3PJWA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, i23
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 130
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjwA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjwA01
2IM2A 3ISNC 3NGDA 1HQEA 1S1VB 1JX4A 1C0UB 5DG9A 2OPRB 5KFCA 5CYQA 5KG6A 3T19A 3U2EA 1DLOA 3MR6A 4K4UA 3QZ7A 1EP4B 4IR1A 2W7PA 3C6TB 3G6VA 4WZQA 4X2BA 2ASLA 1JXLA 4IOBA 4YP3A 4LSLA 3DLGA 1IKWB 1D1UA 3DRRA 4KKOB 4MFBB 4MH8A 1I6JA 1LWEB 1HYSB 1HQUA 3GILA 2BE2B 3LP2A 3OL8A 1N6QB 2R2TA 2DPJA 2ILYA 1IM4A 2WONA 2VG5B 4ZVEA 2C22A 2JEGA 3T5HA 2V9WA 1TV6B 4Y3CA 3GG0A 2C2EA 1LW0B 4YR0A 3I5BA 4Q0BA 4Q0BB 4EBEA 1S9GB 4J40A 1MU2A 4KSEB 2W8KA 2OPSA 3H59A 4O3NA 4HYKA 3PVXA 3PW5A 1T3NA 4ZHRB 1RTDA 4QWDA 1S1TA 2YKMB 3M9MB 3CJ5A 3CDEA 3PW7A 2BASA 1UWBA 5KFUA 5DLGA 2XGPA 5J2PA 1UWBB 1S10A 1QAIA 1JLFA 1RAJA 2IAJB 3KJVA 4NLPA 3TAMA 1S48A 5KFBA 4MK8A 3JYTB 3MEEA 1HNVB 3RAQA 2AU0A 3CVKA 3MEEB 4K4SA 3MR2A 4LQ9A 1RT7B 2R6OA 4IFYB 3KK1B 4EBDA 4ZPCA 4KHMA 3PW0A 5KFDA 1RT1A 5DQGA 4QWBA 3PZPA 2BR0A 4O3SA 4AG0A 3BGRA 1S0MA 3DYAB 1S1XA 3OHBA 3NMAA 2W9CA 3DYAA 1C0TA 2WTFA 3I0RB 3GIIA 4Y8EA 4ECWA 1NHVA 4URQU 4ECTA 3RB6A 1TP7A 5J1EA 4IH7A 1KHWA 2RF2A 4NLVA 4M95A 1KLMB 2I1RA 1BQMB 2BRKA 3DRSA 3QLHA 4K4ZA 3E01A 1JLQA 5JXSA 4FS1A 1K1SA 3E01B 5KFYA 4YR2A 4JV2A 1S6PA 2WOMA 4O4RA 4J9KA 3GFXA 4H4MA 3LP1B 3PJUA 5M1TA 3DOKB 3LP1A 4XPEA 1SH0A 3RB0A 1N4LA 3SI8A 3KLFB 2JEFA 1TKZA 4XPCA 3KMSA 3I5AA 2JC1A 1JLEB 1JLCA 3PFMA 4ID5B 4ID5A 3IRXA 3NAIA 4F4WA 3V6DB 5MF5A 2IM1A 4NCGB 4IG0A 5L1KA 2XC9A 4IG0B 3JSMA 4I7FA 5EWGA 1N6QA 3H98A 1ZTWA 2FJVA 4TQRA 2FJXA 2XWYA 5KG0A 4YQWA 5EDWA 4ECUA 1TVRA 2W9BA 1T05A 5KFIA 3KK3B 3QO9A 2D3ZA 2ZE2A 4O3RA 3IG1A 4PQUB 3LANA 4IR9A 1S1TB 4QWCA 5I3UB 1JLGA 3MR5A 1RT3A 4K4VA 2QV6A 5C42B 1RTHB 2BRLA 4IKAA 5J2MB 5KG4A 4LJ3A 1JLBB 3V4IB 3RBEA 3OHAA 4HJFA 2FJWA 3NKYA 3PHEA 5C24B 4NLXA 4O44B 2YNFA 4Y2CA 5C24A 4RNIA 1DTTB 2IC3A 3KLIA 3LP0B 5DG8A 4YMEA 5HROA 2IA6A 4WYLA 4FBTA 1RT5A 4TQSA 3MEDB 3DRPA 4R0EA 3GFZA 3HV9A 2GIRA 1S4FA 4DG1A 1JLAB 2HWIA 5KFEA 3DM2B 3PR4A 2BANA 2ZKUA 4IRDA 1SV5B 4NLDA 2HNZB 4ICLB 5KT4A 3DMJA 2OPQA 2YNIA 1U09A 3I0RA 2IJFA 4DL3A 3BREA 5KT6A 4ED0A 4WE1B 4ECRA 1T94A 3LP2B 3TQ1A 3IS9B 5J2QB 3LAMA 3H5YA 3DLEA 1S1UA 2E9RX 3KOAA 1S1UB 3N6MA 1S6PB 1FKPB 2D41A 1TV6A 2WOMB 3CJ2A 3D28A 4H4MB 3S83A 1LW0A 4F3HA 5MKGA 3HVTA 4NLQA 4QW8A 2RDJA 1TQLA 1VRUB 4NLWA 3KLHA 3CJ0A 2I5JA 1TL1A 4KB7A 4EEYA 3M9NB 1RTDB 2FVQA 2R8GA 3I0SB 4TY8B 2OPPB 3NL0A 5KFXA 4TY9A 4RNNA 4NRTA 5KFVA 3OSNA 4F50A 1IKVA 4K4YA 2XCPA 1IKVB 3I5CA 3IGNA 3M8QA 3M8PB 4MIAA 1TKXA 2HNDA 5F8HA 2B5JB 5K14A 4RNMA 3PJWA 1TL3B 2HNYA 3MFIA 2C2DA 4QWAA 2HWHA 2HMIA 2HMIB 3V81B 4ED3A 3KK3A 2J6SA 4FOJA 1HMVA 1RT2A 5T14A 5CYMA 3RAXA 1QAJA 3CO9A 4I2PA 4TXSA 5I3UA 4WXOA 1TKTB 1HNIB 1S1WB 1HNIA 1RTIA 3HVWA 4M94A 1W25A 5J2NA 4NYZA 4O4GB 1RTJB 3OL9A 4RW9B 1C1CA 5KT7A 2AX1A 5EWFA 1RT5B 3EZUA 4J9SA 4DEZA 5KG1A 3GV8B 4I2QA 5HP1A 1WNEA 3FFIA 4J9NA 4NRUA 4U7CA 4DG1B 3T5KA 1S0NA 4KIEA 2RKIA 4NLRA 1IKWA 1HQUB 3H4BA 3RB3A 2YNGA 4RUCA 4LYKA 4QW9A 3BQ1A 2R8KA 3KLGB 2VG5A 4Q44A 1JLCB 4R5PA 1S9EA 4IG3A 2ASJA 3KK2A 1S9EB 4PUOA 1D0EA 2AQ4A 2R8JA 1MU2B 4TLRA 3MF5A 4DL5A 2ALZA 2UVVA 3DRRB 4KKOA 4AFYA 1SUQB 2ILZA 5FDLB 2YNHB 4EO6A 4G1QA 3MEGA 1HARA 1XR7A 1RA7A 2WONB 3Q8QB 2C28A 1S97A 2FLLA 3T5JA 2E9ZA 2XGQA 3M9OB 3QIPA 4URSA 3KJVB 1LWCA 1IKYA 3V6JA 4DL6A 1REVA 1FKOB 4KV8A 3OSPA 2AGOA 2IM3A 4TY8A 5EUHA 4U6PA 3UPFA 3KHRA 1NNDA 2ATLA 3BSOA 4IFVA 1KHVA 2AX0A 5KT2A 4ED6A 1JLBA 3TLQA 2XI3A 1YVFA 4LSNB 4B3OB 1FK9B 5J2PB 3CJ4A 4LQ3A 3FDSA 2OPRA 4MK7A 5D3GA 2HNZA 2YKNA 4J9OA 2VG7A 4ZP7A 1JKHB 3RB4A 4Y2AA 1JKHA 4NLYA 5F8LA 3FRZA 1RT7A 3DOLB 2QE5A 3KMQA 3KLEA 2RF2B 4F4ZA 2BQ3A 1OS5A 4IRKA 1IKXB 4ECQA 1RA6A 4Y9OA 1LWEA 1RT6B 5HBMA 5DLFA 1HMVB 1RT2B 3DI6A 3G6XA 3G86A 3KHGA 4WFYA 5KFLA 3MFHA 4MKBA 4NZ0A 4DL4A 2WHOA 3Q8PB 3PJXA 1LW2A 2VG6B 3HVTB 3MECB 5KFRA 4RNFA 1S9GA 4DL2A 2C2RA 1C0UA 5F9NA 4ECVA 4ECSA 3IS9A 4RZRA 3I0SA 4EO8A 1TKZB 3H5SA 1JLQB 4IDKA 3OLAA 4Q6JA 4KFBB 5KFFA 3ISND 4J9RA 4ZP8A 5L1IA 3IRXB 3V6DA 3DLGB 1JLFB 5HLFA 4NLGA 3PJTA 4MFBA 1TKXB 2HNDB 5KG3A 3JSMB 1HNVA 4IH5A 2FLPA 3N6LA 3GQCA 4Q8EA 5KFPA 2WK4A 2DPIA 1SH3A 4R5PB 5KFZA 3C6UB 1T03A 1T03B 4HKQA 2W9BB 1T05B 3ITHB 3T5LA 3CIZA 3IG1B 4K50A 1RYRA 1DTQB 3GIMA 1S1XB 3HKWA 2J6TA 2ZD1B 3UDLA 2ZD1A 3GIKA 3CDUA 4JV1A 2CJQA 5I42A 4R8UA 3PR5B 4R8UB 2AGPA 1HQEB 3BJYA 4PWDB 2XI2A 5KFMA 3BSAA 1C1BA 5J2NB 3UQSA 3QLHB 5KFOA 1SH2A 4MKAA 3JYTA 4KAIA 4URGA 4J9PA 4FBUA 4PQUA 4ECXA 1EP4A 1TKTA 1C2PA 2IBKA 1HPZB 4RW7B 1QE1A 1GX5A 1QE1B 1S1VA 4LSNA 4B3OA 1RT1B 4WZMA 2EC0A 2W9AA 1CSJA 3KLFA 3LP0A 1DLOB 3BGRB 4J9LA 2F8EX 4GC7A 2VG7B 4QPXA 4FOKA 5DG7A 4WYWA 2FVSA 2R2UA 4LSLB 1RDRA 3SFUA 2IMWP 2WRMA 3QIDA 2WB4A 1HYSA 3GV5B 1GX6A 4WE1A 5FDLA 1BQMA 3IGVA 5F8NA 2HAIA 4RU9A 2JEJA 3TVKA 2YKMA 2BE2A 2AGQA 1S49A 2OPQB 4IG3B 5F8MA 3LALA 5F8JA 1TVRB 3DOKA 3QIPB 1S9FA 4NLSA 1R0AB 1VRUA 5DQHA 3UR0A 2W8LA 3D5MA 4DL7A 4ZHRA 4ZPBA 1XR5A 1RYSA 2OPPA 4Q8FA 4RW6A 4IFYA 1FKPA 4WXWA 3KK1A 4RNHA 2GC8A 4KFBA 5L9XA 3RBDA 3H5XA 5KG7A 3V6KA 2YNFB 3M8PA 3HVAA 2IAJA 2RDIA 5D3GB 2FVRA 2V0NA 4EBCA 3H4DA 4TN2A 2FLNA 4RW4A 4IH6A 2IJNA 4RW4B 5KFQA 5KT3A 2UVUA 1S0OA 4J9QA 1FK9A 2V4QA 1S6QA 3KLEB 3HHKA 2R8IA 3DLKB 4ED2A 2ZE2B 2BANB 5KT5A 4GC6A 1ZETA 4Y34A 2V4RA 2CKWA 4ES4A 1N48A 1VRTB 4Q43A 1N5YB 2GIQA 3DMJB 1TL3A 2HNYB 3H5UA 4RW8B 1RT3B 5L1JA 1N5YA 4RW8A 5J1EB 5I42B 2BQRA 2XCAA 3KZPA 3MECA 5C5JA 4O3PA 4RUAA 1RTIB 4RNJA 1QUVA 3G6YA 5HROB 1KLMA 5DGAA 4H4OB 3DRSB 1N56A 2E9TA 4IRCA 1C1CB 4TYBA 1EETA 1RTJA 4QWEA 4I2PB 2JLEA 5JUMA 3NBPA 2UUTA 4ZVHA 1LW2B 2VG6A 3NBPB 4ZPAA 3C6TA 5F8IA 4Y9NA 2R2RA 4ECYA 5HP1B 2RKIB 3IN5A 2D7SA 3H2LA 1JLAA 2I5JB 2IM0A 4WFXA 3EPGA 2J6UA 3BSNA 5KFGA 3FQLA 5F9LA 4RW9A 1JLEA 3BR9A 3C6UA 3KLVA 5EWEA 4KE5A 3Q8RB 5KFWA 3M8QB 4YR3A 4NCGA 1DTQA 5KFNA 1SUQA 3MEGB 1JIHA 2B5JA 5K14B 4G1QB 3GG1A 4ZPDA 4KBIA 3KLGA 3BSCA 5J2QA 1J5OB 1J5OA 1K1QA 5C42A 1ZTTA 3MR3A 4RNOA 2JEIA 3V81A 4WFZA 5KFKA 4K4WA 1C1BB 4KHRA 3KLHB 3QO9B 2OPSB 5KFSA 4J9MA 1BQNB 4FOUA 1JLGB 4K4XA 3CWJA 2ASDA 2FVCA 4K4TA 3MEDA 4XO0A 4ZP6A 4HU4A 3VQSA 4O44A 3V6HA 1DTTA 2IC3B 3KLIB 4JUZA 2OH2A 2VA3A 2B43A 5CYQB 3TAMB 3N3TA 2YKNB 3MTKA 1FKOA 5KFAA 3QZ8A 5C25A 4ICLA 3OLBA 5C25B 4F48A 3NAHA 2YNIB 4TYAA 1HPZA 4RW7A 2W9CB 2WCXA 4EYHB 1C0TB 4ZVFA 4MK9A 2AWZA 3GFYA 3DOLA 3CDWA 3FFIB 4EYIB 3KNAA 2VA2A 3DM2A 1RT6A 3BQ0A 4ED8A 2BQUA 5F8GA 1IKXA 3DI6B 2YNGB 5KG2A 1LWFB 5CYMB 3QGHA 1SV5A 1LWFA 1VRTA 5DQIA 2FVPA 5KFTA 4FS2A 4Q45A 1RT4B 1XR6A 5MKGB 2UUWA 4I2QB 1RT4A 4KO0B 4KO0A 5KFJA 3PW2A 2UVWA 4IQXA 4PUOB 2JC0A 1R0AA 3H40A 4NLOA 2YNHA 1Z4UA 4O4GA 4ECZA 3DLEB 4OL8A 2R2SA 3OL6A 1EETB 2O5DA 2W27A 4NLUA 2B6AB 2B6AA 3PW4A 3KHLA 5KG5A 3KHHA 5L1LA 4G3IA 1LWCB 5HLFB 3N6NA 1REVB 1TL1B 4KV8B 3SFGA 2R8HA 3CJ3A 4I7FB 4RW6B 3QGGA 3QGIA 2UVRA 3GV7B 4IDKB 3KK2B 1S6QB 3BQ2A 3DLKA 2W7OA 3ITHA 3HV8A 4NLTA 1NHUA 4ED7A 3QYYA 3GYNA 3SY8A 2D3UA 4MIBA 4Y9MA 3ICLA 3LAKA 4O3QA 3OL7A 3E51A 4ZP9A 4F4XA 1RTHA 4HU3A 5J2MA 3V4IA 4JV0A 4ZMMA 3Q8SB 4PWDA 5HBMB 3FQKA 4F4YA 4H4OA 1IKYB 4ED1A 3EPIA 1BQNA 5DGBA 3T1AA 3FSIA 4ZVGA 4O3OA 3GIJA 4Y9PA 3DDKA 4IFVB 4H54A 5KFHA 1S1WA 1MMLA 3DRPB
chains in the Genus database with same CATH superfamily
1US0A 1V79A 4RDZA 3SO7A 3CD5A 1JX4A 3GVRA 3WIVA 4IP7A 1XRVA 4XDDA 5CYQA 2XZ7A 2R9LA 3RRXA 3EA1A 1DQAA 3AMGA 1FWTA 1PX8A 4TVAB 1X1NA 3N73A 4B5SA 4NYYA 3R4IA 2DR8A 5KITA 3LP2A 4LB3A 2O9TA 4Q7AA 2R2TA 2DPJA 3VCCA 4FKYA 3SN1A 2MQMA 2RFGA 3WDJA 3DUGA 1WOAA 3AIRA 1YPIA 3GG0A 1LW0B 3I5BA 3LGHA 3Q8UA 4QIGA 2UXBJ 2HBVA 4PUJA 4P7NA 1XDMA 1O1ZA 3RM4A 4KWUA 2BASA 4DQSA 4TU9A 2J0QD 5DLGA 2QN6B 1C8YA 4UB9A 3T9PA 3RAQA 1CB7B 3QMTA 1PVNA 2TYSA 2ZWYA 4JYDA 4AZCA 4U2ZA 1Y5NB 4J5OA 4IUOA 2I5QA 4IIEA 1RT1A 1MW7A 1CBGA 1XLKA 3UWZA 1NMEB 3FSXA 1GKRA 3QSYB 2G96A 4NYPA 1D7KA 1FNOA 1B99A 1WBJA 3MPWA 2KXFA 4LF6J 1YRXA 3FBFA 3AMKA 1K1SA 1ZM9A 5CLWA 3TSDA 4OYAA 4CQ8A 3GFXA 1N34J 3D1OA 2VC5A 1VCGA 4C8YA 5CC6A 1GNKA 4XZNX 3EYZA 3NQDA 2A3LA 2EG6A 5HDRA 3W8GA 2EKCA 2CQPA 1Q7QA 3BLKA 1IGSA 1OABA 5E6ZA 4QJ4B 4U9RA 3PULA 4IL0A 3NXFA 3HVRA 3GR4A 2W4DA 3I6TA 1FRIA 4AD3A 3JTPA 2KX9A 4BWJA 2UV8G 2RB7A 3HB9A 3T41A 1OFBA 4D6FA 2QUVA 1S7HA 4V1Ak 5EDWA 4YHHF 1EQ0A 3W4RA 2VBWA 3OTBA 1W3IA 3DGPA 3U02A 4FXSA 1DBDA 2J47A 3N34A 1RT3A 2GSEA 1KVKA 4LOCA 5HN0A 2ON3A 4R7OA 4AC1X 3GTHA 3U48A 3PHEA 4Y2CA 5C24A 4DIAA 4ZJLA 2PEBA 4KMQA 1HBMB 3TYEA 1Q7YT 3V7PA 4F66A 4QEHA 4XO7A 3DM2B 2DNHA 4MFDA 1OSCA 3DMJA 3ZZRA 3MB9A 2FGOA 2F6XA 4C6FA 3HFKA 2VFTA 1B54A 1VQ9S 1NK7A 2E9RX 4QSHA 3ZQ9A 1T40A 2PWUA 1FDAA 5E0OA 2DH8A 1GTEA 2YWKA 3KVJA 2E28A 3LBCA 1GJUA 2KZZA 2DY1A 3EZOA 1FWCC 3SCWA 1H0IA 4WCEQ 2LA6A 3DKJA 4C7QA 3QSIA 1IKVB 4MAVA 1CJTA 3DHPA 2QLFB 3P45B 3T2PA 2TSYA 3AICA 2YLLA 2VTFA 5BXIA 3RJMB 4QR1A 3M8YA 2X1AA 3W82A 1WSRA 4QZVB 4HT5A 5AE3A 2GHPA 1NSKL 3M1ZA 5BROA 4DSLA 2GVDB 2TPSA 5H91A 3OHMB 3IRWP 2UU9F 4AIBA 2RHSB 2QULA 1QD1A 4O4GB 3A8KA 1EUNA 4PUEA 2DZWA 1RAIB 5CZVA 5JJBA 4RW9B 1C1CA 1J5TA 3L5AA 4CLPA 4N4QA 1W8SA 3MMAA 4FPRA 1L6SA 4N6FA 1APSA 3KVKA 3GNNA 3H2MA 3VDHA 5D32A 2UVVA 1FVPA 1TJPA 2A3BA 3WBAA 1RA7A 4L72B 2WQPA 2C28A 5G4WA 3TFCA 1W1IE 2WVTA 3N12A 4ZVQB 3T5JA 2OEKA 5G4EA 3GJQB 2X1GA 5A6BD 4TV5A 4DUZJ 3QV8A 1GW1A 2AX0A 3N6JA 1TE1A 1PB0A 3KCLA 1Q78A 2IYIA 4LSNB 1XIJA 2GWGA 3U2OA 2QFIA 5FAGA 5A6WA 4CLUA 2Y8VA 2BEFA 1BHNA 4J9OA 1R0CB 4Z2KA 3WKZA 1FD8A 2X0SA 1JKHB 1JKHA 1RADB 2QCLA 3GDLA 1BVNP 1Q4NX 5DLFA 3L3CA 2ZICA 3E1F1 4UTUA 4D6HA 1B3ZA 4JHMA 2QLWA 3L4BC 4F2RA 1AZSA 2DT3A 4DR4F 5AYZA 2UBPC 5KFRA 1C8XA 5XIAA 2AD9A 1D3GA 1OBAA 4R88A 1V6YA 4GUJA 3NQAA 1WO2A 1EPXA 2W4CA 3TI0A 3PTDA 3VGDA 2OWCA 5L1IA 2Z24A 4WEVX 1HR0F 3JSMB 2F1FA 3L4WA 2C0HA 4OZJA 1P0EA 4DCPB 3WEZA 1NJYA 3CIZA 1GOKA 4AMCA 4AZBA 2B8PA 2J7HA 3G5EA 1K77A 3G24A 2ZD1B 3WD1A 2ZD1A 4DI9A 4ANCA 2OHDA 1V6XA 4U8VA 3BGGA 1J27A 2PC6A 3M6UA 3UXIA 2MZTA 4MOZA 3W7KA 3GKFA 1OD8A 4PULA 4JI2F 3VINA 4EFAC 3C2YA 4IJBA 4QQBA 2Q02A 3KAOA 4DQIA 1C2PA 2R9RA 2GK1A 3F03K 1ZZMA 1HW8A 4GY0A 2EC0A 2JVRA 2HQIA 2QA1A 4IQEA 4J9LA 2F8EX 1NDLA 2PT0A 3TN3A 4Z2GA 1W1B1 3I6EA 5J8LA 2BE9B 4GACA 1QMLA 2DGSA 2HHUA 3VAKA 4DELA 9XIMA 4M1KA 2WCAA 2R1MA 4ZVOB 3OTOJ 1KQSR 3C8NA 4N8NA 2OPQB 3HPZA 4LY8A 1VYRA 2N4DA 2DUZA 4DWSB 2C14A 3RYSA 4DL7A 4AIUA 1MROB 2P8IA 4WKFA 4IFYA 1N55A 4RNHA 2F4FA 2GC8A 1NWRA 4C65A 4Z2JA 1J5SA 1WQ5A 4DFPA 3G1VA 2GS8A 3DERA 3TYZA 1OIFA 2W3ZA 1PYSB 3REQB 1TV2A 1Q8AA 4M3PA 1HZYA 1OK4A 1S0OA 4DV1J 2R8IA 1Q8BA 1XBYA 3TJ9A 2NUXA 4W7WA 3LA4A 3U7JA 1N5YB 3H5UA 4RW8B 5DM7Q 3URNA 4WFNQ 1VKFA 3KZPA 1Z7AA 4RUAA 3U9IA 4ACZA 3MURP 2J88A 2PC4A 1VFOA 4QS6A 2EK1A 3BPWA 1X4GA 1BHGA 1RTJA 3WN6A 4C6QA 3FCWA 4WJ8A 2JLEA 2QIFA 3WX4A 3ABXA 4PMJA 3UNTA 3FA3A 5D6GA 3AJ1A 3FYOA 4RW5A 1H62A 2BX7A 2I5JB 4PAAA 4WXZA 2EC2A 4B9TA 3TMLA 3G1FA 3G4SS 3S1XA 1P1LA 4D2JA 1BG4A 1NVMA 4GH1A 5GNXA 3MU7A 5HOSA 4QROA 5LXXA 1BMQB 4CLMA 4AX6A 2CIMA 3AWNA 3MEGB 1TWWA 2Y0FA 5K14B 4GI9A 1YXYA 2E77A 4ZPDA 2OZ0A 3CUHA 3N2BA 3VDGA 2OX1A 5C42A 1J5OA 2ZBRA 3HQPA 2YB4A 4A21A 3EOUA 3D0GE 4NZ7A 4X64J 1RBAA 1W32A 3QAUA 2D2HA 4DWIA 1TG7A 3N2TA 3RTVA 3BE7A 2B9YA 4MJ4A 2YWEA 5ETPA 4O44A 4D8AA 1UWTA 1B3VA 3OLBA 2W9CB 3GXFA 2KO1A 1GPWA 3CXCR 4YLWA 2HVIA 1TTQA 4PA8A 2J9EA 2P9GA 2WSYA 1RT6A 1FDYA 4UCFA 3VOCA 1XWYA 5KG2A 2ISVA 3BCDA 6CGTA 1XLAA 1VRTA 1QOPA 1FWWA 2Y5JA 2XO6A 3A8EA 4KO0B 3SGZA 3TA0A 3T1HJ 3PUOA 1XLLA 2PDJA 4L5ZA 3URAA 3TEHB 2NXUA 4H9TA 4LCRA 2D23A 1KQKA 1DJHA 3W73A 1FXDA 3UWYA 3CE8A 4Z37A 4FMVA 1JRBA 3T44A 3KHLA 2DGTA 4BC7A 3PCOB 5AB3A 3SCOA 3D3BJ 1TL1B 1DHPA 3NDYA 2JNJA 3WIJA 1DKWA 1E1CA 5CC3A 5LNWA 4PMUA 2V3GA 5LJ3Y 3B78A 2OSWA 3R1ZA 1EX1A 2ZVRA 2OMOA 3S0CA 3OVSA 4GFIA 3V3WA 3EOOA 1J6OA 2HXTA 3GTIA 1WEYA 3HHLB 5K9XA 4H4IA 2XQCA 1WKDA 3O8WA 5C2GA 4LVBA 5BU6A 2Y1IA 4FYXB 1DL3A 2JK2A 3HM9A 1TMHA 3NOEA 3WC0A 4F4YA 3VAHA 4X4RA 2VFIA 3WDQA 3SDEB 3GIJA 1RAOA 2DGAA 3D6TB 1PDZA 3EDKA 3W6MA 3WH9A 3RG6A 2IM2A 4AF0A 1F0XA 3B0YA 1IBKJ 4OHZA 1SR0A 3F4WA 2ESCA 3C15B 7TAAA 3DDMA 3UG8A 4DX7A 4JTHA 4CU7A 3DRRA 1PSDA 2EXUA 1E3XA 5IFTA 3A22A 3SN4A 3FFSA 4HMCA 5DN1A 2YCJA 1UH2A 3W7IA 5EBUA 1BSLA 4N7QA 4Y3CA 2IKGA 1S6UA 4BK9A 3H59A 3AFGA 3MM5A 1Y3KA 1VYAA 4O1DA 1YJTA 4K2SA 1S79A 4CWBA 1A0CA 4GKJJ 3NQFA 2XGPA 5J2PA 1UP2A 1RAJA 2IAJB 5JVGQ 3AIVA 1OQ6A 2VENA 1PYFA 1S48A 5HBFA 1WXYA 1HNVB 4HSOA 5ABEA 2X3DA 4EBDA 1ZALA 5E9AA 3GR1A 1R38A 1M1HA 4JNYA 1JZ8A 1U1MA 4Z1YA 3RM9A 2XNQA 1S1XA 3B9OA 1K8ZA 4HVZA 2PTXA 4XTDA 1U25A 4BHQA 5CC7A 1S2WA 5B08A 2JGQA 2XVLA 4IICA 3WMSA 6XIMA 3GXDA 4CO5A 2BVTA 1TA3B 2DP3A 1RGVA 2NUWA 3TJLA 2WOMA 3JQJA 5I00A 3OZPA 2C3ZA 2Y2WA 1QTMA 2G4FA 3RXZA 2MKCA 2D1CA 1C4AA 3ITLA 4DV2J 3KLFB 3S5ZA 3QNWB 5HO4A 4OYZA 2AJ4A 2DRBA 1IXQA 2R94A 4CNTA 2EKNA 2M70A 3L7PA 4F0SA 3QHNA 4BC9A 3IRXA 2DVUA 4HEA9 5I07A 4JTKA 1TUVA 5L1KA 4L1XA 1BWLA 3GTFA 3D3AA 4PUKA 1ME7A 3G1AA 2WSCC 5E09A 4MY1A 3OFGA 2D3ZA 2Q6ZA 1V51A 3MAAB 3W26A 3IG1A 5H8UA 4PQUB 1UR1A 1X0FA 1FY6A 2PF0A 4TVDA 5CJ5A 4K4VA 1ZCCA 3MUTP 4REQA 3GNOA 3OHAA 4USJC 4HJFA 4AZHA 2E5GA 1FHDA 2OWXA 4FX7A 2PSZA 4NA1A 3GDRA 1ZAHA 1SMDA 2Q79A 4LRFA 1R8HA 4XIAA 1B3TA 1OGSA 4MUZA 3LU2A 2PTDA 1W2IA 2XY7A 4WPAA 4UMCA 4ED0A 3OYXA 2PDUA 1RWXB 3MT1A 3W63A 1KXHA 3TQ1A 1YDVA 2YCLB 1VEOA 3IS9B 3LK6A 3H5YA 2OU4A 4UF4A 2EBGA 1HBUA 1RUSA 4GWEA 3WDPP 1VFMA 3H2CA 4QDPA 4AZIA 4TY8B 4W89A 1MLAA 4PB4A 3VOHA 1RVGA 1SZEA 1YWXA 3W83A 3VAGA 1FI4A 3C2OA 3DN5A 4QG8A 3M30A 1BRLA 2R42A 1KWGA 3HCXA 3PZGA 4L56A 2E09A 2M52A 1W1A1 3V16A 2J6XA 2WJEA 4HA3A 4TIMA 4RE4A 1EIYB 3MUAA 1NOFA 2VX7A 2QLXA 3LBMA 4MYAA 3RX3A 3F2DA 2ASHA 4OFZA 1NPKA 4LCSA 2G4JA 2NV2A 4B4HA 3K5OA 2XZ9A 1WELA 1BTMA 4CD8A 3L4UA 3Q2DA 2ZX5A 2YL9A 4CEUC 5F1VA 5F3TA 1LBFA 1XUUA 2YCEA 1F74A 2QJNA 1TREA 4GIAA 3ZZZA 1O12A 1VCTA 3HFZB 4YTUA 5LMNJ 2AQ4A 5A5WA 1PAEX 5BOEA 3UD6A 1O0PA 3HQNA 2E40A 2C71A 3EEGA 2V82A 3O6YX 1X60A 3GC4A 2PTZA 1U47A 3WBZA 1FBAA 1LZOA 3CH9A 2WAGA 3LB0A 3W72A 2E5CA 1RWPB 4IGSA 4JIQA 4IFRA 2X09A 2A2DA 2I9SA 1HJVA 4TX8A 2YXLA 1ZOTA 1JR1A 4CP5A 4U96A 1S5NA 3NFUA 4X2PA 3L65A 1XISA 3A8IA 1YVFA 1B2YA 4CNUA 1FK9B 3IR5B 3EA3A 3EAUA 5KZMA 3HBLA 1BAGA 2EKYA 5D3GA 3DFTA 2HNZA 3BICA 3AUOA 4HHUA 2CJBA 1GKQA 5ECUA 4ZP7A 5DBUA 5HVFA 4FXJA 4WP3A 1UROA 4DSFA 4O13A 3WIUA 4H7CA 3T1GA 3W2VA 3KLEA 4Y9OA 2WBMA 5BJRA 3TVYA 1G7UA 3DZ1A 1IEQA 3RIKA 3V36A 1KTVA 5T9BG 1NU4A 4WFYA 5ADZA 3ZT5A 2ZE3A 3MM6A 1UP1A 5LYRA 1LW2A 4G9PA 4M5GA 1K7EA 3UXAA 2ISDA 3BLPX 3LERA 1HJSA 3P3BA 5LXEA 1TKZB 3H90A 4E8GA 3QRHA 4ED4A 1FJGJ 3WNOA 2NUHA 3H7RA 3BTNA 5ETTA 3PB0A 1KM0A 4Y2MA 4LNCA 3OIXA 4LF1A 5GJPA 1J11A 3AA9A 1HNVA 1VD6A 1W17A 1D3WA 2DPIA 1SH3A 3MUVP 1HJUA 4LQ1A 3EMZA 7PTDA 3DBNA 1GXLA 4PMDA 4QIUA 3O7UA 4ZVJA 5D33A 2ZITA 3WLLA 5EKYA 1S1XB 3I56S 2D1ZA 1O5JA 2XIQA 3VC6A 1B3WA 5I42A 3K1DA 1VLIA 5MLCV 3PR5B 2AGPA 5KFMA 5T7LA 3QJAA 3NDZA 4D6CA 1ZB5A 2DZSA 2RMLA 5A8MA 2DZVA 4X4NA 1PG5B 3GDTA 3ARQA 4HOXA 1O95A 4C8LA 3L95X 4QYRA 1F73A 2YBUA 1QO5A 5BMXA 3KLFA 4Q8PA 3F56A 5D0EA 4LS0A 1TCMA 2PRHA 4ZDNA 2OQLA 1HGWA 2Z2AA 1R2RA 3MHYA 3ALFA 4CD6A 3KHJA 1VS1A 1UWUA 4Y2IA 4OUIA 4TX9A 2HV5A 4DR7F 1QI2A 1A5AA 9XIAA 2DHAA 3UNYA 2LYVA 3GG7A 4MSSA 5AC5A 2WSQA 1VBHA 5B7YA 3B4YA 2YZRA 1S38A 5L9XA 1S3TC 3IS4A 4ZVPB 4K36A 4QOTA 3MUZ1 2OXNA 3OUYA 1FWJC 4W88A 3K5MA 2CERA 1OT2A 3IGHX 4JTEA 4C5YA 2QV5A 4MB4A 1PJ6A 3CB4A 4ES4A 1A3WA 4KRTA 1HT6A 3M1VA 2HHHJ 5DRIA 4S3FA 1JF6A 4GCXA 2YA1A 1QAPA 4QITA 2JZ5A 1W8GA 5LIUX 5LT5A 1W7WA 1W2VA 5AYBA 3R11A 4UMBA 4Y9NA 1TWIA 3WLKX 4RU2A 2J6UA 3W7BA 3ANVA 4OZOA 3QPIA 4WSHA 3KLVA 4I5UA 4KE5A 1XYBA 3DYMA 3M8QB 4NCGA 3ILJA 4W90B 2W6RA 4JFSA 2ONEA 3HF3A 5I03A 2JIEA 5E2QA 3ZM8A 2GLKA 3C46A 2MKHA 2FDNA 5AE2A 1E4NA 1U2CA 2HPMA 4DPQA 4DV7F 3B4UA 3KEHA 1LK5A 4NZJA 1BKHA 3SY5A 2Z58B 2QT7A 4K4XA 4KGVB 1OM0A 4URIA 4XO0A 2HW3A 4YPJA 2XMMA 3TP2A 4MF4A 4A8FA 3GONA 3IIZA 3HO1A 2YXGA 2ISWA 4CH1A 3DU5A 3K5NA 1SO6A 3V5RA 2K3IA 4EF9A 3LD5A 1R7OA 2YBTA 5FF0A 3DOLA 1UB3A 2FJKA 2VDGA 2GSJA 2V5JA 3EPOA 3BN4A 2KRBA 4PUUA 3P61A 5KFJA 4M0XA 2XSJA 3CL6A 2NVDA 4NLOA 3CZLA 4OL8A 1S39A 1V02A 3LLFA 3C52A 2YGYA 5HANA 2D3O1 3KRSA 4NLUA 3ZT7A 2B6AA 2P9CA 3MY9A 4EOUA 3Q2SC 1RAAB 2WWCA 4JV5F 4DZAA 2VPYB 1Y7VA 4O4VA 3J80U 2C15A 2QJIA 2HE5A 1I2QA 3C3UA 1DJIA 3W7HA 2BXVA 4N9DA 4D9PA 4QYZK 2B81A 4RE0A 5HPCA 2Q01A 4CTAB 2BUNA 2Z0GA 1OF8A 1MMFA 3AZSA 4FNIA 4NLTA 4DZDA 4ED7A 4GQGA 1US3A 3PHAA 4O3QA 3SY8A 3G6MA 2DH7A 5HMYA 2QDDA 3TTQA 1SJFA 1X96A 2YH0A 3UN3A 4ZMMA 3SUSA 3Q8SB 3GXIA 1ZU8A 1HJWA 4F7VA 1C91A 4FXWA 3FSIA 3GDBA 4IFVB 3ENAA 4K5RA 2WVBA 4WFAQ 3MDWA 2FD2A 1S1VB 1NWUA 1DE6A 1SQ7A 4J3VA 4Z1DA 4EK2A 1OC6A 2I16A 4PMZA 4Q7NA 3R9LA 1FWAC 5ETNA 3S5SA 3MHFA 1SJAA 1IEWA 1ZLPA 4GBDA 1WC4A 1YK9A 4PCNA 2QUMA 4DB7A 2VQEJ 1O51A 1TV6B 3GXPA 2PGEA 4OZ5A 5FAJA 3TZZA 3UR7A 3SQGA 3HGOA 5GPRA 4ZHRB 4RE2A 2VPXB 1R87A 1SO4A 5FD0A 5KFUA 2BBFA 4WKRA 5EMMA 2OI2A 3JZUA 1XINA 3VIKA 5F2MA 4UTIA 2CA9A 1PAUB 3W1XA 4OYWA 4CH0S 4QWBA 3HXMA 1TB3A 1XSKA 3DYAB 4H8VA 6AT1B 4ECWA 3HFVA 1R8BA 1TP7A 4B3LA 2G97A 3BCJA 1KKOA 1KLMB 4AXIA 3Q8VA 5JXSA 4ADSA 1S46A 3KJFB 1NDCA 1ZNNA 4H4MA 2QCDB 3K0JA 2OTDA 1T9XA 4MKSA 3OR1A 1X39A 1YPXA 5KEZA 4DV4J 4W85A 3MR7A 2E7XA 2KM8C 2JEFA 4DF2A 3RLUA 3LENA 3I5AA 3W29A 3TARA 3QTPA 1UA0A 5JIPA 3VGUA 4M5DA 2CZVA 2JEPA 2YPYA 4OZ0A 4ERDA 1OX4B 1WF2A 2FZBA 3VK5A 4ECUA 1S72S 2GYIA 1EQCA 2Z2BA 4LY4A 4B5XA 4K7QA 2DR9A 1OYCA 1VI7A 4USHA 3TNOA 4DNHA 3SRKA 1I9CB 2R82A 4GPNA 4DRSA 2HQAA 4ELTA 1HVXA 2ZCGA 1WG5A 3W02A 1DARA 3GUWA 4YN5A 4NLXA 2WVSA 3AIWA 1N33F 4IGMA 5A6PA 1G4EA 3P6LA 2RJZA 1GZJA 4Z7YA 4TQSA 5EMKA 3CULA 1HO4A 3M44A 3NVTA 2LEAA 1AK5A 1DWHM 3DXIA 4B91A 4F36A 5AHNA 4J7CA 1XNQF 1UR3M 3AALA 1CX9A 5LSOA 1JIBA 4WCJA 5K8NA 1OJ4A 4CO1A 2CZEA 2W2MP 1NBEB 3NNAA 3QAEA 3CQHA 4ZIWA 1JPDX 3AOCA 3RO8A 4HOWA 3IRDA 1H6KX 2WOMB 2GOUA 1EDQA 1K9DA 2VEKA 3OGSA 1Q66A 4HVXA 3V4BA 4P71A 3KP1A 3EM1A 5CXPA 4PTWA 5SWUA 1VK3A 4CVWA 4JI5J 1R6YA 3STFA 4J5NA 1VLYA 1KQYA 3GUGA 1E6SM 3LTPA 4LRTA 1IKVA 1CJTB 5G0RB 2BOFX 1E72M 3BBBA 4S3GA 1Z3NA 1V3RA 4K6AA 1F9EB 2B5JB 5D8HB 3N01A 4ED5A 2EBNA 2FPYA 1O5XA 3U4FA 4H8UA 1U1PA 1DJYA 1ROFA 2GVYA 3ZJ7A 5HI7A 2HWTA 4UZUA 2YSWA 4LBSA 3T40A 3CO9A 5AHEA 3WQ4A 1TKTB 1U5JA 2XLIA 3TYCA 1M7PA 4ZZ9A 4S0MA 1XCWA 5LOQA 5GMDA 1R3TA 1TELA 4IIHA 4QAWA 1PS9A 2NW0A 4K37A 1WNEA 3M0LA 4MT1A 3SFWA 3HZ3A 3QHOA 1HIZA 1B0IA 4J9JA 1HQUB 1M53A 2FGZA 2R8KA 3KP0A 1FFGB 1EGMA 3KLGB 1QLNA 3MM8B 3MM8A 5CZJA 1XCFA 1VGAA 2JKAA 3IVTA 2ALZA 4KKOA 1KA9F 4AIEA 2YNHB 4JTTA 3AB2B 3OR2A 2BVZA 2PFDA 1U49A 1TRDA 1Y0HA 3CIVA 2GGPB 5HJLA 1IJEB 1SSDA 2R24A 2YTCA 3WNKA 1CG2A 1REVA 2H5JB 2GAGC 1F6TA 3ICJA 1SUXA 1N0VC 5HNTA 1NNDA 6REQB 4IFVA 4OI4A 2WWDA 4GIYA 1H51A 3OXLA 1UVMA 1XR2A 4B3OB 3S47A 3S1UA 1B7FA 3WDOA 4GUIA 1G4SA 3PZTA 4H9YA 3WUGA 4B5UA 5GJNA 2YWWA 4BEUA 4A8WA 3FKRA 5K9FA 4NU7A 3TXVA 1LRQA 3G8SA 2UUAJ 3F4VA 4IRKA 1QNVA 2GA7A 1LWEA 4KCWA 3W9JA 1HKAA 2WYSA 2C2MB 4ZOSA 1PTGA 2MGZB 3P14A 3N79A 3SN0A 3KM8A 1OB0A 4XZMX 4I7UA 4DL2A 1Q7LB 5L9FA 3VOGA 4U67Q 2G5WA 1X97A 1GW9A 2VWTA 4K2XA 1KXTA 1TPWA 4DLEA 3APGA 1LV5A 4LV4A 4JTCA 4AXNA 1R3YA 2FB0A 2OKQA 5D9MA 3I96A 1UJPA 2PDXA 2WK4A 3SXLA 4JQ2A 2Y9HA 2WSFC 2KB2A 4K59A 2R7RA 1ELOA 1HNXF 3L0GA 1GGOA 1UIPA 3MHUA 1Y11A 3PYDA 3PHTA 4GCAA 1FP9A 5D30A 2DQWA 1IEXA 1WXZA 5FEXA 3HSZA 4NNAA 4A47A 2F8MA 3W53A 4OZ3A 3KFTA 4PWDB 3WNNA 4J2PA 5KFOA 1UR8A 5D9PA 4JYFA 5DETA 3NZGA 4URGA 4YVVA 2Z28A 3C15A 5E33A 1VQKS 2M0GB 1QE1A 2NQHA 4NRSA 1QE1B 2F9DA 3CMES 1NPPA 3HMCA 1U24A 3CYVA 2VONA 5M2RA 1DLOB 4USUA 1XIEA 3M8SA 4OZLA 4WUIA 2FFIA 2WZTA 3HZGA 1FXPA 5IHSA 1RHKB 2G41A 1MI3A 2PRLA 3B4MA 4EPDC 7REQA 4NQ1A 1NEEA 1VYPX 1ZJHA 5DQHA 1F3EA 3EXSA 3KTCA 5D0HA 3VGFA 4FR1A 5HUOA 2QDGA 1H5VA 3BN7A 2DIUA 3PFRA 3M2RA 3U57A 4AUBA 3UJSA 4YHHJ 4XAZA 3CJ8A 4EUVA 5MHBA 4I90A 1S2UA 2BOEX 2BLEA 1WKYA 3QC0A 3KWSA 4AWUA 2EPNA 4DPWA 5E3QA 2KRRA 3LHTA 2Y5SA 2C13A 4FX8A 4KGMA 4O3PA 4ACZB 1YBUA 3U1MA 5AHFA 1N56A 2VQUA 4I2PB 1G5AA 2KHCA 5JUMA 3G8EA 3MGJA 2CWXA 5HP1B 4INFA 2IM0A 3VGSA 5CSUA 4LUIA 1LP6A 1LWHA 3FKKA 1XH0A 2I14A 5A8KA 3LRLA 1EA0A 3HHLD 3ATZA 3EXYA 2VPWB 1IR1A 5M2UA 3O9NA 1J5OB 2UZ9A 2RDTA 3T1YJ 2AF6A 5I3GA 4BCAA 4KHRA 3BK0A 2EQDA 5DCDA 3E96A 1WAWA 3PX4A 2WNZA 1NM9A 3KL0A 2X05A 1L2UA 2QC3A 4PPDA 4Y0FA 2ZXDA 1AMYA 3RITA 2ZX6A 3C16A 2DZBA 4C6BA 4HK6A 3CCMS 1RAEB 2XN2A 3FA4A 2YKNB 5EX3A 2W24A 2FHBA 3ARXA 3UZYA 3ZVIA 2WW8A 5DZ7A 4HZ7A 3UJ2A 2BHUA 4DL5A 1TK0A 2G37A 2HBQB 2FZ8A 1B57A 4EYIB 3GZ3A 2QCHA 2GUUA 2BVWA 4F8RA 5F8GA 4ID8A 5J5DA 4ANDA 2M8HA 3W66A 1YPFA 3LTOA 5AY7A 4MNLA 2UVWA 2FZNA 4WDUA 1UD5A 1ODUA 4LCQA 4QE1A 3CMJA 3SV4A 2VB6A 1M6JA 1C8QA 2D24A 3T9NA 3KVMA 3K4AA 2E9BA 4ZN1A 3LGEA 4Y96A 3RHGA 3K8MA 1JXJA 1REVB 4NZ4A 1U30A 1TTPA 1IF2A 3MUXA 3SI9A 3CH0A 3QGIA 4ZR8A 4TNOA 5B0AA 4KTQA 3QMSA 3K5XA 3EWYA 2W7OA 4Q33A 4ZEPA 3QYYA 4MIBA 2QA4G 2PWHA 2HHHF 1QW7A 1G0CA 2RH3A 4Q4RA 3W74A 3EYPA 2V2HA 3M7VA 2HHQA 2XEXA 2Z6IA 3FVDA 2NWSA 1XLCA 3P62A 3LWLA 1BQNA 3T1AA 1V6UA 4ZVGA 2GVGA 1UUOA 1CZ1A 4EF8A 5BXTA 5LHFA 2HVEA 3IM8A 5AXNA 3H2AA 4DQRA 4DV3J 1LXJA 2B4OA 4E6MA 1VHIA 3EDEA 4IIFA 1ZAWA 2OPRB 4UUWA 2LLZA 1HWLA 5D37A 3U2EA 1DLOA 2ZKTA 3QEZA 1IBLJ 5CZSA 3MPGA 4PC8A 3C6TB 3G6VA 3LYEA 4ORIA 3VKBA 1SC4B 4EGLA 2GJPA 3MUY1 1C9WA 1Y0EA 1LWXA 1H50A 4B2DA 2ZDOA 2C22A 3D6MB 3UDEA 1RWOB 3CWNA 1VIOA 3N9RA 4YR0A 5IOBA 4Q0BA 2VI0A 3R6LB 3PW5A 2WANA 1N52B 2ABBA 1S1TA 3SCVA 1O68A 3JAMY 3A3NB 3KXDA 5K8PA 1VQNS 3BOXA 1JFXA 1RQEA 1KW1A 5JQ9A 3JYTB 5KFBA 5DCEA 5IS2A 1QAXA 4U5IA 3M05A 2FZMA 2BM1A 3IARA 3E5PA 5DT5A 4H4KA 2WMIB 5DQGA 4L74A 3PZPA 1GORA 4ROQA 3BGRA 3OHBA 3NMAA 2RIJA 3GIIA 2CZVC 3VGHA 1BYCA 4R33A 1DFDA 1D3HA 4M6PA 2J24A 1MUWA 2I1RA 4B5WA 3ZS4A 3H12A 4HHLA 2ZM6J 1ICPA 1L0PA 2W67A 3UP8A 1A49A 3PEHA 1TK5A 2W2PP 4ML4A 4H7ZA 3ITXA 4LUTB 1OCJA 3CK5A 3T05A 2ATSA 2AQVA 1OQ3A 4B4FA 3SI8A 2OZ3A 3EDDA 1SB6A 3DOMB 4EZ9A 2POKA 1Z6KA 3KFWX 4DN1A 7FD1A 3UYIA 4N6EA 4BQ4A 4FP1A 4F4WA 1JZ4A 5A6BA 1V77A 1J0HA 1WOPA 5D8WA 1VFFA 5EBAA 4MLRA 4WSKA 4G5DA 1UR0A 3BJSA 5KFIA 3KK3B 1IYXA 7CGTA 1UVNA 1TMQA 1VQ6S 1A6LA 2F5GA 2OT0A 1JDEA 1P8GA 4REQB 2VZ9A 3IJIA 2JF7A 4B9NA 5BZAA 2U1AA 2YNFA 2ACUA 3ZR6A 3NLCA 4DFMA 2XVGA 3G8RA 3KL5A 2GO9A 3MEDB 4RZ5A 2ALRA 5KOWA 5C9RA 4R0EA 1P48A 3FEXB 1U6ZA 3R7NB 3NS5A 5EYWA 3DRXA 5EMLA 3FZ2A 2HWIA 3OV7A 3IMQJ 3CUGA 3CC7S 1E55A 2YNIA 2DJWA 1V93A 1I4NA 4J90A 5LIKX 4J9UE 3LP2B 4CGTA 1QRQA 3HPAA 2CQDA 5J2QB 3QQ1A 4RL1A 3GDMA 1T02A 3D6FB 3B9AA 1RTDB 3EGVA 3TAKA 4HMNA 1S12A 3HMJG 5KFVA 1YEYA 5BW6A 3OFFA 4LF2A 1KTBA 1AZ1A 1YE4A 2NX3A 4O15A 1XC4A 4RNMA 2XB2D 2A6NA 3VD4A 2CZ9A 3BC9A 1SM9A 2Y1LB 4GUGA 4DV0F 2OCZA 4Y9AA 1U45A 3WBYA 2GVEA 4FOJA 1FDJA 3SDEA 3EGZA 4GI8A 1UFLA 4PFMA 4TXSA 1F8MA 5D05A 2HK2A 1WPCA 1Q5VA 4R7JA 2LKZA 1L3TA 1W25A 1OFRA 5A8NA 1FWNA 1E70M 1RTZA 1A4MA 2XYPB 2D74B 2OSXA 3K2GA 4NLRA 3OHIA 3OP2A 3RB3A 3IA0A 1KM6A 1JLCB 1CC8A 3N29A 4TLRA 5KMYA 4W87A 1JD7A 2NWRA 4CU8A 3WNPA 4H9ZA 1W3TA 3Q37A 1BLUA 1PBUA 2HAFA 2BB0A 4OYIA 3ZZTA 4PPZA 4C4WA 5GMKa 2Z0IA 2E9ZA 1KD1T 2BOAA 4O17A 3DLHA 3ABSA 4ZSTA 2XZWA 4I9MA 1FKOB 4KV8A 3OSPA 5EUHA 1PCWA 3A4XA 2LQBA 2H3DA 3G8QA 3G8TA 3BSOA 3LQLA 2XMWA 4E5TA 1JLBA 3TR5A 1AB8A 1YJUA 3CJ4A 1V0NA 2DSVA 2EFPA 2KYZA 3CTRA 2WNWA 3TX9A 3TOPA 4UFHA 3ZR5A 5H9FK 2XGIA 5JBEA 4NYUA 2XSJB 1WDRA 4HP5A 2YDRA 1G7VA 1GVQA 1RA6A 5HBMA 1HYSA 3EJMA 2EF9A 1JXKA 4L3KA 3O0FA 4IHCA 3KHGA 4BJHA 3SMZA 1M04A 3Q8PB 1KFSA 4CD5A 4LXFA 1RHQB 4TUFA 2DT0A 3B97A 1Q63A 2XU2A 3UQNA 3NCOA 4I7VA 1H7WA 2MHNA 4HYWA 4HNVA 4ZP8A 4KWOA 4GD0A 2E3ZA 1JCMP 1TKXB 2WO5A 3T78A 3CT9A 3CUXA 2GZXA 3N9UC 4WJBA 1T03A 1T03B 4M51A 3LXCA 3AHZA 3IG1B 1UJQA 1FESA 5C55A 3CD7A 2J6TA 1W56A 1DHKA 4LVNP 5DDRC 4JI6F 2V5BA 1HQEB 3U3HA 1NUEA 3NCQA 1QOXA 3KZSA 4ORMA 1RV8A 1ZCOA 1SIZA 2GAHC 3M07A 4DYKA 3KOYA 4KWVA 1H4PA 4H19A 4S3JA 2VPZB 2IBKA 4RW7B 1AODA 4DBQA 1S5WA 3E74A 1RT1B 2MLXA 5B0EA 3KJQB 5G1YA 1M68A 1FWDC 3CAWA 1S77D 1SW0A 2INFA 3OBAA 3U2ZA 1Q16B 1JJ2R 3ADAC 2IMWP 1DTNA 3MANA 3SCLE 4D71A 2Y0BB 1G2EA 3GV5B 3DDIA 1S99A 3ABRA 1UCWA 2HAIA 2DSWA 1P0NA 1UHVA 4MWAC 4IISA 4OHQA 4YTTA 5T41A 3MPDA 1TVRB 4JDBA 3THPA 1TWSA 2QMKA 5B7ZA 3SAZA 4Y00A 1RWNB 2MQOA 3UWUA 2HIYA 3ID7A 4HSNA 4LC8A 4QTGA 3W60A 5M2PA 1CJUA 1UKSA 3RPDA 3KK1A 1FKPA 2VMFA 1ZTVA 5D77A 2J9ZA 4XD3A 1ADOA 5KG7A 3U8GA 5FJIA 5BRPA 1EF3A 3TTOA 3KUHA 2PP3A 4A8LA 1GZGA 4J3XA 2V4QA 3O07A 4BS2A 4CQBA 4EPEC 2U2FA 4JAWA 1XP3A 3R79A 2CUYA 3FBEA 3AS2A 3CV6A 4JTFA 1E71M 1WKJA 3MECA 4A8RA 3B8IA 2VHGA 3G6YA 1W9VA 3QT5A 4XD4A 1UA7A 3OLIA 1KLMA 5HROB 4ZQOA 4DU7A 2UUCF 2EO7A 2MQPA 2F63A 1MMDA 4W5ZA 2UXCJ 3D68A 5KSWA 2D7SA 4NJKA 4D1JA 1JLAA 2AQOA 2QNEA 3UCCA 3O63A 4F2UA 4OI1A 3MP4A 1M5WA 2NSBA 1OJXA 4JI5F 1SVDA 4A2RA 3PUEA 2E8ZA 3M30B 4KW2A 3BKUA 3BSCA 5BWAA 2UUBJ 4LF9F 3H55A 1XEZA 1I94F 2DXEA 4HCLA 3K30A 1TKKA 3AHTA 4OECA 5CGMA 1OWXA 3AD9C 4KEMA 5ECVA 4ZP6A 2OKTA 4D72A 4W4MA 2RQCA 4CM0A 4ZPTR 4ZO9A 3GD6A 2QCFA 4BWMA 1B3XA 2ALYB 3W22A 1EIXA 4GGHA 1GG0A 4B9VA 4K7VA 1Q79A 4O52A 4NZ5A 4F3QA 3CMGA 1ICQA 1RD5A 2F9RA 4ED8A 2A5HA 4OYMA 1RCQA 4ZCKA 5DQIA 1FP8A 3SEPA 2XSFA 2ZTKA 3UO0A 1F9CA 3PW2A 4MDOA 3PRVA 4IQXA 1BE4A 4ZK7M 2CLEA 4GYJA 2J8SA 3J7ZT 2QCNA 4KIAA 4O4GA 5AYIA 5D2YA 4GNKB 3O1LA 4GG9A 5KG5A 3U4AA 4US5D 1DQXA 3DXSX 4L1WA 3DU0A 2NZ4A 4DR7J 3F7JA 3CJ3A 3MMWA 4U28A 2UVRA 1M5SA 3SSJA 3ZFHA 2K3KA 2VRQA 3DLKA 4YIWA 1FJ7A 4WK3A 1E0UA 2NSCA 1CW2A 1EC9A 1EEXA 1VLOA 4B17A 4JGDA 3CV1A 1ZS2A 2P5VA 3K13A 2BJ1A 2X1UA 1I0BA 3F1QA 5IXEA 3G77A 2TRSA 1S76D 4ZQCA 1VBGA 4KH0B 3NGDA 2QVNA 5IDIA 3B40A 3GP9A 4Y65A 4ZPVR 3BLOA 5K8MA 2Y8UA 3G9CA 1N88A 3C8FA 3GXNA 5AHIA 4H9VA 3S7RA 2DYAA 3UR3C 3FDGA 1MWQA 2CNLB 3R6GB 1IKWB 1S5TA 3P93A 3PPGA 4JKLA 3W01A 3MMAB 3AJDA 4V27A 1UH3A 3P5TL 1H3GA 3U1LA 3QWUA 3T5HA 2FHJA 2FJEB 3ABZA 1ML1A 1VOMA 4QISA 2Z26A 1P6TA 1MU2A 1PYOB 2I6WA 2W8KA 2P3EA 1NDPA 1FRJA 3ETMA 2WAQD 4XAGA 3WFLA 1GKPA 2DRDA 2VURA 4F67A 3FEQA 2F2HA 1N34F 2FHKA 3M9YA 3BSMA 3TAMA 1SJQA 4WOZA 3KVLA 3L7UA 2CNKB 3CDAA 2BYCA 4O8RA 4OE7A 1NDKA 1NZAA 4LQ9A 3MR2A 2BOGX 1S3HA 2ZRXA 1MMNA 3WJSA 4USTA 1FDDA 2ABAA 4A05A 1QFEA 3L21A 2VQFF 1IBCB 2BR0A 2R7TA 1S0MA 3TYTA 4OLOA 1GHRA 1LBLA 1I51B 3H4WA 4RBTA 4Z17A 1UD3A 4O1EA 1E9ZB 1NTHA 3RNDA 4K4ZA 2IS7A 1RJQA 4PL2A 2MQLA 1VQPS 1V4YA 1EWDA 4XD5A 1NM2A 2AYBA 3L23A 2F84A 3W7PA 1OC7A 3RB0A 1CULB 1E3ZA 1B9BA 2IDLA 1MW0A 3NCPA 1X9MA 3SCJE 1WG4A 1EJWC 2YCKX 2OFJA 2CJYB 3UN2A 3EDJA 4ID5B 5IZHA 4ZO6A 3SYZA 4G1IA 3PTMA 2UXBF 1PUDA 1E40A 3NL6A 1KBKA 1UR4A 2V2QA 1E6XM 1BRLB 3UEQA 1OSDA 3ELHA 1GXUA 3IWNC 3MA8A 3GC5A 2G0WA 2BODX 1IV8A 2FFCA 3TONA 5I3IA 2JLGA 4ECLA 1RJJA 1JLGA 1WDQA 1W6TA 4UBPC 5KG4A 2V2CA 1J2BA 4UOHA 1IXNA 3P5YA 1WI6A 5B80A 2RDDA 4N76A 2VGBA 5T8GA 5A2QY 3KS5A 1LUCB 3PBMA 4QSFA 4AF0B 1HKWA 2ATCB 1VQSA 4OT7A 4OX7A 1FWGC 5HWJA 4IRDA 1P0BA 4DUZF 3LPYA 2OSQA 2QTWA 3U2CA 4ER8A 3S42A 3HSDA 1XFBA 5KT4A 3JSBA 2B4GA 4XBKA 3WF1A 3MM6B 1OFOA 1VHCA 4NJIA 1V3LA 2QG9B 1K70A 2ZUMA 1MEHA 2R1PA 1CJVB 3MPVA 3W86A 2HHXA 5H6HA 4DCJB 2P10A 3UF9A 2D41A 4ALDA 1D2KA 3D28A 7FDRA 1H72C 4TU8A 4PABA 3DI1A 5L8RC 4RDYA 5DO8A 3OGRA 2NS1B 1JQVA 2WCGA 4OX9J 2X1BA 1YRRA 3L2IA 3FDKA 4LF4J 2PDMA 2BMBA 3FHQA 3GE7A 5IT0A 3MMUA 3MYOA 1PO9A 3I5CA 4WIIA 1VRXA 2YL8A 4A35A 5F8HA 4R85A 1WOBA 1F3WA 3HX9A 3OVQA 2HGNA 4K1WA 4MNKA 3V81B 3KK3A 4M5JA 3BW2A 2V3FA 1QAJA 2VVSA 4U31A 3GIQA 2FJBB 3FGCA 1VIWA 3CPWR 3E6EA 2GMHA 4OUEA 4LS2A 2X41A 3TXZA 2G2OA 2J0WA 3ISZA 3NNHA 1E6VB 4PMVA 1RK8A 2NSOA 2CDQA 1RTJB 4NPOA 4GH3A 4PZVA 3PANA 1T11A 4MYUA 4P2MA 3CEDA 1LLWA 2HFVA 4DG1B 1EJTC 4OYOA 5HULA 3H4BA 2NX1A 2VELA 3CCWA 4WWSA 5HJXA 4MTVA 2RQMA 3ZOAA 3NEKA 1POJA 1S9EA 5L38A 3I4EA 4C8NA 3UT0A 1ZZNA 2MKJA 1WA3A 1WOSA 4AFYA 2OLWA 3PYEA 3MEGA 3ONCA 3O2LA 1CXEA 1IBMJ 4DO4A 4LEFA 1PAMA 1V3MA 1JZ3A 4UT4A 3M9OB 3SZ2A 4URSA 4C8ZA 5CZ0A 4TY8A 2V8HA 2D22A 4DI8A 1UWQA 1NSJA 3GTNA 1QNPA 4NL5A 3TA2A 4XIMA 4GK8A 2Y7FA 2OMAA 1EJRC 3PWIA 1EKRA 3DHXA 4JFTA 3M16A 2GGGA 2V4JB 1U02A 1V6WA 1K1DA 2RF2B 4F4ZA 2BQ3A 1OS5A 2VYOA 5ETVA 3DXBA 2GFFA 1TZZA 4E2DA 2PTYA 2OEMA 2WLZA 2MSTA 4M1RA 1MQPA 1C0UA 3HURA 1UJ5A 2FZGB 4S3AA 1TUGB 2BGSA 4ECVA 4B3SJ 1NIUA 9RUBA 2FJAB 3HHEA 3BS9A 2D69A 2A3CA 3M43A 4V33A 3Q22A 1C29A 3PJTA 4LUSA 3WJXA 2HNDB 4Q8EA 4W4QA 3VGBA 3GQCA 4FIRA 1M01A 3NSMA 4K8RA 3L2MA 3USZA 5CABA 2QX0A 1LLZA 4TR9A 4W84A 5I06A 2ZM6F 3E0FA 4YYFA 1V3JA 3AS3A 3M64A 4IQMA 2CJQA 1EBGA 2DVIA 4R8UA 1ZAXA 3AHVA 2NYIA 2AIRB 1W26A 1XV8A 4YUDA 4F4KA 2Y88A 3QRPA 4EWTA 4PUDA 1RY8A 3NWRA 3WLIA 3VD5A 5U7SA 1HPZB 3L5LA 2GK1B 7XIMA 3MP5A 1U6FA 3NNTA 2DW6A 3HIJA 1LDCA 5T91A 3V0TA 4XK8C 2WKJA 3R1LA 3EVWA 4WYWA 4HA0A 3UZZA 3VKKA 3GSIA 3GAYA 4NKCA 1X4AA 2IDEA 2WB4A 2NQPA 1LTDA 4PYDA 2J7DA 3GLJA 1VR6A 4MUPA 4ES2A 1ONWA 5EFFA 3QIPB 3M5VA 3LMZA 2VR4A 4YYCA 3N2OA 2HISA 3AQPA 2YX1A 2MXYA 3AIUA 3QGAC 2ACRA 1RYSA 4P9SA 4RW6A 3OIHA 3W7CA 4NEYA 4USMA 4JTJA 4KKXA 4KEUA 3RX2A 4YB5A 3MEKA 1IEIA 1AL8A 1FJEB 4L73A 4RW4A 3E0LA 5KT3A 1N2VA 2D3OR 2KT5A 4AFFA 2Q1LA 1ZRQA 5A2AA 4PMYA 4AVFA 3S1VA 3IWXA 3B54A 4J9VA 4IGHA 5L1JA 5CZTA 1N5YA 3GPAA 4B3MJ 4PMXA 1FFWB 4WLCA 1N54B 4FI4A 4D6DA 1QUVA 3ITTA 3VGEA 1G69A 1FXQA 1E6YA 3TX8A 4ZVHA 4GYKA 2VG6A 1U1QA 4R25A 2VKZG 5I79A 3DC0A 2XWXA 4O10A 5IQ6A 3S5YA 5F9LA 4YTQA 3URBA 1MQRA 1PTDA 5DBTA 1YJ7A 1W9XA 1PKYA 3THVA 2XN1A 2E5LJ 3FUYA 4ES3A 2OZTA 5D0GA 4Q8TA 4GI6A 2B5JA 3EZ5A 2QAFA 2RAQA 5CSRA 3EX6A 2Z1XA 2I57A 4S1FA 1H0HB 2QL5B 3NP5A 4DJDC 5C0QA 3NQ8A 2ZDRA 2VOTA 3QW3A 4DR5F 1X8CA 3CCVS 2PC8A 2CNNB 5K2ZA 3T55A 3WLTA 4NAEB 3M5ZA 3S4TA 2GDQA 5FA5A 1QK0A 2JF6A 2FZKB 4B9ZA 3AXMA 5CZKA 5C25B 3F73A 4JIEA 2WCXA 3UGVA 4ZVFA 4V1XA 1QUMA 2NXEA 1I0DA 4KFNA 3G3DA 3CQKA 3A24A 4F4RA 2KAUC 3OVRA 3QQ0A 4L4MA 3LCFA 1SV5A 2DFAA 3LCXA 5CYMB 2FVPA 2Y0SD 1XRFA 2PA8D 4HA4A 3FS2A 2YZ5A 1UZDA 4BZYA 3UG3A 2QQ6A 2DNQA 2QGHA 1Z69A 3NYZA 1U22A 2VBXA 3R5JB 1X98A 2E67A 2Z57B 5HLFB 3AB4B 2NXCA 4X63A 2R7OA 4I7FB 3QR3A 2Y8YA 2E5JA 4FZVA 2Z1WA 1D9EA 2MEWA 4XZ9A 3LS9A 2IVMA 4LRBA 1P6BA 1U5VA 1UWIA 1GHSA 1R89A 5A2BA 1KFDA 4GVLA 3GM8A 3AXHA 2J8GA 2XN0A 4LFCJ 1UMYA 1ISWA 4NT0A 2HPUA 3LAKA 4ZP9A 3PRDA 3OPKA 1QASA 4QLJA 1W0MA 4GY1A 3MO4A 3BAYA 1OPZA 1M5PC 4I64A 1FCQA 3N13A 3NIYA 5E93A 3EWGA 4M5KA 3OR1B 2RHGA 4NI2A 3E5BA 3C8YA 4RDVA 1H7XA 3A3WA 3RLHA 3SDOA 1GFWB 1EO5A 3TYDA 3CO4A 1S2CA 4GNVA 3NZ1A 3UNGC 2EFNA 2DQXA 5A3HA 4CNZA 3A47A 4O1AA 4OWGA 1GAOA 1NH7A 1Q1KA 3O6AA 4Y6IA 3ZC4A 5D4NA 5AHLA 2OO0A 2JALA 2WMHA 5D78A 3I65A 2I7GA 2DJXA 3TP4A 2HGLA 2JX2A 2FTYA 3GH7A 4H6RA 4LANA 3JS3A 2ZZ4A 3LHZA 1CWYA 4PRWA 1VYSX 2DNKA 1VPYA 5C2XA 2VZVA 4F0LA 1BVZA 3M2UA 3BR8A 1SKSA 1CS4A 5IHRA 1UJ4A 3LV5A 3CUZA 1FWFC 1CQMA 1RT7B 4YWIA 2YJQA 2ABYA 2MPUA 2MTLA 5CCLA 1XYZA 5SZTA 5KFDA 3AXXA 4IJRA 2ZE0A 2V5LA 1VHFA 3D47A 4LIWA 2DIVA 4JQ1A 1AD1A 5EX0A 2ZA1A 3S2NA 4AVNA 2HS4A 4ECTA 3RB6A 3AS1A 3RCNA 4S3BA 4JHOA 4FXFA 2GJFA 1H7RA 3FLUA 2IRYA 2P76A 3P8BB 3FBCA 1WC6A 4JX4A 3M5YA 4M7TA 3BB5A 4O4RA 4FLSA 2XMVA 4RLIA 2NXNA 3POHA 2HEJA 3QTGA 1BTCA 1YG0A 1X1ZA 1G01A 2B4UA 1LRNA 1SW3A 3DFSA 1LT7A 2V8DA 1NAL1 2PP0A 3MCNA 3Q24A 1HKMA 3UNDA 1ZZFA 2J5AA 4PXEA 3GG8A 3I7QA 5HJYA 1Y3JA 4MWAB 1J0JA 3L4XA 1QHOA 2ZZ7A 4XG1A 2PDPA 3R7MA 2DNMA 3SGGA 1R3QA 1IGWA 3VGGA 3SURA 3B0UX 3SQOP 2ZUGA 2GJXB 2GZOA 2E9MA 3CT7A 4FLQA 2WW4A 1SO5A 1XF0A 2MKSA 5J2MB 3V4IB 3AMDA 3S6TA 3RK8A 2CLMA 3W88A 4K4YA 5F2GA 4RNIA 4LVOP 5TIMA 1E4LA 4KETA 4ZS6A 1NFGA 2DTJA 2KFYA 2QPSA 1HL2A 1H5YA 3LLXA 3E0WA 4RKUC 1J79A 4R7WA 1VJWA 4N41A 4DEFA 3RPTA 3D4JA 2MGZA 1LL4A 2B7PA 1G6BA 3GHRA 3MAHA 1Y7PA 3VMNA 2R8WA 4EAMA 5DLCA 3RR1A 4G7EB 5MAOA 1SQEA 3LHYA 1TPVA 2D9PA 4H4MB 5D09A 4HIBA 5MKGA 2RDJA 2NUUG 2R1NA 2ZRVA 5GVJA 5F41A 3US5A 2R8GA 3M9NB 1IZKA 5J04A 4MB3A 1PIFA 5TAOA 3NCRA 1LYXA 3NL0A 1PIIA 3M0XA 4F50A 3NUKA 2A10A 2YKOA 3I3BA 3VTIA 3IGNA 2NPIA 3OUYB 2HNDA 2WC4A 2HROA 2HNYA 4K8HA 3TQKA 2W0UA 2LQ9A 1GVSA 4LW7A 1M1BA 2BZNA 4Z0SA 1UQYA 1LOSA 5CJNA 5IV4A 4QBUA 3WQEA 1K4GA 1SW7A 3GS6A 4LAUA 1GEHA 1DJZA 1E0WA 1F5CA 3W8PA 1K7XA 2Z27A 4OHXA 3GYEA 3FAXA 5EMYA 5CLTA 5AVHA 4CUCA 5AECA 4J9SA 3EZUA 2ZA3A 2PA3A 3KLLA 3KW3A 1LQ2A 4PCPA 2V3EA 4GMKA 4DJDD 3ITCA 5I5RA 3BO3A 3C6CA 4J3UA 3GHSA 3GQYA 3MSRA 4JI4F 4H9MA 3KK2A 1EO7A 1KCLA 3K4WA 4QG6A 4ZCIA 4J28A 1NDVA 3DGPB 1EZZB 1Q3NA 1XPGA 2J6VA 3VAIA 4X65J 3MJYA 4DI6A 1TTJA 3WYZA 3W6LA 2CQGA 1ZL1A 3M2UB 4O12A 3ENLA 3VNLA 2GQ8A 3B0VC 1VJQA 3MDUA 4DJFA 4UUXA 4U6PA 3KHRA 1J93A 1F9HA 4L75A 4PYSA 3ZJKA 3CEPA 3VIPA 3RMJA 3IGUA 1UEUA 4E2OA 2OPRA 3LCWA 1QT1A 2BGNE 4CO3A 4D8ZA 5F8LA 3FRZA 5G4HC 3DOLB 1QSLA 1QWKA 2GFTA 3OZOA 4IR9A 3OYZA 2E5HA 3BLDA 3NQ2A 3AHYA 4Z0JA 2WJFA 1JYWA 1VFHA 3MFHA 1XH2A 4AUKA 4MYXA 3CAQA 1YBTA 2D0HA 1GMUA 4ZODA 2Y85A 4A4AA 3EGJA 1F1BB 1BWKA 2RDUA 4RNFA 3HF5A 1KQFB 4H6KA 3OVAA 3W1LA 4E8DA 4EVZA 3T4WA 4PMOA 2CPEA 2YCIX 1WP6A 4U33A 5FJTA 3UDVA 1XXXA 4HQVA 4NXNJ 3K4DA 1RWVB 3AXKA 1DIKA 1PBAA 3M0YA 1K9EA 1VZWA 4AD0A 1KM1A 3O05A 1BY9A 2WVEA 3KTQA 4JOUA 3S1TA 5K7JA 2PRMA 4DR4J 3LTYA 4TVUA 4GKLA 1R85A 2GJXA 1HHSA 4I6YA 4AEEA 2PE4A 4YCPA 5THWA 3BMWA 2CQ1A 3CQJA 4JV5J 3P67A 4AL7A 4DV3F 2CG4A 1VBXA 2R7SA 2CG8A 4PQUA 1EZ2A 4U3CA 5REQB 5CA5A 3MCOA 1XLMA 3WFZA 1EP4A 3W75A 1WZAA 4JCMA 4ONVA 4I5RA 5I3HA 4IMFA 1CLXA 2DGOA 4B3OA 3BO9A 3SBMA 4BR1A 2BKPA 3H22A 1HG3A 3JVAA 4Z2LA 1H7PA 1S2TA 4C6LA 2IRXA 2YXXA 2FQQB 3SRFA 2CLLA 4AU0A 3IUHA 2IW0A 4WRHA 4MWAA 2WK2A 4U3AA 4KPLA 2JGYA 1XDJA 3L7RA 2XNRA 4CO4A 1XWLA 3MCSA 3BDPA 1SYTA 4I69A 2XBPA 2R1KA 1XYLA 2IVYA 3H5XA 4I9JA 2ZBQA 2OP5A 3ARVA 4LYQA 2K7KA 3M4XA 2YDAA 2J74A 3PZNA 4TN2A 2FLNA 3R3TA 3B8WA 4GKJF 4TO8A 1FWPA 2E1PA 3HHKA 4IFKA 2FZDA 4GINA 3KRBA 5J5RA 2HVNA 3G3MA 1UOKA 4CT9A 1JF5A 3MMBB 5BR8J 4Q43A 3OW1A 2NZLA 2RKXA 3W2JA 3VE7A 1ITCA 4UY85 1D8ZA 2PWEA 4I6VA 1TQJA 1T5AA 2DY3A 3S01A 3R13A 1UMLA 2CW6A 3NEHA 2QVHA 2HPIA 1CJKB 3JTOA 2BS9A 3NYDA 3KLKA 3NPWA 4QHRA 1JAEA 4UNLA 1W31A 3DCPA 2WMGA 2AGKA 1FCVA 3R5GA 4JNMA 4C98A 3LPPA 4O28A 4LSBA 1XLEA 1KFLA 5LIYX 1MG7A 3JW7A 2D0GA 5CG7A 6A3HA 4ZVUB 2MB0B 2V38A 2X1RA 4L7ZA 2DGXA 1SUQA 3W65A 1EFZA 2P53A 1NFPA 1CGWA 4IIGA 2XWDA 4Q6XA 4WFZA 4Y90A 2W61A 8AT1B 3QO9B 4GKKJ 2IA0A 3MM5B 3ZVHA 1H2VZ 1PKNA 3P82A 3ARSA 2O7QA 1Y5LB 3MJMA 3IJQA 3V0SA 3E2VA 3L66A 5A8RA 5K9DA 4ADTA 3OJSA 4LBIA 3NDOA 3VZZA 4ICLA 1QI3A 1OY0A 3HU7A 1WHVA 2RGLA 3QPYA 3MD3A 5K4XA 2C3YA 4FNQA 1TX2A 4FYYB 4AYSA 3DI6B 4R53A 3HDSA 1T3OA 4DY1A 5D02A 2ZC3A 1XR6A 2HZCA 4LFYA 1PZ0A 2ZEJA 1LNQA 3R7SB 2X16A 1U1LA 4JFUA 3R5CA 2DNYA 4P72A 5C9WA 2AGTA 2AMGA 3BQ6A 3R12A 5IQQA 5EY5A 2BABA 4PG5A 4GISA 1K9MT 4X4VA 1KLYA 2VUNA 2Y89A 1FDBA 3IAM9 5A8KB 4P2FA 1IWGA 4QS5A 3BQ2A 4P8UA 2DZAA 4XQ6A 3LO3A 2WSEC 3V5CA 3VI2A 3AMLA 4LRAA 4F4XA 1QJHA 4K8GA 4MWAE 1AQHA 1X5SA 2AT1B 4CLKA 1AW0A 1IQTA 4LS1A 5HXMA 4QP0A 1V08A 3BGJA 3DRPB 1SC3B 2ACYA 1NSPA 3BG3A 4F0HA 3M32B 4NZCA 2K8GA 2W25A 2RRAA 3M0IA 2FJDB 2CQBA 1SR9A 4NXMJ 3MBFA 4HNTA 4I56A 2OYMA 3N25A 2MJNA 4OI2A 1GJPA 5HMXA 2ASLA 2PI6A 2QJJA 3OVGA 1YHQS 4HMEA 1LWEB 4IG2B 4LR9A 2ILYA 2EBEA 2VG5B 1CI1A 2ZUWA 5A6LA 2V9WA 2YIHA 1QNQA 1UG6A 3F2BA 1M1GA 1JL8A 3OD2A 2OPSA 1XKJA 1CIUA 1X9WA 4ENOA 1JAKA 3M9MB 3CJ5A 4Q2LA 1SKRA 4RZBA 3SJ3A 1LWIA 5DJBA 3MOJB 1BKSA 2DR7A 1RPKA 2F8QA 4O4WA 5EFDA 4DBSA 4P10A 2PWFA 4O54A 4NLPA 1BYAA 3HQOA 3BJTA 4DX6A 5HL7Q 2DW7A 1B9ZA 1GPFA 1TIWA 2R6OA 4JPGA 5G2WA 2Q6CA 2CU0A 2QCCA 4M1BA 3WNMA 1FQ0A 3DKDA 3VF0B 4IIBA 2FHMA 4LF7F 4H04A 4N4PA 2FDMA 3M6WA 3DYAA 2FIUA 1Q65A 1C0TA 1G7CB 5BYSA 1IJFB 1NHVA 1XW8A 1S6OA 4IH7A 1K9FA 4Q8UA 4HPNA 3FMWA 2BRKA 5DMLA 2C2OB 2VUGA 3CD6S 2VP8A 1E6QM 4FXDA 4JV2A 4V15A 4E4PA 1U0HA 3LP1B 3NZPA 1ECEA 3LP1A 3VUSA 3N2MA 1SH0A 3W5ZA 2V69A 1ZFJA 3GHUA 1JB0C 3E49A 2EPKX 5E0CA 1EUAA 2ZH9A 4C48A 1D09B 5LA2A 4IG0A 2DGWA 4IG0B 3UCQA 5EWGA 2DNOA 1U2RA 1HKJA 1T05A 4WR3A 1K6WA 3WEMA 3CCQS 5M03A 2D2OA 3VNMA 2HFZA 1SL2A 1FRMA 2GJNA 5FJUA 2PZNA 1S1TB 4TU7A 4K5SA 1SZRA 1UFWA 2ACMA 4M7SA 1JLBB 2PD1A 3VALA 1QVGR 5HROA 2IC3A 3FXYA 1CNVA 4MB5A 2YDSA 1F3FA 2JKPA 2AW0A 4ZCLA 1Q6QA 1Y8BA 3LSBA 3IBCB 3M6VA 1HA1A 2J9DA 3FEMA 4KQNA 2DT2A 2L5HA 3DECA 5A8PA 1AUDA 4J3WA 1A5BA 3I0RA 2KT3A 4DL3A 1NY1A 3BREA 4E98A 3W7MA 3R43A 4UMAA 3HPOA 1TZ7A 2VR2A 4N77A 1JCYA 2ZZNA 4XPCA 2NQZA 3N6MA 2A85A 1U26A 3E2RA 4NLQA 2ZWZA 3NO1A 2XTJP 3ET6A 4JQ3A 1OFQA 3GH4A 1YDNA 2QSWA 4D3HA 3RFAA 3ITYA 3ZVHB 2X51A 3TUPA 4L80A 2LXUA 3F4NA 1ONRA 2XH7A 4DX5A 4WP9A 1VHNA 3CPGA 1Z44A 1Q4WA 3VO0A 3M8PB 3J7YI 3ORWA 3PJWA 3MFIA 4D6EA 4FO4A 4CH7A 2HWHA 2IFXA 4H00A 4C6NA 4ZOEA 2YQ0A 3SQSA 3VAVA 3B0XA 3M6DA 1X5PA 4F0KA 5ETSA 2J6SA 4A4JA 3RR7A 3CB3A 5T14A 5DDQC 1V6HA 1UP0A 2WHLA 5A95A 3PZ9A 4YN3B 1F6KA 4NYZA 4M6VA 1ZJAA 2EEYA 2Q3OA 2V63A 2AX1A 4HCHA 3WJWA 4DSKA 1TYGA 2M88A 1E9IA 2KFZA 3OA3A 2O4MA 5C6MA 2LXFA 1KCXA 1L6GA 2FTWA 2WZIA 5A6SA 4UQGA 2DB1A 4LF7J 1JGIA 2F2KA 4IG3A 4GC4A 3AIBA 5IT9Y 3PTWA 1MU2B 3WLSA 4WSJA 5C7VA 4WTOB 4EAYA 1FE4A 3GLCA 2QGYA 4XTIA 4RR4A 3V1PA 1Q85A 2XLJA 3K8WA 7AT1B 2YKAA 1Q86T 2CQ0A 4BDPA 4K38A 2FLLA 4C11A 1F6YA 3KBWA 3L0NA 3N4EA 3VABA 4IQLA 2YWGA 5B0CA 4LMZA 3ABOA 4ED6A 1KRBC 1VFJA 4ZQNA 3VZXA 2E6DA 2H54B 3BAKA 1ME9A 5ENLA 3FCVA 4MMOA 2YKNA 1BQCA 4MHBA 3W1TA 5XINA 1KD0A 1F3XA 3NGSA 1XJBA 4BLGA 2GQAA 4GA8A 4OV9A 2G1HA 1RT2B 3KX6A 3W7OA 3OQEA 3CUNA 3BZGA 1W3LA 5ABGA 2Y6ZA 3CNQP 3T42A 2DIJA 2WHOA 3H26A 1I3OB 2XMTA 2C2RA 1J0ZA 2DO0A 4ECSA 2OKOA 1P6CA 4DPTA 2OSRA 3VXGA 4ZGYA 1OC5A 1EBHA 3OLAA 1UZ1A 3LW5C 2YKKA 1HKKA 1ZENA 1PE1A 3AQOA 4U10A 4M80A 3DHDA 5FJRA 4IH5A 3N6LA 4S38A 3AY0A 1EIBA 1PX3A 4ALZA 1XK8A 1PV8A 1Q6CA 4JY9A 1XD1A 1VMBA 2OUGA 3CC1A 2UXDF 3QVQA 1DTQB 3D0CA 4L61A 2CQCA 3G71S 4NSBA 1F3VA 3TE9A 3TN5A 5I0DA 4LF9J 1UUMA 3NO5A 5HMDA 4LRSA 3RBZA 3MMJA 4FYVB 2VV5A 3ECQA 2J7WA 2CPXA 3JYTA 3FJ4A 1S5ZA 1CLVA 3N4FA 3QMRA 1GCYA 5C5YA 1CGVA 4TQTA 1HI1A 2XG9A 3W3OA 3CJKB 3QBCA 1R5YA 4JCLA 3FZBA 2Q8XA 3LGGA 3LQGA 1ZM2A 3R2CJ 1CSJA 2XFYA 3BGRB 5CBIA 3WBEA 4B9MA 3G1DA 1QNOA 3SFKA 2PD9A 3JXOA 1QOQA 4LYPA 1PYMA 1E15A 2BXYA 5IBXA 1UA3A 2QCEA 2NT1A 2AKMA 3H20A 3AC0A 2BE2A 3S3GA 3IWLA 3ZMRA 1XMOF 1VQLS 1QO2A 2BSLA 4JIIX 4GOAA 4LUTA 4YY3J 1VC6A 5EL1A 4CNOA 4LAZA 1CB2A 2X7IA 4PCSA 3FK4A 2XIIA 3TDFA 5A6MA 2QIIA 3R8YA 3D5MA 5DO2A 3GNDA 1DQWA 4QCEA 3CCES 4KFBA 3EBVA 1EHWA 2Z2MA 1JJKA 3HVAA 2BWGA 2QHAA 5D3GB 3ZXWA 5LSLA 1FKWA 4PBEA 1L3UA 3PY8A 4U8YA 1X6UA 4WX2A 3ANUA 3KLEB 2ZXAA 3VV2B 3H25A 3NL2A 1SC6A 4HPGA 2CKWA 3IC1A 2NCKL 4FX6M 3AD7C 1WEXA 4GQRA 5AYYA 1X7FA 3MSYA 1U48A 2V5KA 3L0KA 3TNVA 3K17A 3GXMA 1Q6EA 2WJZA 2BQRA 2QA4S 4YB1P 3K46A 4K1GA 5IM51 3CCLS 4TYBA 5A76A 2G0CA 1D9FA 2PLJA 1B4SA 2INEA 2A0FB 1WKEA 3NM3A 4FPIA 2OWWA 4UR9A 5DEZA 3IJ9A 1L3SA 1MDLA 4UOCA 2KG0A 3RAMA 4AQLA 4X65F 2NUYA 3CL7A 4QBXA 3HG5A 2UUBF 1D8CA 5KZDA 3GWQA 4O19A 5CPMA 5EMJA 3Q8RB 1L3KA 5KFNA 2J9CA 1IXPA 3E2QA 3CJRA 4FVMA 3C3LA 4WY0B 2G9OA 1GZ1A 4WY0A 1M3UA 3TWBA 4IMEA 3SM0A 5FF4A 3PS7A 2WVCA 1MWZA 3V81A 3KTXA 3B9EA 1GQKA 3HM7A 2M9KA 4NAFA 4KY3A 3QHMA 2DNZA 1R7AA 4WDXA 2FVCA 3I87A 1MSSA 3KS6A 2N7YA 1Y4ZB 2H4YB 1GMWA 1R3RA 2KVQE 4EPKA 1NF7A 3VUPA 2R7WA 2UUCJ 2OH2A 4Q8VA 5KFAA 2J8FA 3HD1A 5LL6d 5C25A 5F0UA 1SZFA 5GMEA 4E8UA 3NS7B 3GFYA 1V02E 1N33J 4I8YA 1WDDA 4MWAD 5AHMA 3L9CA 4Q4SA 2AJQA 2H9AA 4B3ZA 2IIHA 1YTEA 4ZCWA 1XLBA 2O1PA 3W70A 2VFVA 2JHEA 5HSPA 2B7NA 3G18A 2FZ9A 2PDKA 3DLEB 2FVKA 1R7IA 1IIHA 2KTQA 1OHLA 3PPFA 4B9LA 3PW4A 2ZUNA 3M2VA 3SFGA 4AY8A 1W3KA 1UC4A 3LA0A 4QIEA 1B3YA 3CZKA 4MPKA 1YTYA 2VZUA 1FERA 3T7VA 2BKNA 3PN8A 4GIEA 4XZLX 2ZHAA 2HQ3A 2OYKA 4M8UA 3E51A 2DUXA 3IUIA 3K57A 3N1AA 4DX8H 1EARA 4N7TA 1QHPA 3KWMA 1QBBA 4DBDA 1FEEA 2E5LF 1TRIA 3GTXA 1UL3A 4E3VA 1O4UA 4C6IA 4WF7A 1YJNS 4AISA 3K8LA 5DG9A 2O67A 2E8YA 1YYAA 3RU8X 4AD5A 4M5PA 2XH4A 3QPZA 3MR6A 4LBHA 3QZ7A 2PDFA 4IR1A 4EIVA 2XLKA 4IPJA 4H83A 3WQPA 4YP3A 2ZZ3A 3W27A 2OAUA 3ARYA 2YR1A 2IUZA 1TPDA 1I8JA 4ZVEA 3GU0A 1ZBCA 1FX2A 3A1YG 9ATCB 1SQFA 1EXPA 1SIWB 3VTRA 1IZJA 4NZ1A 1ZSXA 1S59A 1AH4A 2DSKA 1HFEL 1JRCA 1UUQA 1FFSB 1DYSA 3IIXA 4GVIA 4IMGA 1PBGA 2DJLA 4X64F 2FJUB 2HQGA 3MEEB 2OB3A 2PMWA 4ZPCA 1R6VA 4AX7A 4KHMA 3UXLA 1ZA1B 4GVFA 4NIRA 4KRUA 2C3OA 3P60A 5ETLA 2DDXA 4YDDB 5K20B 2PWVA 5DDPC 1SPQA 2JJ4D 1A7GE 3NY0A 3E0IA 3S6OA 4MDPA 1OFAA 3AXIA 3H2EA 4F04B 1H49A 5FL1A 5KAKA 4ETZA 3S2JA 3W38A 3OBEA 4G7FA 4NA3A 2GQQA 5C7HA 4OI6A 2J8AA 4R3UA 4F8XA 3LWMA 4BWLA 3O16A 3WLQA 1XTZA 1EA9C 4UQCA 1HR0J 4PUMA 4GHRA 1VQOS 1YITS 3VFLA 1CTNA 2KU7A 3LHUA 2FVMA 4KRWA 3M46A 4KC5A 3V6DB 4ELVA 4CTAA 1SJDA 1QVBA 1I5OB 4LAKA