3PJWA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, i23
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
430
structure length
423
Chain Sequence
b'AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 130
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjwA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjwA01
5KFLA 3NGDA 4Q8FA 4HKQA 1XR6A 1T03A 2IM3A 2HNDA 4RUAA 1JKHA 4JV2A 1HMVB 4EBCA 3PW4A 3DLEB 3V6KA 2HNZA 4RNIA 1HQEB 3MFIA 5DG7A 3LAMA 2ATLA 5EUHA 4F4ZA 3ITHA 5FDLA 3BREA 3UPFA 3DOKB 4RNOA 1S1XB 3DRSA 5KFTA 3KMSA 4WFYA 3DLKA 3DRPA 4TY8B 1TKTB 4R8UB 2W9AA 5KFMA 1SV5A 4NZ0A 5EDWA 5F8IA 3BSAA 5L1LA 1EP4B 4RW6B 2FLPA 5J2PB 3MR5A 1HARA 5DG8A 2BQRA 1C1CB 4I2QA 1S9GA 5C5JA 2IAJB 5KFOA 5JXSA 4K50A 3PR5B 1N6QB 1MU2A 3LANA 3UR0A 5KFPA 4LSLB 2W7OA 4K4UA 1S0NA 5F9NA 1SH0A 4MK9A 5HROA 3LP1B 4RW7A 4TYAA 4HU4A 3RB0A 3MEEA 5C42B 3RAQA 3NBPB 3N6NA 2E9RX 2ZD1B 3KLVA 3BGRA 4TLRA 3IGNA 4J9OA 2RDIA 4NLPA 1IKWA 2D7SA 4R5PB 3H40A 4RNJA 1LW0B 3HHKA 2W9CA 3H59A 4PQUB 4MIAA 2XI2A 2AGQA 1SUQB 4O44A 5CYQA 3MR6A 1DTQA 5KFBA 1RT4A 1RYSA 3N6LA 3PJWA 2JEIA 2WONB 4I2PB 2FVPA 2VG6A 4LQ9A 4IFVB 5HBMB 5J1EA 4IRCA 3H98A 3QGIA 1LW2B 1IKVA 5KG1A 4YR3A 4EO8A 2ZKUA 3M8PB 3KNAA 1S0MA 4K4WA 1S0OA 3ISND 4B3OB 4ID5B 3Q8SB 5KFSA 1RTJB 1RTIB 1JLQB 1JLEA 3KJVA 4K4ZA 2HMIA 5MKGA 4KSEB 4TQSA 3KLIB 2D3ZA 4F4XA 4WXOA 2XGPA 5F8MA 5DQIA 5DG9A 1R0AA 1S1WA 4PWDB 3EZUA 3C6TB 1RTHB 4IG0B 1RTDA 2JEFA 5DLFA 3SY8A 1C0TB 4HJFA 3PW7A 5F9LA 3EPIA 2OPRB 1S6QA 4ES4A 1TV6B 1JLFA 4IOBA 3SFGA 5KT5A 5KG6A 3KLHA 2B6AA 1TKZA 3SI8A 1EETB 4F48A 4F4YA 2BASA 5I42B 2I5JA 4GC6A 5HLFA 2FLNA 2W8LA 4FBTA 2EC0A 3FSIA 1RT7A 4H4MB 1KHVA 4ZVEA 2YNFB 2D3UA 2YNIA 3CJ5A 3QO9B 1FKPB 3KK2A 5I3UA 3H5UA 4NLQA 2AX0A 2UUTA 4DG1A 5KT6A 4J9SA 4FOUA 3LP0B 4K4YA 4QWEA 4NLUA 2OPQB 3LP2A 1BQMA 2YKMB 1S10A 2BE2A 3PJTA 1IKYB 4I7FB 4ZPBA 3DRRB 2OPPA 3G86A 4KIEA 4Q0BA 3KOAA 4LJ3A 1S1TA 1LWFB 1TL1B 3HVTB 4H4OA 1RT2B 1N5YB 3OSNA 1IM4A 2RF2A 1HQUB 3FFIA 3JSMB 3GFXA 3MR2A 4KKOA 3PZPA 2V9WA 2VG5A 3LALA 1JLBB 5K14A 1RT5B 2W9BB 3DMJB 2CKWA 4G1QB 2AWZA 3DDKA 4NLTA 2R6OA 2B5JB 5CYMB 2I1RA 5KG0A 5KFHA 2C28A 1SH2A 4IH5A 4EBDA 3QGHA 3V81A 1LWCA 3QZ8A 4O3QA 3S83A 4AG0A 3U2EA 1BQNA 4MFBA 4JV0A 2JEJA 2VG7A 2ILYA 4DL2A 4LSNB 4MK7A 5KT4A 1YVFA 2HWHA 2IMWP 1RT6B 4KHRA 2JC0A 4K4SA 1HMVA 4J9RA 3OLAA 1WNEA 2GIQA 3DLEA 4TN2A 4LYKA 4KE5A 1HQEA 3I0SB 3GYNA 5J2QB 3I0RB 2AQ4A 4Q6JA 3DOKA 3TVKA 1S1XA 2JEGA 3KLFB 4TY8A 1JLCB 5KFDA 1GX6A 1TKTA 4R8UA 2IBKA 2FVRA 3BJYA 3I5CA 1IKXA 2W27A 5D3GB 1RT1B 4RW6A 3V4IB 2R2TA 5J2PA 1RAJA 4ZP9A 5F8HA 4O3RA 1C1CA 1S6PB 4NLDA 5KFZA 3D28A 2IAJA 4NRUA 3DM2A 5KFWA 5KFKA 3I5BA 3T5LA 3V6DB 1S48A 2WOMA 3IGVA 3HV8A 3GIIA 4MKBA 4WZMA 4ECTA 4Y9MA 1XR7A 3DOLB 1TL3B 4LSLA 4MIBA 3QLHB 5DQGA 3CDUA 4IKAA 5KFUA 4U7CA 2AX1A 1VRTB 1RYRA 4Q43A 5HP1B 4ED0A 4NYZA 3CIZA 3LP1A 4R0EA 4RNNA 2V4RA 3G6XA 4ECWA 4YMEA 4DL4A 5C42A 3NBPA 5KFEA 2BR0A 2ZD1A 3GG1A 1C0UB 3PJXA 4AFYA 3PJUA 3CO9A 2HAIA 3MECB 3E01B 4R5PA 1LW0A 2WHOA 4IFYA 5KG5A 2R2RA 4TYBA 1SUQA 5KG4A 4KFBB 4O3OA 1VRUB 4EYHB 4FS2A 3H5XA 4XPCA 3T5JA 3OSPA 2WONA 4I2PA 3MFHA 4MKAA 4IFVA 5HBMA 1DTTB 1RA6A 5F8JA 1SH3A 2HWIA 3M9OB 3KLGA 3M8PA 2XCAA 2YNGB 3TAMB 3KHLA 2XCPA 2XWYA 4O3PA 3M9NB 4RW8B 3IG1B 2AGOA 1J5OA 1JXLA 2UVRA 4ID5A 1D1UA 3D5MA 1RTJA 3NAIA 3RBEA 1RTIA 4ICLB 4ZVFA 1LWEB 3NL0A 2WK4A 1HNVB 4ZPDA 2BQUA 2E9ZA 1QE1B 3CJ3A 3MF5A 3HVWA 5KT2A 1JLGB 3KLIA 2OH2A 4ECQA 2BANB 5C25B 3LAKA 2IC3A 3QIPA 4RNMA 4PWDA 3FRZA 2AU0A 1TKXB 3C6TA 3M8QB 4IG0A 5J2NB 1KLMB 4EO6A 3BR9A 4K4TA 3IN5A 1RT3A 1S9FA 1C0TA 1TP7A 5DQHA 2OPRA 1TV6A 5HROB 4GC7A 1QUVA 3KK1A 4KV8B 1EETA 5L1JA 3HVAA 2QE5A 2D41A 4RW4B 5I42A 3UQSA 3BQ2A 4DL7A 4IDKB 2ZE2B 3N3TA 1FK9A 4H4MA 3SFUA 5KFAA 4XO0A 2YNFA 5KFYA 3QO9A 3CDEA 4Y9PA 4RW9B 2J6TA 3Q8PB 4URQU 4U6PA 3PVXA 3LP0A 3OLBA 1QAIA 2YKMA 3RBDA 3KK3B 1I6JA 1JLAB 2YNHB 1IKYA 4I7FA 1XR5A 4JUZA 4YP3A 2ASDA 2V4QA 3DRRA 5C24B 5KFCA 3EPGA 2C2RA 1JX4A 4RNHA 1LWFA 2YKNB 1TL1A 3DYAB 3HVTA 4WFXA 3H4DA 4ECRA 1RT2A 2C2EA 3GIKA 2W7PA 2R8IA 3RB3A 1HQUA 4ZP7A 3JSMA 1N5YA 4MK8A 4LQ3A 3H5YA 3MEGB 4YR0A 1ZTWA 4K4VA 2OPSB 4KBIA 1JLBA 4NLSA 5KFVA 5KFFA 2W9BA 2FJXA 3OL7A 3DMJA 3MTKA 5CYMA 2F8EX 2B5JA 3H4BA 4M94A 4KO0B 2V0NA 4PUOB 4WE1B 4DL5A 3KHRA 1JLEB 4IR9A 3KMQA 4XPEA 1TVRB 1S49A 4ZVHA 1UWBB 4IG3A 2RDJA 3PW0A 1S1VB 1KHWA 3V6HA 2BRKA 2BQ3A 3UDLA 4ZHRB 4LSNA 4YR2A 4O4GB 1HNIB 4QWCA 3BSNA 4NCGB 3T5KA 4Q8EA 5KFRA 3TLQA 3IRXB 3T19A 3JYTB 1RT6A 3C6UB 4IRDA 4ZP8A 2RKIA 2B6AB 4WYWA 2WCXA 4Y9OA 4Y2CA 3HKWA 5HLFB 2ILZA 4URGA 4ECVA 1RT7B 5J2QA 2JLEA 3GV7B 4WZQA 3OHAA 3QGGA 2XI3A 3KLFA 4NRTA 3DI6B 5KFIA 3H5SA 3IS9B 2W8KA 2BRLA 1ZETA 2WTFA 2E9TA 4K4XA 1N4LA 3T5HA 5J2MB 2C2DA 1HPZB 3N6MA 4QWAA 3GQCA 1S9EB 5D3GA 1RT1A 1GX5A 4WYLA 3Q8RB 3V4IA 2R8GA 4O3SA 4G3IA 2OPPB 3GILA 2GC8A 2WRMA 4Q0BB 1REVB 3MR3A 3Q8QB 4ED3A 3CWJA 4Y2AA 3V6DA 2RF2B 1QAJA 3T1AA 2VG5B 1TL3A 3DLGB 3DOLA 4QPXA 5L1KA 4X2BA 3RAXA 4B3OA 3QZ7A 4F4WA 1EP4A 5KG3A 4OL8A 1VRTA 2FVCA 5HP1A 4NLYA 4FS1A 3PHEA 3MEDB 5KT7A 1C0UA 4ZMMA 3E51A 4ZPCA 1N6QA 2J6UA 1HYSB 4ECYA 3MECA 3GIJA 3E01A 4DEZA 1DLOB 2AGPA 2FJVA 3FQLA 5F8NA 4KFBA 1VRUA 5KT3A 1T94A 4O4RA 1T05B 2DPIA 4JV1A 1MMLA 1C2PA 4O3NA 1TQLA 4Y34A 3G6YA 1C1BB 4ECUA 4ED2A 2HNYB 2UVWA 2VA3A 1N56A 1DTTA 2IA6A 4PQUA 2IM0A 3PR4A 5DGAA 4HYKA 4F3HA 4J40A 1FKOB 3KLEB 2YNGA 3TAMA 1S1UB 4KHMA 2O5DA 4RW8A 3IG1A 3G6VA 1T03B 2HNDB 1JKHB 4ICLA 1LWEA 5KFGA 3KHHA 1IKXB 1HNVA 3NAHA 2HNZB 1LW2A 5KG7A 1OS5A 1QE1A 3KHGA 4DL6A 3ITHB 5FDLB 1JLGA 4EEYA 3DRSB 4RUCA 3DM2B 2BANA 5C25A 3DLKB 3DRPB 4J9KA 2WOMB 1ZTTA 1RDRA 1SV5B 5KFJA 4Q45A 3GFYA 1TKXA 3M8QA 5J2NA 4IQXA 1JLQA 1KLMA 4J9QA 1U09A 1RA7A 4WXWA 5KFXA 4IR1A 1K1SA 4I2QB 1S9GB 4KV8A 2JC1A 3KZPA 3OL9A 4TXSA 3NKYA 4RW4A 4J9MA 4J9PA 3GG0A 2R2UA 4HU3A 2ZE2A 4IDKA 5EWEA 1MU2B 2UUWA 4YQWA 4ED1A 3NMAA 5M1TA 1RTHA 4ED8A 2R8JA 4IFYB 4RW9A 3CVKA 3RB6A 4NLXA 1Z4UA 4ECSA 2FJWA 3CDWA 4RW7B 5KG2A 2R8HA 3KK3A 3MEEB 1JLAA 2YNHA 1D0EA 2B43A 3BGRB 3PW2A 5C24A 3BQ0A 1T3NA 2ALZA 5L9XA 1IKWB 2YKNA 3DYAA 1W25A 1FKPA 4IH6A 2W9CB 3V6JA 3KLGB 4RZRA 4O44B 4MH8A 5DLGA 5CYQB 5KFQA 3MEGA 5MF5A 1DTQB 2OPQA 3FDSA 4KAIA 2OPSA 4URSA 1NHUA 1RT4B 1J5OB 5DGBA 2R8KA 2VG6B 4KO0A 5J1EB 2UVVA 4PUOA 4WE1A 5F8GA 1IKVB 1TVRA 4QWDA 4J9LA 1UWBA 5EWFA 3PW5A 2VA2A 1S1VA 3GV5B 3BSOA 2IC3B 3QIPB 4QW8A 4Y9NA 1RT5A 1K1QA 3CJ4A 4ZHRA 5L1IA 4O4GA 4G1QA 1HNIA 3FQKA 4NCGA 5F8LA 3GIMA 3IRXA 3JYTA 1RT3B 1N48A 3KJVB 3C6UA 4QW9A 4ECXA 1NHVA 5MKGB 4ED7A 2HMIB 4NLRA 3KK1B 4F50A 5KFNA 1FK9B 1R0AB 1S1WB 4TQRA 2ASLA 4ZP6A 1RTDB 4FOKA 5JUMA 3DI6A 2IM2A 4J9NA 3IS9A 3CJ2A 2IJNA 1S6QB 3CJ0A 1JLFB 3KLHB 5T14A 5J2MA 3H2LA 1HPZA 1TKZB 3QYYA 1S9EA 4M95A 2XGQA 1NNDA 3I0SA 2I5JB 3RB4A 3TQ1A 1REVA 3I0RA 4EBEA 2C22A 2YNIB 2IM1A 2WB4A 4NLVA 5I3UB 3KK2B 4NLOA 4Q44A 3ISNC 3ICLA 3PFMA 1JLCA 4DG1B 2FVQA 3BQ1A 4ZPAA 3LP2B 3QIDA 1BQMB 3DLGA 3OL8A 4DL3A 5EWGA 4FOJA 3VQSA 2BE2B 4EYIB 4RNFA 4FBUA 4Y3CA 3OL6A 4IRKA 4H54A 1S6PA 4TY9A 1S1TB 4QWBA 2UVUA 4NLGA 4H4OB 3MEDA 4IH7A 3FFIB 4NLWA 4ED6A 2XC9A 2ASJA 4IG3B 4ECZA 4KKOB 4ZVGA 1HYSA 2DPJA 1CSJA 5K14B 4Y8EA 1DLOA 2QV6A 3QLHA 4WFZA 3GFZA 3I5AA 1T05A 2FLLA 3GV8B 3V81B 1LWCB 4RU9A 1JIHA 3HV9A 2R2SA 2J6SA 4KB7A 1C1BA 2RKIB 2HNYA 3OHBA 3M9MB 1BQNB 4MFBB 3BSCA 1S4FA 2IJFA 1S97A 2VG7B 3KLEA 1FKOA 2FVSA 2GIRA 2CJQA 1S1UA
chains in the Genus database with same CATH superfamily
2V5HG 4JX6A 2DQWA 2FZDA 4HOXA 2HURA 1YZ6A 1RWXB 3QFWA 1T03A 4AY7A 4JV2A 4JIRA 1W3TA 3E2RA 1TMMA 5CG0A 2BW7A 3BOLA 3PFRA 4ZTXA 3UPFA 3CPGA 1S1XB 3BH4A 1HP4A 1W1B1 3NOYA 3DRPA 2Z30B 5KFMA 3W70A 1SV5A 5F8IA 3S6EA 2V2ZA 3QLLA 4RPPA 1R27B 3PO5A 2QCGA 1C1CB 3N4WA 2ACRA 3EZ4A 1J9YA 2PTWA 2VDHA 4Y2WA 2A85A 1U2YA 1N82A 2XPKA 1EP2A 3UR3C 1QATA 4PRTA 5GNZA 4Q4MA 5F9NA 1GKPA 1DQ9A 4DZHA 3W7HA 5GAEU 4TYAA 4YHEA 1TPFA 5LIWX 1ZJIA 3CO0P 5LHFA 3VM7A 2Z27A 5ABFA 3U7BA 3W2VB 3EOUA 3H59A 1QOPA 1UWAA 1RR2A 1MO0A 3LCXA 1T9XA 3TFXA 4C65A 3P5YA 3ET6A 2MMYA 4H6KA 3KRZA 3UDVA 1W17A 2DIKA 3MANA 7FD1A 3T1GA 3RW7A 3IA0A 3IEBA 4Z2IA 4Y00A 3OBEA 3DG3A 1QWKA 4BK9A 3WD3A 3EGNA 4BLGA 1WG1A 1EJUC 1HJUA 5A6WA 2OJ3A 5A8GA 1VFFA 2YXXA 5BU9A 3MSDA 4EMDA 1WB0A 4CDIA 1ZP3A 1U1MA 1LRTA 4F79A 1S3HA 3ALGA 4C8OA 3WH9A 1EC8A 2VPWB 2MJNA 3OJUA 4GI6A 4LV4A 3ZVHB 4NNAA 2XZDB 3EDRB 1U1PA 2J4GA 1ZB5A 1QW7A 5FF0A 2MKCA 4AWSA 2BASA 3T9PA 2I5JA 3ENWA 4B9MA 2ZZMA 4J2PA 1R6WA 1DORA 3NUKA 3KK2A 1RLCL 4ZOAA 1KR1A 2PDFA 1NDZA 1W6TA 1BXNA 3OGVA 3TQ0A 3OHIA 4E8GA 2OAUA 1XYLA 2E9BA 1IM4A 1KTQA 4RDWA 2WW5A 3NEVA 4C6EA 4YTSA 4DR6F 4I9TA 5C54A 5B7ZA 1GMWD 1GMWA 1LNQA 3FJ2A 3MAHA 4I7WA 4GIRA 1F9FA 2VGBA 2JEJA 2ILYA 5CXTA 4G56A 2E7VA 3JW7A 3W7GA 2R1MA 4LF5J 2ZBPA 3CE8A 3UNYA 4ZK7M 4EI2A 1KBJA 3ZSSA 1TV5A 3NIYA 3VAFA 3L7OA 2CJXB 1KWGA 5LA2A 1RHMB 3NFUA 1WKDA 4DF1A 3HZGA 1RUSA 2A3LA 2IPJA 4GQRA 4LUIA 1JLCB 1Z2ZA 3Q8YA 3WDJA 4HPGA 2BFGA 2J79A 1CX9A 1R31A 3LO3A 4W5ZA 4LFCJ 4NRSA 3HTWA 2JK2A 4O1DA 3FSTA 1KOHA 1WSVA 4NZ5A 4NRUA 4NI2B 4RPFA 3I4PA 2OEKA 3D6TB 3JTPA 2MQNA 3CDUA 5IDZA 1RYRA 1KGWA 2J7FA 1IEVA 1RALA 3LP1A 1R3VA 4KCUA 5EY5A 1VIZA 4DUYJ 4B9LA 1EPVA 1GOXA 3NWRA 3R12A 1IXKA 2ZD1A 1X1ZA 3GG1A 3MGJA 4DV0F 5DM7Q 2XINA 4LS1A 3MM6B 1GPFA 2XFYA 3E01B 2AOSA 1L6SA 3VYLA 2I0XA 1JJKA 3R94A 3DU5A 4TU1A 4A8YA 2PMHA 3SBMA 1E3ZA 1R47A 2L48A 1IBLF 1KBLA 3GHUA 3KLGA 2D3OR 2XCAA 2ZOGA 3LU2A 1EC7A 4PB5A 1GMUA 1W3JA 1D1UA 4ZENA 1RTJA 2JZ5A 2VQUA 3RITA 5JVLA 1EHAA 3GDLA 3DRXA 4GWEA 1OF8A 1QE1B 3I32A 3MF5A 3BSHA 2YZRA 2OD6A 4IISA 5A6MA 3EUNA 5F1UA 3TR9A 2BVYA 3TN3A 4FNRA 2W01A 1TUGB 4ZQRA 2P2CB 2CNOB 3FRZA 3VM5A 2BNJA 1C4AA 3VC6A 4NQ1A 2WMJA 4C90A 2DNZA 1RD6A 3H2OA 3N2CA 4XD4A 1TP7A 4DSEA 4CIOA 1S5NA 3GD6A 4L6HA 2XUCA 1XPGA 1R87A 4LRTA 4LVDA 5DS7A 1GEQA 2B7CB 1NBEB 5KFYA 3HO1A 4YS2A 2DIVA 4W90B 3W64A 2YIHA 3ZSTA 3QBCA 2UUBF 3A4WA 2YNHB 4TX8A 4LAOA 5C24B 4JZ5A 4ZQPA 5G0RA 3OQEA 5IFMA 3H4DA 4B5UA 1B0IA 4P75A 1B3OA 4ZMGA 1HIYA 1T7LA 4KBIA 3N73A 1UUOA 1KEKA 3G5EA 4XG1A 3C66A 1OYDA 4BI7A 3MMBB 5EMKA 3LXAA 1NH8A 2V0NA 2E5HA 4WTOB 1Z44A 1JLEB 3FDGA 2KDOA 2VR2A 1JGMA 4GMEA 5I77A 4QEHA 2AZ1A 3EYZA 1FUYA 3PUDA 4TV5A 1RAAB 5F3TA 1LRQA 3LM3A 4HK7A 3OR2A 3A24A 4WD0A 1OFOA 3R2DJ 2OMOA 3MUMP 4OV4A 2C3YA 4WYWA 3RXZA 3G1XA 4YVVA 2UY3A 5I7GA 1AXQA 4CLPA 4NRTA 2RGLA 4E4PA 3CHFA 3KBSA 1FRIA 4Z2JA 4M8LA 3FBCA 2FGLA 2M8HA 2VEIA 1VBUA 1IEQA 5D4OA 1Q5YA 3AMKA 4JB8B 3V4IA 2OPPB 2GC8A 2H3BA 3A4AA 2ZADA 2XIMA 5CPLA 3VGSA 2PDGA 4RJEA 3PTQA 4PG5A 2W91A 4EPEC 2YWHA 1QPRA 5LIXX 4ELTA 4TIMA 5GNYA 2BBFA 4OL8A 1H50A 4GYFA 2XISA 3IXQA 1P0EA 4D3GA 3NYDA 1YG0A 3F2CA 4XZMX 2WSCC 1IE7C 3LXCA 4FZIA 2KAUC 5AHFA 1K1DA 1OIAA 4RR5A 5FESA 3OG3A 1N6QA 3NGSA 3MECA 1F6KA 1DLOB 1S2UA 1KTCA 4KFBA 2RHSB 5KT3A 3PEHA 5BMXA 1R7IA 1O95A 4AL5A 4NZJA 2H4YB 4UTKA 3RYSA 1UR3M 1L0PA 4ED2A 3CEPA 3GUGA 3M0HA 1E6XM 4PCFA 1YDLA 2VFFA 3UESA 2LDYA 3KLEB 2WJFA 5A6BA 2PA3A 3IBCB 2D74B 4UZUA 3IG1A 1Y00A 4XX6A 2XVNA 3UR8A 1WJ9A 2PE4A 1LXNA 2QIIA 1IKXB 3A13A 3OPSA 2CNLB 4MKSA 2YPZA 1XLFA 1X31C 2X8RA 3RU0A 2FB3A 4DPWA 1JF5A 4DPTA 1GYMA 3KXQA 3H54A 5J2NA 3GDMA 4J9QA 2WZ1A 4DJDC 4J2MA 4W8BA 4C5YA 4Z1AA 2HZCA 3O15A 1MUCA 3KZPA 3ENAA 2CLMA 4ED5A 2BOPA 1URRA 2KXHA 1MSWD 5KTQA 4ASTA 5BOEA 1KRMA 2QCHA 4B90A 2KG1A 4IQDA 1Y9OA 1O60A 3HHLC 1V0LA 1JG9A 4EFAC 2G9OA 1W2VA 2BTMA 1Q78A 4LAKA 2Z0GA 4IH6A 5FD1A 2HVDA 4F2RA 5KFQA 3N6HA 2CDRB 3MEGA 2QN6B 3CUGA 3R43A 3VOGA 2PDHA 2FJUB 1C8YA 3GIPA 6ENLA 1ZA2B 2NXGA 4B16A 4EF9A 4JI1F 4Y9NA 2ZVSA 4V33A 4O4GA 3KJFB 1EZ2A 1VYRA 1ZZMA 2CXEA 1TJPA 3IAS9 2FGCA 2PTZA 2CRLA 4P7VA 4NLRA 2OODA 3ARQA 3BW3A 4TR9A 5T9BG 3DKDA 4IUGA 4JI4F 3ADAC 2BY1A 2NV2A 4Q7BA 3WF0A 2IM2A 3PN8A 2P9EA 3PANA 3OVAA 4WKFA 1JLFB 3L4TA 4H83A 1I5OB 2EK6A 4ATWA 4M95A 2DKOB 3BAIA 1IEXA 3EGWB 1BHNA 2ZUSA 2POZA 3NZGA 3CDBA 1T3OA 3KXDA 3OIXA 4HEA9 2KX9A 2BJ7A 5I3UB 4JD4A 3PZOA 1Q5MA 3SCQA 3TN4A 2Q8XA 2KXFA 3LP2B 3M6UA 2NS1B 2VKRA 2UXBJ 4GKTA 2NUWA 1AJ0A 4REQA 2ZX9A 5C6MA 2QSWA 2ROEA 5IC4B 3SGUA 2CZEA 3W88A 1FCAA 4DRSA 3I56S 2DR7A 3FCWA 1LM1A 4LR8A 3I3BA 1AT1B 1U45A 3CMQA 2EFNA 3C19A 3ETMA 3R7NB 1B57A 3N3MA 3QRHA 2U1AA 3PBVA 3BSCA 4GIYA 2CNNB 3GYXB 3NGDA 4DJFD 4Q8FA 1WTFA 2IM3A 2HNDA 3JS9A 4P2FA 3MEKA 1A5LC 3T3FA 1A49A 2YY3A 2JKEA 1L8PA 2UV8A 5FJPA 4O8AA 2YXLA 3AQOA 2VPZB 2QDDA 3UXDA 1E6SM 2HHWA 3AIVA 3WC2A 4JI6F 1E51A 1CJTB 3IJDA 3GR4A 5L1LA 1VQ4S 2YXOA 2NT1A 4AIBA 2GGPA 2OWWA 1ZU8A 5D02A 3NQ8A 4O4VA 4NF7A 1HKMA 1MU2A 1LWHA 3BYPA 2IVFB 4CLZA 5TD4A 1OYBA 3QM3A 4IXHA 3VMNA 3MEEA 5D38A 3H4WA 2E9RX 1B99A 1GQLA 4C2MA 5DM6Q 2RDIA 4UOCA 3CC1A 1QASA 3MM7A 1KXVA 1R5YA 3LWLA 4PRFA 2AGQA 3EPNA 1AFSA 2C7FA 2WM1A 2PN6A 1H73A 4B5TA 3FBFA 2DZTA 1FWDC 1RYSA 3HQOA 3PJWA 1V79A 2HDJA 5HBMB 2HBVA 4CNZA 1XYFA 4JI7J 5KG1A 1S79A 4M6QA 3W24A 2AJQA 4GNKB 3P14A 2A4AA 3UY8A 5M2FX 2FZGB 4P2MA 3QJLA 4Q4SA 4N8OA 2QPSA 5DJBA 1DIOA 4MNMA 2GQCA 4BA0A 3DI0A 4FNSA 4FPRA 5KTLA 4WY0A 2P88A 2D3ZA 2Q09A 4DU7A 3C4UA 1X5PA 1NJYA 3MUZ1 3QV9A 3C6TB 4IPIA 3T0AA 2XFRA 3NXFA 3MQTA 3SFGA 2N4DA 3KG4A 4IIHA 3UA4A 3SGZA 1QDUB 4LMZA 3DHDA 3ZJ7A 5TAOA 4ZE4A 4H4MB 3QO9B 1EBGA 4LUSA 2JVOA 1A53A 1WDRA 4RR4A 5A3HA 4K4YA 1N36J 3V3WA 2VR5A 2CZVC 1FXDA 2J7DA 4ZPWR 2GVYA 3KOAA 3CIMA 3WUFA 3GHTA 3ZR4A 2HHSA 1SQ7A 3FFIA 4R27A 3W2WA 5IOLA 5HANA 4IL2A 3CZGA 2PEHA 4NEYA 4ZN1A 3GBDA 4H8NA 1KLYA 5CC6A 1JZ2A 1U7LA 2CKWA 2I1RA 1MQPA 5C0QA 1JQGA 4PKDB 2EF9A 4KMQA 4WFBQ 1OC7A 2ZWPA 4O3QA 3DESA 4ZDNA 4E2OA 2DZSA 3CB8A 4R7WA 5REQA 3D3FA 4LSNB 3VOIA 2AZ3A 3C0SA 2YLLA 1OPIA 1YVFA 4O13A 4K4SA 5RUBA 1ICSA 1QBBA 4LC6A 4H04A 2C6QA 3PY2A 4LF7F 2MY7A 1DQXA 3R5GA 3KUHA 4IPJA 2YW4A 5BRPA 4AHOA 4UTMA 1WI8A 2OZ0A 4B3TJ 1S1XA 3BO4A 4IP7A 3RLUA 3OVPA 3WBAA 4UFHA 3N18A 1ZLPA 3I5CA 4V19J 1RJPA 2DR5A 3TARA 2ZNYA 1C1CA 5KFZA 2V68A 2HHTA 2GJ2A 3O44A 1Z2LA 4DQRA 4ECTA 5AC8A 3TYCA 4DLGA 3QLHB 1RPKA 2FVLA 4O8RA 4ED0A 2FZ9A 1UA0A 4RNNA 1N5QA 3H24A 4I6YA 3TWAA 2EPOA 1R38A 5BRBA 1C0UB 1VOMA 2AL2A 3WQEA 4GQBA 4AFYA 3W2VA 3O63A 5AXMA 1FNXH 1NJZA 3HG2A 3JZUA 4NAFB 1JZ4A 2DZUA 3DFEA 5BR8J 4U3CA 1L6WA 4XISA 2EI5A 1V5IB 4IPNB 5EFFA 2DGTA 3GXPA 1NSKL 1DWGM 4ENLA 4DWSC 4F4AA 2R91A 1NK8A 4RW8B 4P7OA 1NP0A 1H7WA 1PX4A 4HCHA 4KH0B 3BLOA 2FHBA 2FHOB 1Q8IA 3HT0A 3RCMA 1XLEA 1E40A 2A0NA 3LYEA 3E6EA 4H9VA 1W5OA 4QM1A 1GG1A 3O6YX 1E6NA 2EKNA 2I57A 3W82A 1HL6A 4WK1A 3STCA 2K3IA 5EBUA 3VFLA 3ZVHA 1W5QA 1SJ3P 3TTEA 4PMVA 2CWNA 3F4NA 4JI8F 5DQHA 4GC7A 2CQBA 1HL2A 2R82A 1MMNA 4J28A 2ZRYA 2AMXA 2YA2A 1TCDA 3W75A 3N9UC 3MDFA 1J5EJ 5CZXA 3WLIA 2KG0A 1XR5A 3PZGA 4WU3A 3OLIA 1SMAA 2V8PA 3C86A 2WOQA 2EW9A 3W9ZA 3SCPA 5ETVA 1J0IA 4DCJB 5HMYA 3QC3A 3WNKA 4NLSA 5L9FA 1FRXA 3JZEA 3HFKA 2E5LJ 3EPMA 4ED4A 3UDEA 2V8ZA 1US0A 5JXQA 2FQQB 3VCDA 5A8MA 1HJSA 1J0HA 3D66A 2BQ3A 2WSYA 4ID8A 4ZHRB 4YR2A 4DR7F 4DUWA 4Q8EA 1T95A 2PSZA 1XG3A 5EKYA 4HN4A 2WCXA 3LA4A 2BKNA 3TCEA 1D2KA 2HRTA 4WZQA 2XI3A 4OZOA 1Q3NA 3DI6B 3RYLA 3MTWA 3UETA 4B5XA 3T5HA 1NM9A 1V93A 1RU1A 3FGCB 2F4VJ 3ZQ9A 3C8NA 3UG4A 2XWXA 2VC7A 1J27A 1W2PA 1PTAA 3GSIA 3ONQA 4NI2A 3NDYA 3GKFA 4KFOA 1WORA 1M7OA 3VINA 3W76A 4B3MF 1NLKL 1W2BR 3GK0A 1PKLA 2H65B 3RAXA 1EO7A 4DFPA 1JYNA 2E40A 3G8TA 3FSXA 3WNPA 3NQDA 4WGHA 1Q8LA 4ZXOA 4WKYA 4NYYA 3MM6A 1HYSB 1CGWA 1HJVA 3MHFA 3E01A 2QT3A 3M8RA 2AGPA 3LENA 3IV8A 4CQDA 4GGHA 1PZ1A 3APTA 3M6YA 4F67A 2OG9A 2BB0A 5GAGU 2QUNA 3GG7A 3BSMA 4XAYA 3SUTA 1NCLA 5GMEA 1BSIA 4OV9A 4KFPA 3M8YA 5KFGA 2UUAF 1X6LA 3AIEA 1X4HA 3KHHA 2VC1A 1QE1A 2HHVA 2QUTA 3BG5A 3LNPA 4O1AA 4XK8C 3S6TA 1EIYB 5GNXA 3U5UA 1RBAA 4X61A 3S1WA 3MOZA 4I2QB 4CQAA 4M1RA 3HMCA 4TXSA 3MMCB 3CCJS 2E6DA 4O57A 4UTIA 4HU3A 1VQ9S 5A6AA 4RCXA 1XR2A 3LH2S 4K8GA 4MY8A 5DCEA 4OT7A 3WFAA 2OLWA 2HIQA 2YNHA 1D0EA 2DSWA 2KJWA 3M0JA 5C24A 3VKBA 2BE7D 3UNTA 1OX5A 2VUGA 3CQJA 3VAJA 3QQ1A 3PX0A 1O8BA 2DEIA 4N9BA 4KAIA 3NGRA 1NHUA 4M5DA 4TVAB 3MMBA 2R8KA 4FF3A 1QI5A 2G3JA 1DJIA 3HPAA 4XKYB 4J9LA 1NJIT 4WRHA 1IBMJ 3L12A 2IC3B 3VAKA 1QHOA 1PL9A 2Z57B 1KRBC 1N48A 4C6DA 5JBFA 2LQ8A 3QW4B 3N9SA 4DHVA 3GX9A 4Q4QA 2BHUA 4CO5A 1FEEA 2Y6ZA 1X4DA 4EP8C 1R85A 4X63A 5M3WA 3AJ1A 1GWJA 3TCSA 1PJ7A 4LBUA 2ZH3A 3I0SA 3FKKA 2DY1A 4TMBA 1Q66A 3E12A 3W38A 1WKKA 1SZEA 2GHPA 1JUKA 4GBUA 2WJZA 3FFSA 4ZCKA 1ODZA 1B31A 3WJZA 4RNFA 3WH7A 7REQB 1UEKA 3MUY1 4ZSTA 1OX6A 1J12A 2DIEA 5CKSA 1FD2A 2X1AA 2ZZTA 4IH7A 2ZTKA 1HZYA 2V8DA 2VOPA 3TW0A 3EX7B 4IG3B 3VD9A 1Y0HA 3MSYA 1D3GA 3T09A 4D6HA 1DLOA 2F63A 1F8IA 2Y7FA 3I7RA 2QV6A 3H42A 5ADZA 4U95A 4UTUA 2VC6A 1ZH5A 3IAPA 1FXRA 3BGAA 3ABSA 1EB0A 5EL1A 2QV5A 4EACA 2RAQA 1AD4A 2A6LA 5B80A 3KLEA 3CCWA 1TA3B 2E8ZA 4AQYF 4A2RA 4QYZK 2XMMA 2G3FA 3HJFA 3DLJA 1CXIA 1TK5A 3AXXA 1BYAA 3FSIA 2CZFA 5I3HA 4WHBA 5GMKa 1KN6A 2BHYA 4O1BA 3UZ5A 1RACB 4NJJA 3ILOA 3PWGA 4OHXA 3CD7A 4W85A 2E09A 3AO0A 3VIMA 2Z29A 3AOBA 5DG8A 4NAEA 2BOEX 3HULA 3NZQA 4N7TA 3B0XA 1E6RA 3P0WA 2ZRVA 4EIVA 4HYRA 4S3AA 3J7Z5 4CUCA 4AY1A 1GZ1A 1XYCA 2EEYA 1N5VA 1LP6A 3CXOA 4NZ6A 3UF9A 2YFNA 1CQNA 2G1DA 4HU4A 3IGXA 1HX0A 4R9XA 3DC8A 1AVAA 2JGYA 4XBSA 4P7TA 3S5NA 1HKAA 4M5HA 2DUAA 3LUYA 3R7BB 3V75A 1S2CA 2FZCB 3N6LA 4Z2GA 2Y62A 5E3PA 3VIPA 2VQFJ 5K4XA 3B04A 3G8SA 3KBWA 1XGEA 3M8PB 3ILIA 1XYAA 2DR8A 3DLBA 3TFCA 2UUCJ 4KC5A 3NQBA 1HF6A 3G3MA 4FXFA 1YDNA 4J5NA 4HTIA 4X62F 1V6HA 4AUKA 3L5MA 3MAAB 3HPSA 4TQSA 4J4KA 4CNOA 3L09A 1OC5A 5DQIA 5D2TA 1QTMA 1K7EA 1H2VZ 4HTBA 4HJFA 3SXLA 2RQCA 3OXFA 4IH3A 4R7JA 3EDKA 1JLFA 1KFCA 3T4WA 3CCES 5KG6A 3D7SB 1VLWA 1JL8A 1P48A 3GIQA 1Q7MA 2FPYA 3CO8A 3OQ2A 2BW2A 2WC3A 3H7UA 4YHGA 5I3UA 3SCWA 2X1BA 4OYXA 4GX9A 2ZVIA 3K2GA 4FOUA 3LP2A 1DBDA 3FXYA 2DSUA 3LERA 3KWMA 2EFGA 2ZNZA 2HVZA 1NK6A 4O18A 1Q6LA 1W9BM 3UGRA 2DCLA 3EGZA 2WM0A 5I23A 4O15A 3D6FB 1OX4B 3THDA 2BKOA 4YHHJ 3CJSA 1FNOA 2W9BB 5HOSA 2J8TA 4G1QB 3T08A 3MI7X 5KFHA 2XLIA 1SPBP 3QGHA 4XZHA 2CZDA 3WJYA 2F61A 2OT1A 2YBTA 3WMBA 4HSHA 2VD3A 1SPQA 4A22A 3ZXWA 4LYPA 3NZRA 2Z24A 1A7GE 3G2GA 5GAHI 1HKIA 1UEUA 5EU9A 2Q43A 2QA2A 1X5SA 4C6IA 5CBJA 2HLUA 2J0SD 4PWWA 1IVZA 3NGJA 1Q6DA 2GFTA 1KFDA 1SM9A 3QAUA 3GH5A 2D69A 2MXYA 1U30A 1XJBA 2DU2A 3OJGA 4KRZA 3KVMA 3V35A 4MNLA 1CJTA 4WP3A 5HO4A 3ITCA 5LGXA 3OV7A 4DO6A 4UOJA 2DHAA 3LQLA 1PYOB 2NVDA 4PCSA 4USUA 3NZPA 1OFAA 3G2XA 4WCEQ 2DP3A 4YS1A 1GUVA 3V6DB 3CHDA 4LT6A 2JKPA 2D1ZA 4IIGA 4FS9A 3E74A 1TL3B 4K6AA 4Q43A 3TA9A 2G0IA 3S2LA 2C13A 3T6BA 1U26A 1EQMA 4NJIA 1F05A 2VEMA 3GCXP 3W7LA 2R1KA 2JFEX 3LPFA 1UUMA 4R88A 2PDQA 5CZKA 1G7UA 2ADCA 4F04B 4GQQA 2X1RA 2DVUA 3JS3A 4OUEA 5LGZA 3FMWA 2VDGA 3CUZA 4ZA0A 4KEMA 1XD0A 3BAJA 5A76A 3MP5A 5HBMA 1EH9A 3IM8A 4LBSA 4L1WA 1W9UA 4NI3A 1SH3A 1QDSA 1KRPA 5B7YA 4AIEA 5D04C 1ZAJA 4LVNP 3B3DA 1KQKA 3NAIA 4UTTA 3CSKA 3NL0A 4A8OA 4WQ6A 5DO2A 4AVFA 1UETA 2NSBA 3CJ3A 5B0FA 1IZCA 9XIMA 1P6TA 4GZJA 3AB4B 4J9VA 1IF2A 1HP5A 2EQDA 3AJ2A 3EXYA 1G7VA 3C6TA 5I79A 4IJRA 3ZTSA 3FC9A 3KK1A 4KPYA 4RLIA 3RPMA 2WHKA 4HOZA 4DL7A 5AFDA 3FAWA 8ATCB 3BQ5A 2QLXA 1HW8A 4H4MA 7FDRA 3HF5A 3OFFA 3QO9A 3E2QA 1FJ7A 4HPXA 2Y70A 4J3WA 1UP0A 5C9XA 4UQDA 3Q8PB 1N52B 2YFOA 9XIAA 3HIJA 1VC6A 1YPIA 2Y0BB 4JUZA 4N41A 3VIKA 3LZ3A 2XDFA 4RE0A 4OJ3A 3VIHA 1SJRA 2C2EA 4DNHA 5IWAJ 4MK8A 3BBCA 1EA0A 3QRPA 3MTKA 2YB4A 3GTYX 2DSKA 2V5JA 3OD2A 3KHRA 4RW3A 4GKKF 3ABOA 4MNKA 3PW0A 3VUSA 2GJPA 4KJIA 4LSNA 2A21A 3U2ZA 1XIMA 2QJIA 2E9LA 2VC5A 1YBTA 1TUFA 1XLJA 3GHSA 3QZ6A 3SY1A 4PMJA 2Z4PA 1Y5XA 2P8CA 3HKWA 2JLEA 2W24A 1NRKA 3BV7A 1GQIA 3TVYA 2Z1XA 2OYKA 1HPZB 2X0HA 4CNUA 4LR9A 3UZZA 4WR3A 1J2VA 3GILA 3PBGA 2X30A 3CJQA 3K30A 1RV8A 2AYBA 3OBIA 3T1AA 1ULRA 3UCZP 2W67A 3NA8A 4F4WA 1A0DA 2KT3A 4RV3A 3KFWX 5A6LA 4MLJA 4DU8A 4OWGA 2FDMA 3OW1A 1P6WA 3VZXA 1C0UA 1UB3A 2C91A 3IJLA 2V2DA 3TSMA 1MWZA 2JOQA 5EHHA 2OCZA 4D8AA 1LT7A 2E6AA 3SMZA 3FQLA 3R5DA 1D9DA 1N34J 4E2VA 1K8XA 4NAFA 3DXSX 4DV2J 2PEBA 3WQ6A 3CM4A 1U0HB 2E1WA 2MKHA 2CHOA 3BW2A 4XTIA 3RMEA 2WCGA 5CEWA 1FCUA 1VENA 2ZQ0A 4DVOA 4O23A 4RW8A 5DEZA 2E1CA 4ZJOA 1C9WA 4CD5A 4U7UK 3R8YA 5IZHA 5JVGQ 4QS5A 4U2ZA 2ABYA 2UWFA 4C8ZA 3KHGA 4X0NA 3WD4A 1VQ6S 5FDLB 3TJ9A 3DRSB 1KTBA 1V3LA 2D3O1 4NZFA 1P9QC 3N5BA 1RP9A 4DPQA 1WYIA 3SCIE 2ZRXA 4JIQA 1NELA 3TC3A 5CAHA 2AJFE 1IJEB 3BICA 1M68A 1GNXA 4JKLA 2GWGA 4QITA 2GS8A 4JI2F 5M1TA 4ED8A 3EX3A 2NCKL 3FEMA 2CPJA 5H1SV 3CDWA 2XULA 1H0GA 4FO4A 4UY8T 2PP1A 3CAWA 3OT9A 3LHVA 4RX0A 1S77D 1OD8A 2N82B 2CQ0A 1RQEA 1MNZA 2XIOA 1TUXA 3FSUA 2KHCA 5HWMA 4WLCA 3CULA 3L7RA 1T02A 3KJNB 2VYOA 4PTDA 3WENA 3QT6A 5HUOA 2ZC4A 3JSYA 1Q8BA 2IJRA 3N04A 1U48A 2HFNA 4FVMA 2VASA 2N7YA 3LHZA 1AFJA 4ZPVR 3R7SB 1R0CB 1VFJA 1DE5A 2WHLA 1AQHA 1CLFA 4MPQA 2Z58B 2V5CA 3OBKA 2PMQA 3GJQB 4C6AA 4ZHRA 1SJ1A 3LI1A 4YPJA 3PBUA 3BVJA 2HMCA 4HNTA 4B9TA 3N25A 1I51B 5CSYA 2BP1A 4QR0A 3AWOA 4XTTA 1S5VA 1W56A 2ZDSA 3LRLA 4Y9AA 3VIGA 3PYFA 5IXUA 3PULA 1FK9B 2Y5JA 4A2SA 1KFEA 5E3QA 3S3GA 3DI6A 3O3RA 2IJNA 5B08A 3CJ0A 3KUMA 1W1PA 1VJQA 2NXJA 1D8WA 1KLZA 1PZ3A 3HPZA 3I0RA 2V8GA 2ICSA 1PZ2A 4C7FA 1Q1KA 4EBEA 2PO4A 4L6V3 4NXKA 3CMJA 4MY9A 2DK2A 1SQFA 5EWGA 4C6OA 4D8LA 2QCFA 3IUDA 4Q8OA 4C4WA 1S1TB 1C7SA 1WZMA 4LRSA 4GISA 2XC9A 2GUYA 4QLLA 1HYSA 4WY0F 5IV4A 1O7AA 1UWSA 1Z42A 1JUEA 3CWOX 1R6YA 3GFZA 1N0VC 4MWAD 4O0NA 4A47A 2FTWA 3O6AA 5D32A 2RKIB 1HWJA 1LG1A 5AY7A 4M63A 1E3XA 5CPQA 1E5JA 4D2JA 1Y4ZB 1ZJAA 1NJXA 3TOQA 4XO7A 4MDOA 3TXZA 4GLEA 3CUHA 2NV1A 2ZWYA 3AYSA 4F0HA 1HQ2A 3ENQA 4JTGA 3OYXA 1E0XA 4FNPA 2GMLA 5LSOA 3NDZA 4RNOA 1OFBA 3MHGA 3DOKB 3O16A 4LB4A 1FH9A 3B78A 3GS6A 1WXYA 2XSFA 5EDWA 2ZZ2A 4C6BA 1QSLA 3W7JA 3BR8A 3MR5A 4I2QA 5D9MA 4W9TA 1JR1A 2CYYA 3C56A 2F65A 4O1EA 3MMCA 4O1CA 1RISA 1ROFA 1BRLB 5HJLA 3SCOA 1PX3A 2DITA 5ENLA 3DU6A 2CQIA 2XHYA 1SH0A 1KM2A 3AD7C 3T1YF 1PSCA 3VOFA 1G4PA 1UUQA 1S76D 3N6NA 3V0TA 4F0SA 1H7NA 3ZIZA 4ATNA 1PIGA 3I10A 1XYBA 2LXUA 1WBJA 1FVPA 2UXDF 2HFSA 4KF1A 3W23A 4HHLA 1HFEL 3N2MA 1F4AA 3WQFA 3PZVA 1MFVA 3L4VA 1O94A 3WN6A 2XYGB 4ZQOA 2VX4A 3MV11 3MMDA 1E43A 4GK8A 2OSRA 4HZ6A 3EDDA 1BYCA 3SQOP 4YR3A 2A2DA 4XKYA 3WL1A 4K4WA 4FF2A 4GUHA 5D37A 1K8AT 1JJHA 5AC6A 5L8RC 2C15A 1K9TA 1GZJA 2NUYA 4RL3A 4TLQA 1DJWA 4ZLNA 1XLGA 2PTYA 4EZ9A 4JYAF 1T40A 3URBA 2PDLA 4KSEB 1GTEA 4F4XA 4DUTA 1JCXA 2XGPA 3BOFA 5AHMA 2PCQA 4PWDB 1K0TA 4LFBF 2VTFA 3NQEA 1XH1A 4ZLPA 1TV6B 2QCCA 3IV3A 2BJDA 3IM9A 1W1YA 2W4XA 1Y0EA 4FBTA 4INFA 1ZJHA 3MM8B 4Y2KA 1WKYA 5IRPA 4W5UA 3MU7A 3WF4A 1HJWA 2LLEA 2MKYA 3Q24A 1M1GA 2IRUA 5KT6A 1IT0A 4NLUA 2R7VA 3CWHA 1JDCA 1XBWA 5L9NA 3UERA 4H9YA 3MM5B 1DFDA 7REQA 1FP8A 3GR1A 1M7XA 5LNRA 1K6AA 2PGRA 2VRKA 4DHGA 1YIJS 1HQUB 3JSMB 2PE8A 1B0TA 3H2MA 2TSYA 5EMJA 4NLTA 5FLXU 3G1AA 1JDDA 2CZ9A 4K59A 4ILLA 3FVYA 1IR1A 4C0HA 3MCNA 4L72B 3OFEA 3S2JA 3U3HA 1TKKA 2A2IA 1TZZA 2XMAA 1TA3A 1UR9A 4JXCA 4DYJA 2HLTA 3HFVA 1VS1A 3CQHA 4UR8A 4J9RA 3GJRB 2ZX7A 1VJZA 1V6XA 1UBPC 1DHPA 1DURA 1UZ4A 3FJLA 5XIMA 1YJ7A 2BJEA 4GD0A 2XN0A 4DCOB 1GPWA 4S3EA 5B09A 5D3GB 1JQXA 2OELA 2UZ9A 2R2TA 4MWAE 5BRQA 3TX9A 1OY9A 5FF4A 4WK9A 5FJOA 3WL0A 1S48A 3VD4A 2WOMA 2JQXA 3DOLB 2POTA 1HHQA 4N42A 3UPMA 4RWWA 2G95A 1WA3A 5HNNA 3AZTA 2PDBA 1TVNA 1W2IA 1FJGF 4JGDA 2PLKA 4FX8A 3REQB 4CEXC 4IFYA 4J35A 1Q2RA 2WW8A 4Q4KA 2PWDA 1I1GA 1FJCA 4RLEA 1MYRA 1XNRJ 4DN1A 4OZ3A 1IGWA 1XIGA 4AUBA 3U48A 3C61A 2VQEF 3GLCA 2G2OA 3F03K 3IRDA 1IBKF 1NEEA 3M8PA 4UR7A 3ZLHA 2XWYA 4LSZB 3FW6A 3HSJA 3LOTA 2V67A 1OYEA 4L9YA 1SFLA 3WZ0E 3FEZA 4X65J 1ACMB 1KTVA 3MAAA 5AYYA 1OCJA 2YWGA 5AOUA 3LQGA 2CLFA 5GAEI 4GO7X 3OJSA 1LBMA 1TWDA 3DYPA 1S2WA 4RNMA 3CBWA 3SRKA 3ENLA 3TEVA 1G1XA 5FIIA 4JHMA 1ADOA 2ATCB 5A8NA 1KV5A 1KLMB 2Y0SD 2VX6A 3BH7B 4J27A 5G4WA 5D4NA 1NU5A 5HROB 4A8IA 4KV8B 3TAOA 3CCTA 1Q0NA 1Y5VA 2EBGA 3N3TA 2HIYA 4LBIA 2PDYA 2GSJA 2HNEA 8XIMA 2ZYFA 4CLLA 3TTSA 3IS4A 3CPWR 1SJBA 5DELA 2HGMA 1TR1A 2HZVA 2Z4GA 4K7VA 4OYIA 1UD4A 1TPWA 3FNDA 2HS6A 4LQ3A 1FFRA 6REQB 1I94J 1VGAA 4U5IA 1OX4A 3H5YA 4V15A 3W65A 4RXFA 2OO4A 5KFVA 3APGA 2W9BA 1V3HA 2R8WA 4CO0A 1Q6QA 1V3IA 4LT9A 1CQMA 3KMQA 4XPEA 3SCRA 4OX9J 4QZVB 1QRQA 1VKFA 1XS2A 4YXGA 4QWCA 1SJDA 2X09A 2DGOA 3EXRA 4UZBA 3BGGA 2REQB 4ZP8A 3BLPX 1UVLA 2QJJA 2FZBA 3V7PA 4MLRA 2YKOA 2FTPA 1RT7B 2VO5A 2ZXAA 1VEMA 5FF7A 3GV7B 5ETRA 1GVIA 4C9DA 2MZQA 1KSPA 3IS9B 2E9TA 2BRLA 1WD6A 4K4XA 5EMMA 3TW9A 3FOKA 1JB0C 3PUOA 1N4LA 3BYRA 4AYSA 5AYZA 3CZ8A 1R30A 3HGRA 3G0SA 1AB8A 4Q0BB 3Q83A 2NR0A 3J81U 1PGZA 1O0PA 4M5GA 3V6DA 2QUUA 1WEYA 1GKRA 3AIQA 1TL3A 4DBWA 5CPMA 5H6HA 1PKYA 2O55A 2LP4A 3M6XA 3TMLA 2FPVA 3GE7A 1DWFM 1G01A 5E9AA 3W7OA 3TW6A 1CW2A 4ZPCA 2P6TA 4DV6J 4D3HA 2DQXA 3GIJA 2Y3YA 4ZLJA 1HKWA 1ML1A 3CCQS 2P0OA 5EA9A 3T0TA 4JV1A 3QV6A 4QJ4B 2HAFA 3G6ES 3G6YA 3QQ0A 2IA6A 4PQUA 3W71A 2AJ0A 1NTHA 2E0PA 4HGXA 1KGUA 3TYUA 5ABEA 4LWWA 2HRYA 4ZB2A 1JKHB 4LBPA 4OV1A 1VBXA 4LV9A 3DYMA 1CCWB 3HHLB 5AXKA 3ZO9A 2W62A 2UU9F 1G0CA 1Y5LB 2KJVA 4E4UA 3DC2A 4RUCA 1OT1A 4R34A 2YL9A 3NQ6A 3L0NA 5H91A 4DV1F 3W9HA 1JLQA 4AH7A 5A0YB 1US2A 2BDQA 5AYXA 1FWWA 1ONEA 4CQCA 2MZ1A 2DRBA 2DH9A 3H2CA 4DZ6A 3GG0A 3UWYA 2R2UA 2E28A 1U22A 2Z6JA 2X40A 3UNGC 4GVLA 2O9OA 4L6OA 1QUMA 5G4EA 3RB6A 3LUTA 5BYWA 3T1HJ 4FF5A 1W3HA 1FWFC 5H8PA 3M2VB 1HGWA 3BGRB 1KM3A 2KU7A 3OFHA 3V5CA 3VOJA 1IIGA 2ZKTA 4PCTA 4MHBA 4RZRA 1R8AA 4URSA 1JNRB 5AXNA 2V2CA 1J5OB 3W2MA 2VIHA 4JCMA 1D3HA 2KFZA 1KQGB 3M47A 2Y1LB 3WDPP 1WKFA 5F8GA 3CHCA 3DRYA 3MPGA 3L5LA 4QWDA 2GUUA 3HHNB 5A1AA 2EFOA 3PW5A 4ICNA 1QAXA 1XP3A 2PWHA 4JNMA 1S59A 4DV3F 3GC5A 3KRSA 1F3FA 4GACA 2MSTA 1RWWB 1F76A 3HX9A 1Q6GA 2HQAA 3I4EA 2PEVA 3URQA 3W6YA 4ADUA 5CCMA 1Q7YT 2LQJA 4JKKA 1EP1A 1WQ5A 3UCGA 1H2TZ 4TQRA 3UD3P 1M5OC 3ATZA 4Z0JA 4KYZA 3X3UA 1RAEB 1YK9A 5IOBA 3TN5A 3CD6S 2FYXA 3L2MA 2DNOA 5CPOA 3QYYA 1HPZA 1Q6CA 2XH0A 2HE8A 2PRHA 4Z2KA 4C8YA 4MMWA 4LF4F 1S72S 2CLHA 3AA9A 2J75A 2YNIB 1RAIB 1BWKA 4H9TA 4NLOA 4Q44A 5DDOC 3MSGA 7AT1B 4DF8A 4B5VA 1FRMA 3EVWA 4FYWB 4NASA 2BV9A 2E4TA 4TU8A 5D2XA 1HR0J 1ZENA 4AXKA 2SFPA 2CETA 2UVUA 4UMBA 4KETA 3AHYA 2QCEA 4LVOP 4P2XA 3T05A 2PLCA 1PWLA 4Y8EA 3D54A 2OTDA 1HKVA 1EDTA 3VHQA 3N2TA 3MWAA 2HPUA 3EDEA 1U0HA 1S4FA 1FCVA 3CTRA 4EXQA 2VG7B 5A2BA 3MPDA 4FSAA 4JNZA 2HVOA 2PU0A 1MN9A 2CQ2A 2CJQA 3M05A 2VEFA 3INPA 4EXBA 1R8PA 4AEFA 4EBCA 3PW4A 3KUGA 1I2OA 3DLEB 4RU2A 3N34A 2VXNA 3W22A 1ONWA 3GU2A 4HA0A 2ATLA 1SI9A 3FGVA 5FDLA 3DRSA 1TV7A 4WOZA 2XY7A 4DOZA 4AXJA 4P8XA 4V1XA 2WNWA 2Z1KA 1XGDA 4OI6A 4AD6A 1HARA 3IVTA 3QPZA 4NNBA 1NMEB 5CSUA 5EFDA 3ELFA 2HFZA 4H1ZA 3PJ9A 1UWUA 2EG6A 3HSDA 2PDUA 4K4UA 2P5NA 1WHVA 4AVNA 2MSSA 2E6YA 4B9YA 4NLPA 3OZPA 4GJIA 1TJ0A 4KTQA 1TMLA 1E4NA 3TSDA 5CSSA 1SUQB 3MR6A 5E1QA 1DHKA 2RRAA 2WONB 4S23A 2X0YA 1KTNA 2GWNA 1T7PA 1ZS2A 1BHGA 1PO9A 3NNCA 1E72M 1GG0A 1GEHA 1XIBA 1HWKA 2B4GA 1E0VA 3EXTA 1OCNA 2BY2A 3EWWA 4NSBA 3MPWA 4USHA 3ZTQA 3BUVA 1SL0A 1TTQA 1LT8A 4ES3A 2FC8A 4PUEA 5C9ZA 3K5XA 3S46A 1A5KC 4C6JA 3VPLA 1MWYA 3BZQA 3VD7A 1W5NA 4MYXA 3WF3A 1WSRA 1VFSA 2FZKB 2CIPA 3ZC4A 2XM2A 3ARZA 5HNTA 1C0TB 3CTLA 5ABHA 2GAHC 4AZIA 1H5YA 3V5OA 4Z37A 1O5XA 2YH1A 1PJ5A 4GYPA 2J8GA 5E0CA 4DR5J 1FWEC 2ZWOA 1VLYA 1DL3A 4ZB5A 1NHKL 3UU0A 4CD4A 3MCMA 5J1NA 2VCBA 4F7VA 2J7HA 4M7SA 4QWEA 2OPQB 4NX0A 2GJFA 1S10A 1RJRA 3M7VA 5LIKX 2RILA 3B4MA 1S1TA 2IA0A 4V1YA 2AKWB 3CW2C 2BJ9A 1RT2B 1X39A 1K02A 5F4WA 1C93A 2UP1A 5HATA 4GC3A 1HL9A 1LF1A 3LALA 1F1BB 1DJQA 1LRNA 3GHRA 1QK0A 5AHNA 3DG7A 3QZ8A 1WDQA 4L3KA 2D9OA 2YBUA 4JP8A 4NCBA 1L3TA 3NQMA 3TTYA 3JTOA 2H5IB 1RADB 3CEUA 4DM2A 3I6TA 2OOGA 5HMSA 4ILMA 2J9CA 1OK4A 2AJ1A 1E6PA 2HWHA 3W9IA 5DX7A 2EPKX 1RT6B 1HWLA 3WLKX 3MVIA 1YIXA 2IPWA 4ZEPA 4KE5A 2Q71A 3D6MB 3GYNA 2PMZD 3VGDA 3DOKA 3E0FA 2PZ0A 1HW9A 1PXGA 4KRUA 1RBOB 4AF0B 2QGYA 5K7JA 4Y28C 4DXVA 1XICA 2LFVA 1EX8A 2X3DA 1YE4A 5E93A 4ERAA 5F8HA 4DWSB 1AZ2A 4BWMA 3K5OA 4USTA 3S1GA 3T5LA 3NO1A 4JTSA 1BRLA 4AEOA 1W9VA 4DZ5A 3OGSA 3S2MA 3AHPA 1TO3A 2Z2AA 4OZ1A 3SDEB 3G0UA 4NYZA 2DT0A 3RX2A 3G6XA 5GVQA 4ORMA 4Q33A 4DPYA 1GOOA 5AE1A 4UFJA 2I17A 4S3FA 3CYJA 2WC7A 3N6QA 5HMFA 5PTDA 2MQQA 4FLRA 1FRKA 2ALRA 2PWFA 2P1FA 3OA3A 3HG3A 3SUUA 2OTJS 3EB4A 4WXZA 3TC7A 3OSPA 3P84A 3Q67A 1QMLA 1Q63A 2XIIA 4GZEA 4YDXA 1DWHM 5DETA 4GUFA 2KFYA 1Q7LB 4AIUA 2A3HA 4G1NA 5LNSA 1XSIA 2ZX5A 2AGOA 2ABBA 1SZNA 2XTKA 2HRWA 3GAKA 4KRWA 1WF2A 5HDRA 3QSTA 5H9FJ 4NUWA 2WVUA 2FHJD 1PBGA 3JR2A 3MBDA 3JRKA 1CVJA 2YDQA 3DGBA 2HQ3A 3LTPA 2QS8A 3F1QA 2Z6IA 3QR0A 5I3JA 1EGZA 4PWDA 3SW6A 3TA0A 1TKXB 2Q6ZA 5IBXA 2NWRA 3O0KA 1TV6A 2ZM6F 1C91A 2ONEA 3LTOA 2D41A 4ACZB 3MM8A 1QBAA 1SR9A 5KFAA 2JWNA 4IMEA 2J6TA 3B05A 4NXMF 4F2SA 1V6UA 2V81A 4LH8A 1QPOA 4XSMA 4TU9A 4NILA 1KC7A 2B4PA 1SW7A 4DN9A 4A8KA 3UJSA 1UC4A 1H7PA 4LUJA 1RAFB 1HQUA 3JSMA 1UOKA 3EEGA 1VBYA 3R1ZA 2X42A 2EKCA 4NYOA 2G3IA 4Q8TA 4LBHA 4PUOB 4NRRA 4ZVUB 4YIWA 1OWQA 1FFSB 4LUTB 1QTWA 4QNEA 2W25A 5K9FA 3G96A 2HNHA 2RS2A 1W31A 1JXVA 3A6OA 1ZCOA 1UPPA 3STGA 4NCGB 3I68A 3M07A 2Z26A 5DO8A 1RPXA 4IRDA 2ZXQA 8A3HA 3G8RA 3F2BA 1E73M 2VCAA 4Y9OA 2HFVA 1I1WA 1G6CA 2G41A 3KFTA 3WH8A 3LN3A 4AYBD 5J2MB 1JCNA 4IUOA 1S9EB 5D3GA 4KWSA 3DERA 2F9DA 4O3SA 4ZE5A 1OFQA 4G3IA 3WLHA 4GH1A 4XKMA 5E9XA 2DDXA 2VQTA 3H22A 3QW3A 4UF4A 3DOLA 3QEZA 2V5KA 3T0DA 1OG0A 2R24A 2CAJA 3KTCA 3M4HA 3ZWTA 5B0BA 1W3LA 3ICJA 2NX3A 2R42A 3D0HE 1VQOS 1C9DA 4PBEA 4ZMMA 1J6PA 4Q8QA 4I4BA 3REQA 4HKPA 3FYOA 5CGMA 4C48A 2DNLA 2Q3PA 4O10A 1U8SA 3L7PA 3NSXA 1GQNA 1IJFB 1ADSA 4DR4F 3DNCA 1XIJA 4XBKA 3BF4A 2RJZA 1ISXA 3LGHA 1U24A 4MM1A 3KLLA 4O17A 2BGQA 3CMAS 2E25A 3F41A 4UFIA 4JI3J 1HI8A 1E6VB 1RJJA 1UJ4A 2PT0A 2YWWA 3W63A 4UNIA 2IRYA 5H8MA 3MBFA 1CLKA 5GQBA 4PXDA 4JV5F 1B64A 4GOAA 1PYSB 4Q45A 4YN3B 1KLMA 2D22A 3D3AA 2OP5A 3RNDA 3VTIA 3J81j 4L1GA 5D78A 3SCVA 2HBYB 1I0BA 4KV8A 3AU6A 4MB3A 4Z1YA 1DARA 1TMJA 4QAIA 1F2GA 1SO4A 2ZUGA 4CU7A 3B0PA 1UKQA 1FH7A 4OYPA 3CIWA 1FE0A 2IRXA 3MD1A 4CT8A 4OZJA 2QCLA 4M0XA 4DZIA 5EMYA 4J37A 2IVMA 2ALZA 1LQ0A 3EDJA 4MYUA 1FKPA 2FJKA 5CHCB 2V2HA 3CZJA 4DV4J 2D0GA 5T9CE 2Z7GA 3BCDA 1ZPWX 3IMQJ 1H38A 5E5NA 3QV8A 3TUIC 2AJ2A 5FEPA 3VDCA 3A3PB 1VHIA 5HSPA 5LSRA 3PAOA 3LXBA 5GPRA 4YB6A 2FFIA 2UBPC 3ARSA 4GGBA 1RT5A 1K1QA 1MQRA 2KT2A 1OINA 3PF3A 4NXSA 4OIFA 2XFWA 3TC6A 3V2UC 3KL5A 5MKGB 1NM2A 2REQA 3VUPA 3F0NA 5AHEA 1YRTA 4FA3A 3CMGA 3AYVA 4HHUA 4DQPA 2WWCA 5K8PA 3EE3A 2ASLA 3WDOA 3YPIA 1W3IA 3IS9A 1HHTP 1H1ZA 3M8WA 1TJ1A 4UTTC 1FEHA 2Q3RA 1NNDA 4EZ6A 4MKYA 1LZOA 4DF2A 4D1IA 4HHJA 3SZ2A 4RZ5A 4BQ5A 2YWEA 4PQAA 4MSSA 3TWBA 3OTOJ 1ELSA 3OL8A 5H8UA 2CPYA 3M2RB 3CMES 7PTDA 4Y6GA 3IGUA 1H1NA 3IIZA 3AQPA 1F07A 2W63A 2DYAA 1UD8A 2ASJA 3UZYA 5CCLA 5U47A 1E0TA 2WBMA 3L4WA 1TQJA 4LUYA 2J7KA 4WJ8A 2VUNA 3TYZA 3AHXA 1ONXA 3B8TA 4DJDD 4O16A 3GV8B 1QNVA 1VEPA 3DN5A 1L3KA 2CG8A 2HK1A 5A6JA 1XUZA 1HGYA 3S9IA 2Y0FA 1KA9F 2WW4A 4DQSA 5C71A 1H74A 2GHWA 3LA0A 3WQ8A 2BOFX 1VCFA 2WAQD 4HKQA 2XYLA 2GDVA 4RUAA 1JKHA 2GO8A 1B5TA 1FX2A 3PBMA 4K5RA 4OOZA 3HHLA 3HHLD 3PYGA 4PGLA 1QSSA 1QUPA 2H9ZA 3L4YA 1LDCA 1U5VA 2QHAA 3IK4A 1RLDA 1HNWF 1APSA 3KRBA 1KW1A 3O9NA 1YXYA 2HHHF 5JBEA 1NPKA 3CT7A 1PIEA 1J5SA 4XD3A 1GVYA 3RX4A 2V94A 5A0YA 5J2PB 1FWRA 1K6WA 2J9DE 5DDRC 5B0AA 4JI5J 2F3JA 3Q58A 3HP6A 3RU6A 2O01C 3V16A 4GHRA 3A1YG 3LHWA 3PZQA 3BC9A 5GAGI 3I7QA 1VQMS 2XVGA 2GVZB 3RB0A 3DX5A 3B9AA 3WEMA 3UN3A 3M2VA 3BGRA 4TLRA 2ATSA 1ZHAA 3A8KA 2ZZ1A 2LVWA 3DDNA 3QGAC 4Q8NA 3WLQA 2E7XA 3IACA 5C7PA 1RHUB 1K73T 1UVMA 3BJTA 1T99A 1OZQA 3HXMA 5ABTA 3H98A 1LW2B 3UFCX 3ZZRA 2ZKUA 1S0MA 2BHZA 3F4WA 1NDKA 4U9RA 3CASA 3AIUA 2QYCA 4DBQA 4JTUA 2GV1A 2VOOA 2RJHA 3D47A 4J3ZA 4K4ZA 3BO2A 4CH7A 4O11A 3VGUA 3C3LA 1A5OC 3FNNA 1X7IA 2X3GA 3EZUA 1RTHB 1H7XA 3VCNA 3AYTA 4BS0A 3EPIA 1I75A 3A9BA 4ZBCA 4ES4A 4IOBA 5LMNJ 4MZYA 2C1IA 3EMCA 3ANUA 1JXJA 1F5CA 2ODOA 3IR7B 2J13A 1KKOA 4ZVEA 2JVRA 3NS5A 2YNIA 1XLDA 2J7EA 5JBDA 3IWXA 4YYFA 1A0CA 4PSRA 3FVMA 1ZZFA 1TFYA 3DRRB 1KBBA 4K3ZA 1E1FA 1TL1B 5GJPA 1ZBCA 1N5YB 1YEYA 3GFXA 3H7VA 4UUWA 3V5FA 5L6UA 1JLBB 3B06A 1GAOA 1SCJB 2EG1A 4K39A 4YY3J 1XQIA 3UWVA 2GK1B 3EZ5A 1IEIA 3W6MA 1J6OA 1V3KA 2VELA 2VG7A 4UXDA 1OEPA 3WQ5A 1PKNA 1CZ1A 1L9WA 1VYPX 5FJRA 5HUPA 2FJBB 4I6AA 4DL0C 3UPBA 3DLEA 1QAYA 5HMDA 2N3LA 3EWZA 2ALDA 3GH7A 3M43A 1DTNA 3SJNA 3TVKA 2JEGA 3FKBA 5H9EJ 4AC1X 2DZWA 2B7QA 3G1RA 5FLXY 1JNEA 1GTHA 3S5SA 4HI2A 3IAQA 2QRRA 5K8OA 2CIMA 4WX2A 2ZBRA 2ALYB 1X98A 3AA8A 4YCOA 5LA1A 3WK3A 3MMAA 4PL2A 1T8EA 4IKAA 4FALA 4EU0A 3WMCA 1V6TA 3CV6A 4HPHA 3TZFA 1R46A 1NK4A 2G1HA 4NOHA 4Z1BA 3EXCX 1N33J 3CO9A 3AICA 4LEQA 4F2BA 5LM7E 4DYEA 1QO5A 3ZZZA 5K20B 1SUQA 3M2UB 3UD4P 4PB4A 3EMQA 2XWDA 4QDMA 1DOSA 5D30A 4M56A 4FYYB 4YOEA 2WONA 3N14A 1XH2A 3ZOAA 3QH2A 3KRUA 1DTTB 2IDEA 3C2FA 2NXHA 3SY5A 3HURA 4DIAA 4B08A 2J25A 4HIBA 1F6PA 1VCTA 1YLVA 5GJNA 2BM0A 1QNQA 1Z6KA 4QIVA 1LWEB 1TE1A 1DTUA 2DY9A 3L95X 3VC5A 3RRAA 4MADA 2WMHA 5D4YA 2OX4A 4UZCA 4QJ1A 2E67A 2VT0A 1UAWA 4QGCA 3K1GA 4FF1A 4ZZ9A 4UBPC 4NXNJ 3KVKA 1WC4A 2JHEA 4RKUC 2HEJA 1BVNP 1R8LA 1C0TA 2DJXA 1B3WA 1SO3A 3K1DA 3S6DA 2NQ5A 2EK1A 4JHZA 4R3UA 2PRMA 1IYXA 3RO8A 5L38A 4LAMA 3UQSA 4YN5A 3POTB 3LZ5A 1BYDA 1L3SA 4JDBA 3WLRA 4US5D 1Y3JA 2JJ4D 1QM9A 1M90T 2PB1A 4AWTA 1TYGA 1OYCA 1WEXA 2IMRA 2QIWA 2C2RA 3LCFA 2Y89A 4S0MA 1NOFA 4PMXA 1RT2A 4CO1A 4LRBA 3HJZA 1RJQA 2CHRA 4OTKA 3U02A 1RWOB 2OPSB 3QY6A 1N5SA 1IXPA 2DW6A 4RE2A 5BOFA 5BYSA 1NQKA 3THQA 2P9CA 4ZVJA 3QC0A 1FXQA 1CJUB 4X4TA 2BRKA 3MAQA 2GVDB 3C2PA 1GT8A 4L73A 4JEQA 5KFRA 3W27A 3IRXB 2QMKA 4QSHA 2DVIA 3CV1A 1RT6A 3M0XA 4AD4A 4CWBA 1RI7A 2EPNA 3RCYA 2ILZA 3PDNA 4ECVA 2D1CA 2VZ9A 1BKHA 4I8DA 2HYIB 4P7LA 1CEZA 2I2YA 4AF0A 2WTFA 1PHWA 4LNCA 3NNAA 2ZZ7A 3AOFA 3GQCA 1GK8A 3G8QA 1L3UA 1SO5A 1KR4A 1LL7A 1ZBTA 3UT0A 3R27A 4KRTA 4DWSD 5C2CA 2OQHA 2VODA 3SM0A 3FKRA 3OOQA 1SFSA 5BOOA 1CULB 3HQ1A 3R13A 3SDEA 3ZR6A 2I5GA 1H63A 3D6NA 1R9ZA 2QG9B 2YYTA 4IOTA 1Z89A 2L3MA 7TIMA 4GI4A 1IXNA 4R9OA 2H5JB 4ECYA 1K8CA 2J6VA 4ZFMA 3RLHA 1EIBA 4PMRA 4ZFCA 1V02A 3BPDA 4X66J 3TIMA 3VZHA 1H6KX 4O3NA 3LB0A 3CJ8A 4PR6A 4I68A 2CERA 1MWOA 3G9CA 2KFNA 3PFEA 2HRUA 1W9PA 3WUEA 3J81Y 4W86A 3E5BA 2CQ3A 1U1UA 2RKXA 4FMVA 4I7UA 3G6VA 1VPXA 4QJ3B 4QIGA 4M6UA 3QYSA 3TJLA 3DCPA 5LMUF 4QBXA 3W7NA 3C16B 5KG7A 4P10A 4UWMA 3W7QA 2EPMX 5DY2A 1DQ8A 3LQVA 4KGZB 1E5NA 3RUBL 3TP2A 1YYAA 3DLKB 5LJ3Y 1RDRA 4NYUA 1TKXA 1VCVA 1OCBA 3WQOA 2QVNA 1RWPB 4URIA 1XINA 1IM6A 3HQNA 4ACZA 2WVDA 4WWSA 2M2BA 5EWEA 2A6OA 2WV8A 3W7PA 1NARA 5I03A 4HK5A 4ML9A 5C9WA 2K8GA 3CJTA 4DX5A 4DZDA 3R5AA 1CTNA 5AECA 2R8HA 5CA5A 4PWUA 2L5HA 2GZOA 4YB1P 2RQKA 4O0ZA 3QRQA 1W9XA 1THFD 1VGYA 3KLGB 4N5SA 1VC5A 3HLUA 3W72A 4I6VA 4LEFA 3KP1A 2B51A 3CJPA 3FDSA 3ME3A 3CO4A 4JIEA 5GVJA 2HG4A 5J1EB 2FUG9 4PUOA 3WUBA 3THPA 3CUNA 3C0QA 1XLLA 1FFQA 2XN2A 4LUTA 4LJMA 1C3FA 2KKHA 4EX4A 1IR2A 4J3VA 2ON3A 3LMZA 4H9XA 2W92A 4UMAA 4QW8A 3BSOA 4ICMA 2J78A 2R1PA 4M7TA 4OJ1A 2COLA 3UD6A 1BAGA 3TE9A 4NCGA 3F56A 4K0KJ 1SB6A 5DRKA 3QZEA 2WSRA 4C6NA 3GM8A 3VVTA 3M0IA 3LCIA 2HTMA 3AD8C 1PIIA 4F8XA 4UT4A 3GIYA 4BQ2A 3EVOA 3AHZA 3HGJA 5JUMA 1VAHA 2AAAA 4Z1DA 2QUVA 3AC0A 5J2MA 1PV8A 1A5SA 1T5AA 1S9EA 4BHQA 2BMBA 2C0HA 3K8LA 2DNYA 3O5TB 1Q86T 3T55A 1W91A 4L4OA 4J9JA 2WMFA 4NZCA 1LOQA 3SECA 5DANA 2YPYA 4AD3A 3MYOA 5J1PA 2OKOA 3UYIA 4QWBA 2QLWA 1V9OA 4NE9C 2F8HA 6AT1B 1A47A 1UZHA 5A8OA 4CO3A 4UQAA 3NL5A 3I9ZA 1OFEA 4EAMA 2M9KA 4LS0A 2J6SA 4ZQCA 1VBHA 5BW6A 2I9EA 2Z7KA 3HFTA 1S97A 1DJNA 1CI1A 2IKGA 4GZIA 3CS2A 1H0IA 3GU1A 4H9ZA 4JBCA 3C6CA 1T9VA 2G97A 1EFZA 1L8NA 4ZGYA 2PCEA 2H54B 4HL9A 1E6VA 2Y1RI 1OSCA 3SRHA 2ADBA 4C91A 1IWPA 3KMSA 5G4HC 2ZITA 3D5HA 2NREA 4TTUA 4R8UB 3W1QA 1K9FA 5CG7A 2E29A 4RK8A 2QMXA 1NJWA 1XRFA 1H49A 3BSAA 4LF5F 3T6JA 4RW6B 3UNDA 2WXDM 1TV3A 2HGNA 3PVFA 4WOQA 1N6QB 4Q2LA 3LANA 1XRTA 3SJ3A 3MPUB 2PODA 3LLXA 4S3JA 3TVAA 4LSLB 4NMLA 4N7QA 3MHUA 4QEEA 3TZWA 2PURA 4EE9A 3M0YA 2XEXA 4F9DA 1RY8A 3H26A 4LFCF 4IT1A 5FAJA 3NG8A 1T0OA 1LW0B 2GGJA 2EPIA 2C42A 4LF8J 2RDTA 2ZUNA 2WJDA 4WEVX 1B1YA 5CPNA 3TYDA 1JAKA 4QX4A 4DUYF 2FVPA 1NFGA 4NX9A 2NXUA 4J9UE 4EO8A 3KBJA 4R5EA 4PE8A 1FDNA 4HD5A 3PNUA 2R9LA 4WDWA 1U1OA 1U49A 2WMKA 3U2OA 3V4MA 3HT3A 1Y5WA 1Q7QA 5MKGA 1PUDA 1CLVA 1JCYA 5FL1A 1G4CA 1V3ZA 5F4SA 4ZR8A 4G65A 2C3MA 1VC4A 2J7GA 4QYRA 3N4FA 1LFPA 1BE4A 2ZJRQ 4K37A 1LROA 1P1TA 2YTCA 5AHLA 3H2EA 3WNOA 1EETB 4F48A 4F4YA 3UWZA 3CC2S 2LCWA 3K8MA 2BZNA 1F6TA 1CIUA 4QR6A 4NA3A 2PBGA 1P43A 1YZ7A 2I5QA 1PWMA 4WKAA 2M88A 4E2BA 3L4UA 1NEYA 2OZ8A 3M2RA 3ORWA 1VF8A 4QE4A 2VPYB 1EC9A 4PSPA 2BX7A 3DFTA 2YDSA 1OY8A 3U9IA 3GXNA 1D8CA 1EPXA 2VG5A 4Q8MA 3DMJB 3SAZA 4FPIA 4E5TA 4IH5A 3VVGA 4AW7A 1F3EA 3UJ2A 3U2EA 3VIOA 5FSDC 4GIEA 2ROGA 2C16A 2B8QA 2W3ZA 4DXLA 3QJAA 4Z17A 1FH8A 6XIAA 1T8XA 1HWUA 5DZ6A 4TN2A 4CN6A 2YDAA 2RVJA 4OJGA 2G4BA 2FDSA 3SUWA 5BZAA 2WSKA 4TKTA 3OVRA 4GUGA 1S7HA 4AZGA 1BUXA 3P80A 2YA0A 1VRQC 3CGIA 1FTRA 2QT7A 5J2PA 4R33A 3O07A 3OEXA 4F2UA 1RBLA 4MY1A 2VENA 4WSKA 4Z7CA 3SN1A 3LPPA 2MKKA 2DO0A 4ONVA 4S1FA 1ZPTA 5DQGA 4N4PA 5BXPA 3EKGA 1WZAA 2QVHA 2XN1A 4DV5J 3CAVA 4LALA 2GVZA 2WYSA 3BKUA 3UJRA 3RF9A 4GRSA 4AL6A 3STEA 2PDMA 3TMQA 2NT0A 1XWYA 4WU2A 3UE2A 2R2RA 2W6RA 1ISVA 3WMSA 3UWQA 3CUFA 3MCOA 2G0JA 3QWPA 4N9EA 1FHLA 3AJDA 3ZFVA 3UR7A 3OR1B 1Q45A 2V69A 2YCLB 3AZRA 3PX6A 4KH2A 3JTNA 3TAMB 1KVKA 2YQ1A 1WHWA 1M1KT 5HXMA 3TQEA 1ADDA 4RZBA 4AXNA 2VD8A 1XLKA 2NYIA 3W2LA 4ZPDA 2E9ZA 1KFJA 3W4RA 2YL6A 4NJHA 1O5QA 5D05A 4W8AA 2BANB 3QIPA 3CC4S 2WHMA 4W8LA 2JIEA 4RE4A 4CCCA 1VBKA 1RT3A 3AAWB 2HVEA 3I55S 2CESA 2VRQA 2ZOFA 3EWCA 3FBBA 2VZOA 4ANCA 1CT5A 3BQ2A 3SFUA 2MUCA 1NJJA 5A6KA 3KJQB 4LANA 2DEPA 4IM4A 2C1GA 1ZAVA 4U8YA 1SZFA 2A3BA 4M19A 3DRRA 1AL8A 2FHMA 1MDRA 3WX8A 4JTTA 4RNHA 2YKNB 1TL1A 4X60A 3D0IE 3DYAB 2XY6A 1C8XA 1N5YA 4IOAQ 3RB3A 2C14A 2E66A 2QQ6A 2BE9B 4FEZA 1JLBA 1AK5A 1UCNA 3OL7A 3H4GA 5EMUA 5LXRA 4WF7A 3H4BA 1UMYA 3W00A 2GK1A 5AVHA 4WPAA 4ZVHA 5LA0A 3M44A 5HQLA 4YTTA 1SKRA 3MMUA 2HS8A 2Y8WA 5K5MA 4J3UA 4DI9A 2INEA 4JTQA 1KD1T 5JQ9A 3G1DA 3JYTB 4JTKA 4QDPA 1KM0A 4F26A 3O3LA 5DRCA 2GZXA 4URGA 3NGFA 4E6MA 5C5YA 3RTVA 1S6UA 5HVHA 4OI3A 3K13A 2VFRA 1J0JA 2LU2A 4W4QA 2PI5A 3H8YA 8TIMA 4KH1B 3GSDA 1M03A 1FX6A 2CBJA 3POCA 1UWTA 4IOCQ 2WRMA 3AWNA 1J0ZA 1UP3A 3DFHA 3MWCA 4QPXA 2NVAA 1HI1A 3SV3A 2VONA 1YRRA 1E9ZB 2HZGA 1L2QA 4FS1A 3WK2A 3PHEA 2J7BA 3EDFA 4GYPC 1HUVA 2NW0A 1DBTA 4C6QA 2EC2A 3E51A 4OBSA 3CHVA 3U7JA 7ODCA 3P60A 4DB7A 4B5WA 1FA2A 3M2UA 5HVGA 5I3PA 3G87A 2UXBF 3P45B 3QR3A 5C8BB 2PLMA 2QCNA 2UXCJ 3DYOA 3VF0B 4DFMA 2IPFA 2UVWA 2VA3A 4NVTA 5XINA 1DTTA 2QZ8A 3KL0A 2IM0A 5H2ZA 1M5SA 1PO6A 1YDYA 3D3BJ 1S1UB 4KHMA 2IS7A 3LSCA 1FX4A 3BMWA 4JYDA 2Z0IA 4QQUA 4ZQNA 4CQ8A 1LWEA 2CLLA 1OC6A 3M7WA 3OLGA 1ZQ5A 2SXLA 4DNMA 2HE5A 4A3UA 4PG4A 3AI0A 2YJQA 2RB7A 1PE1A 4J9KA 4CRJA 2RRBA 3S8HA 2NUHA 3A22A 3IJQA 4BBYA 3G6MA 2EKYA 2ZBCA 4ZSUA 4UNKA 5K4ZA 1FWAC 2WMGA 2I9UA 1SMDA 1UKPA 1V4YA 1FO1A 1Z69A 3K8VA 3POTA 2AL2B 3F44A 1FWPA 4ITSA 4O52A 1XMQJ 1S0VA 1CPZA 1SL1A 2AGKA 4GPNA 3IAM9 2G50A 3I96A 3C46A 1HO1A 2DUXA 1BWVA 5SWUA 4OZ5A 4DX7A 1KP6A 4LW7A 4EPBC 3TI0A 4AEEA 2YKQA 4X22A 5CYQB 1K4HA 1QFEA 1YMYA 5ETPA 4F0LA 1AJ2A 4WJEA 2OPSA 1RWKB 5DGBA 3OZOA 4GIAA 2VWTA 3TZYA 2PIIA 1IUJA 4DR2J 3WQ4A 2ISDA 1CJUA 4AXIA 2BXZA 4IMDA 4PBGA 2V5BA 3N13A 4GE8A 5U7SA 2GVDA 2IQTA 3GDRA 1XYZA 4FR1A 3IRXA 4TU7A 3R0UA 2Y9HA 2L9NA 2HMIB 5IFPA 1CC7A 1XMBA 4ED7A 1VIXA 4RUBA 1S39A 1U2CA 4JI7F 3VGTA 3IPWA 3EKLA 3PB2A 1WZKA 1VB9A 3H20A 4KCTA 3NM1A 1V3RA 2VHGA 2QLYA 2V0TA 4H9UA 1IWAA 4GUIA 5HNRA 3E9AA 1MEWA 4H7ZA 3NCQA 3SCSA 3N28A 2YX7A 1NKEA 3N11A 1NOWA 1V3MA 1TUVA 3RR7A 4RDZA 1ZS6A 3ISNC 1CULA 2C3UA 4PPDA 3WK1A 4UCGA 2K1RB 2XSXA 4MUZA 1BQMB 3TNVA 2J62A 5BNKA 3QYQA 1TPVA 5IBXC 2J88A 1GXTA 4KEUA 5T8GA 2EWHA 3KS6A 3VV2B 1TIMA 2FTRA 2DPJA 4QTGA 2DGAA 2VOMA 2WB1D 1IEWA 9CGTA 1N36F 1Q6EA 3HV9A 4CQ9A 1KFSA 2RIJA 2NWSA 4IGHA 2M8DB 3ATYA 1QNRA 1S38A 3KAOA 2HQCA 3R5JB 1UEVA 3F7JA 4UNLA 3SN4A 3LOUA 2IJFA 1X6NA 3QATA 2Z2MA 3TYBA 5A6PA 5JJBA 1CWYA 1PHQA 5BJRA 2R9RA 2XFFA 1OYAA 1B3XA 3QSRA 3C16A 1UROA 5FCZA 1H5VA 1M1HA 3HM7A 1POJA 1YLXA 3RPDA 5IS2A 3DLKA 3TJXA 3N4EA 3H2NA 5E2QA 3K7RA 4ANDA 3W5ZA 1WEZA 5LNWA 3R4IA 1ZRQA 2YA1A 1JCJA 2YW3A 5KFOA 1G67A 1VQ5S 1QU4A 3AALA 3LRMA 4B3TF 1ME9A 1NDLA 4A8RA 2KVIA 1X7VA 4P52A 1SJQA 1UZDA 4AC7C 3MMTA 4L9XA 1F6YA 3IBFB 4QPTA 1TL7B 4CLYA 2Y5EA 3HHKA 4MIAA 1BSLA 3URNA 4LOCA 4RE3A 1NU4A 1JZ3A 2WNZA 2UY2A 3VKJA 1TRDA 4DQWA 1GVEA 4K1WA 3GYGA 4RKAA 1UMLA 5J1EA 3CMFA 3BANA 5CJNA 3UVIA 5CCZA 3K2YA 3MUTP 2E77A 4WCJA 5EB8A 2P6SA 5I5RA 3NLCA 3M5XA 1GCYA 1AMKA 1CXEA 5I3KA 3SADA 4B4HA 5KFSA 3GZ7A 1WG5A 3GU0A 3TJ4A 1CXHA 4XZNX 3D1QA 5BR8F 3TR5A 4LC8A 3O7UA 5BXIA 4FVCA 5KMYA 1Y5IB 4DEFA 2V2KA 1XQKA 1JJ4A 3L4BC 2XYHB 3AXHA 3G0XA 5G1MA 2IYIA 3DFQA 2LEPA 1TVLA 3BG3A 2KHDA 4TTGA 5E33A 4C0BA 1M5VC 1U1KA 3RRGA 4YB7A 2B6AA 2O4MA 1EJ7L 5I42B 5HLFA 2PWEA 4FNHA 3MURP 3Q2TC 3P49B 4Z42C 5AYIA