3PLAC

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 36
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3plaC00
1YJWF 3E1YA 1ZWZA 3OBWA 2KG4A 5GINC 1K9MH 3JCMM 1T0KB 3G6EF 5DCVA 3ON1A 5IT9M 1PXWA 4BW0B 2KTUA 3CPQA 1CK2A 3NMUC 3PAFA 3LWPC 1KC8H 2FC3A 3LWVC 3CCLF 3N4ZA 1QVGF 3LWOC 5GIOC 3J81M 1NMUB 3FFMA 2AIFA 2OZBA 1VQMF 1RLGA 2QEXF 3LWRC 3V7EA 1W2BF 1YITF 5GANK 1Q86H 1X52A 3CMAF 1YI2F 5EWRA 2QI2A 4TZZA 3VI6A 1W40A 1VQPF 1YJNF 2OHWA 3WXMB 3PLAC 1W42A 2WALA 3LWQC 5A2QM 3O85A 3IR9A 3AGKA 1SDSA 3RA5A 4X3MA 3I56F 1K8AH 3LFOA 3J80M 1QVFF 3RA6A 1VQLF 1H7MA 1KQSF 5G4UC 5FJ4C 3OBYA 5GAPK 1DT9A 3CCSF 3CXCF 1X7PA 2HVYD 3CCQF 1VQ6F 1M1KH 3CC7F 3NK6A 1VQ9F 2I6DA 1Q82H 3CCJF 3MCAB 2KTVA 5G4VC 3JAMM 3HJWC 3G71F 3SIUA 1S72F 1VQKF 3CCVF 2VGNA 4X3LA 1JJ2F 1GO1A 5GIPC 3J7AR 1YIJF 2LBXA 5EO3A 1Q7YH 1YJ9F 1E7KA 4LCKA 3NVIB 3NVKE 2JNBA 3NK7A 1GO0A 1VQ8F 2QA4F 3CCEF 1M90H 5FLXM 3GYQA 1YHQF 2OTJF 3OW2F 1IPAA 1W41A 3SIVA 1W3EX 3N4YA 1KD1H 3HAXD 2LBWA 3I55F 3CCMF 3CPWF 1VQOF 3V7QA 2BO1A 1VQ7F 1NJIH 1GZ0A 3CG6A 3CC2F 2OTLF 1Q81H 2VGMA 3CCUF 4NUTA 3CCRF 3CD6F 1CN7A 1XBIA 3E20B 1VQNF 3CMEF 2CZWA 3VMFB 1K73H 1VQ5F 4C4WC 1RA4A 4BY9D 2ALEA 3CC4F 3G4SF 1X7OA 1N8RH 1VQ4F
chains in the Genus database with same CATH superfamily
3IMPA 3JARB 1YJWF 1COMA 2PMPA 3OBWA 5ITZB 3MBMA 1K9MH 3KIZA 5IYZB 3KE1A 4U3JA 1NQ3A 5MN6A 3MQWA 1TUBB 2H8EA 2LCAA 3TD4A 3CPQA 1CK2A 1IV4A 1YQNA 3ERNA 1T0AA 4C8IA 5J2UA 2RHJA 1KC8H 4ZI7B 4YJ2A 2N48A 2UZHA 5LP6A 4O4HB 2AIFA 1CLIA 4F6RB 2UYKA 3HKBA 4FFBB 3VTIC 1RLGA 4X1IB 1X25A 1W2BF 4ZHQB 5LYJA 1YGYA 4ZOLB 2V9YA 3R0PA 4O2AB 3DDNA 4TZZA 3PLAC 3JALB 4O4LA 2RHHA 3VOAA 1UI9A 4X3MA 1W5AA 1K8AH 3N2KB 4EI9A 1FFXB 3D00A 5JH7A 3RA6A 4EB6B 5G4UC 5FJ4C 3OBYA 3DC2A 4O4JB 1QD9A 5J2TA 1X7PA 3WPXA 2HVYD 3VCZA 3IEWA 5CB4A 5JVDA 3IEQA 3ESJA 3CCJF 4WBNB 2HS4A 1W5EA 5G4VC 2UYNB 3M1XA 1JN1A 3E22A 1S72F 2PHNA 4ERHA 2VGNA 3OONA 4X3LA 5BMVA 4U3JB 3VO8A 4BT2A 4NQ3A 1FNKA 1JY8A 3MCQA 3NK7A 3GTZA 3RYHA 1GO0A 2B33A 5J2UB 2RB9A 5HP8A 3V3TA 1W5FA 4PWTA 4YJ2B 3JATA 2ZVZA 1KD1H 4M8IA 3F0DA 3V7QA 3HTNA 5LP6B 1VQ7F 4G4XA 1GZ0A 3CG6A 2OTLF 4EI7A 3CCUF 3HKBB 1Q81H 3CCRF 3U0OA 4B45A 3M4SA 5C8YA 5LYJB 3GHZA 3CMEF 2CZWA 3VMFB 4C4WC 3JAWB 5AVMA 4G4YA 4O4LB 4LNUA 4BT7A 3G4SF 2ZAUA 5JH7B 3S02A 1VQVA 1T0KB 3G6EF 3K0TA 5HXZA 1OFUA 1PXWA 4BW0B 2KTUA 2UYJA 5CB4B 3NMUC 1JD1A 5JVDB 5IJ0A 3V4DA 1OAPA 4G4VA 4RQOA 3S0WA 2RHOA 5MN5A 4DXDA 2Q1YA 3N4ZA 3E22B 4IHJA 1QVGF 4C8GA 4X1YA 3VYUC 5HY0A 5KX5A 1VH8A 4B62A 1VQMF 4ZHYB 1RQ2A 3RYHB 3CMAF 2QTPA 3HKDA 3WGLA 2BTQB 4TUYA 3VI6A 1W40A 2OHWA 4C81A 1W42A 3JATB 3IR9A 4G4WA 4HNAA 5B8FA 5JCOC 3M84A 2HP0A 3LFOA 5EIBD 4I50A 3UT5A 1H7MA 3VOBA 5C8YB 2GZLA 1VQ6F 3CB2A 3HWUA 5HP7A 1VQ9F 3S03A 3MCAB 3JAMM 4LNUB 5EIBC 3JAKB 2YXZA 3VYTC 2RHLA 1XHOA 1W55A 3P10A 3CCVF 4TV9A 1GO1A 4C8EA 5EO3A 3QUWA 1E7KA 3NVKE 2G9IA 1J7HA 5JQGA 5IJ0B 3JVHA 3S0YA 4YJ3A 2QA4F 2Z1FA 3CCEF 5FLXM 2OTJF 4IHJB 5FNVA 3SIVA 3RYFA 4X1YB 2GVIA 3HAXD 4X1KA 3CCMF 4O2BB 1RQ7A 1VQOF 2FGYA 2ZF8A 1H47A 5KX5B 1NJIH 5KMGB 3CC2F 3WGJA 4BT3A 2Z1TA 5CA0A 2ZODA 5EAZA 3HKDB 1PF5A 4U39A 4TUYB 3HKCA 1ONIA 2ALEA 4HNAB 3LDTA 3E1YA 2HP0B 2KG4A 3C8LA 4I50B 4NWOB 5GINC 3UT5B 1W581 3JCMM 3WPWA 5HWEA 2CHSA 5DCVA 3ON1A 3RYCA 4BT6A 2HS3A 3B6NA 2HP3A 2NMUA 5LXTA 3RE3A 2BTOA 2LBTA 4IIJA 1H48A 3K14A 3CCLF 3I3FA 4B46A 1XV2A 3C9UA 5GIOC 2VAWA 3J81M 4BT5A 3Q8HA 3WGKA 5EB1B 4TV9B 1TUBA 3P0ZA 4I4TA 3D54A 3FFMA 2DYYA 2IG8A 2MQEA 3LWRC 3V7EA 1Q8RA 3KJJA 2W8BC 1YITF 1X52A 5JQGB 1YI2F 2QI2A 4YJ3B 5J2TB 4B5CA 1VQPF 3F0FA 5FNVB 2WALA 5LOVA 3RYFB 3LWQC 3WJQA 5A2QM 3AGKA 3CYPB 3RA5A 4X1KB 3I56F 1SA0A 3IKEA 1W5BA 3C9SA 3J80M 3IKFA 3P4EA 4RHAA 5CA0B 3CCSF 5BMVB 1IV3A 3HKCB 2H6LA 3JASA 3NK6A 5LA6A 3VIUA 4E6EA 3N2KA 3HJWC 3I7TA 4G4ZA 4X20A 3SIUA 1JFFA 1FNJA 2AMTA 4ZHVA 1VQKF 2HRYA 3ZP7A 3C9TA 3K2XA 3LYBA 2KGWA 1JJ2F 3WJPA 5GIPC 3J7AR 2LBXA 1Q7YH 2F9ZC 3RYCB 4LCKA 1U40A 5EYPA 5HY2A 2DT4A 4BVRA 1VQ8F 1W57A 4IIJB 1M90H 1R1MA 1RLUA 4BVQA 3GYQA 1YHQF 3OW2F 1IPAA 1W41A 5LP6C 4DRXA 3N4YA 4BVSA 2LBWA 5HY1A 3I55F 3CPWF 2Z1UA 3S0HA 4I4TB 2BO1A 2P6YA 3N2GA 2VGMA 2H8CA 4NUTA 5JCOA 3CD6F 2VAMA 2CSLA 3WGMA 1KNKA 1W59A 3KHNA 4ZK7A 3ZO8A 1VQ5F 1U43A 5LOVB 1RA4A 2OTMA 3RYIA 4BVTA 3LMEA 1TVKA 3TD3A 4EI8A 5IJ9A 3S06A 1N8RH 3FD6A 3FPIA 1VQ4F 1SA0B 1ZWZA 1U3LA 3FBAA 5MN4A 4XCQA 1KNJA 3HKEA 5CA1A 5EZYA 2Z01A 5KMGA 3BYQA 3F6MA 4G88A 2L26A 5IT9M 4TV8A 3JAWA 2HS0A 2R751 2ZVYA 3JASB 3PAFA 5LA6B 3LWPC 3C9RA 3K12A 1UFYA 2CHTA 3WGNA 2FC3A 3LWVC 4X20B 1JFFB 1VHAA 3LWOC 1NMUB 4O4IA 2CWJA 4ZHWA 1U3PA 2OZBA 2QEXF 4R40B 5EYPB 4I55A 2R6R1 2UYPA 5GANK 1Q86H 1SZQA 5HY4A 4C82A 5EWRA 1IV2A 3KJKA 1YJNF 3WXMB 1Z5VA 4DRXB 2BTUA 3O85A 5GONA 1SDSA 3VYSC 2HRUA 3JARA 2VXYA 1Z5WA 3N2GB 5ITZA 1QVFF 3QHDA 1VQLF 3F0GA 1KQSF 5IYZA 5GAPK 1DT9A 2VAPA 3CXCF 2AIZP 3CCQF 1QU9A 3EORA 1M1KH 2IAFA 3CC7F 5EB0A 2I6DA 1Q82H 3MDOA 3RYIB 1TVKB 2KTVA 2Q1XA 3ELCA 5HXUA 3FD5A 5IJ9B 3G71F 1DBFA 4ZI7A 2ZOVA 1XRGA 2HX0A 2I6RA 3F0EA 3HKEB 5CA1B 5EZYB 4O4HA 1YIJF 1ODEA 4F6RA 4FFBA 1YJ9F 2EWCA 3NVIB 4TV8B 4X1IA 3T80A 3L7QA 4ZHQA 2JNBA 3QTYA 4ZOLA 3JAKA 3WJRA 4BT4A 4O2AA 1IV1A 2Z1EA 2YYEA 3JALA 1W3EX 4O4IB 2CW4A 3ZOPA 2CVLA 3CYQA 1FFXA 3D01A 1CN7A 2HQSC 1XBIA 4I55B 4EB6A 3E20B 1QAHA 4O4JA 2K1SA 3ZP4A 2GLZA 1VQNF 1GX1A 1FSZA 1K73H 1VK3A 4O2BA 4KWEA 4BY9D 5GONB 4WBNA 2IQQA 5LXTB 3CC4F 1X7OA 2UYNA 3TD5A
chains in the Genus database with same CATH topology
1YJWF 3E1YA 1ZWZA 3OBWA 2KG4A 5GINC 1K9MH 4XCQA 3JCMM 1T0KB 5HWEA 3G6EF 5DCVA 3ON1A 5HXZA 5IT9M 1PXWA 4BW0B 2KTUA 3CPQA 1CK2A 3NMUC 3PAFA 3LWPC 1KC8H 2FC3A 3LWVC 3CCLF 3N4ZA 1QVGF 3LWOC 5GIOC 3J81M 1NMUB 5HY0A 3FFMA 2AIFA 2OZBA 1VQMF 1RLGA 2QEXF 3LWRC 3V7EA 1W2BF 1YITF 5GANK 1Q86H 1X52A 5HY4A 3CMAF 1YI2F 5EWRA 2QI2A 4TZZA 3VI6A 1W40A 1VQPF 1YJNF 2OHWA 3WXMB 3PLAC 1W42A 2WALA 3LWQC 5A2QM 3O85A 3IR9A 3AGKA 1SDSA 3RA5A 4X3MA 3I56F 1K8AH 3LFOA 4EI9A 3D00A 3J80M 1QVFF 3RA6A 1VQLF 1H7MA 1KQSF 5G4UC 5FJ4C 3OBYA 5GAPK 1DT9A 3CCSF 3CXCF 1X7PA 2HVYD 3CCQF 1VQ6F 1M1KH 3CC7F 3NK6A 1VQ9F 2I6DA 1Q82H 3CCJF 3MCAB 2KTVA 5HXUA 5G4VC 3JAMM 3HJWC 3G71F 3SIUA 1S72F 1VQKF 3CCVF 2VGNA 4X3LA 1JJ2F 1GO1A 5GIPC 3J7AR 1YIJF 2LBXA 5EO3A 1Q7YH 1YJ9F 2F9ZC 1E7KA 3NVIB 4LCKA 3NVKE 4NQ3A 5HY2A 2JNBA 3NK7A 4BVRA 1GO0A 1VQ8F 2QA4F 3V3TA 3CCEF 1M90H 5FLXM 4BVQA 3GYQA 1YHQF 2OTJF 3OW2F 1IPAA 1W41A 3SIVA 1W3EX 3N4YA 4BVSA 1KD1H 3HAXD 2LBWA 5HY1A 3I55F 3CCMF 3CPWF 1VQOF 2FGYA 3V7QA 2BO1A 1VQ7F 1NJIH 1GZ0A 3CG6A 3CC2F 2OTLF 4EI7A 2VGMA 3CCUF 1Q81H 4NUTA 3CCRF 3CD6F 1CN7A 1XBIA 3E20B 2GLZA 1VQNF 3CMEF 2CZWA 3VMFB 1K73H 1VQ5F 4C4WC 1RA4A 4BY9D 4BVTA 2ALEA 4EI8A 3CC4F 3G4SF 1X7OA 1N8RH 1VQ4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW F;  3E1Y A;  1ZWZ A;  3OBW A;  2KG4 A;  5GIN C;  1K9M H;  3JCM M;  1T0K B;  3G6E F;  5DCV A;  3ON1 A;  5IT9 M;  1PXW A;  4BW0 B;  2KTU A;  3CPQ A;  1CK2 A;  3NMU C;  3PAF A;  3LWP C;  1KC8 H;  2FC3 A;  3LWV C;  3CCL F;  3N4Z A;  1QVG F;  3LWO C;  5GIO C;  3J81 M;  1NMU B;  3FFM A;  2AIF A;  2OZB A;  1VQM F;  1RLG A;  2QEX F;  3LWR C;  3V7E A;  1W2B F;  1YIT F;  5GAN K;  1Q86 H;  1X52 A;  3CMA F;  1YI2 F;  5EWR A;  2QI2 A;  4TZZ A;  3VI6 A;  1W40 A;  1VQP F;  1YJN F;  2OHW A;  3WXM B;  3PLA C;  1W42 A;  2WAL A;  3LWQ C;  5A2Q M;  3O85 A;  3IR9 A;  3AGK A;  1SDS A;  3RA5 A;  4X3M A;  3I56 F;  1K8A H;  3LFO A;  3J80 M;  1QVF F;  3RA6 A;  1VQL F;  1H7M A;  1KQS F;  5G4U C;  5FJ4 C;  3OBY A;  5GAP K;  1DT9 A;  3CCS F;  3CXC F;  1X7P A;  2HVY D;  3CCQ F;  1VQ6 F;  1M1K H;  3CC7 F;  3NK6 A;  1VQ9 F;  2I6D A;  1Q82 H;  3CCJ F;  3MCA B;  2KTV A;  5G4V C;  3JAM M;  3HJW C;  3G71 F;  3SIU A;  1S72 F;  1VQK F;  3CCV F;  2VGN A;  4X3L A;  1JJ2 F;  1GO1 A;  5GIP C;  3J7A R;  1YIJ F;  2LBX A;  5EO3 A;  1Q7Y H;  1YJ9 F;  1E7K A;  4LCK A;  3NVI B;  3NVK E;  2JNB A;  3NK7 A;  1GO0 A;  1VQ8 F;  2QA4 F;  3CCE F;  1M90 H;  5FLX M;  3GYQ A;  1YHQ F;  2OTJ F;  3OW2 F;  1IPA A;  1W41 A;  3SIV A;  1W3E X;  3N4Y A;  1KD1 H;  3HAX D;  2LBW A;  3I55 F;  3CCM F;  3CPW F;  1VQO F;  3V7Q A;  2BO1 A;  1VQ7 F;  1NJI H;  1GZ0 A;  3CG6 A;  3CC2 F;  2OTL F;  1Q81 H;  2VGM A;  3CCU F;  4NUT A;  3CCR F;  3CD6 F;  1CN7 A;  1XBI A;  3E20 B;  1VQN F;  3CME F;  2CZW A;  3VMF B;  1K73 H;  1VQ5 F;  4C4W C;  1RA4 A;  4BY9 D;  2ALE A;  3CC4 F;  3G4S F;  1X7O A;  1N8R H;  1VQ4 F; 
#chains in the Genus database with same CATH topology
 3IMP A;  3JAR B;  1YJW F;  1COM A;  2PMP A;  3OBW A;  5ITZ B;  3MBM A;  1K9M H;  3KIZ A;  5IYZ B;  3KE1 A;  4U3J A;  1NQ3 A;  5MN6 A;  3MQW A;  1TUB B;  2H8E A;  2LCA A;  3TD4 A;  3CPQ A;  1CK2 A;  1IV4 A;  1YQN A;  3ERN A;  1T0A A;  4C8I A;  5J2U A;  2RHJ A;  1KC8 H;  4ZI7 B;  4YJ2 A;  2N48 A;  2UZH A;  5LP6 A;  4O4H B;  2AIF A;  1CLI A;  4F6R B;  2UYK A;  3HKB A;  4FFB B;  3VTI C;  1RLG A;  4X1I B;  1X25 A;  1W2B F;  4ZHQ B;  5LYJ A;  1YGY A;  4ZOL B;  2V9Y A;  3R0P A;  4O2A B;  3DDN A;  4TZZ A;  3PLA C;  3JAL B;  4O4L A;  2RHH A;  3VOA A;  1UI9 A;  4X3M A;  1W5A A;  1K8A H;  3N2K B;  4EI9 A;  1FFX B;  3D00 A;  5JH7 A;  3RA6 A;  4EB6 B;  5G4U C;  5FJ4 C;  3OBY A;  3DC2 A;  4O4J B;  1QD9 A;  5J2T A;  1X7P A;  3WPX A;  2HVY D;  3VCZ A;  3IEW A;  5CB4 A;  5JVD A;  3IEQ A;  3ESJ A;  3CCJ F;  4WBN B;  2HS4 A;  1W5E A;  5G4V C;  2UYN B;  3M1X A;  1JN1 A;  3E22 A;  1S72 F;  2PHN A;  4ERH A;  2VGN A;  3OON A;  4X3L A;  5BMV A;  4U3J B;  3VO8 A;  4BT2 A;  4NQ3 A;  1FNK A;  1JY8 A;  3MCQ A;  3NK7 A;  3GTZ A;  3RYH A;  1GO0 A;  2B33 A;  5J2U B;  2RB9 A;  5HP8 A;  3V3T A;  1W5F A;  4PWT A;  4YJ2 B;  3JAT A;  2ZVZ A;  1KD1 H;  4M8I A;  3F0D A;  3V7Q A;  3HTN A;  5LP6 B;  1VQ7 F;  4G4X A;  1GZ0 A;  3CG6 A;  2OTL F;  4EI7 A;  3CCU F;  3HKB B;  1Q81 H;  3CCR F;  3U0O A;  4B45 A;  3M4S A;  5C8Y A;  5LYJ B;  3GHZ A;  3CME F;  2CZW A;  3VMF B;  4C4W C;  3JAW B;  5AVM A;  4G4Y A;  4O4L B;  4LNU A;  4BT7 A;  3G4S F;  2ZAU A;  5JH7 B;  3S02 A;  1VQV A;  1T0K B;  3G6E F;  3K0T A;  5HXZ A;  1OFU A;  1PXW A;  4BW0 B;  2KTU A;  2UYJ A;  5CB4 B;  3NMU C;  1JD1 A;  5JVD B;  5IJ0 A;  3V4D A;  1OAP A;  4G4V A;  4RQO A;  3S0W A;  2RHO A;  5MN5 A;  4DXD A;  2Q1Y A;  3N4Z A;  3E22 B;  4IHJ A;  1QVG F;  4C8G A;  4X1Y A;  3VYU C;  5HY0 A;  5KX5 A;  1VH8 A;  4B62 A;  1VQM F;  4ZHY B;  1RQ2 A;  3RYH B;  3CMA F;  2QTP A;  3HKD A;  3WGL A;  2BTQ B;  4TUY A;  3VI6 A;  1W40 A;  2OHW A;  4C81 A;  1W42 A;  3JAT B;  3IR9 A;  4G4W A;  4HNA A;  5B8F A;  5JCO C;  3M84 A;  2HP0 A;  3LFO A;  5EIB D;  4I50 A;  3UT5 A;  1H7M A;  3VOB A;  5C8Y B;  2GZL A;  1VQ6 F;  3CB2 A;  3HWU A;  5HP7 A;  1VQ9 F;  3S03 A;  3MCA B;  3JAM M;  4LNU B;  5EIB C;  3JAK B;  2YXZ A;  3VYT C;  2RHL A;  1XHO A;  1W55 A;  3P10 A;  3CCV F;  4TV9 A;  1GO1 A;  4C8E A;  5EO3 A;  3QUW A;  1E7K A;  3NVK E;  2G9I A;  1J7H A;  5JQG A;  5IJ0 B;  3JVH A;  3S0Y A;  4YJ3 A;  2QA4 F;  2Z1F A;  3CCE F;  5FLX M;  2OTJ F;  4IHJ B;  5FNV A;  3SIV A;  3RYF A;  4X1Y B;  2GVI A;  3HAX D;  4X1K A;  3CCM F;  4O2B B;  1RQ7 A;  1VQO F;  2FGY A;  2ZF8 A;  1H47 A;  5KX5 B;  1NJI H;  5KMG B;  3CC2 F;  3WGJ A;  4BT3 A;  2Z1T A;  5CA0 A;  2ZOD A;  5EAZ A;  3HKD B;  1PF5 A;  4U39 A;  4TUY B;  3HKC A;  1ONI A;  2ALE A;  4HNA B;  3LDT A;  3E1Y A;  2HP0 B;  2KG4 A;  3C8L A;  4I50 B;  4NWO B;  5GIN C;  3UT5 B;  1W58 1;  3JCM M;  3WPW A;  5HWE A;  2CHS A;  5DCV A;  3ON1 A;  3RYC A;  4BT6 A;  2HS3 A;  3B6N A;  2HP3 A;  2NMU A;  5LXT A;  3RE3 A;  2BTO A;  2LBT A;  4IIJ A;  1H48 A;  3K14 A;  3CCL F;  3I3F A;  4B46 A;  1XV2 A;  3C9U A;  5GIO C;  2VAW A;  3J81 M;  4BT5 A;  3Q8H A;  3WGK A;  5EB1 B;  4TV9 B;  1TUB A;  3P0Z A;  4I4T A;  3D54 A;  3FFM A;  2DYY A;  2IG8 A;  2MQE A;  3LWR C;  3V7E A;  1Q8R A;  3KJJ A;  2W8B C;  1YIT F;  1X52 A;  5JQG B;  1YI2 F;  2QI2 A;  4YJ3 B;  5J2T B;  4B5C A;  1VQP F;  3F0F A;  5FNV B;  2WAL A;  5LOV A;  3RYF B;  3LWQ C;  3WJQ A;  5A2Q M;  3AGK A;  3CYP B;  3RA5 A;  4X1K B;  3I56 F;  1SA0 A;  3IKE A;  1W5B A;  3C9S A;  3J80 M;  3IKF A;  3P4E A;  4RHA A;  5CA0 B;  3CCS F;  5BMV B;  1IV3 A;  3HKC B;  2H6L A;  3JAS A;  3NK6 A;  5LA6 A;  3VIU A;  4E6E A;  3N2K A;  3HJW C;  3I7T A;  4G4Z A;  4X20 A;  3SIU A;  1JFF A;  1FNJ A;  2AMT A;  4ZHV A;  1VQK F;  2HRY A;  3ZP7 A;  3C9T A;  3K2X A;  3LYB A;  2KGW A;  1JJ2 F;  3WJP A;  5GIP C;  3J7A R;  2LBX A;  1Q7Y H;  2F9Z C;  3RYC B;  4LCK A;  1U40 A;  5EYP A;  5HY2 A;  2DT4 A;  4BVR A;  1VQ8 F;  1W57 A;  4IIJ B;  1M90 H;  1R1M A;  1RLU A;  4BVQ A;  3GYQ A;  1YHQ F;  3OW2 F;  1IPA A;  1W41 A;  5LP6 C;  4DRX A;  3N4Y A;  4BVS A;  2LBW A;  5HY1 A;  3I55 F;  3CPW F;  2Z1U A;  3S0H A;  4I4T B;  2BO1 A;  2P6Y A;  3N2G A;  2VGM A;  2H8C A;  4NUT A;  5JCO A;  3CD6 F;  2VAM A;  2CSL A;  3WGM A;  1KNK A;  1W59 A;  3KHN A;  4ZK7 A;  3ZO8 A;  1VQ5 F;  1U43 A;  5LOV B;  1RA4 A;  2OTM A;  3RYI A;  4BVT A;  3LME A;  1TVK A;  3TD3 A;  4EI8 A;  5IJ9 A;  3S06 A;  1N8R H;  3FD6 A;  3FPI A;  1VQ4 F;  1SA0 B;  1ZWZ A;  1U3L A;  3FBA A;  5MN4 A;  4XCQ A;  1KNJ A;  3HKE A;  5CA1 A;  5EZY A;  2Z01 A;  5KMG A;  3BYQ A;  3F6M A;  4G88 A;  2L26 A;  5IT9 M;  4TV8 A;  3JAW A;  2HS0 A;  2R75 1;  2ZVY A;  3JAS B;  3PAF A;  5LA6 B;  3LWP C;  3C9R A;  3K12 A;  1UFY A;  2CHT A;  3WGN A;  2FC3 A;  3LWV C;  4X20 B;  1JFF B;  1VHA A;  3LWO C;  1NMU B;  4O4I A;  2CWJ A;  4ZHW A;  1U3P A;  2OZB A;  2QEX F;  4R40 B;  5EYP B;  4I55 A;  2R6R 1;  2UYP A;  5GAN K;  1Q86 H;  1SZQ A;  5HY4 A;  4C82 A;  5EWR A;  1IV2 A;  3KJK A;  1YJN F;  3WXM B;  1Z5V A;  4DRX B;  2BTU A;  3O85 A;  5GON A;  1SDS A;  3VYS C;  2HRU A;  3JAR A;  2VXY A;  1Z5W A;  3N2G B;  5ITZ A;  1QVF F;  3QHD A;  1VQL F;  3F0G A;  1KQS F;  5IYZ A;  5GAP K;  1DT9 A;  2VAP A;  3CXC F;  2AIZ P;  3CCQ F;  1QU9 A;  3EOR A;  1M1K H;  2IAF A;  3CC7 F;  5EB0 A;  2I6D A;  1Q82 H;  3MDO A;  3RYI B;  1TVK B;  2KTV A;  2Q1X A;  3ELC A;  5HXU A;  3FD5 A;  5IJ9 B;  3G71 F;  1DBF A;  4ZI7 A;  2ZOV A;  1XRG A;  2HX0 A;  2I6R A;  3F0E A;  3HKE B;  5CA1 B;  5EZY B;  4O4H A;  1YIJ F;  1ODE A;  4F6R A;  4FFB A;  1YJ9 F;  2EWC A;  3NVI B;  4TV8 B;  4X1I A;  3T80 A;  3L7Q A;  4ZHQ A;  2JNB A;  3QTY A;  4ZOL A;  3JAK A;  3WJR A;  4BT4 A;  4O2A A;  1IV1 A;  2Z1E A;  2YYE A;  3JAL A;  1W3E X;  4O4I B;  2CW4 A;  3ZOP A;  2CVL A;  3CYQ A;  1FFX A;  3D01 A;  1CN7 A;  2HQS C;  1XBI A;  4I55 B;  4EB6 A;  3E20 B;  1QAH A;  4O4J A;  2K1S A;  3ZP4 A;  2GLZ A;  1VQN F;  1GX1 A;  1FSZ A;  1K73 H;  1VK3 A;  4O2B A;  4KWE A;  4BY9 D;  5GON B;  4WBN A;  2IQQ A;  5LXT B;  3CC4 F;  1X7O A;  2UYN A;  3TD5 A; 
#chains in the Genus database with same CATH homology
 1YJW F;  3E1Y A;  1ZWZ A;  3OBW A;  2KG4 A;  5GIN C;  1K9M H;  4XCQ A;  3JCM M;  1T0K B;  5HWE A;  3G6E F;  5DCV A;  3ON1 A;  5HXZ A;  5IT9 M;  1PXW A;  4BW0 B;  2KTU A;  3CPQ A;  1CK2 A;  3NMU C;  3PAF A;  3LWP C;  1KC8 H;  2FC3 A;  3LWV C;  3CCL F;  3N4Z A;  1QVG F;  3LWO C;  5GIO C;  3J81 M;  1NMU B;  5HY0 A;  3FFM A;  2AIF A;  2OZB A;  1VQM F;  1RLG A;  2QEX F;  3LWR C;  3V7E A;  1W2B F;  1YIT F;  5GAN K;  1Q86 H;  1X52 A;  5HY4 A;  3CMA F;  1YI2 F;  5EWR A;  2QI2 A;  4TZZ A;  3VI6 A;  1W40 A;  1VQP F;  1YJN F;  2OHW A;  3WXM B;  3PLA C;  1W42 A;  2WAL A;  3LWQ C;  5A2Q M;  3O85 A;  3IR9 A;  3AGK A;  1SDS A;  3RA5 A;  4X3M A;  3I56 F;  1K8A H;  3LFO A;  4EI9 A;  3D00 A;  3J80 M;  1QVF F;  3RA6 A;  1VQL F;  1H7M A;  1KQS F;  5G4U C;  5FJ4 C;  3OBY A;  5GAP K;  1DT9 A;  3CCS F;  3CXC F;  1X7P A;  2HVY D;  3CCQ F;  1VQ6 F;  1M1K H;  3CC7 F;  3NK6 A;  1VQ9 F;  2I6D A;  1Q82 H;  3CCJ F;  3MCA B;  2KTV A;  5HXU A;  5G4V C;  3JAM M;  3HJW C;  3G71 F;  3SIU A;  1S72 F;  1VQK F;  3CCV F;  2VGN A;  4X3L A;  1JJ2 F;  1GO1 A;  5GIP C;  3J7A R;  1YIJ F;  2LBX A;  5EO3 A;  1Q7Y H;  1YJ9 F;  2F9Z C;  1E7K A;  3NVI B;  4LCK A;  3NVK E;  4NQ3 A;  5HY2 A;  2JNB A;  3NK7 A;  4BVR A;  1GO0 A;  1VQ8 F;  2QA4 F;  3V3T A;  3CCE F;  1M90 H;  5FLX M;  4BVQ A;  3GYQ A;  1YHQ F;  2OTJ F;  3OW2 F;  1IPA A;  1W41 A;  3SIV A;  1W3E X;  3N4Y A;  4BVS A;  1KD1 H;  3HAX D;  2LBW A;  5HY1 A;  3I55 F;  3CCM F;  3CPW F;  1VQO F;  2FGY A;  3V7Q A;  2BO1 A;  1VQ7 F;  1NJI H;  1GZ0 A;  3CG6 A;  3CC2 F;  2OTL F;  4EI7 A;  2VGM A;  3CCU F;  1Q81 H;  4NUT A;  3CCR F;  3CD6 F;  1CN7 A;  1XBI A;  3E20 B;  2GLZ A;  1VQN F;  3CME F;  2CZW A;  3VMF B;  1K73 H;  1VQ5 F;  4C4W C;  1RA4 A;  4BY9 D;  4BVT A;  2ALE A;  4EI8 A;  3CC4 F;  3G4S F;  1X7O A;  1N8R H;  1VQ4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...