3PKMA

Crystal structure of cas6 with its substrate rna
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
244
structure length
229
Chain Sequence
HHHHGSRFLIRLVAFKVPYNHQYYLQGLIYNAIKSSNPKLATYLHEVKGPKLFTYSLFMAEKREHPYFLGYKKGFFYFSTCVPEIAEALVNGLLMNPEVRLWDERFYLHEIKVLREPKKFNGSTFVTLSPIAVTVVYDVPPMEKEFYSIIKDDLQDKYVMAYGDKPPSEFEMEVLIAKPKRFRIKPGIYQTAWHLVFRAYGNDDLLKVGYEVGFGEKNSLGFGMVKVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cas6 protein
publication title Interaction of the Cas6 Riboendonuclease with CRISPR RNAs: Recognition and Cleavage.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase/rna
total genus 45
structure length 229
sequence length 244
chains with identical sequence X
ec nomenclature
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01881 Cas_Cas6 CRISPR associated protein Cas6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pkmA01
3.30.70.1900 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3pkmA02
4ILMA 4ILLA 3I4HX 3UFCX 3PKMA 4C98A 3QJPA 3ZFVA 4C8YA 4C8ZA 4ILRA 4C9DA 3QJLA 4C97A 3QJJA
chains in the Genus database with same CATH superfamily
5KOXA 2J76E 2FZKB 2E44A 2Z2YB 1I3OB 4LR8A 4OZ0A 1NO8A 3QZ7A 2FHOB 2OELA 5B0EA 2VICA 1B99A 2RU9A 1OYEA 4ZA1A 2MSSA 2JC1A 1EKRA 4IDKA 4WFBQ 2WOMA 1S1TB 1U24A 4DPOA 3SI8A 2UUCJ 2XY5A 2E5JA 1RTHB 4P7VA 3IM8A 2KVIA 7FD1A 3SDEA 1NSPA 3VCDA 1RT6A 1KS2A 2B9EA 3PFEA 4FZVA 4ZVFA 2KVQE 4HI2A 5IT4A 3D3CJ 2ZM6J 5IOLA 1F2HA 2QZ8A 4ZIWA 3OLAA 3VAFA 2DNPA 1NK4A 2MJUA 1OY6A 5L1LA 2HHWA 3W8GA 1FWLA 4J9NA 4N8NA 2XMKA 1R89A 4ECQA 3OPKA 4C3KA 3P8BB 2P9GA 3PNIA 4F02A 3ZFVA 4X84A 2HNZB 1F6TA 1REVA 1OIAA 4O3OA 5EWFA 2J7KA 2XZTB 3NS7B 2MB0B 4DSEA 1TUWA 3B54A 3MAQA 1WC0A 4LIWA 3OTDA 2OPRB 3MAAB 4LREA 4W98A 4K0KF 3I55S 2LXUA 1R0AA 1J5EJ 1U1NA 1SXLA 3C6TB 3U27A 3UE2A 3CB4A 1H98A 1VQSA 1D9AA 3QT5A 4QWDA 3W5ZA 3HHLD 2JFKA 1ZPWX 3NMRA 1RKIA 1RACB 3BPDA 5E33A 4ERDA 3RAQA 1JLAA 1IR2A 1I6JA 2IBOA 5CD4H 1F5CA 4MJKA 3M8QB 5AJ3F 2MQNA 2R8IA 2HHVA 1LWEA 2PEBA 3I87A 4XPCA 3QZ8A 1NDPA 1VQNS 1FDDA 1WKKA 2VKRA 3VHQA 2GO9A 1VS3A 1YKWA 4NLTA 2VJVA 1N36F 5HBMB 5HQ8A 2QEXS 1FJ7A 3LOUA 3Q8YA 2YH1A 3EUNA 3TZYA 4ID5A 3QYYA 4X66F 1T02A 5I3QA 4IOAQ 1T95A 3OHAA 2YH0A 1REGX 4I2QA 2RRNA 4NLVA 3EM1A 5C7PA 3IXQA 3CJKA 1BXNA 2EK1A 3FCWA 1UL3A 1N6QA 3IAS9 3PYEA 3PX6A 1EQ0A 4DFPA 3K59A 2B7BB 2DGQA 1N5QA 3CE8A 1U1RA 2FPHX 2ZJQQ 5LXYA 3OXGA 2B8QA 2WB1D 1G1XA 1QM9A 3NGUA 4USIA 1RADB 1DAXA 1T94A 3A13A 3CMQA 2CNLB 2YNFA 3MEKA 3KLHB 2EFGA 4CLUA 1R7IA 1N5VA 4I0WA 2JLFA 4IRCA 4TVAB 2OSQA 4DR5J 2CPFA 2W8KA 2J9EA 3IGVA 3JQKA 2DNOA 5KFGA 4DWIA 1NH7A 1WG5A 1WOOA 5B0FA 2N3LA 5D0EA 4DEZA 1SL0A 4MYUA 1D9DA 2BX6A 3H40A 2U2FA 4TXSA 5ITHA 1VIOA 1NK6A 1UMJA 3MM8B 5I42A 1I94J 2IRYA 2UV8G 5DDQC 2XS2A 4WTYA 1IQTA 2CQHA 3KG0A 1UP1A 4Y2MA 4CO0A 2XZDB 4BHQA 4DCOB 2JVOA 3A8EA 1DRZA 5L1IA 4URSA 3BYPA 2W2MP 1HHTP 3BV8A 3CPWR 1HNIB 2ZZMA 2AHOB 1WC4A 4USWA 3CJ4A 3P4UB 2XNRA 3G2XA 4YB1P 4P73A 4U9RA 2ADCA 2KFZA 1LW2B 2K7JA 3IC1A 2UUAF 1IN0A 1Y5NB 2MLYA 4CO5A 5C2GA 3GJSB 4J9LA 4FVMA 4DV3J 4Q0BB 5IXUA 1FJCA 3FFIA 1HPZA 1QY7A 4ES3A 3DDIA 3CNQP 1K9MT 1G7CB 4X4TA 5M2RA 4OJGA 1X9WA 3DOLA 1JLEB 4OZ3A 3UFCX 4RBTA 1EQMA 3PKMA 2XMTA 3POTA 2OSRA 2QG9B 3T19A 3H7HB 5F3TA 2EC0A 2CJXB 3GJTB 5KOWA 4M8LA 3VQSA 4UQTA 3KTQA 3I4HX 4WCEQ 1N32F 4G6VB 5KFXA 1Q4RA 1DQAA 2BABA 3KMSA 1VQ5S 3KG4A 4PXEA 1SQEA 2F8MA 2V8DA 4P10A 1WEXA 3HK2A 4H4OA 2ZZNA 3RZAA 2P8IA 3G71S 3QRPA 3CO9A 1T9UA 3FC9A 1X4GA 4HDGA 1JLFB 1N4LA 4I67A 2XHCA 1IJFB 1F9FA 4FYWB 2BBEA 1CJTA 2RHQB 2OMLA 2FGCA 1URNA 4U96A 1WOSA 3HSDA 1FTRA 5LMNF 2E9TA 3I32A 1HMVA 1S77D 1HBNA 3MR6A 1KLMA 3FQKA 2EXUA 4PG4A 5AXNA 2V2KA 1U25A 1O0PA 3K5PA 4ZPDA 4WK3A 3CD7A 1U0HA 5IT9Y 1XIQA 1OPIA 2XY7A 4WZMA 5HVHA 3IBFB 5G0RA 3TUIC 2B5JA 4GO7X 2B9WA 4RBVA 4Q8FA 2OFGX 4JI4J 2KZMA 4J7CA 2B4PA 5D0HA 2BM0A 1Q81T 2EFNA 4AXJA 3BPSP 2FVPA 2M52A 5ETTA 4HR2A 5HANA 1WD6A 4A8QA 3W2VA 3RTVA 4ZMMA 2RDIA 2EW9A 3TR5A 1GNKA 3HSZA 1WI6A 3VZHA 2EFQA 4LSLA 2RJZA 3EMTA 4DHVA 4LFBF 3M2RA 5IQQA 2R2UA 5B7WA 2OAUA 4Q8EA 1ROFA 5L9XA 3I0RB 1K1QA 2Y9HA 2ZBIA 2W24A 1XMQJ 1WTBA 1QE1A 4LF6J 5KFMA 3MEEA 4ZP9A 3ULHA 4QU6A 2VDIA 3HZGA 5DG9A 3HHKA 1EZZB 3AXKA 3MGJA 3Q23A 1IUJA 4J37A 1QDUB 3KLFA 2ZH4A 3HJVA 4L3KA 1EETA 1RWNB 4MKBA 3TAMB 1FNXH 4X4OA 3WC0A 1NJXA 2YWWA 4H54A 5K9FA 5EHHA 1LWCA 1FXDA 4X64J 2RQCA 2DNNA 2GVZB 3SQGA 3PTWA 4CH7A 5ETQA 3Q22A 4YB6A 4KSEB 3U02A 2IPOB 3I5AA 3CIMA 3MEDA 4ZVHA 2NSBA 4MH8A 4KB7A 4YY3J 1KRPA 1FNOA 4A8MP 3IWNC 2AX1A 3IWLA 3KLEB 5LOQA 2W9BB 2VBZA 1R8BA 3P49B 3MF5A 4DG1B 4UUXA 3QO9B 1UVIA 2AGPA 4DPYA 4WWSA 1TK5A 2XI2A 1Y10A 3BKTA 1PAEX 2D74B 5T7LB 3FRZA 1RHKB 2DNLA 4NPOA 1VDHA 2FD2A 1SPBP 2C1EB 4DSIA 5DM6Q 3OL9A 2CPEA 2C2MB 3DU5A 3DYAA 2JX2A 1RXOB 4GO5X 4WTOB 2ZH7A 3KDOA 2FJEB 3EICA 1S6OA 4ED6A 4PQUB 4CM0A 3GZ7A 4TY9A 2OPPA 3NEKA 4J90A 2CPZA 5T41A 4V19X 2XY6A 1TR0A 3LGMA 3MMCB 2QGFB 4YFUA 4ZHRA 1IWGA 1MWZA 4KGKA 1D9FA 1WNEA 1H2TZ 2UZAA 3CDUA 5B0CA 2XHWA 2DR6A 3N6MA 5MLCV 2DGUA 4I1TA 3BN7A 4WE1A 4HH0A 3MCSA 1U8WA 4YDXA 2W7PA 1PILA 5HLFA 1SC4B 1VJWA 3OBIA 3PRVA 1IJEB 4QW9A 4W4MA 3OL8A 5EWEA 4QOTA 1TMJA 2B4OA 4IOBA 4JV2A 4I7FA 2KYZA 3D5MA 1L5UA 4NEYA 1GMVA 3H5YA 3BGOP 5HMXA 2HFSA 3VAJA 3UVJB 5C42A 3D2WA 4UY8T 4PXCA 4OI0A 3E01A 3NNAA 1WHVA 1Y5LB 2G1HA 4ED0A 2CFXA 5THWA 1HNXF 3HVTB 1TK0A 3AA9A 4O4GA 2ZOMA 1WSVA 2DY9A 4CO2A 3MHYA 1OPZA 2XZWA 2ZVIA 3IRXB 1BMQB 2V2QA 1VRTA 8RUCA 4K4VA 1KQGB 3DXSX 2QLXA 2GIFA 1S1UA 2C3PA 1GH8A 4M5JA 3SEOA 3LP1B 2HHHF 4UQGA 3MUVP 2R4FA 2WAQD 5GVQA 2HLUA 3I4PA 2MSTA 3UDCA 2ZITA 4NZ0A 2EG1A 2ZH2A 1ITPA 1SQFA 4V19J 2WBMA 1S1WA 3A3OB 1VQOS 4NLSA 1HFEL 3BBFA 1WHYA 2MQLA 3C6UB 3GG0A 4M5DA 2D69A 1UVLA 2CPXA 3MM5A 3MM9B 4NLPA 4JV0A 2MJNA 4JI6F 5LMUF 2BXJA 4JV1A 4IH6A 5H9EJ 3CDWA 3KNAA 1SV5A 2YNIB 3G96A 1TZ0A 3SV4A 1WI8A 3ET6B 4USKA 2E7XA 1SH2A 5DO2A 2VPWB 3SMZA 3OVBA 2N7YA 1CSJA 4KHPF 3HI9A 3KDNA 4DUZF 2KFYA 3H2VE 3UN5A 1XMBA 2HKEA 4U6PA 1QLNA 2PC6A 2HFZA 4H4MB 1TK8A 5BXIA 4LVOP 4F25A 2VB6A 5DDOC 4YR3A 1IR1A 3BKFA 2CXEA 4LFCJ 1VJQA 4ECVA 3C15A 2HS0A 4IG0B 3L7PA 3AQOA 2FVSA 4PEOA 1WC1A 4BC9A 2GMLA 3M9MB 1QSLA 2VH7A 4P52A 1TKXB 1R6VA 3MEGB 1ZETA 4DV5F 5F9NA 1GXLA 4DV1J 1T3OA 4CNYA 2RE1A 4EMDA 3P3DA 2RDJA 2XS7A 2ZBQA 4UTGA 2LP4A 2NR0A 2W9AA 4ANEA 5A8RA 4PR6A 4KYZA 3UR0A 2MHNA 2HGNA 3D9BA 3LPYA 1VRUA 2CJYB 3B4MA 2FUG9 4NLQA 5KFAA 5DM7Q 3M9OB 1KFDA 3ZTOA 4DX6A 2BEFA 4RW8A 2ZHBA 1FJEB 2EI5A 1U4BA 1YJ7A 3S01A 2QN6B 3TA1A 3FMWA 5J1EB 2FY8A 2Q1LA 2ZNZA 2G4BA 3HT0A 2QFIA 3PW2A 2V69A 5LJ5Y 1LWFB 2VBWA 4OI3A 1UZHA 4LQ9A 4DSLA 4P6QA 3BGRB 3UD4P 3FZ2A 2RKIB 4E2FB 3MMBB 4ES2A 3NCRA 1HBUB 5IS2A 5CYQA 2EFVA 3OTBA 2RVJA 3UD5A 1CS4A 1GX5A 4RW9B 1DLOA 1QJHA 4JI1F 2GCFA 3J80Y 3MZIA 4ATNA 2J0SD 3RW7A 1HWLA 1SJ1A 1UEKA 2OLWA 1S0VA 2BKNA 2F4VF 2CJ9A 2YKMB 1E6YB 5KFPA 2MY8A 3U1MA 2R9LA 1F60B 2DY1A 2RAQA 3D6FB 4LQ3A 3D1HA 1VQLS 2BQUA 4OI2A 2GJIA 2JZ5A 4LRBA 4OLPA 1BQMB 5E2QA 1PO6A 4A46A 4QW8A 2YNGA 3DGPA 3M6XA 4B3MF 1NDKA 3UCZP 5KFDA 5KFBA 3P96A 1TL3A 3MR5A 5AE3A 4TU8A 2R2SA 2NUUG 4HACA 2ZDPA 4DOZA 1FRKA 4C98A 4QIEA 3CIZA 2GGPB 3GFYA 1S6PA 4C9DA 3M2UB 1KQFB 1D09B 2EKNA 2WSEC 5E3RA 2X1GA 4J5OA 1VQKS 4OI4A 2K8GA 4MMOA 2LYVA 4JYAF 3H5UA 2QA4G 1FO1A 2FJWA 2HFOA 3K0JA 3PY8A 3EXCX 3F0NA 4F4WA 3MD1A 3MOZA 4CIOA 3DRXA 2VQEJ 4J9OA 1WORA 2IM1A 4GVBB 4DL4A 1UJ5A 3MURP 2CQPA 3VAGA 4PXBA 3RB3A 3SBMA 1U09A 2QV6A 4KGMA 1XR6A 3R6GB 1NH8A 2WVDA 3R5JB 1J2VA 2L3MA 1YDLA 3N79A 5I3PA 5HSPA 3ISZA 4DPTA 5B0DA 3J81Y 4IG3A 4RNHA 4WFYA 2YX4A 1J5OB 1SUQB 1TV6B 4B9TA 1VQ7S 3MUTP 4Q5VA 3IMQJ 4KHRA 4FXVA 1EIYB 2AT1B 3M30B 2AJQA 2L9DA 3G6YA 3DFEA 4DV2F 4UOCA 2J7WA 3AOCA 1QAJA 2QX0A 5IC4B 3HLUA 2G0CA 2W2QP 1Q0NA 1S6QA 2GAHC 2ZFHA 5A6WA 5HROA 4BCAA 5GMEA 4CO4A 5BJRA 1VC6A 5KFVA 3GSDA 1Q7LB 2W9CB 2HNYA 1OO0B 1KR4A 4IKAA 2ZD1B 1SJ3P 1GX6A 3HKZD 4NCGA 2DNHA 3M8WA 2WVBA 1HNVA 3LGHA 1M1KT 5K14A 2GHPA 2B9YA 2FQQB 4TKTA 4OYZA 3QT8A 1FJGJ 3TP2A 4Q2LA 3N9UC 2CZ9A 4F04B 3RBEA 1NK5A 3J81j 3W62A 1BE4A 4KT0C 4B3SF 1HD1A 1FVQA 3B4DA 1MROA 4CYUB 3T6JA 2Q6CA 1F0XA 1NJIT 1VLYA 1GMWD 4CTAB 2I1RA 2DEIA 5HMYA 4ECYA 4XAKA 4I2PA 1TKTA 2GVDB 2CYYA 4K59A 4ICLA 2YWEA 4OYXA 2FVQA 4ZVUB 4LRFA 5SZTA 3V5RA 2W25A 3NBPB 1RT3A 2KZZA 3QPIA 3PO4A 3R5CA 2FLLA 1K0TA 4Z37A 1RTHA 3EVMA 5DS7A 2A2CA 2OEJA 4B02A 2R7SA 3H20A 1TKZA 1SJFA 4QCLA 4GKKJ 1N33J 3TANA 4B9LA 2AW0A 2ZNYA 3U1NA 2H5EA 5F9LA 4NRUA 3UI3A 3AT1B 1HHQA 2KL8A 2BKPA 2C2OB 4HT5A 1I51B 1P9QC 2VL1A 4G1QA 3KLGA 1WDTA 2VFSA 1VBXA 1N48A 3H0PA 4DDFA 2E1AA 1RHJB 1X4DA 4NYOA 3G6ES 3W63A 2QL9B 3T5LA 4KC5A 5EGYA 3GJRB 5J2MA 1YIJS 1RLCL 1IXKA 1RDRA 2C2KB 2DCUB 3R7SB 3V6JA 1DHMA 4DR7J 1S9GA 1KBRA 1KTVA 1RB0A 4LUBA 2ZJRQ 4DU8A 4C11B 4ZVQB 2MZQA 2ZUGA 4JBCA 1H72C 4M5IA 3MM7A 2CQ4A 1N52B 4DCJB 1S10A 1HNWF 2Y1JA 2PMHA 1KTQA 4DX5A 3ETMA 1RT7B 2LQ5A 3IN5A 5HP1B 2AEJA 1W7WA 2ZKTA 3BGLA 2ZBRA 2LQJA 3OW2R 2H5JB 1OY9A 1BQXA 1NHUA 2OPQB 2CDQA 4DU7A 2JEFA 1K44A 1YBAA 5LM7E 4B3OB 2Q43A 1ZOTA 1SH0A 4I6AA 1GMWA 2QSFA 2VG5B 2YNHA 1KQSR 2FYXA 4CT9A 5DETA 3J7ZT 3MWBA 3W3SA 1VQPS 4JI5J 3DMJB 1K1SA 2ASYA 3ZZPA 2RMLA 3ZXWA 4NLWA 1PIEA 3QATA 2HGMA 2BA9A 3MMAB 2E7WA 4Q43A 2ZOGA 4FYVB 3PEHA 2XB2D 5KFEA 3HHEA 3M6UA 1FT8A 5IWAF 6AT1B 1WF1A 1IBMF 1TL7B 1JNRB 3EX7B 1V3SA 4RWWA 3D1QA 3JYTA 5AXLA 2RUSA 1TELA 2RF2B 3OR1B 3O3LA 4E0DA 3I31A 1ZPVA 3AXMA 3K17A 2HIYA 1YI2S 3DN9A 3F41A 3KUGA 4NA3A 1U6ZA 2X51A 4DV6F 2L9NA 2CWKA 1JKHB 2Z57B 5GMDA 4LSNA 1KOOA 2QMWA 4K4YA 4N41A 3V81B 5DQIA 4EU0A 1Z2ZA 4TNOA 3GILA 3KUEA 4XIUA 1FD8A 4C97A 3IBCB 2C2EA 1MMNA 3BH6B 3ICLA 3TEHB 1TMMA 4DV0J 2XGPA 3OFFA 2ZBPA 3MM8A 3BSNA 2RSQA 2HQCA 3BZQA 2KDOA 3TYTA 3GV7B 1HI0P 2I38A 2YX1A 5IT9U 4DR6F 2Y1IA 3W9HA 3QJJA 1UCNA 1HNIA 2YKOA 4ETXA 1JJ4A 3DHXA 4LFAF 1C0UB 1WF0A 4LVNP 4OYOA 1E6VA 5BR8F 3EZUA 4CI0B 1Q8KA 3CD0A 2BJ3A 4WPAA 3J7A1 2VUGA 2AKWB 3UDLA 2E29A 3ZZRA 3O6QA 4MFBA 5KFRA 4K8RA 2ZH3A 1KWMA 1K0VA 4A4JA 2DT9A 3DDKA 1U49A 2A1BA 2LDIA 3K7RA 2P5VA 3VWSA 1RHMB 2HVEA 1LFPA 3D0HE 3FRYA 3VGUA 2RNEA 1S1XB 1RWMB 3FSYA 5KG2A 3SYZA 2JSXA 1VQ4S 4K4XA 2W7AA 4X62F 1RAJA 2V67A 2J0QD 2CPDA 2PN6A 3Q8VA 2FB0A 4DJBA 4DL5A 3QLHA 1RK8A 2OI2A 3FBBA 2R2TA 1UFKA 3FCHA 1RAHB 4YOEA 5CCLA 1DTTB 2HQDA 5J2NA 1RAAB 4K0KJ 3QWPA 1L3SA 2CNNB 3VGVA 2M0GB 1FRLA 3SCLE 1L3UA 4O23A 3VAMA 4IFYA 1NJWA 1D8ZA 2HIQA 4ER8A 4JI2J 1SJRA 1F9HA 1NPKA 3E51A 2OHDA 1QUVA 1FKPA 4ZJQA 4KH0B 4ZP8A 2GQ2A 2XBPA 2BUNA 2HRUA 2CPIA 3JSMB 3EVOA 4K4ZA 4ZPWR 1RWUA 1O6XA 1BUXA 2VFTA 1OQ3A 2C2DA 3GV5B 4RNFA 3TUJC 4LJMA 4U7UK 1YJTA 4OX9F 2DB1A 3NMAA 2LQBA 4KKOB 5L38A 2JL9A 3UPFA 3OLBA 3FKBA 4BWMA 3HSGA 1NK0A 3FK4A 1MU2B 2NXCA 1YJVA 1U26A 1ZS6A 3PDNA 1VQ8S 4DN0A 2BQRA 2IBKA 1YQHA 3ENAA 2VG7A 3ENQA 3J7Z5 2LXIA 1TUVA 3JXOA 4JI3F 2MZRA 2BJDA 1M5SA 3MFHA 2IMWP 2GV1A 2IAJA 1IQZA 3BDEA 3D54A 2WHOA 1NB2A 3D66A 3N6NA 5GAHI 2MLZA 3QRQA 2OTJS 1R0BG 3ETOA 1GTEA 4UOHA 5HL7Q 4KO0A 4ES1A 4FF2A 3B78A 1P8GA 3VAKA 1RU1A 3EXYA 3R27A 2E5HA 2V8PA 2HZAA 5DGBA 1AZSB 1NHVA 4NE9C 4NA2A 4WYLA 3FDSA 5L1KA 3D7SB 3TUZC 2BZ2A 4L74A 2UUCF 1WELA 2DIVA 1PYSB 1HR0J 1Q7YT 3OXLA 2HVZA 1IKXA 3IRWP 1T03B 1UVKA 2ZWOA 2PMWA 2PO4A 3PR5B 1EX8A 4OJ3A 2LU1A 2MKIA 1U2FA 2ZM6F 3PX4A 1NB7A 3QWUA 2VC0A 3HO1A 3C8YA 3ZNJ1 1C0TB 4ZPTR 4OJHA 2CVEA 2FHMA 2HZVA 1LEOA 5E3QA 3A8IA 1WACA 1FNMA 3AODA 5IM0A 2C2RA 1VMBA 4CNZA 3H4BA 3ENVA 1XQIA 1TQLA 2EPIA 4IUFA 4LF9F 4USHA 3FBCA 5KG5A 2FHJA 3R9LA 3S1TA 4DL3A 4F4XA 5EDWA 3NS6A 3HDSA 4RUAA 3FJ2A 4NXMJ 4F8RA 2CJAA 5KFWA 1QSYA 2Z0GA 3D6MB 2HNDA 5D0RA 4RR5A 1QUPA 4UW2A 2QL5B 3QT6A 3TI0A 1FHTA 2DIUA 5KG1A 3DRYA 1Q1KA 4F3QA 2J0WA 5BYRA 3ZZYA 3G8SA 2UP1A 1TL4A 4O44B 4PAAA 2FIUA 2UXDF 1NUEA 4MAKA 4WIQA 3GSIA 4HHUA 4QWBA 3A3NB 3HP6A 1RBOB 4YUDA 3I82A 4OYWA 3BM7A 3KK1A 1JLBA 2MKCA 5L46A 2GC8A 1UEVA 3MOJB 2PSZA 2UUBJ 2MHEA 3UCGA 2XLIA 4DSKA 4X4PA 2LKZA 2KT5A 2IHR1 1VQMS 4X4VA 3CCMS 1RAEB 5F8JA 2F5GA 1RT1B 1S9FA 5F8HA 2DXDA 4EO6A 3EGWB 2H5IB 2UVUA 4XTTA 2EFOA 2YKNA 4QIGA 4RNMA 4CLTA 2R3VA 4DUYF 1TL1B 4ENOA 3N01A 3M4XA 4EZ9A 5DZ6A 2RQMA 4I68A 1KVIA 4J9QA 4X4RA 4YHHJ 3K5NA 2IM3A 2YTCA 3GFHA 3OSPA 3H2LA 1T0TV 2FLNA 2E9RX 8ATCB 2FJVA 5H9FK 3CEDA 1RYRA 2D3O1 3FBFA 2IC3A 1JB0C 3LP0A 2QRRA 4ZPVR 4YS2A 2VU5A 3N0VA 2ACMA 1S1VB 2A3JA 2D41A 2ZUAA 3C3LA 4GRSA 1R27B 5KFOA 1KDNA 2M88A 3PR4A 2YXLA 4G1PA 3LANA 4PWDB 1GTHA 5KFHA 1HL6A 2GJFA 1ZM9A 4J9KA 3HULA 4DV4J 1I94F 3NS5A 2ASJA 3D1OA 1M1GA 4Y3CA 2XGQA 4LFBJ 5FJ4A 2NSCA 3WIUA 4LRDA 1C1BB 2DNMA 3MM9A 3AJ2A 1YRUA 3IG1A 4NRTA 4OV1A 1RBAA 1OYDA 2G2ZA 3PIOQ 2ZH6A 5JVHQ 2XMJA 2F40A 5EWGA 1I1GA 1JLCB 2KJVA 5A6PA 4TU7A 4NI2A 1JX4A 4RW7B 1QD1A 2VQFJ 4ECXA 1P1TA 2ZKUA 1RYSA 3J80U 4U7CA 2V9WA 1X4HA 3IO1A 1Q79A 2WOMB 4F4AA 4DV3F 3NXZA 4NL5A 3OUYA 4X2BA 1N0UA 5D3GB 2POKA 1CVJA 3W64A 3SDEB 3SV3A 5J2PA 4PUOB 1WG4A 3UR3C 2ZZTA 3TAQA 4OJ1A 2DVIA 1EJ7L 2FJAB 1URRA 3DLGA 2PIIA 1QSSA 1TKXA 3BGUA 2GZOA 2NUHA 5ETLA 1H74A 1S79A 4D3HA 3KOAA 3J7YI 3SCKE 3CCZA 3IA0A 2KXFA 2MKKA 2BDPA 4B3TJ 2P9EA 4UT4A 1XERA 4I69A 4O3PA 1REVB 1VFJA 2F7VA 3R97A 2XG8A 5F8MA 2I5JA 4ZP7A 2GS8A 5IFMA 1IKWA 3JQJA 4O3QA 2HFNA 3CGIA 3KHHA 3GR0A 2HSEB 1R0AB 2B6AA 2XYPB 4LIRA 1HNZJ 1X31C 3O5TB 4NLYA 3JSBA 4KV8A 3OSNA 3KJQB 4C8MA 4CWBA 3KLIB 3TX8A 4KJIA 2R42A 1ZM4A 2CAJA 5HATA 1KC8T 1CBKA 1VK3A 2VBXA 3RR8A 1KKHA 3MR3A 2ZHAA 2JRSA 4DI6A 1Q53A 4NMXA 1JLAB 3VR1A 5CA5A 2QTWA 1ICEB 4FKXA 1C4CA 2MKSA 2D9OA 3L95X 1CG2A 3B82A 5IV3A 3CDEA 1LWEB 4Q2MA 1MW7A 3V4MA 3U1LA 3J81U 1SC6A 2AQ4A 2WK4A 3GJQB 3HFKA 4JP8A 4IO9Q 1WOPA 3AH6A 4GKJJ 4OZ2A 3C16A 2NCKL 5HMZA 4DR1J 4WXWA 1QVFR 4O3NA 2IIHA 1QVGR 4ID5B 4CO3A 2JDJA 4K4TA 3FVYA 3GYNA 4OI1A 2G0IA 4FF1A 5CYMA 2CA9A 4DF8A 4I2QB 3PJ9A 3CJKB 5RUBA 2AYMA 1VBZA 3RUBL 2DJWA 3FEZA 1N6QB 4KE5A 1Q5VA 3OTOF 2MKHA 4FDFA 2QT7A 2KT2A 4LF6F 1IM4A 3BEGB 2JC0A 5J2QA 3LGNA 3IBWA 2AGQA 3TZXA 4F26A 3CJ3A 2QA2A 5B08A 2VG6B 4HHJA 3R3TA 4RKUC 6FD1A 3FGVA 4ELUA 2YWKA 2ERRA 2KN4A 1HARA 2KHDA 5B0BA 3AA8A 3R5GA 3LAMA 3QIDA 2YNFB 3IAM9 1XR7A 1FA0A 1R8AA 3T1YJ 3T1AA 2J6SA 5K5MA 2CRLA 2IVFB 2HHXA 3I0SA 5KFYA 2OTLS 1RE1B 2J9CA 4WXOA 4F4ZA 2YKQA 2PA8D 3LALA 4K4SA 2RDDA 4B17A 3CCES 2HHHJ 5DRKA 3SZ2A 3PKYA 5AXMA 2O01C 2MZ1A 4GVBA 4FVCA 4N76A 3CULA 4U8VA 1B4SA 4P7TA 3K5MA 4RNOA 4CH1A 2GW8A 3KYLA 1SH3A 5KT2A 1XMOF 1KHVA 1BHNA 2DNYA 2HQIA 2ASDA 2VPYB 3TOQA 1YJ9S 1XNRJ 2W2OP 3FNNA 2UUTA 1FERA 4C8OA 1TP7A 4GC7A 3W66A 4DL7A 1FWPA 1GXTA 1QTMA 2ZWPA 3BREA 1ZZFA 2G0JA 3OV7A 4PG5A 4QIFA 5CAAA 1X0PA 1SUQA 3W9JA 3RRGA 3FEYB 2K1RA 3M30A 1FKAF 2MQQA 1NRKA 3Q8PB 3UD3P 3S6EA 2KG0A 1VRQC 3QGPA 2J6TA 3D0GE 4ILMA 1S12A 1HKAA 1IKVA 4ED2A 4FNHA 1FE0A 1DBDA 4USTA 3UN2A 3M2VA 3CO0P 2WONB 2D9PA 4NLGA 2F9JA 1H2VZ 3FFIB 1HPZB 4QWCA 3NGKA 1FCAA 3ADAC 2EFPA 4FYYB 4ED8A 4HEA9 2R7WA 3DOLB 2Y1LB 1SL1A 3TRGA 2QO3A 2DHHA 4DZDA 4AYBD 2AIRB 3P6YC 1MLAA 3CUNA 3POTB 4M1KA 1JJCB 4GC6A 3CCVS 4K5RA 5CZVA 3GB0A 5DLGA 1SI9A 3BBCA 2RRAA 3J7AN 4CTAA 4H4OB 3QGIA 2AZ3A 1O8BA 4OYAA 2HHTA 2VA3A 4PQAA 2HURA 1RWVB 1CULA 2C2NA 2RQ4A 2HK2A 3GE9A 5L8RC 2DNQA 2BOAA 1U6BA 2IMOA 3MCMA 4P2SA 1HMVB 7FDRA 3DLEA 2COLA 1HBNB 1KLMB 2F8HA 2HHUA 2QMUB 3NCQA 1VI7A 4JUZA 3GYGA 2GQQA 4EYIB 1IBLJ 2HW3A 1U0HB 5G0RB 1K73T 2B5JB 2R7OA 3MUMP 4X4QA 1OSCA 1SKRA 2DGVA 5F41A 1RTZA 3FUYA 4CT8A 2PDAA 1V5VA 3F44A 4G3IA 4JI1J 4L73A 1NPPA 4BBYA 2VODA 2EEYA 1CJVA 4HI1A 1RCOB 3NOCA 5GADI 1FKOB 3W2VB 2F4VJ 1PC4A 4DUTA 4A47A 4LSLB 2HFVA 4JI8F 3FMBA 1RCXB 1PCAA 2VFVA 3M2RB 1Y7PA 1Y5IB 2DXEA 1RWXB 4RBUA 1OWXA 3PEJA 3WBZA 2D3UA 1HA1A 1DARA 5HO4A 1RT4B 4B3MJ 4QIWD 1B0TA 2K7KA 3KK2A 3CMES 1QE1B 1PC5A 1HHSA 3MEEB 5D4NA 3EDQB 4F50A 3PO5A 4LSZB 2CPHA 4OZ1A 5HP1A 2D3ZA 4RZRA 2CPYA 4KY3A 3KJNB 4Y65A 2A18A 1ZH5A 5D4PA 4ZVGA 1YRTA 1LWCB 5T14A 2BRLA 4LFCF 4JI0F 1HQUA 3MPVA 1A7GE 1OQ6A 2W01A 1Q95G 3SCJE 2DITA 2UVRA 4K5SA 4NZ7A 3GG1A 1RU2A 4P2XA 3MEDB 1U1KA 3HHLA 3QAEA 4MYTA 3AD8C 3DMJA 1VHFA 4DV1F 3DI6B 2IRUA 3IP0A 1P1LA 1EKSA 2DR9A 4DR3J 1X4FA 2YBVA 2C3UA 4PPDA 1CLFA 2IDLA 3GR1A 1AT1B 2FC9A 2QIFA 3DOMA 2J8SA 1OJ4A 2HS4A 3RW6A 4IR1A 2ZH5A 3DRPA 2MDAA 1RWPB 3MECB 4LF7J 2CQCA 3DYAB 5C24A 4NXNJ 4LR7A 3WIVA 4DV2J 2HMIA 4OQJA 4NLRA 1WTFA 3GCWP 1AXQA 2X7IA 4ZVTB 3G8QA 1CC8A 5F8GA 4DSFA 1NKBA 4QIVA 3LP2B 2DRDA 1D1UA 1ZM2A 2OPPB 1TFWA 2YY3A 5GAGI 5A2QY 5HK4A 3HJFA 5A0YA 2VJUA 1MWYA 1L3VA 1T9TA 3AJ1A 3DXBA 4QPXA 4HHHA 1RTDA 5B0GA 2VKZG 4ANDA 1UPMB 2CIMA 3ILIA 1KOHA 4CO1A 2KM8C 4WE1B 4EYHB 2DTJA 4CLKA 1MN9A 4CQ1A 3U7JA 4I64A 1NEEA 5HLFB 4OZ5A 4FPIA 3I56S 1ELOA 4I7FB 2HVIA 1U45A 3BS9A 5KT5A 2CJBA 2Z2LA 4P75A 2DYAA 1JXLA 4QJVA 3F73A 2FC8A 3VVTA 3E01B 1C0UA 1YGYA 3S8SA 3R1HA 1H0HB 1R0CB 4DQSA 2AJ4A 3G82A 3DM2A 1RWKB 2B8PA 4LBPA 2LEPA 4F2RA 2RQKA 4ETZA 2JNJA 1X4BA 3IS9A 4XO0A 3H59A 4X65J 1H38A 2OPSA 3M8SA 2H9ZA 1RABB 3H42A 4C8ZA 2FLOA 1S0MA 3QQCD 1S1UB 2V4JB 3R7BB 2WRMA 1IVZA 3T5KA 1WKJA 1Q82T 4YN3B 3OJUA 1RP5A 2HBQB 1DZ5A 2GMHA 3GIMA 1JLQA 2HFUA 3PHEA 5F3ZA 1FDAA 2IY5B 1LNQA 3H98A 2B9XA 4ED3A 4JI7J 5DDRC 4DPWA 3AJDA 4PXDA 4M5DB 2UVVA 1GT8A 4E8UA 2XO7A 1LWXA 4X4SA 1S48A 2ZDOA 3BKUA 1SV5B 1SC1B 1LXJA 4OHZA 4DX7A 1BQNA 4ECTA 1X5OA 1CQMA 3KLVA 1Y0HA 3FSXA 4KBIA 3B8HA 4RPFA 3ZNUA 1HI8A 4M5MA 4EWTA 5CQGA 3CC2S 2WB4A 3TJ8A 3TX0A 3OQ2A 2EVZA 4ZVOB 2W4PA 2CZVC 2XNQA 5CHCB 3DU6A 4PZVA 3NCPA 5DQGA 4PG6A 3D0IE 4RUBA 4A8XA 2BANA 3C15B 2WVEA 1IR0A 1VQ9S 4QU7A 1WC3A 4ZCKA 2EC2A 2HHSA 4C0OC 2ATCB 2WW4A 2AX0A 2EBGA 4AL7A 3W2WA 3RAXA 3EGNA 4MKVA 2CNKB 4DQRA 4HTJA 2BE2A 5ETNA 4Y28C 4XDCA 1DQ8A 5HJXA 4FXWA 4DBQA 3P5TL 3NG8A 3R2CJ 3ZZZA 4IFVA 2DH7A 2AJ2A 2Z58B 5IWAJ 1LV5A 3W9IA 1HWJA 1IBMJ 2Q66A 3NL0A 3E3XA 1VRUB 2DXFA 4W90B 2QLJB 4KGXB 3GMGA 4F0KA 5ADZA 2NZ4A 1A9NB 1LK5A 1LW0A 3D4JA 2BE9B 4RW8B 4LF8J 2UXCJ 1UWAA 3LO3A 2IRXA 1SJQA 3VGSA 2Z4PA 1SKSA 2QYGA 3S7RA 2KM8B 1RAOA 2XMAA 3CSKA 4ZK7M 4Y00A 4GVLA 4KTQA 3JB9k 3MAHA 3B6BA 3BH7B 2QYCA 1GQEA 2QE5A 2NZCA 1NKEA 2YWHA 4GKKF 1N33F 2YPYA 4Y0FA 5KG6A 3MFIA 3MPDA 3KUHA 1NPRA 2V4QA 5FD1A 5CYQB 1M5KC 2EBEA 1TL5A 4QZVB 4N56A 2DO4A 5A8KA 2GA7A 1DLOB 4EO8A 4PABA 2P9CA 1AW0A 5CXTA 5IV4A 1R43A 1ZAXA 2VPXB 2RD5C 3A1YG 1R3NA 1ZA1B 2OD6A 2PMZD 2DK2A 4N7TA 3GCXP 2GO8A 3HSJA 1P6TA 2ZVSA 1B0VA 4DR6J 1WSRA 4R8UB 5AE2A 2YNGB 2MGZA 1B70B 3DGPB 4P72A 2IVMA 2GHVC 5J1PA 2GIRA 5KFCA 3HHNB 1TL3B 1T05A 4QWEA 4ECSA 2WZ1A 2VD3A 1HYSA 5BR8J 3NWRA 5LSRA 1FFGB 1YTYA 3CXCR 4G65A 2R7UA 1VC5A 2I2YA 3MDFA 4ZLPA 5U47A 4Y34A 1UW4A 3O8WA 3WHIA 4C8LA 2C42A 2CWXA 1YRXA 5CYJA 4OV6A 2VZ9A 1MSWD 1U2RA 4KFBA 4XDDA 2JEIA 3AD7C 3LUYA 2I9SA 2M4MA 3NOGA 4OFZA 1JLGA 2OJ3A 2XM3A 2BQ3A 3NKYA 1NKCA 2NREA 4LF2A 4WP8A 5D4OA 4JI5F 1RJJA 2LLZA 3OR2A 4WU2A 2GX8A 3TARA 3DLBA 2DNGA 3VALA 1RTJA 2PGCA 4YB7A 1M5HA 2H54B 2HAFA 3GIRA 3SIPB 4A8WA 1JXVA 4OHVA 3Q24A 4TN2A 3LWLA 5C5JA 4A8FA 4URGA 4ZITA 4H4KA 1YBTA 4Q44A 3RB6A 1FE4A 3WX8A 4OL8A 1KVKA 3T5HA 4K50A 2O5DA 4BDPA 3CJTA 4EBCA 1KD1T 7AT1B 3RJMB 5LSOA 5FDLA 2E66A 1NAQA 4C0BA 3JQMA 4NLUA 9RUBA 4ZJLA 1S9EA 2NS1B 3M8RA 4LF5J 3A3PB 1S6QB 3M05A 1EP4A 1J27A 3EWGA 4IH7A 2F3JA 1RISA 3E8OA 4O4RA 5HROB 4NCAA 3OD2A 2DH8A 3QRRA 5HVGA 2ZBCA 4OX9J 1SKWA 1U8SA 2HNYB 2QLWA 2CQDA 2ASLA 2DEJA 4NCGB 4A8SA 1NZ8A 4DV0F 2Y8WA 2QL7B 3RRKA 1RAIB 1HNVB 2HS3A 5F8IA 4QQBA 2J9DA 5K14B 3V4IA 1RTIB 2HYIB 2RHSB 5GAHU 1HI1A 4IQMA 3BDPA 2AMCB 1C1BA 3IFEA 1XTZA 5KAKA 4ECUA 1YLXA 3KMQA 5GMKa 2IJNA 5KG0A 3FZBA 1NM2A 2CKWA 1KN6A 1MROB 1JLCA 2VONA 2AV5A 4RW7A 4DPUA 3C46A 4A8OA 1FX4A 3L7UA 4UUWA 3HVRA 1YK9A 2KXNB 3PJWA 4I2PB 1FTCA 1TKTB 4ICLB 5HI7A 4CLLA 4PCQA 3Q83A 3DRRA 5DZ7A 1RT3B 4Y6IA 1RZMA 1SB6A 3V6DA 1HQEA 3CD5A 1MWQA 3V6KA 2RS8A 1U1OA 5D3GA 4OYMA 1DQ9A 4PUOA 1L3KA 1U6FA 2AYGA 3M32A 3KJVB 2YX7A 1VGYA 1TKZB 5F0WA 4TYAA 3HHDA 4QYRA 2Q6BA 2C2ZB 3N5BA 2D3OR 4M95A 4OHWA 1A0OB 5EX0A 1CC7A 5GAEI 5KFJA 1YJRA 1YSJA 5DLFA 1GEHA 1UTAA 1GK8A 2X3GA 4G1QB 3C66A 3WZ0A 3KLGB 3MPYA 3M1VA 4DXLA 5A8WA 3OVSA 4R5PA 3HPOA 1V6HA 4ITSA 3ISND 4DR4J 4LF9J 2IA6A 5ETPA 2MMYA 1C1CA 2VBYA 2DRAA 3A4TA 2AEFA 3EJMA 5J2MB 2V5HG 1FF2A 4DS5A 1LFWA 2GQCA 2F4FA 3DDNA 4KGVB 4NX9A 1S9GB 4UY85 4OLOA 5L1JA 3PV8A 2MQMA 2Y8YA 2XULA 1O51A 2FVRA 3NGTA 3KLIA 4RW6A 4DV7J 4JI2F 2JLGA 4JV5J 2H65B 4F0MA 1YJUA 1HWIA 1HBMB 3MM7B 1MMLA 2AYBA 2UXDJ 4DFJA 5I3UA 2KXHA 2ZE2A 2M8HA 1DTQA 3K2YA 5KFLA 1KEKA 2B4VA 2BJ7A 2VOPA 3DRSA 2AP6A 1NLKL 1UVNA 3KXDA 1RKJA 1WHWA 5K8MA 3RBXA 1UW9A 4ZPAA 4ED5A 1C2PA 1NNDA 5ETVA 1VK8A 2OGUA 3LH2S 3W61A 3DLKB 5LSLA 1D3WA 2YNHB 3HFZB 2N7CA 4L72B 1IWAA 1UVMA 2KB2A 2KH9A 1PSDA 2DNZA 2R7VA 2ZHOA 3G6VA 3THTA 2AJFE 3TQEA 1AROP 4NYPA 4DUYJ 1DJ0A 2V63A 1D8YA 3RR7A 3MD3A 3PW5A 2KFNA 1IBKF 1HBOA 4LMZA 2LA6A 3JYTB 4K4UA 3H2UB 1JQGA 3Q2TC 5F8LA 4Q45A 1UWBA 2VG6A 3JAMY 2R8HA 3ITHA 3N28A 4TY8A 2YWGA 5KFTA 4RW4A 3KHLA 1HW9A 1HR0F 3BR9A 4QR0A 1M5OC 5KFFA 4LSNB 2MQPA 3C14A 2CPJA 3GONA 4YR2A 3LQVA 3CCSS 1V3ZA 5EN1A 2YVSA 3KHRA 3T5JA 1SC3B 4F0HA 1X5SA 2XSJA 4ZP6A 3MM6B 2EG2A 3BSOA 4AQYJ 1SVDA 1CJUA 2QSWA 5IC6B 2R7TA 2QC3A 2KI2A 1NSQA 1Z1ZA 3CMAS 2PI4A 1T9WA 2RUGA 5C25A 1X7VA 1F3VA 1M5VC 4NXMF 1TVRA 4MK8A 1UFWA 3DOKA 3ZO7A 3BSAA 1CJKA 3PYGA 4DR2F 2YWFA 1R8CA 1YHQS 5BYQA 3SCIE 3UO0A 4RUCA 4ILRA 1T8EA 2M70A 4KR0B 3X3UA 1FK9B 3W5YA 5K8NA 1N54B 4B9UA 1S1TA 3BJYA 3PG9A 2DD8S 2ROGA 2OEMA 3CWJA 3PW7A 1E6VB 2ZC3A 4USVA 2XLKA 2CG8A 3DLHA 1S76D 2WONA 2DGWA 2ZOFA 4WF9Q 2N4DA 2ZH8A 5SUHA 2KTQA 3VV2B 5D0GA 3UW1A 2FJXA 1B3TA 5KT7A 4MFBB 4RU2A 1IBCB 2UUBF 2KRBA 5E3CA 4K2XA 2ZC4A 3TVKA 3CDAA 3CD6S 2CZ4A 3J7YU 1W2IA 4B3RF 4ZPBA 2HNZA 3QIPB 3KK3B 1XNQJ 5AT1B 1NZAA 3TJ9A 3V6HA 2JEJA 2P6TA 2OPRA 3MAAA 5LJ3Y 3C6TA 3QLHB 4WJBA 4PYDA 3UN3A 4ZVSB 3Q0AA 2UXBJ 1X4EA 4FF4A 3LF0A 4QR2A 5J2NB 5DJBA 4TYBA 2B3TB 4YHHF 4IFYB 5LL6d 1UJ6A 2C3MA 4FKYA 2UU9J 4B9NA 4B9VA 2V2ZA 2H4WB 2YQ0A 1D0EA 2CQIA 3QMQA 4ED4A 3M8QA 2QA4S 1FKPB 2DGSA 3RRHA 5AE1A 3T1HJ 4OX8A 2HWIA 3SFGA 3PIPQ 2BRKA 4F4YA 3PJXA 4C8YA 1Z4UA 4ELTA 3BF4A 4PWUA 2AF6A 2FLPA 5HBMA 1CPZA 3PXGa 2RILA 3G9CA 1TAQA 3FCVA 5DG7A 3OTEA 5JXSA 1X9MA 1U47A 1Y00A 3EGVA 4P2FA 4MKYA 1YJWS 3KG1A 3NAHA 1FKOA 4FYXB 4LBIA 1N34J 3K57A 4CLPA 4DV4F 3BYRA 2KO1A 2R2RA 1ZTWA 2RIJA 2VG7B 4CLZA 4ZVRB 3TAPA 4E98A 1W26A 1OMSA 2ILZA 2WVCA 1MN7A 4A48A 1YX2A 3M9NB 2IAJB 2L9WA 3NWGA 1RT4A 4X4NA 5A2QU 1UKUA 3LA0A 2CQ3A 3OTOJ 2GIQA 3CJ5A 4IOCQ 1B7FA 2V8GA 1RT5B 1SJ4P 1R31A 2J9DE 4UZCA 1BY9A 5K8OA 4MK7A 1RBLA 4ALZA 4KO0B 2VQFF 4LT6A 2DNKA 3NNCA 3CDBA 2IFXA 4M5LA 3SSSA 3KLHA 1X0FA 2IM0A 1GMUA 5DQHA 3NGRA 3WC2A 4KAIA 3ILLA 2HVDA 2ILYA 1RAFB 2Z2ZA 3HX9A 4O0IA 3IGNA 1IKXB 1YG0A 3THPA 2PFDA 4ZIVA 3NGDA 2BM1A 2ZH1A 2XYHB 2W4CA 3HM9A 3OT9A 3SSQA 3T3FA 2J8AA 1U7LA 1FFSB 1LXNA 4WFAQ 2C22A 1Q78A 3DI6A 4R0EA 2CQGA 1XMOJ 3BB5A 4J9VA 2E5LJ 4HT7A 4LF4F 1PG5B 5IM0B 2QFJA 3THVA 2OP5A 2BJ8A 3F56A 4LRAA 4B3TF 1KLNA 1SQGA 2MPUA 4UZBA 3ZTRA 4OHYA 3RB4A 1NXIA 3CJSA 5CCMA 1Y4ZB 3D6HB 3VGTA 1XC9A 4ZPCA 3ZC4A 1JWWA 1X4CA 3UDEA 1N5YB 3G86A 3Q2SC 4AE5A 2MQ8A 3MECA 5HQMA 1HNZF 4DF4A 5HJYA 3RB0A 3CJ0A 3M6WA 4L6V3 1U1LA 2HNDB 2YKPA 4DX8H 4S0MA 3QSYB 3CJRA 5KFQA 2HAIA 3H5XA 1PAUB 1LW2A 1PBUA 3O2IA 3H4DA 1B7YB 1F5BA 4ZKAA 2W8LA 2VASA 4IO1A 4Z7YA 4V1Ak 4Q0BA 2NXJA 3LP2A 2ACYA 2JH3A 3LAKA 3EVWA 2O3DA 1IKYB 1JLEA 2F63A 2B4UA 1H2UX 3KK1B 3GLJA 4ZS6A 5BYSA 1X9SA 2VOOA 3O1LA 1JLBB 4P2MA 5K20B 2XWXA 3L3CA 2Z8QA 3CCRS 2Z30B 4EBEA 3HD2A 1NCLA 3A12A 1ZTTA 4IH5A 2W2NP 3T9NA 2SXLA 2E7VA 4GKJF 4C0HA 1CEZA 1W2BR 4DR1F 2MKJA 1BGXT 3PM9A 5AXKA 2BMBA 2B0GA 3TNVA 1RUSA 4U7UD 3RGIA 2V9KA 1G2EA 1HWUA 4HVZA 4TLQA 1JLFA 2YKNB 3ZZOA 3QFWA 1LK7A 3M6VA 3MTKA 2MTLA 1WKLA 5E0OA 2IJFA 5L39A 3OVAA 1KSPA 3LTOA 4ANCA 2DHSA 1PJ7A 1RA6A 2ZJPQ 4ZVPB 5IQ6A 3N6LA 2L08A 2MZSA 4F3OA 4DQPA 4NLOA 2K3IA 2XCPA 2LEAA 4KGZB 2NXEA 5AJ3J 2NYIA 1ZM3A 2XCAA 2E5GA 4WU3A 3PX0A 2PFFB 1HW8A 3I6PA 2PI5A 2IC3B 3T1YF 1BC6A 2WW8A 2RRBA 1U0SA 5DG8A 2V4JA 3AY0A 3LP0B 2IYIA 2HRYA 1RA7A 1JXEA 5HN0A 1EHWA 3R7NB 4WK1A 5GADU 2ATLA 2YKAA 1HLWA 1N36J 4AXIA 4C48A 2KRRA 2AGOA 1HWKA 4FS1A 4MIAA 4X66J 1RT2B 2KHCA 5M2PA 1MMDA 2V8HA 2G9OA 1UETA 1XNRF 1G6BA 1Q86T 1QAYA 4JI8J 3I0RA 2AD9A 2YPZA 1BD6A 2N4CA 1WDDA 2FHKA 4EZ6A 4HH1A 2CJKA 3IG1B 3IWXA 3TEGA 3UDVA 3QGGA 2HQFA 3BQ2A 1HIYA 1HD0A 3OL7A 4NI2B 3OFGA 2DR8A 4QBUA 3IR7B 1SKUB 4N8OA 4F4KA 4PG8A 3QBCA 5LT5A 4KPCA 4NOHA 5ETRA 5CZXA 3TAMA 3R8YA 5KFIA 1QAXA 2OMOA 1Q8LA 4I4BA 2M7SA 4ECRA 1JIHA 3Q89A 1FDBA 5HQLA 1T9YA 2GVZA 5L9NA 1TKDA 2CJQA 2DISA 3QT7A 4DMZA 4CM2A 4CLWA 3OUYB 4JI0J 4RL1A 3D68A 5J2PB 4FBTA 1AFIA 5B0AA 3EDRB 2XEXA 1GAOA 4KRWA 1H73A 4IRKA 3DLGB 3KLEA 2W9BA 3KKFA 3CCWA 4NEZA 4KIAA 4DG1A 4F7VA 3QO9A 1APSA 3EE3A 5T7LA 4LR9A 4QR1A 4PPZA 2JHEA 4WP9A 3K5OA 3DLJA 4DPXA 1Z2LA 1J5EF 2F1FA 4G1IA 1VBYA 4L76A 2RB7A 2I5JB 2IVYA 4F2SA 1PGZA 3QNWB 1IKWB 2HWHA 1N5TA 3HMJG 3OFEA 2B6AB 5FLXY 3R6LB 5IZHA 4KV8B 2KG1A 3AOBA 2WVFA 3G4SS 3M8PB 4PQUA 2E1PA 3AHPA 2CQBA 1F1BB 1ULRA 2X1AA 2UUAJ 2ALZA 1S59A 1S4FA 5GAGU 2MZTA 4P9SA 1DY3A 3T6BA 1FI4A 3MMCA 3QAUA 2MQOA 1IBLF 3RBZA 3L9ZA 5E41A 3OTCA 2Y1RI 4AT1B 4DL6A 1FX2A 4A8YA 2D7SA 1WEZA 5A76A 4M94A 2WBRA 2XMVA 4NZ6A 3LPEA 4K7QA 3UNGC 4AL5A 2DCLA 3VF0B 4C8KA 4QYZK 5KG7A 3C16B 5KG4A 4WFXA 3JTPA 1N32J 3HCXA 2DRBA 4C3MA 1UA0A 3L4BC 2ABYA 4R8UA 3UVJA 5CYMB 3DCAA 3Q8UA 4O3RA 3HVTA 4ECWA 3OJSA 3L7OA 5LMNJ 1P9YA 5J2QB 1UJ4A 2F9DA 3GPAA 4XPEA 2HWTA 3K89A 2W2PP 3UCUP 1Q8IA 2LQ8A 1S0NA 3IRXA 4LBHA 2CUYA 2RH3A 2HGLA 1WG1A 4USUA 4AFFA 3MI7X 4UOFA 1U1QA 5KT4A 3DC2A 1VQ6S 4DR5F 3LP1A 3MR2A 2CG4A 4DCPB 2N3OA 1PBAA 3I0SB 5JMNA 4OX6A 4RJVA 4N47A 3WDOA 1FFWB 4PWWA 4FXDA 2V8VA 3IR6B 4WKYA 1PYTA 2XI3A 3FQLA 2PEHA 3C6UA 4HL9A 5KFUA 1F3FA 4DR3F 1ZAVA 2DHAA 4ED7A 2UUWA 3I5CA 2W1BA 1WC6A 2M5YA 2MEWA 4D3GA 3AB4B 2DHGA 1UA1A 2YNIA 3AQPA 1Q5YA 3GFZA 4AUKA 2M9KA 3ET6A 2M2BA 2K1RB 4LF7F 5K8PA 3MMJA 2C28A 2LEBA 3C19A 3R5BA 4NXNF 5IT0A 3HHLC 4NCBA 1YZ7A 2OH2A 5KT3A 4F3MA 2KU7A 4NYZA 4J9SA 4IDKB 1AUSL 2GMJA 1IKVB 2V0NA 4H4MA 1LQ9A 3EYZA 4F67A 5D15A 2OD4A 2V2VA 3M2VB 1YBUA 4IG0A 4YQWA 1WC5A 4HLBA 4YDDB 3NP5A 1XEZA 1RT6B 4Z7CA 2HG4A 2XYGB 4N5SA 2C3OA 2J7UA 2A6MA 1TAUA 4OMFG 3MEGA 2KYXA 2DH9A 1YJNS 1RWOB 2IA0A 2DR7A 5E3PA 1RTIA 1VC0A 3KNGA 4ZCMA 4A8KA 2F8EX 3MCOA 1SL2A 2L41A 1NJYA 4UF4A 4EBDA 5D77A 1OSDA 2AWZA 4MT1A 1JK9B 5CABA 1UZDA 2N82B 4RLEA 1NSKL 3EGZA 1F9EB 2ZH9A 1S49A 2J5AA 2O66A 4PG7A 1FXRA 1TTHB 2JEGA 1WEYA 3DLLQ 5J1EA 4ILLA 4OX7A 3CC4S 2DO0A 2RU3A 1CULB 3MR7A 3T9ZA 2B7CB 1S7HA 1S4EA 1LWFA 5KFSA 3DLEB 5DGAA 3BGRA 4EFAC 4X65F 4FNIA 5CD4A 4C4WA 2CDRB 5KT6A 1C4AA 2RKIA 4O3SA 3MMBA 4YEAA 1HBUA 3DGVA 2MYFA 3KJVA 4TQSA 1NBEB 4ELVA 4JI4F 1ACMB 2FVCA 2FY1A 4RW9A 1JJHA 4ZJOA 5EX3A 5KFKA 3D28A 1XJWB 4ZVEA 3PCOB 4KQZA 4MIBA 2VFRA 3AAWB 3CC7S 4MIWA 2VC1A 4FF3A 1YZ6A 2YKMA 3BR8A 1FXLA 1T3NA 4NLDA 1JJ2R 3ENWA 4M63A 1E6YA 3JAMU 1CJVB 1ZZNA 3GTYX 4JI7F 2XTJP 1BQMA 1ZYQA 4ZCLA 4WBFA 1U1PA 1RLDA 2JOQA 2MKYA 2AYEA 3BSCA 3TA2A 3TUPA 1XMQF 3MTJA 3WQPA 2LA4A 1FRIA 2LCWA 1HNXJ 5KG3A 2KT3A 4Z2XA 3KK2B 4L75A 2WSCC 1HBMA 1FRXA 3CCJS 3GFXA 1T7PA 1X4AA 2GGPA 3UWTA 2PD1A 3ZTSA 4IRDA 3ILJA 3M2UA 1BWVA 2V4RA 3E2EA 2PA3A 2O67A 4L3NA 4ZCIA 4X64F 3HD1A 2R8GA 1Q8BA 1MNEA 2W7OA 3KWMA 4HDHA 2EWHA 1RHQB 4OZNA 1HQUB 4DZ6A 3K58A 3WX4A 1NMEB 4YY3F 3DLKA 1DFDA 1W25A 2DPJA 3AOAA 3RU0A 3DHWC 3VTIA 3HHLB 2HPUA 2ROPA 1KNZA 5I42B 6FDRA 2ALYB 4FBUA 2JJ4D 4USJC 4DL0C 3PYDA 1G4CA 3M8YA 2XWYA 1J5OA 5I4MA 1TV6A 3CJQA 4DSJA 1S57A 4JI6J 5LMUJ 3DOMB 3ILOA 1S6UA 4RNNA 3NGSA 3DRPB 2DHXA 2HZCA 2G13A 4DFKA 4LF8F 2UXCF 1NK9A 2FJBB 2OO4A 5C24B 4KHPJ 3TO8A 3PHTA 3MPWA 2ROEA 4DUZJ 2HMIB 2ZEJA 3VAHA 3CT9A 1GFWB 2CNOB 3GQCA 2W9CA 2BW2A 2ZD1A 4EEYA 1Y9OA 3O44A 4DLGA 4P71A 4M5GA 2Q79A 3CCLS 5A0YB 3BO3A 1RI7A 3MM6A 4LF1A 4PKDB 1H7WA 2JWNA 2G1DA 4YMEA 4WYWA 4K4WA 2D1CA 3TW0A 3L09A 1RTDB 4DV5J 2CADA 2QMXA 1Q16B 5EUHA 2H3EB 1O5JA 3ZZ0A 3TQ1A 2EKYA 3HT3A 1NJZA 1M0SA 3AD9C 3GU0A 4XK8C 1TFYA 4CYUA 3N4WA 4P74A 2A0FB 1M90T 3PW4A 2NLWA 3OFHA 4KH1B 4YR0A 2Y3YA 3G87A 3QGHA 2Q3PA 4OYIA 1JMTA 1I5OB 1YWXA 2HLTA 1PJ6A 2GVDA 2K2PA 1FK9A 1EARA 3H5SA 1XK8A 3RBDA 1RHRB 1V5IB 1CJTB 4NASA 5KFNA 3Q8QB 3KFWX 1NK8A 2E5IA 4DFMA 3NBPA 1PKUA 1FDNA 2JLEA 1KONA 2O1PA 3G82B 3DM2B 3Q8SB 3I96A 4WIIA 4C2MA 4B9MA 2LECA 1AA1B 3BQ0A 3IS9B 3JTNA 2OPSB 3PFOA 1FD2A 1NDCA 4J9PA 4WZQA 5GAEU 3K8WA 2VV5A 1R6YA 1R8HA 2XMWA 5D8HB 1S0OA 2FTRA 4IYQA 1RQ0A 1WHXA 4QPTA 4R25A 1KP6A 3FEXB 3QIPA 3KK3A 1LOUA 4USMA 2B43A 1JLQB 1M1HA 4ZN1A 2QLBB 2QLFB 3W65A 3D3BJ 3CW2C 3BQ1A 5ETSA 1ZBTA 4ZLNA 5JVGQ 4Y2IA 2XMMA 1UFLA 1KVJA 3TJAA 2H4YB 1U1MA 4BLGA 4C11A 1N88A 1NSAA 2P2CB 2LFVA 3EZOA 4ZOSA 2X3DA 2R8JA 3RG6A 4M5KA 4KHMA 3IM9A 2FZCB 2WCXA 2DBBA 4CP5A 2VFUA 4ZLLA 3KLFB 5HVFA 1RT7A 1BQNB 2FHJD 2AEMA 3Q86A 1EETB 4LF5F 2OPQA 1FEHA 2J0XA 1MG7A 5G4DA 4AL6A 3H25A 4B3OA 2L48A 3I9V9 3SQGB 3W1YC 4J9UE 4JYAJ 5D6GA 1FWKA 2MY7A 3A8KA 2A6OA 2OUGA 2VG5A 1B0PA 3JTOA 4H4KC 2BANB 4NLXA 4OYBA 4NMLA 3HXMA 2BACA 5D4LA 2A2DA 2NQPA 3R1LA 4C3LA 4IR9A 4JOUA 3PYFA 5H1SV 1VQYA 1VR6A 2YQ3A 3W2WB 3OXFA 3MMAA 2APOA 2OFHX 4ZLJA 2W4DA 2BE2B 1Y3JA 2HBZB 4CRJA 2I6WA 4M5HA 2PT0A 2AJ1A 2BV3A 4C8NA 5KTQA 1TL7A 5F8NA 2HQ3A 1RT5A 3W5XA 3HZEA 2RF2A 3OR1A 4IFVB 4CDIA 1IBKJ 2I8EA 2XQCA 2V34A 3GIKA 2HEKA 2V50A 2NXUA 4CLSA 3I9ZA 2G2YA 1F5AA 2H51B 1NK7A 1LW0B 1FRMA 1FESA 1JKHA 1SBRA 3R5DA 3V81A 2HRTA 3VZIA 2HBYB 2KKHA 4Q7AA 3NRBA 1AB8A 2DKOB 4OHXA 4ZHRB 1V3RA 3FBEA 3K5LA 1AUDA 4WKRA 1H6KX 2BOPA 1U02A 4DQIA 4BWJA 5JUMA 2V68A 4BS2A 3HF5A 5A8KB 3PACA 4CZCA 2GHWA 4NWBA 3IR5B 2H1YA 2AU0A 3I5BA 3SQOP 3ELHA 4DR4F 2C3YA 5E7OB 2MLXA 4M5NA 4B3SJ 3GV8B 2RT3A 1BWEA 3NNHA 4UOGA 1N5YA 3CCTA 1FVSA 2HBRB 3EPIA 2JFDA 1WUUA 2NXNA 4DR2J 1HQ2A 5C42B 9ATCB 3UQSA 3QJLA 3R5AA 3A8JA 4X4UA 2AZ1A 2MGZB 3BBBA 4DV7F 4MKAA 4JV5F 2J6UA 3MPUB 3NY0A 3TVZA 4O4GB 1VLOA 1XWLA 3M7VA 3PW0A 5DDPC 1T05B 2Y0SD 2WSFC 2R7XA 1FEEA 1P27B 1HYSB 4TU9A 1N8RT 3R2DJ 3HVAA 2QA1A 4K2JA 3QFHA 4WFNQ 4CLYA 2LXFA 1VRTB 3ZZUA 4J9RA 1IKYA 3GYXB 2ADBA 5E5NA 1SIZA 5ETMA 2R7RA 3W60A 4GMKA 1UVJA 1ZA2B 4B9SA 2KJWA 2BE7D 2FZGB 4TLRA 3VVUA 3QSIA 2OEKA 3RAMA 3EZ5A 3CTRA 4KFBB 3TZWA 2VQEF 1S1XA 2E9ZA 2K3KA 4B3RJ 1AYEA 1VBKA 2E1MC 5F0UA 1JLGB 2MZJA 3P5BP 2GFFA 1ZAWA 5E3AA 2IYGA 3AB2B 4NA1A 5C2CA 3KJFB 1S1WB 1DTTA 3OR2B 3ZZTA 2Z2MA 1RTJB 4OZJA 3MM5B 2CVIA 5ETKA 4QWAA 2OIHA 2LDYA 4FPRA 2H48B 1HNWJ 2BVZA 1UAWA 3JSMA 3W7BA 3W8PA 5FDLB 3QJPA 4FP9A 4I6YA 4MK9A 1H3DA 5JJBA 2P6SA 3TZZA 3GIIA 1UPPA 1S9EB 1KHWA 4LRCA 3Q8RB 4OZLA 4KKOA 2E1CA 1EP4B 2GJ2A 2IJRA 3DNCA 4DLEA 1EAYC 1MU2A 1V9OA 3K8VA 4RU9A 2Z56B 1RWWB 1WJ9A 2CQ2A 3HFVA 3RYLA 2JVRA 4DN9A 4AQYF 5FLXU 1RT2A 2AJ0A 2VF3A 1RGVA 1FJGF 1S5ZA 2UV8A 5KFZA 3OHBA 1F2GA 3EPGA 3V4IB 1NDLA 5LXRA 2DGTA 2LQ9A 4OIXA 3ZTQA 2HVHA 1NU4A 3TWZA 3PRDA 3ISNC 2BJEA 5A8RB 4YB5A 4EK2A 4QYZJ 2B56A 2HK3A 4F36A 3P45B 2FGOA 3BO4A 1T9VA 4URQU 1Y11A 3HKWA 1YITS 3C2PA 1T9XA 1AZSA 1BLUA 2VA2A 4DL2A 1LKZA 4O0NA 3G8TA 2YQ1A 1FRJA 4AD6A 4DV6J 3H8YA 1T03A 3DRRB 3D67A 3CCUS 2B51A 4PRFA 2CQ0A 3V6DB 1HQEB 1VCTA 3UNYA 3TVYA 2XS5A 2HQGA 2VIHA 2QJ3A 2K06A 3MCNA 1VIXA 2XC9A 1A6LA 3M32B 2M8DB 5H9FJ 5CH7B 1C0TA 4U95A 1CS4B 3V2UC 4CLFA 1XBWA 2R7QA 1QAIA 2NPFA 3SFUA 1R8PA 2R8KA 4PYAA 2IM2A 1SCJB 2GNKA 4R0JA 2X1FA 2LMIA 1NHKL 2X1BA 5H9EK 1N0VC 2I0XA 4FYDA 4FN5A 1XNQF 3PZPA 4LF4J 3M1VB 5A8WB 1S72S 4R5PB 2HHQA 3PVXA 3T41A 2RS2A 2CQ1A 2V6AA 1C1CB 4B08A 4DR7F 1K8AT 4RO0A 1S99A 2Y0BB 1K47A 1B64A 2NYHA 1XN9A 2UXBF 4HYKA 1EB0A 2HHPA 3NLCA 3BO2A 1Y3KA 1VISA 4LFAJ 4J91A 1TU0B 3N5FA 4HKQA 3M8PA 4O44A 1X5PA 5HMWA 2UU9F 2BJ9A 1PJ5A 4RW6B 4OYPA 4HACB 3ONQA 4HTIA 4I56A 3US5A 3FSIA 3G6XA 4FS2A 1GXUA 2VDHA 1X5TA 3GIJA 3T1HF 5I3UB 2ZE2B 1S6PB 2G2OA 1DTQB 1RAGB 2MXYA 3DRSB 4Y2KA 1KQKA 2NPIA 2UVWA 5M2UA 1N56A 4W92B 2DGOA 1PYOB 1M5PC 3CCQS 3CF5Q 3JS9A 3BN4A 4YP3A 5ETOA 2BR0A 4Y2CA 2LVWA 1YVFA 5J1NA 1X60A 2OKQA 1RT1A 4RWXA 2FJDB 1OY8A 2M3DA 4C7QA 4TQRA 1N34F 3VQTA 3CVKA 1QTNB 4X62J 2F65A 4IQXA 8AT1B 3GP9A 2A10A 4MTPA 1VOMA 4EI2A 2V94A 1TL1A 1UEUA 2VPZB 4ZN3A 3DKDA 2DNRA 5HAOA 3PRBA 2BYCA 3MXHP 1TUGB 3JSYA 4IG3B 1WF2A 3BGFA 3CJ2A 2BKOA 4ECZA 4N77A 3HVWA 1AFJA 2PE8A 1OS5A 2XLJA 1S97A 1HBOB 1G3OA 2BW7A 4Y2AA 1UWBB 5D78A 3H90A 4RUHA 3ZTPA 1SIWB 3ITHB 4TY8B 1U2CA 3D6TB 3GWCA 4RW4B 1DURA 1S7IA 3JSRA 2XMUA 3SXLA 1RSCA 3X1LB 1S1VA 4OI6A 2DR5A 2E1RA 1CQNA 2VHGA 4RX6A 3C14B 1U48A 4PWDA 3SSRA 1WWHA 1FRHA 4CCHA 2LU2A 1JNZB 2GAGC 1KFSA 4U67Q 1IM6A 2DGXA 2FDNA 3OL6A 2XSJB 4EUVA 3M8ZA 5MAOA 2WTFA 2EK6A 3TA0A 4WP3A 4WFZA 4ZDNA 4J9MA 1CJUB 1RHUB 4CH0S 2E5LF 2IDEA 5FIIA 4I6WA 4JI3J 4ED1A 4C6AA 4DQQA 4KPYA 3VAIA 2DPIA 1VYAA 4U8YA 3LW5C 4BC7A 1T11A 5B09A 4ID8A 2BJ1A 1VHIA 1L3TA 5C25B 4EGLA 1N5SA 1TVRB 1X8DA 4JB8B 3LWMA 1XR5A 3KHGA 2XSFA 3DOKB 3CJ8A 3AFGA 3NAIA 1H7XA 2XO6A 1CJKB 2U1AA 4DS4A
chains in the Genus database with same CATH topology
4NLWA 5KOXA 3MMCA 2J76E 3OJUA 3QAUA 2E44A 2MQOA 1RP5A 4OZ0A 1NO8A 2HGMA 2BA9A 3MMAB 1IBLF 1DZ5A 2E7WA 3QZ7A 4Q43A 2FHOB 5B0EA 2ZOGA 2GMHA 2RU9A 4ZA1A 3GIMA 4MKYA 2MSSA 1JLQA 3PEHA 2XB2D 5KFEA 5E41A 3HHEA 2JC1A 3M6UA 3OTCA 1FT8A 3PHEA 5IWAF 4IDKA 4WFBQ 5F3ZA 2WOMA 1S1TB 2Y1RI 1FDAA 1U24A 1WF1A 4DPOA 1IBMF 3SI8A 1JNRB 3EX7B 1V3SA 4RWWA 4DL6A 3D1QA 2XY5A 3H98A 2B9XA 2E5JA 3JYTA 4ED3A 5AXLA 2RF2B 5DDRC 1RTHB 4P7VA 4A8YA 3OR1B 2KVIA 3O3LA 4PXDA 7FD1A 4E0DA 2D7SA 3I31A 1ZPVA 1WEZA 3SDEA 4M94A 2WBRA 2XMVA 3VCDA 4NZ6A 1RT6A 4M5DB 1KS2A 3UNGC 4AL5A 2DCLA 2UVVA 3VF0B 3PFEA 4FZVA 1GT8A 4E8UA 2XO7A 4C8KA 4ZVFA 1YI2S 5KG7A 3DN9A 3F41A 4HI2A 5KG4A 5IT4A 4WFXA 3JTPA 4NA3A 1U6ZA 4X4SA 2X51A 1S48A 4DV6F 2DRBA 2QZ8A 4C3MA 3OLAA 2ZDOA 2L9NA 3VAFA 1SV5B 2DNPA 1UA0A 1NK4A 1JKHB 4LSNA 2ABYA 2MJUA 1KOOA 5L1LA 2QMWA 1LXJA 4OHZA 4K4YA 1BQNA 4ECTA 1X5OA 2HHWA 1CQMA 3KLVA 4N41A 1Y0HA 4R8UA 4J9NA 4N8NA 2XMKA 3FSXA 3V81B 5DQIA 5CYMB 1R89A 3DCAA 4KBIA 4EU0A 4ECQA 1Z2ZA 3B8HA 3OPKA 4TNOA 4C3KA 3GILA 2P9GA 4XIUA 3PNIA 1FD8A 1HI8A 4C97A 4O3RA 4EWTA 5CQGA 3CC2S 4F02A 3ZFVA 2WB4A 4X84A 2HNZB 3HVTA 4ECWA 2C2EA 1REVA 1OIAA 4O3OA 5EWFA 1MMNA 3OJSA 2J7KA 3ICLA 3OQ2A 3L7OA 4DSEA 2MB0B 2EVZA 2W4PA 2CZVC 2XGPA 2XNQA 5J2QB 3MAQA 1UJ4A 2F9DA 4LIWA 5CHCB 3OTDA 4XPEA 2HWTA 3DU6A 4C8YA 3OFFA 3UCUP 1Q8IA 2OPRB 3NCPA 4K0KF 3MM8A 3I55S 5DQGA 2LXUA 4PG6A 1R0AA 1S0NA 3D0IE 3BSNA 1U1NA 2RSQA 1SXLA 3C6TB 3U27A 3IRXA 3CB4A 3UE2A 3BZQA 2RH3A 2KDOA 4A8XA 1H98A 2BANA 1VQSA 1D9AA 2HGLA 1IR0A 1WG1A 3TYTA 1VQ9S 4QU7A 4QWDA 4AFFA 3MI7X 3HHLD 2JFKA 1ZPWX 4ZCKA 3GV7B 1HI0P 3NMRA 2I38A 2HHSA 1RKIA 1U1QA 4C0OC 2YX1A 5E33A 5KT4A 3DC2A 4DR6F 1VQ6S 2Y1IA 4ERDA 4DR5F 3QJJA 2AX0A 2EBGA 3LP1A 3RAQA 4AL7A 1JLAA 3W2WA 3MR2A 3RAXA 1I6JA 2CG4A 2IBOA 5CD4H 3EGNA 1F5CA 1HNIA 2N3OA 4DQRA 3I0SB 4MJKA 4HTJA 3M8QB 2BE2A 2YKOA 5AJ3F 2MQNA 4ETXA 2R8IA 4Y28C 1JJ4A 3DHXA 2HHVA 4LFAF 1LWEA 4XDCA 1DQ8A 4OX6A 4N47A 3WDOA 1C0UB 3I87A 4XPCA 4FXWA 3QZ8A 1WF0A 4DBQA 1VQNS 3P5TL 4LVNP 1E6VA 5BR8F 3NG8A 3EZUA 4FXDA 3ZZZA 1FDDA 4CI0B 3CD0A 2V8VA 3IR6B 2VKRA 4WKYA 4IFVA 3J7A1 2XI3A 2DH7A 3FQLA 2GO9A 1LV5A 1VS3A 1HWJA 2VUGA 4NLTA 2Q66A 2PEHA 3C6UA 4HL9A 3UDLA 2E29A 3NL0A 3ZZRA 3E3XA 5KFUA 1VRUB 3O6QA 4DR3F 1ZAVA 2DHAA 1N36F 4ED7A 5HBMB 4MFBA 2UUWA 5HQ8A 4W90B 2QEXS 3GMGA 3I5CA 5ADZA 1FJ7A 3LOUA 2NZ4A 1A9NB 2YH1A 1LK5A 2M5YA 4D3GA 1LW0A 3EUNA 3AB4B 5KFRA 4RW8B 2ZH3A 2DHGA 1UA1A 4ID5A 3QYYA 3LO3A 2YNIA 4X66F 2IRXA 1SJQA 3AQPA 1T02A 3GFZA 2Z4PA 5I3QA 4AUKA 1SKSA 4IOAQ 3S7RA 1T95A 3OHAA 2KM8B 2YH0A 2M9KA 3CSKA 4ZK7M 4Y00A 4A4JA 1K0VA 2DT9A 3DDKA 4I2QA 2RRNA 4NLVA 4KTQA 3JB9k 3IXQA 3CJKA 2M2BA 3MAHA 1U49A 2K1RB 2A1BA 2EK1A 4LF7F 5K8PA 3MMJA 1UL3A 2LDIA 2C28A 3K7RA 2P5VA 3IAS9 2LEBA 1N6QA 3R5BA 2QYCA 3VWSA 1GQEA 2QE5A 4NXNF 1LFPA 3PX6A 3D0HE 3FRYA 5IT0A 2RNEA 1S1XB 3HHLC 3FSYA 5KG2A 4DFPA 4NCBA 1NKEA 2YWHA 3SYZA 2OH2A 2JSXA 3K59A 4GKKF 1N33F 4Y0FA 5KG6A 5KT3A 3MFIA 4F3MA 2B7BB 1VQ4S 2DGQA 1N5QA 2KU7A 4K4XA 4NYZA 2W7AA 3CE8A 4J9SA 1U1RA 4IDKB 4X62F 1RAJA 2J0QD 2V4QA 2GMJA 2FPHX 2CPDA 5FD1A 1IKVB 2V0NA 5CYQB 4H4MA 2PN6A 1M5KC 2EBEA 1TL5A 1LQ9A 2FB0A 4QZVB 2ZJQQ 4N56A 3EYZA 2DO4A 4DJBA 4F67A 4DL5A 5A8KA 3QLHA 2OD4A 1RK8A 2R2TA 2GA7A 3M2VB 1DLOB 4EO8A 5LXYA 3FCHA 2P9CA 4IG0A 3OXGA 4YQWA 2WB1D 5CCLA 1DTTB 1QM9A 1G1XA 4YOEA 1AW0A 5CXTA 5J2NA 1R43A 4HLBA 1ZAXA 4YDDB 3NP5A 2VPXB 1XEZA 1RT6B 3QWPA 1L3SA 2RD5C 4USIA 2M0GB 3A1YG 1DAXA 1R3NA 1FRLA 2OD6A 3SCLE 1T94A 1L3UA 2PMZD 4O23A 2HG4A 2DK2A 2YNFA 3MEKA 4N5SA 4IFYA 3VAMA 1NJWA 2C3OA 2J7UA 3KLHB 2EFGA 1D8ZA 2GO8A 1TAUA 2HIQA 4OMFG 3MEGA 1P6TA 2KYXA 2ZVSA 1R7IA 1SJRA 1N5VA 1B0VA 4I0WA 2DH9A 1YJNS 2IA0A 2JLFA 3E51A 4IRCA 2DR7A 1QUVA 2OSQA 2CPFA 2W8KA 5E3PA 1FKPA 2J9EA 3IGVA 4ZP8A 4R8UB 1RTIA 2GQ2A 2XBPA 1VC0A 2BUNA 3KNGA 4ZCMA 2HRUA 2DNOA 5KFGA 4DWIA 2CPIA 5AE2A 4A8KA 2YNGB 1NH7A 2F8EX 2MGZA 1WG5A 3JSMB 1SL2A 2L41A 1NJYA 5B0FA 2N3LA 4K4ZA 4ZPWR 1RWUA 2GHVC 2IVMA 4EBDA 5J1PA 2VFTA 2GIRA 5KFCA 3HHNB 1TL3B 4DEZA 1OQ3A 5D77A 4MYUA 3GV5B 2C2DA 1SL0A 1OSDA 3TUJC 4LJMA 4U7UK 4RNFA 1T05A 4QWEA 4ECSA 2AWZA 2VD3A 1D9DA 1YJTA 3H40A 4OX9F 2U2FA 1JK9B 4TXSA 2DB1A 5ITHA 2N82B 3NMAA 4RLEA 1HYSA 1VIOA 2LQBA 4KKOB 5L38A 1NK6A 3EGZA 5LSRA 2JL9A 1UMJA 3MM8B 1YTYA 3CXCR 5I42A 3UPFA 2ZH9A 3OLBA 1S49A 2J5AA 2O66A 4BWMA 1U4BA 1NK0A 2R7UA 4PG7A 1FXRA 1VC5A 2I2YA 2JEGA 1WEYA 3MDFA 4ZLPA 3DLLQ 5U47A 1MU2B 2IRYA 5J1EA 4ILLA 4OX7A 3CC4S 4Y34A 1UW4A 2DO0A 3O8WA 1YJVA 2UV8G 5DDQC 2RU3A 2XS2A 4C8LA 2C42A 1U26A 4WTYA 3T9ZA 1IQTA 2CQHA 3PDNA 3KG0A 1VQ8S 1UP1A 2B7CB 4DN0A 2BQRA 4Y2MA 1S7HA 4CO0A 2IBKA 1YQHA 1YRXA 2JVOA 2VG7A 3A8EA 4BHQA 5CYJA 4URSA 1LWFA 2VZ9A 5L1IA 1DRZA 3ENQA 1HHTP 3J7Z5 1MSWD 5KFSA 1U2RA 2LXIA 3DLEB 4KFBA 1TUVA 5DGAA 4JI3F 2MZRA 3BGRA 4XDDA 2BJDA 1M5SA 3CPWR 4EFAC 1HNIB 4X65F 2JEIA 2ZZMA 4FNIA 3MFHA 4C4WA 2IMWP 2GV1A 3CJ4A 2IAJA 1IQZA 2XNRA 3BDEA 3LUYA 2I9SA 5KT6A 1C4AA 2RKIA 3D54A 2M4MA 2WHOA 4O3SA 3MMBA 4OFZA 4YEAA 1JLGA 1HBUA 2OJ3A 2MYFA 4YB1P 3KJVA 3N6NA 4U9RA 4TQSA 2ADCA 2BQ3A 3NKYA 5GAHI 1NKCA 4ELVA 2OTJS 2KFZA 4JI4F 1LW2B 2FVCA 2NREA 2K7JA 3IC1A 3ETOA 4RW9A 2FY1A 1JJHA 5D4OA 1IN0A 2UUAF 1Y5NB 1GTEA 4JI5F 1RJJA 2LLZA 5EX3A 5KFKA 4CO5A 4J9LA 5HL7Q 3D28A 4KO0A 4FVMA 3OR2A 4Q0BB 4ZVEA 5IXUA 4KQZA 1FJCA 4WU2A 3FFIA 4MIBA 2GX8A 1HPZA 2VFRA 4ES1A 3TARA 4FF2A 3DLBA 1QY7A 3AAWB 3B78A 3CC7S 4ES3A 2DNGA 1P8GA 4MIWA 1K9MT 3VAKA 3VALA 1RTJA 1G7CB 2PGCA 4YB7A 4X4TA 1M5HA 3EXYA 3R27A 5M2RA 2E5HA 2VC1A 4OJGA 4FF3A 1X9WA 2YKMA 3BR8A 4A8WA 1FXLA 1T3NA 4NLDA 5DGBA 1NHVA 4OHVA 1JJ2R 3ENWA 4M63A 3Q24A 1E6YA 3DOLA 4NA2A 4WYLA 4TN2A 3FDSA 3LWLA 1JLEB 5L1KA 5C5JA 1ZZNA 4A8FA 3TUZC 2BZ2A 4URGA 2UUCF 3UFCX 1WELA 4JI7F 2DIVA 4RBTA 1Q7YT 4H4KA 1BQMA 3OXLA 1ZYQA 4ZCLA 4Q44A 3RB6A 2HVZA 1FE4A 1U1PA 1IKXA 3IRWP 4OL8A 2JOQA 1T03B 1UVKA 3T5HA 2AYEA 4K50A 3PKMA 2O5DA 3BSCA 4BDPA 2XMTA 3POTA 4EBCA 1KD1T 3TA2A 2OSRA 5LSOA 5FDLA 3T19A 2PO4A 5F3TA 3PR5B 2E66A 2EC0A 1NAQA 5KOWA 1XMQF 4M8LA 3VQSA 4UQTA 3KTQA 4C0BA 3MTJA 4NLUA 4OJ3A 2LA4A 3I4HX 4WCEQ 2LU1A 2MKIA 1N32F 1FRIA 1U2FA 2ZM6F 1S9EA 3PX4A 4G6VB 5KFXA 1NB7A 3QWUA 2NS1B 1Q4RA 2VC0A 1DQAA 2BABA 3M8RA 3HO1A 3C8YA 2LCWA 3KMSA 1VQ5S 3KG4A 1S6QB 3M05A 1EP4A 5KG3A 4PXEA 1C0TB 4ZPTR 1SQEA 2F8MA 2V8DA 4IH7A 2KT3A 2F3JA 4OJHA 1RISA 1WEXA 2CVEA 4Z2XA 3E8OA 3KK2B 3K5MA 3HK2A 4O4RA 2WSCC 5HROB 4NCAA 4H4OA 2FHMA 2ZZNA 2DH8A 3RZAA 1HBMA 2ZBCA 1FRXA 1SKWA 3CCJS 3G71S 3GFXA 3CO9A 5E3QA 1WACA 1U8SA 1FNMA 1X4AA 2GGPA 1X4GA 2PD1A 4HDGA 3UWTA 1T7PA 1JLFB 1N4LA 4I67A 4IRDA 5IM0A 2C2RA 1VMBA 2HNYB 4CNZA 2QLWA 1IJFB 3H4BA 2CQDA 3ENVA 1F9FA 1TQLA 2EPIA 3M2UA 4IUFA 2BBEA 2ASLA 4LF9F 4USHA 2V4RA 5KG5A 3E2EA 2PA3A 2FHJA 2O67A 2OMLA 4L3NA 2FGCA 1URNA 4NCGB 4ZCIA 3S1TA 4A8SA 4DL3A 1FTRA 5LMNF 5EDWA 3I32A 4DV0F 4F4XA 1HMVA 2E9TA 3RRKA 3NS6A 4X64F 3HDSA 1S77D 4RUAA 3FJ2A 1HBNA 1HNVB 2HS3A 3MR6A 1KLMA 3FQKA 4F8RA 5F8IA 2R8GA 1Q8BA 2CJAA 4QQBA 1MNEA 2J9DA 5KFWA 1QSYA 4PG4A 5AXNA 2V2KA 2W7OA 1U25A 2Z0GA 5K14B 3KWMA 3V4IA 1O0PA 1RTIB 2HYIB 4HDHA 2EWHA 4OZNA 2HNDA 3T5KA 3K5PA 4ZPDA 1HQUB 5GAHU 1QUPA 4WK3A 1HI1A 4UW2A 4IQMA 3CD7A 3BDPA 5IT9Y 1C1BA 3IFEA 1XTZA 1OPIA 2XY7A 3K58A 5KAKA 4ECUA 4WZMA 3WX4A 3TI0A 1FHTA 2DIUA 5KG1A 5G0RA 5GMKa 3KMQA 3TUIC 2B5JA 4YY3F 3DRYA 3DLKA 2IJNA 1DFDA 1Q1KA 4F3QA 5KG0A 3FZBA 2J0WA 1W25A 2DPJA 4GO7X 5BYRA 3ZZYA 3G8SA 2UP1A 1TL4A 2CKWA 4O44B 3RU0A 1KN6A 1MROB 3DHWC 2B9WA 4RBVA 1JLCA 2VONA 2FIUA 4Q8FA 2OFGX 2UXDF 2AV5A 4RW7A 3VTIA 3HHLB 2KZMA 2HPUA 4MAKA 3C46A 4A8OA 2B4PA 2ROPA 2BM0A 5I42B 1KNZA 1Q81T 6FDRA 2EFNA 4UUWA 3HVRA 4AXJA 4FBUA 2JJ4D 2FVPA 2M52A 2KXNB 4QWBA 4USJC 3PJWA 3HP6A 4DL0C 1WD6A 4I2PB 1FTCA 3I82A 4YUDA 3BM7A 1TKTB 2XWYA 4A8QA 3W2VA 3RTVA 3KK1A 4ICLB 1J5OA 5HI7A 5I4MA 4ZMMA 2RDIA 2EW9A 1JLBA 3TR5A 1TV6A 1GNKA 4DSJA 2MKCA 2GC8A 1UEVA 1WI6A 2PSZA 3VZHA 3MOJB 4PCQA 2EFQA 4LSLA 2RJZA 2MHEA 3UCGA 2XLIA 4DHVA 4DSKA 3DRRA 4X4PA 4LFBF 1RT3B 4Y6IA 2LKZA 3M2RA 5IQQA 2KT5A 2R2UA 5B7WA 2OAUA 4Q8EA 2IHR1 1SB6A 3V6DA 1ROFA 1VQMS 4X4VA 1HQEA 5L9XA 1S6UA 4RNNA 3CCMS 3CD5A 3V6KA 3DRPB 2DHXA 2HZCA 2RS8A 1U1OA 5D3GA 2G13A 3P49B 5F8JA 3I0RB 1DQ9A 4DFKA 1L3KA 1K1QA 1U6FA 4PUOA 2AYGA 4LF8F 2UXCF 3M32A 1NK9A 3KJVB 2FJBB 2OO4A 2YX7A 5C24B 1RT1B 1VGYA 2ZBIA 3TO8A 1TKZB 5F0WA 3MPWA 2W24A 2ROEA 1WTBA 2HMIB 4TYAA 1QE1A 5KFMA 3HHDA 3MEEA 4ZP9A 3VAHA 3ULHA 1S9FA 4QU6A 4QYRA 3CT9A 2Q6BA 3N5BA 5F8HA 2D3OR 3HZGA 4M95A 5DG9A 3HHKA 4EO6A 3GQCA 4OHWA 5EX0A 1CC7A 3EGWB 2W9CA 2BW2A 5GAEI 3MGJA 3Q23A 2UVUA 1IUJA 4J37A 5KFJA 2EFOA 2YKNA 1YJRA 4QIGA 4RNMA 1YSJA