3PJWA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, i23
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords Cyclic dimeric GMP binding protein
total genus 130
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjwA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjwA01
5KG4A 5HROB 1S1TA 4EO6A 4WE1B 3U2EA 3SFUA 5F9LA 3KK2B 2YKMA 5EWGA 5EDWA 4MFBB 4NLDA 4PQUA 4WZMA 4I7FB 4DL5A 5DGBA 1MU2B 2BE2B 2GC8A 5F8MA 4DEZA 3NBPA 4ED7A 2B6AB 4URGA 4KFBB 3GFZA 3TAMB 1S1UA 2O5DA 2YKNB 1JLGB 2WONA 4NLPA 4RW4B 3RAXA 1RYRA 4O3OA 3M9OB 2FLLA 2VG7B 4PWDB 3PW7A 1HNIA 3I0SB 3QGHA 1RA6A 2J6SA 4J9OA 3DM2A 3V81A 4EBEA 4ED2A 5F8NA 3MEEB 3DI6A 1RTJA 4YP3A 4EYHB 1S9EA 3MEGA 4DG1A 2YNHA 1RTHA 1W25A 1JLAA 4G3IA 5F8IA 4I2PB 1HMVA 2RF2A 3H40A 1JLGA 1T05B 3ITHB 3DYAB 1S9GA 2W8LA 1T3NA 2D3UA 1VRTA 3MEGB 4NLGA 2ZE2A 4F48A 4R0EA 4K4SA 2XC9A 5KFEA 1QAJA 4JV1A 5J2MA 4LYKA 2IC3B 3NKYA 2BQUA 5DQIA 4J9QA 2BQ3A 4RNHA 3Q8RB 2JLEA 4O4GA 1J5OB 2AGPA 4O3SA 4Y8EA 2GIRA 4O3NA 5F9NA 2R2UA 3QIDA 4RW8B 3G6VA 2VG5A 2HMIB 2ASJA 1RTJB 1NHUA 3GFYA 4O4GB 4IDKA 1RTDB 5FDLB 4IR1A 4DG1B 4KFBA 4ECWA 2IAJA 3QLHB 3NMAA 2BE2A 3KOAA 1HYSA 2OPRB 4IDKB 1VRTB 3G6YA 3DRRB 4TLRA 2YNIA 2FVQA 1S1UB 1TL1A 2YKNA 5L1KA 4ICLB 2RDJA 2WONB 2GIQA 5DLGA 3Q8SB 4O3RA 3LANA 3FQLA 3BR9A 3LAMA 3DMJB 3MEEA 2QV6A 3PR5B 1FKPA 1S9FA 4ZP9A 3DLEA 4KO0A 3MEDA 1IKVB 5KG7A 4RNIA 4NCGA 1KLMB 4RW6A 3V6DA 4ZHRB 2C2EA 2JEJA 4FBTA 4O3QA 4U6PA 3KHGA 3PJXA 4ZMMA 1IKVA 4WYLA 4R8UB 1RTHB 1XR6A 2FVSA 3IGVA 2OPPA 3GQCA 3OSPA 2I1RA 2VG6B 2HAIA 4URSA 4O3PA 4ICLA 4R5PA 5DQHA 5KFIA 3T5JA 4LQ9A 3KLGB 3E01B 4FS2A 3DLGB 2YKMB 3FDSA 3KLEB 3PJUA 5HBMA 3KHHA 5DGAA 1RT1A 4Q8FA 3H98A 1D1UA 2ZD1B 5KT3A 2FJXA 3I5BA 4NLWA 5KFOA 2JEGA 4Q0BB 1JLQA 2WHOA 2JC0A 3QYYA 3IG1A 1RT6A 5C42A 5J2PA 2QE5A 2W9CB 3QIPB 3H2LA 4TN2A 1JKHA 1C1CA 2UVRA 4U7CA 3GIMA 2YNIB 3QGIA 3BGRA 2AWZA 3MECB 3OSNA 4KBIA 3M9NB 4O4RA 3E51A 5KT2A 3T5KA 1RT7A 1S1WB 1VRUB 3DM2B 3BSNA 4Y9NA 1TKXA 3GV7B 3HKWA 5KFNA 2V4QA 3DMJA 3V81B 1HNIB 3I0SA 4MIBA 3KLHB 3GILA 1REVA 4RW7A 5HBMB 3H5UA 4G1QB 1IM4A 3SY8A 1HQUA 1GX6A 3CWJA 2DPIA 1BQMA 1TKTA 4IH7A 4I2PA 1T05A 1C0TB 3PFMA 2XI3A 2YNGB 5J2PB 4ECRA 4ZVFA 2B43A 3M9MB 5L1JA 3NBPB 3JSMB 4F4YA 2ATLA 4QWAA 1U09A 4K4ZA 5KFBA 1RT7B 1VRUA 2AGQA 2FVPA 2AX0A 1DTTA 2IM2A 2ILYA 3BGRB 5HP1A 3RB6A 1N6QB 4Y3CA 1HNVB 5KFPA 1ZTTA 4H54A 3KK1B 3MFHA 4EBDA 3TLQA 1TP7A 1S1VA 4RW7B 4ECQA 5KFKA 2ASLA 4ZVGA 2BR0A 1S0OA 5KFWA 3PW0A 3KK1A 2R6OA 3BSAA 5DQGA 1RT2B 2ZD1A 2IMWP 5CYMB 3GIJA 2R8KA 3LP0A 4DL7A 3C6TB 2D41A 4Y2AA 4KV8B 5KG1A 2R8JA 4RW4A 5KFMA 2JC1A 5D3GB 3GG0A 4B3OA 3CJ3A 2BRLA 3KMSA 3DLKB 3H5SA 4QW8A 4NZ0A 1YVFA 3HVTA 4MK7A 4XPCA 3KK3B 5L1LA 4DL6A 2UVVA 2HNZA 2WOMA 3LP1A 1C0UB 4RW9A 3FRZA 3RBEA 1LW0A 3BSOA 1I6JA 4H4MA 2CJQA 3CDEA 3T19A 5K14A 1RT2A 4MFBA 3MR6A 3MEDB 3PVXA 3DDKA 3KK2A 4IQXA 4PQUB 5CYMA 3V6HA 1S1TB 3Q8PB 1SH0A 2FJVA 4O44B 2VG6A 2VG5B 1LWEB 1N4LA 2YNGA 4F4ZA 2HMIA 5J2NB 5I3UA 4LQ3A 1JLEB 3ISNC 4B3OB 4IG0A 1LWFA 1BQNB 1K1QA 3UR0A 3DRRA 2I5JA 2OPRA 5HP1B 3LALA 4MK8A 3KHRA 1XR5A 3EZUA 1TV6B 2WTFA 1RTDA 3I5AA 4ZP7A 4KAIA 5JXSA 4FOKA 1JLCA 3PJTA 1HARA 4HJFA 5MKGB 4LSNA 5I3UB 5J2NA 1HQEB 5C24B 4EO8A 5J2QA 3IS9A 4ES4A 3TAMA 5KFLA 1RT4B 2WRMA 4QPXA 3KLFB 4TXSA 3UQSA 5J2MB 4Q45A 3GV5B 1NNDA 4JV2A 4NLRA 5KFTA 2E9ZA 4YR2A 1RA7A 5KG6A 5KG3A 2IJNA 3IN5A 4WXOA 1S0MA 2HNYB 1QE1A 3KLGA 1TKTB 3H4BA 1QAIA 3T5LA 4RW8A 5CYQB 1HQUB 2OPSB 1JLCB 1IKXB 4IG3A 3SFGA 4RNFA 4QWDA 1R0AA 2B6AA 2D7SA 4KB7A 3BQ2A 5KFJA 4I2QB 5KG5A 4ED1A 5F8GA 2BASA 4ECZA 1S6QA 2WCXA 3CJ0A 4J40A 3KZPA 1C1BB 3DOLA 3TQ1A 3LP2A 1OS5A 3RBDA 4URQU 1JLFA 3CJ5A 1IKYB 2W9CA 4TYBA 4KIEA 2OPQB 3GIKA 3JYTA 4MK9A 3GYNA 4NLQA 3RB3A 1LWCB 2C2DA 2IBKA 1IKXA 3UDLA 3PJWA 5EWFA 1DLOA 4TYAA 5C5JA 1JIHA 4ECSA 4ECXA 2RKIB 4NCGB 4K4VA 2XI2A 4ECVA 3C6TA 5KFRA 1S6QB 2W9AA 2EC0A 2AGOA 5DLFA 1RYSA 1DLOB 3NGDA 3G6XA 1JKHB 4WYWA 4XPEA 3BJYA 4Y9MA 3HV9A 4YQWA 4IR9A 5KT4A 4J9NA 2BQRA 2OPPB 1IKYA 1C0TA 4X2BA 2AX1A 2R8GA 3RAQA 1IKWA 4IFVA 4QWBA 4R8UA 2C28A 1D0EA 2E9RX 2IJFA 3CO9A 2V9WA 2IM0A 1TL1B 4NLOA 5KFGA 3OL6A 2R8IA 3MTKA 3GIIA 3HVWA 2C2RA 2W8KA 2FJWA 3LP1B 4WFXA 1DTTB 3I0RB 3PW5A 1N6QA 1WNEA 1SUQB 4J9SA 1FKPB 4ZPDA 3UPFA 3KMQA 4JV0A 1GX5A 3PW4A 4IG3B 2W9BB 1N5YB 2ZKUA 1HMVB 1NHVA 4QW9A 2FVRA 3N6NA 3QIPA 2RDIA 3V4IB 1JLAB 4DL2A 4IFVB 1JLEA 4HYKA 2ASDA 3M8PB 1KHVA 3N6LA 2XGPA 2FVCA 3M8QB 5T14A 2XCPA 3NAIA 4KSEB 4LSLB 4ZVEA 4FS1A 1S1WA 1FK9B 2I5JB 1TKXB 3I0RA 3N6MA 5DG9A 1RAJA 3FFIA 1S4FA 1EETA 1RTIA 2RKIA 2C22A 3GFXA 1C0UA 4RW9B 4RUAA 5KFCA 3OLBA 2W7OA 2R2RA 1BQMB 3KNAA 3KK3A 3ISND 4J9MA 1JLBB 4F4XA 4DL4A 1SV5B 1JLQB 2W27A 4NLSA 5C42B 4QWEA 4IOBA 4ZPBA 4F3HA 1S97A 5I42A 5HLFB 3M8QA 2ILZA 1RT4A 3KLFA 1RT5B 5L1IA 4J9LA 1S10A 3H5YA 5KT5A 1FKOB 1XR7A 3BQ1A 3MECA 2RF2B 4FOJA 1LWFB 5DG7A 2FLPA 4K50A 4TQRA 4TY9A 4XO0A 2IM1A 3DOKA 3MR3A 1R0AB 4HU3A 2DPJA 1S1VB 4TQSA 3CJ4A 2OPSA 3TVKA 3PW2A 2BRKA 2VA2A 4NLXA 4ZP8A 1RT3A 4Y34A 4ZPCA 5EUHA 4WE1A 3CVKA 2HNDB 2WB4A 4KHRA 3NL0A 4RW6B 3V6DB 4H4OA 5M1TA 3LAKA 1BQNA 1RT3B 5F8LA 4J9KA 5C25B 1TKZB 2BANB 2IA6A 3RB0A 3BREA 3DLKA 4NYZA 1LWCA 4WFZA 5J2QB 4Q8EA 3JYTB 5D3GA 3T1AA 5C25A 4GC6A 3MF5A 1RTIB 2HWIA 4KE5A 3PR4A 3KLEA 2AQ4A 4ECTA 3PZPA 1N48A 2FLNA 5K14B 3VQSA 4J9RA 4FBUA 4H4MB 2W7PA 4ED8A 4LJ3A 1K1SA 3IRXB 1T03B 4TY8B 3DRPB 3DRSA 4NRUA 3KLIB 5FDLA 5J1EA 4YR3A 4J9PA 2IM3A 5CYQA 1S9GB 4QWCA 4KKOA 1MMLA 1JLBA 3CJ2A 4IG0B 4M95A 3MFIA 4K4UA 2B5JB 3BQ0A 4WZQA 1S48A 4RNMA 4K4TA 1J5OA 1N56A 5KT6A 5HROA 2IC3A 1TL3B 2HWHA 4K4XA 4AFYA 5KG2A 5L9XA 1JX4A 1JXLA 3H5XA 4ECYA 4YR0A 4MIAA 3MR5A 4IRKA 3NAHA 3E01A 3SI8A 4IRDA 2UUWA 4Q44A 1TVRA 4IH5A 3V4IA 3HV8A 3HVAA 4KKOB 4LSNB 3MR2A 3CIZA 3PHEA 4ED0A 2UVUA 4WFYA 4IRCA 5J1EB 3DOLB 1HYSB 3BSCA 2IAJB 2BANA 4EBCA 1FK9A 3JSMA 4MH8A 4ZVHA 4PUOB 5KFQA 3IS9B 5KFFA 4HKQA 3QO9B 2UUTA 2J6UA 2VG7A 3Q8QB 3OL7A 3FSIA 1IKWB 3T5HA 3DLEB 4KO0B 1T94A 3FQKA 2YNHB 3CDWA 4YMEA 3DRSB 4NLUA 3D28A 4RU9A 4O44A 2J6TA 5KFYA 3IRXA 1T03A 4Y2CA 4TY8A 2XWYA 2ZE2B 1SUQA 4I7FA 4ZHRA 1MU2A 1KLMA 5KG0A 4RNJA 1C1BA 3ITHA 3QZ7A 5JUMA 1HQEA 5C24A 3KHLA 3OHAA 2B5JA 4PUOA 1RT5A 3I5CA 3GG1A 1C1CB 5KFHA 4RUCA 4Q43A 3QLHA 2W9BA 1N5YA 5KFDA 3KJVA 3S83A 2UVWA 2JEIA 3HVTB 5EWEA 2OPQA 4F50A 4IFYA 1JLFB 4ECUA 4M94A 4ZPAA 1EP4A 3KJVB 2HNYA 2R8HA 2R2SA 1DTQA 1LW2A 4ZP6A 2HNDA 4Y9PA 1EETB 1S49A 2ALZA 1LW0B 4GC7A 3FFIB 1C2PA 1EP4B 2R2TA 5KT7A 5KFZA 1UWBA 2WK4A 3CDUA 4I2QA 4Q6JA 1ZTWA 4MKAA 1LWEA 4K4YA 3D5MA 1TQLA 2F8EX 5KFAA 2XCAA 1S1XB 1TKZA 3GV8B 3DYAA 1SH2A 1UWBB 3QO9A 4EYIB 4K4WA 1ZETA 5KFXA 1QE1B 2YNFB 5F8HA 3QZ8A 1REVB 1Z4UA 1DTQB 4HU4A 1LW2B 2CKWA 3QGGA 4DL3A 4IH6A 3EPGA 4NLVA 1RDRA 1SV5A 2E9TA 1HPZA 3OL8A 3C6UB 3DOKB 5KFSA 3OL9A 4ID5A 1S0NA 3H59A 4FOUA 3LP2B 1S1XA 2XGQA 2V4RA 3C6UA 3IG1B 2V0NA 3KLVA 1TL3A 4OL8A 4LSLA 1CSJA 4H4OB 4NLTA 3M8PA 4PWDA 1RT1B 3EPIA 2YNFA 3OHBA 4MKBA 3DLGA 5KFVA 5DG8A 4RNOA 2HNZB 2WOMB 3IGNA 1KHWA 1TVRB 1HNVA 4ED3A 4IFYB 1RT6B 4F4WA 3N3TA 1S9EB 4ID5B 1S6PB 4Q0BA 5KFUA 4RNNA 1HPZB 4NRTA 4KHMA 3DI6B 2D3ZA 1TV6A 4JUZA 4RZRA 3G86A 5MF5A 3KLIA 4KV8A 4AG0A 3V6JA 4EEYA 3LP0B 3V6KA 3H4DA 1FKOA 5MKGA 4Y9OA 3HHKA 3OLAA 4NLYA 2JEFA 2VA3A 5F8JA 5I42B 5HLFA 4WXWA 4R5PB 2OH2A 4IKAA 4G1QA 2AU0A 1QUVA 3KLHA 3ICLA 1S6PA 3RB4A 3DRPA 1SH3A 4ED6A
chains in the Genus database with same CATH superfamily
1J0HA 5EMLA 2X7IA 3NM1A 4V27A 3PBWA 1OIMA 1X5OA 5EDWA 5ETLA 4NLDA 1CLKA 4KIRA 1KRBC 2RGMA 2GC8A 3QY7A 3W66A 3VE9A 1RCOB 4QQBA 3NO3A 3Q86A 4ETXA 1DWIM 2IXUA 1D3GA 2J7GA 4DN0A 2W2NP 3LCXA 3CB8A 4OJYA 2I2YA 2CESA 3MTJA 4UNIA 5DZ7A 4H6QA 3TZFA 1NF0A 5F8NA 4PR6A 4OJHA 3WMSA 1UQZA 3GCXP 2HHQA 4EX4A 4B3LA 1QO5A 3GVWA 2CVIA 3H40A 1NWUA 4L1XA 3SJNA 1F60B 3TWAA 1KRMA 1M65A 3IJ6A 2WMFA 1PJ9A 4M5KA 4J9QA 3PSVA 1PXGA 1H1NA 1S2VA 2ISSA 3RPMA 2HMIB 2MXYA 2BY0A 2NSOA 3GFYA 4W4MA 2FGOA 5HJLA 3PUGA 1KM0A 2VOMA 5KZEA 4KGVB 3PF3A 4N47A 3TA2A 1Q7QA 1HZYA 4Z0SA 2J9CA 2BJEA 2QA2A 4FLSA 3NDOA 5HOSA 3LM3A 4UQCA 4PEOA 4LB4A 3AD7C 3PKYA 2JF7A 1V0LA 4WOZA 4C97A 1ZRQA 1K3UA 1N32J 2Z2BA 1H3DA 2QV6A 3UCGA 3ZTOA 3KUGA 3MYOA 3MEDA 4KGMA 4NCGA 1S6UA 4B15A 2E5LF 2JEJA 4LFCJ 1JFHA 2HSAA 3CGIA 1X1NA 2CJXB 4ZMMA 3Q2TC 3QBUA 4QITA 3OSPA 4W8BA 4CCZA 2GLKA 3N17A 2HAIA 4URSA 2PRHA 3CNQP 3MHGA 4LQ9A 4UBPC 3E01B 3DLGB 2YKMB 1TFWA 2WVTA 4D8AA 1TZ9A 3ZIZA 4JI6F 1D1UA 4OOUA 1RABB 1R7IA 1LDCA 3PUOA 1Y4ZB 2YL8A 4JHOA 4AWSA 4JY8A 4G8TA 3QYYA 4A8YA 2HFOA 3BBFA 2A79A 4I5XA 1C1CA 5KOXA 3M30A 2AWZA 1SB6A 3BZGA 1GHSA 1YGYA 3P49B 3W83A 3S9YA 3KLHB 3A24A 1TKTA 2YPYA 5J2PB 1AZSA 3WK1A 2H4WB 3CLMA 2D1CA 1LJYA 2C0HA 4PUDA 3JW7A 4BI5A 3L4XA 4GQQA 4NRRA 3D1OA 5E5NA 1LFPA 2IS7A 2KG0A 3ZZ1A 4ROPA 4Z0JA 3W9HA 3TLQA 3M6UA 3GXPA 4CLSA 4RL1A 4X4QA 1S1VA 1X39A 5KFKA 3VAJA 5T8GA 3SIZA 2VQFJ 2YKPA 1FWKA 2BVDA 4I6YA 1IBLJ 4YVXA 1NK0A 3ARWA 3UY8A 1DWAM 2KU7A 3R9LA 4HN4A 1QWKA 2XVKA 2ISFA 3EZOA 3CXCR 2H9AA 4KBXA 3H5SA 1QK2A 4OI0A 5HR6A 1TVPA 3HVTA 4NZ0A 5A8PA 3ITGA 1GVFA 5C2CA 2YGYA 2UVVA 2JK2A 1R6YA 2KTQA 4FDFA 2DNPA 4PQUB 1YX2A 1NH8A 4U10A 3N2TA 2Y8UA 2DHAA 3ONBA 2Y0SD 1EJRC 4LQ3A 5A8WA 4FVMA 2QQ6A 4AZ6A 3VMOA 4DZHA 4J2MA 4DV5F 1XG3A 2E0PA 3VNLA 3DRRA 4QQ3A 3M43A 4BWLA 3TR5A 3UW1A 3I55S 1UC4A 3E5BA 2N7CA 1UVJA 2Y89A 2G50A 4CQCA 2VODA 2LU1A 3TJIA 3LF0A 2WTFA 1PG5B 3KVJA 4LBPA 2PAJA 4FOKA 3H23A 4H6KA 2X51A 4LSNA 4ZSUA 3G77A 1VI7A 1FFRA 1HHSA 4EO8A 4Q7BA 5A6PA 4UQ9A 1N8RT 5C54A 4C6QA 5J2MB 3LTYA 4PUJA 1TFYA 4K3ZA 1NNDA 3HLUA 3FN9A 1FFWB 3SYZA 1SU5A 4TU1A 2PGCA 4E8DA 2VBZA 1CLVA 1QE1A 2XY6A 2A0NA 1ZM2A 4RW8A 2P0IA 5KMYA 3O3LA 3HZ3A 1FWRA 3PSWA 2XFYA 3WQPA 3EVWA 4IMEA 4YIWA 1R8CA 1FKWA 4YVPA 1KXVA 3NOYA 5JIPA 4DHVA 3I4KA 3PYDA 1NU4A 2YY3A 1FCBA 3W5XA 3W6YA 1J96A 3W2WB 3IK4A 4G6VB 4K4VA 4IICA 2W9AA 5AHFA 1IEVA 4QU7A 2GQCA 2GGHA 3HV9A 1IXNA 3L4UA 5KT4A 4MF4A 2AMGA 1IKYA 1C0TA 2R8GA 6FDRA 2XSAA 3D4JA 4C90A 3A3NB 3LV5A 3SMZA 4YVVA 4Z2IA 4J7CA 2Q8ZA 3UZWA 3UJ2A 4YB1P 3MAAA 2IBOA 4WGXA 3N11A 4RL3A 1JRCA 2A3EA 4EP8C 2V9KA 1B3YA 3BYPA 4PTVA 2DUZA 2BDPA 3SGUA 2ZKUA 1D8WA 1RR2A 1AZ1A 3H2CA 2XSFA 4YEAA 1VK8A 2RQCA 3N6LA 2WSCC 4ZOSA 3G1RA 3UG3A 5DG9A 4MB1A 2RDWA 1A53A 3MAHA 4NXSA 1UZ4A 5CC5A 3PULA 3UN2A 2EG8A 1DHKA 3THQA 2GJ2A 2TYSA 2DRBA 1OX4B 3UF9A 4A8MP 4HB7A 3P8IA 2PSNA 1T40A 2J13A 2BWGA 8RUCA 3O2IA 1HD1A 1XIMA 3NA8A 1LL7A 5DG7A 1IXKA 3W02A 3FAWA 4LF4J 3HT0A 1LUCA 1VKFA 1QNRA 4GINA 1Z42A 3R25A 4DX3A 4GRSA 3CCZA 5DT7A 3NL0A 4JZ5A 1OSCA 5LZLA 1HL9A 3LERA 3C66A 1BQNA 1C90A 1AXQA 3QBCA 4USMA 3L3CA 3E5PA 4I68A 4KCTA 1V6YA 1TCMA 3DRYA 3T1AA 1JQVA 5FIIA 4GC6A 4YN3B 3DG6A 3HA1A 4RU2A 3K8LA 4TY8B 1SZEA 4NRUA 2IIHA 4V15A 4M51A 2VFDA 4G9PA 3CJ2A 4NXMJ 3TNOA 1FRKA 2DKOB 3BQ0A 2D2GA 2DRDA 1UHVA 2WBRA 3M6DA 4DAIA 4CM2A 4L6V3 1U2RA 1JXLA 2I6WA 4AWEA 3DH7A 4MIAA 3GDRA 2YDRA 3NAHA 5CJNA 3PZQA 4FEZA 4FAMA 3GK0A 4LSNB 5J1EB 3TV8A 3VGDA 3TAKA 4EBCA 3W64A 4X9SA 2JFDA 1POKA 1YEYA 4DBUA 3FEXB 2UUTA 3HF5A 3KTSA 3BPWA 1UTAA 4P2FA 2OWCA 3F2BA 1PL9A 2GVJA 4MFDA 3POHA 5KTQA 1XS2A 3FKRA 2Q43A 3M0XA 4YMEA 1WKFA 4NLUA 1V6VA 5KFYA 2WM0A 4H9VA 1KLMA 3KHLA 3CW2C 3ITHA 4GH3A 4DV0F 4JI2J 1RT5A 4RUCA 3QLHA 4M6QA 5HVGA 2OD4A 5EFFA 4LRFA 2Q71A 4NYUA 3HI9A 5FESA 1GMVA 2LMIA 1XUUA 3T42A 1XERA 1WEZA 4HTYA 2HNDA 3HO1A 2YVSA 2XHYA 2B4OA 3MURP 3EYZA 4C4WA 4DUXA 2XYHB 1YJVA 1OGSA 4G1KA 3LPYA 2ACMA 3NQ6A 2JIEA 3MI6A 2F8EX 1OC7A 1TKZA 2DGUA 2XYGB 4CNZA 4HU4A 5DX7A 1Q8LA 7TAAA 5E33A 2MHEA 4OX6A 4UNKA 1PYFA 5CPQA 1R6VA 3F1QA 1NIUA 3N6HA 1UD2A 3M0KA 3VF0B 2V4JB 2B31A 4DV5J 4OJGA 1MROB 3W74A 1XG4A 4PA8A 3IG1B 5I0DA 4W85A 3PNIA 4ZE5A 3W7GA 2PI4A 3CWNA 4CNYA 1OG0A 3UXIA 2IDLA 1HW6A 4DXVA 2BXVA 3OW1A 4R25A 3ZZOA 3EMCA 2HRYA 2PDKA 3G8TA 2X05A 4QE5A 2OTDA 5JBEA 4CNTA 1U6BA 1H98A 3TOYA 4LANA 2JHEA 2H3DA 5HMWA 1FTCA 4NCAA 1FDYA 4MVAA 4ORIA 1BHNA 4Z08A 4Y9OA 3BR8A 2VQFF 1FA0A 2HLUA 3O44A 3O0FA 4IKAA 4K38A 3IJLA 2Y1LB 3S9ZA 1XNQF 2TPSA 1H61A 3IAPA 1QM9A 4C0OC 3UZXA 1KD1T 1X5PA 3VE7A 3S1GA 4AZCB 3GVQA 2QCMA 3W1RA 3W1MA 4IPLA 4ZVPB 1RYRA 1Q2SA 1HFEL 1SL1A 3M9OB 2FLLA 4GVLA 1K6AA 3CH9A 1R5YA 4FF7A 2D24A 4NI3A 1QUPA 3MEEB 1HG3A 3NWRA 4B4HA 1NJWA 3MCMA 2BFGA 4G3IA 2LVWA 1NOUA 1MDRA 4J3UA 2PF8A 1HMVA 2QFJA 4DO5A 3WF4A 1XDLA 3HSZA 5LKYA 3HU7A 4PXEA 1U1JA 1MWQA 4D6DA 1XBVA 2UY2A 1K44A 4N9DA 2EG6A 1U48A 4GGHA 3VOIA 3CQKA 2VG5A 2ASJA 5J1PA 5AHLA 4U33A 3H55A 5FDLB 4DG1B 2HHUA 3OG2A 4K5SA 3FNDA 4H3DA 4K8RA 1N36J 1AFJA 2RIJA 1NDYA 4FF3A 1BWVA 2ALDA 2C3UA 1GKRA 1HJSA 1VFFA 2JVOA 3NR0A 4ICLB 4S1FA 2EO7A 3PS7A 3UD3P 4W7UA 2WBGA 3MDUA 1FWJC 2VONA 5FJOA 1WORA 1UH4A 1TRDA 5FI8A 1RY0A 1QD1A 4J3VA 4R8UB 4IX2A 2OMAA 2I1RA 2B7OA 5K8MA 2FYMA 1HWUA 3OTDA 5A1AA 3VWSA 3TW7A 4KCUA 3KLGB 1WYIA 2BM0A 3PZTA 3GXDA 3KLEB 1WG4A 4HHUA 2VX6A 4NZ7A 2FTYA 4GUJA 4H9UA 3CIVA 1AW2A 2JC0A 4AZCA 3A47A 2HXUA 4QR1A 4ZKAA 1OYBA 3T05A 2G0WA 4IQDA 4N6EA 5EPDA 3BGRA 2EQDA 2X7VA 3VAHA 1SL2A 3DFTA 1VRUB 5GAEI 3CMAS 2OYMA 1MW7A 3OJSA 6AT1B 2VJXA 4CWBA 2HGLA 1VBUA 4Z2XA 1RAHB 4F3QA 2QIIA 3PO4A 1T05A 3B9EA 1KFCA 1Y8BA 4DNHA 1DXEA 1ZGDA 4DJBA 1F6PA 2ATLA 4QWAA 1R47A 3PIOQ 4IMDA 3U2ZA 4ADTA 3BGRB 1FI4A 4BFAA 3WQ4A 4L9XA 4BKNA 1J2VA 1GORA 1RVGA 4KRUA 3HJFA 4TIMA 3W88A 4R85A 4ZVGA 4CEUC 1L3UA 3FNNA 3FS2A 5DQGA 2P10A 4LUJA 1SMDA 4KWSA 4NXMF 3WL0A 2E1DA 3NSXA 1BD0A 2D73A 4W8LA 1G0CA 3KMSA 2LA4A 3DLKB 1DJGA 1C4AA 4ZVSB 2E29A 5L1LA 4DQIA 4OX9J 3AQPA 4XZWA 3NQBA 3UBPC 3T19A 3QPEA 2YWHA 4Z1CA 2VZOA 3Q8PB 3WKZA 4DLMA 2XYPB 1P9YA 1CLXA 2BGQA 1HWLA 2Y85A 3GVGA 4PG6A 3L4YA 2ZH2A 3GDBA 3PACA 3PDNA 3DRXA 1PZ3A 5LSOA 1NJZA 1FWHC 3G1SA 1AQ0A 2HVDA 4W7VA 4PB4A 4PMXA 4LUTB 3VO0A 1HNZJ 4A8FA 1P7TA 1FFGB 3Q8YA 3TJXA 1VGYA 1QW7A 2CQ3A 2Z4PA 2KXNB 4ES4A 2DORA 2RUSA 4Q45A 5K9FA 4QJ1A 3HG5A 2CXEA 2LQ8A 2OEJA 1S79A 1UJQA 5B0GA 2HVEA 2ZBCA 2CU0A 1L6SA 4IGNA 4CH7A 1VFTA 4IG3A 2YKKA 1WBHA 3W7QA 3GC4A 1RU1A 4X62F 1N55A 1QR7A 3RPTA 4TVUA 3BQ2A 2NXHA 3R0DA 1IBKJ 4ECLA 2ZJRQ 2VOOA 1YSJA 4WKAA 1UAWA 1PS9A 2X1SA 4Y6IA 2IQTA 3SUVA 3WY1A 3UQNA 2L3MA 3HJVA 1Z48A 1DE6A 3VYLA 4K0KJ 1IWGA 2V82A 2UY4A 1ITCA 1S6QB 1TKKA 1Z9AA 1F5CA 3NGUA 4WP8A 1E55A 1R7OA 4OU1A 3NL3A 4MNKA 4J9NA 2E6AA 1V79A 1K8ZA 3RAQA 2C28A 5BRPA 1WAUA 3FXGA 3OVPA 3TYTA 3QGVA 4Y6GA 3TJAA 4LW7A 4L56A 1NPPA 7AT1B 1KD0A 3KTCA 1F9EB 4LH8A 4J9SA 1Q63A 2QDDA 3OR1B 2V2QA 5CYJA 3P3DA 3PY8A 2W9BB 4C7QA 5IM0A 1NHVA 2F8QA 1R9ZA 1GK8A 4D6GA 1JLEA 2VFVA 2VVSA 4IGMA 5D9OA 1KTBA 5K7JA 1KHVA 1RHRB 2F1FA 3M8PB 5CH7B 2XCPA 2UXDJ 4AD3A 3ZTQA 4P6QA 4KGKA 2KXHA 5A0YA 3B0XA 2OEKA 1RAJA 3FFIA 3EZ4A 4MWAC 2Q79A 3GSIA 4OI1A 1FP9A 3OZOA 5FF0A 1UFLA 3LCHA 3HPAA 1JLQB 5C42B 1ZBCA 4QDWA 3C2OA 1B99A 1F3TA 1S7HA 3M8QA 4HPGA 4FP9A 1RT4A 1LCOA 2C2MB 3B4MA 3KLFA 4XB3A 7XIMA 3AROA 1RHUB 2ZH8A 3MECA 4HMEA 2C71A 2WV8A 4BK9A 3HG3A 1P5BA 3TRGA 4B9TA 3AIUA 3DOKA 2BJ3A 3GXIA 1TMQA 2FDSA 3W65A 4D9PA 1Y11A 4K68A 1H74A 1IEIA 3IJQA 4M5PA 3ET6B 1IQZA 3NCOA 3TVAA 3CJQA 1DIOA 4KESA 5BWFA 4I3GA 2NWSA 1UWIA 4AYSA 2QNEA 2HBQB 3G8QA 1TKDA 1FWBC 4GKKF 1NXIA 1O5XA 2PMHA 4U95A 3VX1A 3LRLA 3PTDA 4LCQA 4ZVQB 2XO7A 3UCQA 3RLHA 2AQ4A 1MYRA 1Z2ZA 4LNCA 4H4MB 1TPB1 3DRPB 2VQEJ 2JEQA 4X4NA 5FDLA 2I17A 1A4MA 1JLBA 2DSVA 2UXDF 3QAEA 1T7LA 1X4AA 3VVGA 1L0PA 3BTNA 1S48A 1W2PA 2V3FA 3H53A 3WNKA 2QL9B 1JNEA 3U4FA 2C3MA 1U47A 4GYPA 4O50A 4LPCA 3TC6A 2OT1A 1VQPS 3MCSA 1U1LA 3FGCA 4X66J 3E01A 4NA3A 1UEKA 1E3XA 2ANUA 3IBFB 4AC1X 4ED0A 4DJFD 2FJDB 1K70A 3WJZA 1US0A 3LGEA 5F2LA 3MMCA 1BXBA 3GDKA 1WB0A 4ML4A 4CCDA 4XZMX 3RFAA 2J7UA 2M0GB 4V2XA 1JUKA 3IS9B 5KFFA 4HKQA 3PWGA 3R0KA 2D3LA 3VGHA 5L8RC 3B97A 1A5BA 4ZZ9A 4UTFA 1CI1A 1D9EA 4H41A 4DB7A 3AISA 4AEOA 6PTDA 4WKRA 2J24A 4D6IA 2E25A 4P7NA 4IOCQ 4J9JA 1XEZA 2DVIA 3E0IA 3KP1A 4XO6A 2MLZA 4I7FA 2WBMA 2B81A 3CHEA 2OEMA 3SADA 4OGZA 2B5JA 4ZXOA 1KM6A 4O8RA 1WEYA 1B90A 2DZUA 3S1UA 3GLJA 5KFDA 2UVWA 4IFOA 3R7BB 4BZYA 2RHGA 2XM2A 4X84A 4GFIA 1PSCA 2Z1VA 3SSSA 3QPZA 5E1QA 3PO5A 4HOWA 1P6TA 4GIYA 5CPMA 1HR0J 1CW2A 3WJSA 3WO8A 1FJEB 4IJRA 5CEWA 1OFQA 3AY0A 4J3TA 4WFAQ 3BJSA 4GNKB 3R27A 4EYIB 1XQKA 4XQ6A 1DAXA 1EEXA 3KFWX 4Q5VA 3IWNC 1V6UA 2YBUA 4GISA 2WZ1A 3C4UA 3NEKA 4LR9A 4DCPB 1CGXA 1S38A 1DBDA 1HPZA 4WK1A 3OL8A 3M7SA 5JUVA 4ZK7M 2BUNA 3NGSA 1C7SA 1DFDA 4HCHA 3RMJA 4W98A 2V0NA 2AJ0A 4TU8A 1IZKA 1CC8A 3X1LB 1KGUA 2YH1A 3W27A 1RT1B 2K1RB 2G3JA 3BUVA 5EBUA 4D1JA 2L9DA 3IGNA 1KLZA 2NZCA 4FYWB 3EMTA 1CXEA 3SBMA 3GKFA 4Q8PA 1YADA 3NYZA 3T08A 3SZ8A 2YA0A 2DJWA 1FH8A 1KFEA 1PPIA 1NJXA 2V5JA 2OGUA 3POCA 4OZOA 3CUZA 4UTLA 2OH2A 3KYLA 3VCNA 3KLHA 3TE9A 1A49A 5FEZA 5I3GA 1SR9A 4NL5A 4N42A 3QVQA 3G9CA 2GJPA 3TUJC 3R58A 1KM5A 4MFBB 3B8IA 1ZNNA 1N5QA 5F8MA 4DEZA 3S5SA 2HK1A 1DJQA 4AZGA 4AF0A 1NM2A 2VUYA 3D3BJ 1NTHA 1JLGB 2A3BA 1CJUA 4Z2KA 5BOFA 1Q8JA 3BDEA 3KUEA 4TMCA 3GSMA 3TJLA 2W4PA 4AX7A 5FAJA 3ZC4A 2YCIX 3W07A 3T2QA 2GA7A 5EX3A 1CLFA 1U5VA 4JDYA 1RTJA 5HQEA 3J80U 3AXIA 4JQ4A 2YNHA 4QOTA 2AKMA 2RF2A 2A21A 2D2JA 3EKGA 3VTRA 4E2DA 3RN6A 2ZE2A 4K4SA 2W92A 3PEJA 2Z1XA 4IH3A 3IWLA 4IFKA 2W61A 4RZ5A 4LR8A 1O68A 4O4GA 1KM1A 1ADSA 2B0GA 5HMEA 1HNWJ 4O1FA 3H2MA 1BXCA 1RTJB 4NX5A 1FERA 1P0NA 2G4BA 4ZIWA 3CAWA 4UMBA 2F7VA 1BWKA 1SL0A 3KL3A 4DNMA 3DRRB 4GQGA 4TLRA 2IMOA 3QQ1A 2HPMA 3W7LA 3QT7A 1C7TA 2VENA 3ZR6A 3BURA 4A6GA 3OIXA 2ZVRA 1OFOA 1Q6LA 2CKRA 1B3XA 3W26A 4HDGA 1HNYA 1M3UA 3WL1A 3AFGA 2BP1A 4IPJA 2E6DA 4DUYF 1BQGA 2BXZA 3IFEA 1N8FA 1HR0F 1MUWA 1WHYA 1QI4A 4QSHA 3IR6B 1KN6A 2JGYA 1QPNA 1GYMA 4OJ3A 1FDDA 3K5OA 4ZJQA 4MY8A 3KHHA 1WC5A 4ZCKA 1JB0C 1TELA 1N5VA 3M4XA 4JTGA 5BXRA 5JVHQ 2GL5A 3MUAA 2QE5A 4HNCA 3KXQA 4IJCA 5DMYA 4UF4A 3MTWA 3QHNA 3MM5B 2CVEA 4V19X 1EJ7L 3W8GA 1J79A 1I2PA 3UR5A 4O11A 4HTJA 2KX9A 1KNZA 4N6FA 3SRHA 3H7UA 4PTWA 4ZVFA 5DBTA 2B9WA 2PDWA 2PUZA 4CLUA 2QAPA 2W63A 2DNQA 1NJIT 4K4ZA 5KFBA 3BAXA 4RJEA 2AGQA 5EA9A 3BLEA 3P0XA 3VNKA 3J7HA 5M17A 4CTAB 2CPZA 1ESWA 3MI2A 3ZJ6A 4OLOA 4QJ3B 4NF7A 4ADUA 3FEYB 3S2NA 3W28A 4F0HA 4B91A 4X2PA 2ASLA 2V67A 3PW0A 1XIFA 2XH2A 4RLEA 2QX0A 3E2VA 4BI7A 3GNRA 1SJFA 3LP0A 3RG6A 3Q45A 2Z28A 1XHGA 2I5GA 3AODA 3CJ3A 3RGTA 1VQ5S 3EKZA 4JBCA 3LOUA 3TC7A 4JI8F 6REQB 4Q8TA 4RW9A 2QUMA 1QPQA 2CJQA 3HPOA 4WY0A 3MSDA 1IXQA 3Q23A 4O16A 4CVWA 1JIBA 2DH2A 1V3IA 3CK5A 2ZM6F 3TA9A 5J2NB 1HWKA 2ZBRA 4LF5F 4OHQA 3FEMA 3PG9A 4F9DA 3E1F1 4C1LA 2OPRA 1NY1A 3HIJA 2XWXA 4OYOA 4C7FA 1FHDA 3T1GA 3ALFA 2J7KA 3EE3A 2F6XA 3UESA 1JJCB 2YW4A 2FZ9A 4UFLA 1IZCA 5I3UB 2O01C 1UR2A 2J78A 2EPNA 2GVEA 3M2UB 1XGZA 3GUWA 2GCFA 3JQKA 2HHTA 3I87A 5DF0A 1G4PA 2ESCA 3TLLA 4ILLA 2AF6A 2BDQA 1GZ1A 1SO6A 1WHXA 4O12A 4FZVA 3H4BA 1JD9A 3CIMA 4UIOA 1R0AA 5A5WA 4W87A 2ZUNA 4EANA 1U8WA 2W67A 3BL3A 4R3UA 6ALDA 1WG5A 3RW6A 4PYSA 3HZGA 4J40A 2NQLA 1C1BB 3KOZA 4JI2F 4DV0J 1TAQA 3QSYB 3BCJA 3QWUA 4JTJA 1GOKA 2VCAA 3WQ6A 4KW2A 4Y9AA 5F0UA 2BVWA 2MJNA 1JCYA 2RKIB 3ATYA 3JAMU 1CJVB 2XI2A 2PPGA 1F3XA 5CCMA 1HJWA 4J9VA 1JKHB 1M01A 1VYRA 4LTSA 1E0VA 3PUEA 3LWMA 1FEHA 2JKEA 4DUZJ 5M2RA 3AHTA 3UDCA 4FI4A 3K2GA 1EJWC 2QUTA 1P6WA 2G3IA 1T9YA 4NQ1A 2AAAA 2J75A 2WVUA 3L2LA 4EACA 3PW5A 3TUIC 3NGRA 2QXWA 3M0JA 3QOKA 4HYWA 5I02A 4BA0A 3UPFA 1WACA 4JYAF 2CQ1A 4KWVA 4QW9A 1UZDA 1O8BA 3N18A 2DK2A 3QY8A 2Y7DA 4Q32A 3ID7A 4FN5A 2R7SA 1OC5A 3TNVA 2GSJA 3NAIA 1IBKF 4BEUA 2G37A 4O0KA 4R9XA 1L2UA 5E93A 1S1WA 3I82A 1AW0A 3VGSA 3EXCX 3RYSA 4G5DA 1W32A 4DWSB 1NDPA 2CLIA 2INEA 3MGJA 2R2RA 1I94J 3KK3A 1JLBB 4JICA 4MLRA 2QJJA 3R43A 3TIMA 4UUWA 1WNOA 4ATWA 1FKOB 5KT5A 4AXIA 3NGFA 2FKPA 1BWLA 3DKJA 2B9YA 4NJIA 3TANA 1ODZA 5HNTA 4RKUC 1HNZF 3EXRA 2ZWZA 3IJ8A 2ZNYA 2YPIA 5LXRA 1SVDA 3VOCA 3NGJA 1SQGA 3W7HA 4G1PA 3CTLA 3IMQJ 3GNNA 1AL8A 3HOJA 2PFDA 2J88A 3DYMA 2HXTA 4XUGA 1LFWA 2IA6A 2OTLS 3WH5A 1FH9A 1NSPA 2RDTA 4JNMA 5D3GA 3FK4A 4CO0A 3MF5A 4GA8A 1GHRA 3FKBA 4NJJA 3A9BA 3E0FA 4K5RA 1TTPA 5AC8A 1E6QM 4UQAA 2P0OA 3DN5A 5HUPA 1HNXJ 5EMKA 2DT3A 1MMLA 2ADAA 3CMFA 1TG7A 3U2OA 3MFIA 4XIMA 1U0SA 1BVZA 5ETTA 3GMGA 5H9FK 2TMDA 5AYXA 4K4XA 3UN3A 5IT9U 4ZOBA 2ZTJA 1BQCA 1RQHA 4Y90A 2A3AA 3N28A 3VNJA 5ADZA 5AZ1A 3TZYA 3LV6A 1F3WA 1F05A 3MR2A 2PSZA 4LUBA 3LBOA 1Q7ZA 5D2YA 2YFNA 1NUEA 3BO2A 2MUCA 4MIWA 3QO9B 2PDNA 3T9ZA 3CV6A 4YOEA 5A69A 3K5PA 3EVMA 3UWEA 2L5HA 4WX2A 3FQKA 4IFKB 5EX0A 3I56S 1PWLA 5GNZA 3VMNA 3N4WA 1TMJA 2P6TA 4RNJA 4PYDA 2HPUA 1MNSA 2CKSA 2QLFB 4XK2A 5AC7A 5E0OA 1MZRA 3OZMA 3RZAA 3UFYA 4OI4A 2ASHA 4ZPAA 2VGIA 1NJJA 1YITS 4JX6A 4ZP6A 3II1A 2OGJA 1VJQA 3L95X 1KRCC 3QV8A 3LSBA 1C2PA 1MLAA 4GKJJ 1GZGA 1E4MM 4Q6JA 4XTIA 3CZGA 4A46A 4ZE4A 5A2CA 2HHSA 2FZKB 1SH2A 1BGXT 3UE2A 2V8GA 1PDYA 4P8UA 1RBAA 3QO9A 4P73A 4XZBA 4M80A 4YL2A 1GAOA 3WUBA 3IEBA 2GQ2A 3QR3A 2ASYA 1TMMA 2IDEA 3KDOA 4IH6A 1UR3M 2D3NA 4CI0B 4L6HA 1QTMA 3HD2A 3H2FA 4ID5A 1S0NA 1J6PA 4W88A 4F4AA 1ITXA 3UI3A 2DZVA 2ERRA 4TO8A 4KCWA 1N36F 2MGZB 3NO5A 1HHTP 2CNLB 1KFLA 1R31A 1KKHA 2ZBIA 2D2OA 5BXPA 3B03A 3UD6A 3M0VA 4V1YA 4ELVA 2VELA 4FMVA 2XVLA 4BC9A 2W66A 1X4FA 3MUTP 5BYSA 4L72B 1S6PB 4B3RJ 1X7VA 5LA0A 3UZYA 5EN1A 4DR5F 1XMOJ 3BH4A 1OD8A 3CTTA 4J35A 1WDWA 3H7RA 3F0NA 3S6EA 3OZPA 4DR7F 2VA3A 2L41A 5HLFA 3G8SA 1ISXA 2X30A 4LS0A 5LIUX 1Q53A 2DGSA 1GOQA 3ICLA 4MNJA 1E9IA 2RU3A 4CIOA 1Z32X 3AUJA 1MNZA 2FZDA 1H49A 2XVNA 3AMLA 1MN9A 3MEKA 1KR1A 1MU2B 2H3BA 3GW0A 3TYDA 4DWSC 5HMFA 3NBPA 1XC4A 3DOMA 2UU9J 2HS0A 5IFPA 2QKFA 5FJIA 2PGRA 2DHXA 2VPXB 1VYPX 4NLPA 4UUXA 3BBBA 1VAHA 2W4XA 3S1TA 1BG4A 4B5VA 5LGZA 4CH0S 2EHHA 2X40A 4DF0A 1WHWA 3O8WA 4H00A 3BARA 3GZ7A 2LQ9A 2EKNA 1ZS6A 2EJAA 3DNCA 3RU8X 2E6FA 3DI6A 4NMLA 4GNJA 5F41A 3TQEA 1HTIA 3GU0A 3MM8A 1FHLA 3MMTA 2UV8G 5ETPA 1JPHA 2WSYA 1YRTA 1OABA 4NLGA 4O10A 4M1BA 1KKRA 3WEMA 2Y88A 2RT3A 1QAJA 2OHDA 1RWWB 1SJQA 3UJSA 1PGZA 4LYKA 3A13A 1G1YA 1R8BA 3AD8C 4TNOA 4CH1A 1U45A 4HQVA 1J5OB 3E0VA 2JGQA 2DXFA 4O3SA 3DLLQ 3FX4A 3V5RA 1MO0A 1OF6A 2QZRA 3U48A 3VIFA 2V8HA 3GD6A 3P45B 1NKBA 2IUZA 3F03K 5D8WA 1P7TB 5DDRC 3EWXA 4IR1A 2HMCA 3O07A 4M56A 1PYTA 1UUQA 2QCNA 5D09A 1ZFJA 5EBAA 3LHTA 1UPMB 3QGKC 1EOKA 4OUEA 3L2MA 4QNEA 1E1CA 1MNEA 4NSBA 2FVQA 1XI3A 4BHQA 4A8LA 4O3RA 2PDQA 4NAEB 5HWMA 2V8ZA 3VTIA 2DY3A 4IT1A 2PF0A 4ZP9A 4RE4A 2GHVC 1VJZA 1PKUA 4O3QA 3KHGA 3Q8VA 1FWGC 4UCFA 4P75A 3FKKA 2AZ3A 3OBEA 5HANA 1VYAA 2GK1A 1Q6CA 1XR6A 4DUWA 2GPTA 3T6JA 1AZ2A 1PAMA 4TTGA 4AL7A 1YMYA 3H2EA 1JMTA 4XV0A 4NKCA 3QSIA 4ANEA 1WDDA 1VQTA 1XRTA 4DPWA 5A6LA 4FB7A 4OMFG 1JLQA 3E9AA 4LYPA 1ICQA 3X3UA 4A8OA 1W1YA 4GIRA 1RT6A 3M0ZA 2YKQA 4LRTA 3MM9B 2W9CB 1NK4A 1F6TA 1JKHA 2AZ1A 4DX8H 1J5EF 5T9BG 4U7CA 4KBIA 4CRJA 3LHVA 3HHNB 4ERIA 3QSTA 3V3WA 1FY6A 2GO9A 4Y9NA 4LS1A 3D67A 1UQYA 3GVVA 3DM2B 5KFNA 5G1MA 2V4QA 2HQIA 2JKPA 4P7OA 1KFJA 1SKWA 1JNDA 2ISDA 1IM4A 1K9FA 3N04A 5I6SA 5GVQA 3PR2A 4U9RA 2FQQB 1S5NA 3ALGA 3PFMA 1S5TA 2GX8A 3M9MB 4RZ4A 2OLAA 2GQ3A 4DY1A 2YZRA 3GXFA 1QI0A 1T9WA 2DHHA 2F4VF 3EDEA 4CO5A 3LCFA 3NQEA 4HCDA 3GKAA 1M5SA 3DU0A 5SWUA 4RW7B 1H3GA 2RJZA 1AJZA 1AYEA 3FY1A 4PUMA 4K1GA 2BNJA 3W82A 1RT2B 3A4TA 1M5VC 5CYMB 4P52A 4W84A 4KV8B 5JU6A 5D15A 4TV6A 2AL1A 2PC4A 3L4VA 3HHLC 4HZMA 4QIEA 4B2DD 3FBFA 2WYSA 1EP3A 4PMQA 5IFMA 1LQ9A 2PA6A 4PMDA 4Q33A 3L7OA 2P3EA 3CV7A 3R5EA 3ULHA 4KJIA 1IWAA 5U4NA 2CBVA 3DDKA 3KK2A 1PKYA 3LUYA 4ILMA 1XPGA 3I7RA 3VKKA 2DY1A 2WQDA 1ZPTA 4DSKA 2E8ZA 4O44B 4ZTYA 3D3AA 1G7VA 3UR0A 1FJGJ 2XMJA 4PBFA 1JJ2R 1VYSX 2I5JA 3OTCA 5HP1B 2W5FA 1Q78A 2AL2A 5BMXA 1GKPA 3VIOA 3KBWA 5A76A 2X2GA 2R7WA 3T1HJ 1CPUA 3CCWA 3WC0A 2C42A 1RWXB 1SFSA 3OQ2A 1DJYA 2E9LA 4IQMA 1ONEA 2GGPA 2R91A 4B3TF 1QBAA 4C3KA 5IXEA 4W86A 3RRAA 3I31A 2OXNA 4WXOA 3EX1A 3KLGA 3GJTB 5CYQB 1TZZA 2PB1A 1JLCB 1IKXB 1BG9A 2QV4A 2B6AA 4PB3A 4KB7A 3DFSA 1P1MA 2VFEA 4I8DA 1IT7A 1OZQA 4DLEA 1OK6A 3IK2A 2HEKA 3LPEA 1UASA 2M3DA 3MS8A 4WF7A 1W1VA 2F8HA 2R7QA 2Z57B 3A8IA 3PRVA 4L76A 4NAEA 4JIPA 3T2PA 5I78A 1HN1A 1RZMA 1CGUA 1X5TA 4NCGB 1S72S 4JTKA 2FZGB 2L9WA 3L68A 2RDXA 3LBCA 4GG9A 4DJDC 1BWEA 1L3KA 1OD0A 4MFEA 3QQCD 1X6LA 1NSJA 4IGHA 1ZZNA 2ABAA 4Q4KA 3R79A 2A7RA 7CGTA 3OLEA 4GBUA 3N4AA 1WNEA 2WSPA 1N5TA 2A6OA 3BM7A 4JTFA 2EBEA 1UA0A 1HJVA 3OVSA 2M88A 1CXHA 3QIPA 1DHMA 1IQTA 4WFBQ 4LT6A 4YY3J 1CQNA 3TCEA 4QYRA 1E9LA 4DJFC 5A8MA 1OY0A 3SCNA 2HJPA 1HJUA 3SECA 1RKIA 5AJ3F 2CXGA 2DNHA 2F6KA 4DL4A 1N7KA 1SV5B 2I1OA 2GZOA 4QWEA 4FX7A 2MLXA 2BBFA 1M7PA 1VQLS 4Z2JA 3AS2A 5GPRA 1OFBA 2I0XA 1XR7A 3W7JA 3EA1A 3UGVA 3SCVA 3TYEA 1SC4B 1T9TA 4B9SA 1OC6A 3H2UB 2DV0A 1ZAWA 4PRWA 6TIMA 2FMOA 3IA0A 2VZ9A 1JDDA 2AQVA 1P1XA 5HMZA 3W9IA 1P0BA 1UD3A 4KWOA 4EWTA 3HHDA 3VAIA 1U8SA 5BU9A 2J0XA 2ACUA 3QZ6A 4EE9A 3SRDA 3UZZA 3O15A 2HFZA 3DG7A 4L1WA 8A3HA 1KQGB 4I7VA 2J8TA 4MDPA 3W9JA 1GW9A 2JL9A 4CCHA 4CQAA 2WLZA 3VQSA 3WBZA 1X60A 1K1SA 4GIAA 5T7LA 2CZEA 2PWVA 2WZEA 4DHGA 3KLIB 4YS2A 1VQ6S 3WLJA 2WPBA 2WOQA 3FA4A 4A8WA 2DH3A 2EKCA 4DYEA 2FZCB 4DV7J 1EX1A 4FF1A 2Q3OA 2J9DE 3BAIA 5KT6A 5HK4A 5B7ZA 1E72M 5GVJA 2KL8A 2WMKA 3H2NA 4YN5A 1VRDA 3V0SA 4Q44A 2NT1A 3HVAA 3BBCA 3P6LA 3KL0A 4RDVA 2AEFA 4ZFMA 2ZH7A 5G1TA 5A2QU 1P48A 2VDHA 2JX2A 1TJ0A 4QDMA 3T09A 2CBIA 2Y8YA 1SKRA 2J6VA 3R8YA 2CLPA 2GVZB 1EC7A 3GTYX 4QP0A 4WDXA 3ZZZA 2Q8XA 1HIYA 3DLEB 1G1XA 1F5ZA 4M63A 2YNHB 4YDDB 4OE7A 5C5YA 3QR0A 2ZH9A 1UR0A 3T9PA 2VFHA 1J6OA 1SUQA 1VP5A 2QLYA 2Z2UA 3QGPA 4UMAA 2BKOA 4QIUA 1Q81T 4O0NA 4R34A 3FW6A 2CQ2A 2ZRYA 1VIXA 1AVAA 4DM1A 2YB1A 4F50A 4NNBA 1F9HA 4JI6J 1JYWA 4AY1A 3R89A 3USBA 1DTQA 3ITYA 4Y9PA 2M4MA 1X1OA 2RQMA 3BXWA 2WB1D 2O55A 2E5GA 5KFAA 5CJ5A 1ZBVA 3G22A 4LFCF 1ZTVA 3E74A 1V3LA 4PEEA 1UP0A 2K3KA 4DL3A 4FS9A 1D2KA 3VXGA 4MKVA 2DGXA 2Z0GA 1UP3A 3IBCB 3U4AA 4HOZA 4J37A 3KBNA 2RQ4A 3L9ZA 3MJYA 4AHQA 5KFSA 1MEWA 4FF2A 4FOUA 1PUDA 3LCIA 1WXZA 3W73A 3CCQS 1L3VA 4EPBC 1V3ZA 3ILIA 3VKJA 1BYAA 3RR7A 2QUNA 1XYLA 4CDIA 3EPIA 1H6KX 1TV4A 2QV5A 2PIIA 1TVRB 4WD0A 2A3CA 2BS9A 2FC9A 4KT2A 3W25A 4K39A 1UD5A 2J25A 5CZSA 4ZEPA 5AXMA 3T6CA 2MY7A 3DESA 3JVAA 1Q4NX 4UTIA 3LN3A 4IP4A 4UQGA 2PFHA 5DFAA 1FE4A 1VRQC 4B02A 1N8IA 2DZSA 2FJKA 3MDFA 2L08A 2NVCA 3B9NA 2Y61A 3WHIA 3BGAA 4YCPA 1MWOA 4PCPA 2TRSA 4ICMA 4MY9A 4PTXA 3KJQB 4LIWA 4JV5F 1LRTA 1YXDA 5G2WA 4IG2A 5AE1A 3L0GA 1YDYA 3PX4A 1OZMA 4PCSA 2B6AB 3OJGA 5LSLA 3WQDA 1A5LC 4MAVA 4NCBA 2XG9A 2E6YA 4RZBA 2O5DA 4S3CA 4K36A 4AH7A 1WC3A 2WONA 4O3OA 3U6WA 3WC2A 2WKJA 1O6XA 1RK8A 2VRKA 2WZHA 2CBJA 4DJDA 1UEUA 2PLJA 4F67A 1H11A 2R3VA 1VOMA 2CQPA 4I2PB 2ZRVA 1LRNA 2W8LA 1XD1A 4F48A 3SGZA 1XLLA 1BLUA 3LGHA 3A8EA 4H2CA 1W3LA 3E0WA 2EFNA 1VGAA 4AT1B 3F5LA 3FCHA 1MFVA 4M0XA 3CCVS 5ETQA 4D72A 4JFVA 3GC2A 4ZJLA 4GI9A 3W1AA 3W1UA 1X0PA 1C4CA 3TVZA 2ICSA 5FSDC 2DITA 4IIFA 4QX4A 1DXFA 5HVFA 3QRRA 1F8MA 3G6LA 3GH4A 2PT0A 4F79A 1NBEB 1VISA 2KT3A 2X41A 3TQPA 1PBGA 5DO8A 3LBMA 4A3HA 2XMMA 1SSGA 3PZGA 3WDIA 3R12A 4WIIA 4ZHRB 2WM1A 4CT9A 4ASTA 5IXUA 3N0VA 1DJ0A 1Z7AA 3FA3A 4NRSA 6XIAA 4QSFA 1JDEA 3HQOA 2J8SA 1JYVA 3T1YJ 3GP9A 2LEBA 4XTTA 4F0LA 5LXYA 4K8EA 3ARXA 2P2CB 4F02A 4OKDA 3KJFB 2PZ0A 1B0IA 4USKA 4DR6F 2BOAA 4QNWA 2EPOA 4GXPA 5F2GA 1K47A 3OSNA 4NZ3A 3E51A 2E67A 3KG1A 4JD4A 1RT7A 5J5DA 1SBRA 1R9YA 3BQ5A 1K77A 3K8MA 1N88A 2FQIA 1XYBA 2UUAJ 1DWFM 4TVAB 1D8CA 4HTBA 4G56A 1YNQA 3LLDA 4FALA 2G95A 1VIWA 2HS8A 5FA5A 4N4QA 4WVXA 5G4HC 3CUHA 1WUUA 1DTTA 3M30B 3CMGA 5HP1A 4M7SA 2Z24A 4U2YA 5C9ZA 1OX5A 1UZ1A 1AFIA 5KFPA 3BLFA 1ZTTA 4H54A 1D9DA 3OFFA 3EX2A 1TP7A 3L23A 1D3CA 1Y0HA 4DPXA 2CJ9A 3OW2R 3MMAB 2R6OA 2EPIA 3B9OA 1I3OB 3IS4A 2HHXA 3T81A 1EIYB 1NEYA 3WLPA 3NQMA 3M8RA 1T5AA 1FJCA 4O0IA 3GG0A 5H8PA 2HHVA 2CLHA 3U7BA 3KWMA 1GVYA 1YJWS 2VJVA 4ZO8A 1BXNA 1KTVA 2W2QP 3IUHA 4H4MA 3BSOA 5K14A 2YX0A 2F8MA 3MEDB 4Y28C 1FWWA 3OFEA 3PX0A 4P7LA 5F4WA 2FJVA 1F73A 2XG8A 4XZLX 4RV3A 3ZXWA 4B3OB 1MMNA 1A5AA 4V28A 3C56A 4WCJA 3OTRA 4O54A 4IG0A 1S46A 3SCKE 3AHXA 4ILSA 1FESA 4WF9Q 3DIPA 2A2DA 2YWKA 5MLCV 2DUAA 3W37A 3VIPA 4HOXA 1WKEA 1O5RA 4M5MA 3FFSA 5CPTA 4M8UA 3I5AA 4ZP7A 1RP9A 2XFWA 3NZ1A 5MKGB 1QDSA 2VGGA 2QSWA 5J2QA 2QJ3A 2GUYA 2YLAA 2UUCJ 3CD6S 3HHLB 5KETA 3P5TL 5T9CE 1GVOA 3BLDA 3WNPA 2GVYA 5KG6A 3PKMA 3CT2A 3A4AA 2O9OA 3T55A 4OVXA 4XBSA 2OPSB 2W01A 2VDIA 4AAJA 4RNFA 4C6AA 4QWDA 3LWLA 4HT5A 1QTNB 3MUIA 2KT5A 2DT9A 3C2YA 1VLWA 1FKXA 1GNXA 3ARRA 4D71A 2ZC3A 1YQHA 4JL1A 1WSRA 5GMKa 3W71A 1RWUA 3L7UA 3GYNA 1ZZFA 1AW1A 2IBKA 1KP6A 4X64F 2N3OA 2ACRA 4O8AA 4ZB0A 2A4AA 4M6PA 1WDTA 2J9DA 4S2CA 2R7VA 2QAFA 4WKYA 3C0JA 1F61A 4X4RA 1LOQA 1V6WA 5FF2A 5AVNA 1UUMA 2J7BA 4FXVA 2RDDA 1ZCCA 2PBGA 2OPPB 4H01A 2D3O1 3RILA 3LMYA 1T3OA 3CHVA 3WEOA 4AEFA 4DCOB 1SIWB 2IM0A 1H09A 1OQFA 3GIIA 1BD6A 5E3CA 1YE4A 1WDPA 3SY1A 3N9UC 4RDYA 3RF9A 2V5KA 4A3QA 4I67A 1J5TA 4LVAA 4CD5A 4X65F 3FJLA 2DVXA 3V4IB 3VD3A 1K8CA 4IFVB 1UKTA 3WN6A 2ZH1A 1UJ5A 3DOMB 4CO4A 3B4YA 3NL2A 4LSZB 1TKXB 1B3ZA 1T8XA 3AIBA 1TQXA 3A8KA 3R1ZA 1S4FA 2V63A 2HTMA 3NXFA 3BB5A 3CQHA 4DSJA 3CXOA 5K8OA 3CJPA 4QCLA 4S2BA 2AMXA 5DM7Q 3MANA 4WTOB 5L1IA 2GAHC 2RKXA 1UMJA 3QH2A 4LF7F 5LNWA 4FXWA 3DXIA 1B3WA 4OT7A 2K2PA 4BCEA 1GQEA 2OPSA 3E6EA 5KZMA 3PW2A 3MM6A 3CMQA 8XIAA 4RXFA 2OZ8A 2QCDB 2X42A 1ZBKA 2QN6B 3APGA 4H83A 5LJ3Y 1M41A 1VLOA 3W2KA 1VHIA 3GNDA 4GVBA 2PTZA 1UOZA 3R2DJ 4J4KA 1O51A 4QHRA 3MKVA 3ITOA 1TJRA 1J5SA 4DFJA 2QJIA 4ADSA 2X0HA 4BF7A 4XG1A 3VZZA 4ECTA 4ED8A 2XGIA 1EGMA 3IRXB 2AYMA 1LEOA 2CCRA 1UA3A 1OPZA 4KGJA 2KRRA 3DFPA 4EK2A 1PIGA 4HTIA 4GO9A 2IM3A 3SQSA 1SQEA 1F74A 1TYGA 3OXGA 2RJGA 2MKYA 1BYDA 4WZQA 1E40A 3A5VA 2CLOA 1P6BA 1PYOB 4UZCA 2V8VA 1L3TA 1E6SM 3CDAA 5GMEA 2MY8A 2IVYA 4OYMA 3LCLA 1T96A 4RDZA 3QKEA 2ZHBA 3ICJA 4REQA 4ES2A 3BE7A 4KH0B 4IRCA 1F4HA 2H8ZA 2P9CA 4AIBA 1XFBA 3CD7A 4WFYA 2BW7A 2WHLA 2EBNA 2R82A 3JQJA 1GXUA 1JPMA 1A9NB 1KLNA 3JB9k 3WQ8A 2GAGC 4UFKA 4A8RA 3K8WA 5CLWA 2J6UA 4P74A 1BAGA 1E71M 3P61A 1IKWB 2VV5A 3ZNJ1 4P2SA 2VX4A 3O6YX 2HQCA 3EA2A 2PD1A 3DRSB 4RU9A 4P61A 1Y3JA 3KOYA 4FYVB 3W76A 2PE4A 4ICCX 5JUMA 1HQEA 3M6YA 3J81Y 4PMJA 2QL5B 1KWKA 1TVLA 3ATZA 1I1WA 2VFRA 2W24A 2C0AA 3WUEA 4ALZA 1MW2A 4ZQMA 2XM3A 1X38A 2UBPC 4CQ8A 2R2SA 4JEJA 4JYEA 1N54B 1EETB 2G5WA 4DQRA 4FF4A 2DH7A 4K2XA 2WK4A 2XU2A 5KSWA 2NXJA 4C5ZA 3LDVA 2FGBA 4DLGA 1FVQA 1SJ1A 3BGFA 1FWLA 3T41A 3MW7A 2IPWA 4D3HA 1FRMA 2YNFB 4Y0FA 5TF0A 2RNEA 2C8NA 1ZJAA 2VC1A 1X4GA 4W9TA 1QFEA 1VQMS 5XIMA 3ADAC 3SDEB 3VVUA 2WVVA 4OHVA 3VKBA 4LQ1A 1S2AA 1N52B 2PDAA 1DWJM 4ORMA 3LP2B 4L5ZA 4DF1A 2KZHA 4OECA 3F5JA 3IARA 4DPPA 2R9RA 4G65A 2J7EA 4Q2LA 1R38A 2PU0A 4NX0A 3RK8A 1JJHA 3GB6A 2CJAA 4HD5A 3FGCB 3N3TA 3A3PB 2H6RA 4O1DA 1W9PA 3CO0P 4AG0A 3NCPA 4EEYA 3N12A 3LP0B 4UTKA 2E09A 3K30A 2Z56B 4O4WA 4CU7A 1XGEA 1WKKA 3P8BB 1B64A 1W1PA 1FDNA 3V5FA 5LJ5Y 3AAMA 1TPC1 1SH3A 2IJRA 3ZLGA 1S1TA 3U2EA 1G69A 5ECUA 1KFBA 3C2PA 2YKMA 4R7JA 2J0SD 3DI0A 4DPOA 1J10A 2LP4A 2BJ8A 2GGJA 2A1BA 3K1DA 4OI6A 3W0KA 2HFUA 1PTDA 4HHMA 2XNQA 1MSSA 1XYCA 3BGJA 1QT1A 5I3DA 1U30A 5D9MA 2F40A 3PHTA 2W4DA 4CCEA 1VCVA 1WE5A 3GAKA 2J6SA 1PIEA 1YTDA 4USJC 4KGLA 5BROA 2ZITA 3FEZA 1ZP4A 3MMAA 5I03A 1QOQA 3CT7A 4NZCA 5IV3A 2WAQD 1K9EA 1OPIA 1RWNB 4B9YA 1Y7PA 2J9EA 3QRHA 1T3NA 3FCPA 1RP5A 3AJ1A 4TMBA 5JIWA 4DYKA 3SDOA 1XBWA 4H6EA 4ELTA 5E9AA 2U1AA 1AL7A 5EMUA 1DARA 4EGLA 3JSRA 2M8DB 4ED5A 2R2UA 4KEUA 4WXZA 1WKYA 2OB3A 3K4WA 3MHUA 1X4HA 1HKWA 3T1YF 3URAA 4O4GB 2FJEB 4IDKA 2DB1A 2PEHA 1FDBA 1MN7A 4GKTA 1WWHA 3XIMA 3K5NA 1TUWA 3NMAA 4UW2A 1UP2A 4YWSA 4IDKB 1HQTA 4QJ5B 2WSEC 3CL7A 1ZA2B 1CDGA 5FEPA 4FXSA 3KRBA 2O92A 5JVLA 3OTEA 2CLFA 2CPYA 3BKTA 4DWIA 5DN1A 4LFYA 5IOBA 3F4CA 5KG7A 3G96A 2GDUA 1TR1A 2LA6A 1F6KA 1KLMB 3NNAA 4RW6A 3ZYZA 2JH3A 2Y6ZA 4FKXA 3MYPA 1XLIA 1FX2A 1QY7A 4KYZA 1NJYA 1YDLA 2PBOA 3S8SA 3TOQA 4Q8NA 3E8OA 4ICLA 4DV2J 3PB2A 3SFWA 1TUVA 1VHCA 3DHPA 4HSHA 2VC0A 3MMDA 4G1NA 4DSFA 1HWJA 3L7PA 1YIXA 4LVGA 5HBMA 5DGAA 3CQIA 3ARYA 1A5NC 1XRVA 1CPZA 4JNZA 2FJXA 2G3MA 2OZTA 1DQUA 3CQJA 1APSA 1XWLA 4ELUA 1GTHA 4O28A 1FNXH 1W3TA 3E96A 2XFRA 4MM1A 4P8VA 1R2TA 1LL6A 1W31A 1UVMA 1GYNA 3R8HA 5K9CA 3K5XA 1SJBA 1LWJA 3BCDA 1TWIA 2OKQA 9RUBA 2G1HA 3PZMA 3HKWA 2YLLA 4ATDA 1QSLA 3CWJA 2P9GA 2CWNA 2RILA 4JCLA 1VF8A 1C0TB 2Z2LA 1TZ7A 3URBA 4ECRA 1HBNA 3BKFA 3EAUA 5GAGU 1BTMA 3MPUB 2KH9A 3AO0A 2J7CA 4YXGA 5LMUF 2ONEA 3UERA 1JQXA 1VFHA 3RR1A 3LI1A 4H4KA 3EEGA 3KK1B 1TV8A 4AMAA 5DBUA 3W2LA 3VOHA 2C3YA 4F0MA 5HAOA 2PFFB 3SAZA 4ZO9A 3R7MA 3FBBA 3C6TB 3NFUA 2AKZA 3UR2A 4O14A 1A0DA 1ECQA 4AY7A 3EOSA 4DSIA 3NQAA 5K4XA 1NQKA 4LBIA 3PAJA 3GBDA 5DANA 2XY5A 2XZ7A 1U6ZA 2GJNA 2VZVA 3TSMA 3MR6A 1E15A 3H24A 4MFBA 1C9WA 3PVXA 1UD6A 2YYTA 1CT5A 3D0CA 2Z8QA 4N8NA 3RLUA 2DFAA 3CPRA 3HQNA 2JKAA 4UOFA 1TU0B 4C8KA 1IJEB 1QVFR 3W60A 1YXYA 1BVWA 3ISNC 1BQNB 1Q82T 5IC4B 2Q66A 5HR7A 4TU7A 3M41A 1CS4B 1SFJA 2GVZA 1UKUA 2GJLA 1B3VA 4K8HA 3W6MA 1TPH1 3WD2A 1F07A 4XAKA 1VB9A 4ILRA 3WQCA 3ZOAA 3MSYA 1VBRA 1SZRA 2C1HA 5B0DA 1GUVA 1HQEB 4OZ2A 3WQOA 3WK2A 2BSLA 2WPGA 2GWGA 4J1OA 2O7QA 2E9ZA 3UWZA 4NA2A 4C48A 4PXDA 1XYMA 1Y5VA 5A8RB 1YJ7A 3I68A 4WJEA 2GW8A 3RTVA 3LYEA 1HHQA 4OZ5A 4HMDA 3OR1A 1VQ4S 2XHWA 3NNCA 3H12A 4HI1A 1IYXA 5AC5A 4DOZA 4TYBA 1RWOB 3JYTA 4RPFA 4MK9A 2ZOXA 3VD7A 3BSHA 3GNPA 1XIQA 1K73T 1KLYA 5EWFA 1P0DA 1Q8KA 4U7UD 1ZOTA 2AEMA 4DX6A 3D0HE 3AQUA 3K4AA 1LWHA 3N4FA 4QIWD 2VXNA 4N56A 4IR9A 2CZ9A 4UMCA 2CWXA 4NT0A 4PWWA 1SJ4P 1KCLA 2GK1B 3KS6A 3NYDA 2ZRWA 2W62A 9CGTA 3RW7A 5AKQA 5JJBA 3MP3A 3DLJA 1B0PA 4J3ZA 4O53A 4UFJA 1IR0A 1SUQB 5I79A 1ELSA 3KMQA 3T40A 4KETA 1FT8A 3LNMA 2FVRA 3EB4A 1K8XA 4DL2A 1M5KC 4FYXB 3QR1A 4GYPC 1XSKA 1SYTA 2YFOA 2H65B 4WHBA 5C9WA 2PTXA 2CQCA 3ZFVA 1XC9A 1LORA 1TWWA 3RX3A 3VZHA 4FS1A 3WMBA 1FK9B 1KDNA 2BZNA 2QT3A 3CT9A 1QLNA 2DNZA 3OJUA 4GZJA 4HVZA 1LLZA 3OLBA 2CZFA 1VLYA 3BKUA 3THCA 4NLSA 2J0WA 2YBVA 1R2RA 2KJWA 2MKJA 4YDXA 1VQ7S 1K9MT 1CNVA 3PFEA 4DX7A 3N6QA 2GNKA 3BMWA 4E8CA 2FZNA 2UWFA 4DVOA 4KEZA 3AJ2A 4K50A 3CASA 4JI0F 2WVBA 5DELA 3GE7A 2ZXAA 4N9BA 3V35A 2QCFA 2VA2A 1W8SA 1WTBA 1SSDA 4NZFA 1RT3A 3DHXA 3WMCA 2OLHA 4PCNA 4P2MA 3PYEA 4GJIA 3LXAA 1S12A 2XEXA 3ILJA 3G4SS 2O9RA 5DLCA 5F8LA 3J7Z5 1WF1A 3B8HA 4J9KA 4HYRA 3L4WA 4JI1J 3DLKA 1LWCA 3QPIA 4Q8EA 4TTUA 1E43A 3OEXA 4U67Q 3JYTB 4KR0B 4ZIVA 1R3VA 3ECQA 4N7QA 1RTIB 3G6ES 4J5NA 1J0KA 2WZIA 4FIRA 3ET6A 4YY3F 5J04A 2OSXA 2WC4A 3L5AA 4JCMA 1PIIA 1O1ZA 4KKOA 2ZFHA 2WSQA 4WJXA 1PKLA 1PCWA 1W9VA 3C14A 4DS5A 2CJBA 4GHRA 4U28A 1JZ4A 2B5JB 1CVJA 4PQAA 3WLSA 4GD0A 1YBQB 3N9RA 4Z2LA 3UPMA 2O66A 1FHVA 3HM7A 1ZAVA 3U5UA 5FJPA 3S47A 1X9WA 2QVHA 3JSYA 5H9FJ 3OB8A 2UUWA 1WF0A 4C65A 5EMJA 1NDZA 3SSRA 3QHOA 2NQJA 3GIQA 4W89A 1DQ8A 4Q4SA 2XIOA 3IM9A 3CBWA 1UW9A 4V1XA 5GAGI 2XMWA 2Z2ZA 1S5VA 4I8YA 2WMIA 2P53A 4KO0B 4PRTA 4XZIA 3D28A 4PSRA 4ZN3A 2OELA 4O44A 3H20A 2EG2A 2J6TA 1DBTA 5FCZA 4JKMA 1K9DA 3FVMA 1Q7YT 2VO5A 1QDUB 3MD3A 3F4NA 5C24A 3OHAA 3CV2A 4BR1A 4XIAA 1XNRF 3C3UA 4YTRA 5DZ6A 4AD5A 3AUOA 5I77A 1Q6GA 4CO2A 2PLCA 3EWGA 3MUVP 3RYLA 3AMCA 3D0IE 3M6VA 3I96A 1ZTWA 4JR5A 4LXFA 4RWWA 2ZJQQ 4HNNA 3D5MA 1UJ4A 3BF4A 3SCPA 4QBXA 3GNOA 3LO3A 4CLYA 3ZM8A 5LNVA 4AYGA 2BB0A 3PZIA 1HBUA 4JTIA 2LQBA 2J7HA 1XIDA 1BF6A 1RJJA 1W3KA 3R5AA 2OQYA 4KY3A 3C6UB 1KC8T 3EXYA 3WSUA 1FWDC 3SW6A 1UVNA 2DGQA 3B9AA 3ABSA 5EFDA 4A4AA 3KLVA 4UZUA 2NREA 1R30A 3SUWA 4DO4A 2NVAA 3ARQA 4JQ1A 1KHWA 1WI6A 3KUMA 4WDTA 3WDOA 1RHCA 4GC4A 1HPZB 2YL9A 4FXJA 2B0MA 2N4CA 2ZC4A 3MCNA 3DI6B 3R5GA 1RV8A 3KLIA 4FX8A 1VFUA 1WJ9A 2POZA 5M3WA 1SJDA 4ZJOA 1LBLA 4M5JA 1MQPA 4NZ5A 5EL1A 4LEQA 4CQ1A 2AU0A 3GXMA 1QUVA 3SEOA 1GYLA 1W5MA 4C6PA 2V2DA 4PFMA 2ZKTA 3CUXA 3EXSA 5KZ6A 1REQB 3ZTSA 2KRBA 3KK2B 2U2FA 3KVKA 3E3XA 1JYNA 1WZKA 1ULRA 4KRTA 1OEPA 2GDQA 4YYFA 5LMNJ 4MDOA 1YZ6A 4RLIA 4GX9A 3GFHA 4MOZA 3M64A 4WKFA 5M2FX 1FXDA 5IQQA 3PZ9A 3IGUA 3OYZA 2AT1B 3BOFA 2COLA 3C0LA 3A8JA 3GE9A 1GQKA 1B3OA 4CQ9A 3GR1A 3NP5A 1C91A 4J9OA 1QJWA 2JSXA 3UA4A 2B8QA 3IP0A 2XVGA 5U7SA 1S9EA 1KXHA 2OVLA 3QN3A 1A7GE 1DOSA 2DGWA 2YA2A 2EAWA 1JLAA 2PC8A 2B4VA 3ILOA 4O4VA 4G1IA 1W2IA 4AWTA 3M32A 3GC5A 4AUBA 3POTB 1HLWA 1P27B 3UJFA 1HBUB 1GVQA 2JLEA 4O3NA 3R8RA 4HPNA 2NLIA 3AYTA 5MHBA 2C3ZA 2PDGA 3IR5B 4IPNB 1HD0A 2ALYB 4DV2F 3NVDA 2XY7A 3DFQA 4F25A 4O1BA 3KOAA 1FX6A 1PO6A 3GIPA 4GO8A 4ZQNA 1W1IE 2C79A 3MWAA 4H4IA 4E2OA 1GNKA 1KBIA 3F56A 1ZYQA 2R1KA 2AHOB 3OGVA 4WUIA 3DLEA 1DTNA 1QRQA 3CHDA 3IR7B 4ZR8A 1IKVB 3BEGB 3V6DA 4FBTA 3RAOA 2C2EA 2XN1A 3KLKA 4L6OA 2I5QA 1ICEB 1IKVA 1R85A 1EKRA 4JPGA 2G2YA 1H41A 2HWTA 2MDAA 1H72C 2E9BA 4F9JA 3OODA 5BCAA 3PTQA 2ZOGA 5BW6A 2PDBA 3TCSA 3L4ZA 3TAPA 5FJTA 4ZDNA 4DAFA 2Y2WA 1YIJS 4YTTA 3FSUA 1PV8A 2KFNA 1U1NA 2MQOA 3LG3A 1D3HA 4U2ZA 1B0VA 1H7NA 1WV2A 3P2VA 2EFQA 1XNRJ 4LF2A 5TD4A 3KG4A 3P67A 3SUUA 4I6AA 2BHZA 1B30A 2XIMA 2F2HA 2V34A 3MECB 2A3LA 4IIDA 1EQMA 1L3SA 1FNMA 4Y65A 1H5VA 4X63A 4ETZA 1XXXA 3MPYA 4MIBA 3GILA 4PCTA 2W9MA 3QOMA 3TARA 1HQUA 1I60A 2QS8A 3FA5A 3I3EA 3ZZRA 2JBMA 1KWMA 2ZH4A 1NH7A 4JP8A 2GFFA 2YNGB 1YNYA 2DO0A 5H6HA 1W17A 1VFLA 1Z89A 3C2FA 5D4PA 2YA1A 3MD1A 1UIOA 2FZBA 1CS4A 2VASA 4FF5A 1SPBP 3NS5A 3MM5A 4S0MA 3UP8A 2YSWA 3BV7A 2EW9A 1ADDA 1Q85A 3CHFA 2UP1A 4ZB5A 4GMEA 1KRAC 1OFAA 4F8XA 1NQ6A 4KKXA 2V94A 3C6CA 1HVXA 1L6WA 4CU6A 5AT1B 3W86A 4UY8T 3PBGA 3FC9A 1HKJA 1MWZA 3GTNA 3TOPA 3ZJ8A 3ENAA 1HKKA 1L6YA 2FUG9 2GWNA 2HNZA 1NB7A 2BE9B 3KRZA 1XM3A 4RPPA 1N82A 1JXEA 4LT9A 3N14A 1XIEA 1TX0A 1FF2A 3G87A 4PMZA 3USZA 2PN6A 2E40A 3DGPB 3NPVA 1S4EA 1UJ6A 4GO5X 3GY1A 1FXRA 4OI2A 4HU8A 4HP5A 1RISA 2M9KA 3GM8A 1G4EA 1V9OA 1BY9A 1H7PA 1MMFA 3I4HX 4CD7A 2XHCA 3GH7A 3PJTA 1UWQA 3ONCA 1OINA 5FF4A 1KS2A 5C24B 2FPVA 3WK3A 3GX9A 5KFLA 3CWOX 4LRSA 3EWBX 1HBMB 4ZLNA 4GKJF 4GQ0A 3KS5A 3M7WA 4IPPA 3SUTA 2UXBF 3Q0AA 5B08A 1Q95G 1NO8A 1O1HA 3KX6A 3UT0A 3RITA 3WQ5A 2NXCA 2MANA 2QULA 2XIBA 2FHBA 2J4GA 2WNQA 1URNA 3MAQA 3ITCA 1S1PA 5C7VA 3LP2A 5DJBA 1EPXA 5GADI 3GHTA 1JLFA 3VIJA 3E12A 2MB0B 1QSYA 1CYGA 1EQPA 3WELA 3P93A 5HNRA 2HQFA 3AJDA 1DLOA 5C5JA 2BE7D 1JZ3A 1EA9C 5GAEU 4CD6A 1M7OA 4B9UA 4NXNF 4MIMA 4BQ3A 4WYWA 4U96A 1FWEC 5IHRA 2LQJA 3SQGB 1YJTA 1FWTA 4WKHA 2R24A 3P0WA 4XDDA 4FNRA 3BO9A 3BG3A 4GBDA 1OMSA 4QYZK 3ITXA 3SR7A 4F8RA 3O6AA 3QXBA 1N6QA 2GVGA 2IRYA 1V93A 3H4XA 2MTLA 2F9JA 3IJ7A 1GX5A 1RQBA 2DGOA 3W8PA 4A3RA 3PW4A 2OFGX 3N6NA 3RHGA 2AQWA 1WI8A 1NU5A 2A10A 4GC3A 1WSVA 4S3DA 5BYQA 4QQUA 4KSEB 2DR6A 2ZRXA 3B8TA 3FYPA 4GZIA 1K4GA 3CCRS 4OFZA 4M5LA 4DUTA 1U1MA 3VVTA 4XAPA 3OG3A 5KFCA 4KQNA 1EBGA 3CIXA 1BQMB 2KN4A 4IWWA 2QRRA 3JTPA 4IMFA 3FSTA 2DNGA 4R7OA 4DV6J 2PURA 1GVIA 3GTFA 3GDTA 2GMJA 4LRAA 2H48B 1BKHA 4L4MA 1S10A 2RF2B 3KHDA 2FLPA 3T1HF 3DENA 2AGTA 4UQDA 1R0AB 4ZVRB 4NU7A 2BRKA 5AYIA 3I6EA 2BJ1A 4DXXA 3REQB 3ZLHA 2EFVA 4E8UA 1FFQA 4ZQCA 3WLRA 5A8QA 1FJGF 4AMCA 1TJPA 3R0UA 5D4LA 2ZICA 1R0MA 2KZMA 3GVRA 2BANB 2P9EA 3BREA 3TMQA 4BY3A 2ZXQA 1HBOB 4NYZA 4WFZA 1XIHA 3SCJE 1E9ZB 4AUKA 3MVIA 1J01A 3WNOA 4EVZA 3IACA 2WNZA 2OI2A 1MMDA 2XDFA 2Z1SA 1CGVA 2K7KA 4L3NA 3NQDA 3HHEA 1KQFB 2CLEA 4FP1A 2W79A 3KHJA 1QPOA 2DVUA 5FJRA 2FDNA 3WZ0A 3WLTA 5E09A 3UR7A 3B0UX 4G7FA 3WUGA 4I6KA 4I1TA 4RNMA 2AMCB 2I8EA 5D02A 3OHIA 4UC5A 5L9XA 1E51A 4GI4A 2IYGA 3EWUA 4LF8F 2XINA 1JAKA 2IPFA 1ZHAA 3H5XA 3A23A 4RCXA 1IBCB 3SCSA 2FC8A 3VMPA 3ZLFA 2JNJA 1VQOS 5H8UA 4IIBA 2DXDA 3H7HB 4N9EA 5IS2A 2AD9A 4UTWC 2F4VJ 1J2BA 1EO5A 5LMUJ 1LG1A 4JI3F 1FWAC 3FOKA 3PXGa 3TTQA 2MMYA 1YRRA 3LY0A 4MH8A 4PUOB 4FZIA 2ZZ2A 2GMLA 4ZPWR 4FNSA 1BYBA 2YWGA 3W2NA 4HYVA 5DDPC 2R1MA 4AZHA 2AJ2A 2D9PA 1RJPA 2EFPA 1F6YA 4IP5A 2XSXA 3S7RA 2V30A 2YWWA 5AXLA 1C1BA 1EXBA 2V5HG 2ZBPA 3M32B 3CAQA 4RBVA 3QZ7A 4PN2A 5HO4A 3O0KA 3DFOA 4L3KA 4RZ6A 3RBXA 3FSYA 1TK0A 5M2UA 3N9KA 1HO1A 4ML9A 5F4SA 4QBUA 4MTVA 4IFYA 1W37A 5JH2A 3MUCA 4ERGA 2HNYA 2XLIA 1YPXA 4LU0A 1DQ9A 2JLGA 2I16A 1H63A 1OO0B 4JI7F 1J0YA 4PUWA 2BX6A 3V4BA 2FHCA 4K7YA 3NCRA 3T07A 5IT0A 4L65A 2XMTA 4RXGA 1RD5A 1TVNA 4E8GA 2QLBB 1OCJA 3JR2A 3BPSP 2BVYA 5I00A 2CJYB 5KFXA 1VC4A 1D7KA 2QA4S 3QZ8A 1JPIA 2VMFA 1NFPA 2NW0A 4G7EB 1LW2B 4XD5A 3I4EA 4M19A 3Q8UA 2NX9A 2CW6A 3K8KA 3W38A 2PGEA 2AKWB 4UTTA 4M82A 1WELA 3O5TB 4X4PA 2B4PA 4Y2MA 2CIPA 4FO4A 3DYOA 1S1XA 4F0KA 3S8HA 3FMBA 1BRLB 1ZBWA 1B5TA 2ISVA 2P3ZA 1YBAA 3M8YA 2ZM6J 2YXGA 2Y1IA 1U1KA 4US5D 3RR8A 1Q86T 1V02E 2PTWA 4CN4A 1UR4A 3VIHA 2V38A 5HL7Q 4HHPA 3G5EA 1H5YA 4MG4A 4KRZA 2VD3A 3KNGA 1TIMA 4J5OA 5GADU 3W61A 4WGHA 1GPFA 3U02A 4AZ7A 3KWSA 1FKOA 5E70A 2YDSA 5EYWA 1M03A 1NKCA 1EQCA 1XCFA 3TO8A 2FHOB 3IC1A 2CPHA 3L21A 4QIGA 3W1TA 1ZP3A 4ZOCA 2CQIA 1S6PA 1CCWB 5KFOA 5HMDA 1ZBTA 2ZX9A 5ETNA 4PQUA 5D9NA 3L4BC 4H1ZA 1WXJA 2B3TB 3KEHA 3TA6A 3RUBL 2BY3A 1SCJB 3TW6A 5EB8A 1EEPA 2OOGA 1UJPA 3AXKA 1MI3A 3K8VA 1LWXA 4QLKA 1Q7LB 3SQOP 2R4FA 1IF2A 4Y00A 2FHFA 3IV3A 1TV3A 3MAAB 1GXTA 4ATNA 4AQYF 2HRWA 4QYZJ 4S39A 5DRCA 2MSSA 1OIFA 1W25A 5ETMA 5DMLA 4E2VA 5F8IA 3AZRA 1V3KA 3EWZA 2DRAA 1PWMA 3FVDA 3LQGA 4IQJA 2HNHA 3BSGA 3LCGA 1K8YA 2IC3B 1RAOA