3PLAC

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
122
structure length
122
Chain Sequence
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 36
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3plaC00
5EWRA 1KQSF 1DT9A 1QVFF 5EO3A 1JJ2F 2VGNA 3CCUF 3J81M 3CC2F 4TZZA 3J80M 1PXWA 2OTJF 1IPAA 4LCKA 1RA4A 1SDSA 1YHQF 1ZWZA 1KD1H 1KC8H 1X7OA 1GO0A 1GO1A 1YJ9F 1Q86H 5G4UC 2FC3A 1M90H 3NVIB 3HAXD 1NJIH 1VQLF 1K73H 1YITF 3SIVA 3IR9A 3HJWC 1VQOF 3CD6F 2BO1A 5GIPC 5A2QM 3V7EA 5DCVA 3CC4F 3CPQA 3RA5A 1VQ8F 3LWQC 1W42A 1T0KB 2KTVA 1VQ6F 1Q81H 1X7PA 1W40A 1YI2F 1VQMF 3WXMB 1W41A 1RLGA 1VQPF 1VQKF 3E20B 3OW2F 5GANK 1E7KA 5G4VC 1QVGF 1X52A 1VQ7F 3JAMM 2I6DA 3NK6A 1Q7YH 3OBWA 3CCEF 3LWPC 3LWOC 1K9MH 3CMAF 2ALEA 3NMUC 3CXCF 3RA6A 1N8RH 3O85A 4NUTA 2KG4A 2QA4F 3LWRC 1XBIA 3VI6A 1M1KH 1S72F 5IT9M 2WALA 3CG6A 1YJWF 2OHWA 3LFOA 4X3LA 2CZWA 3LWVC 3ON1A 1YIJF 1CN7A 3CPWF 3FFMA 3V7QA 3SIUA 3CCJF 2OTLF 5FLXM 5GIOC 2VGMA 3GYQA 2KTUA 1NMUB 3J7AR 3AGKA 4BY9D 2OZBA 4X3MA 2LBXA 2HVYD 4C4WC 1VQNF 2QI2A 3OBYA 1GZ0A 2AIFA 3MCAB 3PLAC 1W2BF 5GAPK 3G6EF 4BW0B 1VQ4F 1VQ5F 5GINC 3PAFA 1YJNF 3I55F 1CK2A 3JCMM 2JNBA 3G71F 1K8AH 3NK7A 1VQ9F 3CMEF 3CCLF 1H7MA 3G4SF 2QEXF 3CCSF 3NVKE 1W3EX 3E1YA 2LBWA 3CCRF 3CCVF 3I56F 5FJ4C 3N4YA 3N4ZA 3VMFB 3CCQF 3CC7F 1Q82H 3CCMF
chains in the Genus database with same CATH superfamily
3OONA 3ELCA 2W8BC 4ZHQB 4RQOA 1JJ2F 3J81M 3CC2F 1W57A 1TUBA 2OTJF 5CA1A 1RA4A 3HKDA 4EI8A 2G9IA 4F6RA 1KD1H 5EZYA 4BVRA 4C82A 2HP0B 1KC8H 1GO1A 2CVLA 4BT3A 2R751 4LNUB 4O2AB 3SIVA 3WPXA 4TV9A 2I6RA 4ZHYB 2GVIA 2BO1A 3V7EA 1GX1A 2DYYA 2Z1FA 3CPQA 3RYFB 3L7QA 4G4WA 2H8EA 3CYQA 3RYIA 5HY2A 1W5BA 3S0HA 1VQ6F 1U3LA 1W40A 1VQMF 2CW4A 3JVHA 3JASA 1VQ7F 4BT2A 3JAMM 3HKBB 1H47A 1VH8A 3FPIA 4KWEA 5EAZA 4O4HA 3QHDA 1T0AA 3IKFA 3C9SA 4I50B 2GZLA 2N48A 3VIUA 1K9MH 4O4LA 3M1XA 4BVQA 4ZHWA 5JVDA 5MN5A 1N8RH 3TD3A 1COMA 3VI6A 1U40A 4BVSA 1SA0A 5EIBC 3CG6A 2RB9A 1YJWF 4YJ2B 5EYPA 3T80A 4X3LA 5CA1B 3MCQA 3HKDB 3UT5A 4F6RB 4O2BB 4WBNA 5HXUA 3N2KA 5EZYB 3CPWF 5AVMA 3V7QA 3CCJF 1OAPA 3N2GA 3JARA 5FLXM 5GIOC 1W59A 3J7AR 4ERHA 3AGKA 4BY9D 2HVYD 4ZHVA 3IMPA 3U0OA 4TV9B 2QI2A 3BYQA 3VO8A 2AIFA 2UZHA 5GAPK 2VXYA 2MQEA 5LP6C 2ZF8A 3B6NA 3RYIB 1U43A 4G4XA 3JCMM 2JNBA 4E6EA 1K8AH 1VQVA 5J2UB 1KNKA 4DRXB 1W581 4ZOLA 2QEXF 5HP8A 4LNUA 4O2AA 3JAKB 4IIJA 5FJ4C 3JASB 3VOAA 3VMFB 4EI9A 1DBFA 3ESJA 5EWRA 5IJ9A 3RYFA 4B45A 3Q8HA 3CCUF 4O4LB 4R40B 4LCKA 2YXZA 3C9TA 1YHQF 5LYJA 4XCQA 3D01A 4I55A 4NWOB 5HY4A 3DC2A 1X7OA 4TV8A 5JCOA 2H6LA 1SA0B 3IEQA 1Q86H 5G4UC 2FC3A 5EYPB 3FD5A 3QUWA 1NJIH 1VQLF 2CSLA 3N2KB 4I50A 5FNVA 3C9UA 2NMUA 3WGNA 3FBAA 4RHAA 2IAFA 3D00A 5CB4A 1FFXB 2CHTA 4B5CA 1T0KB 2KTVA 5EB0A 3LDTA 4YJ2A 1YI2F 2RHOA 2UYJA 3MDOA 1IV2A 3IEWA 4O2BA 1VQKF 3LYBA 3E20B 1IV3A 1X52A 2P6YA 2I6DA 3NK6A 4ZOLB 1Q7YH 4PWTA 3OBWA 4B46A 5IJ0A 3LWPC 5KX5A 4IIJB 2HRYA 3LWOC 1ODEA 1FSZA 3WGKA 1U3PA 5IYZB 1W5EA 3CXCF 3RA6A 4O4IA 5IJ9B 4BT5A 2IG8A 1W5AA 4FFBB 5J2UA 1S72F 5IT9M 2ZODA 3ERNA 4DRXA 3ZP7A 2OHWA 3LFOA 2BTOA 1YQNA 3JAKA 4IHJA 3LWVC 3ON1A 5LYJB 2PMPA 3HWUA 4I55B 3SIUA 4TV8B 2CWJA 5EB1B 3JATB 2OZBA 4G88A 4X3MA 5FNVB 5LP6A 4C4WC 1IV1A 2UYNB 1W2BF 2Z1UA 3RE3A 3JALB 1VQ5F 4EI7A 3PAFA 5CB4B 3I55F 1JD1A 3EORA 4X1KB 5HY0A 3G71F 1IV4A 3RYCA 3CMEF 1UFYA 3CCLF 3G4SF 4BT6A 3NVKE 1W3EX 3HKEB 4X20A 2Z01A 2RHHA 3GTZA 1UI9A 2L26A 5LA6B 2LBWA 4ZI7A 3CCRF 3CCVF 5LXTA 3KIZA 3N4YA 5ITZB 1H48A 1JY8A 1Q82H 4C8GA 1TVKB 1FFXA 2BTUA 3F0EA 5IJ0B 1KQSF 1W55A 5KX5B 1OFUA 2DT4A 5HXZA 4HNAA 1PXWA 3C9RA 4O4IB 3KJJA 3ZO8A 5LOVB 2Z1TA 1GO0A 1YJ9F 1CLIA 2HS4A 2LCAA 2ZAUA 4G4ZA 4IHJB 4BVTA 2KGWA 3F0FA 2RHLA 5KMGB 3HJWC 3RYHA 3CD6F 5MN4A 5IYZA 5A2QM 2HS0A 2VAWA 1QAHA 2FGYA 4FFBA 5LP6B 3LWQC 1VHAA 1VK3A 1PF5A 2CHSA 1X7PA 2UYPA 3WXMB 4I4TA 1RLGA 5EIBD 1VQPF 2BTQB 3ZOPA 3OW2F 5GONA 1QVGF 3RYCB 3I3FA 3JATA 4X20B 1NQ3A 1XRGA 4X1IB 1RQ7A 5JH7B 1QU9A 4ZI7B 2UYNA 5LXTB 3JAWB 4G4VA 3VOBA 2LBTA 3JALA 3IKEA 3NMUC 2PHNA 3O85A 3F0DA 4NUTA 3HKCA 2QA4F 4X1KA 2IQQA 1XBIA 3D54A 5MN6A 3F0GA 2VAPA 4HNAB 2HQSC 3TD4A 3HKEA 2CZWA 1RLUA 3K2XA 3VTIC 3K0TA 1YIJF 1CN7A 3VYSC 3FFMA 5LA6A 3VCZA 5C8YB 3QTYA 5ITZA 2OTLF 2VGMA 3KHNA 4EB6B 2RHJA 2KTUA 1NMUB 1TVKA 1JFFA 2LBXA 2R6R1 1VQNF 2OTMA 3RYHB 3OBYA 3PLAC 3FD6A 5CA0B 3G6EF 4O4JB 4DXDA 5GINC 2B33A 2F9ZC 3S02A 1CK2A 5LOVA 3NK7A 3F6MA 3M4SA 1H7MA 3CCSF 1ONIA 3MQWA 4I4TB 3DDNA 5KMGA 2ZVZA 3K14A 3I56F 5BMVA 5GONB 5JCOC 3N4ZA 3CCQF 4U3JA 2ZVYA 3WGJA 5J2TB 3S0YA 1DT9A 4X1YA 5HP7A 1QVFF 5EO3A 2VGNA 3LMEA 4TZZA 3ZP4A 3J80M 1JN1A 3S03A 1IPAA 1SDSA 3HKCB 1ZWZA 2EWCA 5JQGB 4TUYB 1XV2A 4YJ3B 4BT7A 2Q1XA 3WPWA 1M90H 3NVIB 4X1IA 3HAXD 2HS3A 3KE1A 3CYPB 2GLZA 1K73H 1YITF 5JH7A 3VYUC 1SZQA 3IR9A 4BT4A 3JAWA 4U39A 1VQOF 1Z5WA 5GIPC 5DCVA 3CC4F 2HRUA 2AIZP 3RA5A 1JFFB 4C8IA 1VQ8F 3K12A 3S0WA 1W42A 2QTPA 5B8FA 1Q81H 4C81A 1Z5VA 1TUBB 3TD5A 3WGMA 1W41A 3MBMA 2K1SA 5C8YA 3WGLA 5GANK 1E7KA 5G4VC 3HTNA 4EB6A 4C8EA 3CCEF 3E22A 2YYEA 4ZHQA 1FNKA 1KNJA 3V3TA 5BMVB 5CA0A 2ALEA 3CMAF 2Q1YA 4O4JA 1W5FA 3WJPA 4U3JB 1R1MA 2KG4A 2Z1EA 3C8LA 1YGYA 3LWRC 4X1YB 4G4YA 2HP0A 1M1KH 2WALA 3VYTC 3P10A 2UYKA 2ZOVA 3P0ZA 3V4DA 2HX0A 2V9YA 3GYQA 1XHOA 4B62A 5HWEA 5J2TA 4O4HB 2HP3A 1X25A 1FNJA 2VAMA 3KJKA 3M84A 3GHZA 1GZ0A 3MCAB 3S06A 3WJQA 4BW0B 1VQ4F 3R0PA 1RQ2A 1J7HA 5JVDB 5HY1A 3WJRA 1YJNF 5JQGA 3P4EA 4TUYA 3CB2A 4YJ3A 4M8IA 1VQ9F 3HKBA 2AMTA 1QD9A 3UT5B 3E1YA 4WBNB 4NQ3A 4ZK7A 2H8CA 3I7TA 3CC7F 3N2GB 1Q8RA 3JARB 3CCMF 3E22B
chains in the Genus database with same CATH topology
5EWRA 1KQSF 1DT9A 1QVFF 5EO3A 1JJ2F 2VGNA 3CCUF 3J81M 5HXZA 3CC2F 4TZZA 3J80M 1PXWA 2OTJF 1IPAA 4LCKA 1RA4A 1SDSA 1YHQF 4EI8A 1ZWZA 1KD1H 4XCQA 4BVRA 5HY4A 1KC8H 1X7OA 1GO0A 1GO1A 1YJ9F 1Q86H 5G4UC 2FC3A 1M90H 3NVIB 3HAXD 4BVTA 2GLZA 1NJIH 1VQLF 1K73H 1YITF 3SIVA 3IR9A 3HJWC 1VQOF 3CD6F 2BO1A 5GIPC 5A2QM 3D00A 3V7EA 5DCVA 3CC4F 2FGYA 3CPQA 3RA5A 1VQ8F 5HY2A 3LWQC 1W42A 1T0KB 2KTVA 1VQ6F 1Q81H 1X7PA 1W40A 1YI2F 1VQMF 3WXMB 1W41A 1RLGA 1VQPF 1VQKF 3E20B 3OW2F 5GANK 1E7KA 5G4VC 1QVGF 1X52A 1VQ7F 3JAMM 2I6DA 3NK6A 1Q7YH 3OBWA 3CCEF 3LWPC 3V3TA 3LWOC 1K9MH 3CMAF 2ALEA 3NMUC 4BVQA 3CXCF 3RA6A 1N8RH 3O85A 4NUTA 2KG4A 2QA4F 3LWRC 1XBIA 3VI6A 1M1KH 1S72F 5IT9M 2WALA 4BVSA 3CG6A 1YJWF 2OHWA 3LFOA 4X3LA 2CZWA 3LWVC 3ON1A 1YIJF 1CN7A 5HXUA 3FFMA 3CPWF 3V7QA 3SIUA 3CCJF 2OTLF 5FLXM 5GIOC 2VGMA 3GYQA 2KTUA 1NMUB 5HWEA 3J7AR 3AGKA 4BY9D 2OZBA 4X3MA 2LBXA 2HVYD 4C4WC 1VQNF 2QI2A 3OBYA 1GZ0A 2AIFA 3MCAB 3PLAC 1W2BF 5GAPK 3G6EF 4BW0B 1VQ4F 1VQ5F 4EI7A 5GINC 3PAFA 5HY1A 2F9ZC 1YJNF 3I55F 1CK2A 5HY0A 3JCMM 2JNBA 3G71F 1K8AH 3NK7A 1VQ9F 3CMEF 3CCLF 1H7MA 3G4SF 2QEXF 3CCSF 3NVKE 1W3EX 3E1YA 2LBWA 4NQ3A 3CCRF 3CCVF 3I56F 5FJ4C 3N4YA 3N4ZA 3VMFB 3CCQF 3CC7F 4EI9A 1Q82H 3CCMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWR A;  1KQS F;  1DT9 A;  1QVF F;  5EO3 A;  1JJ2 F;  2VGN A;  3CCU F;  3J81 M;  3CC2 F;  4TZZ A;  3J80 M;  1PXW A;  2OTJ F;  1IPA A;  4LCK A;  1RA4 A;  1SDS A;  1YHQ F;  1ZWZ A;  1KD1 H;  1KC8 H;  1X7O A;  1GO0 A;  1GO1 A;  1YJ9 F;  1Q86 H;  5G4U C;  2FC3 A;  1M90 H;  3NVI B;  3HAX D;  1NJI H;  1VQL F;  1K73 H;  1YIT F;  3SIV A;  3IR9 A;  3HJW C;  1VQO F;  3CD6 F;  2BO1 A;  5GIP C;  5A2Q M;  3V7E A;  5DCV A;  3CC4 F;  3CPQ A;  3RA5 A;  1VQ8 F;  3LWQ C;  1W42 A;  1T0K B;  2KTV A;  1VQ6 F;  1Q81 H;  1X7P A;  1W40 A;  1YI2 F;  1VQM F;  3WXM B;  1W41 A;  1RLG A;  1VQP F;  1VQK F;  3E20 B;  3OW2 F;  5GAN K;  1E7K A;  5G4V C;  1QVG F;  1X52 A;  1VQ7 F;  3JAM M;  2I6D A;  3NK6 A;  1Q7Y H;  3OBW A;  3CCE F;  3LWP C;  3LWO C;  1K9M H;  3CMA F;  2ALE A;  3NMU C;  3CXC F;  3RA6 A;  1N8R H;  3O85 A;  4NUT A;  2KG4 A;  2QA4 F;  3LWR C;  1XBI A;  3VI6 A;  1M1K H;  1S72 F;  5IT9 M;  2WAL A;  3CG6 A;  1YJW F;  2OHW A;  3LFO A;  4X3L A;  2CZW A;  3LWV C;  3ON1 A;  1YIJ F;  1CN7 A;  3CPW F;  3FFM A;  3V7Q A;  3SIU A;  3CCJ F;  2OTL F;  5FLX M;  5GIO C;  2VGM A;  3GYQ A;  2KTU A;  1NMU B;  3J7A R;  3AGK A;  4BY9 D;  2OZB A;  4X3M A;  2LBX A;  2HVY D;  4C4W C;  1VQN F;  2QI2 A;  3OBY A;  1GZ0 A;  2AIF A;  3MCA B;  3PLA C;  1W2B F;  5GAP K;  3G6E F;  4BW0 B;  1VQ4 F;  1VQ5 F;  5GIN C;  3PAF A;  1YJN F;  3I55 F;  1CK2 A;  3JCM M;  2JNB A;  3G71 F;  1K8A H;  3NK7 A;  1VQ9 F;  3CME F;  3CCL F;  1H7M A;  3G4S F;  2QEX F;  3CCS F;  3NVK E;  1W3E X;  3E1Y A;  2LBW A;  3CCR F;  3CCV F;  3I56 F;  5FJ4 C;  3N4Y A;  3N4Z A;  3VMF B;  3CCQ F;  3CC7 F;  1Q82 H;  3CCM F; 
#chains in the Genus database with same CATH topology
 3OON A;  3ELC A;  2W8B C;  4ZHQ B;  4RQO A;  1JJ2 F;  3J81 M;  3CC2 F;  1W57 A;  1TUB A;  2OTJ F;  5CA1 A;  1RA4 A;  3HKD A;  4EI8 A;  2G9I A;  4F6R A;  1KD1 H;  5EZY A;  4BVR A;  4C82 A;  2HP0 B;  1KC8 H;  1GO1 A;  2CVL A;  4BT3 A;  2R75 1;  4LNU B;  4O2A B;  3SIV A;  3WPX A;  4TV9 A;  2I6R A;  4ZHY B;  2GVI A;  2BO1 A;  3V7E A;  1GX1 A;  2DYY A;  2Z1F A;  3CPQ A;  3RYF B;  3L7Q A;  4G4W A;  2H8E A;  3CYQ A;  3RYI A;  5HY2 A;  1W5B A;  3S0H A;  1VQ6 F;  1U3L A;  1W40 A;  1VQM F;  2CW4 A;  3JVH A;  3JAS A;  1VQ7 F;  4BT2 A;  3JAM M;  3HKB B;  1H47 A;  1VH8 A;  3FPI A;  4KWE A;  5EAZ A;  4O4H A;  3QHD A;  1T0A A;  3IKF A;  3C9S A;  4I50 B;  2GZL A;  2N48 A;  3VIU A;  1K9M H;  4O4L A;  3M1X A;  4BVQ A;  4ZHW A;  5JVD A;  5MN5 A;  1N8R H;  3TD3 A;  1COM A;  3VI6 A;  1U40 A;  4BVS A;  1SA0 A;  5EIB C;  3CG6 A;  2RB9 A;  1YJW F;  4YJ2 B;  5EYP A;  3T80 A;  4X3L A;  5CA1 B;  3MCQ A;  3HKD B;  3UT5 A;  4F6R B;  4O2B B;  4WBN A;  5HXU A;  3N2K A;  5EZY B;  3CPW F;  5AVM A;  3V7Q A;  3CCJ F;  1OAP A;  3N2G A;  3JAR A;  5FLX M;  5GIO C;  1W59 A;  3J7A R;  4ERH A;  3AGK A;  4BY9 D;  2HVY D;  4ZHV A;  3IMP A;  3U0O A;  4TV9 B;  2QI2 A;  3BYQ A;  3VO8 A;  2AIF A;  2UZH A;  5GAP K;  2VXY A;  2MQE A;  5LP6 C;  2ZF8 A;  3B6N A;  3RYI B;  1U43 A;  4G4X A;  3JCM M;  2JNB A;  4E6E A;  1K8A H;  1VQV A;  5J2U B;  1KNK A;  4DRX B;  1W58 1;  4ZOL A;  2QEX F;  5HP8 A;  4LNU A;  4O2A A;  3JAK B;  4IIJ A;  5FJ4 C;  3JAS B;  3VOA A;  3VMF B;  4EI9 A;  1DBF A;  3ESJ A;  5EWR A;  5IJ9 A;  3RYF A;  4B45 A;  3Q8H A;  3CCU F;  4O4L B;  4R40 B;  4LCK A;  2YXZ A;  3C9T A;  1YHQ F;  5LYJ A;  4XCQ A;  3D01 A;  4I55 A;  4NWO B;  5HY4 A;  3DC2 A;  1X7O A;  4TV8 A;  5JCO A;  2H6L A;  1SA0 B;  3IEQ A;  1Q86 H;  5G4U C;  2FC3 A;  5EYP B;  3FD5 A;  3QUW A;  1NJI H;  1VQL F;  2CSL A;  3N2K B;  4I50 A;  5FNV A;  3C9U A;  2NMU A;  3WGN A;  3FBA A;  4RHA A;  2IAF A;  3D00 A;  5CB4 A;  1FFX B;  2CHT A;  4B5C A;  1T0K B;  2KTV A;  5EB0 A;  3LDT A;  4YJ2 A;  1YI2 F;  2RHO A;  2UYJ A;  3MDO A;  1IV2 A;  3IEW A;  4O2B A;  1VQK F;  3LYB A;  3E20 B;  1IV3 A;  1X52 A;  2P6Y A;  2I6D A;  3NK6 A;  4ZOL B;  1Q7Y H;  4PWT A;  3OBW A;  4B46 A;  5IJ0 A;  3LWP C;  5KX5 A;  4IIJ B;  2HRY A;  3LWO C;  1ODE A;  1FSZ A;  3WGK A;  1U3P A;  5IYZ B;  1W5E A;  3CXC F;  3RA6 A;  4O4I A;  5IJ9 B;  4BT5 A;  2IG8 A;  1W5A A;  4FFB B;  5J2U A;  1S72 F;  5IT9 M;  2ZOD A;  3ERN A;  4DRX A;  3ZP7 A;  2OHW A;  3LFO A;  2BTO A;  1YQN A;  3JAK A;  4IHJ A;  3LWV C;  3ON1 A;  5LYJ B;  2PMP A;  3HWU A;  4I55 B;  3SIU A;  4TV8 B;  2CWJ A;  5EB1 B;  3JAT B;  2OZB A;  4G88 A;  4X3M A;  5FNV B;  5LP6 A;  4C4W C;  1IV1 A;  2UYN B;  1W2B F;  2Z1U A;  3RE3 A;  3JAL B;  1VQ5 F;  4EI7 A;  3PAF A;  5CB4 B;  3I55 F;  1JD1 A;  3EOR A;  4X1K B;  5HY0 A;  3G71 F;  1IV4 A;  3RYC A;  3CME F;  1UFY A;  3CCL F;  3G4S F;  4BT6 A;  3NVK E;  1W3E X;  3HKE B;  4X20 A;  2Z01 A;  2RHH A;  3GTZ A;  1UI9 A;  2L26 A;  5LA6 B;  2LBW A;  4ZI7 A;  3CCR F;  3CCV F;  5LXT A;  3KIZ A;  3N4Y A;  5ITZ B;  1H48 A;  1JY8 A;  1Q82 H;  4C8G A;  1TVK B;  1FFX A;  2BTU A;  3F0E A;  5IJ0 B;  1KQS F;  1W55 A;  5KX5 B;  1OFU A;  2DT4 A;  5HXZ A;  4HNA A;  1PXW A;  3C9R A;  4O4I B;  3KJJ A;  3ZO8 A;  5LOV B;  2Z1T A;  1GO0 A;  1YJ9 F;  1CLI A;  2HS4 A;  2LCA A;  2ZAU A;  4G4Z A;  4IHJ B;  4BVT A;  2KGW A;  3F0F A;  2RHL A;  5KMG B;  3HJW C;  3RYH A;  3CD6 F;  5MN4 A;  5IYZ A;  5A2Q M;  2HS0 A;  2VAW A;  1QAH A;  2FGY A;  4FFB A;  5LP6 B;  3LWQ C;  1VHA A;  1VK3 A;  1PF5 A;  2CHS A;  1X7P A;  2UYP A;  3WXM B;  4I4T A;  1RLG A;  5EIB D;  1VQP F;  2BTQ B;  3ZOP A;  3OW2 F;  5GON A;  1QVG F;  3RYC B;  3I3F A;  3JAT A;  4X20 B;  1NQ3 A;  1XRG A;  4X1I B;  1RQ7 A;  5JH7 B;  1QU9 A;  4ZI7 B;  2UYN A;  5LXT B;  3JAW B;  4G4V A;  3VOB A;  2LBT A;  3JAL A;  3IKE A;  3NMU C;  2PHN A;  3O85 A;  3F0D A;  4NUT A;  3HKC A;  2QA4 F;  4X1K A;  2IQQ A;  1XBI A;  3D54 A;  5MN6 A;  3F0G A;  2VAP A;  4HNA B;  2HQS C;  3TD4 A;  3HKE A;  2CZW A;  1RLU A;  3K2X A;  3VTI C;  3K0T A;  1YIJ F;  1CN7 A;  3VYS C;  3FFM A;  5LA6 A;  3VCZ A;  5C8Y B;  3QTY A;  5ITZ A;  2OTL F;  2VGM A;  3KHN A;  4EB6 B;  2RHJ A;  2KTU A;  1NMU B;  1TVK A;  1JFF A;  2LBX A;  2R6R 1;  1VQN F;  2OTM A;  3RYH B;  3OBY A;  3PLA C;  3FD6 A;  5CA0 B;  3G6E F;  4O4J B;  4DXD A;  5GIN C;  2B33 A;  2F9Z C;  3S02 A;  1CK2 A;  5LOV A;  3NK7 A;  3F6M A;  3M4S A;  1H7M A;  3CCS F;  1ONI A;  3MQW A;  4I4T B;  3DDN A;  5KMG A;  2ZVZ A;  3K14 A;  3I56 F;  5BMV A;  5GON B;  5JCO C;  3N4Z A;  3CCQ F;  4U3J A;  2ZVY A;  3WGJ A;  5J2T B;  3S0Y A;  1DT9 A;  4X1Y A;  5HP7 A;  1QVF F;  5EO3 A;  2VGN A;  3LME A;  4TZZ A;  3ZP4 A;  3J80 M;  1JN1 A;  3S03 A;  1IPA A;  1SDS A;  3HKC B;  1ZWZ A;  2EWC A;  5JQG B;  4TUY B;  1XV2 A;  4YJ3 B;  4BT7 A;  2Q1X A;  3WPW A;  1M90 H;  3NVI B;  4X1I A;  3HAX D;  2HS3 A;  3KE1 A;  3CYP B;  2GLZ A;  1K73 H;  1YIT F;  5JH7 A;  3VYU C;  1SZQ A;  3IR9 A;  4BT4 A;  3JAW A;  4U39 A;  1VQO F;  1Z5W A;  5GIP C;  5DCV A;  3CC4 F;  2HRU A;  2AIZ P;  3RA5 A;  1JFF B;  4C8I A;  1VQ8 F;  3K12 A;  3S0W A;  1W42 A;  2QTP A;  5B8F A;  1Q81 H;  4C81 A;  1Z5V A;  1TUB B;  3TD5 A;  3WGM A;  1W41 A;  3MBM A;  2K1S A;  5C8Y A;  3WGL A;  5GAN K;  1E7K A;  5G4V C;  3HTN A;  4EB6 A;  4C8E A;  3CCE F;  3E22 A;  2YYE A;  4ZHQ A;  1FNK A;  1KNJ A;  3V3T A;  5BMV B;  5CA0 A;  2ALE A;  3CMA F;  2Q1Y A;  4O4J A;  1W5F A;  3WJP A;  4U3J B;  1R1M A;  2KG4 A;  2Z1E A;  3C8L A;  1YGY A;  3LWR C;  4X1Y B;  4G4Y A;  2HP0 A;  1M1K H;  2WAL A;  3VYT C;  3P10 A;  2UYK A;  2ZOV A;  3P0Z A;  3V4D A;  2HX0 A;  2V9Y A;  3GYQ A;  1XHO A;  4B62 A;  5HWE A;  5J2T A;  4O4H B;  2HP3 A;  1X25 A;  1FNJ A;  2VAM A;  3KJK A;  3M84 A;  3GHZ A;  1GZ0 A;  3MCA B;  3S06 A;  3WJQ A;  4BW0 B;  1VQ4 F;  3R0P A;  1RQ2 A;  1J7H A;  5JVD B;  5HY1 A;  3WJR A;  1YJN F;  5JQG A;  3P4E A;  4TUY A;  3CB2 A;  4YJ3 A;  4M8I A;  1VQ9 F;  3HKB A;  2AMT A;  1QD9 A;  3UT5 B;  3E1Y A;  4WBN B;  4NQ3 A;  4ZK7 A;  2H8C A;  3I7T A;  3CC7 F;  3N2G B;  1Q8R A;  3JAR B;  3CCM F;  3E22 B; 
#chains in the Genus database with same CATH homology
 5EWR A;  1KQS F;  1DT9 A;  1QVF F;  5EO3 A;  1JJ2 F;  2VGN A;  3CCU F;  3J81 M;  5HXZ A;  3CC2 F;  4TZZ A;  3J80 M;  1PXW A;  2OTJ F;  1IPA A;  4LCK A;  1RA4 A;  1SDS A;  1YHQ F;  4EI8 A;  1ZWZ A;  1KD1 H;  4XCQ A;  4BVR A;  5HY4 A;  1KC8 H;  1X7O A;  1GO0 A;  1GO1 A;  1YJ9 F;  1Q86 H;  5G4U C;  2FC3 A;  1M90 H;  3NVI B;  3HAX D;  4BVT A;  2GLZ A;  1NJI H;  1VQL F;  1K73 H;  1YIT F;  3SIV A;  3IR9 A;  3HJW C;  1VQO F;  3CD6 F;  2BO1 A;  5GIP C;  5A2Q M;  3D00 A;  3V7E A;  5DCV A;  3CC4 F;  2FGY A;  3CPQ A;  3RA5 A;  1VQ8 F;  5HY2 A;  3LWQ C;  1W42 A;  1T0K B;  2KTV A;  1VQ6 F;  1Q81 H;  1X7P A;  1W40 A;  1YI2 F;  1VQM F;  3WXM B;  1W41 A;  1RLG A;  1VQP F;  1VQK F;  3E20 B;  3OW2 F;  5GAN K;  1E7K A;  5G4V C;  1QVG F;  1X52 A;  1VQ7 F;  3JAM M;  2I6D A;  3NK6 A;  1Q7Y H;  3OBW A;  3CCE F;  3LWP C;  3V3T A;  3LWO C;  1K9M H;  3CMA F;  2ALE A;  3NMU C;  4BVQ A;  3CXC F;  3RA6 A;  1N8R H;  3O85 A;  4NUT A;  2KG4 A;  2QA4 F;  3LWR C;  1XBI A;  3VI6 A;  1M1K H;  1S72 F;  5IT9 M;  2WAL A;  4BVS A;  3CG6 A;  1YJW F;  2OHW A;  3LFO A;  4X3L A;  2CZW A;  3LWV C;  3ON1 A;  1YIJ F;  1CN7 A;  5HXU A;  3FFM A;  3CPW F;  3V7Q A;  3SIU A;  3CCJ F;  2OTL F;  5FLX M;  5GIO C;  2VGM A;  3GYQ A;  2KTU A;  1NMU B;  5HWE A;  3J7A R;  3AGK A;  4BY9 D;  2OZB A;  4X3M A;  2LBX A;  2HVY D;  4C4W C;  1VQN F;  2QI2 A;  3OBY A;  1GZ0 A;  2AIF A;  3MCA B;  3PLA C;  1W2B F;  5GAP K;  3G6E F;  4BW0 B;  1VQ4 F;  1VQ5 F;  4EI7 A;  5GIN C;  3PAF A;  5HY1 A;  2F9Z C;  1YJN F;  3I55 F;  1CK2 A;  5HY0 A;  3JCM M;  2JNB A;  3G71 F;  1K8A H;  3NK7 A;  1VQ9 F;  3CME F;  3CCL F;  1H7M A;  3G4S F;  2QEX F;  3CCS F;  3NVK E;  1W3E X;  3E1Y A;  2LBW A;  4NQ3 A;  3CCR F;  3CCV F;  3I56 F;  5FJ4 C;  3N4Y A;  3N4Z A;  3VMF B;  3CCQ F;  3CC7 F;  4EI9 A;  1Q82 H;  3CCM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...