3PJWA

Structure of pseudomonas fluorescence lapd ggdef-eal dual domain, i23
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
430
structure length
423
Chain Sequence
AALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for c-di-GMP-Mediated Inside-Out Signaling Controlling Periplasmic Proteolysis.
pubmed doi rcsb
molecule keywords Cyclic dimeric GMP binding protein
molecule tags Lyase
source organism Pseudomonas fluorescens
total genus 130
structure length 423
sequence length 430
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3pjwA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pjwA01
4H4MA 4X2BA 3PZPA 4H54A 3H4BA 4KFBA 2ZE2A 2IC3A 4MIAA 5KG2A 4H4OB 5KG7A 3RB3A 4EEYA 4IRDA 4JV2A 2AWZA 2BQRA 3KK1B 4Q0BA 1LW2A 1TV6B 4ECRA 4ECYA 1TKZA 1JKHA 3PW5A 3KJVB 3CJ0A 5EUHA 5F8GA 2W8LA 4ICLA 5DQHA 1S6QA 3CJ2A 2IM1A 4HYKA 4RZRA 2WONA 4IG0A 4KO0B 1HNVB 4NRUA 1RT3A 5L9XA 4Q43A 3DRRA 1JLQB 2WRMA 3DYAA 3KLEA 1HPZA 4LSNB 2FJXA 5JXSA 4PQUB 3QZ7A 4YR0A 3CDUA 1GX5A 2RDIA 3BGRB 5KFPA 2QE5A 2IM2A 3IN5A 4FOKA 3GV8B 3HV9A 3BJYA 1RT7B 4RNNA 4ZMMA 1N48A 1S0OA 4H4MB 2OH2A 4IQXA 3CO9A 1S1UB 1LW0A 3MEDA 2ZE2B 4KFBB 5KG3A 3SI8A 3RB0A 2IC3B 5D3GA 3GG1A 4KKOA 3BQ1A 4J9PA 3OL7A 3V81A 1D1UA 1BQNA 4Y2AA 1JLEA 3Q8SB 4NCGB 1J5OA 3N6LA 1JKHB 1RA7A 3KMQA 4YR3A 4Y9OA 3I0SA 4QWAA 2R2UA 5F8NA 4ICLB 4LYKA 4J9RA 1S6QB 3CWJA 2VA2A 4IG0B 1KHWA 1C2PA 1REVA 1RT3B 2J6UA 2VA3A 1SH3A 3DRRB 3HKWA 3DYAB 4LSLA 2HWHA 2W7PA 1HPZB 4ZVHA 4O3RA 1JLCB 3PW2A 4F48A 4O3NA 3GV7B 1RTDA 2C22A 5MKGA 4TLRA 4Y2CA 3LP0B 3NBPB 2UVRA 3RB4A 4QWBA 1LWCA 4TYAA 5KFQA 3MFHA 3LP1B 4K4WA 3TAMA 4KE5A 2JEIA 5KFLA 3MEEA 1LW0B 3MEDB 3PHEA 1IKXA 4QWCA 1RT4A 4I2QA 4ZPCA 3C6UA 2WTFA 5D3GB 4KKOB 1ZTWA 1XR6A 1T3NA 1QAJA 1MU2A 3H2LA 5KG5A 3GIKA 1HQEB 3V81B 2R2RA 4Y9NA 2CJQA 1BQNB 2HNYB 3FRZA 2C2RA 1EETA 1JLEB 3JSMA 2IAJA 1SUQA 3BSNA 5KFHA 2R2SA 3UDLA 2O5DA 2UVUA 3IGVA 5KFWA 3DOKB 1S9GA 2W9AA 3GIIA 1REVB 3MR5A 4EO6A 1DLOB 4LSLB 4JUZA 4Q8EA 3DRPB 2XWYA 3U2EA 1QE1A 4YP3A 1RTDB 4FS1A 3H5XA 5MKGB 1ZTTA 4TY9A 3E51A 3IG1A 4F4XA 3DMJA 5KFVA 1LWCB 5KFOA 4RNOA 3KLFA 5KFTA 2XCAA 2UVVA 4K4SA 3FDSA 4ZP8A 3TAMB 1C1CB 4NLVA 3M9OB 3KHGA 1S9FA 1S10A 2D7SA 3PJWA 4IH6A 1RT4B 4U7CA 5J2QB 2ALZA 1S0NA 2DPJA 2AGQA 1IM4A 1MU2B 4K4UA 1RTIA 3DLGB 3M9MB 4MKBA 5F8MA 1EETB 2R8IA 2IAJB 4FOUA 1SUQB 1XR7A 5KFRA 3OL8A 3V6DA 3Q8PB 5HP1A 2E9ZA 1VRUA 2VG5B 4IFVA 1S9GB 2FVCA 4RW6A 5DGBA 3JYTA 4H4OA 3QLHB 3UPFA 1S97A 2FLPA 4AG0A 3CIZA 1JLBA 2F8EX 4RW7A 3PW0A 2I1RA 2R8GA 3N3TA 3KK1A 2R8JA 5KFGA 1QE1B 2YNIA 4NRTA 3IG1B 3FSIA 3DMJB 4K4XA 4KIEA 3G6VA 3KLFB 2B43A 4KO0A 1HNVA 4U6PA 2FVRA 4WYLA 4NLSA 4GC6A 3KK2B 2WOMA 3V6HA 2W7OA 3OL9A 4B3OA 2YNFB 5HBMA 4NLQA 4EBCA 1RTIB 1NNDA 5KFAA 4ED1A 1FKPB 1LWFB 3BGRA 3V6KA 1S0MA 3CDEA 3UQSA 3H5UA 2BRKA 2YKNA 5FDLB 4XO0A 1C1BB 2ZD1A 1S1UA 3OLAA 4Y9PA 3V6DB 5HP1B 3NMAA 1TKTA 1VRUB 3NKYA 4IFVB 4RW6B 2XGPA 1IKYB 2IM0A 3JYTB 1C0TA 1C0UB 4MFBA 1JLBB 4RW7B 4WXOA 2D3ZA 4YQWA 3PJXA 1S4FA 3QGGA 3LAKA 5DLFA 1IKWA 4NLWA 1TKXA 4NCGA 5L1KA 4ECQA 4IH5A 3LANA 5KFYA 4FBTA 3DLKB 4M94A 2YNIB 3PFMA 4WXWA 2GIRA 5KFBA 1T05B 1HARA 1RT1A 4TN2A 4ZHRA 4I7FA 5F8LA 3MR2A 2WOMB 4Y3CA 4AFYA 4Y34A 4B3OB 3S83A 1JLCA 4O3PA 5HBMB 5DQIA 3NAIA 1T03A 1S1XB 3LP0A 3NBPA 3MEGA 5KFXA 2WHOA 1SV5A 4ED7A 2IA6A 2OPQA 2R8KA 2W9CA 4O4RA 3T19A 4IR1A 3LP1A 5C5JA 3RBDA 2YKNB 2IJFA 3LALA 3M8QA 5CYQA 2ZD1B 1HNIA 4J9MA 2OPSA 1TKTB 3PVXA 1N56A 3QIPA 4Q44A 3EZUA 3HHKA 1C0TB 4MFBB 4IOBA 1HQEA 3V6JA 3H5SA 4F3HA 2HNYA 4WYWA 1IKWB 4MK7A 3BQ0A 1TKXB 4ECXA 1HYSA 4QPXA 3RAQA 4LQ9A 4ZVFA 2ASJA 3UR0A 3DOKA 3MFIA 3KNAA 4I2PA 1GX6A 1RT1B 4KV8A 5F8IA 2HMIB 4ZHRB 1QAIA 4I7FB 5EWFA 3H98A 2GC8A 2C2EA 2WK4A 1DLOA 2IMWP 3DRPA 3GILA 5C42A 2CKWA 4MK8A 2D41A 2ASLA 3QGIA 2ILYA 4IKAA 1T03B 4ZP7A 3MEGB 4RW8A 1SV5B 3MTKA 2OPQB 2W9CB 3KHRA 1RDRA 4RNJA 3CJ3A 3DOLA 2HNDB 5KT5A 3BQ2A 4J9NA 1C1CA 3M8QB 3MECB 5DQGA 5CYQB 3MR6A 3M9NB 4J9QA 1HNIB 4M95A 1UWBA 3SY8A 2OPSB 4QW9A 5J2NA 2RKIA 4NLYA 3H4DA 3QIPB 3T5LA 5J2QA 4J40A 4K50A 4RNIA 3DLGA 2OPPB 4RNFA 1HYSB 4JV1A 4ECZA 5DG7A 4ZVEA 4Y9MA 3BR9A 1K1QA 1RTHA 3OHAA 2VG5A 3GYNA 5DGAA 3I5BA 2R6OA 4I2PB 4KV8B 3QLHA 4O4GB 3GQCA 4K4TA 4PUOA 2E9RX 5L1LA 1EP4A 3T1AA 4URSA 3CJ5A 4TY8A 4R8UA 1SH0A 4WZMA 3KLVA 4MKAA 5C42B 4DL5A 1HQUA 4NLRA 5T14A 3KK3A 2VG7A 4KSEB 3FQLA 1NHUA 3CVKA 4RW8B 5K14B 3DRSA 3G6XA 2AGOA 4OL8A 2QV6A 3DOLB 3KLIA 2B5JA 5KFZA 3KK2A 5KFFA 1UWBB 3MR3A 2YNHA 2BRLA 4IH7A 2RKIB 4O3QA 5J2NB 2YNFA 2AGPA 2FJWA 4J9SA 3I0RA 4FBUA 4URGA 4J9LA 1FKPA 1LWFA 1TP7A 2AX0A 5EWEA 4EYHB 4ECSA 3SFUA 3G6YA 2HNZA 1K1SA 4NZ0A 2R2TA 4J9OA 3EPIA 2FLLA 2ZKUA 3PR5B 5FDLA 1RTHB 1C1BA 3PW4A 3GFYA 4ES4A 1S6PB 3BREA 4KB7A 4ED8A 2ASDA 4LJ3A 1IKYA 2JEFA 2V0NA 2DPIA 1C0UA 4PUOB 1EP4B 1TL1B 3LP2A 4TY8B 4F4YA 4R8UB 2BE2A 4RW9B 5J1EA 2C28A 2AQ4A 1HQUB 4FS2A 3DLKA 4KHRA 3KK3B 1IKVA 2VG7B 3TQ1A 3KZPA 1JX4A 3DRSB 3KLGA 2YKMA 4F50A 1T05A 3QIDA 2VG6A 3KLIB 2B5JB 4QW8A 3NGDA 3T5JA 5J2MA 4NLUA 1RYRA 2UUWA 3C6TB 4R0EA 2BQUA 3CJ4A 2YNHB 4QWDA 4HU3A 3QYYA 2WCXA 3I0RB 3Q8QB 5HLFB 1DTQB 5KFNA 1S1XA 4YMEA 4EBEA 1RT5B 4ED3A 5L1JA 4FOJA 3D5MA 1JLGA 2HNZB 4O44A 4HJFA 4DG1A 1N4LA 1VRTA 3PJTA 3IRXB 4WFYA 4ZPDA 3KLHA 1CSJA 1HMVA 5KFCA 2BASA 4LQ3A 5EDWA 2B6AB 1N5YA 2ATLA 1LWEA 3ICLA 3LP2B 1TL3A 2BR0A 2BE2B 5J1EB 5KFDA 5F8HA 2XCPA 4EYIB 4WE1A 2EC0A 1S1WB 5JUMA 1N6QA 3KOAA 2XC9A 1IKVB 1FKOA 2WB4A 4O3OA 4Q6JA 1TVRA 3BSCA 4IDKB 4URQU 3KLGB 2YKMB 4DEZA 2FVSA 3DM2A 2HMIA 5C25B 2VG6B 5J2MB 4ZP9A 1XR5A 3SFGA 3M8PB 2BANA 3DDKA 5C24A 4F4ZA 5KFSA 3KHHA 1RYSA 4RW4A 5F8JA 4NLPA 4R5PA 4IG3A 4WFZA 1JLGB 4O44B 4DG1B 3QGHA 1VRTB 3KLHB 2HNDA 3H40A 1R0AB 3MECA 1QUVA 5KFKA 1HMVB 1OS5A 3I5CA 3HVTA 1WNEA 4GC7A 1N5YB 1S1TA 1LWEB 4DL3A 4RNMA 1TL3B 2OPPA 5MF5A 4NLDA 4NLXA 4IRCA 3IGNA 2HAIA 4WE1B 4WFXA 4ECTA 3FFIA 4ECUA 1N6QB 3GFZA 3RB6A 4KAIA 3VQSA 3KHLA 1FKOB 1DTTA 3TLQA 5KFMA 5KFJA 4ED2A 1TVRB 1Z4UA 2JLEA 4NYZA 2RF2A 2RDJA 3DM2B 2OPRA 4O4GA 1JLFB 5C24B 2BANB 1KLMB 5KT6A 1D0EA 4RW4B 5CYMA 3HV8A 3PJUA 4EO8A 4K4VA 4R5PB 4IG3B 2IBKA 2XGQA 4HU4A 4KBIA 5K14A 5J2PA 5I3UA 3BSOA 4RNHA 4TQRA 5KT2A 5F9LA 4PWDA 5KG1A 2JC1A 2UUTA 4Q0BB 1LW2B 2AX1A 4TYBA 3KMSA 2J6TA 3DI6A 3MF5A 1TKZB 3HVTB 2ILZA 4G3IA 1S48A 3RBEA 1S1TB 4YR2A 2W8KA 5KG6A 3T5HA 3TVKA 5KT3A 2W27A 2HWIA 2WONB 1NHVA 1W25A 1RAJA 3GFXA 3E01A 3FFIB 3T5KA 4F4WA 3KLEB 1DTTB 2UVWA 2XI3A 1S6PA 5DG9A 5KG4A 1KHVA 2RF2B 1BQMA 1RT6A 3BSAA 2FVPA 2OPRB 3OL6A 3ITHA 4RUAA 4DL6A 4K4YA 1TL1A 1FK9A 3HVAA 2V9WA 4RW9A 2I5JA 4J9KA 3N6MA 2C2DA 3H59A 5CYMB 2V4RA 3OHBA 4ZPBA 5KT4A 5KFIA 1ZETA 5J2PB 5I3UB 4ED0A 3IS9A 4Y8EA 4PWDB 4WZQA 2YNGA 2GIQA 2AU0A 2BQ3A 4Q45A 3C6TA 4ECVA 3GG0A 2XI2A 3DI6B 1J5OB 2JEGA 1RTJA 3V4IA 2E9TA 3G86A 4G1QA 5I42A 3I0SB 2FJVA 2JC0A 5KFUA 1DTQA 5HLFA 4NLGA 1RT5A 3NL0A 4HKQA 3OLBA 3N6NA 2FLNA 4DL4A 4MH8A 3IRXA 4ID5A 3E01B 5F9NA 2IM3A 3GIJA 3I5AA 2B6AA 5KFEA 1BQMB 1RT6B 3D28A 4IR9A 3ITHB 1RT2A 5DG8A 4TQSA 1FK9B 2J6SA 2JEJA 1JLAA 2I5JB 1TQLA 4JV0A 3CDWA 1S1WA 4MK9A 4ED6A 1S9EA 3MEEB 4TXSA 4DL7A 1IKXB 3DLEA 4ECWA 4I2QB 1MMLA 3C6UB 4IDKA 4NLTA 1S1VA 3OSPA 3PW7A 2IJNA 3IS9B 4NLOA 3Q8RB 1JXLA 4IRKA 5C25A 2YNGB 4QWEA 4DL2A 2W9BA 5HROA 3M8PA 3QO9A 4IFYA 3JSMB 4O3SA 1U09A 1RTJB 4RUCA 3QZ8A 3V4IB 4G1QB 5I42B 4RU9A 5EWGA 1T94A 4EBDA 1I6JA 1JIHA 1S49A 4ZVGA 4K4ZA 3ISND 3NAHA 4ID5B 4ZP6A 4Q8FA 1R0AA 4KHMA 5M1TA 3GIMA 1TV6A 3LAMA 3KJVA 5DLGA 1RT2B 2FVQA 3HVWA 1JLAB 5KT7A 1YVFA 3ISNC 3OSNA 2V4QA 3GV5B 4XPCA 2R8HA 1JLQA 1S9EB 4MIBA 3DLEB 4LSNA 3PR4A 5L1IA 1S1VB 4PQUA 1SH2A 3FQKA 3EPGA 1JLFA 2D3UA 5HROB 2W9BB 4ZPAA 1KLMA 3QO9B 4IFYB 1RA6A 5KG0A 4XPEA 1RT7A 3RAXA 3H5YA
chains in the Genus database with same CATH superfamily
3HHEA 2AQWA 4WVXA 3USBA 3IRSA 4NPOA 2JGYA 2ZE2A 4LBUA 2DVIA 1Z32X 2BXVA 2OQLA 3QFHA 1YI2S 2WHJA 3FRYA 1YBQB 1QD1A 3C2RA 4CWBA 3N2TA 2YCKX 3ZWTA 4KRUA 3PHAA 3EDDA 2VCCA 1XWYA 4FLOA 4HEA9 3EYZA 4WKFA 3HPXA 2HKEA 3TTOA 3TWZA 2WQPA 3BQ6A 5HMFA 1J93A 2B4UA 2LEPA 1LBLA 1E56A 3LSBA 5C7HA 2JFEX 4U33A 3O7UA 2Y4SA 2YY3A 2G3JA 2DGSA 2GS8A 3TR2A 2HFSA 4LEFA 5BXPA 2CIMA 2MJNA 2R7SA 4GQQA 2OLAA 4XVEA 3CHCA 4ZIVA 2WSEC 4G7FA 1UJQA 2DORA 2WVTA 4A46A 3BBFA 1DQWA 2DITA 4Y2AA 4M6QA 4GOAA 2XYPB 3CNQP 1E0UA 1E51A 4PBEA 4DAIA 4M80A 2KG0A 1LJYA 4JEJA 4HACA 3WLSA 4C6BA 4IGSA 4LAUA 4CNUA 4JI0F 1GT8A 3PWGA 3SSRA 2XYHB 5HJXA 4HYWA 4W85A 4ZVHA 3Q23A 1WKDA 1GMWA 3BG5A 2DBBA 1PZ0A 3MFHA 2OSWA 3WG6A 4NRSA 3FVDA 1VK8A 1KB3A 2E7VA 4UW2A 3C6UA 1H73A 3QMRA 3OVGA 2PF8A 3V81B 1HBOB 1JCMP 1OZMA 1A3WA 3O06A 2QA2A 1YJNS 1XGDA 1N34F 1NFBA 4U3AA 3TZZA 3J7ZT 5HA7A 4IIDA 3PX0A 1X1OA 1M41A 4US5D 2OFGX 2QV4A 2OYMA 1D9AA 2QL9B 1QE1A 2ZTKA 2VICA 3W9HA 3BW3A 2BKOA 3PTDA 3CPRA 3DMJA 4FXJA 1EP3A 4UY85 3TC7A 1EXPA 1GVEA 2D3OR 1X38A 1S9FA 4LF6J 1VFTA 1UOZA 5CD4H 3MSDA 2DPJA 3GTYX 2BVZA 4CLZA 1AW1A 1MDLA 2CPDA 2R8IA 4XIMA 4JI8F 3FJNA 5KFRA 1QMLA 1Z1ZA 4JTTA 2OGJA 4AXIA 4A8XA 1S5TA 1JRCA 1VRUA 1VFFA 3SB0A 3SY5A 1V0KA 3QKZA 4IP4A 3K1DA 2VCBA 2V5BA 5JH1A 3CH0A 2X05A 3R12A 1J10A 3SCUA 1QHZA 1FWPA 2DHAA 1J0YA 2FVRA 3RMEA 2B0GA 3OZPA 1R46A 2FDSA 2VEFA 5E93A 3UW6A 4DZ6A 4QHRA 6CGTA 4O16A 3V6KA 3NVTA 3BAIA 3LGMA 2GK1A 2RHGA 4XO0A 1UOKA 4QLKA 2I8EA 5HP1B 3CJKA 1U24A 4RW6B 4UUWA 1F9HA 4H6EA 3D6HB 3PRBA 4LY8A 1VAHA 4ECQA 3JQKA 1TREA 1P0KA 5I3GA 5KOWA 2VFHA 5FOOA 4CCDA 2GIRA 1J01A 5FF0A 2DR8A 1UKOA 3QW4B 4LUSB 2D22A 5B0BA 2W1BA 4GO9A 4DR3F 4KFOA 3UGRA 1S1XB 4P8XA 4JTRA 1JNEA 4AD1A 4ZFCA 2OPQA 1EP1A 1J2WA 4GI6A 2A79A 1TFYA 2VB6A 4KHPJ 3TJAA 1WF2A 4WR3A 1C93A 4HVZA 2KXFA 1MEIA 3P6YC 1UC4A 2P3ZA 2WC7A 4ANEA 2DIJA 3S3GA 3PNUA 1RKJA 2QIIA 3F2BA 3WJYA 3GQYA 3PN8A 1OGGA 2HNHA 3H7HB 1U1JA 1YBTA 1L2QA 2Y85A 5A5WA 1T9WA 2MUCA 3QGIA 5D6GA 1LOSA 4RNJA 3BQ2A 4DBDA 3DGPA 4F9DA 4C6FA 2OPSB 4Z2IA 4L74A 3LRMA 4JYDA 4OJ3A 3T5LA 3BPWA 3UWTA 1GPFA 5IOBA 1S72S 3E9AA 2XLJA 4X0NA 1JXKA 4PFHA 4DV1J 3PYGA 1S3HA 5JQ9A 1G9HA 4JR5A 1OABA 2HBQB 4I6AA 4URSA 2VR2A 3VAVA 1S2WA 2LU2A 4XKMA 2YKKA 2HROA 3FQLA 2WM1A 2DNHA 2DU2A 2OU4A 5M03A 3FKBA 5KZDA 2VBYA 3BOXA 3HSZA 1DKWA 3M8ZA 4QBUA 2EXOA 4EMDA 4AQLA 4F0RA 3QATA 1Y7PA 4LC8A 1O7AA 4I69A 1TQJA 1YDVA 4QEHA 3CCVS 2XINA 4N42A 2AEJA 3CB4A 2Y7EA 5AXMA 4MZ8A 4C2MA 1NDWA 3PCOB 1M7XA 4CNSA 4H6QA 2WSRA 4UF4A 1Y5IB 1XKYA 4FNPA 3PNIA 2VXNA 2J0QD 4KCUA 4X4VA 4B9VA 4KBXA 1OYEA 4ZCIA 2AQ4A 4CM2A 1JIBA 2DH2A 2Y8VA 4OV9A 2HQDA 5A0YB 4RO0A 1PX8A 1IVZA 1ISZA 1KV8A 2CDQA 2OSRA 1T41A 4GYKA 2D2HA 2MLYA 1S2CA 1R9ZA 1JGMA 2PZNA 3U2OA 4QWDA 3CMES 4NZ3A 3C14B 3QZAA 1J12A 2IPGA 1NJYA 3DG6A 1HW8A 3OTCA 1TG7A 2KYZA 2HIYA 5ABTA 1E71M 3ICLA 1K6AA 1LXJA 2ZC8A 1GONA 2YOCA 1KRPA 2MY8A 2J0WA 3TWAA 4JHOA 1YJ9S 4WE1A 2WVUA 2Y2WA 1PUDA 2OWCA 5LIUX 1G7CB 2QA4S 4DV5J 2PFHA 4FXSA 2DNQA 3D47A 5BYWA 2W7AA 1EQCA 2A0FB 1LNQA 3S46A 2X1TA 4JTUA 1W31A 2V9DA 2YKOA 1A5NC 4JQ4A 4ES2A 4CUCA 1RPXA 3CV7A 4HSOA 5CSYA 3VKDA 1K47A 1LWXA 4IT1A 1J0IA 5ETNA 2CPJA 4XISA 3LHUA 3IMQJ 4MMOA 3EWYA 4WFNQ 4N77A 1CVJA 1W9BM 3V75A 1G1XA 2LQJA 4Q7AA 1S1TA 2EK1A 3WX4A 4ML9A 2FZNA 3WIJA 1V3JA 1EX1A 4MM1A 4AX6A 4ECTA 5LIXX 4KAIA 4IMDA 1VQLS 2ZTJA 3V5RA 1BGAA 1PS9A 3TK7A 2FZDA 1XLDA 1XYZA 3R4IA 2NYHA 2GQAA 4ROPA 2YDRA 5T7LB 2BY0A 3WNKA 3DLBA 1TL4A 3DRYA 1WJ9A 4QIGA 1XNQF 1A7GE 2OYLA 2EAWA 3V0SA 3TJ9A 1SL2A 4BI6A 3TX8A 1OT2A 1PX3A 3F0NA 1RA5A 5E0CA 3DX5A 4GO8A 3E74A 4GC3A 5IC4B 4O1FA 1FWAC 6REQA 2A3AA 3TO8A 2W8KA 5FJIA 3CUFA 3LNPA 2MZ1A 1C8YA 1TSIA 2HURA 1JMTA 4AZ6A 2L3MA 2OKQA 1H4PA 2Y9HA 3LRKA 1QHPA 4TR9A 4J37A 4JXCA 2OD6A 3BSAA 2JDJA 2WC3A 2QMUB 2P9CA 1DRZA 1XCFA 2GDVA 3GPAA 1UW9A 2V4RA 2PMQA 1YJVA 2WBRA 3AYRA 2PA6A 3AH6A 2OELA 3KX6A 4DSEA 4O23A 3UE2A 4B3SF 4J3ZA 3C6TA 1ME8A 3CJPA 3A4WA 4UZBA 2JEGA 3G9CA 4DUXA 3IIVA 2VASA 2DZAA 2W62A 1LXNA 4FYYB 1VQOS 3GRIA 2J6VA 2O9PA 5FF2A 3B0PA 4XDCA 1J27A 3ITHB 5AT1B 4XAKA 3GH5A 4PH6A 5I00A 3IWLA 4W7WA 2XFWA 1G01A 4LUTB 1Q6EA 5DDRC 5JVGQ 1S1WA 3N25A 3NGFA 2HFOA 4RPFA 1QUMA 4JTCA 4FPIA 1W6TA 1C9DA 2Z26A 5LXEA 4UFHA 3M5YA 1ADDA 3HBLA 4GH1A 2IQDA 4BA0A 4ZB0A 1I6JA 5DXYA 4CD5A 3NGUA 4HOZA 1VGYA 3GU2A 1BY9A 2Q6ZA 1ULRA 3GIMA 2ZE0A 3WQFA 1V0LA 1AQFA 3QT7A 2XLIA 3CCJS 3WC2A 3U4AA 3PZUA 2O01C 4ZA1A 2BY3A 5AC4A 1CJTA 1FJ7A 2N7YA 3NL5A 3ISNC 3OSNA 3QPEA 3UU0A 2GVZA 3L2LA 1Q5MA 4PUWA 5KZ6A 1PWMA 2Z7KA 1EX8A 3RUBL 5L38A 5F7UA 1Q5YA 1YX2A 2VP8A 1XP3A 4ZPAA 4Z1CA 4Q8TA 2X0SA 3FXYA 4XTTA 3CQKA 1V7AA 4F8XA 1B0VA 1JB0C 2HFNA 4LF1A 3RLVA 2FFIA 3MPGA 4O52A 4W87A 5HNUA 2F4FA 2X2YA 3HM7A 4UMCA 4AHQA 3W23A 2YB4A 2D0HA 2XGIA 3G1VA 2VOOA 1TJPA 4IG0A 4NA2A 5L9XA 1RK6A 1C90A 5D8HB 5C2GA 4NMLA 1FF2A 1C8QA 1K70A 2EG2A 2FJXA 1UR3M 2AKZA 3EWZA 3I3BA 1JJKA 2MZTA 1QWKA 1RR2A 4RDZA 2PDYA 2J7GA 3XINA 2HHTA 2IQTA 4S1FA 4RNNA 4NASA 4IQXA 4UTGA 4YL2A 2XPKA 2FYMA 1SJRA 3QBCA 2WKJA 3WN6A 4KTQA 3QEZA 3S1VA 3SRKA 2HFVA 3BF4A 1US0A 4M6PA 2BKPA 3A5VA 1RA7A 4AXJA 4MUPA 8XIMA 3GB0A 4QWAA 1NFGA 3CWJA 3MVIA 3HJVA 2UUCJ 1PWLA 3D3CJ 4O3RA 4K7VA 4AZGA 5D04C 1N54B 3EMQA 3YPIA 2O9OA 1TJ2A 1U8SA 4MY8A 3Q83A 1IWGA 2J7WA 2C91A 5G4WA 1T3NA 4I2QA 4AF0B 3WBYA 4N47A 3NCOA 2DSVA 4S23A 4XO6A 4EXQA 1ZA2B 4O10A 3LTPA 2N3LA 5KFHA 1L6GA 5G4HC 1S0VA 3R79A 4DMZA 1X0PA 3P8BB 3C66A 3CC7S 4CNOA 1S9GA 4G65A 3OUYB 3VD5A 1V77A 2WANA 1DJQA 1KWMA 2Q66A 2ZUWA 1KXQA 1LG2A 4DX7A 1UD5A 7ENLA 2PU1A 1RTDB 1S79A 4OHZA 1QT1A 1HJSA 2J62A 3PB0A 3MP5A 2Y3YA 1OD8A 3WIVA 3DBNA 1YJRA 3G18A 3HGOA 4XIUA 1UA3A 1ZP3A 1D3GA 4FF7A 4NXMJ 4PE8A 4XD4A 4C11A 3RILA 1S7IA 6FDRA 1U1LA 3OL8A 4J28A 5D78A 3UN5A 3WQDA 5F2GA 3B0UX 3EX4A 2FLPA 4FVCA 4DI8A 4AG0A 2DGVA 2QCDA 3U4FA 2IJRA 4QZVB 3P5YA 2B3TB 3CDAA 2FUG9 3M2VB 2XZ7A 1UEKA 2ONEA 1UQYA 5HVGA 2W4PA 4DU8A 2RHQB 3KUHA 4QITA 2FHOB 4C3KA 1QSSA 3OZYA 1RB0A 3RM8A 4GQRA 4PN2A 2XUCA 2YNFB 4IGMA 3TAKA 4X63A 1PYTA 3MHGA 1ZP4A 3BOFA 2OOGA 3UQSA 4LS0A 1XLJA 2FTYA 3K8LA 1R89A 3DIPA 3GY1A 1FWLA 2KHDA 1H5VA 4AZCA 1XPGA 4M5KA 1JLBB 4ICCX 3TYAA 3PG9A 4JI3F 2AJFE 3WD1A 1TO3A 3K4AA 5LGXA 4X62F 3UG4A 3B0VC 3W2JA 2Y88A 3EWDA 2EVZA 3RBXA 1MUWA 4QSHA 1R8PA 2KVQE 4G7EA 3R5BA 1U8WA 3HDSA 1QNVA 4Y34A 1GJPA 3S83A 2BJ3A 3ITXA 3EXCX 4QIUA 1U1QA 5EYWA 5K4XA 2MKKA 2PWDA 4Y6GA 3TI0A 3S5YA 1JXVA 5HMWA 3W88A 1KGXA 2VC9A 4ZPVR 3EPOA 1N33J 1L8PA 3QIPA 4OI3A 5EPDA 1AQMA 4IOBA 2KO1A 1HQEA 4GY1A 1VPQA 3LQVA 3IR6B 3SN1A 1UP3A 3WFZA 2EXUA 3BZQA 4ZVFA 3WNNA 2VF3A 3C52A 4V15A 1YGYA 3MFIA 3KNAA 2RNEA 5CC6A 1QAIA 2G0CA 3H98A 1PE1A 5IDZA 3V35A 4N5SA 3UJFA 3DRPA 4NX9A 2EI5A 4O11A 5G2WA 2HVNA 2ILYA 3ULHA 3CCSS 1E3XA 1OCBA 2Z27A 2CVIA 2NREA 1VQ9S 3LPEA 1FESA 4HOWA 1HIYA 3K5MA 1I0DA 4X0VA 3VNIA 2BXJA 2PMWA 3OR2A 4KRZA 3RMJA 2OZTA 4IIHA 4OHXA 3SY8A 2VQEF 1UWAA 1OFPA 4F79A 1DHMA 1HL8A 2YWGA 1DJGA 5ETRA 4Y9MA 2CZVC 1TJ0A 5HR7A 1RTHA 3MD3A 4NJJA 1JD9A 3GK0A 1JZ6A 1ZSXA 2FHMA 4PUOA 1YXCA 4KKXA 4DBSA 5JBDA 4TY8A 4MJ2A 4R8UA 3PV8A 4CU7A 1FA0A 3LYEA 8CGTA 3G2GA 4B3LA 1ZL1A 4NLRA 1Q82T 4C9DA 3CT2A 1UD3A 1L5UA 4P2MA 3ECQA 1RP9A 1FRHA 2LDIA 3BN7A 1H72C 2APOA 3OVRA 4R27A 1EPVA 2YNHA 2AGPA 1V3SA 1H1NA 1NXIA 1E6YB 2LKZA 3ZZRA 2OVLA 4CO1A 4Z0SA 3S1XA 3VXGA 1FKPA 1AUDA 3NL2A 4LMZA 1UAWA 3CYJA 3G6YA 4LF9F 1Q8AA 1EUAA 5C70A 4H3DA 3PR5B 1PJ7A 4JNMA 1RWVB 3WH7A 3HGJA 3DLHA 2PGFA 2EFPA 2A6MA 2JEFA 3MKCA 5ABFB 1N5SA 1YRXA 2MKCA 3Q4DA 4KH0B 1EUNA 4NCBA 4Z7CA 3EOLA 4UTWC 4X4RA 1OVDA 3AA9A 1E6VA 2A3JA 4NAEB 3M0IA 1W54A 3R11A 1FTXA 4MNJA 3U9IA 3M2RB 1C91A 3AICA 4C5ZA 2F9DA 2XTJP 3UG8A 4CO4A 4YMEA 3NZQA 1JK9B 1JLGA 4K0KF 2KKHA 2SXLA 1UWQA 3FCPA 4HMCA 2NSOA 3VGVA 1LCOA 4EGLA 4AL7A 1UMJA 4GBDA 1HIZA 1P6CA 3B03A 2X3GA 1X9MA 3FCHA 2FC9A 2JWNA 1JNZB 1EB0A 5A69A 4MJ4A 4B3TF 2A3HA 3HGSA 1XR5A 1P43A 5D0HA 5KMYA 2QAFA 3KHHA 1IBLF 5BOEA 1XMOJ 1EP2A 4CNYA 3GZAA 3P84A 2M70A 2REQA 2JBMA 3R89A 3RK8A 4F0MA 3QGHA 4D1JA 1XX1A 4WQ6A 5T9CE 3CQHA 9XIMA 2IRUA 4I9TA 2QJJA 4M19A 4YNGA 3T6CA 3R94A 3HD2A 2JFKA 4WSHA 1YPFA 5GNZA 1RWWB 3A24A 2H5IB 4PMDA 3HZEA 2GAHC 3EB4A 2GQ3A 2PEHA 1TVRB 4QGCA 3LI0A 3CLWA 1TK8A 2QVHA 5C9ZA 4WHBA 3I4EA 3VX1A 2BANB 3DFOA 4W8BA 5HR6A 1XQLA 4ZN1A 4C6AA 2RDXA 2EF9A 4MIWA 4J9JA 3ETOA 5HMEA 3M6YA 4PWDA 5D4YA 4AZHA 2A18A 4LV4A 4TVAB 2G0WA 4QR0A 5DCEA 2KN4A 3CCWA 2RS2A 3IRWP 4F3QA 2NSXA 4O1BA 3B4YA 1RAFB 1NHVA 3UD4P 3QQ0A 3EDKA 4GZEA 1UETA 2QGHA 3K2YA 5EMLA 4PTWA 5JU6A 3G1RA 3Q8VA 1S6PA 1HFEL 4NA1A 4HMEA 4JB8B 2YA2A 5D4NA 3CLMA 4P71A 1TPUA 1BYAA 2FZCB 2CEQA 3KBMA 3IVUA 1JQGA 3MSYA 3VIGA 1YZ7A 4LB3A 4WZQA 4REQB 2YNGA 4DR5J 1VQ8S 2VHGA 3VOGA 3MBDA 4JNYA 1NDVA 4NOHA 3LENA 1G0CA 1HGWA 1PC4A 3N6NA 4ZDNA 2EKCA 4ID5A 4MH8A 2Z57B 5HVHA 2JK2A 4RDYA 2FPVA 1F3TA 3LGEA 1FK9B 2PAJA 1XICA 3UPWA 2YPIA 3N34A 1HGYA 1X6LA 2PDNA 3UXDA 4HCDA 3N2BA 3B8DA 2ADBA 4QDWA 1GQLA 3WH8A 4XB3A 1F3WA 2RRNA 2W9BA 4ZXOA 1DXEA 3W2MA 2IVYA 4F0HA 3U2CA 1PSCA 2QYCA 4PG8A 2PCQA 2YJQA 1JPKA 1H7XA 3O15A 4IL0A 2RJGA 4C6MA 5M3WA 3GDTA 4YDDB 1OX5A 3TQVA 1AT1B 2C7FA 1EJSC 3TOYA 1P48A 2E3ZA 2VOMA 1RT2B 1WWHA 3WQCA 4J4KA 2ESCA 3R0KA 1K4HA 4O17A 3RYSA 5DBTA 1GMVA 1WOOA 3DLEB 1KM0A 1ZZMA 1E6ZA 1T02A 3L12A 1LG1A 2CESA 3QPZA 5HROB 1G4TA 1RT7A 4N0RA 1V6HA 1V5XA 1LROA 2DZSA 4B5NA 4JDBA 1NEEA 4C1NA 3GFHA 4TUFA 1U25A 4CCEA 2FHKA 4MYAA 4BR1A 2QCNA 1SR0A 1W1TA 3PFEA 5CPTA 3R97A 1ZM9A 4EPDC 3AD8C 3CJ0A 3H24A 1AZSA 1OD0A 4HYKA 1ZZFA 4A6GA 4GCAA 2QZ8A 1L6FA 2GWGA 2D74B 3NS7B 2ZM6F 1P1LA 1W3HA 4KCVA 4FP1A 3W4RA 4UOQA 4NA3A 4BBYA 4FOKA 3LZ5A 3MY9A 3B04A 1QOPA 3NNHA 1JCJA 3M05A 1XYFA 2RU3A 5KG3A 3CHDA 2H5JB 4JI1J 1B3TA 3P82A 4O13A 3OL7A 1QU4A 1OC7A 1JRBA 3M2UB 5AB3A 1I8JA 4JGDA 3I0SA 5K8OA 1JZ2A 5I3DA 2WWDA 3H7VA 4DR1F 3PRDA 3LBCA 5BXSA 5B0EA 3SCRA 4EANA 3ZZZA 2W7PA 3AFBA 4DX3A 2Z2UA 3PW2A 4CD8A 3LP0B 4JOUA 3HTWA 3WIUA 5KFQA 2JEIA 4OYXA 3H2EA 4X4QA 4DUYF 4O4VA 5D3GB 1UVLA 2X1AA 3S5NA 2QUTA 5FAGA 1MU2A 1QAJA 2QPSA 4HU8A 3CD0A 3GIKA 3OTOF 3OJUA 2V8DA 3P5BP 2IAJA 5D9NA 4EAYA 1UZ1A 1CULB 2AYBA 4QX4A 3CJTA 1M1KT 2UVUA 4QR6A 5B7ZA 3FA3A 4NAFB 2EG1A 3UW1A 4AWTA 3GIIA 5M5DA 5IHSA 2G4BA 2GJLA 4JUZA 2E5LF 4ES1A 4CH0S 3TUZC 4HI2A 1MW2A 3K2GA 3VMOA 3W2NA 4RE3A 1DIDA 1ZGDA 2O56A 3NSNA 1M5SA 1CXKA 2F1FA 1HJVA 1V3MA 2AGQA 1QBAA 5A8NA 4ZPTR 4ZLJA 2A7RA 1KWGA 1XLMA 1P6TA 4AIEA 3TIMA 2ACQA 1NP2A 3T8QA 4DR6J 5FEXA 4YVPA 2Z30B 1NFPA 1ZB5A 3LOTA 1GWJA 3SQLA 3KEHA 3QLHB 1Z2ZA 4P7VA 3N3TA 2BLEA 3N04A 4JOMA 3GNRA 1KRBC 1FT8A 1N36F 4PG7A 3C4UA 4FALA 4NT0A 2DGWA 3FBCA 2E1DA 3PZNA 3ZSTA 4A8MP 3SO7A 1SPBP 1DWHM 4MKYA 3DI0A 3E2EA 4OOUA 5HULA 3V6HA 3P7YA 1Q6OA 2WZIA 4B5WA 4LR7A 5KITA 2VR4A 2F84A 1T9VA 5GMEA 2CNCA 2IA0A 4PMQA 4LRCA 4I8DA 3V6DB 3E5BA 1PYOB 1TKTA 2PWHA 2GSHA 2XGPA 1NSPA 3JYTB 1C0UB 1WKKA 2E9MA 1QOXA 3QHMA 3PJXA 3QGGA 5DLFA 1G94A 1TR9A 3SDOA 1UVKA 5DM7Q 4FPSA 4WXWA 5KFBA 2D69A 3LO3A 1T05B 1JCLA 4QIFA 2I9UA 4B9LA 6AT1B 3TTQA 1RHCA 1GOWA 5BU6A 2K7KA 5LXRA 3WUFA 2XMAA 3UPBA 5GPRA 4FX7A 1DEDA 2YA1A 3ILLA 4JI6J 1HZYA 3MEGA 1MXDA 1OJ4A 1T7LA 4DSJA 4IR1A 1WKEA 3B97A 2F4VJ 3II1A 3D54A 3VD3A 1Q3NA 4XZIA 4ZQCA 4HTIA 2V5HG 1YDNA 4Q2LA 5KZMA 1T8QA 3BZJA 2FKPA 5ENLA 1F73A 3MHFA 2F63A 1OCNA 3SEOA 2YH1A 4GY0A 3OBIA 3CIWA 4DV3J 1MFUA 4LSBA 5HWJA 1Q6QA 3BV4A 3OG2A 1I45A 1HBMA 1TUGB 1VISA 3CIMA 5CAHA 4TU8A 3GILA 4W8LA 4MK8A 2EC2A 2J5AA 1UR8A 4IKAA 3MUY1 3VIHA 2Y5EA 1OF6A 3DXIA 1VBKA 1IJEB 3J7HA 3TRGA 3HU7A 3QLDA 5KT5A 3M8QB 4RR4A 5D2YA 4NI2B 1XCXA 1GXTA 1V6YA 5CPMA 4M95A 1BKSA 2ZBPA 1J4EA 4GYFA 2CG4A 3A21A 4JIRA 5LSMA 1QVBA 2QCCA 3AS2A 4RNIA 4NL5A 2KL8A 2FTPA 1E0WA 4OU1A 2VX4A 1PTAA 1MNSA 2VD8A 1SKWA 5CG0A 5IRPA 3OHAA 2EPOA 2GQQA 4MOZA 4DZIA 2R6OA 2MZSA 2ZEJA 1EIBA 1GJUA 4LUBA 4XSLA 3A47A 2Z0GA 2VFUA 3D1OA 4WZMA 2PDLA 4J9UE 1AW0A 2ROGA 2UXDF 1TV5A 3R0DA 3G82A 3OFHA 4JN6A 1DYSA 1JCXA 1TPDA 3WNPA 1Q78A 2R82A 1BLUA 3KLIA 4NYUA 1FRMA 4OFZA 2GUBA 2WMKA 3VUPA 2VH7A 4DFJA 2CQGA 3VU2A 2W92A 2H8XA 3DHUA 4WCJA 1V9OA 4QQBA 2C1GA 2HNZA 2VT0A 4OJGA 4NZ0A 1NQ6A 1O95A 2D9OA 2QCGA 5D37A 2HWTA 2ASDA 3B8IA 1XIMA 1AXQA 1H98A 1UKSA 3C0JA 2VVNA 2FQQB 2GCFA 3NURA 3QV9A 4JL1A 1E9LA 1GG1A 2PWGA 1TX2A 4D3GA 1SW7A 3OEXA 3PPHA 1VFJA 1H3DA 4EF8A 2VU5A 1V6TA 3VCCA 3TNBA 3N4WA 4NLUA 3KFTA 2BQUA 1H62A 3NGSA 1ITPA 4NI3A 1R8CA 2WCXA 3ZZPA 5HLFB 1EQMA 3R1HA 3FS2A 3GTHA 2HJPA 1UBSA 4AYBD 4ELTA 2OAUA 3PZMA 4M8UA 1FVPA 2Z2MA 3W1RA 3IRXB 3MDFA 4DJFD 5U7SA 1HNXF 3J80U 4JN7A 5KFCA 4TLQA 1E1CB 3K4WA 4GKLA 1N5YA 5J5DA 1Q6GA 2GMLA 1X8FA 1X4EA 3LTSA 1QJHA 5JUMA 3URBA 4G6VB 3K4DA 1W1IE 4HPXA 3W75A 3MUAA 4DEZA 3W3SA 4JI8J 4YN3B 4LTSA 4PYAA 4EUVA 2KVIA 3FVMA 4HHLA 3ZO9A 3PY2A 2I6WA 3I82A 4PTVA 1RBAA 5A8KA 5IM51 3J80Y 5HNNA 1IN0A 4DG1B 1VRTB 4KF1A 3FMWA 1PO9A 1JDEA 3QTGA 3G1SA 2ZZ4A 2QW5A 4PXCA 1V3KA 3HPOA 3VZHA 3OA3A 3NR0A 4LBSA 4UTLA 1VEPA 5K4ZA 1TMMA 3STGA 4ED2A 3TANA 2PDMA 5BYRA 3IANA 2EBNA 3TOPA 2ZWZA 1OY8A 5C24B 2WSFC 1U47A 1D0EA 3M6XA 4Y0FA 1QR7A 1CJVA 3ZNUA 3L2IA 3GU0A 3PJUA 4IG3B 1KN6A 4G1PA 2PDHA 1FNMA 2Y62A 3BH4A 5FESA 4QEEA 3W1LA 4DLMA 2RH9A 2IQ0A 1BYBA 2ISWA 3U7VA 3VGUA 3QKEA 2F2HA 5BRQA 4UTFA 3RG6A 3S6DA 5H8MA 1Q8BA 1HP5A 4HPJA 1V08A 1TIMA 1U49A 3JQJA 3FBBA 4UTKA 2RF2B 5KG4A 5LMUF 5GMKa 4DL6A 4ZO7A 1SFTA 4GXPA 4HK6A 5CPOA 2M9KA 2Z1KA 2BDPA 4M5HA 3VGGA 2C2DA 5GJMA 2VEIA 5G0RA 1R3WA 4POCA 1UKTA 4MNMA 2PODA 3AZRA 3JZEA 2I38A 3T09A 3BDPA 3BLOA 3CZJA 4QJ3B 2DHXA 4YS2A 1F9EB 1S76D 1YTDA 2PDPA 3QSTA 1RT5A 3MUMP 3NL0A 1HA1A 4HKQA 4ED4A 4KH2A 4F0SA 1FVSA 3PFOA 4C60A 3KBJA 1Q7ZA 2XDFA 3KTXA 2HFZA 1TVLA 3CL7A 3LCHA 3ZMRA 1A5CA 2F8QA 1KR4A 3C6UB 7FD1A 4ZO8A 3UCQA 3MCSA 1O6IA 2KZMA 4NLOA 4CLSA 2AAMA 3WBXA 1KGWA 4LUJA 1SM9A 2DY3A 1KXVA 4A2SA 2Z56B 4RUCA 3EWGA 4G1QB 4ZR8A 2G50A 2BW2A 3RHGA 4P2VA 5CABA 1QTNB 4H7ZA 3MZNA 3K0JA 2NQLA 4OLOA 4K3ZA 4WKAA 3DGBA 3PULA 4ZP6A 3I87A 1RHKB 3PBWA 4F7VA 1QDSA 4JTGA 2FVQA 1VR6A 3AO0A 4ZB2A 2R42A 1XLCA 2B0MA 1LLWA 3THAA 5KT7A 3BGUA 2AAAA 1ZA1B 3OHIA 4IUGA 3WQPA 4LSNA 4A05A 2Q8XA 3ONCA 1HL2A 4Q4QA 1EC9A 4RZ6A 1JAEA 4MY9A 2CLKA 3ZZYA 5CZJA 5KG0A 2QAPA 2QGYA 2LFVA 4DBUA 3AD9C 4L3NA 3URQA 2XM1A 4HK7A 2HQIA 1RADB 2MHNA 1YQ2A 2PB1A 4JBRA 2R7VA 1DPMA 1HKJA 3OVAA 2V4JA 5FIIA 5K20B 1UCWA 1XK8A 1VRXA 3KLEA 3MSRA 1V0NA 3NGRA 4PQUB 3L95X 3F73A 1V6UA 2ZHBA 1BQXA 2BOAA 3DECA 1MMDA 4LVOP 3U57A 3GV8B 3U7JA 3NWGA 4PSRA 1GOOA 3GNXA 5E9XA 1UVJA 1CX9A 3WD2A 4B90A 4QIWD 1ICQA 3Q8UA 1MUCA 1TKKA 3W86A 1TYGA 3PFRA 5A6LA 3LBMA 2R9LA 4USJC 3N6LA 1R3RA 1HW6A 4ES3A 3KMQA 1YRRA 2CRLA 2E66A 2DZUA 1REVA 2QLJB 3N2MA 3QH2A 3ES8A 2BSLA 2MQNA 2Y8UA 3DKDA 5FA5A 3WH5A 2KFYA 2XTKA 2YX0A 4ACZB 4M5PA 3W6YA 1RWOB 4MNLA 3WDOA 1MEWA 1LW0B 3SCVA 2HXTA 3FK4A 1D9DA 5EFDA 5A1AA 3MZIA 2CLOA 4RBTA 2FQIA 2R1MA 1EETA 3O6CA 1RBOB 2DSKA 3MPUB 1XD0A 3VFLA 1A53A 5CGQA 2NS1B 5E6YA 3G0XA 2V69A 3PPFA 3TJ8A 4BI5A 1XNQJ 2JNJA 3I96A 1IHIA 1QI3A 5I3HA 2PSNA 3QJAA 1EFZA 5AYYA 1NPRA 2F9JA 3C8NA 1LWCB 3USZA 5C2XA 2KXNB 1N2VA 3V1HA 5AN7A 4A48A 1O94A 4S0MA 4L75A 1PV8A 1Z2LA 2A0NA 3HPAA 3MMJA 3DYMA 2GZOA 3WK3A 3SQSA 3ARQA 5E5CA 1ITUA 5LSLA 1R2SA 1SUQB 3IP0A 3KLKA 2NQZA 5EHHA 3Q8PB 4A4AA 2D3NA 3N14A 3L9CA 3CWHA 3QLLA 5AC8A 5LIKX 1I9CB 3KK1A 3W1PA 3W29A 1L9WA 2E7FA 4OGZA 1JFXA 4NRTA 4OIXA 4B3SJ 2XVGA 4C6OA 1X5PA 4PUNA 1SKRA 3G6VA 2WNNA 5ABGA 2QEXS 3ET6B 4NLSA 5MLCV 1M5HA 3SIPB 2P0OA 4DPPA 3NOYA 3HD1A 4AZIA 2AD9A 2IKJA 4W8AA 3RCMA 2VBXA 1NUEA 2E5IA 4B02A 4GG9A 1FFRA 2XEXA 4K8RA 1H5YA 3NKYA 1HT6A 3PUOA 1LK7A 2U1AA 4IFVB 4K2JA 2VZTA 3LAKA 2P6TA 4LBRA 1KDNA 4Q4SA 3BAXA 3SIZA 3IM8A 3UNYA 1XN9A 1OGBA 1P0DA 2HW3A 4XAPA 5BWFA 2DB1A 3QAEA 3OPKA 4QPTA 1VPYA 2RDTA 4Z1BA 4TX6A 1ZHAA 1FRBA 4A8FA 1UVMA 4DF1A 4KT0C 4JI7F 1NCLA 3NZRA 3M5XA 2PMHA 1HNIA 1GQKA 3F4CA 2QR6A 3MPWA 4A8NA 4R3UA 4XAFA 1TMQA 1O5KA 3H21A 5EFFA 3W73A 1E0VA 2A21A 1DQ8A 5CJMA 1TKXB 3SECA 4K5SA 4FLQA 3KTQA 3KUEA 5GQBA 4RDVA 2NLIA 2ZXAA 2X3DA 1R2TA 4FPRA 3F4DA 3IVSA 5C9RA 1Q65A 3MI2A 3G96A 4GINA 1S6UA 1VBHA 2W4DA 1GHRA 3HSGA 1WDPA 1U02A 3ZVHA 1RDRA 5E41A 4DR2F 2BOPA 5G2HA 1C1CA 4EWJA 4NX5A 1ZAVA 1KW1A 4PMXA 3UQNA 2BOEX 1M5VC 3G1HA 2W6RA 1ZBWA 4KWOA 2P0IA 3WL0A 3FLUA 3L4WA 5M2PA 3B06A 2DHGA 1XD1A 3WEOA 4F26A 3NYDA 5LA2A 4CNZA 3WHIA 1Q95G 2PDJA 3RGTA 8TIMA 5FJ4A 2G1HA 2FVLA 3TMLA 4DR4J 4KV8B 3UJSA 4Q22A 4R7OA 1ZENA 5C42B 1FE0A 2VZUA 3CV6A 1K02A 3W6MA 1A4LA 3CVKA 1WO2A 3P14A 1VKFA 4KRWA 1P27B 2CETA 5LNWA 1CGWA 1W1VA 3TA6A 1SSGA 4GVLA 2MHEA 1X5SA 2V34A 1OINA 3TWBA 2Z1SA 4LAZA 1VOMA 4NILA 2ISDA 4MAVA 1SQEA 1GVOA 2A85A 3L4YA 4P72A 2X41A 3GXFA 3CGIA 1QW7A 4WOQA 5CJNA 3REQA 5A8PA 3CM4A 4KQZA 4F4AA 4ES4A 3W85A 3LDVA 1LOLA 2NZ4A 1EWEA 3GKAA 1XLLA 4I7WA 1O68A 2JLGA 3N13A 3CMFA 3R2CJ 1XYCA 3VNJA 1M01A 4HH0A 1W2BR 2LEBA 4QW8A 4LF5F 3C6TB 1Y5WA 3C5QA 3GD6A 1H38A 5A2CA 2CQ3A 5MHBA 4FR1A 3G1DA 5LIWX 3QYYA 9RUBA 3QMSA 1RAEB 3K59A 4AD3A 3O9NA 5L1JA 1HFBA 3I4HX 4J5OA 3LMZA 3PJTA 4IFKA 2YCLA 4GFIA 4Y8FA 3Q8YA 2PLMA 2EKGA 1C7SA 1WG5A 3DFPA 3TEGA 1GNXA 3S2MA 1UH4A 2ATLA 2IMRA 3HF5A 3N73A 1S1WB 5CLTA 3IO1A 1U1UA 1YK9A 3QY8A 4GFSA 4QQUA 1KSPA 1TPEA 2ON3A 1REGX 2DH7A 4BWLC 2CIPA 1GOQA 3NCRA 3M7WA 3KDNA 3NMRA 2O0TA 4PXDA 4TOQA 3ADAC 4LYPA 2DXEA 3EDRB 4C7GA 4WFZA 1S77D 1ZBCA 1G5AA 1YADA 3F5KA 3AWOA 3ZZ1A 1TMJA 1O51A 1SQGA 2GGPA 4W84A 2O4MA 2FB3A 3SBMA 4BHQA 2AV5A 3N3MA 4ASTA 3KOWA 1OFQA 4NY2A 1DIKA 2HBZB 1UR4A 3U2ZA 1M53A 2UY3A 1CJTB 2OPPA 2WW8A 4A8KA 1NWSA 2ZCGA 1FVQA 3FFIA 2GMHA 4CEUC 1DTTA 1VQSA 2KZHA 3UETA 4TV6A 2QA4G 1GH8A 2Q3PA 3WQ8A 1SC6A 2X7VA 1TMLA 2W66A 4DIAA 3WUEA 3WQVA 1NJZA 2BKNA 1MUMA 2ZDRA 2AP6A 2B81A 2YL5A 2LA4A 4JI3J 5I3UA 4FYDA 3VM7A 1WZLA 1C8XA 4IQLA 1VH7A 3OBKA 2Q1LA 1OFAA 3AXXA 5TAOA 1NHKL 4JN8A 3QWUA 2NYIA 4X62J 1GK8A 1NU5A 4IMAA 1NSAA 4J90A 2YQ0A 3W9ZA 1JDDA 1KRMA 4K7YA 4N7QA 3EBVA 1JF6A 3TYZA 1FFSB 2FVPA 3ELHA 4CNTA 4B3MJ 1QJWA 2ATMA 3BK0A 2UXCF 4R0JA 2I5JA 3P61A 3EAUA 1ZBVA 4R33A 4DXXA 1Y5XA 4I8YA 4UNIA 4ZITA 5B0FA 4GQ0A 2WMFA 2KDOA 4OZ1A 3I10A 2EWHA 1M1HA 1WEZA 3QZEA 2R7TA 1NH7A 3C0SA 1HN1A 3ENVA 1O66A 4XKYB 4WPAA 4IO9Q 3QQCD 4RPPA 3KOYA 3ZJ8A 4BQ5A 4LREA 2N7CA 3FSTA 4PG4A 2ZVRA 3WQWA 3GIJA 2B6AA 1RT6B 3D28A 1R0BG 4TQSA 2B7PA 1M5WA 2OD4A 3E2SA 3TC6A 1VJQA 4ZPWR 3FIGA 4I2QB 4ECWA 1D9FA 1FJEB 3IS9B 6ENLA 3IUHA 2DQWA 1UTAA 3GTIA 3QO9A 3VD9A 1RTJB 2FHJD 3V4IB 2XMUA 1NK5A 1FCBA 1G4EA 4HDGA 4KWVA 2C15A 4H2CA 1SZGA 2QHAA 1PBUA 3BKFA 1LP6A 1YBQA 5M1TA 1PCKA 2NR0A 2GPTA 2V8VA 2QGFB 1DQ9A 4CNNA 3GJTB 1S9EB 1U1OA 5KTLA 4EXBA 3M8YA 4JI2F 4LF9J 4PKDB 3HJFA 1Y8BA 3GVVA 1MWZA 3DYOA 4MAZA 4UTJA 2AYGA 3H54A 4GX8A 1WKLA 4GNKB 2DIUA 1KR1A 4MIAA 2VEKA 1BGGA 5KG7A 3WQOA 4JV2A 3CCTA 1JVNA 3RPTA 3QGKC 1FWIC 2CLMA 3H7UA 1YRUA 1TV6B 2QRRA 1AFIA 1HI1A 1YJUA 4Q33A 2XMKA 3IAM9 3IJ7A 4OWGA 2PIIA 1B90A 4O4WA 3PPCA 1RWPB 3CQ0A 1HO1A 3UWYA 1R9XA 3TA1A 1BXCA 5GJNA 4B92A 4MJMA 5KINA 5DDOC 1AD1A 1DJWA 1TAUA 2QPXA 2KX9A 3QZ7A 4K0KJ 1MN7A 3KRZA 4IISA 3HV9A 2XM2A 3CW2C 3UPMA 5PTDA 5TQLA 1DIOA 5F3ZA 2OYKA 4AZCB 4J9PA 3V81A 5AHNA 1HBOA 5E3CA 1OYAA 4RZBA 4AD5A 2G1DA 1ZZNA 4L4LA 4JI4J 1S3TC 1ZBKA 2C14A 4B3TJ 1SXLA 2VFVA 2UBPC 3SJNA 4OZOA 2E68A 3H26A 3TYDA 1DHPA 2VWTA 2MTLA 4ZXLA 3NQCA 5I3KA 5F1UA 2XN1A 2C22A 2VKZG 4K2SA 1K4GA 4P7LA 4YYCA 4K7QA 4XO7A 4BLGA 1J96A 2WVBA 4K4WA 3PRVA 4A8QA 4S3BA 5AHLA 1N8RT 3MEEA 3WUBA 1B70B 1DORA 2PWVA 3B9DA 4ZVRB 2D1ZA 2YCIX 1HQEB 2OP5A 2EBGA 1K8ZA 1R7OA 2GGGA 1NDLA 3I7QA 4HK5A 2VQFF 4NCAA 5LJ3Y 3A5FA 2J77A 3NQGA 3GR0A 4PTDA 3UERA 1RE1B 4Q8EA 2PDGA 3DRPB 4KR0B 2VFTA 2VWSA 5MKGB 8RUCA 2OTJS 4TY9A 4F4XA 1X4FA 3MI6A 3ZJ7A 2NSCA 3P80A 3PVFA 2R4FA 2WVCA 2FFCA 1MDRA 5A6KA 3OR2B 1HVXA 3GX9A 4IH6A 1RT4B 2DRDA 4HPGA 2KHCA 1TAQA 2VFRA 2GNKA 4XZMX 1MEHA 3C0LA 2UZAA 1LORA 3UJEA 4X66J 4LCQA 3BO2A 4IWWA 3CUNA 2J9XA 1T96A 3F44A 4WBFA 3C3LA 5HP1A 4RW6A 3SM0A 3KBWA 4IG2B 4A29A 4C4WA 1HKAA 4B3ZA 2HMCA 4M24A 2OOFA 3ARRA 1HUVA 4KRTA 4FLRA 1J11A 2F61A 2EEYA 3NRBA 3PTQA 4KO0A 4O0QA 2ZH2A 1EIYB 1G4SA 4LUSA 2NWRA 5C9WA 1NDCA 3WH9A 3C61A 2Q3RA 4I7UA 3W9JA 2FPTA 4FP9A 1DQUA 1NNDA 1PZ3A 4CD4A 1FKPB 3AXMA 5E33A 1VBUA 1VHCA 1H11A 2KTQA 3GR1A 2PE8A 4A8OA 4ONVA 1XIEA 2VD3A 3R7MA 3QT5A 1XLEA 3LNMA 1J2VA 4UWMA 1FE4A 5ECUA 2LQ9A 3UVJB 3BOLA 2NCKL 3WNOA 1KQZA 3WQ4A 4LVFA 1ZPVA 4IXXA 3GDRA 1WHXA 3FJLA 2MDAA 5D4OA 3GYGA 2YNIB 1EPXA 2ISSA 3S6TA 5IZHA 3P49B 1BD6A 3L67A 3CTLA 5F8LA 4M5MA 2BHUA 4O1CA 1Q1KA 4B3OB 2A1YA 3LBOA 4IO1A 5HBMB 1SPQA 3NGTA 2R8KA 2ZX6A 4Q4RA 3M32A 2VZOA 3KWMA 1T8XA 5L39A 4J9MA 1V3IA 2OPSA 3S47A 3BYRA 4ER8A 2CXEA 1QI5A 1S2AA 3H5SA 2YTCA 4MK7A 2FPHX 4PCFA 4HL9A 2KYXA 3UDCA 4P7RA 3S6EA 4NVTA 3IBFB 3BDKA 4UOCA 5E5NA 3KUGA 4MG4A 1FA2A 4I7FB 4ADTA 2GC8A 3AJ7A 4JKLA 4AY8A 2EPIA 1W0MA 2DGOA 1UVNA 3A8IA 2W24A 3WL1A 1OFOA 4ZP7A 4U8YA 4QJVA 1CZ1A 1EJTC 2PDWA 4FK9A 4CCZA 1MMFA 3N9UC 3BG3A 3CJ3A 1U5JA 1WA3A 2BG5A 2POTA 4V19X 5CYQB 5J2QA 3TARA 2JIWA 1ALDA 2V5JA 4WDWA 2FTWA 4K50A 3DNCA 4JTSA 2DGQA 2OO0A 3M46A 3QSRA 4LC6A 2G5WA 3BR9A 1K1QA 1X6UA 4GABA 2F65A 4P7OA 5GAEI 5LHEA 2F9RA 3GYNA 3GQCA 5DGAA 1F74A 4ED5A 1GVYA 3TA2A 1XLAA 3EVWA 2B4VA 2FJKA 1VJWA 2ZUAA 2PEVA 3RPMA 4NJGA 1WC4A 3APYA 1TPFA 2HVHA 3RNDA 1NDKA 3M1ZA 3M47A 5JIWA 4MTPA 1FP8A 1UWBB 1HLWA 3HFVA 4HNVA 4DR1J 2BRLA 4DUZJ 2J7KA 4GBUA 2ZA1A 1FDNA 3D5HA 3WO8A 3C14A 1CB2A 1MXGA 2YZRA 4E5TA 2AX0A 3D68A 2QUVA 3G8TA 1BHGA 4HVXA 4UY8T 3LQLA 1B5TA 1OEPA 1EA0A 1S6PB 4QSFA 1C29A 4LJ3A 2JL9A 5IM0B 4DUWA 2W2NP 3CIXA 4F40A 3R8YA 4DUYJ 2C28A 4QE5A 1H7NA 4HZMA 3TJXA 4KH1B 2VG7B 3SSJA 3OTOJ 3V4BA 1SI9A 3PZTA 1KR0A 3P60A 2P6SA 3SCWA 4M6UA 1WAUA 1ONWA 5IDIA 3U6WA 4TU9A 4AD2A 4LAOA 3DN5A 4DQSA 5AHMA 3AMLA 4P10A 2E5LJ 2FHBA 4OYIA 4WD0A 1UIOA 2QXWA 3CPUA 5BNKA 4ZQPA 1PVNA 4A3HA 4JL2A 4KHPF 4ZFMA 1VIZA 1QNQA 4UTTC 1LWHA 5KFDA 1W1ZA 4DJFC 1R6WA 5A6JA 4KPLA 3HZGA 1WAWA 2IMOA 4HZ6A 2XYLA 4LRAA 3GHUA 3MHUA 2DNNA 1CLKA 4ORMA 1FHLA 2X1RA 4UIOA 3TZFA 5T7LA 5GAEU 1W3KA 1IIHA 1TWDA 5E3PA 3M4XA 3E0VA 2VJVA 3MU7A 3IJLA 3E0FA 2OZ3A 2FH8A 1RY0A 3J81j 3COTA 4YN5A 4Q3MA 1N36J 4U7UK 1WUUA 4NNBA 3AODA 4NYOA 2A6LA 3I5CA 3BLFA 3CE8A 3W76A 3FEXB 1IIGA 3VZZA 3G2XA 4RNMA 3OXLA 4AEFA 2YWFA 2QL5B 3OW1A 3RB6A 1GMUA 3TLQA 1RCXB 1HKVA 3G8RA 3BL3A 3QJLA 4AY1A 3B6BA 2R1KA 4MB3A 1UFLA 2YLAA 3DHXA 1FEHA 4X4TA 1IZKA 4FHAA 4KYZA 3GXDA 3QBUA 1YRTA 2V5DA 4RNHA 3BSOA 1VC0A 2HVDA 3K8WA 1PKLA 5HBFA 3KMSA 2J7DA 2OLSA 3HVTB 2ILZA 3W2VA 2VBWA 4GUFA 1YEYA 3PEJA 2J8AA 1WTBA 1TVPA 4W89A 3R10A 2HWIA 4Y2IA 2IFXA 1PAEX 3LRLA 1OFBA 4F4WA 2WJFA 3OQEA 2GQ2A 4UZCA 3ZXWA 3VABA 3W7BA 3ITHA 5I2UA 3AUOA 4FEZA 1N32F 3IGXA 3OZOA 1U22A 3LK6A 3L9ZA 1NDPA 2TAAA 1QPRA 2PC8A 3CHEA 4HKPA 2CNKB 2GDUA 4M56A 5AHFA 3TZWA 1FX6A 3W7QA 4UNKA 1LV5A 4PCSA 2CPEA 3I0SB 4TV5A 2HHPA 3A8KA 4M29A 3GSDA 1OFEA 2FLIA 1DV7A 1QHOA 1T5AA 1TV4A 2E1RA 5KETA 4L72B 5F9NA 1GW1A 1L6WA 1GVIA 2E4TA 2MQ8A 3A3NB 1QK2A 4IR9A 3EA1A 3AQPA 3R5DA 1VZWA 1Z44A 3FMBA 4ZGYA 1H09A 4JV0A 1LL6A 3CDWA 3R25A 5GVJA 1UG6A 3I3DA 4ZQRA 4OYMA 3TYBA 2OJPA 2IJNA 4DV5F 2ZHAA 3AXHA 4DL2A 3M8PA 1FDZA 2DEIA 4O3SA 4DBEA 3CMQA 5EWGA 3LHZA 1XEZA 1PX4A 1TZZA 1V51A 2UXDJ 3BKTA 4M81A 2O4QA 3CCRS 3ENLA 2YDSA 1ZJIA 1GORA 3LAMA 2ADAA 2CC0A 1FP9A 2E29A 4LRDA 5G1MA 3N4AA 2DT2A 3FV9A 2BACA 3GHTA 1W5MA 1JLAB 4WGHA 4MIMA 4AD6A 3AAMA 1PZ2A 1U2FA 5A8GA 3CAWA 1KTVA 4K6AA 4G6CA 5HVFA 3FQKA 4ZL1A 3W25A 3NLCA 1UP0A 1GVSA 1RA6A 3PBMA 1AFSA 1QBBA 2GJ2A 4J9VA 4N9CA 3ABQA 3D1HA 3NPVA 1J8VA 4HGXA 2C6QA 4I90A 4WXZA 3A4TA 4IGHA 5FJJA 3KS5A 3CT7A 2ZUGA 1A5BA 1W5OA 4AUBA 3BANA 3KL5A 2POKA 3A22A 2IM1A 2VL1A 2YR1A 3NPUA 1BTMA 5JBEA 3IIOA 2JGQA 2J7CA 3TVYA 1QI4A 2EPLX 1KCLA 1AQ0A 4O0KA 2K3IA 3W61A 2TPSA 4H4MB 1PB0A 5DELA 3SI8A 3OU8A 2OX1A 3L0KA 2IC3B 4AF0A 3SZ8A 4RJVA 1EEXA 3BGAA 3SRFA 3BQ1A 3W02A 4B3KA 5HJYA 1JZ7A 4YVVA 4DF0A 1LF1A 3NCQA 3LW5C 1V3HA 4KFPA 5ETTA 3BLPX 3T07A 1P1TA 5AJ3F 3TQ0A 2NXCA 2DZPA 4GYPC 3OUYA 2QCEA 3G0SA 2JKAA 6TAAA 3L4XA 2VGGA 3IC1A 2YL6A 5AZ1A 2CNOB 1JWWA 3HURA 4JIHA 1WKJA 1RTDA 3D7SB 1G69A 2PBGA 3R6IA 4U5IA 2YQ1A 1M1GA 1YITS 5HXMA 4QWBA 4L4MA 2YA0A 2GWNA 4O8RA 3U48A 4GI4A 3UDEA 4B15A 2J9DE 4DV2F 4IXHA 4Z2KA 2IIHA 1B3WA 4GKTA 4B91A 2V68A 4MDPA 3TQEA 4RW3A 3H55A 2VFDA 1REQA 5CYJA 3C15A 3NM1A 3IFEA 5JUVA 3BSNA 3UZYA 4DDFA 4WIQA 4LQ1A 4ZCLA 3WSUA 4FKXA 4IIEA 3IGVA 1WHWA 1TZ7A 5HINA 2FJAB 1W1A1 2QMXA 3DEQA 1E4IA 4JV5F 4GRSA 1Q45A 1IEQA 4KS0A 3THVA 4ORIA 2ZBTA 2VZVA 1SMDA 5I0DA 3M2VA 1S57A 3I32A 2D20A 1KQYA 1XLBA 4L6DA 3TAMB 1S10A 4Y2KA 3L66A 2Y5JA 2FZMA 4U7CA 1A0CA 4PB3A 2DCLA 3QGPA 3NPWA 1KEKA 3AOCA 1K9FA 2FJUB 1MRAA 4DZHA 3NXFA 1JLBA 3UZ5A 4PTXA 4GVFA 1RK5A 3T40A 5BCAA 1WF1A 5E2QA 3UEQA 2CFXA 3IG1B 2V3EA 3DXBA 4ZCKA 3N5FA 1V3LA 4CLPA 2VURA 4UR7A 4EPEC 1UH2A 1RU2A 3OL9A 2XWEA 2JF7A 3FX4A 3WELA 4DOZA 4UC5A 1FKWA 1W5PA 5LMNJ 5HUPA 3ZFVA 4ITSA 2BRKA 3UZXA 2QDDA 5A2BA 1Z41A 2ZWOA 3EUNA 4IPJA 3S5ZA 5LA0A 1WORA 1GOIA 3TZNA 4C98A 3AC0A 2UP1A 4DZDA 3VMNA 1E4LA 1M5OC 3GAYA 4C1KA 2RSQA 1XIGA 4WLCA 4X84A 1X7FA 2C8NA 3CB8A 1HD0A 5BU9A 2ZRXA 1HKWA 3UESA 4EAMA 1IXNA 2WMHA 1ICPA 4DEFA 4S2BA 4NXNF 2X51A 4E3VA 1H2JA 4DM2A 1GEHA 3D6MB 1HR0F 1J0JA 1WKFA 2G4JA 3SCKE 4QBXA 2V2HA 2VMFA 3CUXA 3VDBA 1BMQB 3MVTA 4ZHRB 4OQJA 2MKIA 5FL0A 5FACA 2VC6A 3BAWA 2Q8ZA 2PS2A 3GNOA 2XM3A 1CC8A 2PGCA 1JUBA 3SW6A 3RN6A 1T03B 2DNMA 3MTKA 1WTFA 3V4MA 2IYIA 4J9NA 2UUBJ 2BDQA 1XGEA 5B7WA 4D3HA 1T9YA 2X1IA 4FVMA 3VR1A 1MO0A 1EH9A 2DZXA 1E6YA 3M0VA 1GKRA 5TD4A 3H2VE 3HO1A 3AFGA 1UP2A 1DJXA 2WLYA 3PKYA 3EWUA 5DG7A 1UROA 1MWQA 2TSYA 2BJEA 2Z1XA 4AUKA 4L1XA 1NOFA 4HZ7A 3BLIA 2KT3A 4M5GA 3SYZA 4HCHA 1K03A 3TJLA 2BVTA 1WDWA 1OYBA 4B5UA 2Q8LA 4XZBA 1TV7A 4DQIA 3UXAA 1UJ4A 3VGFA 1WBJA 4NAEA 3DOLB 1JJCB 3JTOA 5EMMA 3M2RA 3R5CA 1BHNA 1Q0NA 2BFGA 5D9OA 4EU0A 3I6TA 2HZCA 4PCTA 2RKIB 2XS2A 3FZBA 1MROA 1BXBA 3RAOA 1BQGA 3ABXA 2WYSA 3R7NB 2YX7A 5D9MA 4XD5A 2R2TA 3TR5A 5IBXA 2HBXA 4RL1A 3GFYA 2GL5A 2D3O1 3BREA 4KB7A 1N88A 2VV5A 1VQ6S 3NL6A 1HQUB 4LRTA 5FD1A 3VV2B 3F4WA 5G0RB 2XY5A 3TAQA 1JX4A 1ENUA 3QIDA 5D2WA 2XO6A 2BY2A 3U8GA 2HQCA 3KZSA 3M5ZA 3MWAA 6PTDA 1MQRA 2D24A 2RJZA 1PO6A 4LVGA 3DOMA 3I0RB 1CG2A 1S59A 3N6JA 4LJMA 1RT5B 4DSKA 1F5ZA 1X6NA 3MS8A 3T9NA 4MKVA 1VGAA 2K1RA 2R7WA 4HD5A 2GYIA 1FCQA 1SSDA 3ZLHA 2FDMA 4H83A 4L6OA 2M88A 2UV8G 4B5TA 1JZ4A 1JQVA 5I3FA 4KWUA 2XH7A 1ZAWA 2XC9A 2CZ9A 4ERDA 5C54A 2OLWA 4LUIA 2DJLA 1TVRA 1W1YA 3KLGB 2QJIA 2FVSA 3T0TA 4K8GA 5FF4A 4QYZJ 3BJFA 3SQMA 2BANA 4C8LA 3GH4A 5KFSA 5F8JA 1I51B 1CDGA 1RUSA 1MVYA 4NU7A 2ZFHA 3MWCA 7TIMA 1F2HA 5H1SV 2VDHA 1R7IA 1UFWA 5L9NA 1X9WA 3HHLD 3AHTA 1F3EA 3WMLA 1W56A 4OZ3A 2E8ZA 1RTZA 3TX0A 3OLIA 4C6IA 3TQKA 2PTWA 1WNEA 2NXEA 2GJFA 2WW4A 3I31A 1N6QB 3T1YF 2O7SA 1PJ9A 1B4EA 4AEEA 4J2MA 1MN9A 2PP0A 1W26A 3BR8A 1XJWB 3E0IA 3DM2B 2H3BA 3U7BA 4OYWA 1PZ1A 1EJUC 2NSBA 2QJMA 4P7NA 3AB2B 1TPH1 4HIBA 2C3MA 2BBEA 3SCIE 3A6OA 1EJXC 2NXIA 1RCQA 2OSYA 1ESWA 2JALA 1KKHA 2HZGA 3LCIA 5E0OA 3C2OA 4WK9A 4Z2LA 4NE9C 4TQRA 4REQA 2XMVA 3GBEA 2HXUA 3W7KA 3MF5A 4G56A 3LY0A 4YR2A 5HQ8A 4JX5A 3ZOAA 2R91A 1XBVA 3WFLA 4C1LA 5GADI 3KLEB 4MZYA 2AGTA 5I06A 3LX9A 3JQMA 4M0XA 4DV0F 1KLNA 4WGXA 2YX1A 1AUSL 3ENAA 3SEPA 1WHVA 1TL1A 1H41A 3JAMU 1FK9A 4EPBC 2ZH8A 3ZC4A 3FSYA 4O50A 2CPFA 2F8MA 2DHSA 3GVGA 1QATA 2VQUA 4JFUA 3JZUA 1RHMB 3N17A 4P5UA 1SIWB 2ROPA 4JP8A 2HZVA 3KJQB 2HISA 1IWBA 1XS2A 3Q0AA 1DY3A 4QP0A 9ATCB 2XN0A 3MPVA 2V0TA 4DYEA 4X22A 1JI1A 4I6KA 1OADA 3TONA 2BZNA 1D7FA 3GDKA 3STFA 4USMA 2K7JA 3JAMY 3BCFA 3N9SA 2WMIB 1RT2A 5FI8A 4DM1A 4DFKA 2FTRA 3F5LA 4KCTA 2PRLA 1F07A 2J7EA 3LCGA 5D8WA 4DL7A 3UR8A 3CT9A 4HSNA 2DIKA 1FCAA 2A1BA 3DLEA 4RW5A 1SJAA 3VOCA 2PDFA 5HROA 2X30A 3SGZA 4JTEA 2MQMA 1ZJAA 1UH3A 3WLQA 2VL4A 4V1XA 4USKA 3C6CA 1NRKA 4ZVGA 4OYPA 1W9UA 1JAKA 3W74A 1EARA 1DAXA 3G1XA 3TUPA 1G7VA 3OVPA 1IXPA 1E4NA 3GTNA 2Y8YA 3LGNA 1R6VA 3C19A 2X2GA 1GTHA 3DGVA 4OZNA 1KBJA 1KOOA 3HOJA 4Y6IA 3DFNA 3PSWA 1HWUA 2B8QA 3WC0A 4DYJA 2OMOA 4I6VA 1Q6RA 3W87A 4DWSD 1UP1A 1JLFA 4PCNA 2XQCA 5C7VA 1JYWA 3SV4A 1TZ9A 2KM8C 3B8SA 3T0BA 2RIJA 1F1BB 2ADCA 4KCWA 2XULA 3M2UA 1WEYA 3KK1B 1LLZA 4YTUA 4CU6A 1C9WA 2DSZA 4NRUA 3BPSP 1VFHA 1GPWA 4FO4A 3CMJA 3TZYA 3O1LA 4DUOA 1BSLA 2CLIA 2QE5A 3HVRA 1Z8AA 3WFAA 3RLHA 1RI7A 2HTMA 4ZMMA 2YSWA 5D3GA 2ZNYA 1T8EA 3CULA 2ZKTA 4YCOA 3QV7A 3CJRA 2JHEA 2R24A 4S38A 4PUDA 1JKHB 1U2CA 1CULA 3EMZA 1HJXA 3B05A 2FVMA 4LYKA 3CSKA 4NAFA 3KVJA 4XUYA 1QW8A 4AMAA 3DYAB 1IXKA 4DUTA 1R3YA 2DQXA 4XTIA 2HHVA 3K5PA 3NNCA 3ARWA 2EEXA 1N0UA 5IC6B 4UQ9A 4TLRA 4Y2CA 3QRPA 1M7OA 1TWWA 1SZRA 4I6WA 4KE5A 3FA4A 2G0JA 3HFKA 1JCTA 2V5KA 2X42A 3ILIA 3MEDB 4ZPCA 1H7RA 5L46A 2BOFX 1XR6A 4L9XA 1S46A 4AEOA 3B4DA 1NVMA 4ERGA 3MAAB 2DZBA 1UVIA 3N12A 4ZMGA 8A3HA 4G8TA 1WE5A 1TUXA 4LSLB 3MMCB 4EZ9A 5A8WB 4CH1A 2HAFA 3UF9A 2FZ8A 1UQZA 4JTHA 4IMFA 2XCAA 1DFDA 1EC7A 1C1CB 3KOZA 2YDAA 1FWRA 4GVBB 2ALZA 3LWMA 2ZC3A 2CLEA 4K4UA 3N29A 4GVGA 1RU1A 2P50A 1EDQA 3TW9A 4EKJA 4MKBA 2HZAA 1OSCA 1GTEA 1G4CA 4WTOB 1NU4A 3V6DA 3HQOA 4I3GA 3JYTA 3S42A 1S97A 2UXCJ 3ME3A 3QF0A 4LPCA 4WK3A 1F6KA 2EHHA 2QT7A 4NRRA 3CDBA 4H19A 1W3NA 4HA3A 1CWYA 4OVXA 2Y1JA 2E28A 1ZFJA 1WZMA 2P9GA 2FHFA 1RALA 2DT0A 3H0PA 4W4QA 3QWPA 2AJQA 2H51B 4PBGA 3VNMA 2BOGX 1R3TA 2ZNZA 5SWUA 1FD2A 5CCMA 3NSXA 1RTIB 3ZO7A 6FD1A 2ZH7A 5TIMA 2XSBA 1MQQA 2XY7A 3H5UA 1X7IA 2B56A 4EOUA 4JTAA 2NVAA 3OQ8A 4E2DA 3PBVA 3FGCA 4DY1A 1S4FA 3VCRA 1VBJA 4JI1F 4M94A 4FF1A 3OW2R 2XWXA 1FDDA 3RX3A 3PM6A 4S3EA 3RRHA 2WOMB 1OSDA 3SQOP 3CCQS 1JLCA 1BE4A 3PY8A 2KM8B 2GVGA 3C2PA 1KM6A 4IUFA 1UKPA 3EWCA 2VPZB 3ARYA 2YCLB 2ZXBA 1ZAIA 2YKNB 2MKHA 1A50A 3M8QA 5H6HA 4YTTA 2ZD1B 4NI2A 1FHVA 1HO4A 3V5CA 4UTUA 1KRAC 4DS5A 1IR0A 3EZUA 1JXEA 2POZA 1FO1A 1XC6A 3BH6B 1LLOA 5DMYA 3V6JA 3AU6A 1IKWB 1Z6KA 4GWEA 4HH1A 2XH0A 1H7PA 3CYVA 1K8XA 1YSJA 3OFEA 2H4YB 4UOGA 1Q8KA 2WHMA 1A5UA 3ALGA 3HQNA 2EFGA 3J7YU 2WK4A 1DLOA 4F2RA 1UIPA 3N6HA 1ZAXA 2OXNA 1NIUA 4TVUA 4PODA 1VLIA 4S3DA 3QYQA 1SV5B 3B0XA 4U10A 2AQOA 1WSVA 4W92B 3CZKA 4UQTA 3GZ3A 4YXGA 2CWKA 2BS9A 1WF0A 2WHKA 4UOFA 1QVFR 4R53A 1KCKA 2BYCA 4PYDA 2Q6CA 2NVDA 1RZMA 3MI3A 2OPPB 4D9PA 5A2QU 1HYSB 4LBIA 4ZVEA 1FDBA 3G24A 2XIQA 3UCUP 1N8FA 1VQKS 2VG5A 1NM2A 3I5BA 4K4TA 4MKNA 2VGFA 1H0GA 3CJ5A 2BM1A 1S1PA 4QG9A 2YH0A 3H90A 4OV4A 3LEPA 2F5GA 4UFMA 1AODA 1WOSA 5D0GA 4RW8B 3UT0A 3E2QA 3KE0A 1WI8A 1XH0A 4B9ZA 3VE7A 3AHZA 4ANCA 3OHMB 2J24A 1ONRA 2V2QA 3HJZA 3SRDA 5A2QY 3RJYA 4UFIA 2CPHA 3UY7A 1NWTA 1LKZA 2ZBIA 3BICA 4N9BA 2WJZA 4ICMA 1D8CA 3GH7A 4O0NA 2YWWA 1E1CA 1B57A 3G8EA 1RWNB 3WLLA 4DV7J 2Y70A 4UOZA 1Q7YT 5HQLA 3LLFA 1FCVA 1XBWA 1BD0A 3WLOA 3TN3A 3HSDA 1JJHA 3H23A 2VQFJ 3LH2S 1RYRA 3ARZA 4F3OA 4JTLA 2GLKA 3QC3A 2NPIA 5CEWA 3K89A 1R2RA 1EHAA 3VHQA 3FCVA 4H6KA 1BXNA 3QXBA 3FVYA 1IEVA 2J7FA 3RFAA 4DG1A 1VRTA 1ITXA 1N4LA 4JI6F 5HMSA 4NYPA 3RR8A 3EX7B 2A10A 2G4FA 1QTWA 1GHSA 2B6AB 3PO5A 3WF2A 2F4VF 4H8NA 4EACA 3TA9A 5C9UA 3Q2DA 2BP1A 3D46A 2LXFA 4PMUA 1OBAA 5IFTA 1RQHA 2OMLA 1SJBA 3EB2A 1AJZA 4Q8MA 4KFNA 2C16A 5ETLA 2DZTA 1TV2A 3GAKA 2HMIA 3LG3A 4DV3F 3SFGA 5C24A 4Z37A 4QE1A 1NJXA 4JQ2A 3TV8A 4IG3A 1UYQA 2QPUA 1WX0A 4JDYA 1WKYA 3BLLA 4UUIA 1XYBA 4DXVA 1YLVA 2OR2A 3C2YA 5EX3A 4JZ5A 2LQ8A 1PSDA 1O5XA 1YQHA 4GC7A 4QJ4B 1TL3B 4YTRA 3W5YA 4MB5A 4X3ZA 2UUAF 4US6A 1FNXH 2QMJA 4CCHA 5KFMA 4QAWA 2B7OA 2RF2A 4YY3J 3ARTA 4PB5A 4O4GA 1WXJA 3G3DA 1BVNP 3G0UA 4USUA 2NLWA 4WIIA 4O28A 1SU5A 2NVCA 2XHCA 4EO8A 4NZFA 3VVTA 1RHJB 2JEQA 4UQEA 3AA8A 4NEZA 3CAQA 4C6PA 3T1HF 3BAKA 4WDTA 1S5WA 3C2FA 4U5KA 3IA0A 2ACRA 4X9SA 1SR9A 3RBEA 1HQTA 5I23A 4JBCA 3TVKA 1M6JA 4BK9A 5I07A 3WCZA 4ZOBA 1YG0A 3AOAA 3T5KA 1QPOA 2NZCA 2V81A 5CHCB 1OGSA 2OMAA 5T9BG 1DJNA 1NK6A 1K77A 4PL2A 1PILA 3D9BA 3MJMA 4Y2WA 3JXOA 1YE4A 3EPNA 4GA8A 1UR1A 1X5TA 1K7XA 1FWKA 5D38A 4ED0A 4W7UA 1A5SA 3LHVA 3UZJA 3FN9A 2VUYA 4FLSA 1LRTA 2MKJA 5AHEA 3W7LA 5DT5A 2G8ZA 2BWGA 3GG0A 1FRLA 1ZUAX 3SN0A 3BO9A 4G1QA 1E70M 3HMCA 2I7GA 4F4RA 3F56A 2Z6JA 4O18A 2MQQA 3W24A 1JCYA 4XZWA 1KFSA 4IJBA 4EWND 3C16B 5AHIA 4HQVA 1FJCA 4U3CA 2J9DA 5LT5A 2YKAA 5KFEA 2ZOFA 4HLBA 1R0MA 2D0GA 3J7A1 2PO4A 2GHVC 1FBAA 4KMQA 4BQ4A 2J78A 4F25A 4H7VA 3MEEB 2YFNA 2KRBA 3IGHX 3IPWA 2Z25A 2WAGA 5CZXA 6XIMA 5C25A 1E43A 3AIRA 4MLRA 4AQYJ 4QXIA 1A5KC 4M5DB 4MVAA 1GZGA 4RPQA 1U09A 2ALRA 1PDZA 4JCLA 3OOQA 1KXHA 3GMGA 1WDSA 1WOBA 2FZ9A 4CEXC 4EBDA 3QJPA 5C0QA 2XVNA 5HO4A 2Y0BB 1D7KA 2YW3A 3SCPA 1XDMA 3I3EA 1R9YA 3TAOA 5BMWA 3KBNA 3LN3A 4PEKA 1PIEA 2OWXA 5FJRA 4KEVA 3QV8A 3W1QA 5L1IA 3IK2A 1S1VB 1KNWA 4PQUA 3HFYA 1MW7A 3EPGA 2D3UA 1S99A 5ETKA 3N79A 3IM9A 2HE8A 1X0FA 2OEJA 3L5MA 4H54A 3PZPA 3M6UA 2XMMA 2PI5A 4OTKA 4EEYA 2AWZA 3PTMA 2O67A 4OYBA 4J27A 1LW2A 1V3RA 4NZCA 3HG5A 2V38A 1TKZA 3PW5A 3D0CA 1UC5A 2VHLA 4KERA 1S38A 5EUHA 4OHVA 3GM8A 4KO0B 1JUEA 1IWPA 3AMCA 3MP4A 2HPIA 3NG8A 3DU6A 3EVOA 4CQBA 4X64F 2B4GA 4CO0A 1J0HA 1W9PA 4MMWA 4ACZA 2GQ8A 2ZZTA 3WLKX 3P62A 3TLLA 1LW0A 1C3FA 3OZMA 3M8SA 2VM8A 1CXIA 2WLZA 5A8OA 3EEZA 5HMDA 1G6CA 4M7SA 2P2CB 4QCLA 3V2UC 3MHYA 2J9CA 4RUHA 4Y9OA 4MAKA 4AYGA 5CZKA 6ALDA 2QCFA 1WUFA 5JIPA 4ICLB 1GOXA 3VFCA 2HLTA 1Q8LA 2J6UA 1ZY9A 3M7VA 4V1YA 3NQ8A 1OYCA 1U1PA 2ZBQA 1FCUA 1UCNA 2NPFA 3PBUA 4FZIA 1HKMA 1B64A 2PDXA 5CXTA 1MW3A 4KJIA 1LWCA 1R8LA 3M32B 3SDEB 2QT3A 2B9EA 3MM6A 1HQ2A 2YX4A 4QROA 1QK0A