI3F 1ZM4A 2DSVA 1XLJA 5K5MA 3P60A 3OODA 3Q24A 3LHZA 3R43A 3SQOP 4M6VA 4GCXA 2F84A 1P5BA 4ZMGA 3TVYA 2R14A 3AH6A 5E5CA 1O5KA 3GG1A 4DF1A 4IL2A 3KHLA 3GP9A 3H25A 3CV6A 1I3OB 1EL3A 3B8IA 2ZM6J 2E8ZA 2V4JB 2XIMA 5KG5A 4MNJA 3W82A 2B51A 4W98A 2RU3A 2PDMA 1J0HA 1NJYA 4ZOCA 3GXTA 4WUIA 2GAHC 1FWWA 1FRMA 3D4JA 2QZ8A 1TJ0A 1TJ2A 2KH9A 3LDVA 1A5CA 2YNGA 1VIWA 1MEIA 1TKXA 2XH4A 5GMDA 1VPYA 1U48A 4MTVA 3KLEA 4Y6IA 3TANA 4JEQA 2CADA 3DI6B 2D1ZA 1FNXH 1GMWD 1WF0A 2GJIA 1XGEA 4GYPA 4AXIA 4DBEA 1W5NA 3G6ES 1JYVA 2ZZ2A 1D8ZA 3ZM8A 2IXUA 1PTAA 2ZBCA 4YWSA 5AC8A 3NFUA 2XYHB 4HOWA 4MADA 1UEVA 2GIQA 3M5YA 3UJEA 2VBXA 4AISA 3CNYA 3B04A 1TPC1 2YXOA 1P0NA 3GDBA 3UPMA 2BDQA 2V5BA 1IKVA 2IDLA 4I8YA 1IIHA 3WQFA 4CCDA 3J7ZT 4LVBA 1N6QA 5J5DA 2HFUA 4HTIA 1XKJA 4MFDA 4TUFA 2W7AA 1DLOA 3W9HA 1V02E 3TQ0A 4LBUA 2Y89A 3FBBA 3HFYA 5IWAF 2Y2WA 3PFMA 2W7OA 4Z2KA 4V15A 4B90A 4A8IA 1ZP3A 4L9YA 4XSMA 5FF3A 4OT7A 2CLLA 4XZNX 3FMWA 2FJBB 3N2MA 5GADU 3CC7S 1E0XA 4LBRA 4JCLA 3MQTA 1MO0A 1X7IA 3APGA 3EXSA 4WYLA 3TXZA 2Y8UA 3MWCA 1OK4A 1R27B 3TLLA 3STEA 4NT0A 2E1RA 1XP3A 4IMDA 3VZIA 4RE2A 4QJ5B 1JLGA 5F2GA 2WZEA 4DV0J 4GGBA 2DUZA 1S72S 4X64F 3IARA 4AD3A 1V02A 3ES7A 4XBSA 1P1LA 3H7RA 1NDWA 4F3MA 3C0LA 2MB0B 4PFHA 4U7UK 2AJ2A 2D41A 4LF5J 2RH9A 4OJ1A 2PN6A 3TZXA 3CC4S 4MJ4A 1BSLA 1W6TA 2OODA 4S23A 3O8WA 3F4WA 1XIDA 1BLIA 4JFSA 3VX1A 2A3EA 4NAEA 2E9BA 2X7IA 2ZUWA 3PFOA 2W79A 1AH0A 5D8ZA 4C6KA 3S6DA 4ZOEA 2ASJA 4D8LA 4L4OA 3NYZA 3BMWA 1WC3A 1UWQA 5J2QA 4V19X 3C61A 4DV2J 1VEPA 3UR7A 5DJBA 1RYSA 4JXCA 3VGBA 3AS3A 3WDQA 5FAJA 2Q09A 3VALA 4BF9A 5GVJA 1HBNB 2QTWA 3OR2A 2XMKA 1MWQA 4YB5A 1KLYA 1LQ2A 3R1HA 1N82A 4DL5A 4I4BA 3RMJA 2FGLA 4LEQA 2A7RA 3OTCA 2ZDOA 1UWTA 1FJEB 3EPNA 2VC9A 3G0SA 1ISYA 3UWYA 3U57A 3UXLA 1IWGA 1JPIA 3WQPA 1DHPA 3GH7A 2AZ3A 1XLIA 1WC1A 4ZP9A 2DVXA 3JAMY 5DXYA 3OTOF 1YRRA 2O55A 3JTPA 1IEQA 5I3PA 2GVYA 4DVOA 5GAEU 3K57A 2BJ8A 3QYQA 4BK9A 3ZTSA 2VQFJ 5C54A 1CLVA 1GOQA 4N0RA 2BVYA 2TAAA 1FWFC 4IOBA 4RR4A 5E7OB 1JRCA 1B7YB 2LXFA 4A8KA 5EMLA 3N6HA 1JF6A 1KWGA 2B56A 3OR2B 5HQ8A 1M53A 5F2IA 3UWUA 3W81A 1ZUAX 3HFZB 1NH7A 2RS8A 1UOZA 2MY7A 2ZKMX 4XUYA 3DC0A 1NXIA 3TZNA 3M2RA 4KYZA 4O0NA 1EJVC 1S7IA 2PBGA 1TTJA 1UMLA 2P8BA 1RJRA 1B3TA 2ZE2A 3PN8A 5EA9A 3TAOA 2YSWA 3S4TA 1WKFA 1RHQB 2N7YA 2CQHA 1SI9A 5FJUA 3ICJA 2FIQA 1S1WA 2MTLA 2OPJA 4LRTA 3UQSA 3CNQP 3W7OA 4S1FA 3OPKA 4F4RA 1RWVB 3STFA 4HNCA 4Y9MA 4B9VA 4OE7A 4HDHA 4XAZA 3VNLA 4UOGA 1T11A 2CJBA 2AEMA 1FHUA 3PIPQ 3B0UX 4EPKA 1EBGA 2Z2AA 4FN5A 4WZMA 2JQXA 4ANEA 2I5QA 4ZVJA 2YJQA 3CCUS 2R9RA 2J62A 1GOIA 5LNRA 3HZEA 3MUMP 1RCXB 1FI4A 1R8PA 3QN3A 4GX8A 4IFYB 1WKLA 3PPGA 4RPPA 5LXYA 2WMHA 1X0FA 2BM0A 5HWJA 3HQOA 1QBAA 3M5ZA 5L39A 1TZ7A 3DRYA 2K06A 1G5AA 4RW4B 3BMVA 1J5OA 2JLGA 3GV5B 4D1JA 4M56A 2CDQA 4OHVA 4LVAA 5F7UA 2OZ8A 3MM9B 5DG9A 5HJYA 1G4CA 3AIQA 3RX4A 2HHTA 1ZU8A 2J7UA 1LBLA 2FMOA 1MXDA 4FMVA 2RFGA 3WN6A 3OVBA 3QKZA 3VWSA 3OZPA 3P96A 3M8WA 2F2HA 3IRSA 4IISA 3THCA 3B0VC 4XUGA 2NSCA 1SVDA 4M8UA 3I0SB 2ZWOA 3BSAA 3D0IE 4OTKA 1OYAA 4WCJA 4O3SA 2O4MA 2GGPA 3KJQB 4Z0SA 2OGYA 5E33A 1HNIA 1Q6RA 1K0TA 1T5AA 4KRUA 1C1BB 2R24A 2IA6A 3CJ4A 4QCFA 2CZ5A 2ISDA 3MPVA 5DMLA 5DY3A 4Q8TA 1RVKA 5A94A 4IFRA 4DELA 3SCNA 1B3OA 4GRSA 4FK9A 5XIMA 3N34A 3S1UA 1RWUA 4YMZA 4I5RA 3THVA 4JI7F 4IQEA 1PIIA 2GIFA 1GVSA 2E7FA 1PIEA 3EUNA 3NBPB 4XD3A 3BDEA 1RA0A 1P7TB 1S59A 2QR6A 3MWBA 4NI3A 4L9XA 2VB6A 5BMWA 1N32F 1ZM2A 4LSNA 2X0HA 1PILA 1CPZA 1AJ2A 2DHAA 3PZUA 4JNYA 3L4UA 4KKOB 1HNIB 3TCSA 2VC5A 1FJGJ 1PBUA 2EKCA 2EQDA 1U2RA 3HVTA 4IPJA 2OD4A 4GPNA 1TPH1 1Z9AA 3LM7A 1T95A 5DLGA 1Q95G 4G3IA 3BOLA 1WB0A 1YX1A 2BWGA 3X1LB 1P1TA 4ENOA 2JWNA 1S3TC 4M5PA 2QAPA 2PF8A 3NPXA 3MPDA 1OY8A 3O07A 4MNKA 3TH6A 4DL3A 1RBLA 2R1KA 3VMNA 3UDVA 4EP8C 5A8QA 4AE5A 4AG0A 1PWMA 3ZZRA 4LF8F 1A5BA 3OP2A 3WIJA 1S39A 4IJBA 3GYNA 1ZP4A 4JD4A 1U1KA 1D8CA 3W1UA 2HFNA 1J2WA 4HSOA 4HPXA 2V63A 3N17A 4IG0B 4H4MA 4RPFA 5DQHA 3V5CA 3IS9B 3VOCA 2BXYA 4R25A 1UC4A 4DBQA 1LUCA 1DE6A 2G1HA 4JHZA 1GG0A 1OFEA 3F03K 1PSCA 1DL3A 2HSAA 4HVZA 4QJ4B 3W1RA 1SJFA 3GIQA 1K8XA 1X97A 1SJAA 4B3OA 2YKMA 4CD8A 3ARQA 4EF9A 2KL8A 2AKZA 5C8BB 1T9VA 1ZM9A 3BGFA 4A4JA 3QMRA 2Z7GA 3E0IA 3TMLA 3AS1A 2YDRA 2PA8D 1J01A 3UZZA 3M07A 3EOOA 3IFEA 1F4AA 4L6DA 3QGKC 4X4UA 4E0CA 2RIJA 2ZOGA 1QY7A 2H9ZA 5H8PA 1FXRA 4IQDA 3KP0A 3OYZA 2P9CA 2NUUG 3C86A 2DR6A 3PX6A 2AP6A 4BJHA 1VMBA 1KFWA 3N19B 1ISVA 4W9TA 2QCEA 1T6MA 4RZ4A 3E1F1 4KW2A 5AE3A 3AAMA 2BDPA 2PWUA 3GBDA 2BE2B 2LMIA 2PZNA 2NXCA 1KFEA 1S2AA 1TL1A 3S1TA 2XWYA 4P2XA 1C7TA 1EX8A 2OFGX 1I2QA 2VHGA 1BG4A 1VQPS 4LRFA 4JQ4A 2CPIA 4CQAA 4UTHA 5T9BG 4AVFA 2QCDA 5BMXA 2BKPA 2G4FA 3TOQA 4JKMA 3DU6A 1X4GA 2Z29A 1NMEB 2VG5A 1KLNA 1JL8A 3K8LA 4PG4A 4YMEA 4IH3A 2DORA 1LWCA 2FLLA 3QV9A 4WDWA 2OKQA 2FTPA 1ZPVA 3QLHB 3UWZA 1F8IA 1N5YB 4HA0A 1WDQA 1OG6A 1SYTA 4DNMA 2IPOB 4I6AA 3BV8A 4W92B 2M8HA 5J2PA 4JY9A 3CCQS 3C3LA 1LJYA 1AUSL 5MF5A 5HOSA 4EUVA 4IFKB 1R7OA 1OQFA 4NQ1A 3MEKA 2K3KA 2IVYA 3GMGA 1SC4B 2MQOA 5FJJA 2JKPA 1ZAHA 3TNBA 1BQMA 3QT6A 3N9KA 2NUYA 2WMJA 2JHEA 4HOXA 4H19A 2TYSA 4AEOA 1GQIA 4IUFA 1ZBVA 2K2PA 1NSKL 1GPWA 5C2CA