3PJWA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, i23
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclic dimeric GMP binding protein
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 130
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjwA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjwA01
2FJVA 2XGQA 5J2PA 1MU2B 2I5JB 2W9BB 3KZPA 1RT6B 4IG0B 1JX4A 4IFYB 2YNGB 3Q8PB 2HNZB 4HYKA 2E9ZA 1RAJA 5KT4A 1VRTB 2BANA 1JXLA 4YQWA 2AQ4A 3HHKA 1RTHB 2RKIA 4YR2A 3V4IB 3TVKA 2UVVA 2IM3A 1S1WA 4KSEB 4HU4A 3T5LA 1TVRA 1C0UA 2ZD1A 3M9MB 3Q8RB 1S48A 2FVCA 4QWAA 3DRPB 5JXSA 3G6XA 1RTDB 5MKGB 4ZP8A 1RA7A 5KFQA 3BSNA 4J9SA 3BREA 3PW2A 4JUZA 4ZPCA 5KFEA 3H98A 3EZUA 4F4YA 3C6TA 3GIMA 1S6QB 5KG2A 4ED8A 1JLQA 3I5AA 1N56A 1RT1B 1S0NA 4R8UA 4Y8EA 3FRZA 4JV0A 3N6LA 2FVQA 2ILYA 4ZPAA 4ED3A 4IRDA 4ZMMA 4IDKA 1LWCB 4IH5A 3M8PA 4KB7A 4ED1A 3LP1A 3NGDA 4TQSA 1QUVA 2RF2B 3GG1A 3G6VA 3KLGB 1HYSB 1FKPA 1TKTA 2UUTA 4J9RA 1C1BA 5KT7A 5KFVA 3IRXA 2R2TA 3IG1B 4KIEA 2IJNA 4O4RA 4PWDB 5KFSA 3LAKA 3RBDA 5EUHA 4MKAA 4FS1A 3ISNC 1C1CA 3CJ4A 3MEEB 4WFZA 4WYWA 5C5JA 2OPQB 3S83A 3QZ7A 3DMJA 3SFGA 4IRKA 2AGPA 5KFNA 4IFVA 1S97A 3I0SB 4G1QA 4I2QA 1JLCB 2YNFA 5J2MB 4RNNA 4KO0B 2YNHA 3KLFA 5KG6A 5HP1B 2IJFA 2EC0A 2D3ZA 1SUQB 2AU0A 3FFIA 5J1EA 5KFIA 3T1AA 1D1UA 4RW4A 4ZVEA 3MR5A 5HROA 3ICLA 2C22A 1JLEA 4M95A 3DOKB 4KAIA 4O3RA 2R8KA 3RAQA 3DLGA 4ZP9A 1LW2A 1UWBA 3DRSB 1S1XA 4EBDA 3RBEA 2RDIA 1LW0A 1HQUA 3V6DA 4HKQA 4DL2A 2ZE2A 1BQMA 3G86A 2V9WA 4ZVHA 1J5OB 5F9NA 4J9MA 4IRCA 2OPPA 3BGRB 1TQLA 5L1JA 4IQXA 3E01A 1RT7B 4H4MA 3OSPA 1BQNB 1JLBA 1TV6B 4RW6A 5KFRA 3OL6A 4Y9MA 2C2DA 4ID5B 4WZMA 5L1IA 5CYMB 3DM2A 5J2NA 3EPIA 3BR9A 2WRMA 3KLVA 1OS5A 4MH8A 4KFBB 2XCPA 4J9NA 4DL5A 4B3OB 1C0TB 5J2QB 4IR1A 4LYKA 2XI2A 4O4GB 3VQSA 3CJ3A 4QWEA 3BQ1A 5DGAA 4EYHB 4NLGA 2R2RA 1S9EA 4Q6JA 3Q8SB 4NLVA 4EYIB 4RNHA 4ED6A 4KE5A 3QIPA 4MK7A 1RTIB 3D28A 4KHRA 2IC3B 1JLGB 4TN2A 4RZRA 3OL7A 1S1UB 3CVKA 5I42A 3KHLA 1S0OA 2WOMA 2HNYB 3DRRA 1HPZA 5K14A 2WONB 4ICLB 3NMAA 4X2BA 2IA6A 2OPRA 3GIJA 3RB0A 4MK8A 4DG1B 4KKOA 3GFZA 4J9QA 3LAMA 1RT5A 5DG7A 3LP0A 4PUOB 3CWJA 3H4BA 5KT3A 4RNFA 1KLMB 3QO9A 2GIQA 4LSLB 4MIAA 5F8IA 5KT2A 1T05B 3HV9A 1IKXA 4TY8B 2AGQA 3V6HA 2AWZA 1JLFB 4O44A 3QGIA 4J9OA 4WFYA 1VRUA 1LWEB 1EP4B 1YVFA 4LSNA 4O3SA 4JV1A 5J2PB 2B6AA 4ES4A 4IR9A 3QZ8A 4RW7B 2HWHA 5F9LA 1TL3A 5D3GA 4U6PA 4Y9PA 4ZPBA 2BANB 2JC1A 4RUCA 4URQU 2RKIB 1RT3A 4DL3A 4WE1B 5F8NA 4MFBB 4J9LA 5KG3A 1ZTTA 3KOAA 2ASLA 4FOUA 1IKVA 1R0AB 2YKMA 3KHRA 2O5DA 3NBPA 2FJWA 2ZD1B 4RW9B 4TLRA 1DTTA 1W25A 3TQ1A 2IBKA 2VG5A 3MEDB 4PQUB 2BASA 4Y3CA 2AX0A 1HMVA 2CKWA 2UVUA 3OL9A 3IS9B 3RB4A 3NL0A 3JSMA 4ECQA 4ZHRB 1SV5A 3GFXA 3PR4A 5CYQB 1FKOB 5C42B 4R8UB 3I0RA 4ECRA 4ECWA 4H54A 3PJXA 2V0NA 1S6PA 4IDKB 3OLBA 3PFMA 1NHUA 4TYBA 3M8PB 2R8JA 3N6NA 3LP1B 4NLDA 4F4WA 3LALA 2JEIA 5KG1A 3KK3B 3T19A 1TKTB 1S9GA 4WZQA 3DLKB 3GV5B 1IKWA 2R8IA 1JKHA 3DOLA 5DG9A 3KK1A 5KFXA 1REVA 2YNIA 4R5PA 5HLFB 1T94A 5KG4A 1S0MA 1SH3A 4NCGA 4AG0A 3ISND 1HQEB 2IAJA 3HVTB 4IFVB 1HNIA 3BSCA 4I2QB 1RT2A 2YNFB 3EPGA 4RW8A 5KT5A 2VG6B 4FOKA 4O3NA 2DPIA 5KFUA 4NLXA 4XPEA 4YR3A 4FOJA 4AFYA 3U2EA 1LWFB 3FFIB 3M8QB 3KLHA 2OPSB 4RW4B 4TYAA 1N4LA 1RTJA 2VA2A 1TKXA 1JLEB 4OL8A 3NAHA 4EO6A 2FLNA 4LQ3A 4NLYA 4NLPA 2I5JA 5I3UB 1RT6A 1UWBB 1DTQB 3C6UB 3QGGA 4IG0A 2W9BA 4F4XA 4K4TA 4IFYA 3OLAA 2W9CB 2HNZA 4DL4A 1BQMB 5EWFA 3OSNA 4ZVFA 1IKYB 1VRTA 4NYZA 4Q43A 5F8LA 1XR6A 1RTHA 2HNDA 4NZ0A 2BRKA 3V81B 3V4IA 2J6TA 2ILZA 4H4MB 3IN5A 3GG0A 3DM2B 3MFIA 4O3PA 2E9RX 4U7CA 5KFFA 2B5JA 3DRPA 2F8EX 3KHHA 3PW0A 3GFYA 5MKGA 3LP2A 2I1RA 3MECB 4WFXA 2D3UA 1N5YA 3T5HA 2W27A 5KFDA 3T5JA 2R2UA 2VG7B 5HBMA 2HWIA 4NRUA 3QIPB 4O3OA 3N3TA 1T03B 2QE5A 3KJVB 4NLQA 5DQGA 2RDJA 1RT1A 1HNVB 2D7SA 3DLEB 3LANA 1JLAA 3DI6B 2WOMB 3DRRB 1QE1A 1HPZB 2B43A 5DQIA 1LWCA 3KMQA 3PVXA 2OPRB 2J6SA 3TLQA 5EDWA 3CJ0A 2RF2A 2C2EA 3PJUA 3KLGA 2XC9A 3LP0B 5DQHA 3IG1A 2JEJA 4HJFA 3PW7A 4M94A 4NLUA 1RT4B 3GQCA 4IKAA 1S1TA 4EO8A 4RNMA 3SI8A 5EWEA 1S10A 3DYAB 4O44B 3JYTB 1RYRA 1VRUB 4H4OB 3KLIA 4LSNB 4EBCA 1EETA 5DLGA 2C28A 1N6QB 2HMIA 5J2MA 5KFKA 4KO0A 5KFPA 1XR5A 5HP1A 4I2PB 4ECXA 5C24B 3M9OB 2YKNB 1Z4UA 3HVWA 2UUWA 2JLEA 4TY9A 3CIZA 2BE2B 4K4WA 3QLHB 4ED0A 3RB6A 5C25B 4ZP6A 4ED7A 3CDWA 2WHOA 3SY8A 3KK2A 4F4ZA 4URGA 4JV2A 2XI3A 3NBPB 4Y9NA 2C2RA 2JEFA 5KFAA 1DTTB 3H5SA 3MR2A 5KFZA 2VG5B 5KFGA 3KLEB 4K4YA 3TAMA 3BGRA 4TXSA 4FS2A 3GILA 5KFJA 3CJ5A 3BQ0A 4NRTA 3MEGA 1HARA 3NAIA 4ID5A 3H2LA 3GIKA 5CYMA 5KFLA 1RDRA 5DLFA 2FJXA 4IG3A 4K4UA 2XCAA 4B3OA 1C0TA 5KFMA 5J2QA 2ASJA 4O4GA 2ASDA 4F3HA 5L9XA 1S1WB 1TVRB 2R8GA 1TKZA 1C0UB 1JIHA 3UR0A 1RTIA 2BQUA 2IC3A 3KHGA 1S9GB 4IH7A 1S1UA 3KNAA 2FLLA 2HNYA 3H40A 1KHVA 1S49A 3BSOA 2WONA 3KK1B 5FDLA 2XGPA 1REVB 4QPXA 3C6TB 4WXWA 4NCGB 4DG1A 4KV8A 4K50A 2FLPA 1JLQB 2IAJB 2AGOA 4PUOA 3BJYA 5MF5A 2WK4A 2OH2A 1RT2B 4EEYA 3D5MA 3QGHA 1KLMA 3SFUA 1T05A 4LSLA 2AX1A 2HAIA 4TY8A 4YMEA 4RUAA 3H5XA 1QAIA 5T14A 1FK9A 3KLHB 5L1KA 3MF5A 1FKPB 1C1BB 4I7FA 3UQSA 3IRXB 5EWGA 4RNJA 3MR6A 1GX5A 4WYLA 3I5BA 4RW7A 2J6UA 1C1CB 5KFOA 4NLSA 1DLOA 5DG8A 5KFCA 3DMJB 4ECTA 3G6YA 3H5YA 4Q0BA 2HNDB 4G1QB 3HVAA 3UPFA 4WE1A 3KLFB 4MFBA 2YNHB 3FSIA 1I6JA 1S1VA 5KG7A 3ITHA 3PZPA 1R0AA 1TL1A 4O3QA 2BRLA 3HKWA 4RW9A 5J1EB 5HROB 4Y2CA 3MEDA 1K1SA 2B5JB 4ECUA 2CJQA 4PQUA 4YR0A 1MU2A 3DLGB 3LP2B 1LW2B 5F8HA 3GV8B 1S1XB 2BQ3A 1LW0B 1N5YB 1HQUB 3V6DB 2YNGA 4NLRA 2ZE2B 3PR5B 1QAJA 3IS9A 3NKYA 2W9AA 3GYNA 5HBMB 4ECSA 2ATLA 4ZHRA 4K4VA 1C2PA 4RU9A 4MKBA 3KMSA 5CYQA 1FKOA 2OPPB 5C42A 1ZETA 3N6MA 3E01B 2R6OA 1JLAB 2GC8A 5KG0A 1RYSA 2DPJA 1JLBB 1QE1B 4RW6B 2FVSA 3V6JA 5J2NB 4IOBA 3OHBA 4HU3A 3KK3A 2IMWP 3PJWA 1RA6A 3CDUA 3CDEA 3MTKA 2UVWA 1RTDA 3DLKA 2ZKUA 4KHMA 4ECZA 4RNIA 4QWBA 4F50A 1XR7A 2W8LA 1S9EB 1S1TB 5HLFA 1S6QA 1MMLA 5F8GA 4XO0A 3FQKA 4ECVA 2BQRA 4Y9OA 1HQEA 4J9KA 3KLIB 5I42B 3HVTA 1EETB 3PHEA 4Q45A 2HMIB 5KFYA 4MK9A 5M1TA 5K14B 2VG6A 4K4XA 2FVRA 5F8JA 2WB4A 3M8QA 1LWFA 4KKOB 4Q44A 2OPSA 1HYSA 4LJ3A 1RT5B 3BQ2A 3H59A 1KHWA 4J40A 3E51A 3Q8QB 4Q8FA 3QO9B 2VA3A 5I3UA 4PWDA 3C6UA 1DTQA 3KK2B 1CSJA 1IKXB 1IM4A 2W9CA 4Y2AA 3MEEA 2W8KA 2OPQA 1IKYA 5KFTA 4F48A 5DGBA 1TP7A 4QWDA 3M9NB 4QWCA 3MFHA 3I0SA 3TAMB 3V81A 1JLCA 2B6AB 3MR3A 2WTFA 5KFWA 4QW8A 2GIRA 1TL3B 5D3GB 4K4SA 3MEGB 1SUQA 3HV8A 5KT6A 2V4QA 4Q8EA 4QW9A 1NNDA 5KFBA 4IG3B 5JUMA 2R2SA 3DOKA 1RT3B 4R0EA 5L1LA 3RB3A 3GV7B 2BR0A 2W7PA 4KBIA 4GC6A 3DRSA 1NHVA 3MECA 4MIBA 3GIIA 2W7OA 4ED2A 1IKVB 3RAXA 2YKMB 5KFHA 1TKZB 2QV6A 2VG7A 1J5OA 1S9FA 1WNEA 4G3IA 2D41A 5KG5A 3CJ2A 3KJVA 1T03A 4NLTA 3KLEA 3T5KA 4FBTA 1HNVA 3DLEA 1HMVB 1RT7A 3DI6A 3OL8A 4FBUA 2IM2A 1BQNA 1TV6A 4K4ZA 2IM1A 4IH6A 3JSMB 3FQLA 5FDLB 1T3NA 3H5UA 4ECYA 4DL6A 3PW5A 1SV5B 4KV8B 4YP3A 4J9PA 1U09A 3OHAA 4KFBA 4TQRA 3I0RB 1ZTWA 2UVRA 2E9TA 3I5CA 1S6PB 1K1QA 3DDKA 3V6KA 1RT4A 4ZPDA 4GC7A 1FK9B 5F8MA 3DYAA 3H4DA 2WCXA 4EBEA 4DL7A 1JLGA 3JYTA 2ALZA 4H4OA 4I7FB 4NLOA 1D0EA 4ZVGA 4Y34A 1IKWB 1JKHB 1SH0A 3DOLB 3FDSA 1N6QA 4NLWA 4WXOA 4LQ9A 4ICLA 3IGVA 3IGNA 3QIDA 2JC0A 3PW4A 2YNIB 4ZP7A 1GX6A 1DLOB 4I2PA 4URSA 4R5PB 2JEGA 1SH2A 5C24A 1S4FA 1N48A 2YKNA 3BSAA 4Q0BB 2IM0A 4RNOA 1HNIB 2BE2A 2FVPA 3QLHA 3PJTA 4RW8B 3QYYA 5C25A 4DEZA 3CO9A 1S1VB 2R8HA 3ITHB 1TL1B 2XWYA 3UDLA 1JLFA 2V4RA 4XPCA 1RTJB 1TKXB 1LWEA 1EP4A
chains in the Genus database with same CATH superfamily
4QM1A 1GVEA 2R14A 2PLCA 2YXOA 1MU2B 3UXLA 2I5JB 2FZBA 3S0CA 1R3NA 5FJJA 1WC5A 2GVYA 2BKOA 3C3UA 1LG2A 4M7TA 2NPFA 3S5ZA 4YR2A 3W81A 4KESA 5THWA 3TJIA 2UZ9A 5F2LA 1X9MA 3VDHA 3M9MB 2ZZ5A 2VDHA 3HHDA 5D4NA 3VGTA 3VWSA 1X7IA 5D2VA 3LRMA 4ZP8A 1Q53A 4J1OA 4ZLNA 3BREA 4C90A 5BJRA 4YY3J 2V94A 3GYGA 3EZUA 4ZB0A 2F61A 4DV3J 3C2OA 3F41A 1EPXA 2XG8A 1S0NA 5GAEI 4DUZF 3HN3A 3CEPA 4LUYA 4OHZA 3NGDA 3QOMA 3B9EA 2RF2B 3TJXA 4C60A 1C1BA 3H23A 1BGAA 3W9IA 5JIWA 1XBWA 2XS7A 2VNCA 2V9KA 3BK0A 3BOFA 2JKPA 1KQSR 2X42A 2V8PA 3R3TA 5KFNA 5H8UA 1LM1A 5E70A 3I6PA 3CCSS 4KEUA 1I2PA 3RM9A 1TKDA 5J1EA 3CTTA 4GISA 4GVIA 4ZVEA 3S1GA 1MWQA 4O3RA 3NZPA 1UWBA 6PTDA 3OLDA 1UJ5A 3BLOA 3H24A 1QXLA 5U4NA 3BDPA 3FJNA 4OUEA 4QG6A 1BHGA 1OC6A 1LOSA 4MUPA 3BGRB 1E55A 4QE4A 3MO4A 5F2IA 1FTCA 1TV6B 1H98A 2C2ZB 3W7RA 4UMCA 1S5VA 5CYMB 3NZQA 3RO6A 2N3OA 1KBKA 4L6OA 4Z7CA 2DR8A 4B3SJ 4B3OB 3CMJA 1R86A 1ZAVA 3PUOA 4NAFB 3J7A1 4RZRA 5H9EJ 1ZBCA 1GHSA 4Y7EA 1AZSA 1I51B 3DCPA 3CUXA 1BLUA 3M30A 5HVFA 1A5SA 1CEOA 2HRYA 2U1AA 2J74A 4AY7A 3CWJA 4P2SA 1LOLA 4USHA 4HTYA 2ZHBA 1MSSA 4BKNA 3EX3A 2AMXA 2OSQA 3QGIA 3G0XA 4WFYA 1EP4B 4L4LA 4X9SA 4G5DA 3QQCD 4HNNA 1MNEA 3AO0A 4EZ9A 5I4MA 3MUMP 2MKHA 4H7ZA 3TYDA 1E6VB 1HP5A 5CZ0A 1KFDA 1PZ1A 5E6YA 1ZGDA 4DR6J 1CIUA 2J8TA 3VNKA 3H42A 3PAJA 3MAQA 4MFBB 2B4OA 2VFUA 3BANA 2QSWA 2JQXA 3QBCA 1KBJA 4PUNA 1KOOA 4OLOA 4EPKA 3S46A 2ZTJA 4GNVA 4KIAA 4E6MA 1DKWA 2WBKA 2G2ZA 1E9IA 2RHQB 5I3JA 2NQPA 2W01A 1SC1B 1R2SA 3BZJA 4NXKA 2X0HA 3J7AN 3MXHP 4A8OA 5B08A 3DG6A 4B17A 4F9DA 3HPSA 1C9DA 1BXCA 5FJOA 4MIWA 3PKMA 1JJHA 3BPWA 1D3CA 1NHUA 4GPNA 4TYBA 2DIUA 3H25A 3M8PB 4GJJA 4LIRA 3TQEA 1UD2A 2W4CA 4NLDA 5FF0A 2VUNA 1HNWJ 4PG5A 2XY6A 3KXQA 4MPQA 5AT1B 2LDIA 1KR0A 1UA3A 1S0MA 4LF7J 1K3UA 5E0KA 4OECA 2VICA 2C0HA 3BSCA 3OHMB 4GGHA 3SEPA 4RJVA 4U3CA 3EX2A 4XPEA 3VV2B 4DBQA 1SI9A 3NQBA 3JXOA 4OL8A 3AMLA 2FB3A 1W1TA 4IG0A 1MFVA 4LYQA 2W9CB 1TA3B 4OZ0A 4AUBA 3G22A 4MZ1A 1KP6A 3PRDA 2QV5A 4U2ZA 2YR1A 3N0VA 4NYZA 3R9LA 3AMDA 4H8VA 2G4JA 5KZEA 1F3EA 1YBTA 5HMZA 3LBMA 5A0YA 2PI6A 4JFTA 2L3MA 4PEOA 4TU8A 1KM0A 1W32A 3GFYA 3H7RA 8RUCA 3LNPA 2UUAF 1MWOA 2O55A 9XIAA 3A5FA 2ZZTA 1SO3A 5CSRA 1HL8A 2QE5A 3TN5A 4L6V3 1VFLA 4UTFA 4X4SA 4NJIA 3T8QA 3LANA 4NYPA 2G3FA 4ITSA 2B43A 1QK2A 3B0XA 4S3FA 5B0EA 3IBFB 4NJGA 1CB7B 1F9HA 3MV01 2AW0A 2R82A 3KLGA 1S5TA 3ENQA 4MLJA 2P0IA 1L3SA 2XGBA 1KFLA 4P8VA 4ZPTR 5HQMA 4IKAA 2WNWA 4WIWA 1D8CA 3SSSA 3NL6A 5LXEA 5IV3A 1FWPA 1TK0A 4KO0A 4GYFA 5HP1A 4DN1A 3GXTA 1I1XA 3U27A 2XIJA 1TJPA 1UWIA 2Y8WA 1WKJA 1S1PA 3CDWA 2MYFA 1FKAF 2QCHA 1NAQA 3NBPB 1XH1A 4FIQA 3FJ2A 8XIMA 2VG5B 4JTRA 1Q45A 1JZ5A 1R7OA 1ITCA 2NXNA 2LMIA 3G2XA 5LJ3Y 3KTQA 1FI4A 5LNRA 5DLFA 2CQPA 1UFKA 5K7JA 1S1WB 3MAAA 1M1GA 2IS7A 2Q8ZA 4ZENA 3P5ZA 1S49A 3LWLA 3BO4A 4QU6A 3E74A 2H48B 1TVNA 3CB8A 2CHRA 2DISA 3T4CA 3E02A 1Z6KA 3LGGA 2WSKA 3BJYA 1W2VA 3UE2A 1RALA 4K68A 3O8AA 1RWXB 1LUCA 3TN6A 1BXNA 1G9HA 2G97A 2PURA 5T14A 4LUTB 1JRBA 4LWWA 1JQXA 1CCWB 4UTJA 1E4LA 2BKNA 2I16A 4R7OA 4ZO6A 3SCJE 4NT0A 4Y2WA 3CULA 1G4CA 2FFCA 3UR7A 1JJ2R 1G4EA 1AD4A 5D9MA 1XTZA 2NXCA 2D23A 3ZNJ1 1EJTC 4LFCJ 2LQ9A 4F4RA 4PYAA 3HKWA 4AHQA 3BM7A 2YZ5A 1OY6A 4RL3A 1Q5MA 2XHCA 4ECUA 3EMZA 2CJQA 1ITXA 4OYWA 3PANA 4Q2LA 4PG7A 2WLYA 4Q7NA 5FL0A 5U7SA 4ECSA 2B8QA 1C2PA 2H3EB 5LNUA 1KKHA 1JFXA 2AJFE 1NJYA 2EKNA 4NX0A 4FN5A 2DPJA 2NXJA 1JLBB 2W7AA 2DZVA 3B6BA 3G9CA 1KFWA 2JIWA 3POTB 1C93A 3G1DA 4WKFA 1R89A 3I9ZA 1XBXA 1PUDA 1KSPA 2Z28A 1EDQA 3KG4A 2ZKUA 3W29A 3L21A 3H4WA 2VELA 4Z1BA 5JBDA 1DQUA 3FXGA 2CETA 5ETQA 1WV2A 5HWJA 1V6TA 4PMJA 3UN2A 3UWEA 1JI2A 1TJ2A 2HMIB 1V6UA 2XWXA 2RQCA 4DFPA 1XYBA 2GGGA 4QGCA 1W9XA 4MOZA 1RT5B 3DXBA 4I7UA 5E41A 1HBNA 1JJCB 4FYVB 5I3UA 3HOJA 1T02A 3LO3A 1G67A 1XFBA 1AK5A 3TYEA 3ITLA 3MSDA 1TP7A 3PG8A 5E09A 4QWDA 1LL7A 2D1ZA 2R1LA 2DH3A 2AHOB 1PJ9A 1B7YB 3KVMA 5DT5A 5IT4A 5D3GB 3KNGA 4ETZA 2WSRA 5KAKA 3L4TA 5CPQA 3CASA 2Z2ZA 2HNHA 1HWJA 4U9RA 4IG3B 1US2A 3RPDA 2QIIA 4CLLA 3BG9A 1W5NA 3MP5A 1R3QA 1XIFA 2CPHA 2EFQA 3VALA 5CCZA 3CJ2A 2F6XA 3WQFA 4M81A 3E0VA 4KERA 4MB4A 1N54B 3ZTQA 4K4ZA 3N12A 2NLWA 3P8JA 2X09A 3ZR6A 1G5AA 4DL6A 1FDZA 5CPLA 1NVMA 3QYQA 1WQ5A 3HULA 4TU7A 5F41A 5GMEA 2WZEA 1F2GA 4M19A 6REQA 4ZA0A 4Z2GA 2Q6BA 2VB6A 4BWMA 3J81Y 3FGCA 2NSOA 4ZSTA 1KLYA 4GXPA 1IEWA 1P0BA 4GMKA 4H4OA 3VAJA 1B57A 4GKJF 4OX7A 2DZXA 3UFYA 3VMOA 1IWGA 5D8ZA 3C2RA 4NAEA 1YADA 3IGVA 1Q85A 3XISA 1GPFA 2BXYA 3M6WA 2ROPA 3GR4A 2QUUA 1FRHA 2YKNA 3VD4A 3PJTA 6CGTA 4IO9Q 2YW4A 5IFTA 1RU2A 3BV7A 1JJKA 2XWYA 4ZKAA 2MY7A 3VDGA 2LLEA 3G8TA 1UOKA 2XGQA 1GVQA 4RBUA 1H11A 1BUXA 1OK4A 2BBFA 4HYKA 2K1RB 2UY4A 5E3AA 1VBXA 3W9JA 2IPWA 1RAJA 1MLAA 1KC8T 3RX4A 4LT6A 3UN3A 4J3XA 2OPJA 5ETKA 3NGRA 2C1EB 4CO2A 4PKDB 4HU4A 3QT6A 1WXYA 2VBYA 3Q8RB 1Q6RA 4E3TA 1CULB 5KFEA 2Y63A 2X40A 4QIWD 4ED8A 1F5AA 1TPDA 3SQLA 4LFBJ 3NS7B 3GVRA 4ZMMA 3CCMS 2PPGA 2QDHA 4KB7A 3G6VA 4DS4A 1KFEA 2UXCJ 1T99A 2VPYB 3GYXB 3R7MA 3OVGA 4CLZA 1K9MT 2VBWA 2OVLA 4MVAA 4FS1A 4ZGYA 1B0IA 3D0GE 4GIEA 2OPQB 2BYCA 4ZPVR 4M8UA 1VJQA 3UXAA 3AHZA 3HPOA 2DW7A 3LHZA 4L9XA 1NP0A 1FBAA 1MEWA 3BGOP 4DJED 5E33A 3CHEA 4AY8A 3IFEA 4B9TA 2J8SA 3M0JA 1K8XA 2GVEA 3A8IA 2G13A 1NJZA 2F2KA 4MB3A 1JDCA 4CLYA 3FKRA 4ICMA 1MUCA 4QIGA 3BGJA 3R5AA 4IQXA 2M9KA 1BYBA 4NSBA 1AFJA 1DHMA 4KPLA 3FVDA 3OTBA 1GVOA 4O13A 1A0CA 2FPHX 3GJQB 2UUBJ 1VB9A 4IIHA 2YPIA 3RR8A 2J88A 3MZIA 3H26A 4XZNX 1JYXA 4N8OA 2DNLA 3A3WA 1NDVA 3P6LA 2VZ9A 1T9WA 2VHLA 1R43A 4Q8PA 3TZXA 2WC3A 3R94A 3W26A 4ACZB 3DESA 3EE3A 3GVWA 2FZCB 3CD6S 2MKYA 3OTEA 5K14A 1R9XA 3R1LA 2VPXB 3NY0A 1JCYA 3VIOA 3GAYA 5HNNA 2XSJA 4KKOA 2QC3A 4B9LA 1CZ1A 1RAIB 2CU0A 5J1PA 3B97A 2GIQA 3W7GA 2RNEA 4LUBA 3W1XA 2DY9A 2MZRA 3FS2A 3NQ7A 4MNJA 4ERIA 3BPDA 3N13A 2XYHB 3DFHA 2FMNA 4ED5A 3LCHA 1VHCA 2ZDRA 3MZ2A 2ZBRA 3GTHA 2WNZA 4J9VA 4U6PA 3KP1A 4ZQPA 4AZ6A 1IXNA 4DX7A 5G1TA 6AT1B 1JGMA 1F9FA 3AD9C 5KG3A 1ZTTA 1YK9A 3ARQA 1TX0A 2ISVA 2VZVA 1DJIA 1LQAA 1TV4A 2NZ4A 5F4SA 2HSEB 4OYOA 1MUMA 4OTKA 4GINA 3M6DA 2REQA 4LVGA 2UVUA 2N3LA 1Q1KA 3GHSA 2X2GA 4S3DA 2J0WA 1ZY9A 5FKYA 1FRIA 1SV5A 5LGXA 3B82A 2RDUA 4LOCA 3PJXA 4JD4A 3VAVA 1YG0A 4EPBC 4MM1A 4PRWA 3UNTA 3WFLA 3HP6A 2OQYA 4Q3MA 2WAQD 3K57A 3CLWA 2V3EA 1X5SA 1FWEC 3QF0A 3UWWA 2AGTA 1T94A 2MKIA 2HK0A 4MY9A 4IFVB 3M0VA 4WP3A 1RT2A 3VMPA 3ZLHA 3AXXA 2DGQA 2G4BA 4MJZA 3BLEA 5KFUA 3HT3A 1H5YA 1ZJAA 4A05A 3FCWA 3QMQA 3TX8A 2E5LF 1UB3A 3TQVA 1HUVA 4RW4B 1DVJA 3F73A 4K1GA 2VA2A 4OX6A 2OFGX 3WHIA 2DZPA 2W2MP 4IFYA 2NUXA 2WSQA 1PTDA 4IG2A 5E2QA 5CZJA 1SJQA 4I68A 4OGZA 3JAMY 3VI2A 1KTCA 3N5BA 1J10A 1G4SA 4MTPA 3LZ5A 3B4MA 3D47A 3VAMA 1QVGR 1XICA 1LLWA 3W60A 3IR6B 2F8EX 2Z6IA 3WK2A 1TZZA 3IV8A 4LRTA 2GJIA 3PIPQ 1KD1T 1XYAA 3W74A 4NYOA 2VTFA 3VZXA 3GTFA 1X60A 4B91A 3L4VA 2RDJA 3EVOA 3HDSA 3VUSA 2WC7A 4I7VA 4OT7A 1BD0A 3LOUA 4D1JA 4P7VA 3OZOA 2DGXA 3BR8A 5I6SA 3R12A 1NPPA 2WANA 3UGVA 2HZAA 4I6KA 1R7IA 1YWXA 3FIGA 5KOWA 5D9PA 4EBCA 1W5QA 4JIRA 1AD1A 2UY5A 4AZGA 2E77A 1XJWB 1T8XA 2E5BA 1UW9A 2I1OA 3R2CJ 3EXTA 4CN4A 3HVWA 2DEIA 4ED0A 2BE2B 1NBEB 3M8ZA 3QLHB 3CWNA 3UVAA 3J80U 3QR1A 4LCSA 2GVDB 1W31A 2DSVA 1RSCA 1DTTB 3N9RA 1Q5VA 5IOLA 4GY7A 1BAGA 4FS2A 3TTYA 5E9XA 4BS2A 4JIPA 2HXUA 3GVQA 3QM3A 1G6CA 5BRQA 2CNNB 1I0BA 3A21A 3MSYA 2VJVA 1KRPA 1PC5A 2DV0A 1U2FA 1YXCA 3MUY1 1ISWA 3FA4A 7AT1B 3BN7A 1G4PA 1OX4A 5L9XA 1TVRB 2R8GA 1TKZA 4NF7A 4GZJA 3NGFA 2LQ5A 2Q3OA 5CLWA 4ZXLA 2BQUA 2CXEA 3K5OA 3IVUA 1NDZA 3W24A 4P2XA 4UTLA 3N34A 5HMFA 3B8UA 4S3EA 1VJWA 3NGKA 1MZHA 3OLGA 1YMYA 4NY2A 5I77A 2LU1A 4ELVA 4MHBA 3PZQA 2ISFA 1XLLA 4GIYA 4I6WA 3TTOA 4P74A 2BGQA 4EEYA 3FBFA 1ZAIA 2Z1BA 1BY9A 1WUEA 1ALDA 1KFJA 1FK9A 3KLHB 2AYBA 4B90A 4MGGA 4BQ3A 3MR6A 5IT9Y 4B5TA 1HR0F 3VNLA 2FDSA 3VX0A 2PO4A 1J0HA 3F4VA 3M0LA 4AZIA 3ILOA 2E25A 1FF2A 4G1QB 3BDEA 4M7SA 1DBDA 1N8IA 3FSIA 1I6JA 3R79A 3AALA 3KRSA 2FH8A 4PC8A 4B4FA 5FSDC 1CLFA 3GKFA 1LW2B 1JL8A 1N5YB 4FR1A 3W28A 3IS9A 2LFVA 2XS2A 1IWAA 2LXFA 3VKJA 3ONQA 4TU1A 3WJSA 1OFDA 2HBZB 1QE1B 1YYAA 4DJFD 5HR6A 4AIBA 1KTBA 3G5EA 2D1CA 5J2NB 2GMJA 2WVDA 3I7RA 3IUDA 2IMWP 1RA6A 5F7UA 1WEZA 2GVGA 5AC7A 3DOMA 5EX3A 1VFOA 5FJUA 5D30A 2NXIA 4LBIA 3TNVA 4F50A 8ATCB 2W8LA 3PV8A 4XIAA 2EPHA 3VD7A 3ZFVA 3TCEA 5C9XA 1LDCA 2RHSB 4QJ3B 3EDJA 4MK9A 3QV8A 3GR7A 3TZNA 2FVRA 5KZDA 3ARPA 1ZJHA 3TYBA 1WOSA 1AMKA 3KK2B 2KX9A 4H00A 2GJNA 4C6JA 3BCDA 3DX5A 1HWIA 1JUEA 3GHUA 2VONA 2HQAA 4H19A 3TC7A 3MUIA 3V7PA 1JLCA 2DR5A 4AC1X 3EB4A 3THCA 3G24A 4ATNA 2MJUA 3SCPA 3PVFA 2QJJA 2Y6ZA 5JUMA 1F9CA 2ZTKA 1PAMA 2P2CB 2RRBA 2ZXQA 4GC6A 4BWLC 4YLWA 2O9OA 2OO0A 2VG7A 1BD6A 3C46A 4LYRA 3KJVA 4OI3A 2CIPA 2DBBA 1YPFA 4UOQA 4ANEA 1FCBA 1P6TA 4B5XA 1OMSA 5HXMA 1LBFA 1KR4A 1OYBA 1EZZB 1TELA 5DMLA 3ZT6A 1MSWD 3KWMA 2ZVIA 4HIBA 3MMCA 3RK8A 4Q32A 4CCDA 3I5CA 3K5NA 1S6PB 1CT5A 4FA3A 3AIUA 3V6KA 4UFKA 3EOEA 3U2ZA 2CQ4A 1H74A 5M3WA 3DYMA 4B9MA 2B7QA 3HSJA 4F25A 1AL7A 2DFAA 3N1AA 3AHPA 4MDPA 7TAAA 1R8HA 4FF7A 1XMOJ 1EB0A 2JEGA 2KDOA 3O05A 5J1NA 2U2FA 1Z9AA 3IBCB 3D7SB 1F3VA 1TTJA 3S5SA 1W3TA 2L9WA 4DM1A 2Z2MA 4JX6A 4XAYA 3TJ9A 3V1PA 2YL9A 4UQDA 5AC6A 1TRDA 4KFOA 4O1EA 4BWLA 3T7VA 3C0JA 4RWWA 3D1QA 1FWHC 2PTWA 4LF9J 3V5RA 2GWNA 4IH3A 2CWXA 3Q65A 3TR9A 4W93A 3HPFA 1Q82T 1IF2A 2YH0A 4OZ3A 1UR1A 3HURA 2NV1A 2YWEA 2PI4A 1S6OA 5CD4A 1PIGA 2PGCA 2O9PA 1TWIA 2BP1A 4GJIA 1Y8BA 1QPOA 1XYLA 1EGZA 4US5D 2H9ZA 3LN3A 1O5JA 3GJRB 1UFWA 3LUYA 2DGTA 3GTYX 3FAXA 3FHAA 3RILA 2F9RA 1L2UA 3E2VA 1Y5NB 2F2HA 1RAAB 1FD8A 4Y8EA 5CCMA 3VGDA 3N6LA 1EBGA 3AXMA 1NDCA 1OFQA 5EX0A 3BG5A 2WMIB 2A7PA 2QL5B 1TKTA 1FWGC 3W85A 2FZGB 4ECLA 1VQPS 1XX1A 4KIEA 1V3JA 2FZ9A 4CNTA 5K9DA 2VFHA 3W5XA 1YGYA 5FEXA 4IRKA 3D6HB 3T0AA 1GNKA 2RQMA 2Q66A 4BFAA 2UV8A 1XCXA 4JI0F 1YTKA 1FXQA 1SM9A 2VD3A 3Q2SC 3LDVA 5U47A 4JTAA 4IWWA 2RDIA 4RO0A 2ZA2A 1RA0A 3AB2B 1X8DA 1XLGA 4PMVA 5HMXA 1J5OB 3ES8A 3AWOA 4NHVA 1KQFB 5AC5A 1RLCL 1YJRA 3HCXA 4YTTA 1ITPA 3WLOA 2MJNA 4QR2A 1TQLA 3CH0A 4PCSA 2Y85A 1SW7A 2ZA1A 3EM1A 4LF5J 4BF5A 5CQ1A 4IPNB 1LOQA 4OZJA 2Q8XA 4ZVQB 4Z2XA 4KFNA 1FE4A 3BE7A 4JHMA 1HI0P 1GK8A 2TPSA 3WF0A 4IL0A 1W1IE 1VI7A 3W1LA 4MK7A 3DFOA 1S1UB 3BAYA 1EXBA 4DFKA 2WOMA 1P27B 4LF1A 4UNIA 4Z1CA 3N9KA 4PRFA 4X2BA 4MPKA 2IJRA 5A6SA 2GGHA 2R94A 3GIQA 3RO8A 2MKCA 2XO7A 3WNLA 5HPCA 2A0FB 3ONBA 2DZAA 1G6BA 1JDFA 1XWYA 3ARRA 3U6WA 1KLMB 3P4UB 2DZTA 4I56A 2AWZA 4ZITA 2QCNA 1I2RA 2EK6A 4DQPA 3TROA 4GNKB 3ET6B 4ALDA 4OV1A 1EQCA 3RMJA 4DXVA 3RZAA 1Q66A 2HRUA 3UI3A 2VCAA 3ITYA 3BV8A 1Y5XA 4KTQA 2W66A 4ZPBA 4HOWA 2JC1A 3B8WA 4YN5A 3SN1A 2HRTA 3IJ7A 2PDCA 4WXZA 2PRLA 1JPKA 3LHTA 2V5KA 4D6FA 1F73A 3IP0A 4RX6A 3HGOA 4C6PA 2H5EA 2AX0A 1ODUA 1LRQA 4DWDA 3B78A 4DPYA 3DH7A 3JSMA 2OB3A 2ABAA 2F9DA 4JZ5A 3OR2B 3KL3A 4WU3A 4UTIA 5AE2A 3AZRA 3B03A 4C11A 1PSCA 4ECRA 3T1YJ 4W85A 4CLKA 8TIMA 1E0UA 3UN5A 2OD4A 3P7YA 4DV0J 4MAVA 3GWQA 1VQYA 3S2CA 1S9GA 2BTMA 3BYRA 4YS2A 3DLKB 1JD7A 3C0LA 1SZGA 4DNHA 1LTDA 5FJPA 4ES1A 3ZZ0A 1U6BA 4YMZA 1GZ1A 3FBBA 1R6WA 2YNIA 2VJUA 2L5HA 4BJHA 4N0RA 3SSZA 3TH6A 3ZVHB 3LPYA 3QWPA 2FUG9 4JAWA 2KT5A 3EPGA 1H63A 1GYNA 4I9TA 1H2TZ 1G69A 4FYWB 3AU6A 2DNRA 1OINA 4AEOA 3GQYA 4NU7A 3ILJA 3MUCA 3W61A 4Z37A 5EWFA 5D8HB 4Q43A 4CRJA 5HQ8A 1P7TB 4NUWA 1VLOA 1CJTA 4B16A 2PDMA 4IIFA 4WKRA 2V4JA 2J75A 3AHXA 3RLUA 3KHHA 1PILA 1QVBA 1V08A 2M4MA 2YVSA 1VPXA 4EUVA 3OIHA 3H0PA 4WGXA 3SIZA 5FESA 2NT1A 1N88A 3PBYA 3MMAA 7REQB 4NLQA 1XIBA 2WKLA 4PG6A 1TV7A 3CWHA 4HVXA 3VFCA 3ORWA 1EH9A 2WKJA 3DBPA 1UIOA 4GI8A 3CD5A 2RKXA 2C79A 4EXBA 5EKYA 2JEJA 4HLBA 1WOBA 3GDLA 3GQCA 4CWBA 1XYCA 1YPIA 1JK9B 3DYAB 1L9WA 3WLHA 4DQSA 5EHHA 1RYRA 4E4PA 2FDMA 3HIJA 3OA3A 2DSWA 2C28A 4F2RA 5BOFA 4Q22A 3TN3A 3CCQS 1M90T 4YTSA 2CZ9A 3T09A 3M9OB 1O1ZA 4NNCA 3NZ1A 1ZALA 5BYQA 2ZUVA 4ZP6A 3R89A 2R7OA 3GM8A 3KHJA 3NL2A 1T9VA 4JB8B 4PMNA 3GXFA 4R88A 4ZVOB 3OW2R 3UWUA 3IIVA 4JNZA 2CAJA 2PDJA 3EA1A 2Y1LB 3H2VE 3EKLA 1X6LA 2YTCA 1FKWA 3M2RB 4IIDA 1F61A 3R27A 1FRBA 3GE9A 4UIOA 2ZYFA 1KCXA 4DZAA 3RHGA 1TTIA 1H0HB 2XHWA 3UR0A 3KHGA 4E2VA 3MOJB 2KVQE 1W5PA 3L4UA 3BGFA 3H40A 4Q7AA 1KVKA 3TAQA 2V8HA 4QNEA 1REVB 1T9UA 1DQAA 2C2OB 3B0PA 5SWUA 3AWNA 2DT9A 1NJXA 2OH2A 2F6UA 3M7SA 1T05A 3SI9A 4IGMA 1K02A 2EFVA 4DI8A 3N2OA 1O68A 2EPIA 2RE1A 4S1FA 4IFRA 4R85A 1RADB 4J5OA 2E8YA 1SJAA 2O7SA 1GX5A 1YJVA 1NM2A 2GQCA 2J6UA 1PBAA 4E8DA 1DLOA 3E2RA 2ABYA 2PWHA 2HURA 2LQBA 3AJ2A 4GIRA 2J13A 4Q8NA 3JB9k 1LT8A 4OV4A 5CPSA 2OGUA 3G1HA 1QNPA 2G3NA 3RCNA 5SZTA 5E5NA 1T8QA 1U5HA 1ZYQA 5AHLA 1K1SA 4PQUA 3P82A 1BYDA 5ENLA 3SUSA 1MU2A 2PMHA 3DLGB 4JBCA 2BQ3A 4V19X 1QUPA 2DZBA 4PMXA 2XY5A 3I6EA 3VOGA 4ML4A 2J7CA 2JKEA 2LQJA 2CVIA 1BXBA 1GKPA 3S5YA 3VIIA 4CEXC 5C42A 1ZETA 2NREA 1GW9A 1RHJB 2KT2A 3PUEA 1QSYA 1H1ZA 4JI3J 4L1WA 1QBBA 2J7HA 4O23A 3NGJA 3TSBA 3MD1A 2PD9A 2V38A 4U2YA 2VC6A 4K59A 1PCWA 4MB1A 3N28A 1F05A 2O1PA 1LK5A 2VOPA 2FHFA 1DIOA 3HVTA 3CAQA 2HHUA 3PHEA 4LR9A 4LRSA 3N9UC 1G7VA 3QR3A 2CESA 3MUAA 3PKYA 2E68A 5DY2A 3T42A 1OADA 2ERRA 3W2NA 1YRUA 1UWUA 4ANCA 3K59A 3S1WA 1QD1A 1IM4A 4USIA 1XD1A 4HT7A 3UQNA 4HMDA 1RWWB 4QHRA 2QFJA 4DBEA 4Z42C 3HG2A 1U47A 2XZWA 2JKAA 2WZTA 5KT6A 1PHQA 3HO8A 3ZT7A 2V4QA 3ZZTA 6TAAA 3CQHA 2QPUA 3VD9A 2CJYB 4H9YA 5A6KA 1Q81T 4KEMA 4B9SA 1DXIA 3CUJA 2ZUWA 5K8MA 2IPFA 3UR5A 4I5RA 2NQZA 1WC6A 4QCFA 2XH2A 1IXKA 2EFPA 2VT0A 3P5YA 2C3UA 5CLTA 2V34A 2FZNA 4Z7YA 2DNZA 1Q6GA 3HFYA 1JYWA 4OZLA 4UUIA 1YDNA 1HJSA 5AOUA 3H6OA 1WG1A 4WSHA 3DI6A 1TV6A 2E09A 2PE8A 3HFVA 4NE9C 2H6RA 1R8CA 5FDLB 2VPWB 3GO2A 2ABBA 4AZHA 1VJSA 3SEOA 2HK3A 3IWNC 2UVRA 1RUSA 1WACA 4LT9A 1Q8KA 1FJCA 1MRAA 2A6NA 3OTOF 4K8HA 3WIUA 4B3ZA 4DO6A 1WDRA 3JYTA 2W5FA 5TBOA 1ACMB 3JSYA 2L9NA 2OWCA 3GLCA 2P8IA 3R5BA 5LHEA 4P7LA 3QIDA 2V3GA 2ZXAA 3UG8A 4BA0A 3WLIA 2QN6B 3WC2A 1A3XA 1ZCOA 1GOOA 4RW8B 3DLLQ 1JZ8A 3TEVA 1TL1B 2V4RA 1IV8A 1XDJA 4HA0A 3WUFA 3ENWA 1EP4A 3ZZ1A 2G8ZA 2J7DA 3Q8PB 4E3VA 4PUEA 3KVLA 4WLCA 1JZ2A 3S3GA 3K5PA 3HM9A 1E9YB 2D0HA 2I9EA 4ORMA 1DJHA 4DUYJ 3TVKA 4DF4A 2G37A 4A35A 3G1AA 4IQJA 4X63A 3SXLA 1B0VA 2FLOA 2EG2A 5GAGU 4X62F 3K8KA 1RTDB 1ZM2A 3R6LB 5KMYA 1EJXC 2HKEA 4JUZA 3T07A 4PB4A 1PX8A 4X2PA 3C6TA 2PLMA 3BYPA 4N8NA 3VZHA 1W1YA 3TMLA 2VZUA 1XIJA 2WSPA 1N56A 4LPCA 1J5TA 1FP9A 2GDQA 4IRDA 3P14A 3CB4A 1E1CA 4IGHA 1PO6A 4QU7A 3W37A 3M8PA 4PYSA 1QUVA 1UVIA 2F8QA 3HD2A 4J9RA 4IQEA 4RXFA 3VVGA 4A46A 3W23A 1W3LA 2WK2A 3VKCA 3RR1A 1D2KA 3W65A 4MKAA 5E1QA 1TPUA 5FOOA 2DD8S 1NWRA 1X4DA 2F9JA 5BXPA 3DMJA 1WSVA 4AUKA 3NA8A 2HBXA 3O6CA 3LSCA 4UTWC 1ZRQA 4TKTA 2WVCA 2ZZMA 1AG1O 4XAKA 3W3SA 2AU0A 1GH8A 3TA0A 4DQQA 4JI2J 1VJIA 2FHJD 5HROA 4QTGA 3ICLA 2JRSA 1CLKA 4B08A 3VD3A 1HD0A 3INPA 1JNEA 4JTIA 3AYRA 3JVAA 2EG8A 3VAFA 3JQJA 3OOQA 3VDCA 4B5UA 2GYIA 4M5HA 2G0WA 4QIFA 2HQIA 1G2EA 1RT7B 1WF1A 1WUUA 1OYCA 5HMEA 3R6IA 5CGQA 3WJYA 3WLKX 4PPZA 1OS5A 4KFBB 1R6YA 2RDXA 2WLZA 1C0TB 1LLOA 2X51A 3TANA 3CJ3A 3S8HA 1DJNA 5BYWA 2B4UA 1W3JA 1FRKA 4EPEC 4CO1A 4TN2A 1D3GA 1RTIB 3O07A 4E5TA 3DKJA 4MADA 4ZSUA 1DTUA 1EL3A 4N02A 1H6KX 1KVJA 1GOIA 4AWTA 5DZ7A 2EQDA 3VK5A 4C3KA 5IV4A 4NI2B 2CEQA 4CQBA 2CPUA 2I6WA 1OZMA 4UTWA 2LEAA 5ETSA 1WC4A 1OIFA 4MIAA 4CLFA 1RPKA 1YXDA 3C15A 4AF0B 5L9NA 4FXJA 3DYPA 4ZN3A 1JLFB 1Y5LB 5B09A 3OPKA 1V77A 3G18A 2NYIA 1KBIA 4IR9A 3QZ8A 1B3YA 2J9DA 4I69A 5LMUJ 2M8DB 1TMLA 1RE1B 3SB0A 3OBEA 3W1PA 1TMQA 2ZZ7A 3CTLA 2M3DA 5FF3A 4JL2A 1F5CA 1TL7B 4URQU 1C9WA 2J62A 4NJHA 1VHFA 1OCBA 4F04B 4XZMX 3N25A 4MYAA 4BC7A 1R8LA 5A8RA 3NBPA 1VCGA 1VDHA 2ASHA 2VG5A 1UKQA 1G3OA 3I4KA 4WU2A 1WPCA 3UCGA 1RHMB 1JCLA 5BXIA 4WFNQ 4KGLA 4ROQA 3UR2A 3OL9A 3EKGA 1TWZA 3FKKA 4IQLA 4ECQA 2GOUA 4A2RA 5C55A 3GFXA 1V5IB 2QA2A 5CYQB 3WBAA 2JGYA 5ETTA 1J0KA 1UH2A 3UF9A 4AWUA 4IDKB 3OLBA 4ECWA 3EMCA 2RDTA 3R0DA 2DR9A 2X7VA 3GUWA 4HK6A 4NMXA 3A4WA 4YDXA 2YB1A 2VEFA 2E1DA 2XLKA 3DOLA 1WEYA 4L3NA 3AC0A 2WB5A 3TVAA 1B2YA 3R43A 1UP2A 3SRHA 1VFUA 1YBUA 2IRYA 4AISA 4LV9A 2RJGA 1J2WA 4G2DA 4DO7A 4C0BA 1Z42A 4FX7A 3WNPA 4LALA 6ALDA 2GCFA 3KCLA 3HHNB 2F65A 4JI8F 3NO3A 3PPHA 3DN5A 2UU9F 4LANA 3FHQA 3TWAA 1SL1A 3P0XA 2QKFA 4C6BA 3AYTA 2DY1A 2HG4A 2J7BA 1B4SA 3KHDA 3FCVA 2KZHA 1YRTA 5F8LA 4GO9A 1U33A 3I6RA 2J6TA 3MM6B 2D3NA 1RAOA 3IN5A 1XBZA 5C7VA 2AL1A 1PWLA 1ZM4A 3THPA 4PTWA 2E9RX 4NZ4A 4R53A 3DRPA 3N4WA 2WWCA 4KETA 4NZ3A 3Q37A 2A3HA 4AX7A 1PIEA 4YNGA 1HNVB 3HTWA 4K38A 1CLVA 1VQSA 4IMDA 4JOMA 3GBDA 4NP7A 1HPZB 3G8EA 1EWDA 1W0MA 5CD4H 3POTA 4DR5J 3OBAA 2VFIA 1V6VA 3PJUA 2BOGX 2B9YA 4B5NA 1UQYA 3W1UA 4LBSA 1K9FA 1GXUA 3KOZA 1RT4B 2HVMA 3SI8A 4FYDA 4XWUA 2VP8A 4QISA 4DV7F 4ZODA 3IGXA 1FHTA 6ENLA 3CHDA 3GXIA 2HMIA 1QI5A 2HHQA 5L38A 1H60A 1RK6A 1IBLJ 3HBLA 3OFGA 2DQWA 1MI3A 4X64J 4LRFA 4BS0A 2EBEA 1CXIA 2CBIA 1NWUA 3PZGA 1FRXA 4F4ZA 1LWIA 1LV5A 1TPB1 4TQTA 5KFAA 1HNZF 5KFGA 3KLEB 4PBGA 1OSCA 1OGSA 2HQDA 5AE3A 1QHPA 5KFJA 3BQ0A 3C2FA 3MM9A 4B3MF 3PPGA 4IG3A 4CO5A 3CL7A 4QLJA 2IQ0A 3DHDA 2PIIA 4DS5A 2BV9A 3JR2A 1EQMA 3HKZD 4FNHA 1C0UB 1ICPA 2ZHAA 2F4VJ 4RBTA 4TVDA 1UWSA 5FIPA 2H5JB 3FMBA 1K70A 2HBQB 4NCGB 3EX1A 2XQCA 4BCEA 1U26A 1V9OA 4A4AA 3SFUA 2Z29A 3N4AA 1G94A 2X1BA 4WDXA 1WXZA 2DRAA 2W61A 4BI7A 1QNOA 2QL9B 4W5UA 4G8TA 4RNJA 3W2MA 4WYLA 2BE7D 4I1TA 3G8QA 4DIAA 4KCVA 3BW3A 3WBWA 3W00A 3CJQA 4V19J 3EWCA 3OQ8A 3QLLA 3H8AA 3PZPA 1R0AA 1H73A 6FD1A 3PPFA 1SKUB 1F74A 4JNYA 4QZVB 2GJ2A 3UXKA 2FHCA 2QJ3A 1ME8A 5I0DA 1YNYA 3MYPA 3GV8B 2BOPA 4NLRA 2K1RA 1JI1A 1PYSB 5HBMB 1DJGA 1R3YA 4IUFA 1OT1A 2OPPB 4RK8A 3G1VA 3Q8YA 3SY5A 1ULRA 4RW6B 1SFTA 3V6JA 2W25A 1UR0A 1V03A 4O28A 4K6AA 1FXPA 2GSEA 1Q2SA 3CL8A 4Q4OA 3K1DA 4J7RA 1MMFA 4F2BA 3MTKA 3F2DA 4UOCA 2OAUA 1N34F 3BZGA 4RNIA 4ZB2A 2R1KA 4FYXB 1OYDA 3LEPA 4GIAA 5H8PA 3CIXA 4CD6A 4JIIX 3EMQA 4UWMA 1R87A 3WDHA 1UR4A 2EG1A 1QW8A 3EAUA 3ZLGA 3W6LA 5IOBA 2KFZA 4P61A 1LWFA 1NZAA 4DZHA 1KRBC 4Q44A 4G7EB 1M5KC 2AJQA 3RAOA 3TMQA 3GUGA 2M2BA 4M63A 4XZHA 4OHXA 1WD6A 2OPQA 1EF3A 1QAYA 2IPGA 1JRCA 4ORIA 3AJXA 3OD2A 4DJEC 3RCMA 5T7LB 5KFWA 4HN4A 4L1GA 4R34A 4LFAJ 4W87A 2CQ0A 1TL3B 3HV8A 4DF8A 3IARA 5IFMA 2ZWYA 2MUCA 4LNCA 4D6GA 4CNPA 3GR0A 1K7XA 4MIBA 2B9WA 4LF4F 2ZVSA 4JFSA 3QPZA 1NM9A 1G7CB 3L2MA 3UZJA 2N4CA 2WVEA 3VNDA 3UFCX 3FZ2A 5AYIA 1RKIA 1Z44A 1M7JA 3M16A 4PSRA 4NI3A 3NYZA 2C1HA 7FDRA 4BC9A 4B9VA 2NPIA 2V6AA 4LB3A 1U8SA 4I8DA 3PW5A 4KV8B 2WMGA 1EIXA 2Q3RA 1U09A 3LU2A 4CM2A 1PBGA 2H9AB 1ESWA 2HFZA 2IVFB 2FY1A 4M5LA 3BKUA 2E1WA 3HF5A 5F4XA 3H4DA 4PB3A 3OFHA 1EQPA 4I7FB 4O8AA 1JKHB 2DJXA 1W6TA 4UMAA 2SXLA 4ZP7A 1GX6A 4OJ1A 2VOMA 1KGWA 4EFAC 1XIGA 4DJEA 5K8OA 1NK6A 3ZFHA 5HWNA 3NDZA 1S1VB 5ABTA 5BNKA 5HO4A 5C8BB 1EA9C 3VOHA 1E3ZA 1O60A 4NIRA 5DX7A 3UG3A 2CW6A 1QSLA 5IHRA 2WOQA 1MO0A 3OQ2A 4L72B 3D66A 1BFNA 2VC9A 4IOTA 1KRMA 2FPVA 2NUYA 3I87A 1E43A 5EMYA 4PBFA 2I38A 1NOWA 1KCLA 3TW0A 2MHEA 1I2NA 1EC9A 4PGLA 2AT1B 5GAGI 1K0TA 2EFNA 4MWAD 2HCVA 2DH9A 2WC4A 4WGHA 2PGEA 2VOTA 1IR1A 4KWOA 3OA5A 2QRRA 2LVWA 1S7IA 3N6HA 1YTDA 4TX6A 4NWBA 4IM4A 2ILYA 3F4CA 2MGZB 5HL7Q 3QGKC 2QCDA 3PUDA 4YB6A 2IUZA 3SCTA 2WQDA 3QJAA 4PWDB 2HQ3A 3VFLA 2IJNA 3H2UB 3ZC4A 4E2BA 4LRBA 3WEOA 1FVQA 3A8JA 1C8YA 1US3A 4IFKA 3HSDA 4MLRA 3SFGA 4IFVA 4CLWA 2AGKA 2F8MA 3BMXA 3IRDA 2EC0A 1SUQB 5H1SV 2V5LA 4QE5A 4FR6A 4RW4A 2HHSA 1JCTA 3FBCA 2MSTA 1AW1A 4HTIA 5HMDA 1Z41A 2WHMA 1UH4A 1X1NA 3C2EA 5H91A 1NJIT 3TJLA 2KN4A 4IGSA 1RD6A 5FAGA 3MBDA 4U31A 2TYSA 4IPIA 2FH6A 2MQQA 3OSPA 3AIWA 1BF2A 3OL6A 2A6OA 2WVUA 1J11A 5CG7A 1T6MA 2QMKA 4NRSA 3M0KA 3BR9A 3N2BA 4HACB 3ALGA 5HK4A 3GRIA 4QP0A 4LYKA 2CJBA 2D9PA 4O4GB 3RR7A 4ZCWA 4EYHB 2VFVA 2XH0A 2ZWPA 4JI4F 1JLGB 2BXVA 1CJUB 3NLCA 2CCRA 2KG0A 1URRA 3NMAA 2K3KA 4S3BA 4H6RA 1MQPA 3NXZA 3FYOA 2BOFX 1JPHA 4ZCKA 3MM7B 1KDNA 2PRHA 3SSQA 3S1UA 3SADA 4KPYA 1JPIA 3PX6A 5CPOA 1NQKA 2FZ8A 2INZA 4C7FA 5REQB 4GKKJ 3THQA 2B6AA 4ES4A 2IKJA 2Q09A 2DNOA 4K2JA 2WM0A 3QR0A 1Z89A 1U1OA 1OIMA 2CWKA 1NY1A 2CC0A 3ZJ8A 3O2IA 3JZUA 3Q22A 2GVDA 3QV9A 1NKBA 2RHGA 3TZWA 1IKVA 2CA9A 4TLRA 3EPOA 1DTTA 1N5VA 1EJRC 3PP7A 3PG9A 4Y3CA 1CEZA 4Z17A 1HMVA 2CKWA 4W89A 5I3DA 1R9YA 2ZWOA 1RJJA 1NK4A 3RW6A 2CWNA 4C6MA 5EA9A 2HFOA 2V0NA 3LD5A 4US6A 2EJAA 1QMLA 3M6UA 3U9IA 3UO0A 4QLLA 3LALA 4AEFA 3KS5A 2H65B 2R8IA 2UXBF 4F4AA 2XPKA 4A29A 2FB2A 3NL5A 1QJHA 2RUGA 1RVKA 4DR2J 2ALRA 2HTMA 1YQHA 1EC8A 3W75A 1YIJS 1I2QA 2ZZ6A 3PB2A 3E3XA 1E3XA 3KLHA 1M7PA 1IEXA 5IM0A 2VWSA 1T9TA 4UQTA 2CFFA 1WCGA 2ZOXA 4NZ6A 2W9BA 4N2YA 4MKNA 1JYVA 2HNZA 1FTXA 1IKYB 4MNLA 4U5IA 1VRTA 1FJGJ 5EMKA 2RGMA 3LENA 3W1QA 3V4IA 4JYAF 1C3FA 1KWMA 3M4HA 4YB1P 3WIVA 3O44A 4M1BA 1GT8A 3DM2B 3MFIA 3THDA 2Y9HA 4CH7A 4IISA 3CJRA 2KM8B 2VWTA 2W2NP 3NQMA 3M0XA 1N5YA 5BZAA 3DGPB 1KCKA 5LZLA 1GNXA 3S5OA 2CNCA 3P3BA 1T03B 4DJFC 3P61A 3GZAA 3DLEB 1TE6A 3DRRB 3NSMA 1QE1A 3I7QA 4Z0JA 1VFJA 4J3SA 2HGLA 2J9CA 4JV5F 3ARXA 2QLWA 4JPGA 3T1HJ 1N36J 1TPC1 4CTAB 4FF1A 4WTYA 2MLXA 1QOXA 1IXPA 3UW1A 3G6ES 3BAIA 4EIVA 3FEXB 3WLTA 4K8RA 3FN9A 4IPJA 3ABZA 4DWSB 1FVPA 1UBSA 2ODOA 4LSNB 3N2TA 4I64A 3WF4A 5CA5A 2XBPA 1IT7A 2WJEA 3TXZA 4O10A 1HBMA 4AMCA 3KTXA 1RWMB 3UCUP 5LIWX 2Q43A 2V9DA 4P7RA 4O0QA 4LC6A 2JLEA 1B4EA 3AIRA 2RILA 4QEEA 4M6UA 3KK2A 3TE9A 1EBHA 2W63A 4IIGA 1BF6A 1UJ4A 3PR2A 1HBUA 4RV3A 2YX7A 4DV2F 4LSZB 3OLEA 1IIHA 2OYMA 4TXSA 1BG4A 4NPOA 2VIHA 3AS0A 4FS9A 3XIMA 4DJFA 3UJSA 4G1NA 5AYBA 2UUCJ 1W9VA 1BQCA 5I3QA 2PTDA 1HNXJ 3DHWC 2X1AA 5HWMA 4IF2A 3UCQA 7ENLA 1B64A 1VHNA 4B9YA 2UXDJ 5EMMA 3OVPA 3BB5A 4RWXA 2C71A 4HCLA 3C2PA 2QIWA 4IX2A 1M7OA 1R46A 1QHOA 3P8BB 3HFTA 2IAJB 1FHUA 3T6JA 3HU7A 5EU9A 3HHLB 2BOAA 3D5MA 5GNZA 3OIXA 1UWQA 4CD5A 4LSLA 1B9ZA 5CGTA 3K4AA 1IJEB 2GGJA 1G7UA 3IIXA 3CM4A 4WVXA 3J81j 2KHCA 1FQ0A 5I3IA 1Q8JA 1HBOB 3LCLA 5EGYA 2EPKX 3GTIA 5A8MA 3SFWA 3I5BA 4P72A 4USKA 3M7VA 2MANA 4J35A 1Q63A 2J77A 1JDEA 3G1FA 1HP4A 4DX8H 3CV2A 1GWJA 2YSWA 2DIJA 5KG7A 2WPGA 2BVWA 2YL5A 3TR5A 1WYIA 3BJFA 1R5YA 2ZRXA 5BU6A 4A8SA 3VYLA 1X5PA 1E6YA 1S1XB 3CQIA 1CXHA 2ZJQQ 1P0NA 1EKOA 3MM8B 3IJIA 3EDEA 5RUBA 3DLJA 2O67A 4ALZA 2A3BA 1P1MA 2WSYA 1A0EA 4I6YA 1O5XA 2XN1A 4V1XA 5G2HA 2GC8A 4REQB 1FX2A 2FVSA 3CPUA 2XNQA 4HU3A 3HG3A 4X61A 2GJRA 3O1LA 4AQYF 4OI0A 3K1GA 3SIPB 4O8RA 1QCWA 1SVDA 1XGEA 2HQGA 4PQAA 2J0QD 5HLFA 3KP0A 5FJ4A 1V51A 3ISIX 3LXCA 4QQ3A 1VEMA 3RGIA 2NV2A 3MMWA 1KFKA 1ZM9A 1N8RT 2Y8UA 1V79A 3ECQA 4PCPA 3CDAA 3M8QA 2WMIA 3CEDA 1YJTA 2O66A 4ZA1A 4YCOA 2JX2A 3WQ5A 1IKXB 2B56A 5FLXY 4KFPA 5I79A 4X0VA 5KFTA 3IVSA 3LHVA 3AS3A 3SSJA 2XIOA 3TAMB 1EDTA 1T0TV 3MR3A 2MZ1A 3A1YG 4AHOA 3MEGB 5FEZA 4PB5A 4Q8EA 5KFBA 4PTVA 3M5XA 3TX9A 3W2KA 4JOUA 5L1LA 2NVAA 4MNMA 1RHRB 2BE9B 4US5A 3M5VA 4IO1A 1J5OA 5AHIA 4OZOA 1JPMA 3W82A 3MHGA 2VC5A 3OG2A 2WAGA 3MKCA 2PF0A 3W87A 4FBUA 1VHIA 2KU7A 3V0UA 3GNDA 2ZH2A 3VA8A 4TQRA 2GHWA 3TYAA 4C3LA 3D3AA 2VDGA 3H21A 4ZO9A 4RE4A 2WCXA 4DBSA 3R0KA 1N32J 1SH0A 4XG1A 2HHTA 3NOEA 5T9BG 2EPOA 2G41A 2XU2A 5C24A 5AVHA 1N48A 3U1MA 3BSAA 4DUTA 4DV5J 2GSJA 4QNWA 3R8GA 1TMJA 4ZFMA 5A94A 1F3WA 3ITHB 2Y8KA 3QGVA 2DNPA 3TZFA 1U22A 4BF7A 1RWVB 3QQ0A 1SKRA 3T81A 3EA3A 4Z1DA 2QYCA 3LM3A 1P48A 4F40A 1KM1A 1L6WA 3S7RA 5CQGA 3F44A 2DCUB 2O4QA 3LS9A 2B51A 1P0DA 4OJYA 4FYYB 2OMLA 3AIQA 1NJJA 1H7RA 1S48A 1UZHA 4HTJA 3BSGA 3FK4A 2YL8A 3MM5A 4AB4A 2CIMA 1L8NA 3BSNA 3W76A 4M5GA 4R3UA 3I4EA 1ICQA 4F4YA 3M41A 4XAGA 5KG2A 3OR2A 1NO8A 2J79A 1LXJA 2W62A 4HPHA 2QIFA 4PXBA 2I5GA 2R7TA 1LWCB 1Z1ZA 2AKWB 2A85A 4PULA 2DR6A 1N33J 3URQA 2ESCA 2PA3A 1OQ6A 2B7PA 1A5AA 5EUHA 3LPOA 1C1CA 4NZ7A 3VGFA 3HXMA 3IRWP 1X9WA 4GCXA 4UTUA 3M2VB 3ZVHA 1ZAWA 3IVTA 1UD6A 4J3TA 3T9ZA 1QR7A 4F4KA 5J2MB 3GXDA 5HINA 3AIEA 3ZJ6A 1A6LA 2IJFA 3PBGA 4RPFA 5FAJA 3NNAA 5F1UA 1BTMA 4RZ5A 3QYSA 1EARA 1NZ8A 5CJMA 2IRXA 1KKOA 3VM7A 3G86A 2R7XA 4HNCA 5A8WB 2ZXDA 5F9NA 4J9MA 2A7NA 2J8GA 3ZSSA 2VDIA 4S38A 3NCOA 1FWWA 1HI8A 1ZL1A 4GYKA 5KETA 3MMBA 4J4KA 1FFGB 1AH0A 3AZSA 2JF6A 5LIUX 4YY3F 4Q4SA 1E6QM 3WDOA 4DUWA 4DV3F 5H9EK 1ELSA 4DR3J 1FWTA 4J9UE 1FCAA 3ZNUA 4DL5A 3OTDA 4HR2A 4QWEA 2VFTA 3WKZA 2A79A 4NYUA 4EWJA 1TPEA 4Q2MA 3KBSA 7REQA 3CVKA 3SBMA 3W7CA 2OLSA 4YB7A 3QMTA 3QTPA 5D0HA 4TNOA 4ICLB 3PF3A 1K77A 3SO7A 1UKUA 2HFNA 4D6IA 3AROA 1PE1A 4WDWA 2AIRB 3LGEA 4JFUA 1AJ2A 2BXJA 4YFUA 3HV9A 2QR6A 1RACB 2AGQA 4LR7A 4JFWA 4J9OA 4GUJA 2RDWA 1NDKA 2DUZA 3WQEA 1SUXA 5BWAA 3UA3A 3ENVA 1OG6A 4K36A 3BOXA 3CUZA 3IGUA 3AY0A 1XDMA 3ZOAA 3UZZA 2YZRA 4C6QA 5CPNA 2H5IB 2R3VA 1XG4A 1XLDA 3H4GA 1E6RA 5CBIA 4RW9B 3CT7A 3M1VB 2OJ3A 2IBKA 2BSLA 1XCFA 2BJ7A 4RZBA 4DFJA 5G4DA 4WP8A 4B3SF 1V0KA 3BAKA 3BKFA 1W9DM 3NL0A 3OYZA 3BXWA 1VFHA 1M1HA 2H3DA 4R8UB 1GZGA 1MUWA 4BHYA 4HPGA 1NK5A 1FH7A 1CBGA 5CPTA 2PMZD 3H2CA 1JULA 4G1IA 3R8HA 3MDWA 4POCA 5DN1A 4MNKA 3U2CA 3SSRA 4K0KF 1REVA 4RE0A 2E6FA 3MW7A 5EBUA 1QUMA 1HQEB 3IR7B 3RXZA 1HNIA 3EGWB 4GLEA 3VAGA 2DPIA 4GGBA 3ME3A 4EF9A 3PJ9A 3QSYB 2E6DA 3SCKE 4FNUA 2AJ1A 2MZSA 4TYAA 3AICA 4EO6A 4LQ3A 1HGWA 1YBAA 2YBTA 1EFZA 1US0A 5HNRA 3SQOP 2F8HA 3CMAS 4F4XA 4DSLA 3VCCA 3ZTRA 2A7RA 3BWWA 1E6NA 1VEPA 3S6TA 3FZBA 4H9ZA 4UR9A 4AZBA 5EGRA 4NZ0A 3A8KA 3I65A 2DGWA 3A9IA 4XD3A 3I82A 3N14A 4O3PA 1GONA 1MVYA 2DZSA 3SDOA 5A2BA 3N19B 5LSMA 4FXWA 2PGWA 1M7XA 2I1RA 1MW2A 3QMSA 4DSIA 2KTQA 3T5HA 2ZUSA 4QITA 5E9AA 1VQ9S 1TL4A 2KXFA 2F5GA 1HNWF 4QQBA 2PBGA 2A5HA 1BRLA 4V15A 1D8YA 3CJ0A 2VHGA 3QQ1A 4LF7F 4C6OA 3AU2A 4D9PA 4WIQA 2BW2A 4NKCA 3MDFA 3PW7A 4ILMA 1U24A 4NLUA 3PY8A 3NTYA 4ZCMA 2CHNA 3GYEA 1JVNA 1S10A 4LQ1A 2WBRA 2QCEA 1LFWA 3OXGA 5DLGA 4LRDA 3Q86A 3T1GA 3WQ4A 1XR5A 3CGIA 1XLKA 2PGFA 4FPIA 4HH1A 4I2PB 1LFPA 4CGTA 1LCOA 2MXYA 1JR1A 3RM8A 4JTFA 3WH8A 5LIXX 1NH6A 4CCEA 1X4GA 4Z2KA 3NDYA 5J8LA 1A4LA 3K5XA 5AYXA 3M43A 2WVTA 2XGZA 2Y5EA 3EYPA 3W7QA 2MPUA 1T8EA 3FOKA 2KKHA 3LW5C 3W84A 3QNWB 1UKTA 4N7QA 1PS9A 3TTEA 1V7YA 4HNUA 4H6QA 1Q2RA 2QUNA 1FHLA 3TLLA 1TQXA 3WQOA 3D3FA 4F3HA 1PAEX 2IKGA 4NZCA 1Q0NA 3UDEA 5HMWA 4DX6A 5EFFA 1J01A 3FSYA 4K7QA 4AD6A 1YITS 3VIHA 4DF2A 2YB4A 4ZO8A 1NDYA 5FDLA 5D37A 5IZHA 1TIMA 1DJQA 4DYKA 2QCFA 5D38A 2O3DA 2OX4A 4PUOA 3VDAA 4XBJA 4WK9A 4DLGA 1LF1A 2PFDA 1SJBA 3G8SA 1EEPA 2DHGA 4RUAA 1XBVA 3C14B 1QTMA 4ATDA 2XMWA 2VX5A 5DDQC 3VAKA 3I4HX 4S3GA 3MWBA 3IRXB 2FZMA 1W7WA 2XULA 4RZ6A 4P71A 3IO1A 3L68A 3WNMA 3NXLA 3G71S 1T40A 3ZO9A 4NLSA 3NQEA 1ADOA 3A3HA 3CMQA 1YTYA 1BSLA 5GPRA 2Y7EA 2Y88A 3ABOA 3PRVA 1YBQB 1ZBWA 2ALDA 2P50A 4FX6M 3R5GA 3NMRA 2F63A 4USMA 1TL1A 4NXMJ 2H1YA 1WTBA 2M0GB 3O16A 2GVZB 2HPUA 4ZK7M 3BO3A 2HROA 4Q5VA 1LOUA 2PU1A 2H4WB 4M1KA 3MOZA 2HNEA 4WIIA 2ONEA 3SV4A 3WC0A 2ATLA 1HKKA 4G7FA 5DLCA 4WF9Q 1RHCA 5CAAA 3KMSA 4OZ2A 2XM1A 4GX8A 1X5OA 3RYSA 3IRSA 3DENA 2DY3A 1VOMA 3RX2A 2R91A 3SCVA 5AZ0A 1ZAHA 5KZMA 3NURA 3BEGB 3CDEA 2KXNB 3KK3A 1C8QA 3LCWA 4TMCA 3TZYA 1RTDA 3W25A 3L9CA 4W8AA 2CJKA 1R3TA 3UY7A 1ZZNA 1S9EB 3W8PA 2XJ7A 1FWRA 3VZZA 4QJ1A 4LUIA 1POJA 5A6JA 1EOKA 4AXIA 3EOSA 3WMCA 2Z4PA 3TUJC 3HHEA 1PG5B 3IM9A 5XIAA 4WJEA 5FACA 2P3ZA 2Z6JA 4DAFA 2ADBA 2IHR1 3QO9B 3O63A 4RDWA 4LFCF 4ZCLA 1NU5A 4XKYB 4BQ5A 5DFAA 1YHTA 3VHQA 3G1XA 2W8KA 4LF6J 2VGGA 4U95A 2G1DA 3V81A 3CUIA 2KH9A 3UZWA 3GW0A 1F6KA 3G2GA 4H2CA 1TKKA 4LSBA 4N77A 2R2SA 3DFEA 3U4FA 2XVGA 1HR0J 4Z2LA 4IT1A 3OXFA 4Y6IA 1PKMA 3O1NA 1VCFA 2QCLA 1VQ6S 2XUCA 3ZJ7A 1JPDX 1QDSA 3OVAA 1VIWA 5C2CA 1TB3A 3CV1A 2JK2A 1RT7A 4HA1A 3L4BC 4LRAA 4JX4A 3U48A 4EI2A 4IH6A 3QN3A 3OGRA 5HPOA 4A3UA 2CPJA 4KFBA 3BV4A 4LB4A 2ZDOA 3S2NA 2P3EA 5IDZA 2XIQA 3AUJA 1GMUA 2ADAA 4GC7A 1K0VA 4H01A 2QAFA 4M51A 1X4HA 1O5KA 4Y34A 3UCZP 3MP4A 1EJVC 3P5BP 3TW6A 4Q4KA 2D2JA 4WF7A 2D73A 1EIBA 3UWYA 2XMMA 3GDKA 1M53A 2OMOA 1U0SA 4AEEA 1EX5A 2GMLA 1W1PA 2FHJA 3URBA 2ZH4A 1FNXH 2FVPA 3Q0AA 1QSSA 1QK0A 5IXEA 2VUGA 3UESA 4LY8A 2DEPA 1JLFA 1KN6A 3LPGA 2ZWZA 4XDDA 2PMWA 1RWPB 3FFSA 1WKYA 4PUJA 1BKHA 2YNGB 3EXYA 2E9ZA 3UG5A 2XNRA 4X60A 2QDEA 5T41A 5IXUA 2D24A 3NWGA 1N0UA 2XSBA 3R1ZA 1ZBVA 1GOWA 1KFCA 4O18A 1XDLA 4RDYA 3BQ6A 1HJUA 1BYAA 4M6PA 1DIEA 2L48A 2Y2WA 4WSKA 2NSCA 1FOBA 3TSMA 2PB1A 3W38A 1Y7VA 2VRQA 2WW8A 3OFEA 1T7PA 2XGIA 4ZPCA 2JLFA 4G1KA 1RCOB 3N73A 3NNHA 4AX6A 3KWXA 4LF2A 3ID7A 1JLQA 1RJPA 2AZ1A 2A2IA 2FVQA 3LQGA 2MLZA 4IDKA 4N9CA 4BQ4A 2CUYA 3I3BA 3AXKA 4QG8A 5KFVA 1DQXA 2AL2A 4O4RA 3TNBA 1A5KC 3HG4A 5A8KB 3LAKA 1A0DA 1UBPC 3BLIA 3R25A 1KRAC 1Z69A 4LGXA 1S7HA 1QLNA 1BEUA 3KBVA 4HU8A 4AIEA 3KLFA 1UFLA 3W62A 1SPBP 1HKVA 4KIRA 1CI1A 2Y0FA 3W1MA 4C7GA 3AYSA 3R5DA 4C3MA 4E0DA 5CSYA 3TCSA 4UNKA 3R1HA 4YTQA 4FF4A 3RBEA 4Q4QA 1HQUA 1EKRA 4DZ6A 3N04A 1H61A 4ROPA 1S5MA 4TVUA 1X7FA 2VASA 3IAM9 3T6CA 3MM6A 3G87A 1TFYA 4UTHA 1QTWA 2XLJA 3QRHA 4DR7J 4ID5B 5L1IA 4ES3A 4INFA 2DIVA 1NSQA 3U1NA 4DSEA 2YPZA 1EYEA 5J2QB 4LFBF 3VQSA 5DGAA 5CG0A 2W79A 1ZJBA 2YJQA 3HMCA 3T2OA 2ZNZA 4ED6A 2IC3B 2DK2A 1KEKA 2VFDA 1S1RA 2MQLA 4FVMA 3KHLA 5LSOA 5JVLA 3P67A 2HS4A 1HPZA 5H1WA 1XRFA 1ZENA 3UD4P 1DYSA 3CAKA 1JMTA 5B0BA 2XVKA 3SUTA 3CCUS 1GKRA 2Y8VA 1QHZA 5KT2A 3AS1A 5CSSA 5JIPA 4Q8VA 3U1LA 1UKPA 1X39A 4F3OA 2X3DA 1O95A 1NELA 1Q6FA 1M41A 2V68A 4UZUA 4OIXA 2B0MA 2FPTA 3NQ2A 4WE1B 4J9LA 2VZTA 4GO8A 1SIWB 4D1IA 4FOUA 1FD2A 5K3VA 4H41A 4H9VA 4DLEA 1VK3A 3TQ1A 4ILSA 4JQ4A 2EGZA 1J79A 3L2IA 4ATWA 1L3VA 2BASA 3CCJS 3O3LA 3G1RA 1PO9A 2UUBF 2RRNA 2XMAA 4EK2A 1W8GA 1KM6A 3MMJA 2PDGA 4KGJA 3N29A 2TODA 2JHEA 2YY3A 5IS2A 1E51A 4EAMA 4I9MA 1KQGB 3QPEA 4J3ZA 4DMZA 2GUYA 1S72S 1PTAA 3RCYA 2JFKA 4W90B 5JXQA 1XWLA 1E71M 3CQ0A 2PODA 2GPTA 3BG3A 3AOFA 2K06A 1SJRA 2QAPA 3DDNA 3DU5A 1SH3A 4NCGA 1MYRA 4WWSA 5CEWA 1X4EA 1HA1A 3GDMA 3GWCA 3AUOA 3GC4A 4Y2MA 4N41A 3PWAA 2YPYA 4FOJA 1YE6A 3O5TB 1IQ8A 2DH2A 3CB3A 2QX0A 1RTJA 1SSGA 2YCLB 3EKZA 3C6UB 3DGBA 4XSMA 4PL1A 3IK4A 3RG6A 4GQRA 2EPNA 4FHAA 1ZPWX 2LECA 4JTGA 3WSUA 4UQEA 5LL6d 5A2QY 3NGSA 3CAWA 1Z3NA 2WBGA 2YXLA 1X5TA 4F3MA 4U7CA 3T44A 4F0LA 2IQDA 1J0ZA 2O4MA 2POTA 1JXJA 1CXEA 5HBMA 4NRUA 3GIPA 1T9XA 1FWFC 1OHLA 2YLAA 1GVRA 3H7UA 2FTYA 2AJ2A 3RMEA 3W7EA 2ZC4A 1GVYA 4HI1A 2PDKA 3PVXA 4DOZA 1C92A 3MMDA 1HIYA 3L7UA 1P4CA 2QA4G 1RQ0A 1V6YA 4NZFA 4M94A 3NRBA 1R2RA 2LP4A 4HCDA 4DSFA 3PX0A 1HJVA 3K4WA 3BGUA 3BMVA 1G01A 4OZNA 4XSLA 4GYJA 4J91A 1WG4A 2QLJB 2VPZB 2W9MA 3W2WB 2OYLA 1F76A 2CJ9A 4TY9A 4K4WA 2FC9A 3AHVA 2XEXA 4LMZA 4ONVA 4ILLA 2CG8A 4QDMA 3GAKA 1Q7ZA 4RE2A 1UD4A 4HTBA 3P81A 4K4YA 5LYRA 1FP8A 3L0GA 1RISA 4PA8A 4OMFG 2FLIA 5T7LA 4DR4J 3GNOA 3F0NA 2LXUA 3SUWA 1FERA 4JDYA 1JZ3A 1KONA 2J7EA 1UZ4A 3WH7A 2QULA 4XBKA 3DC8A 4HDGA 3AHTA 3W01A 4NCAA 1TPWA 1DIKA 5D4PA 3TZZA 2NUHA 3W2VB 4PEKA 4TR9A 4IH7A 4UOJA 3P5TL 4M5DA 2HBRB 2HNYA 4QIEA 3I55S 1UOZA 1QY7A 2WONA 2IYGA 4ZE5A 2QTWA 4HN8A 3WX8A 1KFBA 4EWTA 5CXTA 5LOQA 4KV8A 1M3UA 2YKOA 3M32A 4L75A 4M5PA 2WJZA 5CC6A 4YVPA 5AYYA 5JBFA 2MB0B 3H5XA 3MF5A 2HGMA 4XDCA 1HN1A 1C1BB 4I7FA 2BHUA 3R97A 3PO4A 2BMBA 2VV5A 2AJ4A 1YLVA 1TZ0A 2E3ZA 5B0DA 1TWWA 5KFOA 3U3HA 2E6YA 4P7QA 4GQQA 4OBTA 1FUYA 4DUVA 2VX4A 2HNDB 3EZOA 1K4HA 4ZJQA 5KOXA 3P84A 3QHOA 1S1VA 3UA4A 2WW5A 3K8LA 2VQUA 4O3QA 1Y0EA 2BRLA 2XFRA 4FX8A 5J1EB 3BO2A 3JQKA 3OR1A 3MEDA 2WHJA 2QA4S 4YR0A 3N3MA 3LP2B 5F8HA 2DHSA 3JQMA 1VKFA 4HCHA 5FSEC 4CO0A 2W9AA 1MEHA 3MKVA 3B8IA 3S4TA 2E40A 3HQOA 4FXDA 4AZCA 1U4BA 3RRGA 2GJLA 1RZMA 3DGRA 2GL5A 2G50A 3K2GA 4GQBA 4IPPA 4A2SA 4XV0A 4URIA 1MDRA 3WD1A 2XH4A 4YL2A 4MWAC 1CBKA 1NSAA 2V5BA 2EEYA 4R0JA 1J6PA 3PJWA 1GOMA 3AA8A 4DQIA 1RQBA 3KUHA 3K58A 1BLIA 2QGHA 4QWBA 1XR7A 2GWGA 4BEQA 4JY9A 8AT1B 4GXWA 4RZ4A 2DNHA 2XSAA 3EB2A 1AZSB 3EDKA 1PDZA 5KFYA 4JTJA 4LVDA 2VG6A 1XLEA 4XZLX 1B3XA 1OT2A 1ITQA 3DKLA 3MT1A 3VU2A 1H7OA 4TIMA 3HGSA 3CXOA 4PWDA 4DLMA 1Y5IB 1SB6A 1AZ1A 1DTQA 2PTYA 1SQ7A 4DPOA 5D4LA 2W91A 4PTXA 4CU7A 4YS1A 3WQ8A 2ZUMA 2IMRA 2VFEA 1ZSXA 3M8RA 1NUEA 3T40A 2GIRA 2OEKA 4PUUA 1SUQA 3SMZA 4WX2A 4WR3A 4PCQA 2V2HA 1WF2A 5LNSA 2W7PA 2BR0A 4LUSB 3C8YA 4MWAA 4E4UA 4AZ7A 3T0DA 2DDXA 4E2DA 3NO1A 5D05A 3EGZA 1VQLS 1ZP3A 4NLTA 4TX8A 1Q79A 4HU0A 2CDQA 2C91A 4M82A 2P5NA 3LBCA 3T55A 4WUIA 4CVWA 1WDWA 5BYRA 1XLHA 3FYPA 4KCTA 1VR6A 2IM1A 1EP1A 1D8ZA 3D1HA 2AKMA 3BBBA 1W17A 3VOIA 2QCCA 2CQ3A 4YP3A 2R42A 4UCGA 4HACA 4GBUA 4KGVB 3STEA 4JX5A 4AD5A 5G0RA 1N82A 1X4CA 3PB0A 4JQ1A 4EBEA 4JTEA 1JLGA 4ZBCA 2NQ9A 2I5IA 3UP8A 1OSDA 4FNTA 4DWIA 4J5NA 3IGNA 2Z0GA 3PCOB 3PW4A 1EUAA 3RPMA 3MD3A 2Z2YB 1KXVA 2Y1RI 3LCGA 4HD5A 3WLRA 2R7RA 1TVPA 1F07A 3SCQA 4CQAA 4Q0BB 4KGZB 1TTQA 3URNA 3V3WA 3CJPA 5D4OA 5C9RA 3BH6B 1Q6LA 1A50A 5L6UA 3MR7A 4LEFA 5LA1A 1NEEA 5A1AA 7ODCA 3GXMA 4OBSA 1L2QA 4M80A 3QMRA 5REQA 4XD5A 4YCPA 2W6RA 4IG0B 2NT0A 1A5BA 1RQHA 1SJ1A 1J4EA 1XSJA 2VQFJ 2CYGA 5K8NA 3THAA 5FL1A 2HVEA 1E4NA 2CLIA 4F67A 4R25A 2IM3A 5A0YB 3I3EA 2FDNA 1GVFA 4FP1A 4K8GA 4QWAA 1YDYA 3VGGA 3TA2A 3N2XA 3KJQB 3SQGA 4NX9A 5M5DA 4QCEA 1WX0A 3EB3A 3EWUA 1S0VA 1GVIA 1O66A 5A8PA 4LU0A 1NP2A 2ZM6J 4TVCA 1APSA 1E15A 3WH6A 3BS9A 2KM8C 3MCOA 1KGUA 1RWOB 2G3IA 3LHWA 1V02A 3KLGB 1E0VA 3TAOA 1ZLPA 2DIKA 1DTNA 1TV2A 3TAKA 2Z2LA 1A5LC 1P9QC 2ZADA 3MO7A 5KTQA 2YWHA 4CD4A 3MV11 1FVSA 4R27A 2OU4A 2ZEJA 1OSEA 4JI1J 1UR2A 2VC7A 4KO0B 2YNHA 1YKWA 3TRGA 5HP1B 2R1NA 4LF9F 3S6OA 2AQOA 1X4FA 2KJWA 3FA3A 3SECA 1KB3A 4OQJA 2VGIA 4HB7A 3PTKA 4UY85 3UNDA 3ISZA 4GH3A 1LW0A 3V6DA 2VR4A 1YE4A 4LAOA 2ZE2A 3RITA 2Z1WA 2AJ0A 1A3WA 4ERGA 1JCXA 1HF6A 2WMHA 2RRAA 2BY1A 2VCBA 5H2ZA 2YA1A 3E01A 3EXRA 3ABXA 1BQNB 3R5JB 2Z2UA 5CC7A 4F2UA 3DI0A 2DYAA 2ZRUA 3FNDA 3DM2A 1SJDA 4ZL1A 1MROA 3OJGA