3PLVA

Structure of hub-1 protein in complex with snu66 peptide (hindii)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
80
structure length
80
Chain Sequence
LVPRGSHMIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like modifier HUB1
publication title Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Peptide binding protein
total genus 24
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3plvA01
2I1JA 3B0AA 3ONSA 1V5OA 4NJ7A 1XQQA 3ZW3A 2GBJA 3NZSA 3APCA 2JRIB 2NBWB 4IM3A 4FJVB 4BBNC 1AARA 4YL8A 3DDCB 1ZKHA 1H4RA 2KOXA 4NQKE 4DHJB 2KLGA 3M62B 3BINA 4G3XB 4GMVA 4DHZB 2G4SA 2KQSA 4MDKE 2PEAA 3PS6A 4GDKB 2MBEA 3QARA 4OVVA 4KIKA 2L00B 2PE6B 5EDSA 2JXXA 2PJHA 3PREA 4M8MA 1TGZB 4GU2A 5D94A 4FLHA 3HK0A 1KLVA 3RT3B 2EMTA 3VHTC 4TQ1A 3RULA 5E6PA 5E6NA 2MLBA 4FJYA 1LFDA 2FIFA 3L0WB 4FJZA 4I6PA 2KMCA 2KJRA 2MP2B 5DPSA 4ZRKA 2C7NB 1NDDA 2NVUI 1EO6A 3WA0A 2LGXA 4MM3A 2DZIA 4W9JA 1YIWA 3A9JA 2NPTB 4B9KA 1UH6A 3IG3A 1WJ6A 2KX0A 4KSLC 3ZTDA 3WAPA 3PPAA 4W9FA 4MJSA 3WAMA 2MQJA 3DVNU 1MG8A 5FR6A 3L08A 3M95A 2O2VA 5HKHA 4FHJA 3WANA 2KDEB 2ZCCA 4NAWB 2ZJDA 1V9JA 3JYUA 4KZ0A 3K9OB 1LM8B 2L3ZA 2DX5B 3VXWA 3PRZA 4II3B 1YX6B 4ZRIA 2RPQA 4I6LB 3ECIA 2KANA 1XD3B 3GOEA 3RCZA 3RZWC 4EKUA 4ICVA 3L13A 2D2QA 3IHPC 3PVLA 3DBSA 2IO0B 2KK8A 1YD8U 4NJ6A 3HIZA 4W9CA 3MJWA 2KC2A 3K9PB 5G55A 1V5TA 1WM2A 3ZLZA 2FCSA 4HXDA 3H7SA 3QJZA 3VTUA 4ZDVA 2J0JA 2LASA 4XZ4A 2KO3A 4HJKA 3R7RA 1V6EA 3DBHI 1WXAA 2LVQA 4WWNA 5CHWA 3NY5A 3QCAA 3A1QA 4JGHB 4GN1A 2NCNA 2ZVNA 4EFOA 4BBNF 2MBBB 1WFYA 3IVFA 4HWIB 5L95C 1EUVB 2KD0A 1P3QU 2KC1A 3R66C 3TJPA 4DK5A 2KTRB 1Y8RC 1WGYA 4AJYB 4DHJD 3EECA 2YLMA 1P1AA 3X23A 3PV1A 1WMHB 2LI5A 3DBLI 2CHZA 4FULA 1KJTA 5TR5A 3W1SA 3UF8A 4M8NA 1RFAA 2C7MB 2ZEQA 4BKGA 1LQBA 2IO1B 4F1SA 1VD2A 5JZEB 4IW0A 1WY8A 2KXJA 2L7RA 3V6EB 4WJNA 2ZCBA 2OJRA 2B3AA 2LWPA 2WWZA 4XC2A 3KYDD 3KUDB 2XK5B 1P0RA 2MCNB 2KFKB 4PYZA 3MTNB 3VUXA 1H8CA 3AULA 2ZPNA 3PTFC 1NI2A 1OQYA 1Q5WB 2LVPA 3ZUNA 3TIXA 4MGZE 2RD0A 4KDIC 2IYDB 4WAAA 1X1MA 2IY1B 2QHOA 3KYCD 3L16A 3VFKA 3ML8A 1UZXB 3VTVA 4CHKA 3A9JB 2JY6A 2GBMA 3U30A 3UIPB 5J2RA 4BOSC 3ALBA 4J6IA 5KHOA 1WGDA 5L83A 3S2AA 4GDLB 2WDTB 4IM0A 2O2VB 5CHFA 3VQIA 3QK0A 3EHVA 3L10B 4G50A 4N9F4 4XX5A 3ZRFA 1HE8A 2K8BA 3DQVA 1V2YA 1WE7A 3A4SC 3VVWB 2VRRB 4MGYE 3ZDTA 2MA9B 4ZYNA 4LJOB 3T8MA 2JVCA 1WF9A 1WGRA 2MWSB 3R7QA 2C60A 3HM6X 3TCAA 3JVZX 3HHMA 3PGEA 2Z0EB 2ZNVC 4HLEA 1WXVA 3ENEA 4BKTA 3CSFA 2LJ5A 2FUHB 3APFA 3TL5A 2O6VB 3UIOB 2IZVB 4AP4C 1L2NA 3TBLD 4ANXA 4AUQC 4URKA 3VH4B 4PS8A 1I35A 2M4NA 1G6JA 1T0YA 1E7UA 4MH0E 2N9PC 1RLFA 1UELA 3GZNI 2K25A 1WM3A 2RGFA 4KZCA 4P7IA 2DAFA 2D10A 4WJPA 2BF8B 2XBBC 3B1LX 3L17A 2LXAA 2K6QA 5GMVA 3QIJA 3CMMB 1V49A 1CMXB 3W1YA 5D7GA 1J8CA 4EZJA 3V62A 4G0NB 4K7WA 3OLMD 2N7DA 3A9KB 4KDLB 1S1QB 3ZNZB 4HVBA 2KWUB 4DDID 3ZTCA 4HPMB 2HTHA 3B08A 3D32A 4W9EA 2PE9A 2LGYA 2G45B 2AEHA 5JH5C 2DYOA 2Z59B 4ANUA 1WR1A 2KZRA 2N1VA 2J7QB 4EUTA 2M0XA 2KMAA 2OOBB 2V3SA 3X0WA 2KJHB 5JHBA 3QX1A 4BOZB 4BVUC 3H7PB 2PPHA 3ML9A 4DXAB 3H9DA 3M63B 2HD5B 3N3KB 3SDLC 4AOFA 4LDTB 3ZNHB 1WJ4A 4A20A 2KX3A 2J0MA 3QC8B 3JSVB 1WJUA 3NHEB 4NQLB 1TTNA 2KWCA 1WZ0A 1J0GA 2IO3B 2KN5A 4MEMA 4GOCA 4MSMB 4WWOA 1GJZA 2UWQA 3DBRI 2N1WA 5LXHA 1I42A 3N30A 4WJQA 1E8XA 3C0RB 4K7UA 3OJ4B 1ZGUB 3SD5A 4I6NB 1F9JA 2K6DB 1M94A 2WX0A 2ZVOA 4HK2A 3RYTA 3WIMA 1Q1OA 4FADA 4ICUA 4GIVA 2KDBA 4W9GA 5JHAA 3DCGA 3PLVA 2C7HA 2MSED 3ZKJC 2MBOA 2DZJA 4HPLB 5KHQA 1NBFC 2JZZA 2CHWA 3PHXB 3T9LA 3V60A 3R3MA 1E7VA 2YVCA 1SE9A 1E5WA 2AL3A 4GDKA 2BKFA 3SHQA 2FAZA 2GBNA 1J19A 2CKHB 2O6VD 4KVGB 2HJ8A 4DDGD 4KIKB 3EFUA 1RRBA 1V81A 2L76A 1E8WA 3V6CB 5BO4B 4RM9A 4EOYA 2KVRA 3I3TB 2LXCA 3IBEA 2A4ZA 4NNJB 2CS4A 2A5UA 2V1YA 1WX7A 2J0KA 2KTFA 4TV3A 4W9LA 4ANWA 3H6NA 2DAJA 4LJPB 5C1ZA 5DPRA 1UD7A 2BYEA 3UINB 3RD2A 4NPNA 2D11A 1ZW7A 3Q3JA 2MRPA 4II2B 2Y5BB 2AYOB 4K7SA 5CTRC 2RR9A 3PSEB 4WQOB 2JZ3B 1XT9B 2NPTA 4ZRJA 2C9WB 4RMAA 3ZO5B 2N9XA 3U8ZA 4TKNA 4MJSB 1FXTB 3QAQA 1WRDB 1WIAA 1V80A 2AWTA 4ANVA 1EF5A 4WWPA 5IAAC 3RUIB 4K1RB 5D6JB 2BYVE 2LUEA 3ZRCA 3NOBA 4A3PA 1TBEA 4E71A 4MELA 4TUUA 4MSQB 1OGWA 4LDTD 1C1YB 1P9DU 1Q0WB 2L0FA 3ZVVA 1YJ1A 2BWFA 1WGHA 3PZDA 4BKSD 1EF1A 2ZZPB 2Z0DB 4E74A 2FNJB 1D3ZA 1KOTA 3UQAA 1GC6A 1R4MI 1IP9A 4E3CA 2NS5A 1S3SG 2FCQA 2M1MA 1WGGA 2NBVB 1KM7A 1SGHA 2W9NA 2MBHA 4IC7B 4PYUA 3VH3B 1YX5B 3KVFB 2FIDA 3A1QB 3AU5A 3OAWA 3QA8A 3TMPB 1GNUA 4BFRA 2CU1A 1WX9A 1WR6E 4KV2A 4LCDE 2IBIB 4W9IA 3ZDMC 2KTRA 2CHXA 1YQBA 3NZUA 1OEYA 3AXCA 3QHTA 1WMHA 4FHKA 2JF5A 1WXMA 1UGMA 2LGDA 2K8HA 5DPTA 3WALA 3APDA 4MGIE 4DBGA 2BGFA 3AI5A 2M8SA 1VCBA 2GBKA 1SIFA 2BWES 1GG3A 3Q3FA 2DYMA 5CHVC 1ISNA 2K8CA 5CX3A 1IYFA 3DVGX 2EKEC 3ZIMA 2I1KA 3KW5B 2KQ7A 4IWOA 2KLCA 2XK5A 4HDQA 2MBQA 2KFKA 5AZHA 2WX1A 5E6OA 2N9EB 1UBQA 2KHWB 2REXA 2JWZA 3PT2B 3BY4B 1PQSA 3PRPB 1C3TA 1WE6A 3CSTA 4FA6A 2BPSA 3ZNID 1TZ1A 2ZNVB 3LDZE 5DPWA 2GBRA 3OJ3A 2MX2A 3N32A 4PS7A 3SU8X 1BT0A 3QQ8B 2JRHA 4W9HA 4AJWA 1IPGA 1JRUA 2MW5A 2DZMA 1WXSA 4FN2A 3RZFA 4X57B 4GDLA 1R4NI 2HE7A 1UBIA 2K39A 3KUCB 3QWZB 4EZLA 3DVNV 4IUMB 3KUZA 3HM3A 2NBUA 4CYEA 4IWQA 3M3JA 1OEYJ 3MHSD 3O65B 5AZFA 4IG7B 4HCPB 2JPHA 4PS3A 4JQWC 3L54A 4HCNB 2NR2A 3PRMB 2KNBA 2ZPYA 4RM8A 1GC7A 2LZ6A 4K81A 3DPDA 1QZEA 5J17A 2O6VA 3H1UA 1Z2MA 4JL9A 2D07B 4TQ0A 4JLCA 5LLIA 4F8CB 5LXIB 4NY0A 1K8RB 3A4RA 2G4DB 2JUOA 2LRUA 2RSUA 2XEWA 4IM2A 5DCNA 1Z5SB 2GOWA 2KJ6A 4DWFA 3NS8A 2FCMA 4GB9A 1L7YA 2KFJA 4MGKE 1OTRB 2KKCA 1WYWB 2L05A 3VTWA 5J18A 2DENB 3AU4A 3ZNGC 5AEKB 2L0TA 4KSKC 4WJOA 2WYQA 2DZKA 2MP2A 4DHZE 3IFWB 4W9KA 2R2OA 3VAWA 2GMIC 3A9KA 2UYZB 4EEWA 3UQBA 2LD9A 4B6WA 4FBJB 1V86A 4IWPA 4OVUA 3KH0A 2V4LA 3JW0X 2KWVB 1WX8A 5D2MB 3LJ3A 4M0WB 3P2BA 3VUYA 5IA7A 4JIOU 2JT4B 4ASWC 3DOWA 4CO7A 2N7EA 2DHZA 3PLUA 3V61A 3VDZA 1LXDA 2LVOA 2KDIA 2IY0B 2K1FA 2DYBA 2C5LC 1E90A 4NAWA 1P98A 1GUAB 2M17A 1E8ZA 4B95A 2ASQA 4F7ZA 2EMSA 1E8YA 4GSWA 5C23A 3WAOA 2IO2B 3H7PA 2KDFB 4HDOA 1WZ3A 4EZKA 1A5RA 3PHWB 2L8JA 4G11A 4GXBA 2FCNA 3JSVA 1WJNA 2N4FA 3CF6E 3EC8A 5AZGA 2BYFA 2R2QA 4A3OA 4AWJA 3UGBB 4GGQA 2D3GA 3A33B 1U4AA 3W1SC 2G3QB 3DVGY 4BKSA 1RAXA 2BKRB 3VUWA 2AL6A 1WI0A 2CR5A 2LRWA 3U7DA 1WH3A 4W9DA 5G2NA
chains in the Genus database with same CATH superfamily
1ET9A 4HKZE 4HKQA 1I4XA 1XF5L 3T3NA 2GBJA 2NBWB 4FJVB 3Q8CA 4BBNC 2W55A 1ZKHA 1DOYA 2HTME 4NQKE 2E6XA 2KLGA 3M62B 2PEAA 4N6EB 2PE6B 3NZ3A 2PJHA 4L1BA 5D94A 1D5XC 1ZXIA 3VHTC 4TQ1A 5E6NA 2MLBA 5IKCM 1GOZA 2FIFA 3NVZA 1ENFA 1XCQL 2PLPA 2WU5B 1PGAA 4W9JA 3P4SB 1Y56A 2GB1A 4B9KA 1WJ6A 3NRZA 3ZTDA 3V05A 1MG8A 5FR6A 3N20C 4OHJA 5HKHA 4ZRPA 3WANA 1HTOA 2ZCCA 3AEDB 1I4QA 1P7FA 1ESFA 2DX5B 4MACA 4I6LB 3GOEA 3RZWC 4EKUA 4ICVA 3ZJVA 3IHPC 4NJ6A 4MT5A 1YD8U 3MJWA 5G55A 1WM2A 3VTUA 1QKZA 4ZDVA 1XLQA 2UU7A 4WWNA 5FKAC 4JGHB 4A9AA 2NCNA 1QILA 2MBBB 5L95C 3IVFA 1EUVB 3TJPA 3P4RB 3B2GA 5HFYA 4HRSA 3EECA 3N1YC 3X23A 3PV1A 2LI5A 4FULA 5TR5A 1KJTA 3UF8A 2C7MB 2KXJA 2KAJA 3V6EB 3Q14C 4WJNA 2ZCBA 2OJRA 4M00A 1TIFA 1XLNA 2MCNB 3MC9A 4RGMA 3PTFC 2IGHA 1OQYA 3ZUNA 4KDIC 1X1MA 2QHOA 3L16A 1E9MA 3VFKA 3ML8A 1KLGD 1VRAB 1DGJA 5J2RA 1L5PA 3AEGB 4BOSC 4J6IA 1WGDA 1F77A 2WDTB 4XGAB 3FC4A 3VQIA 3V3XA 3EHVA 5BYRA 4RGTA 2K8BA 3NUHB 1K50A 2MA9B 4LJOB 5IO9A 3BVZA 2JSVX 2KDMA 2Z0EB 5BMIA 4BKTA 2QC8A 1L2NA 2LHEA 3TBLD 1HXYD 4AUQC 1STEA 4K3BA 1E7UA 1T3QA 1TKGA 2IGDA 4P7IA 4WJPA 3BK2A 3B1LX 2K6QA 3KQ4A 2WP9B 2KQ4X 1V49A 2QEJC 3ABVB 1VZ8A 4XE0A 4KDLB 1HQRD 2K0PA 4DDID 1DYQA 3D32A 3B08A 2PE9A 2LUMA 1FIQA 4EUTA 1PGBA 4KKJA 4P1CC 1LO5D 4OZAA 3SDLC 4AOFA 4A20A 2Q5WD 3BVGA 1TTNA 1GB4A 1WZ0A 1J0GA 1JROA 2XN9C 2V4IB 5LXHA 1N62A 1F9JA 4HK2A 3N1XC 4ICUA 3KWVA 2MSED 2G9HD 2MBOA 3Q8AA 5KHQA 3T9LA 4XYCA 1SE9A 3I5JC 4GDKA 2BW2A 2L52A 2BKFA 2FAZA 2O6VD 1JWUD 1D5ZC 1V81A 2L76A 4M01A 4RM9A 4EOYA 1I42A 4TV3A 1TS3A 3NS1A 2B76B 1IBXA 2IJ0A 3VR8B 1SE2A 3RN9C 3SR6A 2WXIA 4NPNA 4II2B 2Y5BB 4MM3B 2NPTA 4B0EA 3TSSA 1YN4A 1EWYC 3U4EG 2K9XA 3DBHB 1DOIA 4MJSB 3Q8BA 4KGRA 1FXTB 4YSZB 1WRDB 2AWTA 3E9SA 4WWPA 1FFUA 1UF0A 2BYVE 3ZRCA 4A3PA 4MELA 1WRIA 2KYWA 3RPFC 3ZVVA 5EE3A 1PYWD 2ZZPB 4E74A 3RNFC 1GC6A 1R4MI 5D3DA 5C2TB 1WGGA 1KM7A 2W9NA 1KFYB 2X8XX 4D2KA 4PYUA 3A1QB 3OAWA 3QA8A 3TMPB 1WR6E 3EUB2 2KTRA 2MJ3A 3NZUA 1ET6A 5FR3A 3QHTA 1WMHA 1WXMA 1UGMA 2LJIA 4DBGA 4MGIE 1SIFA 1T0RC 3IAS1 3IT4B 3DVGX 1YN5A 2EKEC 2I1KA 4IWOA 2KLCA 2MBQA 1IBXB 3P4QB 3BY4B 1PQSA 4RNAA 1C3TA 4LLGM 3ZYYX 3ZNID 5DPWA 3OJ3A 3HRDD 3SU8X 1QOBA 1BT0A 3QQ8B 4P1BC 1SF0A 4AJWA 2MW5A 4FN2A 4X57B 2WXNA 1R4NI 3KLSX 4GDLA 4JWSC 1UBIA 2K39A 3DVNV 5LNK1 1OEYJ 3MHSD 3BZDB 3L54A 4HCNB 3PRMB 3RI7C 2OJWA 4JL9A 4TQ0A 5HI1A 5LXIB 2QILA 4C4VB 1SEBD 2JUOA 2LRUA 1Z5SB 4GB9A 1OTRB 2WXOA 3W5VB 3VTWA 2BTEA 3AU4A 4KSKC 3H8HA 2V9HA 2LEKA 4W9KA 2DBYA 4B6WA 4FBJB 1JQ4A 4IWPA 2MJDA 2KWVB 3LJ3A 3AEFB 3P4PB 3AE1B 1LXDA 4NAWA 2C5LC 1P98A 2M17A 1E8ZA 2JZPA 2RDHA 5GXGB 4HDOA 2MH7A 2FCNA 4C00A 1AYFA 1WJNA 3EC8A 1MHHE 2BYFA 2R2QA 2HDEA 2D3GA 3A33B 3T3OA 1CJEA 2KVZA 3FILB 2BKRB 2AL6A 2MJEA 2LRWA 2ICIA 3J9CA 3U7DA 3W5UB 3ONSA 4ZHOA 3ZW3A 2QSDA 4IM3A 4RF0A 4TSSA 2WGSA 3O13A 2KOXA 4GMVA 4DHZB 2G4SA 4MDKE 1L4ZB 2MBEA 4OVVA 3AH7A 4A55A 2L83A 3PREA 2J52A 2I38A 4H2AA 1TS4A 2EMTA 3DHGC 5E6PA 4JPSA 3AB5A 2BB6A 4FJYA 3L0WB 1WGKA 4FJZA 1XLOA 2SEBD 2KJRA 4O1NA 5DPSA 1SE3A 1L6UA 1QQRA 1SE4A 1YIWA 1C78A 1YJIA 2QIEB 2MQJA 3DVNU 3KWLA 2AQ1B 3LYYA 4NAWB 4YT0B 2SAKA 1V9JA 3BWUD 1LM8B 1C9FA 3P63A 3ECIA 2QDFA 2KANA 3N9YC 3L13A 3N1ZC 3PVLA 3ZJUA 2WDVB 3TEYA 4JWUC 1E7PB 1L0YB 4HXDA 3H7SA 3NVYA 3AMZA 4UDUC 2KO3A 2PTLA 1EU4A 4RH6A 3QCAA 2WXHA 4EFOA 3I63C 4YTPB 3TUOA 2KC1A 4AJYB 1WGYA 2DNFA 1HZ5A 2YLMA 1P1AA 3DBLI 3ZQ4A 2J53A 2EELA 4F1SA 5JZEB 4ARCA 1WY8A 2L7RA 2KWDA 2WDQB 2XK5B 4WIPA 2RDGA 1NI2A 5AUIA 1QOGA 1Q5WB 4OZCA 4MGZE 2Z8LA 4L2YA 3IT6B 2JY6A 2GBMA 2N0SB 5KHOA 5L83A 4M02A 4IM0A 5CHFA 1WXQA 4G50A 4N9F4 3ZRFA 2NTSA 2LFIA 1XXGA 4L23A 2W82A 4MGYE 3ZDTA 4ZYNA 1YQ3B 3AE6B 1WGRA 2MWSB 3URYA 2C60A 3PGEA 3HHMA 2ZNVC 2PKOA 4NZLB 1EM7A 2WXKA 2O6VB 4PT5A 4HPPA 4ANXA 4URKA 3VH4B 3Q8FA 3Q3MC 1YNTE 3C8YA 3GZNI 2D10A 3BIID 4YSYB 3CMMB 3V62A 3ZNZB 1CK1A 5IOIA 3NJTA 4HPMB 4M0WA 1D4BA 4W9EA 3AECB 5JH5C 4ANUA 2N1VA 2KMAA 3AE9B 5JHBA 1J7AA 2HD5B 3N3KB 2WNMA 2FBWB 2KX3A 3BVMA 3JSVB 1A70A 1MVKA 2KWCA 3P42A 2IO3B 1LGRA 4MEMA 1GJZA 4US8A 3C0RB 3SD5A 4I6NB 2K6DB 3C19A 3WIMA 1Q1OA 4FADA 1SSNA 2WXMA 2LHDA 2JXTA 1TY0A 2BT6A 3R3MA 2YVCA 1KLUD 2AL3A 3MC8A 4NAMA 2GBNA 4DDGD 4LNKA 1NI3A 2M19A 1E0ZA 3GE8C 1T0QC 4JX1C 3I3TB 3IBEA 3VAWA 1WX7A 2J0KA 2KTFA 4W9LA 5AUKA 2DAJA 4LJPB 5DPRA 2BYEA 4RF1A 3UINB 1SJED 4S0RA 2D11A 1ZW7A 2W3RA 1CQVA 4K7SA 1VZ6A 2WXGA 2C9WB 3ZO5B 3MJ5A 3U8ZA 2H89B 1WIAA 3RNGC 2RPVA 5IAAC 3RUIB 3NOBA 1TBEA 3OWEB 1P9DU 1Q0WB 3R2TA 1YJ1A 2BWFA 4LNFA 4FXCA 1EF1A 2DLBA 2Z0DB 1D3ZA 2FNJB 3UQAA 1IP9A 2NBVB 3RNAC 4IC7B 2MBHA 3VH3B 3KVFB 3AU5A 1WX9A 4KV2A 1GAQB 4LCDE 2IBIB 4W9IA 3TEZA 1ZUD2 3RNEC 1YQBA 2IGGA 1TYGB 3AXCA 4FHKA 3APDA 2WXJA 1RFKA 2M8SA 1VCBA 2BWES 1RYJA 3Q3FA 2DYMA 2V3NA 5CHVC 1ISNA 1I7HA 2KFKA 2KT7A 5E6OA 1JWAD 3OG5A 4JE3B 1CZPA 5C3JB 3CSTA 2BPSA 2FUG1 2ZNVB 2MX2A 3N32A 3Q6BA 4P6VF 4PS7A 5HHDG 2JRHA 4W9HA 1WSPA 1IPGA 1JRUA 2DZMA 3RZFA 3QWZB 3HM3A 2NBUA 3MHZA 3M3JA 5FK9C 1MJDA 1N61A 1JALA 2L32A 1TS2A 2KNBA 4OZBA 2QCZA 4K81A 4JLCA 3AN1A 2X38A 2G4DB 2RSUA 2KACA 1FNUA 2XEWA 4IM2A 5DCNA 2GOWA 2FCMA 1SB3C 2WXFA 4MGKE 2V3PA 5JXVA 2KKCA 1WYWB 2WS3B 2ACZB 2DENB 3ZNGC 2L0TA 2D3AA 4WJOA 1D6EC 2RDBC 4DHZE 3IFWB 3A9KA 5G5HA 1C4AA 1V86A 2V4LA 3DBRB 2NTTA 3DOWA 4CO7A 3PLUA 1N5WA 2DHZA 1I4GA 4HJGE 2IY0B 2DYBA 4B95A 3AEAB 1GUAB 1UGJA 1JRPA 2EMSA 3WAOA 2IO2B 3H7PA 2KDFB 1WZ3A 3PHWB 2L8JA 1RWSA 4G11A 1QLBB 4AWJA 1NYQA 3W1SC 3DVGY 4BKSA 1PUTA 2WXLA 4W9DA 2I1JA 2WQYB 1XQQA 3NZSA 3APCA 2JRIB 3BYTB 3NG0A 1AARA 3BK1A 3BINA 4G3XB 2CJNA 3AEBB 2KQSA 1JW9D 4GDKB 4KIKA 4LTUA 5EDSA 2JXXA 4M8MA 3BYYB 4GU2A 4K3CA 1TJEA 1KLVA 4C7ZA 4ZYSA 3AE2B 2NVUI 1GB1A 1OFFA 2INDC 2LGXA 1TKYA 2NPTB 3IG3A 4KSLC 3WAPA 4RFBA 4REZA 3WAMA 3L08A 3M95A 5EE9A 2KDEB 2ZJDA 3K9OB 3RNBC 4NJCA 4II3B 4ZRIA 2RPQA 4BZAA 1FPYA 1OQRA 2D2QA 3DBSA 2IO0B 2KK8A 3HIZA 2KC2A 3QJZA 2LASA 4XZ4A 2I2YA 1V6EA 2WXRA 3DBHI 5CHWA 3NY5A 4ZOHC 4BBNF 4HWIB 4DK5A 2KTRB 1Y8RC 4DHJD 1RM6C 2H88B 1C76A 1WMHB 3W1SA 2CHZA 4AQ7A 4WH4A 4M8NA 1RFAA 2BBCA 1LQBA 3HUIA 1KF6B 4IW0A 2LMCA 2LWPA 4XC2A 1F2RI 1L0VB 3VUXA 1P0RA 1FMAD 2ZPNA 3MC0B 3TIXA 2RD0A 4WAAA 3ETRA 2K22A 4CHKA 3SFDB 3ALBA 3S2AA 4GDLB 2N9KA 1T5XD 1EWCA 2VH2A 3QK0A 1I4PA 2K3UA 2JWUA 1HE8A 3DQVA 2VRRB 5EE0A 3T8MA 2JVCA 1WF9A 3PO0A 1D5MC 3R7QA 3HM6X 3JVZX 4YTMB 1L6VA 1P7EA 4XDCA 1WXVA 3ENEA 2LJ5A 2FUHB 1VR9A 3TL5A 2IZVB 1UWMA 4PS8A 1I35A 2N9PC 1RLFA 2K25A 2RGFA 2DAFA 2XBBC 3L17A 2LXAA 1ACCA 5GMVA 4XDDA 3QIJA 3EFCA 1CMXB 3W1YA 4EZJA 4G0NB 4K7WA 2N7DA 3GP7A 1S1QB 1PDXA 2KWUB 3GS2A 4PK1A 3ZTCA 2LGYA 2AEHA 2DYOA 1WR1A 2KZRA 3IXSA 2BYTA 2OOBB 3X0WA 1SBBB 1F52A 3QX1A 3E56A 3MP9A 3ML9A 2J42A 3H9DA 3M63B 4N59A 2JX5A 3AM9A 3ZNHB 1AN8A 1WJ4A 4YXDB 4IDIA 1WJUA 4NQLB 2LGSA 2TSSA 4MSMB 4LNIA 3EGRA 1PGXA 3N30A 4WJQA 4K7UA 1UWXA 1ZGUB 1M94A 1QT9A 1XO3A 2WX0A 1N60A 4GIVA 5IP4D 1VJKA 3PZ7A 3DCGA 2DZJA 4HPLB 1NBFC 5I4DA 2CHWA 1E7VA 1Q10A 1E5WA 5BYQA 3SHQA 4KVGB 1J19A 1FO4A 2HJ8A 1C4PA 4C56C 1RRBA 1FEHA 1E8WA 3V6CB 2KVRA 2LXCA 1KOTA 3Q8EA 2V1YA 3H6NA 5EE1A 3HVZA 2MRPA 5CTRC 4KGTA 2JZ3B 1XT9B 4ZRJA 2AQ2B 2N9XA 1NVID 4TKNA 2RMMA 3B9JA 4CQNA 3QAQA 1HA5A 4OVZA 3P1MA 2VZKD 1V80A 4K1RB 5D6JB 2BB5A 2LUEA 4E71A 4MSQB 1OGWA 4LDTD 1WGHA 4OW0A 4IOIE 2QJLA 3PZDA 3W2DA 4BKSD 1R7SA 4E3CA 2NS5A 2FCQA 3AE4B 2M1MA 1AW7A 2WXQA 1YX5B 1IGCA 1ZE3D 1GNUA 4BFRA 2CU1A 1C77A 4WWMA 1QOFA 1OEYA 3U7ZA 2K8HA 2LGDA 5DPTA 3WALA 2JQRB 3AI5A 2GBKA 1GG3A 5BMGA 1XEEA 1SJHD 3RNCC 3KW5B 1MI0A 4HDQA 5AZHA 3TEWA 2KHWB 2REXA 3PT2B 2JYTA 1FXAA 1YMHE 1JCKB 3ZXRA 2YEPB 1ROEA 3B2FA 4A6QA 1WXSA 5MPOA 2WXPA 2HE7A 4HROA 3KUCB 4EZLA 2GRIA 2ONQA 3KUZA 1L4DB 4IWQA 3SEBA 1YN3A 1ZOYB 3O65B 4IG7B 4PS3A 4JQWC 4USAA 4RM8A 1GC7A 3IAM1 1B9RA 4MH8A 1QZEA 3RMKC 5J17A 5LLIA 4NY0A 1K8RB 4A8XC 1JWBD 4DWFA 3NS8A 1TS5A 1JWSD 3AE8B 5AEKB 1HZ6A 5BMHA 3LXFA 2DZKA 2MP2A 1XLPA 1FCLA 2GMIC 3UQBA 2UYZB 4EEWA 2LD9A 2OEDA 4QAYA 2J4XA 4OVUA 3KH0A 1WX8A 4M0WB 5IA7A 2CJOA 2Y5CA 2JT4B 4ASWC 1F2RC 3V61A 3VDZA 2JU6X 2LVOA 2KDIA 2ZW1A 2K1FA 4GSWA 1JMLA 5C23A 2INNE 1K53A 4GXBA 1MFWA 3PZ8A 1FM0D 3CF6E 3W9CB 5BYSA 4GGQA 1RAXA 3R2IA 3VUWA 2CR5A 2OHFA 4LNNA 3B0AA 1V5OA 4NJ7A 4XWWA 2R61A 1KTKA 5T8IA 4YL8A 3DDCB 1H4RA 1EU3A 4DHJB 1KH0A 1TT5B 1C4CA 3MFGA 3PS6A 3QARA 4C80A 3ZGZA 2L00B 2JYEA 1TGZB 2GI9A 4FLHA 3HK0A 3RT3B 3RULA 1LFDA 1FRDA 4I6PA 2KMCA 2MP2B 4ZRKA 1YOVB 1ZP0B 1NDDA 1ZPSA 2C7NB 1EO6A 3WA0A 2W54A 4MM3A 2DZIA 3A9JA 1UH6A 1V1PA 4AS1A 1IGDA 1R4MB 2KX0A 3PPAA 4W9FA 4MJSA 3TEXA 4YTNB 2O2VA 4FHJA 3JYUA 1NYRA 3Q3NC 4KZ0A 2L3ZA 3VXWA 3PRZA 3VRBB 1YX6B 2ZW0A 2INCC 1UUPA 1XD3B 3RCZA 3NVVA 2LGIA 2AX5A 3EA6A 1JWMD 4W9CA 3K9PB 1V5TA 3ZLZA 2FCSA 2INPE 2J0JA 1VDVA 3R7RA 4HJKA 1WXAA 2LVQA 3Q69A 3A1QA 3GE3C 4GN1A 1BMLC 2ZVNA 1SIJA 2M0AA 1WFYA 2PVGC 2KD0A 2YEPF 1P3QU 1A5RA 3R66C 2KMMA 1R4NB 2ZEQA 4BKGA 2IO1B 3U52E 1VD2A 2BS3B 2D3BA 4P16A 5D3IB 3R8BA 2B3AA 2WWZA 1B1ZA 1E6EB 3KYDD 3KUDB 1ZDVA 1H8CA 2KFKB 1TKEA 3MTNB 4PYZA 3AULA 3DWMA 4BAXA 2LVPA 4RGNA 2IYDB 1N5XA 2FE8A 3KYCD 2IY1B 1UZXB 3VTVA 3A9JB 2Y5PA 1V1PB 3U30A 3UIPB 4S17A 4US9A 1V8CA 1SXTA 4N58A 2O2VB 1YJJA 4YSXB 4LK0M 3L10B 4XX5A 1V2YA 2DWQA 1WE7A 2MHJA 3A4SC 3VVWB 2KN4A 4DXFA 4ITKA 1NENB 3AE7B 3TCAA 1BXTA 1J7BA 4HLEA 1I4HA 3CSFA 2WHIA 3APFA 1E10A 3UIOB 4AP4C 2AQ3B 4R3DA 4C4VA 2M4NA 1G6JA 1T0YA 3AE3B 4MH0E 1UELA 2WU2B 4KZCA 1WM3A 1FD6A 2BF8B 2BS2B 1WWTA 1MHXA 1UNSA 2IDYA 1NEKB 4RCOA 2PVOD 1FCCC 5D7GA 4C7YA 1J8CA 4HVBA 3OLMD 3A9KB 1F0ZA 1OQQA 2HTHA 2N7JA 1WYGA 2G45B 2Z59B 2EKIA 2J7QB 2VZKB 2M0XA 2V3SA 3U2SC 1MG4A 2KJHB 3AE5B 3VRAB 4BOZB 4BVUC 1L0XB 1FNVA 3H7PB 2PPHA 4LNOA 3I57A 4DXAB 4EE2A 4LDTB 1TZOA 2J0MA 3QC8B 4DXGA 1KRHA 3NHEB 3GB1A 2PW9A 3FILA 2KN5A 4GOCA 4WWOA 2UWQA 3DBRI 2N1WA 3AEEB 2M56B 1E8XA 3OJ4B 4ACFA 2ZVOA 3RYTA 4J3OD 4TMAB 2PMVA 2KDBA 4W9GA 5JHAA 3PLVA 2C7HA 5IN7A 5H92C 3ZKJC 1ZDXA 1ZXHA 2JZZA 3PHXB 3V60A 1PFDA 4YWGG 1BUIC 1F1HA 2CKHB 4KIKB 3EFUA 1MPEA 1K51A 4DQOC 4HEA1 3ZXVA 1FNWA 2CU3A 5BO4B 2A4ZA 2VH1A 2CS4A 2A5UA 2BVCA 4NNJB 5E6JA 4ANWA 5H8YE 5C1ZA 1UD7A 3VR9B 1N63A 2GLSA 3RD2A 1AWDA 3HVDA 2QMTA 3Q3JA 1FRRA 2AYOB 4WQMA 2IPKD 1N6ZA 2RR9A 3PSEB 4WQOB 4RMAA 2NMQA 2N9LA 3Q2AC 3DHHC 4ZRQA 1T0SC 4WURA 4RGOS 2BS4B 4ANVA 1EF5A 3WCQA 2Y3AA 3UI3A 4TUUA 4B0MA 1C1YB 1TY2A 2L0FA 3DBLB 2D5GA 4A90A 1V1OA 2XNAC 1S3SG 1SGHA 4Q2JA 3FKYA 2FIDA 3NVWA 4KGSA 2HJ1A 4KX6B 4WAFA 2D3CA 3ZDMC 2E3TA 2CHXA 2K5PA 1IUEA 2JF5A 5G5GA 2BGFA 2V0GA 2WLBA 2K8CA 5CX3A 1IYFA 3ZIMA 2KQ7A 2XK5A 3ZJTA 2WX1A 3CIRB 2N9EB 4KKIA 2W3SA 1UBQA 1HEZE 3SFEB 2JWZA 1T6BX 1VZ7A 2PIAA 3PRPB 1WE6A 4FA6A 2L1AA 1I4RA 1TZ1A 3LDZE 2GBRA 1YQ4B 3GZNB 5TSSA 3FAHA 1XCTL 4ARIA 4IUMB 1C79A 4CYEA 2WDRB 4XWTA 5AZFA 4HCPB 2JPHA 2MEKA 2NR2A 2ZPYA 1V97A 2LZ6A 3DPDA 2O6VA 3H1UA 3Q3OC 1Z2MA 3CWIA 2D07B 3AV8A 4F8CB 3A4RA 4GLSC 2G1EA 2KJ6A 1K52A 1L7YA 2KFJA 2L05A 1QF6A 5J18A 1J7CA 1FFVA 2ON8A 2WYQA 2R2OA 1QOAA 3LB8C 1M4VA 3JW0X 5HG2A 4ZHPA 5D2MB 3P2BA 3VUYA 4JIOU 2N7EA 3I9V1 1FXIA 1DOXA 1E90A 2BQQA 2ASQA 4F7ZA 1E8YA 4EZKA 3L4PA 1GPXA 1VLBA 1HTQA 3JSVA 2N4FA 3DHIC 3DWGC 5AZGA 4A3OA 3UGBB 4IKGA 1U4AA 2G3QB 3RFZB 1WI0A 1WH3A 5G2NA
chains in the Genus database with same CATH topology
2I1JA 3B0AA 3ONSA 1V5OA 4NJ7A 1XQQA 3ZW3A 2GBJA 3NZSA 3APCA 2JRIB 2NBWB 4IM3A 4FJVB 4BBNC 1AARA 4YL8A 3DDCB 1ZKHA 1H4RA 2KOXA 4NQKE 4DHJB 2KLGA 3M62B 3BINA 4G3XB 4GMVA 4DHZB 2G4SA 2KQSA 4MDKE 2PEAA 3PS6A 4GDKB 2MBEA 3QARA 4OVVA 4KIKA 2L00B 2PE6B 5EDSA 2JXXA 2PJHA 3PREA 4M8MA 1TGZB 4GU2A 5D94A 4FLHA 3HK0A 1KLVA 3RT3B 2EMTA 3VHTC 4TQ1A 3RULA 5E6PA 5E6NA 2MLBA 4FJYA 1LFDA 2FIFA 3L0WB 4FJZA 4I6PA 2KMCA 2KJRA 2MP2B 5DPSA 4ZRKA 2C7NB 1NDDA 2NVUI 1EO6A 3WA0A 2LGXA 4MM3A 2DZIA 4W9JA 1YIWA 3A9JA 2NPTB 4B9KA 1UH6A 3IG3A 1WJ6A 2KX0A 4KSLC 3ZTDA 3WAPA 3PPAA 4W9FA 4MJSA 3WAMA 2MQJA 3DVNU 1MG8A 5FR6A 3L08A 3M95A 2O2VA 5HKHA 4FHJA 3WANA 2KDEB 2ZCCA 4NAWB 2ZJDA 1V9JA 3JYUA 4KZ0A 3K9OB 1LM8B 2L3ZA 2DX5B 3VXWA 3PRZA 4II3B 1YX6B 4ZRIA 2RPQA 4I6LB 3ECIA 2KANA 1XD3B 3GOEA 3RCZA 3RZWC 4EKUA 4ICVA 3L13A 2D2QA 3IHPC 3PVLA 3DBSA 2IO0B 2KK8A 1YD8U 4NJ6A 3HIZA 4W9CA 3MJWA 2KC2A 3K9PB 5G55A 1V5TA 1WM2A 3ZLZA 2FCSA 4HXDA 3H7SA 3QJZA 3VTUA 4ZDVA 2J0JA 2LASA 4XZ4A 2KO3A 4HJKA 3R7RA 1V6EA 3DBHI 1WXAA 2LVQA 4WWNA 5CHWA 3NY5A 3QCAA 3A1QA 4JGHB 4GN1A 2NCNA 2ZVNA 4EFOA 4BBNF 2MBBB 1WFYA 3IVFA 4HWIB 5L95C 1EUVB 2KD0A 1P3QU 2KC1A 3R66C 3TJPA 4DK5A 2KTRB 1Y8RC 1WGYA 4AJYB 4DHJD 3EECA 2YLMA 1P1AA 3X23A 3PV1A 1WMHB 2LI5A 3DBLI 2CHZA 4FULA 1KJTA 5TR5A 3W1SA 3UF8A 4M8NA 1RFAA 2C7MB 2ZEQA 4BKGA 1LQBA 2IO1B 4F1SA 1VD2A 5JZEB 4IW0A 1WY8A 2KXJA 2L7RA 3V6EB 4WJNA 2ZCBA 2OJRA 2B3AA 2LWPA 2WWZA 4XC2A 3KYDD 3KUDB 2XK5B 1P0RA 2MCNB 2KFKB 4PYZA 3MTNB 3VUXA 1H8CA 3AULA 2ZPNA 3PTFC 1NI2A 1OQYA 1Q5WB 2LVPA 3ZUNA 3TIXA 4MGZE 2RD0A 4KDIC 2IYDB 4WAAA 1X1MA 2IY1B 2QHOA 3KYCD 3L16A 3VFKA 3ML8A 1UZXB 3VTVA 4CHKA 3A9JB 2JY6A 2GBMA 3U30A 3UIPB 5J2RA 4BOSC 3ALBA 4J6IA 5KHOA 1WGDA 5L83A 3S2AA 4GDLB 2WDTB 4IM0A 2O2VB 5CHFA 3VQIA 3QK0A 3EHVA 3L10B 4G50A 4N9F4 4XX5A 3ZRFA 1HE8A 2K8BA 3DQVA 1V2YA 1WE7A 3A4SC 3VVWB 2VRRB 4MGYE 3ZDTA 2MA9B 4ZYNA 4LJOB 3T8MA 2JVCA 1WF9A 1WGRA 2MWSB 3R7QA 2C60A 3HM6X 3TCAA 3JVZX 3HHMA 3PGEA 2Z0EB 2ZNVC 4HLEA 1WXVA 3ENEA 4BKTA 3CSFA 2LJ5A 2FUHB 3APFA 3TL5A 2O6VB 3UIOB 2IZVB 4AP4C 1L2NA 3TBLD 4ANXA 4AUQC 4URKA 3VH4B 4PS8A 1I35A 2M4NA 1G6JA 1T0YA 1E7UA 4MH0E 2N9PC 1RLFA 1UELA 3GZNI 2K25A 1WM3A 2RGFA 4KZCA 4P7IA 2DAFA 2D10A 4WJPA 2BF8B 2XBBC 3B1LX 3L17A 2LXAA 2K6QA 5GMVA 3QIJA 3CMMB 1V49A 1CMXB 3W1YA 5D7GA 1J8CA 4EZJA 3V62A 4G0NB 4K7WA 3OLMD 2N7DA 3A9KB 4KDLB 1S1QB 3ZNZB 4HVBA 2KWUB 4DDID 3ZTCA 4HPMB 2HTHA 3B08A 3D32A 4W9EA 2PE9A 2LGYA 2G45B 2AEHA 5JH5C 2DYOA 2Z59B 4ANUA 1WR1A 2KZRA 2N1VA 2J7QB 4EUTA 2M0XA 2KMAA 2OOBB 2V3SA 3X0WA 2KJHB 5JHBA 3QX1A 4BOZB 4BVUC 3H7PB 2PPHA 3ML9A 4DXAB 3H9DA 3M63B 2HD5B 3N3KB 3SDLC 4AOFA 4LDTB 3ZNHB 1WJ4A 4A20A 2KX3A 2J0MA 3QC8B 3JSVB 1WJUA 3NHEB 4NQLB 1TTNA 2KWCA 1WZ0A 1J0GA 2IO3B 2KN5A 4MEMA 4GOCA 4MSMB 4WWOA 1GJZA 2UWQA 3DBRI 2N1WA 5LXHA 1I42A 3N30A 4WJQA 1E8XA 3C0RB 4K7UA 3OJ4B 1ZGUB 3SD5A 4I6NB 1F9JA 2K6DB 1M94A 2WX0A 2ZVOA 4HK2A 3RYTA 3WIMA 1Q1OA 4FADA 4ICUA 4GIVA 2KDBA 4W9GA 5JHAA 3DCGA 3PLVA 2C7HA 2MSED 3ZKJC 2MBOA 2DZJA 4HPLB 5KHQA 1NBFC 2JZZA 2CHWA 3PHXB 3T9LA 3V60A 3R3MA 1E7VA 2YVCA 1SE9A 1E5WA 2AL3A 4GDKA 2BKFA 3SHQA 2FAZA 2GBNA 1J19A 2CKHB 2O6VD 4KVGB 2HJ8A 4DDGD 4KIKB 3EFUA 1RRBA 1V81A 2L76A 1E8WA 3V6CB 5BO4B 4RM9A 4EOYA 2KVRA 3I3TB 2LXCA 3IBEA 2A4ZA 4NNJB 2CS4A 2A5UA 2V1YA 1WX7A 2J0KA 2KTFA 4TV3A 4W9LA 4ANWA 3H6NA 2DAJA 4LJPB 5C1ZA 5DPRA 1UD7A 2BYEA 3UINB 3RD2A 4NPNA 2D11A 1ZW7A 3Q3JA 2MRPA 4II2B 2Y5BB 2AYOB 4K7SA 5CTRC 2RR9A 3PSEB 4WQOB 2JZ3B 1XT9B 2NPTA 4ZRJA 2C9WB 4RMAA 3ZO5B 2N9XA 3U8ZA 4TKNA 4MJSB 1FXTB 3QAQA 1WRDB 1WIAA 1V80A 2AWTA 4ANVA 1EF5A 4WWPA 5IAAC 3RUIB 4K1RB 5D6JB 2BYVE 2LUEA 3ZRCA 3NOBA 4A3PA 1TBEA 4E71A 4MELA 4TUUA 4MSQB 1OGWA 4LDTD 1C1YB 1P9DU 1Q0WB 2L0FA 3ZVVA 1YJ1A 2BWFA 1WGHA 3PZDA 4BKSD 1EF1A 2ZZPB 2Z0DB 4E74A 2FNJB 1D3ZA 1KOTA 3UQAA 1GC6A 1R4MI 1IP9A 4E3CA 2NS5A 1S3SG 2FCQA 2M1MA 1WGGA 2NBVB 1KM7A 1SGHA 2W9NA 2MBHA 4IC7B 4PYUA 3VH3B 1YX5B 3KVFB 2FIDA 3A1QB 3AU5A 3OAWA 3QA8A 3TMPB 1GNUA 4BFRA 2CU1A 1WX9A 1WR6E 4KV2A 4LCDE 2IBIB 4W9IA 3ZDMC 2KTRA 2CHXA 1YQBA 3NZUA 1OEYA 3AXCA 3QHTA 1WMHA 4FHKA 2JF5A 1WXMA 1UGMA 2LGDA 2K8HA 5DPTA 3WALA 3APDA 4MGIE 4DBGA 2BGFA 3AI5A 2M8SA 1VCBA 2GBKA 1SIFA 2BWES 1GG3A 3Q3FA 2DYMA 5CHVC 1ISNA 2K8CA 5CX3A 1IYFA 3DVGX 2EKEC 3ZIMA 2I1KA 3KW5B 2KQ7A 4IWOA 2KLCA 2XK5A 4HDQA 2MBQA 2KFKA 5AZHA 2WX1A 5E6OA 2N9EB 1UBQA 2KHWB 2REXA 2JWZA 3PT2B 3BY4B 1PQSA 3PRPB 1C3TA 1WE6A 3CSTA 4FA6A 2BPSA 3ZNID 1TZ1A 2ZNVB 3LDZE 5DPWA 2GBRA 3OJ3A 2MX2A 3N32A 4PS7A 3SU8X 1BT0A 3QQ8B 2JRHA 4W9HA 4AJWA 1IPGA 1JRUA 2MW5A 2DZMA 1WXSA 4FN2A 3RZFA 4X57B 4GDLA 1R4NI 2HE7A 1UBIA 2K39A 3KUCB 3QWZB 4EZLA 3DVNV 4IUMB 3KUZA 3HM3A 2NBUA 4CYEA 4IWQA 3M3JA 1OEYJ 3MHSD 3O65B 5AZFA 4IG7B 4HCPB 2JPHA 4PS3A 4JQWC 3L54A 4HCNB 2NR2A 3PRMB 2KNBA 2ZPYA 4RM8A 1GC7A 2LZ6A 4K81A 3DPDA 1QZEA 5J17A 2O6VA 3H1UA 1Z2MA 4JL9A 2D07B 4TQ0A 4JLCA 5LLIA 4F8CB 5LXIB 4NY0A 1K8RB 3A4RA 2G4DB 2JUOA 2LRUA 2RSUA 2XEWA 4IM2A 5DCNA 1Z5SB 2GOWA 2KJ6A 4DWFA 3NS8A 2FCMA 4GB9A 1L7YA 2KFJA 4MGKE 1OTRB 2KKCA 1WYWB 2L05A 3VTWA 5J18A 2DENB 3AU4A 3ZNGC 5AEKB 2L0TA 4KSKC 4WJOA 2WYQA 2DZKA 2MP2A 4DHZE 3IFWB 4W9KA 2R2OA 3VAWA 2GMIC 3A9KA 2UYZB 4EEWA 3UQBA 2LD9A 4B6WA 4FBJB 1V86A 4IWPA 4OVUA 3KH0A 2V4LA 3JW0X 2KWVB 1WX8A 5D2MB 3LJ3A 4M0WB 3P2BA 3VUYA 5IA7A 4JIOU 2JT4B 4ASWC 3DOWA 4CO7A 2N7EA 2DHZA 3PLUA 3V61A 3VDZA 1LXDA 2LVOA 2KDIA 2IY0B 2K1FA 2DYBA 2C5LC 1E90A 4NAWA 1P98A 1GUAB 2M17A 1E8ZA 4B95A 2ASQA 4F7ZA 2EMSA 1E8YA 4GSWA 5C23A 3WAOA 2IO2B 3H7PA 2KDFB 4HDOA 1WZ3A 4EZKA 1A5RA 3PHWB 2L8JA 4G11A 4GXBA 2FCNA 3JSVA 1WJNA 2N4FA 3CF6E 3EC8A 5AZGA 2BYFA 2R2QA 4A3OA 4AWJA 3UGBB 4GGQA 2D3GA 3A33B 1U4AA 3W1SC 2G3QB 3DVGY 4BKSA 1RAXA 2BKRB 3VUWA 2AL6A 1WI0A 2CR5A 2LRWA 3U7DA 1WH3A 4W9DA 5G2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  3B0A A;  3ONS A;  1V5O A;  4NJ7 A;  1XQQ A;  3ZW3 A;  2GBJ A;  3NZS A;  3APC A;  2JRI B;  2NBW B;  4IM3 A;  4FJV B;  4BBN C;  1AAR A;  4YL8 A;  3DDC B;  1ZKH A;  1H4R A;  2KOX A;  4NQK E;  4DHJ B;  2KLG A;  3M62 B;  3BIN A;  4G3X B;  4GMV A;  4DHZ B;  2G4S A;  2KQS A;  4MDK E;  2PEA A;  3PS6 A;  4GDK B;  2MBE A;  3QAR A;  4OVV A;  4KIK A;  2L00 B;  2PE6 B;  5EDS A;  2JXX A;  2PJH A;  3PRE A;  4M8M A;  1TGZ B;  4GU2 A;  5D94 A;  4FLH A;  3HK0 A;  1KLV A;  3RT3 B;  2EMT A;  3VHT C;  4TQ1 A;  3RUL A;  5E6P A;  5E6N A;  2MLB A;  4FJY A;  1LFD A;  2FIF A;  3L0W B;  4FJZ A;  4I6P A;  2KMC A;  2KJR A;  2MP2 B;  5DPS A;  4ZRK A;  2C7N B;  1NDD A;  2NVU I;  1EO6 A;  3WA0 A;  2LGX A;  4MM3 A;  2DZI A;  4W9J A;  1YIW A;  3A9J A;  2NPT B;  4B9K A;  1UH6 A;  3IG3 A;  1WJ6 A;  2KX0 A;  4KSL C;  3ZTD A;  3WAP A;  3PPA A;  4W9F A;  4MJS A;  3WAM A;  2MQJ A;  3DVN U;  1MG8 A;  5FR6 A;  3L08 A;  3M95 A;  2O2V A;  5HKH A;  4FHJ A;  3WAN A;  2KDE B;  2ZCC A;  4NAW B;  2ZJD A;  1V9J A;  3JYU A;  4KZ0 A;  3K9O B;  1LM8 B;  2L3Z A;  2DX5 B;  3VXW A;  3PRZ A;  4II3 B;  1YX6 B;  4ZRI A;  2RPQ A;  4I6L B;  3ECI A;  2KAN A;  1XD3 B;  3GOE A;  3RCZ A;  3RZW C;  4EKU A;  4ICV A;  3L13 A;  2D2Q A;  3IHP C;  3PVL A;  3DBS A;  2IO0 B;  2KK8 A;  1YD8 U;  4NJ6 A;  3HIZ A;  4W9C A;  3MJW A;  2KC2 A;  3K9P B;  5G55 A;  1V5T A;  1WM2 A;  3ZLZ A;  2FCS A;  4HXD A;  3H7S A;  3QJZ A;  3VTU A;  4ZDV A;  2J0J A;  2LAS A;  4XZ4 A;  2KO3 A;  4HJK A;  3R7R A;  1V6E A;  3DBH I;  1WXA A;  2LVQ A;  4WWN A;  5CHW A;  3NY5 A;  3QCA A;  3A1Q A;  4JGH B;  4GN1 A;  2NCN A;  2ZVN A;  4EFO A;  4BBN F;  2MBB B;  1WFY A;  3IVF A;  4HWI B;  5L95 C;  1EUV B;  2KD0 A;  1P3Q U;  2KC1 A;  3R66 C;  3TJP A;  4DK5 A;  2KTR B;  1Y8R C;  1WGY A;  4AJY B;  4DHJ D;  3EEC A;  2YLM A;  1P1A A;  3X23 A;  3PV1 A;  1WMH B;  2LI5 A;  3DBL I;  2CHZ A;  4FUL A;  1KJT A;  5TR5 A;  3W1S A;  3UF8 A;  4M8N A;  1RFA A;  2C7M B;  2ZEQ A;  4BKG A;  1LQB A;  2IO1 B;  4F1S A;  1VD2 A;  5JZE B;  4IW0 A;  1WY8 A;  2KXJ A;  2L7R A;  3V6E B;  4WJN A;  2ZCB A;  2OJR A;  2B3A A;  2LWP A;  2WWZ A;  4XC2 A;  3KYD D;  3KUD B;  2XK5 B;  1P0R A;  2MCN B;  2KFK B;  4PYZ A;  3MTN B;  3VUX A;  1H8C A;  3AUL A;  2ZPN A;  3PTF C;  1NI2 A;  1OQY A;  1Q5W B;  2LVP A;  3ZUN A;  3TIX A;  4MGZ E;  2RD0 A;  4KDI C;  2IYD B;  4WAA A;  1X1M A;  2IY1 B;  2QHO A;  3KYC D;  3L16 A;  3VFK A;  3ML8 A;  1UZX B;  3VTV A;  4CHK A;  3A9J B;  2JY6 A;  2GBM A;  3U30 A;  3UIP B;  5J2R A;  4BOS C;  3ALB A;  4J6I A;  5KHO A;  1WGD A;  5L83 A;  3S2A A;  4GDL B;  2WDT B;  4IM0 A;  2O2V B;  5CHF A;  3VQI A;  3QK0 A;  3EHV A;  3L10 B;  4G50 A;  4N9F 4;  4XX5 A;  3ZRF A;  1HE8 A;  2K8B A;  3DQV A;  1V2Y A;  1WE7 A;  3A4S C;  3VVW B;  2VRR B;  4MGY E;  3ZDT A;  2MA9 B;  4ZYN A;  4LJO B;  3T8M A;  2JVC A;  1WF9 A;  1WGR A;  2MWS B;  3R7Q A;  2C60 A;  3HM6 X;  3TCA A;  3JVZ X;  3HHM A;  3PGE A;  2Z0E B;  2ZNV C;  4HLE A;  1WXV A;  3ENE A;  4BKT A;  3CSF A;  2LJ5 A;  2FUH B;  3APF A;  3TL5 A;  2O6V B;  3UIO B;  2IZV B;  4AP4 C;  1L2N A;  3TBL D;  4ANX A;  4AUQ C;  4URK A;  3VH4 B;  4PS8 A;  1I35 A;  2M4N A;  1G6J A;  1T0Y A;  1E7U A;  4MH0 E;  2N9P C;  1RLF A;  1UEL A;  3GZN I;  2K25 A;  1WM3 A;  2RGF A;  4KZC A;  4P7I A;  2DAF A;  2D10 A;  4WJP A;  2BF8 B;  2XBB C;  3B1L X;  3L17 A;  2LXA A;  2K6Q A;  5GMV A;  3QIJ A;  3CMM B;  1V49 A;  1CMX B;  3W1Y A;  5D7G A;  1J8C A;  4EZJ A;  3V62 A;  4G0N B;  4K7W A;  3OLM D;  2N7D A;  3A9K B;  4KDL B;  1S1Q B;  3ZNZ B;  4HVB A;  2KWU B;  4DDI D;  3ZTC A;  4HPM B;  2HTH A;  3B08 A;  3D32 A;  4W9E A;  2PE9 A;  2LGY A;  2G45 B;  2AEH A;  5JH5 C;  2DYO A;  2Z59 B;  4ANU A;  1WR1 A;  2KZR A;  2N1V A;  2J7Q B;  4EUT A;  2M0X A;  2KMA A;  2OOB B;  2V3S A;  3X0W A;  2KJH B;  5JHB A;  3QX1 A;  4BOZ B;  4BVU C;  3H7P B;  2PPH A;  3ML9 A;  4DXA B;  3H9D A;  3M63 B;  2HD5 B;  3N3K B;  3SDL C;  4AOF A;  4LDT B;  3ZNH B;  1WJ4 A;  4A20 A;  2KX3 A;  2J0M A;  3QC8 B;  3JSV B;  1WJU A;  3NHE B;  4NQL B;  1TTN A;  2KWC A;  1WZ0 A;  1J0G A;  2IO3 B;  2KN5 A;  4MEM A;  4GOC A;  4MSM B;  4WWO A;  1GJZ A;  2UWQ A;  3DBR I;  2N1W A;  5LXH A;  1I42 A;  3N30 A;  4WJQ A;  1E8X A;  3C0R B;  4K7U A;  3OJ4 B;  1ZGU B;  3SD5 A;  4I6N B;  1F9J A;  2K6D B;  1M94 A;  2WX0 A;  2ZVO A;  4HK2 A;  3RYT A;  3WIM A;  1Q1O A;  4FAD A;  4ICU A;  4GIV A;  2KDB A;  4W9G A;  5JHA A;  3DCG A;  3PLV A;  2C7H A;  2MSE D;  3ZKJ C;  2MBO A;  2DZJ A;  4HPL B;  5KHQ A;  1NBF C;  2JZZ A;  2CHW A;  3PHX B;  3T9L A;  3V60 A;  3R3M A;  1E7V A;  2YVC A;  1SE9 A;  1E5W A;  2AL3 A;  4GDK A;  2BKF A;  3SHQ A;  2FAZ A;  2GBN A;  1J19 A;  2CKH B;  2O6V D;  4KVG B;  2HJ8 A;  4DDG D;  4KIK B;  3EFU A;  1RRB A;  1V81 A;  2L76 A;  1E8W A;  3V6C B;  5BO4 B;  4RM9 A;  4EOY A;  2KVR A;  3I3T B;  2LXC A;  3IBE A;  2A4Z A;  4NNJ B;  2CS4 A;  2A5U A;  2V1Y A;  1WX7 A;  2J0K A;  2KTF A;  4TV3 A;  4W9L A;  4ANW A;  3H6N A;  2DAJ A;  4LJP B;  5C1Z A;  5DPR A;  1UD7 A;  2BYE A;  3UIN B;  3RD2 A;  4NPN A;  2D11 A;  1ZW7 A;  3Q3J A;  2MRP A;  4II2 B;  2Y5B B;  2AYO B;  4K7S A;  5CTR C;  2RR9 A;  3PSE B;  4WQO B;  2JZ3 B;  1XT9 B;  2NPT A;  4ZRJ A;  2C9W B;  4RMA A;  3ZO5 B;  2N9X A;  3U8Z A;  4TKN A;  4MJS B;  1FXT B;  3QAQ A;  1WRD B;  1WIA A;  1V80 A;  2AWT A;  4ANV A;  1EF5 A;  4WWP A;  5IAA C;  3RUI B;  4K1R B;  5D6J B;  2BYV E;  2LUE A;  3ZRC A;  3NOB A;  4A3P A;  1TBE A;  4E71 A;  4MEL A;  4TUU A;  4MSQ B;  1OGW A;  4LDT D;  1C1Y B;  1P9D U;  1Q0W B;  2L0F A;  3ZVV A;  1YJ1 A;  2BWF A;  1WGH A;  3PZD A;  4BKS D;  1EF1 A;  2ZZP B;  2Z0D B;  4E74 A;  2FNJ B;  1D3Z A;  1KOT A;  3UQA A;  1GC6 A;  1R4M I;  1IP9 A;  4E3C A;  2NS5 A;  1S3S G;  2FCQ A;  2M1M A;  1WGG A;  2NBV B;  1KM7 A;  1SGH A;  2W9N A;  2MBH A;  4IC7 B;  4PYU A;  3VH3 B;  1YX5 B;  3KVF B;  2FID A;  3A1Q B;  3AU5 A;  3OAW A;  3QA8 A;  3TMP B;  1GNU A;  4BFR A;  2CU1 A;  1WX9 A;  1WR6 E;  4KV2 A;  4LCD E;  2IBI B;  4W9I A;  3ZDM C;  2KTR A;  2CHX A;  1YQB A;  3NZU A;  1OEY A;  3AXC A;  3QHT A;  1WMH A;  4FHK A;  2JF5 A;  1WXM A;  1UGM A;  2LGD A;  2K8H A;  5DPT A;  3WAL A;  3APD A;  4MGI E;  4DBG A;  2BGF A;  3AI5 A;  2M8S A;  1VCB A;  2GBK A;  1SIF A;  2BWE S;  1GG3 A;  3Q3F A;  2DYM A;  5CHV C;  1ISN A;  2K8C A;  5CX3 A;  1IYF A;  3DVG X;  2EKE C;  3ZIM A;  2I1K A;  3KW5 B;  2KQ7 A;  4IWO A;  2KLC A;  2XK5 A;  4HDQ A;  2MBQ A;  2KFK A;  5AZH A;  2WX1 A;  5E6O A;  2N9E B;  1UBQ A;  2KHW B;  2REX A;  2JWZ A;  3PT2 B;  3BY4 B;  1PQS A;  3PRP B;  1C3T A;  1WE6 A;  3CST A;  4FA6 A;  2BPS A;  3ZNI D;  1TZ1 A;  2ZNV B;  3LDZ E;  5DPW A;  2GBR A;  3OJ3 A;  2MX2 A;  3N32 A;  4PS7 A;  3SU8 X;  1BT0 A;  3QQ8 B;  2JRH A;  4W9H A;  4AJW A;  1IPG A;  1JRU A;  2MW5 A;  2DZM A;  1WXS A;  4FN2 A;  3RZF A;  4X57 B;  4GDL A;  1R4N I;  2HE7 A;  1UBI A;  2K39 A;  3KUC B;  3QWZ B;  4EZL A;  3DVN V;  4IUM B;  3KUZ A;  3HM3 A;  2NBU A;  4CYE A;  4IWQ A;  3M3J A;  1OEY J;  3MHS D;  3O65 B;  5AZF A;  4IG7 B;  4HCP B;  2JPH A;  4PS3 A;  4JQW C;  3L54 A;  4HCN B;  2NR2 A;  3PRM B;  2KNB A;  2ZPY A;  4RM8 A;  1GC7 A;  2LZ6 A;  4K81 A;  3DPD A;  1QZE A;  5J17 A;  2O6V A;  3H1U A;  1Z2M A;  4JL9 A;  2D07 B;  4TQ0 A;  4JLC A;  5LLI A;  4F8C B;  5LXI B;  4NY0 A;  1K8R B;  3A4R A;  2G4D B;  2JUO A;  2LRU A;  2RSU A;  2XEW A;  4IM2 A;  5DCN A;  1Z5S B;  2GOW A;  2KJ6 A;  4DWF A;  3NS8 A;  2FCM A;  4GB9 A;  1L7Y A;  2KFJ A;  4MGK E;  1OTR B;  2KKC A;  1WYW B;  2L05 A;  3VTW A;  5J18 A;  2DEN B;  3AU4 A;  3ZNG C;  5AEK B;  2L0T A;  4KSK C;  4WJO A;  2WYQ A;  2DZK A;  2MP2 A;  4DHZ E;  3IFW B;  4W9K A;  2R2O A;  3VAW A;  2GMI C;  3A9K A;  2UYZ B;  4EEW A;  3UQB A;  2LD9 A;  4B6W A;  4FBJ B;  1V86 A;  4IWP A;  4OVU A;  3KH0 A;  2V4L A;  3JW0 X;  2KWV B;  1WX8 A;  5D2M B;  3LJ3 A;  4M0W B;  3P2B A;  3VUY A;  5IA7 A;  4JIO U;  2JT4 B;  4ASW C;  3DOW A;  4CO7 A;  2N7E A;  2DHZ A;  3PLU A;  3V61 A;  3VDZ A;  1LXD A;  2LVO A;  2KDI A;  2IY0 B;  2K1F A;  2DYB A;  2C5L C;  1E90 A;  4NAW A;  1P98 A;  1GUA B;  2M17 A;  1E8Z A;  4B95 A;  2ASQ A;  4F7Z A;  2EMS A;  1E8Y A;  4GSW A;  5C23 A;  3WAO A;  2IO2 B;  3H7P A;  2KDF B;  4HDO A;  1WZ3 A;  4EZK A;  1A5R A;  3PHW B;  2L8J A;  4G11 A;  4GXB A;  2FCN A;  3JSV A;  1WJN A;  2N4F A;  3CF6 E;  3EC8 A;  5AZG A;  2BYF A;  2R2Q A;  4A3O A;  4AWJ A;  3UGB B;  4GGQ A;  2D3G A;  3A33 B;  1U4A A;  3W1S C;  2G3Q B;  3DVG Y;  4BKS A;  1RAX A;  2BKR B;  3VUW A;  2AL6 A;  1WI0 A;  2CR5 A;  2LRW A;  3U7D A;  1WH3 A;  4W9D A;  5G2N A; 
#chains in the Genus database with same CATH topology
 1ET9 A;  4HKZ E;  4HKQ A;  1I4X A;  1XF5 L;  3T3N A;  2GBJ A;  2NBW B;  4FJV B;  3Q8C A;  4BBN C;  2W55 A;  1ZKH A;  1DOY A;  2HTM E;  4NQK E;  2E6X A;  2KLG A;  3M62 B;  2PEA A;  4N6E B;  2PE6 B;  3NZ3 A;  2PJH A;  4L1B A;  5D94 A;  1D5X C;  1ZXI A;  3VHT C;  4TQ1 A;  5E6N A;  2MLB A;  5IKC M;  1GOZ A;  2FIF A;  3NVZ A;  1ENF A;  1XCQ L;  2PLP A;  2WU5 B;  1PGA A;  4W9J A;  3P4S B;  1Y56 A;  2GB1 A;  4B9K A;  1WJ6 A;  3NRZ A;  3ZTD A;  3V05 A;  1MG8 A;  5FR6 A;  3N20 C;  4OHJ A;  5HKH A;  4ZRP A;  3WAN A;  1HTO A;  2ZCC A;  3AED B;  1I4Q A;  1P7F A;  1ESF A;  2DX5 B;  4MAC A;  4I6L B;  3GOE A;  3RZW C;  4EKU A;  4ICV A;  3ZJV A;  3IHP C;  4NJ6 A;  4MT5 A;  1YD8 U;  3MJW A;  5G55 A;  1WM2 A;  3VTU A;  1QKZ A;  4ZDV A;  1XLQ A;  2UU7 A;  4WWN A;  5FKA C;  4JGH B;  4A9A A;  2NCN A;  1QIL A;  2MBB B;  5L95 C;  3IVF A;  1EUV B;  3TJP A;  3P4R B;  3B2G A;  5HFY A;  4HRS A;  3EEC A;  3N1Y C;  3X23 A;  3PV1 A;  2LI5 A;  4FUL A;  5TR5 A;  1KJT A;  3UF8 A;  2C7M B;  2KXJ A;  2KAJ A;  3V6E B;  3Q14 C;  4WJN A;  2ZCB A;  2OJR A;  4M00 A;  1TIF A;  1XLN A;  2MCN B;  3MC9 A;  4RGM A;  3PTF C;  2IGH A;  1OQY A;  3ZUN A;  4KDI C;  1X1M A;  2QHO A;  3L16 A;  1E9M A;  3VFK A;  3ML8 A;  1KLG D;  1VRA B;  1DGJ A;  5J2R A;  1L5P A;  3AEG B;  4BOS C;  4J6I A;  1WGD A;  1F77 A;  2WDT B;  4XGA B;  3FC4 A;  3VQI A;  3V3X A;  3EHV A;  5BYR A;  4RGT A;  2K8B A;  3NUH B;  1K50 A;  2MA9 B;  4LJO B;  5IO9 A;  3BVZ A;  2JSV X;  2KDM A;  2Z0E B;  5BMI A;  4BKT A;  2QC8 A;  1L2N A;  2LHE A;  3TBL D;  1HXY D;  4AUQ C;  1STE A;  4K3B A;  1E7U A;  1T3Q A;  1TKG A;  2IGD A;  4P7I A;  4WJP A;  3BK2 A;  3B1L X;  2K6Q A;  3KQ4 A;  2WP9 B;  2KQ4 X;  1V49 A;  2QEJ C;  3ABV B;  1VZ8 A;  4XE0 A;  4KDL B;  1HQR D;  2K0P A;  4DDI D;  1DYQ A;  3D32 A;  3B08 A;  2PE9 A;  2LUM A;  1FIQ A;  4EUT A;  1PGB A;  4KKJ A;  4P1C C;  1LO5 D;  4OZA A;  3SDL C;  4AOF A;  4A20 A;  2Q5W D;  3BVG A;  1TTN A;  1GB4 A;  1WZ0 A;  1J0G A;  1JRO A;  2XN9 C;  2V4I B;  5LXH A;  1N62 A;  1F9J A;  4HK2 A;  3N1X C;  4ICU A;  3KWV A;  2MSE D;  2G9H D;  2MBO A;  3Q8A A;  5KHQ A;  3T9L A;  4XYC A;  1SE9 A;  3I5J C;  4GDK A;  2BW2 A;  2L52 A;  2BKF A;  2FAZ A;  2O6V D;  1JWU D;  1D5Z C;  1V81 A;  2L76 A;  4M01 A;  4RM9 A;  4EOY A;  1I42 A;  4TV3 A;  1TS3 A;  3NS1 A;  2B76 B;  1IBX A;  2IJ0 A;  3VR8 B;  1SE2 A;  3RN9 C;  3SR6 A;  2WXI A;  4NPN A;  4II2 B;  2Y5B B;  4MM3 B;  2NPT A;  4B0E A;  3TSS A;  1YN4 A;  1EWY C;  3U4E G;  2K9X A;  3DBH B;  1DOI A;  4MJS B;  3Q8B A;  4KGR A;  1FXT B;  4YSZ B;  1WRD B;  2AWT A;  3E9S A;  4WWP A;  1FFU A;  1UF0 A;  2BYV E;  3ZRC A;  4A3P A;  4MEL A;  1WRI A;  2KYW A;  3RPF C;  3ZVV A;  5EE3 A;  1PYW D;  2ZZP B;  4E74 A;  3RNF C;  1GC6 A;  1R4M I;  5D3D A;  5C2T B;  1WGG A;  1KM7 A;  2W9N A;  1KFY B;  2X8X X;  4D2K A;  4PYU A;  3A1Q B;  3OAW A;  3QA8 A;  3TMP B;  1WR6 E;  3EUB 2;  2KTR A;  2MJ3 A;  3NZU A;  1ET6 A;  5FR3 A;  3QHT A;  1WMH A;  1WXM A;  1UGM A;  2LJI A;  4DBG A;  4MGI E;  1SIF A;  1T0R C;  3IAS 1;  3IT4 B;  3DVG X;  1YN5 A;  2EKE C;  2I1K A;  4IWO A;  2KLC A;  2MBQ A;  1IBX B;  3P4Q B;  3BY4 B;  1PQS A;  4RNA A;  1C3T A;  4LLG M;  3ZYY X;  3ZNI D;  5DPW A;  3OJ3 A;  3HRD D;  3SU8 X;  1QOB A;  1BT0 A;  3QQ8 B;  4P1B C;  1SF0 A;  4AJW A;  2MW5 A;  4FN2 A;  4X57 B;  2WXN A;  1R4N I;  3KLS X;  4GDL A;  4JWS C;  1UBI A;  2K39 A;  3DVN V;  5LNK 1;  1OEY J;  3MHS D;  3BZD B;  3L54 A;  4HCN B;  3PRM B;  3RI7 C;  2OJW A;  4JL9 A;  4TQ0 A;  5HI1 A;  5LXI B;  2QIL A;  4C4V B;  1SEB D;  2JUO A;  2LRU A;  1Z5S B;  4GB9 A;  1OTR B;  2WXO A;  3W5V B;  3VTW A;  2BTE A;  3AU4 A;  4KSK C;  3H8H A;  2V9H A;  2LEK A;  4W9K A;  2DBY A;  4B6W A;  4FBJ B;  1JQ4 A;  4IWP A;  2MJD A;  2KWV B;  3LJ3 A;  3AEF B;  3P4P B;  3AE1 B;  1LXD A;  4NAW A;  2C5L C;  1P98 A;  2M17 A;  1E8Z A;  2JZP A;  2RDH A;  5GXG B;  4HDO A;  2MH7 A;  2FCN A;  4C00 A;  1AYF A;  1WJN A;  3EC8 A;  1MHH E;  2BYF A;  2R2Q A;  2HDE A;  2D3G A;  3A33 B;  3T3O A;  1CJE A;  2KVZ A;  3FIL B;  2BKR B;  2AL6 A;  2MJE A;  2LRW A;  2ICI A;  3J9C A;  3U7D A;  3W5U B;  3ONS A;  4ZHO A;  3ZW3 A;  2QSD A;  4IM3 A;  4RF0 A;  4TSS A;  2WGS A;  3O13 A;  2KOX A;  4GMV A;  4DHZ B;  2G4S A;  4MDK E;  1L4Z B;  2MBE A;  4OVV A;  3AH7 A;  4A55 A;  2L83 A;  3PRE A;  2J52 A;  2I38 A;  4H2A A;  1TS4 A;  2EMT A;  3DHG C;  5E6P A;  4JPS A;  3AB5 A;  2BB6 A;  4FJY A;  3L0W B;  1WGK A;  4FJZ A;  1XLO A;  2SEB D;  2KJR A;  4O1N A;  5DPS A;  1SE3 A;  1L6U A;  1QQR A;  1SE4 A;  1YIW A;  1C78 A;  1YJI A;  2QIE B;  2MQJ A;  3DVN U;  3KWL A;  2AQ1 B;  3LYY A;  4NAW B;  4YT0 B;  2SAK A;  1V9J A;  3BWU D;  1LM8 B;  1C9F A;  3P63 A;  3ECI A;  2QDF A;  2KAN A;  3N9Y C;  3L13 A;  3N1Z C;  3PVL A;  3ZJU A;  2WDV B;  3TEY A;  4JWU C;  1E7P B;  1L0Y B;  4HXD A;  3H7S A;  3NVY A;  3AMZ A;  4UDU C;  2KO3 A;  2PTL A;  1EU4 A;  4RH6 A;  3QCA A;  2WXH A;  4EFO A;  3I63 C;  4YTP B;  3TUO A;  2KC1 A;  4AJY B;  1WGY A;  2DNF A;  1HZ5 A;  2YLM A;  1P1A A;  3DBL I;  3ZQ4 A;  2J53 A;  2EEL A;  4F1S A;  5JZE B;  4ARC A;  1WY8 A;  2L7R A;  2KWD A;  2WDQ B;  2XK5 B;  4WIP A;  2RDG A;  1NI2 A;  5AUI A;  1QOG A;  1Q5W B;  4OZC A;  4MGZ E;  2Z8L A;  4L2Y A;  3IT6 B;  2JY6 A;  2GBM A;  2N0S B;  5KHO A;  5L83 A;  4M02 A;  4IM0 A;  5CHF A;  1WXQ A;  4G50 A;  4N9F 4;  3ZRF A;  2NTS A;  2LFI A;  1XXG A;  4L23 A;  2W82 A;  4MGY E;  3ZDT A;  4ZYN A;  1YQ3 B;  3AE6 B;  1WGR A;  2MWS B;  3URY A;  2C60 A;  3PGE A;  3HHM A;  2ZNV C;  2PKO A;  4NZL B;  1EM7 A;  2WXK A;  2O6V B;  4PT5 A;  4HPP A;  4ANX A;  4URK A;  3VH4 B;  3Q8F A;  3Q3M C;  1YNT E;  3C8Y A;  3GZN I;  2D10 A;  3BII D;  4YSY B;  3CMM B;  3V62 A;  3ZNZ B;  1CK1 A;  5IOI A;  3NJT A;  4HPM B;  4M0W A;  1D4B A;  4W9E A;  3AEC B;  5JH5 C;  4ANU A;  2N1V A;  2KMA A;  3AE9 B;  5JHB A;  1J7A A;  2HD5 B;  3N3K B;  2WNM A;  2FBW B;  2KX3 A;  3BVM A;  3JSV B;  1A70 A;  1MVK A;  2KWC A;  3P42 A;  2IO3 B;  1LGR A;  4MEM A;  1GJZ A;  4US8 A;  3C0R B;  3SD5 A;  4I6N B;  2K6D B;  3C19 A;  3WIM A;  1Q1O A;  4FAD A;  1SSN A;  2WXM A;  2LHD A;  2JXT A;  1TY0 A;  2BT6 A;  3R3M A;  2YVC A;  1KLU D;  2AL3 A;  3MC8 A;  4NAM A;  2GBN A;  4DDG D;  4LNK A;  1NI3 A;  2M19 A;  1E0Z A;  3GE8 C;  1T0Q C;  4JX1 C;  3I3T B;  3IBE A;  3VAW A;  1WX7 A;  2J0K A;  2KTF A;  4W9L A;  5AUK A;  2DAJ A;  4LJP B;  5DPR A;  2BYE A;  4RF1 A;  3UIN B;  1SJE D;  4S0R A;  2D11 A;  1ZW7 A;  2W3R A;  1CQV A;  4K7S A;  1VZ6 A;  2WXG A;  2C9W B;  3ZO5 B;  3MJ5 A;  3U8Z A;  2H89 B;  1WIA A;  3RNG C;  2RPV A;  5IAA C;  3RUI B;  3NOB A;  1TBE A;  3OWE B;  1P9D U;  1Q0W B;  3R2T A;  1YJ1 A;  2BWF A;  4LNF A;  4FXC A;  1EF1 A;  2DLB A;  2Z0D B;  1D3Z A;  2FNJ B;  3UQA A;  1IP9 A;  2NBV B;  3RNA C;  4IC7 B;  2MBH A;  3VH3 B;  3KVF B;  3AU5 A;  1WX9 A;  4KV2 A;  1GAQ B;  4LCD E;  2IBI B;  4W9I A;  3TEZ A;  1ZUD 2;  3RNE C;  1YQB A;  2IGG A;  1TYG B;  3AXC A;  4FHK A;  3APD A;  2WXJ A;  1RFK A;  2M8S A;  1VCB A;  2BWE S;  1RYJ A;  3Q3F A;  2DYM A;  2V3N A;  5CHV C;  1ISN A;  1I7H A;  2KFK A;  2KT7 A;  5E6O A;  1JWA D;  3OG5 A;  4JE3 B;  1CZP A;  5C3J B;  3CST A;  2BPS A;  2FUG 1;  2ZNV B;  2MX2 A;  3N32 A;  3Q6B A;  4P6V F;  4PS7 A;  5HHD G;  2JRH A;  4W9H A;  1WSP A;  1IPG A;  1JRU A;  2DZM A;  3RZF A;  3QWZ B;  3HM3 A;  2NBU A;  3MHZ A;  3M3J A;  5FK9 C;  1MJD A;  1N61 A;  1JAL A;  2L32 A;  1TS2 A;  2KNB A;  4OZB A;  2QCZ A;  4K81 A;  4JLC A;  3AN1 A;  2X38 A;  2G4D B;  2RSU A;  2KAC A;  1FNU A;  2XEW A;  4IM2 A;  5DCN A;  2GOW A;  2FCM A;  1SB3 C;  2WXF A;  4MGK E;  2V3P A;  5JXV A;  2KKC A;  1WYW B;  2WS3 B;  2ACZ B;  2DEN B;  3ZNG C;  2L0T A;  2D3A A;  4WJO A;  1D6E C;  2RDB C;  4DHZ E;  3IFW B;  3A9K A;  5G5H A;  1C4A A;  1V86 A;  2V4L A;  3DBR B;  2NTT A;  3DOW A;  4CO7 A;  3PLU A;  1N5W A;  2DHZ A;  1I4G A;  4HJG E;  2IY0 B;  2DYB A;  4B95 A;  3AEA B;  1GUA B;  1UGJ A;  1JRP A;  2EMS A;  3WAO A;  2IO2 B;  3H7P A;  2KDF B;  1WZ3 A;  3PHW B;  2L8J A;  1RWS A;  4G11 A;  1QLB B;  4AWJ A;  1NYQ A;  3W1S C;  3DVG Y;  4BKS A;  1PUT A;  2WXL A;  4W9D A;  2I1J A;  2WQY B;  1XQQ A;  3NZS A;  3APC A;  2JRI B;  3BYT B;  3NG0 A;  1AAR A;  3BK1 A;  3BIN A;  4G3X B;  2CJN A;  3AEB B;  2KQS A;  1JW9 D;  4GDK B;  4KIK A;  4LTU A;  5EDS A;  2JXX A;  4M8M A;  3BYY B;  4GU2 A;  4K3C A;  1TJE A;  1KLV A;  4C7Z A;  4ZYS A;  3AE2 B;  2NVU I;  1GB1 A;  1OFF A;  2IND C;  2LGX A;  1TKY A;  2NPT B;  3IG3 A;  4KSL C;  3WAP A;  4RFB A;  4REZ A;  3WAM A;  3L08 A;  3M95 A;  5EE9 A;  2KDE B;  2ZJD A;  3K9O B;  3RNB C;  4NJC A;  4II3 B;  4ZRI A;  2RPQ A;  4BZA A;  1FPY A;  1OQR A;  2D2Q A;  3DBS A;  2IO0 B;  2KK8 A;  3HIZ A;  2KC2 A;  3QJZ A;  2LAS A;  4XZ4 A;  2I2Y A;  1V6E A;  2WXR A;  3DBH I;  5CHW A;  3NY5 A;  4ZOH C;  4BBN F;  4HWI B;  4DK5 A;  2KTR B;  1Y8R C;  4DHJ D;  1RM6 C;  2H88 B;  1C76 A;  1WMH B;  3W1S A;  2CHZ A;  4AQ7 A;  4WH4 A;  4M8N A;  1RFA A;  2BBC A;  1LQB A;  3HUI A;  1KF6 B;  4IW0 A;  2LMC A;  2LWP A;  4XC2 A;  1F2R I;  1L0V B;  3VUX A;  1P0R A;  1FMA D;  2ZPN A;  3MC0 B;  3TIX A;  2RD0 A;  4WAA A;  3ETR A;  2K22 A;  4CHK A;  3SFD B;  3ALB A;  3S2A A;  4GDL B;  2N9K A;  1T5X D;  1EWC A;  2VH2 A;  3QK0 A;  1I4P A;  2K3U A;  2JWU A;  1HE8 A;  3DQV A;  2VRR B;  5EE0 A;  3T8M A;  2JVC A;  1WF9 A;  3PO0 A;  1D5M C;  3R7Q A;  3HM6 X;  3JVZ X;  4YTM B;  1L6V A;  1P7E A;  4XDC A;  1WXV A;  3ENE A;  2LJ5 A;  2FUH B;  1VR9 A;  3TL5 A;  2IZV B;  1UWM A;  4PS8 A;  1I35 A;  2N9P C;  1RLF A;  2K25 A;  2RGF A;  2DAF A;  2XBB C;  3L17 A;  2LXA A;  1ACC A;  5GMV A;  4XDD A;  3QIJ A;  3EFC A;  1CMX B;  3W1Y A;  4EZJ A;  4G0N B;  4K7W A;  2N7D A;  3GP7 A;  1S1Q B;  1PDX A;  2KWU B;  3GS2 A;  4PK1 A;  3ZTC A;  2LGY A;  2AEH A;  2DYO A;  1WR1 A;  2KZR A;  3IXS A;  2BYT A;  2OOB B;  3X0W A;  1SBB B;  1F52 A;  3QX1 A;  3E56 A;  3MP9 A;  3ML9 A;  2J42 A;  3H9D A;  3M63 B;  4N59 A;  2JX5 A;  3AM9 A;  3ZNH B;  1AN8 A;  1WJ4 A;  4YXD B;  4IDI A;  1WJU A;  4NQL B;  2LGS A;  2TSS A;  4MSM B;  4LNI A;  3EGR A;  1PGX A;  3N30 A;  4WJQ A;  4K7U A;  1UWX A;  1ZGU B;  1M94 A;  1QT9 A;  1XO3 A;  2WX0 A;  1N60 A;  4GIV A;  5IP4 D;  1VJK A;  3PZ7 A;  3DCG A;  2DZJ A;  4HPL B;  1NBF C;  5I4D A;  2CHW A;  1E7V A;  1Q10 A;  1E5W A;  5BYQ A;  3SHQ A;  4KVG B;  1J19 A;  1FO4 A;  2HJ8 A;  1C4P A;  4C56 C;  1RRB A;  1FEH A;  1E8W A;  3V6C B;  2KVR A;  2LXC A;  1KOT A;  3Q8E A;  2V1Y A;  3H6N A;  5EE1 A;  3HVZ A;  2MRP A;  5CTR C;  4KGT A;  2JZ3 B;  1XT9 B;  4ZRJ A;  2AQ2 B;  2N9X A;  1NVI D;  4TKN A;  2RMM A;  3B9J A;  4CQN A;  3QAQ A;  1HA5 A;  4OVZ A;  3P1M A;  2VZK D;  1V80 A;  4K1R B;  5D6J B;  2BB5 A;  2LUE A;  4E71 A;  4MSQ B;  1OGW A;  4LDT D;  1WGH A;  4OW0 A;  4IOI E;  2QJL A;  3PZD A;  3W2D A;  4BKS D;  1R7S A;  4E3C A;  2NS5 A;  2FCQ A;  3AE4 B;  2M1M A;  1AW7 A;  2WXQ A;  1YX5 B;  1IGC A;  1ZE3 D;  1GNU A;  4BFR A;  2CU1 A;  1C77 A;  4WWM A;  1QOF A;  1OEY A;  3U7Z A;  2K8H A;  2LGD A;  5DPT A;  3WAL A;  2JQR B;  3AI5 A;  2GBK A;  1GG3 A;  5BMG A;  1XEE A;  1SJH D;  3RNC C;  3KW5 B;  1MI0 A;  4HDQ A;  5AZH A;  3TEW A;  2KHW B;  2REX A;  3PT2 B;  2JYT A;  1FXA A;  1YMH E;  1JCK B;  3ZXR A;  2YEP B;  1ROE A;  3B2F A;  4A6Q A;  1WXS A;  5MPO A;  2WXP A;  2HE7 A;  4HRO A;  3KUC B;  4EZL A;  2GRI A;  2ONQ A;  3KUZ A;  1L4D B;  4IWQ A;  3SEB A;  1YN3 A;  1ZOY B;  3O65 B;  4IG7 B;  4PS3 A;  4JQW C;  4USA A;  4RM8 A;  1GC7 A;  3IAM 1;  1B9R A;  4MH8 A;  1QZE A;  3RMK C;  5J17 A;  5LLI A;  4NY0 A;  1K8R B;  4A8X C;  1JWB D;  4DWF A;  3NS8 A;  1TS5 A;  1JWS D;  3AE8 B;  5AEK B;  1HZ6 A;  5BMH A;  3LXF A;  2DZK A;  2MP2 A;  1XLP A;  1FCL A;  2GMI C;  3UQB A;  2UYZ B;  4EEW A;  2LD9 A;  2OED A;  4QAY A;  2J4X A;  4OVU A;  3KH0 A;  1WX8 A;  4M0W B;  5IA7 A;  2CJO A;  2Y5C A;  2JT4 B;  4ASW C;  1F2R C;  3V61 A;  3VDZ A;  2JU6 X;  2LVO A;  2KDI A;  2ZW1 A;  2K1F A;  4GSW A;  1JML A;  5C23 A;  2INN E;  1K53 A;  4GXB A;  1MFW A;  3PZ8 A;  1FM0 D;  3CF6 E;  3W9C B;  5BYS A;  4GGQ A;  1RAX A;  3R2I A;  3VUW A;  2CR5 A;  2OHF A;  4LNN A;  3B0A A;  1V5O A;  4NJ7 A;  4XWW A;  2R61 A;  1KTK A;  5T8I A;  4YL8 A;  3DDC B;  1H4R A;  1EU3 A;  4DHJ B;  1KH0 A;  1TT5 B;  1C4C A;  3MFG A;  3PS6 A;  3QAR A;  4C80 A;  3ZGZ A;  2L00 B;  2JYE A;  1TGZ B;  2GI9 A;  4FLH A;  3HK0 A;  3RT3 B;  3RUL A;  1LFD A;  1FRD A;  4I6P A;  2KMC A;  2MP2 B;  4ZRK A;  1YOV B;  1ZP0 B;  1NDD A;  1ZPS A;  2C7N B;  1EO6 A;  3WA0 A;  2W54 A;  4MM3 A;  2DZI A;  3A9J A;  1UH6 A;  1V1P A;  4AS1 A;  1IGD A;  1R4M B;  2KX0 A;  3PPA A;  4W9F A;  4MJS A;  3TEX A;  4YTN B;  2O2V A;  4FHJ A;  3JYU A;  1NYR A;  3Q3N C;  4KZ0 A;  2L3Z A;  3VXW A;  3PRZ A;  3VRB B;  1YX6 B;  2ZW0 A;  2INC C;  1UUP A;  1XD3 B;  3RCZ A;  3NVV A;  2LGI A;  2AX5 A;  3EA6 A;  1JWM D;  4W9C A;  3K9P B;  1V5T A;  3ZLZ A;  2FCS A;  2INP E;  2J0J A;  1VDV A;  3R7R A;  4HJK A;  1WXA A;  2LVQ A;  3Q69 A;  3A1Q A;  3GE3 C;  4GN1 A;  1BML C;  2ZVN A;  1SIJ A;  2M0A A;  1WFY A;  2PVG C;  2KD0 A;  2YEP F;  1P3Q U;  1A5R A;  3R66 C;  2KMM A;  1R4N B;  2ZEQ A;  4BKG A;  2IO1 B;  3U52 E;  1VD2 A;  2BS3 B;  2D3B A;  4P16 A;  5D3I B;  3R8B A;  2B3A A;  2WWZ A;  1B1Z A;  1E6E B;  3KYD D;  3KUD B;  1ZDV A;  1H8C A;  2KFK B;  1TKE A;  3MTN B;  4PYZ A;  3AUL A;  3DWM A;  4BAX A;  2LVP A;  4RGN A;  2IYD B;  1N5X A;  2FE8 A;  3KYC D;  2IY1 B;  1UZX B;  3VTV A;  3A9J B;  2Y5P A;  1V1P B;  3U30 A;  3UIP B;  4S17 A;  4US9 A;  1V8C A;  1SXT A;  4N58 A;  2O2V B;  1YJJ A;  4YSX B;  4LK0 M;  3L10 B;  4XX5 A;  1V2Y A;  2DWQ A;  1WE7 A;  2MHJ A;  3A4S C;  3VVW B;  2KN4 A;  4DXF A;  4ITK A;  1NEN B;  3AE7 B;  3TCA A;  1BXT A;  1J7B A;  4HLE A;  1I4H A;  3CSF A;  2WHI A;  3APF A;  1E10 A;  3UIO B;  4AP4 C;  2AQ3 B;  4R3D A;  4C4V A;  2M4N A;  1G6J A;  1T0Y A;  3AE3 B;  4MH0 E;  1UEL A;  2WU2 B;  4KZC A;  1WM3 A;  1FD6 A;  2BF8 B;  2BS2 B;  1WWT A;  1MHX A;  1UNS A;  2IDY A;  1NEK B;  4RCO A;  2PVO D;  1FCC C;  5D7G A;  4C7Y A;  1J8C A;  4HVB A;  3OLM D;  3A9K B;  1F0Z A;  1OQQ A;  2HTH A;  2N7J A;  1WYG A;  2G45 B;  2Z59 B;  2EKI A;  2J7Q B;  2VZK B;  2M0X A;  2V3S A;  3U2S C;  1MG4 A;  2KJH B;  3AE5 B;  3VRA B;  4BOZ B;  4BVU C;  1L0X B;  1FNV A;  3H7P B;  2PPH A;  4LNO A;  3I57 A;  4DXA B;  4EE2 A;  4LDT B;  1TZO A;  2J0M A;  3QC8 B;  4DXG A;  1KRH A;  3NHE B;  3GB1 A;  2PW9 A;  3FIL A;  2KN5 A;  4GOC A;  4WWO A;  2UWQ A;  3DBR I;  2N1W A;  3AEE B;  2M56 B;  1E8X A;  3OJ4 B;  4ACF A;  2ZVO A;  3RYT A;  4J3O D;  4TMA B;  2PMV A;  2KDB A;  4W9G A;  5JHA A;  3PLV A;  2C7H A;  5IN7 A;  5H92 C;  3ZKJ C;  1ZDX A;  1ZXH A;  2JZZ A;  3PHX B;  3V60 A;  1PFD A;  4YWG G;  1BUI C;  1F1H A;  2CKH B;  4KIK B;  3EFU A;  1MPE A;  1K51 A;  4DQO C;  4HEA 1;  3ZXV A;  1FNW A;  2CU3 A;  5BO4 B;  2A4Z A;  2VH1 A;  2CS4 A;  2A5U A;  2BVC A;  4NNJ B;  5E6J A;  4ANW A;  5H8Y E;  5C1Z A;  1UD7 A;  3VR9 B;  1N63 A;  2GLS A;  3RD2 A;  1AWD A;  3HVD A;  2QMT A;  3Q3J A;  1FRR A;  2AYO B;  4WQM A;  2IPK D;  1N6Z A;  2RR9 A;  3PSE B;  4WQO B;  4RMA A;  2NMQ A;  2N9L A;  3Q2A C;  3DHH C;  4ZRQ A;  1T0S C;  4WUR A;  4RGO S;  2BS4 B;  4ANV A;  1EF5 A;  3WCQ A;  2Y3A A;  3UI3 A;  4TUU A;  4B0M A;  1C1Y B;  1TY2 A;  2L0F A;  3DBL B;  2D5G A;  4A90 A;  1V1O A;  2XNA C;  1S3S G;  1SGH A;  4Q2J A;  3FKY A;  2FID A;  3NVW A;  4KGS A;  2HJ1 A;  4KX6 B;  4WAF A;  2D3C A;  3ZDM C;  2E3T A;  2CHX A;  2K5P A;  1IUE A;  2JF5 A;  5G5G A;  2BGF A;  2V0G A;  2WLB A;  2K8C A;  5CX3 A;  1IYF A;  3ZIM A;  2KQ7 A;  2XK5 A;  3ZJT A;  2WX1 A;  3CIR B;  2N9E B;  4KKI A;  2W3S A;  1UBQ A;  1HEZ E;  3SFE B;  2JWZ A;  1T6B X;  1VZ7 A;  2PIA A;  3PRP B;  1WE6 A;  4FA6 A;  2L1A A;  1I4R A;  1TZ1 A;  3LDZ E;  2GBR A;  1YQ4 B;  3GZN B;  5TSS A;  3FAH A;  1XCT L;  4ARI A;  4IUM B;  1C79 A;  4CYE A;  2WDR B;  4XWT A;  5AZF A;  4HCP B;  2JPH A;  2MEK A;  2NR2 A;  2ZPY A;  1V97 A;  2LZ6 A;  3DPD A;  2O6V A;  3H1U A;  3Q3O C;  1Z2M A;  3CWI A;  2D07 B;  3AV8 A;  4F8C B;  3A4R A;  4GLS C;  2G1E A;  2KJ6 A;  1K52 A;  1L7Y A;  2KFJ A;  2L05 A;  1QF6 A;  5J18 A;  1J7C A;  1FFV A;  2ON8 A;  2WYQ A;  2R2O A;  1QOA A;  3LB8 C;  1M4V A;  3JW0 X;  5HG2 A;  4ZHP A;  5D2M B;  3P2B A;  3VUY A;  4JIO U;  2N7E A;  3I9V 1;  1FXI A;  1DOX A;  1E90 A;  2BQQ A;  2ASQ A;  4F7Z A;  1E8Y A;  4EZK A;  3L4P A;  1GPX A;  1VLB A;  1HTQ A;  3JSV A;  2N4F A;  3DHI C;  3DWG C;  5AZG A;  4A3O A;  3UGB B;  4IKG A;  1U4A A;  2G3Q B;  3RFZ B;  1WI0 A;  1WH3 A;  5G2N A; 
#chains in the Genus database with same CATH homology
 2I1J A;  3B0A A;  3ONS A;  1V5O A;  4NJ7 A;  1XQQ A;  3ZW3 A;  2GBJ A;  3NZS A;  3APC A;  2JRI B;  2NBW B;  4IM3 A;  4FJV B;  4BBN C;  1AAR A;  4YL8 A;  3DDC B;  1ZKH A;  1H4R A;  2KOX A;  4NQK E;  4DHJ B;  2KLG A;  3M62 B;  3BIN A;  4G3X B;  4GMV A;  4DHZ B;  2G4S A;  2KQS A;  4MDK E;  2PEA A;  3PS6 A;  4GDK B;  2MBE A;  3QAR A;  4OVV A;  4KIK A;  2L00 B;  2PE6 B;  5EDS A;  2JXX A;  2PJH A;  3PRE A;  4M8M A;  1TGZ B;  4GU2 A;  5D94 A;  4FLH A;  3HK0 A;  1KLV A;  3RT3 B;  2EMT A;  3VHT C;  4TQ1 A;  3RUL A;  5E6P A;  5E6N A;  2MLB A;  4FJY A;  1LFD A;  2FIF A;  3L0W B;  4FJZ A;  4I6P A;  2KMC A;  2KJR A;  2MP2 B;  5DPS A;  4ZRK A;  2C7N B;  1NDD A;  2NVU I;  1EO6 A;  3WA0 A;  2LGX A;  4MM3 A;  2DZI A;  4W9J A;  1YIW A;  3A9J A;  2NPT B;  4B9K A;  1UH6 A;  3IG3 A;  1WJ6 A;  2KX0 A;  4KSL C;  3ZTD A;  3WAP A;  3PPA A;  4W9F A;  4MJS A;  3WAM A;  2MQJ A;  3DVN U;  1MG8 A;  5FR6 A;  3L08 A;  3M95 A;  2O2V A;  5HKH A;  4FHJ A;  3WAN A;  2KDE B;  2ZCC A;  4NAW B;  2ZJD A;  1V9J A;  3JYU A;  4KZ0 A;  3K9O B;  1LM8 B;  2L3Z A;  2DX5 B;  3VXW A;  3PRZ A;  4II3 B;  1YX6 B;  4ZRI A;  2RPQ A;  4I6L B;  3ECI A;  2KAN A;  1XD3 B;  3GOE A;  3RCZ A;  3RZW C;  4EKU A;  4ICV A;  3L13 A;  2D2Q A;  3IHP C;  3PVL A;  3DBS A;  2IO0 B;  2KK8 A;  1YD8 U;  4NJ6 A;  3HIZ A;  4W9C A;  3MJW A;  2KC2 A;  3K9P B;  5G55 A;  1V5T A;  1WM2 A;  3ZLZ A;  2FCS A;  4HXD A;  3H7S A;  3QJZ A;  3VTU A;  4ZDV A;  2J0J A;  2LAS A;  4XZ4 A;  2KO3 A;  4HJK A;  3R7R A;  1V6E A;  3DBH I;  1WXA A;  2LVQ A;  4WWN A;  5CHW A;  3NY5 A;  3QCA A;  3A1Q A;  4JGH B;  4GN1 A;  2NCN A;  2ZVN A;  4EFO A;  4BBN F;  2MBB B;  1WFY A;  3IVF A;  4HWI B;  5L95 C;  1EUV B;  2KD0 A;  1P3Q U;  2KC1 A;  3R66 C;  3TJP A;  4DK5 A;  2KTR B;  1Y8R C;  1WGY A;  4AJY B;  4DHJ D;  3EEC A;  2YLM A;  1P1A A;  3X23 A;  3PV1 A;  1WMH B;  2LI5 A;  3DBL I;  2CHZ A;  4FUL A;  1KJT A;  5TR5 A;  3W1S A;  3UF8 A;  4M8N A;  1RFA A;  2C7M B;  2ZEQ A;  4BKG A;  1LQB A;  2IO1 B;  4F1S A;  1VD2 A;  5JZE B;  4IW0 A;  1WY8 A;  2KXJ A;  2L7R A;  3V6E B;  4WJN A;  2ZCB A;  2OJR A;  2B3A A;  2LWP A;  2WWZ A;  4XC2 A;  3KYD D;  3KUD B;  2XK5 B;  1P0R A;  2MCN B;  2KFK B;  4PYZ A;  3MTN B;  3VUX A;  1H8C A;  3AUL A;  2ZPN A;  3PTF C;  1NI2 A;  1OQY A;  1Q5W B;  2LVP A;  3ZUN A;  3TIX A;  4MGZ E;  2RD0 A;  4KDI C;  2IYD B;  4WAA A;  1X1M A;  2IY1 B;  2QHO A;  3KYC D;  3L16 A;  3VFK A;  3ML8 A;  1UZX B;  3VTV A;  4CHK A;  3A9J B;  2JY6 A;  2GBM A;  3U30 A;  3UIP B;  5J2R A;  4BOS C;  3ALB A;  4J6I A;  5KHO A;  1WGD A;  5L83 A;  3S2A A;  4GDL B;  2WDT B;  4IM0 A;  2O2V B;  5CHF A;  3VQI A;  3QK0 A;  3EHV A;  3L10 B;  4G50 A;  4N9F 4;  4XX5 A;  3ZRF A;  1HE8 A;  2K8B A;  3DQV A;  1V2Y A;  1WE7 A;  3A4S C;  3VVW B;  2VRR B;  4MGY E;  3ZDT A;  2MA9 B;  4ZYN A;  4LJO B;  3T8M A;  2JVC A;  1WF9 A;  1WGR A;  2MWS B;  3R7Q A;  2C60 A;  3HM6 X;  3TCA A;  3JVZ X;  3HHM A;  3PGE A;  2Z0E B;  2ZNV C;  4HLE A;  1WXV A;  3ENE A;  4BKT A;  3CSF A;  2LJ5 A;  2FUH B;  3APF A;  3TL5 A;  2O6V B;  3UIO B;  2IZV B;  4AP4 C;  1L2N A;  3TBL D;  4ANX A;  4AUQ C;  4URK A;  3VH4 B;  4PS8 A;  1I35 A;  2M4N A;  1G6J A;  1T0Y A;  1E7U A;  4MH0 E;  2N9P C;  1RLF A;  1UEL A;  3GZN I;  2K25 A;  1WM3 A;  2RGF A;  4KZC A;  4P7I A;  2DAF A;  2D10 A;  4WJP A;  2BF8 B;  2XBB C;  3B1L X;  3L17 A;  2LXA A;  2K6Q A;  5GMV A;  3QIJ A;  3CMM B;  1V49 A;  1CMX B;  3W1Y A;  5D7G A;  1J8C A;  4EZJ A;  3V62 A;  4G0N B;  4K7W A;  3OLM D;  2N7D A;  3A9K B;  4KDL B;  1S1Q B;  3ZNZ B;  4HVB A;  2KWU B;  4DDI D;  3ZTC A;  4HPM B;  2HTH A;  3B08 A;  3D32 A;  4W9E A;  2PE9 A;  2LGY A;  2G45 B;  2AEH A;  5JH5 C;  2DYO A;  2Z59 B;  4ANU A;  1WR1 A;  2KZR A;  2N1V A;  2J7Q B;  4EUT A;  2M0X A;  2KMA A;  2OOB B;  2V3S A;  3X0W A;  2KJH B;  5JHB A;  3QX1 A;  4BOZ B;  4BVU C;  3H7P B;  2PPH A;  3ML9 A;  4DXA B;  3H9D A;  3M63 B;  2HD5 B;  3N3K B;  3SDL C;  4AOF A;  4LDT B;  3ZNH B;  1WJ4 A;  4A20 A;  2KX3 A;  2J0M A;  3QC8 B;  3JSV B;  1WJU A;  3NHE B;  4NQL B;  1TTN A;  2KWC A;  1WZ0 A;  1J0G A;  2IO3 B;  2KN5 A;  4MEM A;  4GOC A;  4MSM B;  4WWO A;  1GJZ A;  2UWQ A;  3DBR I;  2N1W A;  5LXH A;  1I42 A;  3N30 A;  4WJQ A;  1E8X A;  3C0R B;  4K7U A;  3OJ4 B;  1ZGU B;  3SD5 A;  4I6N B;  1F9J A;  2K6D B;  1M94 A;  2WX0 A;  2ZVO A;  4HK2 A;  3RYT A;  3WIM A;  1Q1O A;  4FAD A;  4ICU A;  4GIV A;  2KDB A;  4W9G A;  5JHA A;  3DCG A;  3PLV A;  2C7H A;  2MSE D;  3ZKJ C;  2MBO A;  2DZJ A;  4HPL B;  5KHQ A;  1NBF C;  2JZZ A;  2CHW A;  3PHX B;  3T9L A;  3V60 A;  3R3M A;  1E7V A;  2YVC A;  1SE9 A;  1E5W A;  2AL3 A;  4GDK A;  2BKF A;  3SHQ A;  2FAZ A;  2GBN A;  1J19 A;  2CKH B;  2O6V D;  4KVG B;  2HJ8 A;  4DDG D;  4KIK B;  3EFU A;  1RRB A;  1V81 A;  2L76 A;  1E8W A;  3V6C B;  5BO4 B;  4RM9 A;  4EOY A;  2KVR A;  3I3T B;  2LXC A;  3IBE A;  2A4Z A;  4NNJ B;  2CS4 A;  2A5U A;  2V1Y A;  1WX7 A;  2J0K A;  2KTF A;  4TV3 A;  4W9L A;  4ANW A;  3H6N A;  2DAJ A;  4LJP B;  5C1Z A;  5DPR A;  1UD7 A;  2BYE A;  3UIN B;  3RD2 A;  4NPN A;  2D11 A;  1ZW7 A;  3Q3J A;  2MRP A;  4II2 B;  2Y5B B;  2AYO B;  4K7S A;  5CTR C;  2RR9 A;  3PSE B;  4WQO B;  2JZ3 B;  1XT9 B;  2NPT A;  4ZRJ A;  2C9W B;  4RMA A;  3ZO5 B;  2N9X A;  3U8Z A;  4TKN A;  4MJS B;  1FXT B;  3QAQ A;  1WRD B;  1WIA A;  1V80 A;  2AWT A;  4ANV A;  1EF5 A;  4WWP A;  5IAA C;  3RUI B;  4K1R B;  5D6J B;  2BYV E;  2LUE A;  3ZRC A;  3NOB A;  4A3P A;  1TBE A;  4E71 A;  4MEL A;  4TUU A;  4MSQ B;  1OGW A;  4LDT D;  1C1Y B;  1P9D U;  1Q0W B;  2L0F A;  3ZVV A;  1YJ1 A;  2BWF A;  1WGH A;  3PZD A;  4BKS D;  1EF1 A;  2ZZP B;  2Z0D B;  4E74 A;  2FNJ B;  1D3Z A;  1KOT A;  3UQA A;  1GC6 A;  1R4M I;  1IP9 A;  4E3C A;  2NS5 A;  1S3S G;  2FCQ A;  2M1M A;  1WGG A;  2NBV B;  1KM7 A;  1SGH A;  2W9N A;  2MBH A;  4IC7 B;  4PYU A;  3VH3 B;  1YX5 B;  3KVF B;  2FID A;  3A1Q B;  3AU5 A;  3OAW A;  3QA8 A;  3TMP B;  1GNU A;  4BFR A;  2CU1 A;  1WX9 A;  1WR6 E;  4KV2 A;  4LCD E;  2IBI B;  4W9I A;  3ZDM C;  2KTR A;  2CHX A;  1YQB A;  3NZU A;  1OEY A;  3AXC A;  3QHT A;  1WMH A;  4FHK A;  2JF5 A;  1WXM A;  1UGM A;  2LGD A;  2K8H A;  5DPT A;  3WAL A;  3APD A;  4MGI E;  4DBG A;  2BGF A;  3AI5 A;  2M8S A;  1VCB A;  2GBK A;  1SIF A;  2BWE S;  1GG3 A;  3Q3F A;  2DYM A;  5CHV C;  1ISN A;  2K8C A;  5CX3 A;  1IYF A;  3DVG X;  2EKE C;  3ZIM A;  2I1K A;  3KW5 B;  2KQ7 A;  4IWO A;  2KLC A;  2XK5 A;  4HDQ A;  2MBQ A;  2KFK A;  5AZH A;  2WX1 A;  5E6O A;  2N9E B;  1UBQ A;  2KHW B;  2REX A;  2JWZ A;  3PT2 B;  3BY4 B;  1PQS A;  3PRP B;  1C3T A;  1WE6 A;  3CST A;  4FA6 A;  2BPS A;  3ZNI D;  1TZ1 A;  2ZNV B;  3LDZ E;  5DPW A;  2GBR A;  3OJ3 A;  2MX2 A;  3N32 A;  4PS7 A;  3SU8 X;  1BT0 A;  3QQ8 B;  2JRH A;  4W9H A;  4AJW A;  1IPG A;  1JRU A;  2MW5 A;  2DZM A;  1WXS A;  4FN2 A;  3RZF A;  4X57 B;  4GDL A;  1R4N I;  2HE7 A;  1UBI A;  2K39 A;  3KUC B;  3QWZ B;  4EZL A;  3DVN V;  4IUM B;  3KUZ A;  3HM3 A;  2NBU A;  4CYE A;  4IWQ A;  3M3J A;  1OEY J;  3MHS D;  3O65 B;  5AZF A;  4IG7 B;  4HCP B;  2JPH A;  4PS3 A;  4JQW C;  3L54 A;  4HCN B;  2NR2 A;  3PRM B;  2KNB A;  2ZPY A;  4RM8 A;  1GC7 A;  2LZ6 A;  4K81 A;  3DPD A;  1QZE A;  5J17 A;  2O6V A;  3H1U A;  1Z2M A;  4JL9 A;  2D07 B;  4TQ0 A;  4JLC A;  5LLI A;  4F8C B;  5LXI B;  4NY0 A;  1K8R B;  3A4R A;  2G4D B;  2JUO A;  2LRU A;  2RSU A;  2XEW A;  4IM2 A;  5DCN A;  1Z5S B;  2GOW A;  2KJ6 A;  4DWF A;  3NS8 A;  2FCM A;  4GB9 A;  1L7Y A;  2KFJ A;  4MGK E;  1OTR B;  2KKC A;  1WYW B;  2L05 A;  3VTW A;  5J18 A;  2DEN B;  3AU4 A;  3ZNG C;  5AEK B;  2L0T A;  4KSK C;  4WJO A;  2WYQ A;  2DZK A;  2MP2 A;  4DHZ E;  3IFW B;  4W9K A;  2R2O A;  3VAW A;  2GMI C;  3A9K A;  2UYZ B;  4EEW A;  3UQB A;  2LD9 A;  4B6W A;  4FBJ B;  1V86 A;  4IWP A;  4OVU A;  3KH0 A;  2V4L A;  3JW0 X;  2KWV B;  1WX8 A;  5D2M B;  3LJ3 A;  4M0W B;  3P2B A;  3VUY A;  5IA7 A;  4JIO U;  2JT4 B;  4ASW C;  3DOW A;  4CO7 A;  2N7E A;  2DHZ A;  3PLU A;  3V61 A;  3VDZ A;  1LXD A;  2LVO A;  2KDI A;  2IY0 B;  2K1F A;  2DYB A;  2C5L C;  1E90 A;  4NAW A;  1P98 A;  1GUA B;  2M17 A;  1E8Z A;  4B95 A;  2ASQ A;  4F7Z A;  2EMS A;  1E8Y A;  4GSW A;  5C23 A;  3WAO A;  2IO2 B;  3H7P A;  2KDF B;  4HDO A;  1WZ3 A;  4EZK A;  1A5R A;  3PHW B;  2L8J A;  4G11 A;  4GXB A;  2FCN A;  3JSV A;  1WJN A;  2N4F A;  3CF6 E;  3EC8 A;  5AZG A;  2BYF A;  2R2Q A;  4A3O A;  4AWJ A;  3UGB B;  4GGQ A;  2D3G A;  3A33 B;  1U4A A;  3W1S C;  2G3Q B;  3DVG Y;  4BKS A;  1RAX A;  2BKR B;  3VUW A;  2AL6 A;  1WI0 A;  2CR5 A;  2LRW A;  3U7D A;  1WH3 A;  4W9D A;  5G2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...