3PLYA

Structure of oxidized p96g mutant of amicyanin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHGFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Proline 96 of the copper ligand loop of amicyanin regulates electron transfer from methylamine dehydrogenase by positioning other residues at the protein-protein interface.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3plyA00
2DYSB 1KCWA 1JXFA 4HZ1A 2Y69B 3UAAA 4KNUA 4Q8BA 4HCFA 2B08A 1TKWA 1T5KA 1X9UA 4HHGA 2IDSA 4YSAA 5I6NA 1AR1B 3NP3A 2AFNA 2WSDA 5I6OA 5TK4A 4K9JA 4L0PB 3NSDA 2XV2A 3ABKB 3TBBA 3NJFA 2VW4A 5AZUA 3L45A 3BQVA 1NTDA 4CSPA 3UADA 2XU9A 2OCCB 2GBAA 4DP8X 2HRGA 3AY2A 5B3SB 3NSCA 1AAJA 5TK2A 2BWIA 3OQRA 4BDVA 9PCYA 1F56A 1RKRA 1J9SA 1SJMA 2FQDA 2YAHA 1PNDA 2QPDB 4NB7A 4A2HA 4YSUA 1AANA 1IBYA 2VSKB 4E9XA 1ZV2A 3QJUB 3FS9A 3CG8A 2YXWA 4DP0X 1NPJA 4GYBA 3OMAB 6PCYA 3RYMA 1L9RA 1ZIAA 4UF7C 1BXVA 5B7EA 1X9RA 3FSVA 2GC4C 3WI9A 2CALA 2IDQA 4GXFA 3EHBB 2HX9A 3CZUB 4YSEA 1NIFA 1J5CA 1JERA 4KO5A 4KNTA 3AG3B 1NICA 1ID2A 2HRHA 1J9TA 3FSZA 2X88A 1GYCA 5E9NA 1DZ0A 1M9WA 1PLBA 4AI7A 4W1TA 1OV8A 4W9ZA 1NWPA 1NIDA 4DPAX 1BQRA 3PAVA 2CCWA 5PCYA 5LDUA 3NJGA 1J9QA 2PPDA 3SBQA 2GIMA 2IAAC 2YAMA 1JVLA 1GS7A 3OM3B 2YAFA 4BDVB 4FAAB 3OMIB 2GI0A 2FT7A 1HFUA 1OCCB 1V54B 4BWWA 1KGYE 2UXTA 4BWUA 1ZDQA 2BZCA 2BO0A 3PAUA 3T9WA 4BXVA 5B1JA 5ANHA 4A68A 1A3ZA 2DWSA 1AZRA 2HLEB 1QHQA 2HZHA 1WS8A 2UXGA 2NRDA 1QLEB 3X1GA 2YXVA 1CC3A 1AG6A 1B3IA 4G7QB 1ET5A 4QKTA 1TEFA 2CJ3A 3PPSA 2XX1A 3QPKA 2FWLB 5PAZA 1BYPA 4N4YB 3S3DB 1PMYA 2Y1AA 5I6MA 1J9RA 4CSZA 5AKRA 1OE3A 2PP8A 1WAEA 2XXFA 4YSRA 1ZIBA 4ZK8A 2UXFA 3UABA 1AQ8A 2UX6A 5I26A 1PNCA 4G70B 2CAKA 1XB6A 1AZNA 2RACA 4HHWA 2P80D 4E9RA 2N0MA 3S3CB 2GHZA 2BZ7A 1SDDA 3ZBMA 4HIPA 3NJJA 4DP4X 1GY2A 3SBRA 3V9EA 3D12B 4G7RB 4EF3A 1AS6A 1BXUA 1NIAA 2PPEA 1KDJA 5IY5B 1SHXA 3HEIB 1JZFA 1PLCA 1BQ5A 4MFHA 1MG2C 3PCYA 2EILB 3C75A 5I5JA 1XB3A 3KW8A 4HAKA 3TU6A 1SHWA 1NIBA 1RZPA 4P5RA 4GP8B 3T6XA 3HB3B 1L9QA 3FU7A 3PLYA 3SBPA 5AFAA 2W88A 2PPCA 4QLWA 1AS8A 2J57A 2GSMB 1NIEA 1ASPA 1AZBA 3SQRA 2CBPA 4E9QA 2YAQA 4YL4A 2IWFA 2EINB 4WKXA 1JXDA 2IWKA 2ZWNA 1M57B 5B7MA 3T71A 5I28A 4UANA 2Q9OA 1E30A 3S3BB 3FSAA 2YAOA 3DTUB 4NAJA 3GDCA 1GY1A 2J56A 4YSCA 4DP7X 5B1BB 4X4KA 4HCGA 4A2EA 4F7KA 3GXUB 1GS6X 1HAUA 3IBOA 2LLNA 1W6LA 1PAZA 2ZONA 4M3HA 2BHFA 3AW5A 1BXAA 4DP9X 1SDDB 2QDVA 1PY0A 1E65A 1KBWA 3ERXA 3FYIB 1CUOA 1IBZA 2PPFA 3ABGA 3X1NA 2AANA 1AACA 3FQ1A 2YQBA 1CURA 2MRYA 2VSMB 3NP4A 4A2FA 3ASNB 2H5UA 4AX3A 3FU9A 3T6ZA 4KOCA 2BWDA 3WIAA 1URIA 3JT2A 1N70A 1BYOA 2I7SA 3WKQA 2GC7C 2YAPA 4Q89A 3FU7B 1V10A 2XUWA 3IE9A 1A65A 1BAWA 3X1EA 4DP2X 3AG2B 2XYBA 1L9OA 4ENZA 1L9TA 3X1BA 1AIZA 4E9WA 1N68A 2IDUA 1NDTA 1ILUA 2HX8A 2XX0A 1BEXA 2FQGA 3ASOB 1XMEB 1KYAA 1SF5A 7PAZA 3FPYA 3FU8A 2PLTA 1EZLA 1RZQA 2VMJA 1OCRB 1SFHA 4G71B 2QT6A 4F2FA 3T6WA 2EIKB 2AZAA 1ADWA 1IKOP 1WS7A 2FT6A 3NSFA 4A66A 1WA0X 2FTAA 3WKPA 3QJVB 1AZUA 2XXGA 2UXVA 2X87A 4PCYA 1J5DA 2BP0A 3ZDWA 1ET8A 4JKNA 1DYZA 2XWZA 3TBCA 1ILSA 2AZUA 2DYRB 1NINA 2EIJB 1W6WA 4KOBA 3S8GB 2FT8A 2HXAA 2GB2A 4E9TA 3FYEB 4G72B 1KDIA 2E86A 2IDTA 5EHFA 2BP8A 5D4HA 4A67A 1GR7A 2IWEA 2I85A 4E9SA 3X1FA 4KO6A 4RH4A 5B1KA 4DPCX 1ASOA 2XVBA 3FT0A 1TEGA 1A4CA 2FJSA 5I5IA 3GYRA 5A7EA 3TA4D 3QJSB 4YSSA 3ZX1A 1OE1A 3CVCA 1XB8A 4AZUA 5B1AB 3BVDB 1I53A 3T6VA 3CVBA 2PCYA 3H4HA 1PZBA 3QQXA 2AVFA 3UGEA 3KW7A 2J55A 4P5SA 3H56A 4DPBX 2OJ1A 4E9VA 2WO2B 2FNWA 3WNJA 4AKQA 3AG4B 4A2GA 4BWTA 4F2EA 4YSDA 1VLXA 1KV7A 3N2JA 3UACA 3PAZA 1OCOB 2BW4A 1OF0A 1SF3A 3AZUA 1OE2A 3EF4A 1MDAA 4DP1X 1OOWA 2BP0B 2CUAA 2PP7A 2VM3A 3QJRB 5I5MA 1IUZA 4UAHA 2PCFA 1FWXA 3FPXA 4YVUA 1NWOA 3N55A 2YARA 3PXLA 4NERA 2BP8B 4YSPA 1AOZA 3X2QB 3NT0A 1L9SA 2PPAA 3EH5B 1JZJA 2JKWA 3UAEA 2QPEB 2YAEA 3NJKA 1PZCA 2VW7A 1GW0A 1ASQA 1KBVA 4N8UA 1JOIA 1W8EA 4DP6X 2H3XC 1R1CA 1EHKB 1WA1X 5B1JC 2JFCA 3NJHA 2ZOOA 1JZEA 4DP5X 2R7EA 5F7BA 2JXMA 1AS7A 1SFDA 4HCIA 5B7FA 2MTAA 3DIVA 4TXVB 1IC0A 3NJLA 2B3IA 3NYKA 3NJNA 4A2DA 4YVNA 1OCZB 3FQ2A 2PP9A 4YSTA 4KNSA 1FFTB 3IN0A 3S8FB 1M56B 2EIMB 2IH8A 3H4FA 3WNIA 3QJTB 3ABLB 3NSYA 4HALA 2A3TA 4GP4B 2Q5BA 3QJQB 3TASA 2WO3B 3EH3B 5I6PA 1A4AA 2P80A 2TSAA 2IDFA 1A4BA 2UX7A 1RCYA 1FA4A 1MG3C 2BW5A 1HAWA 3U25A 4G7SB 2VN3A 3CDZA 5I6KA 2IH9A 1PLAA 1CYWA 2ZXWB 1ZPUA 1ET7A 5I6LA 3FQYA 4KO7A 4E9YA 7PCYA 6PAZA 1NZRA 3NJIA 4JHVA 1KCBA 3G5WA 2XV3A 1MZZA 1GSKA 2DWTA 4BXSV 3OD3A 1JVOA 5FC9A 1JZHA 2TSBA 3CVDA 4WTQA 1NPNA 1SNRA 2R7EB 1V55B 4KO9A 2XV0A 4M4RB 3EH4B 2OV0A 1QNIA 2DY2A 2FQEA 3AG1B 5D4IA 1PZAA 1UATA 2HX7A 1ETJA 4AKOA 1PF3A 1E5ZA 3IEAA 5D4JA 1AG0A 2J5WA 3NJMA 1JZIA 1E5YA 3ZIYA 4FA7B 1BQKA 4AKPA 5F7AA 3DKHA 2QDWA 1CYXA 3JTBA 3WG7B 3MX0B 3ABMB 1ZDSA 1A8ZA 2VM4A 1MZYA 1YLBB 2VW6A 3MBWB 4GP5B 4YSQA 3FSWA 1E67A 1TU2A 3V9CA 4JHUA 1GS8A 1AZCA 3OMNB 2I7OA 1WA2X 2FQFA 2XLLA 2W8CA 3CDZB 1JXGA 4PAZA 1L9PA 4BK5C 8PAZA 4GY4A 4YSOA 3IN2A 1JZGA 2H47C 2DV6A 1PCSA
chains in the Genus database with same CATH superfamily
1T2XA 3CLWA 4JPVH 5DHMC 2ZUSA 3DX3A 3CN1A 4PGEB 1Q9OA 4OY9A 3U7YL 4PBDA 1M7IB 5E00B 1MELA 4KNUA 3RVVD 2XVKA 2B08A 4GH7B 4N90E 3DX1A 3O2DA 3F84A 4H8WL 4HU2A 4JGUA 5CINH 5KYXA 4QJ4B 2IFGA 2E27L 5HDQL 5I19L 5F0JB 1AR1B 2I9TB 1CXIA 1Z5HA 2DWEA 3DTXB 4Z7OE 5ELIA 4UYPA 3L9RB 1IZKA 3X12B 4MS8C 2DPKA 3OKKA 1CFMA 3H7BB 4ZUSA 2DI8A 1U30A 1KJ2L 1UD5A 2V4LA 1IFHL 5CIPA 4AQEA 3JUZA 3RVUD 3CIAA 3DPBB 5C0IA 1FVEA 3KWUA 5A6LA 1NGYB 5GSVB 3JVGA 2OX5B 3ZE1E 4GUQA 5IEHA 3IU4L 4QWWD 4NB7A 1KPVA 2OP4H 4M7LH 2R39A 1JNLH 1W0YT 3QCVL 1ZV2A 3H9HA 3NABH 1I7TB 3BVNB 3DX7B 1JUFA 1K4DB 1CDGA 5DT1L 5GZNC 3CXFA 3QEQE 4O58L 4XCEB 5DQDH 3WI9A 1R6VA 1USQA 1IARB 1FNHA 5GRJH 2CALA 3MGTA 4OF6A 4KQ4H 2GFBB 1XSKA 5AAWA 2YC1A 3VGFA 5EULV 2NW2B 4L3ED 1K6QL 3AAZA 4MXVE 3RL2A 2RHEA 1NGPH 1IKNA 1BP3B 4Q58C 5IBUB 2BIIA 3IKCB 3MODL 3H3PH 4XNDA 1RJZA 4PJ7E 4NOBA 4HD9A 3FUFA 1ECZA 4XP1L 1TKWB 1FRGH 1TQCC 4NXSA 1TQSA 1BZQK 1LMIA 4MMXA 3U30B 4GIPD 1FYTD 4R5XA 3RDTB 5F9DC 3M8OL 4TNWK 1IBDA 4L1LA 5IM7A 3HHMA 3K6FA 4R8WH 3Q9QA 4E36A 1CGSH 5DJZA 3ULVH 1U3HD 2Y3NA 5CJQL 4DEUA 1ONQB 3E80A 3OBAA 4L37B 2CH8A 2IPKB 4WHYG 2GI0A 1CFBA 3HG2A 2DQEL 3OKMB 1FIGL 3G08A 5D1ZB 3V4VA 4S0TD 2F68X 3TEWA 1X5XA 3G6JA 2OL3B 1EANA 4R90H 3ETTA 1Z9SB 3FTSA 3CH1B 4D9RE 5A2KH 5AWNH 1OAQL 1A7RH 3IPBA 1ZEAH 1WYJA 3UAJA 4F91B 3WJJA 2YRZA 3FTYA 3LTVA 2VNCA 2YLHA 2VDQL 1MVFA 4Z8FL 2NRDA 1PTZA 2PR9A 2YXVA 4DJMA 1CC3A 3BUYB 2R56L 2ZKWA 3T77A 2EADA 4UOW1 4C57C 2V5YA 2CJ3A 3DVGB 3VQLA 3OXSB 2CUMA 4EMZA 4Y5YB 2Z7ZA 2HKHH 3DUSB 2CKNA 3Q8AA 4JRXB 4NQTA 3DSNA 1FF5A 1HE8A 3H42H 5DJAB 4K3EH 4LIQH 4MD5A 5HVWA 1AXTH 4PJCE 3MV7E 4AQAB 4Q9QL 2QMJA 4ZTPL 3CLEH 2R2CA 1I1CA 4ZSOB 3U4EB 1PZDA 1YNTA 1I1AC 3PHOA 4I3GA 4PBXA 2MOQA 1I7ZA 5FM8A 2UX6A 4C83B 4OH2A 4PLJC 2E9GA 2NY0C 3L3JB 4KMLB 3L13A 4R9HA 2PYFA 4LLWB 3DUHA 4OZFB 5D6CB 3VXUD 1BQSA 4IKJA 4XZUA 1QPXA 2AAAA 3BAYA 3KGUA 3OHXA 3ATBA 3D0LB 5HHXL 2YBGA 4JO3L 2L3BA 1KIPB 4PW9A 4PRHE 4ANKA 1XD0A 4JNXA 4FERA 3QHTC 4OF5A 4X5RA 1ZCRA 4EI5B 5IJDC 1XB3A 3KPPB 4HF5H 1RZPA 4PY7A 1NUDA 1DCLA 2O5XL 1HHKB 3KD4A 3HB3B 5EEVA 5AYTA 2A9NH 5DYOB 1BQHA 5F9JB 4YHNB 3VWJC 5AOZA 2W88A 2UZPA 2X4RB 1SOKA 1I7RB 3VG0H 1AS8A 3IRPX 4JN2A 4L8DA 1MN4A 2R1XB 2E74C 3BEVA 3R06A 4TQPA 4G42B 4URTB 4YL4A 4P07A 3O3AB 4KTEH 1MQ8A 1ZTXH 1FNAA 2CDFB 1U3YA 2D7TL 2KUTA 3EFOA 1V7NL 5E1IA 3TA3D 1OANA 1A6VL 5I73B 5B7MA 1GGIL 3MV01 4E42A 2VZ1A 2WOYA 4NAJA 1T20A 1ORSB 4N0UA 5GGTH 4UV4L 1INQA 4MHHI 5B1BB 3SJVE 1RZFL 4AEIH 1TQWA 4IRZL 3IJSB 2Z91B 5C0CA 1DVYA 3V5KB 4G82A 2PWDA 1G6RB 3Q3GA 1GZPB 4RMUA 1IC4L 4FXLA 1LWHA 4JDVB 1TCRA 3HAEH 5IBLD 2PCPB 3D7PA 4JCLA 4M43L 5AB1A 3S34H 1EAQA 4AX3A 4ANXA 1HZHL 2K6ZA 4P23D 4F1ZA 3JT2A 3BKJL 3CGTA 3EYVB 2HG5A 1QSFB 5J1AB 5DD3H 1SXZA 5ERWB 2Y5TB 3O3DB 3DX8A 4ZBJA 5H94B 2IADA 1EERB 2VSDA 1PGRB 2MCMA 4KXZH 3TGXA 1B0GA 1TMCB 2IDUA 1ILUA 5HYEA 2E5EA 4JPWL 3EHBC 1XMEB 4PV1C 3T0XA 4KY1H 5EUKB 3HZVB 1PSKL 5GISH 3GXNA 2XN2A 4PW3A 4FQIH 4U1LA 1FORL 3FU8A 5GIRA 4F24A 1OCRB 4LESA 2XPZA 3W11C 3T6WA 5B38G 1U58B 1ZV9A 3LPFA 3O0RH 2EC9U 2F5BH 5L9DL 5FW7A 5F1OB 1MRDL 1U6AH 3ZGIA 5IB2B 2R0LH 3NSFA 1WA0X 4YBHA 2VITA 3QJVB 4YH6A 2QQLH 5D7SL 4NN5C 2B2XH 2JE8A 3AT0A 2V8MA 4MAYB 1UKTA 3BW9B 4MCMA 3HNVL 4JHWH 1OF2A 1XSOA 3I3BA 4XWOD 2JTYA 2GPZA 1IL1A 1MXDA 3E8UH 3BN9D 3FYEB 2BXYA 2G3XA 2BP8A 4L23A 1BVKB 5I8CB 5B39B 1M42A 5EO9B 1A7PH 2DMGA 1PG7L 1HSBB 2DLIA 4N90D 3V52H 2JK5B 4G5AA 4KVNL 2MPAH 4D3CL 1NEZA 1EHLL 1JZ7A 3GLAA 3QIWC 4DZBB 2FJSA 2IH1A 4X9BA 4FG0A 2NY6C 3R1GH 1SYVB 5AUMB 3QCUH 3MLSL 5F7NC 3HE7B 3ARWA 3CVCA 1WT5A 3CAFA 4AZUA 1B2WH 2GIXA 4PRIE 5HJ3B 5CBAA 5LNDA 3CHSA 2OMWB 3H56A 1YECH 2BSTA 4XOEA 4KFZC 5K9QI 1U8MB 4D9LH 1SJEB 4X6CF 3N44F 3AG4B 4X7TA 3VNZA 3GXFA 2FEDD 3UMTA 4I9WD 5IHZA 1GJUA 1KV7A 4XOBA 5DRWA 2MH4A 4BFGA 1L9MA 1PS3A 2YQ3A 3BPNC 3QEQD 1QTYT 4MDJB 2ATPB 3TLRA 2P8MA 2PP7A 5I5MA 4TTDD 2Z35B 4ODUB 3DMMC 3I2CL 4XBEL 4XPBH 3KPSE 4N1HB 3KMDA 3UZEA 1LO4L 4RGOL 3B2PA 4GRWE 1G7JA 1J1PH 3MNDA 3MV7A 3LEXA 4GQ9H 3CVHH 4QHUA 1T4WA 1J0KA 2X6BA 5GSRB 4FX5A 4J3OD 4AEFA 4NQSB 1QYGH 3RU8L 1G7PB 2YAEA 2DJUA 2OYPA 4FHBD 3CZFA 4UQ3A 1DQIA 2NY1D 1FE8H 4HEMA 1IM3D 4NQEE 2ZCKL 4WI2A 4OBSA 3RVWD 4O2CA 5KVEH 3DNKA 4DHLA 5DR5H 2NY7H 1DVUA 5C09A 2WZPD 3RHWK 1WITA 5JW4R 1G9ML 5F7BA 5AOLA 4I48A 1ZT4B 3K4DA 4X6CB 3N44B 2P5PA 4NC1C 1UZ8B 1UYWH 3QPQD 4F9PA 4F8TA 3FBKA 3FOLA 5D55A 1HEZA 2F53A 5E7FA 3SKJL 4RETB 1E8XA 2MNUA 1XWVA 3D39E 3IN0A 2V7HA 3WFEH 3WGVB 3LKRB 1S7WB 4LVNB 3W2DL 1A22B 1X7SA 4D9RD 3GSWA 3MRIA 1OM9A 3LKOA 5EN3A 1LK3H 1XF2B 1DUYB 2BSCA 3KPNB 4NUGH 4CC1A 2OMXB 2WO3B 3KYMB 1T1ZB 3BP5B 2ATKA 3HMWH 4ODSH 3OXRB 1RZKH 2M2DA 1AD0A 1AY1L 3D85D 3LRSA 4PWKA 3TEUA 4X9YA 1CGYA 2KPWA 4UQEA 4YHIB 3U46B 2F5AL 1C08B 5EN2B 1CYWA 2ZXWB 2QGBA 3I9AA 3IMRA 3LN4B 1MFUA 2V9TA 1YEDB 4HUWA 3MRHB 1R0AL 1C5DB 2QKIB 1KCBA 4LASL 3EXJA 1DBBH 5DMGD 2Z4QA 1TPXB 4Y4FB 5CP3H 5FAAA 1HOCA 2MNJB 1S78C 4BKLA 5KVDL 2PXYB 5F7WC 1BPVA 3MRLB 5K1NA 5GRUL 5AVWB 4OZIF 1NPNA 3GM8A 3B3IB 3CSYB 2KQNA 5C9JA 4I3RH 4V1DB 1LILA 4XMVA 4Y8DC 1TJXA 2VRQA 2D73A 4XT1C 4KTDH 1ZA6B 5HHMB 2CDEB 4XNZB 1XHHA 3UTSB 3GXDA 3PWNB 4H0IA 1TZHB 4JFPA 4PRHD 1VSCA 1AGCA 1LYQA 1X4XA 5FHAH 5K9JH 2CJUH 4NZRL 3H0TB 4OF7A 5E2VL 3RY5A 3W38A 2Z93A 1UA7A 2JJTC 3BIBX 2E6QA 4M61A 3OZKA 1LTXA 4NO5A 1AHMA 1DLFH 1F4WL 3A23A 4G3YH 4NUMA 4ELME 5T1DL 3MBWB 4YSQA 3SE8L 4C56B 1NPUA 4Q2ZA 1FO0B 2I7OA 4YWGL 3I9PA 1JGVH 2VZOA 5M7QA 2VDPB 3GRGA 4GKOA 2ZXDA 5E5MA 4HIIA 2AEPH 2QV2A 4JAMA 2P49B 5EU4A 2IANA 5CUSL 4QRRA 4HLZH 1I3GL 4S11A 3R4RA 4OZIB 5KOVC 2DV6A 4M3KB 1U3ZA 2F19H 3C8HA 1MI5A 2DEYX 3QULA 4Y2OB 1WDAA 2ENYA 1XCWA 4KK5D 5CGBA 4HCFA 2LV4A 3SJVD 4CADA 2D3VA 3SGEH 1X9UA 2X10A 3G9VA 3TEXA 3TNMA 4YXKL 4FFWC 2WJ7A 3FFCA 5I6XC 3VXTA 4KK6D 5AZUA 4RX4D 3ZUNC 3WTTA 1U8CA 1YSOA 2BP5M 1S4IA 5TK2A 4O00A 5IBTL 1MVYA 1S7RA 5TPWL 1IT9H 4AK2A 2P1YA 1S9XB 4GEJA 2VR9A 4WU7A 1T1WA 5HI4C 3P9LA 2G2NA 2AEWA 2VDKB 4ETQB 5F3HB 5TDNA 3PV6B 3LSOA 2A6KB 5F7DB 4U6TA 1MREL 2GBUA 2GJ6A 3DTDA 3FQNB 1YYLH 5EWIL 2V0AA 1T2QH 4XNYH 1X9RA 1FPTH 3UTTA 2NSQA 3CDYA 3OKEA 1C16B 1RSYA 4HH8A 5HYSG 2AMGA 4H20H 1ZHBB 3FQXB 5LCVA 2Q86B 3CFQA 2VLRB 5FO8B 5D1XD 5J12B 3EG9B 1NJ9B 3QUXC 3U4BH 3QWOB 1JPSH 3M7OA 2QHRL 3GMLA 1OAUL 4PM1A 1AGFB 4RDQG 4FXTA 1NIDA 3K6OA 4C59B 5LNGA 1WEJL 2QADD 4YHKH 3N43F 4UILH 3OGCA 4WLCA 4RAUA 1TTGA 5LDUA 2QFPA 5FYKH 1KB9K 2PPDA 3MXVH 3QUZB 1JV2A 4GMTH 4Y7MA 3MU3A 3B1UA 1QBLL 4NKOA 3N1QC 3UJJH 2YAMA 3QG6A 5E0QA 4XHQA 1EDQA 2J8UF 4N87A 5CJ5A 4FA8A 3BP4A 3S5YA 2WBJD 3QRGL 4HU8A 1JPGB 5D7JD 3QWNA 3IJYB 4ZO6A 1N59A 2WXLA 3MACH 1J12A 1P4BH 4FRWA 3K5SA 3RA7L 4W4OA 1KGYE 4LSSL 4RQQA 4AGOA 1N0XH 4AXWB 3PAUA 1IGML 4CW1A 3L3GB 3NZUA 4PJAA 5FYLH 1EO8L 3D39A 2YUWA 4AV4A 3JTTB 4PRID 4H1LB 4R7LA 4S1QH 4DNLA 1AXIB 1SBSL 1QSFE 5GZNA 1MCWM 1M53A 4WEUD 2IJ0C 5CO1A 4LSQH 1BX2B 1YEEL 5I15L 1QHPA 1B3IA 2FO1A 3CZGA 5C0ND 3T04D 2WLKA 1I3VA 4MCYB 4FHKA 1XO8A 4N4YB 3S3DB 4PWJA 4PLNC 3N43B 4U1NB 4U6VH 1P6AB 4NZUH 5AAMA 3F65A 4JG1L 5DLML 4A7GA 4HXBH 4DF9A 3BKYL 3Q6FA 2Y23A 1D5XA 2LABA 4PP2A 1XGTA 2J8UB 4I77H 4WNQA 3MFGB 2NNXA 4MXWL 4U0RB 3TVMD 4CVXA 1P7QA 4ADJA 5GS2D 2H32B 3RZCA 5AVYB 1MFDL 5ES4B 5F6HI 2B1AH 3DURA 4GKNB 4O51A 1FCGA 3LEVH 2RQ8A 3LDBB 4IKIA 4F2MB 4ERSL 1Z3GH 3DI2B 4JR9L 4NQED 4DESA 4IIQB 1WBZA 4XN7A 5HPMA 5ISZA 5FB8B 3BVTA 4KZDH 3V4PH 3BSZH 3WFCH 4AQ1C 1NC4A 3KW8A 5MENA 3CCHB 4JM2A 5DHDA 5JPMB 3DHUA 1YQVL 2H6PA 3KPLB 3T6XA 5B38B 2XPYA 1CTOA 1EK3A 5ITBH 4KBPA 1AR1D 3V6ZA 1UZ6F 5EIIB 1DBJL 2F54A 5AD0A 3MAWA 1UJ3A 3F6LA 3P3RA 2FIKB 1WFOA 4YHPB 1KB3A 4ELMA 5IMMB 4ZPTB 2V6HA 1UWEL 5L8LB 3Q43A 3OX8A 1ETZA 3LY6A 3QCTH 1U8IA 4JFDB 1I3UA 1PYWA 3NRFA 3NAAH 1KB5L 1ITCA 4G43A 4GO9A 5AVTB 1ML0A 1OTUD 3VXQB 4BELD 4JCMA 2X4OB 4Y1AA 5F7HA 3DDGA 4A2LA 1TQUA 4NHCL 1F42A 4TUKL 3DIFA 4O4YH 1ZPLA 1OP3K 3CX5J 1T80A 5EFIA 4F7KA 3C6LA 3FJTA 2EECA 2PTVA 4JPKL 3MLWH 5I18H 3SKOA 2WQ8A 5JUEH 5KN5A 1W6LA 3DRQA 3EDJA 1QW8A 1SHSA 4M3HA 4RIRA 3VW3L 2QVFB 5JHDA 2OCFD 3ARZA 4XN8A 5GGVL 2B4CL 1WE5A 3LQAL 3MV9A 5IMOA 5I1HH 2W07B 1L0XA 4LKCB 1XTMA 2CPUA 1QQDA 2QPSA 4A2FA 4B6ZA 5KBPA 3GF8A 1ACYH 3LN5A 4X8GA 4DSYA 4BFJA 4Q9CA 4L05A 4FABH 3C87A 2YSTA 3O2DL 1INDL 3RFZC 3VGAC 1Y0LA 4N0FA 5HGBB 5JA8B 2ZSWA 3MBEA 5HGHB 3UBXA 1UFUA 3RDTD 3WLWD 1FDLH 1NGZA 5C0DB 3LD8C 2FQGA 2H9GB 3CXHJ 1U4FA 2FLBT 2Q76B 4X99A 3HBPA 4IHBA 2P8LA 4XODA 3HG3A 3IFNH 3VJ6A 3ZYZA 1R3HB 1KIRA 1EJOL 3QQDB 2BCKB 3MDJA 4F2FA 3QZWB 3QPXL 3MC0A 5JHLA 4MAUH 5DS1A 3HRPA 3WOVA 1ADWA 1Z9NA 1IKOP 4LLAA 1KFGA 1HSAB 1S6NA 2F74A 4MMZB 2BOLA 1OKEA 3QUMA 2QTVA 3EF7A 3KHQA 3V5DB 3WO3B 5A2LH 1MW3A 2XN0A 4JRFA 4K71C 3P30H 2CLRA 4NKMA 1J1XH 5A3ID 1JN6B 3I3DA 1A3RL 3BP6A 5HHNB 4AYFA 5B4MC 5E5RB 5DJYA 1L0PA 4MA8L 4YHZL 1FZJA 4IK6A 5D1QC 2UYLA 4EBQH 1BAFH 4JRXD 5E6UB 2WXJA 5LG1A 1TEGA 2FJHA 2D7NA 5D7KD 3F7QA 3K2MC 3QJSB 1FH5L 1PDKA 2XSKA 1X5YA 4G6JH 2F0CA 5KJRL 3PG2A 3TYFA 5IGXL 1JYNA 2VXSH 2H1PL 1JPFB 1RZJH 3HW7A 1DBKL 1SN5A 1GYAA 2H2SC 5KSVA 4AYGA 4V1DE 4HXAH 2OJ1A 3Q2NA 2OXGB 3QVAA 5L4JA 5EU7E 3MLUH 1F1AA 3NCBB 4GUPB 5ANMA 4WO0A 2ZUWA 3IYLW 4F2EA 1JZ4A 3UTSE 4J8RA 2EC9T 1Z66A 3SDDC 3ILPB 3V4VL 5HHPB 1X4YA 2FECI 3WNMA 4WFGE 1SM3L 4LVOB 4EI5D 1I9RL 2GUOA 3ESNA 1E27B 3EZ8A 2OMTA 3N42F 1KMGA 3APMA 4G80A 4MKMA 4UTCA 4JKLA 4UAHA 4YIQA 1FWXA 3QORA 2L4OA 5B3NA 1FAIH 2AXGA 3HB3D 5CLTA 3HPJB 4YVUA 2MMXA 4WV1C 1BF8A 3FUMA 1T7XA 2NCMA 4PRDB 4C56E 4DH2A 1CGUA 2W0FA 1L9SA 4EZMA 5J0BA 3NPSC 3UPAA 1JTPA 3AU0A 5IQ9A 3NJKA 2CM6A 4Y4HB 5TTRA 4ZFOL 3CHXA 1CXEA 5F7UA 3NFNA 1KBVA 3ORJA 2PETA 3KBFA 4PG2C 1BFTA 4X8JB 1NBZA 3EO0A 1DEEA 1GXEA 1FUNA 2G0LA 4DP5X 4N5EC 5I0VA 1HESA 3SE3C 1D7DA 4RBPH 2QQQA 1NMCB 3MQIA 1HOEA 2O6FA 1Z2KA 2F9BT 4TLTA 4HEPA 4JZJA 4NT6A 3VGDA 4YSTA 4YZWA 3EOBB 3N42B 3FBQA 4TNVK 4WTZA 5FYJH 2Q2EB 4WNJA 4LPXA 1FAKT 5J57B 2PW2B 3QDAA 1F5WA 3A67H 2HJLA 1ERNA 3P54A 2QSCH 3OJVC 3EDDA 4GSQA 4TL4A 1NMAL 4NKIL 3EH3B 1QSFD 4PV8A 2Q6WA 5ACLA 4QRPB 1AQHA 4JY6B 1KFAL 4NQVB 3F7PC 4WO4D 2W9DL 5I75C 3WN6A 4EUPG 2PTTB 3NPZB 2FEJA 3I9GH 4B95C 1NH6A 5I6LA 2QL1A 4GOSA 4KO7A 4ZRGA 4OGAC 3T0DA 1N5YL 1ORQA 4FG6D 3GKWH 1P7BA 5CD3B 2VLRE 3OD3A 1P5VB 3R7RA 2X9WA 4RAVA 5IFJA 3CPUA 3GO1H 1H8LA 4GSDH 5C8JB 4XNXL 4CVUA 4UCFA 3MRDA 4M4RB 1NCBH 1AIFA 1JBJA 3GSRA 2OV0A 3Q8BA 3WSQL 2NTFA 5E1GA 1IFRA 1CL7L 1OK8A 4UDTA 4MAYD 1JF1A 5IB3B 4PJDF 4O02B 1H5BC 3ZIYA 1SLXA 3H6JA 4FA7B 1EXHA 1YY9C 4I88A 4WI7A 4AVKA 2F61A 4LKXA 4LEEA 3K80A 1R5WA 4WEBH 4QOKA 2VM4A 2E46A 5FLVA 1ZK9A 2I25N 5IESH 3QNYA 5EEUA 3UDWA 4DWHA 3M1OA 4GSUA 5F71A 1QI5A 2YGVA 4U1SB 2DLTA 4Z0BL 1OP5K 2NTSP 3V9CA 5KW9L 3IT8D 2APXA 4TNWF 4LSTH 4PS4H 5KVFL 4U6YA 4ZX5A 3HE7D 3KYKL 2JCCF 2FE0A 3UJIH 1EO5A 2CHNA 4YGVA 5DUPL 5C86A 4H0GA 1QEWB 3LZFH 4LF3A 3FSOA 4PJIE 4NQCA 1M2VB 2BNUA 2YXFA 4KX7A 2XPGA 3ZKSD 1JZ5A 3BPCB 2M83A 3L4VA 3EDFA 3ZQ9A 2EUWA 1JXFA 1JMZA 2EE9A 3LVTA 1TZ8A 3W3BA 5FO7B 1U41A 1CO1A 3MRJB 1XCQA 1KXTA 3CBKB 2E7LC 4ZFQA 5DUMH 2A1WH 4X80H 2VN6A 1RZ8B 1CGXA 1GCFA 3F64A 5LWYL 3DJZA 4PJDB 5KYYA 3KLQA 1OAJA 4V2BA 2OR7A 1HZKA 1O6SA 4HCRH 4JZNB 2GSIA 5GRXG 4ONGH 4TN9A 4IU3A 1J5HA 2WGXA 3MR9A 5ADPH 2DKSA 1N64H 4NBXB 3MVSA 2YEZA 4OD2B 3V6BR 1KGCD 3IDMA 5DMKB 1KBKA 2WM0A 2AJSL 3KWVA 2HP4A 1S9VB 3L2MA 1AAJA 3K3QA 5L4MA 2BWIA 2WWMC 5L8JB 2DQHL 2YA1A 3E9TA 5DFVC 1J88A 3OF6A 4CSSA 3M7FB 1Q0XL 1R3KA 1N6VA 2JCCB 1RU9H 1I9EA 1KTLB 1YUHA 1VADB 2QVTA 3GS0A 3UX9B 3VFSA 4F2ME 1UADC 1U8KA 3UG4A 3UBXI 1QPPA 1QMUA 3PQYB 1HQRA 2ICWA 4R7NA 1DQDH 1LNUA 1XIWB 2AV1B 4X7SH 5B7EA 2G60H 4YPJA 1FFNB 2AQQA 3I6LE 1IGJA 2HB0A 2HX9A 3LEYL 2VDLB 1J5CA 2VMDA 1EGJH 3CPLA 1DSFL 2CMRH 4ZG1A 4V11A 4KNTA 1K5NA 2WLLB 5C07A 2A4ZA 3G5XB 4L3FA 5J13B 3WEMA 1QRKA 2AK1L 2LT9A 5CEZE 1K4CB 1OGAB 3F7VA 2ZUYA 3GMPB 1OM3L 4UT9A 4JFDE 2LLLA 5F2FA 1ND0A 4U31A 2NR6C 1J18A 2LFEA 1KCRL 2WXMA 1BFOA 5F89A 1BQRA 3FB7B 3C6SA 5PCYA 3P11H 5BUPA 5G4MA 1QFWL 3B6SB 3GXIA 5IW6A 4M5YH 5GS1A 1FI8C 5MP6H 5EORL 2DS4A 1N26A 2BFVH 3CU1A 3TBTA 3GUTA 3L5JA 1T7VA 3TIDB 5JMRA 1EXUA 5L4IA 5FWQA 4RZKA 2J5LC 1NSNH 4HGKC 1TJIH 2LTQB 4R4BB 3UYRL 4ONFL 2VMEA 5FFOA 3DDFA 3L4XA 4Y4FD 5CSZB 5DVNA 4QGTA 3BZFB 4BXVA 4K5MA 2K9UA 2WLHA 5E8EA 2PXYD 3ENEA 4N5UA 3QIUC 3SDCC 2QQNH 3EFFA 3INOA 1A3ZA 2F1EA 1AZRA 1MDTA 5DK2A 3PNWB 4P3DB 4PJEF 2DDQH 4V1DD 4XO5A 3LNHA 2DQGH 3AT8A 5J11C 1ETA1 1QLEB 5TGBB 3W37A 2BVYA 2Y7LA 3SGKC 4N2FA 5HHMD 2WD0A 4CN6A 4NNYB 2JLLA 3UTSD 1CBJA 4ABWA 4IKNA 5TQ0H 3BT2H 3Q48A 3SO3B 4PCSA 5GGRY 2KLTA 1GGYA 4OGXH 3RTQA 3SGJC 4LCCC 2IAMA 1KJVB 1JYXA 4JY4A 5LXGH 1KY6A 1R3LB 2CZNA 2WXKA 5TJWK 2EACA 1VFAA 1RMFL 5GZOC 2R0ZL 4MGXA 4QHMB 5DS8A 5EOQL 3TO2A 1ITBB 4C56D 1U8PA 3RWJA 3GSOB 1DVFA 1EWHA 4PP1D 1IGTA 1G4RA 2WZAA 1BZEA 4LRIC 3HS8A 3V9EA 1S5HA 3MFFB 2IBZX 4X6DF 3Q1SL 4ZOCA 4KXCA 3SEPA 2L0DA 4HW6A 2ZPKL 1RP8A 3QE5A 1K2DB 4FXKB 1AO7A 3P0VL 4GKLA 5KYWB 4PJEB 1X5JA 3ZPDA 4JFZH 5KSUA 2BLFA 1NIBA 4KK8D 4XRCB 2K6YA 2VLJA 5G55A 4EE2A 5I16B 2ICEA 2UY7A 5JO5A 1UH2A 3TPUB 4RZCA 4JO2L 1SOXA 2EP6A 4FYSA 3L6FB 1RK0B 3X13A 2VQTA 5KVGE 2HSIA 3LJ3A 1AHWC 1QBAA 1KYDA 4KMTL 3EYFA 3FN0L 1FG2B 3PF2A 5GS0C 2ED7A 5C0AA 3NMEA 4XTRD 3O4LB 2EDNA 3SDAA 3K8MA 2XA3A 2BSBA 2D03L 3MRCB 4KXZI 1JZ8A 4QTFA 1VZGA 5JYMA 4RFNC 4NWUH 3QDJB 2Z3FA 1I1RA 1IILE 3JV6A 4NCC1 5AEAA 2I27N 4PJIA 4X4KA 1CLOL 5FM5O 1YJDH 4X6DB 3EJYD 3EOYG 3ES6B 3QYNA 5CZXD 3RVXC 1CIDA 3FRUA 1Z9LA 1ZANL 1G5AA 3K0YA 3VA6A 1E8WA 3PWPA 2JKJA 4TL5A 2YPLA 3T8MA 3LH8A 5AYUH 1EXGA 3FQ1A 3MOBH 1H6FA 3WENA 4JRYB 4U0QB 1GYVA 3QQNA 4H5SB 1KN4H 2NUPB 1LO2L 2GG1A 2VLRD 4YUEH 4N2DA 3M17B 1IM9A 1ZY9A 2A73B 4Y5XC 5KWYC 4YAQA 5J5EA 1BLNA 3S3PA 1CE6B 1OAXH 2WSPA 2X09A 1IAOB 5E23A 2AV7B 4P5KA 3X3GL 3T0AA 4JK0D 5B3SB 4TNFA 1NANI 2IG2L 3GSNB 1AGEB 4PRPA 3FDWA 3W1ZA 1HEHC 1DSWA 1X44A 5JPNC 1NGQL 5CEYA 3FT9A 1GH7A 1VFBA 4IU2A 1SXSA 3QUZD 5L2JA 2XTJC 1TZGL 2LHAA 3LKSB 2Y2TA 1UH4A 2YEQA 3IWUA 4J23A 2E9BA 3BZDA 3O45B 4HKJB 3K91A 4FQQB 3QUHA 4NCDA 4U7KA 4KITB 5IB1B 1UC6A 2VZUA 3RWIB 4TPRH 4YOKA 4NLAA 4ADIA 2IQ9H 3CFBA 2Y1YA 1YN7B 3RHWF 3WUWA 2VXQA 3B9KC 5I1KH 1O0VA 3IDGB 3S4SG 3QGVA 2UXVA 2CO3A 2IPTH 5GXBB 2VDOL 3ZTNH 3GM0A 4A38A 4WHDA 5KSBF 1NFKA 1DVSA 3OAYK 4OGQC 3PDDA 3ATFA 5TDOA 5DC9B 2BWQA 2B59B 4E9TA 2Y07H 4QRPE 1XGPB 4RRPG 3FQUA 4HC1H 4Y88A 5LCVL 1W8NA 4DKDC 1LO5B 2ZT9C 4ONHB 3U36A 2AXFA 2IWEA 3DRTB 3MUGA 5B1KA 4P4KA 4DPCX 2Y7QA 3TONA 1UXMA 3V0DA 5FOBB 3B2UD 3SDXA 3UL4A 1GPOH 2NY5H 5E51A 4GW4A 2E7HA 4MWFB 4G2AA 4RMQA 3TA4D 2OTUB 5DWPA 4JDZA 3FTGB 3ZX1A 3ZDXF 1BVOA 3LB6D 1FV1A 2OZ4H 4QTHB 4OUUA 2Q20A 2QQKH 2P5EB 2AVFA 4OTXL 4IRSC 1MWOA 3W56A 1UENA 1A5FH 3ARBC 1VFUA 3HNSH 5JXAL 2LGNA 4PJXF 4A6YA 3D9AL 5C2BH 2DLFH 3GSXA 3T0EC 2R29H 2FX8L 4EUPB 2X4TA 3QH3B 2ZCLL 2ICWI 3DETD 4P0DA 5KSBB 1LEGA 1FZOA 2HPOA 3EGXB 4BZYA 4MD0B 5AOIA 1LO0L 3VI3A 4J1UA 1KACB 1OE2A 1H8NA 2CUAA 4N8CL 2X70B 1KEML 1O9WA 1I8IB 2EXTA 1CLCA 3FPXA 2HPTA 5L2KB 4N2EA 3JV4B 1IBGL 1OY3B 1S7VB 1KTDA 4W9FC 4WQOA 3GXTA 5I1IH 1K8DB 1J1OH 4HSAC 3NESA 4GAJL 4L5FE 2JKWA 1MCPH 1B0RB 2EDQA 3K6SA 4DKAA 1J05A 3ZDXB 4PB9H 2VW7A 3WIFA 4JFDD 2Z31A 1WG3A 5I8EA 1JOIA 1OAZL 1MHHA 2WXPA 1EHKB 4E41A 5BVPH 1CXFA 2NY4B 1RFDL 3SPGA 3NIGB 5IVZB 4OM1L 1KTRL 2KZWA 1OSYA 2XQYK 4PJXB 2CBQA 2DQMA 3ARYA 5HGAB 1G7LA 1NOFA 3QFDB 4XGZA 1AZVA 4N20A 3ZY7A 5T3ZL 4R3SA 3UERA 3B7UX 2NY5C 4NX0A 4RA0C 1JGLH 4CUCA 1LEIA 1H9VA 1S7XB 2LLGA 4LU5H 3WCYA 1Z5YD 3EDEA 4K8RH 1H8SA 3MKGA 3TP4A 2XY2A 1HXYA 2CLZB 2EABA 5KYNA 2E9JA 3TBWB 2B3RA 1IGFH 1IC7L 4KXDA 1JZDC 3GBMH 4IBWA 5I1LA 3LH2H 5CWSB 1KJ3L 4TM9A 2YOAA 2OTPA 4G8FB 4LLQB 3ZKND 3GZOA 2JCCE 4G8GA 4MJ4A 1CFTA 4FMVA 5MEQA 3ZRSA 1ECYA 2RFXA 1OSPH 5IIEA 4LBAA 3MLYL 1LVEA 3ALWA 3QXWA 2HLFC 1YEHH 5TQ2L 2YFNA 2MTPA 5EU6A 3V6FA 3C09C 5ABAA 5FGBA 7PCYA 6PAZA 3LS5H 3NJIA 3WHXB 3WJMA 3VE0A 3LRLA 1XDTT 4BIKA 1BF5A 3O41A 1LDPH 2AK4A 3QO0B 5FC9A 1I8LA 2Y72A 2E9IA 5T1MB 3F01A 4K3JH 1I1AB 1GTNA 2JXMB 3C5ZA 4TSAL 3W39B 4UINL 2AEQL 1OGAE 3EO9H 4OFYA 4TULL 2NY0B 3ZMNA 5LBSH 1I9JH 1QNIA 2CO6B 4NJAL 1BOGA 1JNNH 3DBXB 4PJBA 3CFCH 4APQA 1WFUA 5MEOA 1GTFA 3O11B 1L7TL 2CU9A 4GFTB 5IROC 3JWDH 2XWEA 4OV5A 3STLB 2OYKA 3TH4T 2VIRA 1RJLA 1QFUH 3EYOA 1WZLA 4HPOH 3D69A 3CX2A 3OR6A 4HLZG 4JG9A 3VFMA 4OJFL 2EEAA 3WN5C 2L04A 4DTGH 5E2WH 2PYEE 3U2JA 1OIOA 1FBIH 3US0A 5LN8A 3K6IA 2YD3A 4G7VL 4OCXL 3P4NB 3RP1A 3SBWA 4BV1A 1BIIB 4GP5B 4GXVL 1UACL 3AM8C 4K8RC 4PD4J 1R3IL 5AZEH 4JHUA 3EFDL 1Z9OA 3VWJB 5C0EB 3U1SL 3QJOA 1KCVL 5H4YA 4J3VA 1RLBA 4TSBH 5E6ZA 2CR3A 3GGWB 5H2BB 3WAJA 3ZT7A 2EUXA 4GY4A 2BY3A 3BO8B 4M1GH 1UEYA 3GHPA 5GJTL 4HYTB 2O4EA 4OFVA 4PJGF 2XZCL 4PJFF 3GHEL 2FSDA 3RY6A 3DC0A 2Y69B 3MRPA 4JFSA 3TZVC 3EJZC 4EPSA 1D9KA 4LLDB 3CBJB 3RDJA 1GMEA 2Z9TA 3LKNA 3O2VL 2IGLA 2Y6TE 4HHGA 4XC1L 4BFBD 1J8KA 2D9QB 1UJTA 4HX1B 4UBDC 3TO4C 5I6OA 3KVDD 4BFIB 1J8RA 4K9JA 5HYQB 3QUML 2HLAB 5D93C 4TNEA 1R3JA 5F3BA 2A9AA 1I1FA 5HHQB 3NJFA 4FQJH 4HMDA 3L45A 1MH5B 3BQVA 4LB8A 4LSUH 3TN0B 2HKFH 3U4AA 5CJOL 2D0HA 4TV3A 4BHUA 1RZ7L 4JQXC 5A2BA 3BAXA 1GJWA 5HJDA 4FZEH 2OR9L 2YAHA 4R7XA 3T4AC 4N8PA 4Y4HD 2Z7YA 2X4SA 3T3MF 3O4OC 5J1SC 1VPOL 3JWDC 3MCLH 1MEXH 5HGDA 3F05A 1NPJA 3N5AA 4JDTL 4PJEE 1DQML 1G6RL 1YC7A 4HQQL 5I1CL 3VFPB 2GQHA 4PJGB 4XP4H 2ZP9A 3SY0A 4PJFB 1RIUL 1CD0A 3EHBB 5D9SA 2ZXQA 3N91A 4ODVL 2OTWB 4YSEA 5HYSA 4G1EB 1JERA 2MJWA 4JGJA 1NGWB 1UA6L 1THCA 2VN7A 4K7PY 1PKOA 1X7TA 4DO4A 3L5WB 4HFWB 4NFCA 8CGTA 4E0RA 1SY6A 1TNMA 3FMGH 1A3QA 3OWEA 1J9TA 4V2CB 3VXNA 3KYAA 3AXHA 3I6GA 3HC0A 4Z3TA 3QZMA 4WI0B 4XMLL 3VD5A 2DMKA 5C6TL 3T6QC 2F18A 2WUBH 5JQ6H 3HS0C 3SPVA 3QUYC 4L1SA 1F4XH 1RIHL 5D7IA 2FUTA 2VLME 2E7LA 3S48A 4NN5B 3WEOA 2Y9RT 3ZE0F 1R24B 5JXEC 3QDJE 3RAJH 4LCIL 4MB1A 4PREB 1X9QA 4QHKI 7TAAA 4PBVC 3KXFB 1E3FA 3N1PC 4QRPD 4TUJA 4DEWA 4X6DE 1MAJA 3VH8A 2BDNL 3T3MB 5H37H 3NTCH 2JKSA 4QRQB 1A9EA 5IB4B 3E2HC 4JFFA 2JQAA 4P2RA 3V6OC 4BDVB 3MUJA 4Z5RB 4LSPL 5I8OH 1C12B 3AROA 2MKLC 3LRKA 4P2OC 1A7OH 2G5BB 2GT9B 3ZQXA 4BFFA 4LL1A 2UXTA 4JRYE 1P84J 4ZMOA 4FN0A 4GIAA 3QIWB 5CHNA 4HK0A 5FLUA 2KT6A 3GMNA 4RCAA 2NY6B 1MFCH 5B1JA 4AJVA 3WTSA 4RWYL 4NNPL 3HAEB 5ANHA 1DUZB 3OKDB 3QDGA 1HDMA 3B9EA 5KS9F 3G5ZB 1QWNA 4B50A 2FEEL 2GUYA 3KPRB 4OM0L 4RFEA 1OAYL 1LLAA 2R23B 3EOAB 4NWTL 4Y8AA 3SQBA 3RNQB 3FW6A 1FZMB 4UB0L 4XVSH 4BKTC 4I9XA 1TCMA 3TFKC 4WHTA 3MRRA 1EZSA 3HJ0A 4ZQKB 3GMOA 1SXAA 3D2UB 5DD5H 2CCVA 5LAPA 4M9PA 1FHGA 1U8JB 3EJSA 3ZE0B 1JGEA 5AW3B 4DUXA 3RWDA 1T21A 2G2PA 1JK8A 3E3QE 3BPNB 2YWYA 2YKLL 1NCNA 1KGXA 5ICZA 4ENED 1ODUA 4ISVB 4KKCC 4HKZA 1CZ8L 4JHAL 1U8QB 3DMMB 3I6SA 4XXDA 3LIZH 1PNCA 3IDYC 3KBHE 3VX0A 1NFAA 1AZNA 3DVNA 4J3OH 5GGRB 2J6EH 1KPRB 2VQ1A 2A99A 1YEJH 3OB0K 3GBNH 1A6PA 4GB9A 4WTXA 4EF3A 1YEFH 2RBLA 3WHE1 2YHGA 4TVPE 3CFEA 4D9QE 1NMBH 4K7FB 1E4HA 1G94A 2FZ3B 4QHPA 1OGAA 3O3EB 4UTAA 4AW7A 1IO4C 4NO3B 1JZFA 4HIJA 4N3TA 2KZ1B 5KS9B 1IBFA 5IV2B 5I5JA 5DHEA 4F15C 5FKAB 2C7UA 4L9LA 3CDGA 2CBMA 5IFHH 2GJZB 3SIKA 2AJ3A 3Q5YA 5ESQB 2Q7AA 2PYEA 1BZ9A 1C8QA 1NIEA 1OGPA 3RQ3A 3CC5B 4I87A 2D3JA 2CK0L 4N24A 4EKJA 3IPFA 3L16A 3VFGL 1E2WA 2P5EE 3H2WA 3L5XH 4X42A 3T2PA 2EINB 4LCUA 1XV8A 3L08A 4CBZA 5IWLA 3WE6A 4KVCL 1PQZA 2I60H 1OARL 1YEIH 2YMXL 5ILTH 1XXDC 3DOHA 2J56A 1JWUB 1HIML 4P46C 2NUTA 5KANI 3APNA 3SGJA 3LZRA 3QFJB 2UZYB 3PQYD 3VXOB 3U9UA 1G87A 4G8EA 3GZKA 3GPSA 3ILQC 1XIWD 5HDWA 4DP9X 1MPAL 1XF5A 3KYOB 4FFYA 4KJPC 2CPCA 4PV9B 2C9QA 2A0LC 5L2KE 3OJMB 3QJZA 4L4JA 4KZ0A 4V33A 2NYYD 1F3JA 35C8H 3JWOH 3MNMA 4PW4A 5DJ2B 3RWFA 4J3OC 3FQTA 1AP2B 1PIFA 4OLXL 5DFTA 5IHUH 3T6ZA 3MRFA 3T08A 5LQBH 2ARJA 1URIA 1M7UA 1Q9KA 3CVHB 4LCVA 1H6EA 1A6UL 2HTLC 2YD1A 2HRPL 1QR4A 1KIQA 4QR7A 3WKQA 1J5OL 4GXUN 1MJ7L 3OR7A 3ZDXE 3I75A 2NZ9C 3FU7B 4FTVB 4LQ1A 4MJHA 4I8DA 1PFOA 4PS3A 1YRKA 3R0NA 4R4FH 2VT0A 4NO0B 3NIGE 3RGVC 4HJ1A 3VI4F 1JL8A 4PJXE 1T5XB 1BEXA 3POHA 2VL4A 4S2SA 2FJUB 1BGXH 1MFEH 3W82A 5ACZA 2DQJL 2IXQA 3ESMA 2P7TB 3B8YA 4IK7A 1JAEA 2GY5A 5BRQA 3VYPA 4M48L 4MYPA 4LLYA 4EI6A 1N12A 2YLKA 1UQSA 4YO0B 5BMFL 4N1EA 4A2MA 3QI9A 2UWEA 3RIAF 1FJ1A 3U2SB 4H4NA 3KPQB 1CDYA 5BUAA 2VYRE 1G1KA 2XWZA 2FGZA 4UIKL 3QYMA 4ZXBC 4NRXB 4J3UA 5HGGS 3CC1A 4NUJB 2DQFA 2UZXB 3S9DB 3VGBA 1I8KA 1EMTH 2A6JA 3E8VA 4S1DD 1YVLA 2W92A 5EBMB 1PX4A 1SQ2N 4XNQB 1NBYA 4AT6B 3X1FA 1JNJA 4XI5C 2JQZA 2BNRB 3VI4B 2AJUH 2I5YL 2FGWH 3E0GA 1DBAL 4UT9L 4ODXB 4ZUWB 5A7EA 4Y5XA 2FX7H 1QBML 1CI3M 2C1OB 5LKNA 3QXDA 4H0LC 2VDPL 5I6XB 1KBPA 2JIXB 1U8LB 4WWID 5KSAC 1YMHB 3LCYA 2FBJH 5LN4A 4BHUI 4NM4H 4AE1A 1HH9B 3D25A 1TLKA 5CD5C 1OXYA 4WU5B 3UJTH 1JG9A 1NL0L 4FE9A 1I3RB 2FNWA 1TTRA 3O8XC 1BCIA 1SXBA 2JLPA 5EO0A 4IDLA 1ZK5A 1P69B 4IOIB 3A6CH 3IJ9A 4ALAL 1RSFA 4UTBH 5FCSH 4OKVA 1B4JL 2FX9L 1UWGL 4XP9H 4PI2A 1GC1H 4BQCA 3E9UA 5JLZB 4WHCA 4OSUH 5I66A 4IRJC 2Y06H 4WW1A 4OCYL 3ULVE 1F6AA 5FXCH 1JRHI 3GK8L 1QRNA 4I5BB 3PIQB 1IZJA 2ZUVA 3MNWA 4FULA 5D2NE 4BCYA 2HMIC 3VFTB 3NCYP 4GAYB 4MB4A 5LAXB 4Z7UF 3D09A 4U1MA 1MQKH 1PZCA 3K71B 3OKNB 1DQJA 3O4LD 4JFQB 2VDKL 3QIBC 3QUXB 3VWKA 4NPYA 4JVPA 1D6VL 4HH9A 3GS7A 1AQKH 4DAGH 5H35B 4LCWA 5IQ7L 4HS6A 5K1JA 3HLKA 5IK3A 1KXVC 4U1HA 3KS0J 1SFDA 1FFOB 2C3WA 4NC0B 3IS1X 4HFUH 5AYQA 4ZX6A 2ZICA 4F27A 5HXMA 2HN7A 1A1NA 5BZZA 1T04B 4KRPB 2D31B 4LIQE 3ZR5A 1CT8A 5FO9B 4GKZB 5E8OA 2FH6A 3N41F 5DD6B 1KPUA 2W9EL 4JRYD 5JW4M 2IF7A 1MNUH 3GI8H 1JFQL 3F62A 2IIJA 3QBTB 3MRBB 32C2A 3I02B 1HINH 3GEFA 2ENQA 4JZOB 1DDTA 3MA7A 1A4AA 2TSAA 2JJWA 4BINA 4FADA 4Z7UB 2WB7A 4Q56A 1NM4A 3MCYA 2YUVA 3IJ8A 3LHPL 1OSZA 2H0FA 1YEKL 4PJGE 4JE0A 4WEMB 1CD1A 3FQYA 1MFVA 3CFDA 4HJGA 2X05A 3BEWB 1QUNB 1E9QB 4DKTA 1S7SA 4HS8L 2DWTA 3U0TB 1XQ4A 2DQCH 4XMPL 2GJ6D 4ZYKA 3X3FH 2VLKE 1F58L 4IGBB 3W81A 5ETUB 3EOTH 2JVUA 5AKSA 1IU1A 1D3CA 4HV8A 4M8QB 5GS2H 5J1TC 2OMVB 4Z7QF 4AM0A 1I7UB 3N41B 2CGRH 2VL5A 1KN2H 2Y25A 1ZTXE 1ETJA 1JPTH 3IFOB 4XAKE 2AKRB 2DBLH 5FYKU 3IEAA 2O5YL 4GBXC 2NY2C 4OLVH 2WXNA 3FFDB 2C3VB 3LS4H 4K3DH 4TVPD 5DTFA 2E27H 5JIKA 4D9QD 4R2GC 5I19H 2GTWB 3EW3B 3KXFE 2VJXA 1AQDB 3QDMA 5F1NB 4I89A 3T3ME 4HUCA 4XPFL 4JLRB 4LT7A 4M7LT 1AFVH 2R2HB 4AQ1B 4JQIA 1MW0A 1UH3A 3IMBA 4OIIL 3D30A 2XG5A 5F3FA 5LG6A 2E47A 3P3TA 2A77L 3K5RA 3VD7A 3VYOA 2E3VA 3HI5L 4DN4L 3ZKXC 4AE0A 2ENSA 2C1PB 3DGGA 2EYRA 5HYJE 1JNHA 2VZSA 4ZFGH 1KTBA 3CUPB 4MS8D 1A9BA 1GGBL 3F12A 3QCVH 4MRBA 4PAZA 3WL9B 5C3IA 2C8NA 2P5ED 1DJIA 4G6ML 5IEKB 3KPRE 1R5VA 3FSVA 2H3NA 4L29A 3E6HA 2DYSB 5BS0A 2A6IA 4Z7QB 4KTGA 5AKTA 4AZ8A 4HOWA 1MCOL 1ZT7A 1FL5A 3CN0A 5CEXB 1KLUA 2BVTA 2CHZA 3HE6C 3ZE0E 2VXQL 1I82A 4Y9EA 1KELL 2OMYB 3QR1A 3CFKB 1XF4A 2HFEA 1HNFA 5GZND 1I8UA 1OQOA 3LKPA 2NXZC 1NM9A 4HJSA 2WOBA 4APXA 3MODH 1TOXA 2WWNA 4S1SH 2EDXA 4FP8L 1S7UB 1G1CA 5L2KD 1C1EH 5CEZL 1CDUA 4NUQA 4BQ9A 4NIKB 5G5DB 3FB8A 2N3JA 1P5UB 1S3KH 3REVA 3NSCA 4Y2DC 3AWGA 4WY7L 1YMMB 4OZGA 3ULSB 3WKNA 3IDIB 3OQRA 1NCIA 1OTTC 2NYZA 2WC7A 3PWVA 1PJ9A 4F3FA 5JIHA 3LXCA 5A2JH 4IHOA 1AANA 4H8WC 4NYLB 1SYSA 3RFZB 1QTSA 4CN4A 2VZ3A 3VGAB 5HPOA 5KS9E 1H15B 4L3AA 2E4FA 4A63A 4AMKH 4QRUB 1T66C 1XGUA 3NCMA 1NLDH 4M93C 3V4PB 1E7UA 4MA7L 3LD8B 1SLVA 4LAQL 4NC1E 2C4FU 2JB6A 1J7VR 3CHQA 3BUBA 1OAQH 1ID5I 3RWCB 1ZGLM 2VISB 1NGXA 5FGCB 4JFHD 1RLWA 1IAIH 1OCWH 3KYNA 2ZAHA 2HRHA 2OL3H 4NENB 5SX5K 4IMLB 3HVNA 4OCNC 4OT1H 5GRVK 5EOTB 5E94A 5F7EL 5D2NA 1M9WA 3GIVA 4OCSL 2YGOA 2YD6A 5JW5B 2Q8AH 2A9CA 2B77A 3KPMB 4P57A 5C1MB 1E4XH 3SYCA 2UV3A 5F88A 3A0OA 2YSSB 4G9FB 4FQCH 3ISWA 2H8PB 1LJMA 4P9HH 5BOJA 4K71B 1NCCL 4PJ8A 2BHUA 4JB9L 3TBVA 3U7WL 3QFJE 4ZTPH 4LBEA 4OF0A 4Z3JA 3TTSA 2B8OT 1LL1A 5DZVA 3KLDA 4PTUB 1JK9A 1CBVH 3DJRA 2G2RB 3ARGA 4MX7B 2FT7A 5D1QB 1IX2A 5IVXE 4M5SA 5D6DA 5HTSA 4AIZB 5EF1A 1L6ZA 4GAGH 4PTTA 3ME0B 3BWAB 4JGNA 3O6FC 3GB7B 2Z92B 1GHFL 4BH8B 4R6UA 2I9LA 4DGYH 4Z7VA 1OL0A 2EO1A 3ARXA 4YX2L 2FATH 2I07A 4QHLA 1I1AD 2V5TA 1D7FA 2HZHA 3MV9D 4PLJD 2NY0D 3LXAA 1QFWM 3X1GA 1EPFA 2CK2A 2X4NB 3LKQA 4QRTB 4J8QA 4I2XA 1JWSB 5JR1L 1P2CB 1LE5B 5KVEE 3QPKA 3TFBA 2EXWC 3SDDB 3NRPA 5DVMA 3QAZC 5A6MA 4XNBA 5EEZA 4GEIA 5A16B 3KG5A 3GZPA 4ZK8A 4CA4A 5JA9A 4KKLC 4ODBD 3BVWA 1G9HA 2GITB 3MNVA 3N85L 2B14A 2CAKA 4JFXA 5FW8A 3Q6GL 4HHWA 1UVQA 3DYPA 5E6IC 5B22A 4WV1B 5CBEA 3VWJD 1QP1A 5I17A 3C5SA 2OJEB 2YD5A 4WWOA 4CU6A 2VLKA 2YK1H 5M94B 3PWJB 4UV7L 3NPSB 1Q38A 1NFDA 4IRZH 4JRWA 1F90L 5FCUL 4NJ9L 4U1JB 3BE1L 1YQ2A 1D7BA 1ETB1 1A4JA 1AC0A 5J6HB 2ADIA 5EF3A 4X4XA 1IC4H 1UB5B 1RIVH 5MHSD 1TVBA 3ZKQD 2BNRE 3PDGA 2XOTA 4KUCF 1W8OA 3S96B 1L9QA 3VI4E 4OFKA 4G83A 3K72B 1KYOJ 5GGTA 4Z77B 2X2YA 4ICWA 3D6GA 4JPIA 2YRPA 2AJVL 3QRBA 2EDDA 5FF6B 1FNEB 5HJGA 3T2NH 2OXHB 2WIMA 3TJEL 5I1AA 5E2UH 5D70L 1H9DA 5FOJA 2R8SH 3A24A 3KLSA 3FTVA 3DO4A 4R5TA 4NQDB 4JJ5B 4J4PA 4TUOB 3T71A 2ZXEB 1FCCA 1Y18B 2YPVH 4M6ML 4UANA 5HYJA 2HG0A 5L88L 1TO5A 2DM7A 4BZ2L 4P2QB 4U1IA 1H3TA 1KUMA 1CU4H 2G3MA 4ZUTA 3NFPA 3DO7A 2DM2A 3QHFH 4UNUA 1GS6X 4F9LA 2OCJA 1DQLH 3VFVA 4XBPA 2EVGA 3V4UL 2UUDH 3FAWA 2QJDA 3O9WA 2BHFA 4Q4EA 2XV6B 1BZ8A 3VTTA 5I75B 1VKXA 5CS7A 2Z4TA 5DJCB 1F8TL 1BJ1H 2JJVA 4JY5H 4XC3L 1X5MA 2PPFA 3ABGA 4LXFA 1Q9LA 3EHBD 2GBTA 2B9BA 2COQA 4ZT1A 3N1GC 3CHOA 2ODHA 3FN3A 2JJSC 3W11D 5BRPA 3KS0H 1Y1UA 1CQYA 1MHPH 2BP3A 5MERB 1MSPA 3BAKA 1ZKAA 5CFAA 3AXLB 4MB5A 3MRMA 4HDIB 1U92B 1PG7H 3S37L 3QHZH 4XAKD 1E4JA 1NKRA 5K9KB 2YPKA 4HAGA 3FU6A 3VDAA 3PL6C 4PLKC 4POYA 1EHLH 4D3CH 3IWVA 4Q6KA 3ECQA 3KXFD 1H5BB 4BKSC 4UAOC 5CJXC 4AQ8A 4CU8A 5EU5A 5C6WH 5IOKA 43C9A 5FYJU 1E4KA 2JKIS 3VCLA 4KHTL 2DQTL 4GMSL 4XVUC 4YE0A 4NQXA 4I4WB 1EEYB 4UMSA 1H3WM 5T3XH 8FABA 4XP6L 3QIWD 2BOBB 1BQLL 1N9PA 2ICCA 1ZLWK 3S36L 2NY6D 4P59L 1M6OB 3S4SA 4XOCA 1A1OA 4N2BA 4ODHL 3C2AH 4P5TA 5HDBF 4KQ3L 2WIIB 1W6WA 4B9FA 3ARTA 4O02L 2XETA 5DHYA 3D18A 4FEIA 3KPRD 1QX1A 2WQSA 4HGMA 4ODWA 4Z7UE 1Q9WB 4U6HA 5EHFA 2NZ1A 2AC0A 4RSVA 3VQ2C 3F83A 3I2CH 4RRPA 4MNHB 2B0SH 1KTJA 2I85A 4E9SA 1SY6L 3SE4C 5E5LA 1RULH 3D2UD 2BVPB 3KWXA 1JWUA 2XTSA 4FLHA 4XCYB 5IQNA 3UTQB 3U48A 4X4ZA 3W0WB 5K39A 2AQSA 3FHEA 4LSVH 5I30L 1T3FA 3JWNG 3MBXL 4MD4B 2H7WA 4JM4H 1QKZH 4L5FL 2WN2A 4GRLA 5E8DL 3S35X 4HWZB 4NHUB 3DMMD 3UTZB 3GLEA 5D2LA 5IVXA 4K5PA 3BRFA 5EUOE 2GSGA 5AALA 3QEGH 4G11A 2ZNXA 2FUQA 4E9VA 1T22A 1LQSR 3AY4A 4DUVA 1GIGL 1W0WB 1KXQA 1EZVY 3GMRB 1MVUA 3PDOA 3LZLA 4M5ZH 1TJGL 4QGYA 5DXWA 1WLHA 2MEJB 5HDBB 2V7NA 2A74C 1JGUH 1RUML 3FO2A 4LGPB 3EBHA 5FYKE 2Z8RA 2WNGA 3OG4B 4I1RA 5CF3A 4U3XA 1OOWA 4DOHB 3FRPG 4NIYE 3X17A 2X1OA 4MA3A 3WKYA 3NN8A 4M3JA 1OPGH 3ZRFC 3PWUB 3GJFH 4ZMLA 3MRKB 2F58H 4KH9A 3HR5A 4GRMA 4YSPA 1FZKA 1GSMA 4RNRA 1J87A 3EH5B 1TLMA 2X4PA 3VXRA 1KCSH 3FQWA 4ZDHA 1I75A 4ZXBA 3PXJA 2DD8H 5HHOA 4I0PB 1ZHNB 4Q4IA 4JKWA 1WIPA 1RD6A 2CHDA 1EBAA 5FYLE 4Z0XB 1NQBA 3NK3A 4UOJA 5I74C 2VRAA 4HT1H 4ZMTA 4U3SA 1ZVNA 3W9EB 3Q2LA 2O26U 3L3HB 4HCIA 4IEFB 3VFOA 1RL1A 3QFJD 2VDLL 1MUJB 3EDKA 3QJFA 5JNYA 4N2NA 1NCWL 5BJTA 5A40E 3AABA 1Q0YL 2AJZB 5TDPA 2PP9A 3C60C 4ZAKA 2PCXA 4WGKA 4DCQB 3S8FB 2J5LB 1V3MA 5FK9B 4UTAL 4HUUA 1X7QB 3O8XA 1G0XA 4AC2A 1P1VA 2GHWB 4K2UH 3Q05A 1S78D 2FVNA 4FFVC 3L3KA 1G9MC 3QIUB 3SDCB 4XNMA 2YBRB 5BXFA 1A1MA 3M1BA 4MLSA 1MRFL 2VN4A 3O2WL 4FTVD 1L5GA 4WW2C 4FQ1L 3RIFK 3B9AA 2UVEA 1IGYB 3ZO9A 5DI8A 5AOMA 4KHXH 5AG9A 1FNSL 5J11B 4OJCA 3GNMH 4MQTB 1XGQB 2CM5A 4NO0D 5DHVB 5EBWA 4EJ1C 5I6KA 2IH9A 2EE6A 1J8HE 1A02N 4BEIA 1IEAB 4PRBB 3SE8H 4X8CA 5C7XH 3A21A 4H8QA 3R4DA 3L5IA 2RMNA 5DRNA 2XV3A 1T0MB 3GMQB 4GKSB 1DFBH 2X6AA 1MRCH 1GGCL 3IFPA 3QS2A 4LCCB 4MBOA 3P4MB 5SWSA 4HWBL 3WJLA 5FGCE 4NP9A 1UUSA 3QAQA 5BW7C 5J6SA 5F70A 2CLVA 4L3CB 2CIIB 4Y1SA 3BXNB 1AMYA 1FO0H 3BUIA 3E6FA 2R7EB 1GYUA 1VGEL 2XQBL 3UP1A 1GKOA 1QTPA 3WEXA 2D8KA 1QLEL 2JNZA 3RNKB 5I0YA 3MYJA 2ATAA 1UATA 2HX7A 3LMJH 3KLHC 4FFYL 2VWEC 2PWEA 3D06A 3ROOB 5ITFB 5C07D 1IC5L 3UBGA 1E5YA 4H25A 5DA4A 2WXIA 1DN0B 4GLRI 4F7TA 2P42B 3CN4A 4F8LA 2FO8A 2N59A 3HPLB 2FRGP 4X2UA 3OTTA 4J39A 2BVQB 1LWRA 1S8DB 2DM3A 4Q6IB 3PABA 1PD1A 4Z7WF 4R7DB 5D1QE 2VW6A 2EKSB 5TPWH 3UP6A 3A4AA 4JPQA 3TT3L 1CIUA 1VZHA 3L9EA 4M7KH 3AMLA 4FFWD 1AHWB 1TYRA 2FQFA 3KNBB 3DX6B 4YHOL 1JXGA 1N3NB 2DI7A 2MCPH 1QUPA 2SEBA 3ELQA 1XAUA 4QXUL 3WNLA 2YUXA 4UQ2A 4XBGB 3MZGB 3QXTA 2JELL 4EDXB 1WRFA 4ZO7A 1BHGA 1NLBH 4RFNB 2ADJA 1D6EA 3LYRA 5HI4D 3O6LH 1XF1A 3PWLB 1S9WB 4JVWA 1S7TB 1G1OA 1D5BA 3TBSA 1U91A 5I6NA 1DJSA 3WXVH 1U3JA 2WSDA 5DZOA 1AE6L 2VC2B 3VB8A 4U6XB 3S37X 4HUXA 4YFEA 1BSIA 2XV2A 4JANB 1BBJB 5ESAA 5HVGB 4XN1A 3MV8E 3TBBA 1S9YB 2VW4A 4D7BA 1BMZA 4KK9C 1G7MB 1OAUH 2QSVA 1ZHLB 1ZWIB 4UWQB 5CZVH 5EBLA 1DLHA 3VFRA 4XPTL 4DP8X 2P46B 4Z7WB 4I3SL 4OLUH 2WZ0A 4M1CC 1YEGH 1JHLH 1WZKA 3BRDA 1AGDA 4AYDC 5EUOA 2OQJB 3QUXD 4PYHA 1ANUA 2B1HH 3DSFH 4DGIL 4I0KA 5L6YH 1LO3L 3H2QA 5GGSY 4Y4KA 4XBMA 5JPNB 4XVTL 4MNQA 1NDMA 2EH7L 1V3KA 3CZUB 1IGMH 2W60B 2EJ1A 4UT6H 2XTJB 4WFHE 1CLZH 4QCIA 2EDMA 3TCLB 5H37G 3ZN6A 4ZFFA 1CFVH 1SBSH 3T4YA 3BYYA 4AL8L 4P2AA 4NRYB 2ITDB 4H44C 3PUUA 1H0DB 1MY5A 4N25A 4Y16C 2F08A 1YEEH 5T1KB 3H9ZA 3QXAB 2CE6A 4LHQB 4NQDE 3B9KB 1Z9PA 2EE2A 4IJ3C 2X4QA 1HNGA 3HC4L 3FT3A 4FD0A 5DK0B 1BVLA 3CFNA 3HHSA 1OD9A 4HKXB 1U93A 2GIMA 1XTLA 3E1ZA 3L95A 3RI5F 3SDAD 4IS6A 2VH5H 3EYUL 4FNSA 4OB5L 4P4RB 3UOAB 4MRCA 1DJXA 1F11A 4IYKA 2YAFA 2O5ZH 3FH7A 1UB6A 1NDGB 1YHPA 2LU3A 3EUDA 4JKPL 5ALBL 3RPBA 4HG4J 4HKBA 4W6XB 4JFWA 2QV4A 1KGUA 4B53A 3T65B 3UZVB 2XC8A 1QFPA 1T2JA 1ZDQA 4OLZH 3UZQB 4DQOH 1ZVSB 2R2BB 3SSGA 1MFDH 4BH7B 1PZ5B 2ZSVA 5C0JA 1LDSA 1WBXB 3L17A 4ERSH 4TVPL 3GBDA 5LHDA 2HLEB 1QHQA 3MJ7B 1WFJA 4LPYA 3FCUB 4IRSB 1MCWW 4J3OG 1CFQB 1T4KA 3ARBB 2BOCB 5EZOL 5GRYA 1WD9A 4X5PA 3HC3H 3MROB 1UXWA 3RE0A 2E6JA 1KJ2A 1R34A 1WP6A 5EC2B 4IBVA 1DFXA 1MWAH 3T0EB 2XX1A 1U0QA 2R15A 1XGYH 1MCEA 5EIQA 1I8MA 3LH9A 5I6MA 1BPLB 4HHAB 3ZUCA 4NN6C 4ZFZA 4WGVB 4TLUA 2XA8H 5AVUB 1JHKH 3BZ4B 4YSRA 1J8HA 5F9OH 2O6EA 4K73A 1UWEH 2XN9A 5C0GB 4DEPC 4QRSA 4Q0XL 1N2RB 1SGKA 1XGRA 3BQUA 3PJNA 4CNIA 4Z3FA 1VDGA 5ECGA 3IGAB 4X6BB 3APDA 1VRSA 5FYJE 3R8QA 1PZUB 1U95B 4WI4A 5CJBA 4G7RB 4WKZB 5LGJB 1NIAA 5E9DA 4D0CB 3AREC 3CXDL 5FYLD 4C8XA 4DKFL 3JZ7A 1BM7A 2X1PA 2GK0B 4I18B 1QNZL 1MG2C 1NAMB 4YNYB 4UNVA 1QA9B 5I0ZA 1RXLA 2RB8A 5GGVH 1E6JH 2B4CH 2WXRA 3DARA 3LQAH 2NOYA 4BUQA 2ZZUT 4YE4L 2XN1A 1BZ7A 3VTMA 1N7MH 5INCA 3W0WE 5C0RL 2DQUH 2FWOA 3BFWA 3QEUA 1CYGA 1UD8A 1MIMH 3ARDA 5IFAH 3QUKA 2GSMB 5IJKC 3LB6C 5A2IH 1N5AB 5HDLA 2IGFH 3HCVB 3O6KL 5F6HJ 1ZAGA 1KT2B 2HH0H 2XXMB 3IRZA 4OV6F 5DD0H 1YMMD 4NDMB 2X6MA 1M57B 3L5HA 2BSRA 2IMNA 4B9GA 2ZYHA 1UWXH 2E56A 3NCEB 5CMAB 4MYWB 2WWKO 2YAOA 5CIPH 5SWQB 3EJCA 4JQIL 3SE9L 4EQ2A 1H3VA 3VXMB 1T83C 4JPVL 2AJXH 4QLRA 4YSCA 1QO3A 2XHNA 3AWEA 3QR0A 2LU4A 5HDBE 2V3DA 3HRZC 4PRNB 5I0DA 2R69H 3CH8A 4X0KA 4OGYH 2ZD0A 1S9KC 1JCVA 1TSRA 1Z5LA 4TS6A 2X0WA 5CINL 3WIIH 5DJ0A 4DOHE 2XICA 4F1SA 1RH8A 2WV3A 4YBLC 4X83A 1CWVA 3WNKA 3C09B 1WAPA 3IXTA 5C70A 2H41A 1MY7A 1OB1B 1CE1H 3H2PA 3DUUA 4XAWH 2BNQA 5JDSB 3VNYA 3MCKB 3MV8A 1N70A 1G7IA 4OAWA 4OLYH 2QGEA 2B7DT 3SCMA 1HHJA 3NACL 1FL3A 1RUAH 2C9UA 4MA8H 4N8VA 4HOMA 1BAWA 2OP4L 4M7LL 5KBDA 1L9TA 1JNLL 3WFHB 4X98A 3KPOB 3JT0A 4ZW5A 2J12B 4PGBB 3PGFH 1FYTB 4HJIA 3LZOA 4ZMVA 3FCTA 4G9FD 4L4TA 4LARH 4QAMB 5ESVB 2B4CC 2PO6A 3FRPB 3LQAC 4D0DA 5DQDL 1V27A 4A7UA 4D8PA 5GRJL 1HL5A 3TIEB 1KGIA 1FH5H 5B4MD 2PLTA 3BP7A 3WN5B 2D7PA 43CAA 4AC4A 2HVKB 3U79A 4E5XG 1DBKH 4XO8A 2G9HA 5KVGH 3QC6X 5D1QD 2FYYB 1NGPL 4POUB 3H3PL 4UM8A 4CRPA 2GABA 1TJHH 1FRGL 3M6DA 5ENWA 4DK5A 1IQDA 4KZEH 1NINA 4F33A 3P73B 3WD5L 2H2SD 1VESA 3L1FA 1KDIA 4HOXA 3PUCA 4M6OH 4RMRA 1P53A 2WYTA 3U6XS 4KFMA 3JVGC 5IJVB 1CGSL 1DN2A 1J8SA 3QEHB 3QQ3B 3ULVL 4QDGA 4NPJA 4AV5A 5JIMA 1CGTA 3TZVB 3F3HA 3SDDD 4OLWH 1XF3B 4HZAA 4OCLC 4PB0H 3CMOH 1A4CA 5BQ7B 3VSQA 2ZYIA 3TO4B 4MCZB 1MLCA 4ZUVB 5I0WA 1OE1A 5D93B 1LWJA 1EFXB 4R90L 2HFFA 3UMNA 1QW9A 1XH1A 3UGEA 1EQWA 1A7RL 1AMXA 1ZEAL 4NQQA 1K85A 2GEEA 5AAWC 1CR9H 2EVIA 1UD4A 3C5JB 4W6WB 2BVOA 3ARPA 1OZUA 4LLUB 1KY7A 3FB5A 4DVBA 3WTVA 3WNJA 5LUMA 1YC8A 3ZTCC 1IKNC 1MFMA 2ITCB 3IM1A 1BM3L 1NKGA 3T4AB 1WAAA 3O4OB 2OMUB 2HKHL 1FVDA 1Q72H 3P9MA 4NZTL 3LV3A 5IKCA 3H42L 4AJWA 4K3EL 4LIQL 1HILB 1T1XA 4PVMA 1AXTL 4LEOA 1IJ9A 1MLBA 4N5ED 3VXPA 4XP5H 3LRMA 3KEDA 3CLEL 4WFEE 4QRAA 3KCPB 1NCDH 2Z6FA 5IZ7A 3VXSA 2MHAB 2YARA 2DWXA 4NO2A 4QO1B 4CGUB 3RY4A 3ZHLA 4X4YB 2V2TB 4NKIH 4ORGA 1CICA 2HVJA 3B9DA 5BO1L 4L8BA 4NQDD 1CG9A 3VM5A 3WY4A 3HS0B 3QUYB 1A7NH 2N7BA 3MJ8B 4P2QD 3UAJC 2JKNA 3WJJC 1A14H 3CZJA 4S0SD 1G7HA 2K7PA 4HF5L 1ZV5A 2MTAA 2IFFH 3SKNB 5D7EA 3VA2C 1FVCA 2A9NL 4CSTA 3NJNA 3BVUA 1WIOA 4FQHB 4JFVA 1IQWH 3E2HB 3VG0L 3VFWA 2YS4A 1PD6A 2IPUG 2R1YA 4KJQC 1HH6A 4P2OB 4UQIM 1ED3A 4OGAD 3K7UA 3OZ9H 2WO4A 2OYLA 1LE9A 3BAEH 3K2KA 3PRZA 4KUCD 4Z7WE 3NQIA 4KTEL 3V8CA 1ZTXL 3MRQA 3ZL4H 4P23B 2WJ5A 1Z6JT 4FXGA 4WWKA 3QYCA 4PUBH 4PJ5B 4AJ0A 4GIOA 1QFHA 3MRNA 3BX7C 3G04B 3GPEA 5GGTL 1FA4A 3V7AG 3VFNB 2K6WA 2BW5A 3S3SA 2LE9A 1JWMB 3MRGA 3OHXC 2Q1EA 4AEIL 3KJ4C 3D50A 3D07A 1LEKB 1UASA 5CN3A 4PCTA 2ZYSA 2ZP8A 3OSVA 5SWZB 3DA0A 2EYSA 5DEGB 1L4IA 1GSKA 1YY9D 5KVFH 2VCOA 1Q94B 3AS3A 5C3TA 3KYKH 1JZHA 1E7VA 1RPQA 2XWTA 4N0YH 3WFDL 3S34L 4UM9A 1KCUH 5T1LA 4EVNB 3HG1A 3HI6H 5DQ9B 4OBRA 2DY2A 4KJYB 1UHVA 4AUUA 5DD3L 1O5PA 3BGMA 2J5WA 1MJ8H 1A2YB 3WV0A 2ZWYA 3VRIA 4QRBA 5L7XH 4AKPA 1A6TA 4HULB 1ZS8B 2YQ2A 2FO4A 2ARJQ 3CZEA 3MX0B 4HJJH 4KY1L 4PQXA 3WG7B 5GISL 4J7RA 1RZGA 4YFLI 4FQIL 4F15B 5I2IA 3VQ1C 3P3UA 3C9NA 1SUJA 3EJPA 2H6OA 2XFXB 4J3OF 4WFFE 3W0WD 3WUZA 3ZK0A 3ZYOA 3WY1A 3O0RL 2F5BL 1COBA 3BYTA 3P40A 5C08B 3QZNA 1U6AL 5IOPB 2R0LL 3MZTA 1RK1A 3HZMB 2QQLL 3C8DA 4R0LC 1HHIA 4F8PA 4NBYB 2CO7A 1HXMB 1BZOA 1E2ZA 2H47C 1SMDA 4R96B 4H7VA 2XNAB 2WWMD 1DDHA 2P48B 1AD9B 2CDGB 3E8UL 4M29A 4WJ5B 5FKPA 3ARFA 1M7XA 5DFVD 1J86A 4G8IB 3U2IA 4KDWA 4RA3A 3LEYH 3ZKMC 3T0EE 3CDFA 3T1FA 1A7PL 2R1WA 4P46B 3LN9A 5F21B 3KWWB 3V52L 1NBCA 3L3OC 3NP3A 4N2KA 5INDA 4HPYH 2MPAL 2QR0A 4L0PB 4PG9B 7FABH 4FC3E 4MJ2A 3R1GL 5HDRA 2DI9A 3QCUL 1BD2A 1E9OB 5T33L 4R26H 5AL0A 4IJTA 2CKBA 1B2WL 3ZHDA 1HCYA 5CU9A 1LMKA 1YDPB 5K1VA 3HZYB 4MXQC 4EN3A 1YECL 4YPGA 1ZE3H 3U6XA 3MNZA 3SKMB 4A2HA 3B2VH 2ZUTA 4B96A 5C0FB 4Y5VA 4XMXA 5BRZB 3FS9A 1TU2B 3RYMA 1ZIAA 1E8YA 1BVZA 2IH3B 2NR6D 3BSHA 4FQPA 4XVOA 5CCHE 3RGVB 1HZLA 1RPUA 5I1EH 3Q2WA 4XPBL 3TNNA 2Q7YA 1T1YA 3BZEB 2EDHA 4J27A 1W72B 2BJMH 2BIOA 2G4GA 2ZWSA 3GXMA 4LK4A 5GGSB 1J1PL 2WNXA 3NJXA 4GQ9L 3CVHL 3BD5A 4B5ZA 3QJXA 3OZLA 4BQBA 1QYGL 3MXWL 2QLYA 2YRLA 3MSPA 4OZ4A 1JV5B 2WVSA 4PJHF 4MJ5A 2JMRA 3SDCD 3QIUD 4GW5A 1WT5C 4KPHH 4UU9B 5KVEL 2DYPA 3VXME 2P5WA 2NY7L 4WVRA 3L4YA 5DR5L 4LLMB 3D5OF 4JL1A 4AWJC 2X5PA 1CD9B 5ICYB 3NCFB 2CJTA 1UYWL 4P49A 1JZ6A 1H3PH 1RMFH 1NCAH 2C3HA 4IOSD 1V54B 3ZYJA 2BZCA 4L3EE 3WFEL 5DD1H 1NFIB 1NC2B 3FL7A 3QNZA 1QOKA 2VE6A 2XG4B 4DFHA 2G30A 1XBRA 2VABA 5KSAB 1UFGA 3HZKB 4HIHA 4EZJA 1ZE3C 3VD9A 1LK3L 4JO1H 5GZOD 1SVBA 2UXGA 2FBRA 3S7GA 4OIBA 3KM2A 5EO1A 5E99H 4NAQA 3IXAA 3WIHA 3HMWL 4ODSL 5C0BB 1FYTE 3JTSA 1RZKL 4PJHB 1AGBA 1TFPA 3H55A 1PZ3A 2GAZA 1JHTB 2FHBA 3N0PB 2RR3A 3DYOA 5DWUH 4OZHE 2X9XA 2WZ6A 2DB8A 5I1DB 4DGVH 1KB9J 2DQDL 1MJUH 3ALXA 4LLVB 1EHAA 2UXFA 4IRJB 5DRXB 4YXHH 5IW3A 4WFED 4XN9A 1J9CT 1NBVH 4O2FA 1A47A 4L2LA 4FQXA 3QT2A 5IF0A 1W15A 4I0CC 4JFEB 4F9PC 3KEHA 4HUVA 6FABH 2FDBP 1SDDA 3PGDB 3PJSA 3CQPA 4I3RL 3RB5A 3PP4H 5DJ6A 5GS0D 4KTDL 2XBDA 4L48A 5EZIH 4JJOA 1UGNA 4YN3A 2R0KH 3VMNA 3QIBB 4DZ8A 1CJYA 2X6CA 4WK2B 5IG7A 4LP4A 3HKFA 2DBJA 1F1DA 4ZI8A 2YMOA 5FHAL 5DO2C 2CJUL 5K9JL 4HAKA 5IJBC 3T0WA 3RPIA 1RUQH 2XIBA 1PEWA 4AM0Q 5DJDB 1A3LH 1KLFA 5CCGE 4U1KA 1DLFL 4G3YL 3T5WA 5F0PB 3IF1B 5C71A 3NH7H 1RJCA 3RVXD 4ABUA 4PGDB 3MJ6A 2G75A 2C9PA 2GW5A 2RCSH 2YA0A 1T0PB 5LB1A 3UPRA 1JGVL 1VGKB 1UD6A 1XX9C 2WVVB 3AGVA 4KNQA 1RURH 5ADOH 2IG2H 2AEPL 4JG0H 4BGLA