3PLYA

Structure of oxidized p96g mutant of amicyanin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHGFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline 96 of the copper ligand loop of amicyanin regulates electron transfer from methylamine dehydrogenase by positioning other residues at the protein-protein interface.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3plyA00
1DYZA 4YSPA 3FU7B 2IWFA 2AANA 3TASA 2FTAA 4KO6A 3FSZA 4YSAA 1T5KA 1AZNA 2EIJB 3NSFA 4JHUA 1BYOA 1JOIA 2XX0A 3QJVB 1AS8A 2BZ7A 3QPKA 4N8UA 3D12B 2RACA 2XV0A 4E9WA 1ET8A 3EH3B 3BVDB 3DKHA 3FPXA 1NZRA 5B3SB 1NIBA 2DV6A 3GDCA 1BQ5A 2GBAA 2YXWA 3EF4A 3BQVA 1TKWA 3WKQA 3PAVA 3FT0A 2WSDA 3CDZA 3FSWA 5D4IA 4HZ1A 4DPCX 1KYAA 2X88A 4M3HA 2BP8A 3T6WA 4YSUA 1CC3A 3WNJA 1AZUA 1AZCA 2FT6A 3TA4D 1ASOA 3NJJA 1ZPUA 2YAOA 4UANA 4NAJA 4AZUA 3H56A 1OF0A 5B1JA 1GW0A 4BXVA 4YSEA 4YSQA 3OMNB 3CDZB 2MRYA 2FNWA 1OV8A 2GSMB 3AG2B 1NIFA 2VSMB 2W88A 4QLWA 4YVNA 3ZX1A 5I6MA 1J5DA 1IBZA 1GSKA 4E9YA 1RKRA 1A3ZA 3KW8A 5LDUA 5I5JA 1JXFA 2E86A 7PCYA 4KNTA 3NP3A 5AFAA 3S8GB 1V54B 4YVUA 1BQRA 5I26A 3UABA 3HB3B 2AZAA 4A2EA 2BHFA 3OMAB 8PAZA 2EILB 3WNIA 2H3XC 1NWPA 4G7RB 3V9CA 5AKRA 1GS7A 1CYXA 1TEFA 5B7FA 1SF3A 1PLCA 2R7EB 2UXTA 5IY5B 1PNDA 3EHBB 1WA1X 1JVOA 1PNCA 3WKPA 2CAKA 3X1NA 1PZBA 3X1FA 4E9RA 2IDUA 2EIKB 2BZCA 2GC4C 3RYMA 2OJ1A 1KCWA 1L9PA 4G71B 1E5YA 3PPSA 1GY2A 1FFTB 4HAKA 3WG7B 3OMIB 2VW4A 4P5SA 2MTAA 3CVDA 1B3IA 2XXFA 4G70B 3QJTB 4DPAX 4BXSV 1IKOP 2IWKA 2UX7A 1AS6A 3IN0A 2AZUA 5ANHA 1CUOA 1PZCA 4YL4A 1KV7A 1NTDA 5E9NA 2IDQA 6PAZA 1OCOB 4FAAB 2A3TA 2QPDB 2YQBA 4A2GA 4GYBA 4DP9X 1PAZA 3TBBA 2H5UA 4Q89A 4AI7A 4KO7A 1UATA 2PCYA 1SFDA 1E67A 1DZ0A 1IBYA 2AFNA 3T9WA 2I7OA 3X2QB 4A66A 1A65A 1TEGA 4MFHA 3T71A 5B1BB 4FA7B 2P80D 3X1GA 2XU9A 5I6OA 2OV0A 2TSBA 2QPEB 3NJIA 5D4HA 3QJSB 3SBPA 3AG1B 2J5WA 1IUZA 2P80A 3NP4A 3CVBA 5I6NA 4PAZA 2UX6A 3NJFA 4WTQA 3KW7A 4DP8X 1JXDA 2R7EA 2BP8B 1KCBA 3FS9A 2PPFA 1GYCA 3IN2A 2Q5BA 3UACA 1ZDSA 1NPJA 2X87A 1XB3A 2UXGA 2FQDA 1J9RA 1ETJA 1OE1A 4Q8BA 1A4AA 2FQEA 2VN3A 1ZDQA 1A8ZA 1BXVA 4KNUA 4BK5C 1RCYA 2DWTA 4HHWA 3C75A 4DP6X 5I6LA 4GP8B 4GP4B 1VLXA 1JZEA 1RZQA 3PAUA 3PXLA 1AIZA 1J5CA 4TXVB 1KDJA 1ZV2A 2PPEA 2EIMB 2GHZA 4HCFA 1PLBA 2BP0B 3QJUB 2IDTA 1EZLA 4KOCA 2ZOOA 2WO2B 5TK2A 3JT2A 1MG2C 1ET7A 4AKOA 2IAAC 3CVCA 2YAQA 5TK4A 3ZBMA 3QQXA 4RH4A 1ILUA 1HFUA 2YAPA 3HEIB 1MZYA 3X1BA 1GS6X 3UGEA 3G5WA 2XV3A 2HRGA 1AG6A 3FSVA 1TU2A 1WS8A 3ZDWA 3QJQB 2HRHA 4AX3A 2YAHA 2XWZA 3TU6A 3T6VA 1L9RA 2IWEA 3T6ZA 3CZUB 3ASOB 3S8FB 3NYKA 2BWDA 3CG8A 1KBWA 4UAHA 5PAZA 1SHWA 1PZAA 3IE9A 1SF5A 4AKQA 2VW6A 3H4FA 1SJMA 2GB2A 3UAAA 1JZGA 2EINB 1NIEA 3L45A 3NSDA 1OCZB 4YSCA 1N68A 1AR1B 1FWXA 3IBOA 2QDWA 2QT6A 2VM3A 2XUWA 1SDDB 2HXAA 2FQFA 1ASQA 1IC0A 1E5ZA 3FU7A 3FQYA 3PCYA 2VM4A 3FPYA 4BDVB 4CSPA 2YAMA 4GY4A 5B7EA 1J9TA 2DYRB 5F7AA 1BEXA 1AS7A 2N0MA 2ZWNA 3FU8A 5F7BA 2HZHA 5I28A 4EF3A 1AG0A 2DYSB 4K9JA 1JVLA 4DP5X 1X9UA 3S3DB 4F2EA 1OE3A 1AZRA 2HX8A 1HAWA 3S3CB 4DP7X 2XX1A 2XVBA 3EH5B 5I5MA 4AKPA 1ZIBA 2JFCA 3ABKB 3AZUA 3SQRA 1MDAA 2FQGA 1CYWA 1GY1A 1SHXA 2BO0A 4X4KA 3UADA 4A2FA 3NJKA 1V55B 3NSYA 1WS7A 4BWWA 1SDDA 2W8CA 3NJLA 4NERA 1E30A 4JKNA 1E65A 4BWUA 2CALA 4UF7C 4A67A 2PCFA 5D4JA 2UXFA 2IDSA 5PCYA 3MX0B 1KGYE 1AOZA 1W6LA 1NWOA 3NT0A 2PPAA 4HCGA 2BWIA 1OOWA 1PF3A 2Y1AA 3AY2A 2I85A 4E9XA 1BXUA 1QLEB 2Q9OA 3OM3B 4DP4X 1QNIA 4YSOA 1L9SA 4KO5A 1PMYA 1L9OA 3NSCA 1URIA 1JZHA 3QJRB 1ASPA 4NB7A 2PP7A 3S3BB 4JHVA 3ABGA 1CURA 3N55A 3NJNA 3ZIYA 3WIAA 3DTUB 1NIDA 4G7QB 1L9TA 3U25A 3NJHA 4F7KA 5B7MA 4HCIA 4HIPA 1J9QA 1SFHA 2PP9A 4KO9A 4GXFA 2J56A 1A4BA 2HX7A 5B1KA 1JZJA 5I6KA 2WO3B 2GI0A 3MBWB 4DPBX 2DY2A 1J9SA 2BP0A 4M4RB 2B3IA 4HALA 1I53A 3ABLB 3FSAA 3FYIB 1NINA 4QKTA 2YXVA 2YAFA 1AACA 1ET5A 1HAUA 5B1AB 3T6XA 1XB8A 2IH9A 1FA4A 1V10A 1BQKA 1F56A 3AG4B 1X9RA 4A68A 2B08A 4F2FA 3JTBA 1AZBA 1OCRB 4E9QA 2PPDA 2YARA 4E9SA 1BYPA 2VMJA 2XXGA 5FC9A 1AQ8A 1ID2A 2XV2A 1RZPA 3EH4B 3PLYA 3ERXA 1KBVA 1A4CA 1QHQA 4KNSA 4DP2X 1ILSA 3NJMA 1NIAA 2ZONA 1GR7A 1PY0A 3V9EA 1WA2X 2I7SA 3NJGA 9PCYA 4W1TA 3FYEB 2YAEA 2AVFA 2ZXWB 2HLEB 1M57B 1W6WA 2HX9A 2GC7C 1NDTA 1PLAA 2BW5A 2NRDA 1MG3C 3GXUB 2PP8A 1JZFA 3N2JA 2J55A 2FT8A 1BAWA 1N70A 2JXMA 5I5IA 2VW7A 2CBPA 1XMEB 1NPNA 3ASNB 2FJSA 1AANA 4CSZA 2VSKB 3DIVA 3FQ1A 5B1JC 4ENZA 1R1CA 4YSRA 2FWLB 1BXAA 2OCCB 2QDVA 3GYRA 3WI9A 1KDIA 4BWTA 2LLNA 7PAZA 2XYBA 1WAEA 1PCSA 2DWSA 3H4HA 4A2HA 1JZIA 5I6PA 4E9TA 1AAJA 3TBCA 4YSDA 4DP1X 2CCWA 2TSAA 4L0PB 2CJ3A 4P5RA 1WA0X 4GP5B 1EHKB 3FQ2A 2PLTA 1NICA 2UXVA 1JERA 1SNRA 4W9ZA 4E9VA 2BW4A 2XLLA 4N4YB 1W8EA 1M56B 2IH8A 2JKWA 3UAEA 3AW5A 3X1EA 4YSTA 1ADWA 2GIMA 1ZIAA 1OCCB 5A7EA 4DP0X 1M9WA 4WKXA 1XB6A 3FU9A 3OQRA 4HHGA 2PPCA 3IEAA 2FT7A 5EHFA 3AG3B 4G72B 4ZK8A 1JXGA 2H47C 1YLBB 3PAZA 1GS8A 5AZUA 2J57A 2CUAA 2Y69B 1L9QA 4G7SB 4A2DA 1MZZA 4KOBA 4YSSA 2IDFA 4BDVA 3ABMB 3SBQA 1OE2A 4PCYA 3OD3A 6PCYA 3SBRA
chains in the Genus database with same CATH superfamily
4M03A 3FUHA 3Q44A 3RY5A 3V4VL 3Q06A 1NGQH 2FTAA 4P59H 1CLYL 2WXNA 1U3HB 3JWDC 2VXTH 2EIJB 2FR4B 2YGOA 3LAFA 3D12B 3CVHB 2XV0A 4M48L 4NJ9L 5IVNA 1W91A 5IV2B 1PCXA 1MWAH 1JXJA 4DAGH 1E27B 4N0CD 3RVVC 2OL3A 3B2XA 3S37L 3TJHC 2ALWA 2ADFL 1TKWA 3RWCA 4DUVA 1SJHA 3SKMA 3P77B 2XV6B 4FN0A 4ADGA 4AUYA 2VXUH 1VACA 5C0EB 3LPGA 1Q72L 4FQJL 4GSQA 4JANA 4EDWL 2E76C 3T4AB 1M42A 5IVXE 2X88A 4JN1L 4JFVA 2EE3A 1UCTA 1NL0L 2ARWA 3D69B 1HDMA 2OK0H 1DUZB 1F0LA 1E4XH 3HZYB 1SY6A 5JYMA 1OVZA 4JFFB 4A39A 2FUQA 4OIIH 1NMAL 1WFUA 1K8IB 3GB7B 1F4HA 3SGEI 5K9QG 3QIWC 1ZE3H 2BP5M 4PRID 2OMYA 2UVFA 4K7FA 3JV6A 5C08E 3ZTDC 2QHRL 5DD1L 5DFVD 1IVLA 1OV8A 3H6JA 4BZYA 3EOAB 4LOFA 4WHYH 1LE5B 1MJUH 5ITFB 1UEYA 5GQBA 2AXGB 1FL6A 2FO4B 4E9YA 5EH1A 5GS1B 1ZE3C 3K6SA 4OF3A 3HAEB 2WANA 1CN4A 4WW2B 4Y4KB 5I23A 4OTXH 5T3XD 5J13B 1NA8A 4HIEA 1F2QA 2VMEA 3JZYA 4WI5A 2VL5A 5CU5A 2DM7A 3WEBA 5AFAA 4OZIE 1HYSD 4ZQKB 4G8EA 3ZZQA 3BUYB 5F88B 5KBNC 4GO6B 1ZHBB 1CTMA 1E42A 4TUJA 1DSYA 3WEAA 1PX3A 1I4FA 5B8CC 1IBGL 2CLRA 1OW0C 1XF1A 3V7AE 4BUHA 2R23A 1NAMH 3M88A 2VQ1B 2P49B 2Y7NA 1H8NA 3KPOA 4NKOA 1BIIA 1F3RB 3CX5J 4OFPA 4GRMA 5I8OH 3VO0A 2F1AA 4B9CA 2BVYA 4Q0XH 1VHPA 3BWAA 3LRGA 4MJIE 1OP3K 1TITA 3AWEA 1PZBA 2VR6A 4MZ3A 1WWBX 3ETTA 3HFFA 2FEDC 3MRBA 3EFFA 1KCWA 2ICCA 3DBSA 3I9AA 2C9XA 1OK0A 5EU4A 4AYDC 2VXQL 5F6HI 1U41A 5F7MC 3SYQA 2DQDH 5F9WC 2WINB 1IC4L 2H1XA 2FEEL 3P9LA 4P5SA 4YXLH 3VD0A 4IBLT 3PL6B 4TVUA 4X0KB 1ADQA 2AEWA 1IKOP 2YN3A 3MV8A 4J6RH 3TH3T 3GRBA 1S7QA 3GZOA 4LZKA 2IALA 3NIDB 2JELL 3O3AA 1UACH 4X98A 4GW5B 1PZCA 1U3JA 5D1XB 3BAXA 1YNKL 5E9NA 4M93B 3VB8A 2A3TA 4GRWH 3EJJX 4U3SA 1J8SA 3LZLA 2MTPA 4LCCC 3P73A 4LNRB 3DDFA 1MRCH 1MH5A 2ATPA 1QSFD 1P53A 4QHLB 4W9JC 5DC9B 4YDVA 3ZKXB 3PQYD 3IDJB 1X5HA 2AFNA 1BIHA 3O2VL 1KPUA 1UJTA 3APDA 4MFHA 4HULB 4JFDD 5DZJA 2ITEA 1FAIH 3EBHA 5ISZE 3MLYL 5C0AE 3X1GA 2X4UB 4GUCA 2VXVH 5CSGA 3GS4A 2FIKA 4JN2A 3MRBB 3L3OA 4ZSOE 2VC2L 4ZW3A 3LV3A 5SWQA 5CUSL 1G6RB 1MY7A 1SXZA 5L2KD 1FFQA 1G0XA 2H8PA 3IJHB 3VSTA 4WO4D 1CDIA 2WCGA 3FS9A 5HJBA 4NQXB 2BIHA 4JY5H 3MJ9A 1BFOB 4AQAB 2BDNL 2ERJC 4Q8BA 5JZ7C 2HT3C 4B96A 4LP8A 3MFGB 4GRWB 2AF2A 3BEVA 3LXUX 4ZNEA 4CVUA 4U1GB 3F7RA 2IQ9H 2XQYK 1WVZA 3O6FA 1QMUA 2OR8A 5MI0B 2IH3A 4PGEA 3HN8A 3Q43A 3AY4A 2VMFA 4F15C 3CHQA 4Y4KA 5DRZB 2A77L 2WK2A 2YUWA 3MRNA 5F7YC 4GMSH 2R2BA 1RJLA 3W0WD 1ZV2A 2VTFA 2FL5B 3PV6B 4ZS7L 2GHZA 3CK0L 4HCFA 4O2CA 2D4DA 4O2CB 4ODXB 5BUPA 2FDBP 3DTDA 3GHBL 2X05A 1Z3GL 4HIXL 3TM6A 1EZLA 3IFOB 4TULH 5AYUL 1MLCA 4URKA 1TLMA 5HGAB 2N1TE 3VXME 4AKOA 1CGUA 3CVCA 3D0LB 3D30A 4OI7A 5IMMA 2K6ZA 1UB5A 2WGNB 1S9XB 3VXRE 1ZSDB 3NAAL 3BZEA 3N0AA 3TCLB 3QW9A 3FQUA 4X8GA 2HKFL 4J3WA 4IOFD 2X7LA 3FH8A 2FX7L 3FDWA 4WEUD 1XHHA 1MFCL 4XMVA 3LRSB 4IEFA 2WCSA 5A3ID 1WCBB 3UO1L 2SODB 4NBYB 3KPNB 1AG6A 2WLLA 3BDXA 4L4TD 3GRWA 5FLUA 3QPXL 1TZOA 3G9VA 2JLPA 4JDZB 3R8BB 2R1YB 5FO7B 4E41A 3T4YB 3E38A 4PG2C 3M1CA 2A4ZA 4LRIC 5C0IB 1CE1L 35C8H 3MLVH 4MJHA 3HG1B 2A7BA 3V9FA 2BNUA 5JTWA 2GJ6D 3GKWL 5CN3A 1E8YA 3WKML 4NPJA 1U8PB 1X44A 3EADA 1RQ5A 3F6IA 2W0PA 3KLAB 1IAOB 3QO1B 3H3KA 4JRXA 5AVZB 5FUZL 4H20L 2LE9A 4M6OH 5DA0B 3DA0A 1EWHA 1SF5A 1DN0A 2WBXA 5IMOB 4UB0L 3MJ9H 4YFLI 1KXHA 1XH3A 2AI0L 1OCZB 1E4KC 5KVGL 3EO0B 1N68A 2NY2D 3T0DA 3SE8L 1AQMA 5I19L 3BIKA 4GW5A 2UZYA 5IBUB 2IXQA 1OCWH 4PJBE 1ANUA 1P2CA 2JKXA 2OMBA 2V9TA 3V6OA 4XN7A 4NZJA 3WNKA 2VN6A 4PMEA 4UT7H 1R24A 1KF9B 1WTGT 1SN0A 1XF4A 2R0ZL 4HKZA 4JFXB 4P46C 2YEQA 4L9LA 4DTGH 4QRRE 3C09C 3KXFE 1YEKL 2E4TA 2QBWA 4UTBA 4P3WA 4LF3A 5F6IB 1IIIA 1CLZL 1ZK9A 4M1DH 3IWUA 1QUNA 5E03A 3VFOB 4HG4J 2VRKA 4YGAB 3CDYA 4DP5X 5BZDB 4XNUL 2OCFD 4JHZA 2V7HB 4GKNB 3VWKD 2BSRA 2OYMA 4P2OB 3HLAB 4AGQA 2DL9A 1P5UA 2NY6C 5ILTL 2F61A 5F1KC 2X0WA 2VDLL 4UMGA 1WS7A 1NEUA 4K3EH 4NERA 4BWWA 1U3HD 3W39A 3WFBH 2V3DA 4XP1H 4UIMA 1E65A 7FABH 1G9MH 4F5CA 5D72L 2Y2YA 4A67A 2AQTA 1H6UA 4QXVA 2OPCA 3KCPA 1QBBA 4FP8H 3RRQA 2NOYA 2H4EA 2C9SA 2YLHA 2CCLA 4HS3A 2XT1B 1U36A 3I74A 4PRPB 4E5XG 5JORA 1CTNA 3ESVF 4WI0B 4I0CC 5ICXA 2OP4L 4LIQH 4QYOB 2XA8H 5EUKB 4PRDB 2AV7A 4MRCA 4UB0H 3T65A 4P2QE 3WIHA 5FPIA 3L2MA 2ICEA 4PJ5D 1FHGA 4OW6A 5KG9A 3COOA 4KRPC 4C4BA 2HFFA 1HYRC 3FZUC 3BGFB 4ES9A 5D7JC 1URIA 3ZDZE 1JZHA 3QJRB 5E95B 3HPLA 2PP7A 4B9YA 3JV4A 4JHVA 3OJMB 4XVJL 3RVTD 1DO6A 4N28A 5HJDA 3ZIYA 3QCTL 4NC1C 1NIDA 3N3EA 1G43A 2QPSA 3N1MC 4NKDA 1XGYH 1T5WA 1F4WL 1OQOA 3QNXA 3CFBA 3CWGA 4GXFA 4JFEE 4RVBA 3AC0A 3I6SA 4FYSA 4U4BA 1JZJA 2PW1A 3IDGA 3QFJE 2FAUA 2XWEA 4X9IA 3UTOA 1NUFA 5KVMC 2H9GA 2GI0A 5MERA 2H2SD 5CZVH 1COBA 3MUJA 4MA7H 2AABL 1E2WA 3OAYK 3VVWA 1E6JH 3DROA 3QNYA 3O3BB 1GKOA 4JAMB 3LDBC 1T0OA 5JOPD 1XB8A 4CDGC 4OIFA 3TIDB 1VKXA 3MV7E 4MJJA 1RUAH 4G8FA 3HRZB 3DETC 1INQA 3QA3A 4NP4L 5HHOA 4DF9A 4EDXB 5AYUH 3RKDC 3DMMA 4G7YL 3TFKC 1BVKB 1IGCL 5F9AC 2CGRL 1G94A 1MLBA 1PVHA 2K7QA 4KK6C 4QY8B 4XNZC 3GLZA 3X3GH 1E28A 4HC1L 4HX1B 3HS9A 3OB8A 2W9EH 5MEQB 5D7IF 2EIDA 1PSKL 4KNSA 4DN3L 4ELKA 1NIAA 2I7SA 2IOIA 3D87B 3KPQA 2KLRA 1XF3B 1DLFL 2X44D 3MUZ1 1XH1A 1UH4A 3WY2A 4AE1A 1NUGA 4BA8A 4RQQB 1P9MA 1CK0L 2B16A 1HL5A 1WLHA 5CNHA 1NFDE 1FNGB 2E6PA 3RZCA 2AK1H 3FRUA 3Q7JA 5ECJE 1SJEB 1YYML 5HDLA 3REWA 2J1YA 4K23L 3UH8A 4MYPA 1QLEL 1NCCL 1AQKL 1K6QL 4J4PC 3OTTA 5D7HA 5C7ZA 3AXLA 4B0MB 2AS5M 2P8LB 1BAFL 3IU3A 3PWJA 4AYID 1KTLB 2OMVB 3N1PC 3QI9B 4POYA 3K2IA 1JPTH 2YPLB 4TVPH 5TFSH 3SKNA 4IK7A 5DUPL 2NNFA 4FXGC 4HWUA 3S5LB 1D9KA 4BHUA 3GLDA 4LEBA 1V7NH 3FB8B 3U36A 2Z35A 3ZMNA 4P9HH 2H1PH 1WFMA 2CNYA 1FFNB 4MD0A 1SGKA 2PCFB 4N0UA 3UXFA 4QCIA 2TSAA 3T3PF 4BZ2L 5JHAA 5D93C 3FNKA 1SN2A 2IBZX 4PJXE 4YL9A 2X1QA 4NFDA 2Y5TA 5DJYA 4DEPC 3A21A 1JERA 3T8XB 1DJWA 4GLRI 4OVVA 4QRRA 3NAAH 2IH8A 2Q8BL 4PJIA 4HPHA 3F5WB 1CXFA 4DTGL 1OB1A 5I1HH 1MFEH 2VSCA 4MA8H 3FU9A 3OJDA 3ARGD 4M7JL 2F5BL 1A6WH 3PNWA 2B8OT 3BW9A 1FLRL 3QYNA 1M1SA 4Z76B 4O9HH 3TCLA 3D0VA 1ZLWH 3KVDD 5LBSH 3BKYL 3APNA 4R5VA 2YWZA 3VA6A 2QVMA 3PWNA 4LIQE 4PI0A 4R4NC 4XPFL 1G9NH 1OGTA 4X4YB 4NZUL 2PYED 4RFNB 3GBNH 3T8VA 5TTRA 3FULA 5IQ9A 4Z95H 1RK0B 3TCTA 1RZ8A 1OT2A 2WQ8A 4ABVA 1SVBA 3DIFB 3CBJB 3EG9A 3QPKA 4U3CA 3WIIL 5EOCJ 3TYFB 3FT2B 1QFWI 1TPXB 2UWEF 2QADB 3L9RB 5FK9B 4DAGL 3RVUD 3QUYB 4GKOA 1UASA 4QJ5B 3V2AR 4YBLB 1KTLA 1U9KA 2J25A 2OMVA 4L8DB 5CUSH 1G7PA 4KKCD 4NLAA 3H2QA 3WKQA 1U8OB 1DVZA 2FVNA 3WMPA 4X4MA 4JG5A 4AQAA 4KV5F 4X6CE 2VYRE 4ZW7A 43CAA 3M07A 3N50A 4U6XB 4DPCX 1SJEA 3N1FC 1ZLWK 5AZEH 3RGBA 2XN2A 4K2UL 1K8DB 2X28A 3VYOA 2EXWC 5KW9H 1I85A 1YEKH 3H3BC 4PTTB 3MUGA 2PTUA 3LHPL 1UH3A 3HS0B 3WFEH 3VTMA 3T4AC 5ALBL 3QDAA 5FFGA 1SLVA 3H9ZA 4NAJA 1MELA 4YUEL 4ZO7A 3K1KC 1PLGH 3ECBB 4HX1A 4KRLB 4KAQL 3SN6N 4CGTA 4WNQA 1LWRA 1OT1A 3QXTA 4K0OA 5H94B 2N1KA 4NFCA 3RU8L 3OKLB 1Y6NR 5HHOB 2PO6A 4I8DA 8CGTA 5I6MA 4MZRA 4TTGA 3GXFA 1KUMA 1ZT7B 2HPTA 3MUHL 2B15A 3WGUB 2O5XH 2BCMA 3PDOB 5DJDB 1TVBB 2R69H 1Z5YD 3UABA 1GZHA 4NRZB 2AZAA 2AQNA 5HYEA 2Q8AH 2OYLA 3FCBA 3QZBA 4PWEA 3VDCA 1XV8A 1ZEAH 5IEKB 4P2RB 2J2ZA 4UZGA 5GXBB 1J05A 2WWNA 3FXIC 4G7RB 1R3HA 4DERA 1BZ7B 2R9HC 1RLBA 4EKXA 4PJEA 4X50A 3I9IA 5H2BB 1PJ9A 2K3HA 2NDFA 4M6AA 1H3WM 2YWYA 4OIBA 3Q2NA 4QTHA 1S7RB 2GBTA 5CBEA 4E9RA 1BW8A 1XCWA 1YEFH 3OKNA 5HYSA 1PTZA 3NIGE 1XO8A 3O11B 3OR6A 3Q5TA 5JW4R 2X6BA 3V79C 3PP4L 5EZJA 1GY2A 1EAOA 4RCAA 3W2DL 4NCC2 2Z93B 2VSDA 3TYGL 2NY7L 3CU7A 4QLRA 2E5EA 1R5VA 2P5WD 1IM3D 4YHZL 3QEUB 4L1SA 4XMLH 2UX7A 2YEZA 3WUWB 4ZUWB 4JFUA 3KS0H 3QRGH 1NTDA 5HHOE 1CZ8H 3F83A 2LLLA 1X5ZA 4ES8A 1EDHA 5AQ0A 6PAZA 1OCOB 1INDL 1EGJA 2YFOA 3CPLA 1A66A 1BGXL 3ZYIA 3N42B 2HLFD 4PLKD 5G4NA 4YPGB 3SGDI 3CSYA 2RR3A 3WNNA 1A1MA 4K9EH 2EZ0D 2R69L 4NO0B 3T9WA 1WAAA 1TZHA 1ORSA 4P4KB 4HQQH 5F1NA 2N59A 2ZSWB 3WU1A 1AHWB 2NQDA 4RGOH 5MENB 5FA4A 2WP3T 3N1QC 3RGVB 5F3HA 1ZT1A 1CIUA 3U6RA 1JHTB 1HVXA 3SBPA 3U0PA 2A2QT 3FU6A 4TLUA 3BESR 4G9DB 2QVTA 3KPNA 4WTQA 5IB4B 3E6HB 1C8QA 1BMWA 3SDAD 3I75A 1DBBL 2EE9A 5IBTH 2Y07L 4Y9BA 3UAFA 3M7FB 1CPUA 1AFVL 4DCQA 1YY8B 3U9UA 1RJYB 3WJJA 1ZRUA 3KYNB 5I18H 2VUKA 1WCQA 1MHHB 5GGVH 3DYPA 3B2DC 1JZEA 3FTSA 4YFDB 3BSZL 4XN5A 1ZS8B 3DI3B 3FCTB 3LPFA 4LHUB 3P3YA 3TIEB 5J11C 2YBGA 2CUIA 2GBUA 4R3SA 2CM5A 4BFGA 4OGXH 1I9JL 5DD3L 1DN0B 2V5SA 4LAQH 5IM7A 4GKZB 3WTTA 1GL4B 2BMKB 4JGMA 4OM1H 5HGHB 1U21A 4PVNA 2X9XA 5EG6C 4HQQL 1HZLA 4QWWC 2AEIT 3K81A 1IB5A 3ZR6A 1AOHA 5GZOA 1D5IL 4HLZH 4LVHB 3X3FL 4B7LA 1FE8H 5EUOE 1MIEL 1G7LB 4G8GE 3L13A 4MMYB 1XH0A 3B7RL 2NT0A 3W11C 3G6JB 1MWOA 1QNZL 1I3RA 1EGJL 2XKNA 4WLCA 3C6LB 4M3JA 1QSZA 1KGIA 4UAOB 2D73A 4FXKB 1P7BA 2HJFB 2XWZA 3KYMA 3C5ZB 3QZNA 4YH6A 3UTQB 1FC1A 1HTYA 2BY0A 3QUZB 4HCRA 5FYKL 4FQHA 1ZTXH 3BZEB 3OZKA 1YNTB 3STLA 1W80A 3NTCL 2YIHA 5ESVA 5BRPA 3MCYA 1X7QA 3BT2H 2KPWA 4NO3A 4KITB 5J1TC 4I87A 4NENA 4PGBB 5C0BA 1UXSB 1IFGA 4L4VB 1BJ8A 2I07B 2VDQL 1SDYA 4JFTA 4L2LA 3S36L 4GEIA 3WGVB 4PJDE 1G9NC 1FVCB 2R1XA 1KCVH 4OZGB 1HCZA 4TULL 3HPJB 3FU7A 4N2CA 4OR1A 3F7VA 4EQ2A 1OTTD 4FLHA 3ARQA 5FUOH 1I7ZB 1R5VB 5D2LB 1BDYA 1ZEAL 1LP9B 3GSQA 1LP9F 3OKKB 4QJ3B 3SY6A 4JVPA 1R75A 1MCRA 1X5LA 1KBPA 1IC5L 3D3VB 3OPZL 1NDGA 2HZHA 3RB5A 3QQ3B 5D1QE 4YXLL 4QO1A 2R0LH 2JJTC 4NS0A 4AEHH 1AQKH 1K6QH 1RPKA 4X8JA 2X2UA 1L5GB 4YS4A 4P4RA 4XRCA 4QF1A 3KYOB 3L4UA 2ZIDA 2WKGA 5I5MA 2OXGA 3TFBA 4W9LC 5SWSB 4AKPA 5HYQA 3UGUA 3BCDA 1I4FB 3NFSL 3LD8C 3LPOA 2VT0A 4TQHA 5DD0H 4H88L 4OH2A 1CYWA 5I0XA 1J1OL 2NNRA 4YIQB 4ODVH 1DVYA 2DQUH 5HYJD 2COVD 3P1VA 3QAZC 4LSDA 3TX4A 3QXAB 3VFSA 2YGVA 4IRJD 1W8OA 3U46B 1XSIA 2QGBA 4HJIA 3MX0B 1UXSA 5HHMD 2N7BA 1U3HC 4G8IB 4F33A 1S5IL 4H20H 3BDBA 5DUMH 3VD9A 4N2NA 2WYIA 5CU9A 4NJ9H 4YHLL 2CRIA 4AL8L 1CLYH 4CRPA 5JPNC 5JPMA 3H7BA 5IQ7H 3IPEA 3BXNB 4N2FA 1U6AL 1AMYA 2VDOB 4HPYL 4BFBD 2QFPA 2H6PA 3RA7L 5DMYA 2V17L 4JFFA 1HINH 1JYXA 5F7DA 5HVGB 3C2AH 4RZCB 1HH6A 4GQ9H 2CUMA 4WWKC 4GB9A 2GIXA 1INEL 3B2MA 3DVIA 9CGTA 1L9TA 3SPVA 3NJHA 2NYZA 3QAZB 3RFZC 4WHCA 4OQ1A 3SDCD 5DK2A 2F19H 4EI5B 4NKOB 4GKSA 1T20B 4OI8A 1G1YA 2NY5C 5KVEH 1OGAE 3LD8B 4WWKA 2Y4SA 3O81A 1E27A 5I6KA 3VXQB 3GHBH 4JO4H 2EYTA 3WLBB 3V0AC 4RMBA 2DY2A 2D7NA 3FTGB 3BUYA 2DQJH 1VB9A 1GW6A 1I7TB 5FDYA 2K0RA 2Q86B 4WJ5B 2QPUA 1AACA 5CP3A 5ANMA 1LXMA 3WKMH 5KBKA 1B6DA 1F56A 1HHHB 1ZANH 1U8QB 1BVNP 1JWMA 1PZ5A 3QWRD 1J8HA 1MFEL 3O41A 2HSIA 4JDEB 1E40A 1QFPA 4IRZL 2PPDA 1X5FA 3DRTB 4KK9D 2XETA 4E9QA 2ADFH 1BYPA 4OFQA 5DZPA 1UWXK 5JIPA 2FYYA 5DEFB 4LASH 4FTDA 2Y23A 1DBAL 1QSFA 1U6AH 4MDIB 1N10A 4K7FB 1JN6B 4BZ2A 5C1MB 2PCXA 3GB7A 1ZLVK 3HZVA 4PJ7A 5IJBC 3IAGC 1QSEB 5JHDE 2UZXB 5I74B 3THML 1REIA 1W6WA 4Y8AA 1EJFA 2CWRA 4HKBA 5C0JA 1S9YB 1U8LB 4CN4A 5FV1L 2IAMD 4X6DA 4QRSA 4F8TA 4PPTA 2CDFA 4JM0A 4PJIB 1L9NA 4LQFH 3LJ3A 3MU3A 2O93L 3P77A 3PJSB 1E2ZA 3DUSA 1MHPL 1U8JB 3QZPA 5ICYB 5EEYA 1EO5A 3DJZA 5E8EA 1NC4D 2ZOKB 1FYTE 4NO0A 2ZKMX 4FI8A 2JIXA 5BZZA 4O02A 2P3YA 2QDVA 1HKFA 3W9EB 3K6FA 3WI9A 3ROLA 3O6FD 1P1ZB 1Z66A 1GZPB 1RZJH 3I02A 5M7QA 3RHWK 1UZ8B 1D9KB 1JZIA 1ETZB 3QDGE 3DV6A 5T1DH 4PJHF 4OFYA 4M6NH 2GJZB 2G60H 4ZX6A 5KZCD 3TBCA 4BK8A 5C0GA 1J8KA 2UWEA 3HG1E 4Y19E 4XN1A 1M71A 4MQXD 1VESA 1IAMA 4LBEB 3WIFB 1I3GL 3AXLB 1NMBH 4B6ZA 4AMWA 1LEIA 2Y7LA 3CXHJ 4L0ZA 3WFHA 2HVKA 2IBZY 3L9EA 4JKKA 4BSJA 1U8LA 4DW2L 4MA8L 4FLRA 5JXAH 1DUYB 2XPZA 3ARBD 4XX1E 2DIJA 2ICWI 3ESMA 4JQIL 4JO1L 4XB7A 3KD4A 1CYGA 3TO4C 4F7PB 2WQWA 1HT6A 1IRAY 2C34A 4QXGH 4UNUA 4XP1L 7FABL 2W9DL 3ARDC 3OJ2C 1GMIA 4PB0H 5DI8A 4AQEB 1YLBB 4JM4H 3ZGIA 1QSFB 4WUUA 4GI9A 3N44B 5BNXD 4QMEA 1OSPH 3OKMB 5I1AA 4ZX4A 5MP6L 3RIAK 2IGFL 2WP3O 2Z7UA 4Q6KA 4AYGA 3VXPB 3DRTA 3MR9B 2VDPH 1HI6B 4BJLA 1RUKH 1U8QA 2ADGB 3MO1A 2B5IB 2NPLX 4GS7B 4XI5D 3WBDA 1CJYA 3WO4C 2G5BB 4G8FB 3KNBA 1JJUA 4LASL 2GEQA 2RQEA 3DECA 4Q9QL 2QVKA 4XOAA 5IB5B 1I1AA 4JRLA 2UY6B 2WCPA 4OJAA 4J3OF 3GMQA 2NY3B 3FPXA 3U79A 2VOTA 4FLQA 3C5SB 4HLEA 4MQ7A 3B5GA 1E7UA 4XI5C 2E9BA 2HFEA 4TVPE 2YFNA 4M43L 3FT0A 1T21A 3RNKA 1CFTA 1EXGA 1E9OB 1F2XK 3R7QA 4D0CA 5IFAL 4MXWL 1YMMD 2ID5A 1AO7E 4NQDB 4DGIH 3J2PA 4OF8A 1I82A 3RDTA 3ZJAA 5A43C 4RX4A 2OK0L 2BNQA 4PWJA 3KH4A 4X7SH 1HHIB 2AQPA 2A9NL 3NVQA 3C6LD 4ZMPA 4H13C 3OL2A 1DLHB 2F9BT 4BBWA 1HXKA 2EDKA 4NT6A 5D7IB 3GK8H 4MNHB 1J88A 4Z0BL 1YC7A 2J8UF 1UA6H 5A2FA 1JF5A 5F0JB 2GSGA 4LKXA 5B1JA 1KTRL 5BZWB 5BVPL 3D39A 3C6EA 1BBDL 2MRYA 3GSNB 3D8MA 1CXIA 4HUUA 1LE9B 2A83A 3CNKA 4L8DA 3C60A 2WZ6A 4QLWA 3V52H 1J5DA 4XBGB 4Z7WF 1KPVB 3INUL 3U0WL 3D4YA 2OS7A 3GMNA 3ZE0F 1OOAA 4KNTA 2AEOA 5F2FA 2P28B 3BQUD 1JHKH 2NNCA 1LO5B 1MRCL 1U8HA 3PP3H 3KPSD 4UIMB 5IJDC 1PS3A 1DJXA 2GBVA 4BGLA 2NUTA 5BZXA 4JDTL 1HCYA 4IRSD 2GTQA 1WQVT 1ZD6A 4UT7L 5DZ9A 5ECGA 2WB7A 1GS7A 3BUIA 4S1SL 4LPWA 2J20A 2ZKHL 3SEPA 3BAYA 4F7PA 2KZKA 2R7EB 1UHVA 1NCBH 1ZJAA 3NIFE 4YHIA 4UOJA 4H7VA 1GGCH 1HNGA 3RFZB 2VLRD 4HZLA 4KH2A 4X6DE 4DT2A 3K1DA 2OJ1A 5F70A 1PY9A 4ETQB 3ENEA 2MOVA 4HXBH 1ZCRA 3SYOA 2G75A 2MMXA 2YLKA 4HG4K 4YHZH 5IJKC 2E46A 5FUZH 1JI1A 2Q6WB 1K9TA 2DYPD 2GG1A 2XWDA 1FVCA 2IANB 3DX0A 3QT2A 4Z0XB 3TC9A 4DPAX 2GJZA 3HE6A 1AS6A 2F74A 3RTQA 2BWQA 3S2AA 5FGCE 5IVZA 4MD0B 1GZPA 3AREB 4N0UB 1HL8A 1FGNL 4AEIL 3O9WA 1G7MA 5EA0H 3SKNB 2DWDB 4UBDC 4TQEL 3MOQA 5ICYA 1E67A 4GT0A 3F05A 2E3VA 2EDNA 4XN4A 1PGRB 3D1MC 1URZA 4JX0A 3T71A 4Y2DB 3NZ8B 2XU9A 3OBAA 2NY4C 3V0VA 3VX0A 1U8MA 4YZWA 3EJRA 1S9YA 2O1AA 4OIAA 2ZYRA 5CZXD 1YC8A 4L3AA 3AG1B 3FB6A 5HD8C 1IUZA 4ENEC 3CVBA 1S6NA 2CBOA 3KGSA 3NJFA 4I9XA 2GUYA 1DZBA 4PLJC 4E41B 1JWSA 4MMYA 3ULUH 2C1OA 1JXDA 2KLSA 3ETBJ 3L6FA 4Z7UE 2BERA 4XP6H 2AGJH 1GGIL 3LPWA 1JV2A 1TZ8A 3ZDYE 3QHZH 1J48A 4BFKA 2AQ2A 4HFWA 2DI8A 2VN3A 2DQDL 4JN1H 5DZAA 3TF4A 1WISA 4KK6D 3VG0H 3MCG1 1LHZA 1WD8A 5DRXA 3D2UA 2ITCA 3LEYH 5AVYB 5DMIL 3WL9B 1MLBB 2IQ9L 3GBNL 3LN4B 1NBYA 3BJLA 4IOFC 4NZTH 4JZNB 5HGAA 4NI3A 1AHKA 2B4CC 5EOTB 5J6HA 1P7KB 1UURA 4FULA 2UV3A 3MJ9L 2KYIA 4JBSA 1S3RA 3QRGL 2JLLA 1OAZH 4PWHA 4UT9A 4UTAH 4K4KA 4RMWA 1ZGLP 2L04A 3MRNB 2Y06H 3OVUB 1I9JH 2ENSA 3D85A 4MASA 3T2NL 1NBVL 2UUDH 4FKKA 3VGDA 5CGYC 1KY6A 1NC4B 3QNFA 1IC1A 5TPWL 1I1CA 1UD4A 3LRKA 3RWJB 1HILB 4XB8A 4N8VB 3Q8EA 3AAZA 1NBZA 4Y1AB 5FYLH 2D7QA 2EEAA 2KI6A 4ECNA 3LKRA 5ESQB 3WOVA 4AVIA 5I16A 4OZHB 1T04A 1XF5B 2V5YA 1AI1H 4ADIA 1IE4A 3QWRA 4D3CH 2DICA 2Q2LA 5JPNB 1TU2A 5D2NB 5KAQG 3ZDWA 3UJJL 2JF1A 3ECWA 1QLRA 1BYNA 5T1KB 3ISYA 2OSLA 3BEWB 4LVEA 5TE6H 2EVFA 3T1FA 1OAUL 2NQ3A 3Q48A 4HW6A 1MCDA 1MJ7L 5IBTL 1G4RA 2CR0A 2ROYA 3F6LA 3CZUB 1MI5A 5E24E 1XZ0B 3ULAB 4LPVA 2WUBL 4I48B 5FGSA 4LFHD 3ATFA 1KN4H 4TN9A 3ZZLA 4IBZA 1UD5A 1S4IA 3X11B 2JIXD 2Z4TA 4IBSA 3IDJA 4NZTL 2FH8A 3MNVA 1E3XA 4H8UA 1AXTH 3K2MC 5G4MA 2W60A 2P5EE 4BFIB 3IKCA 4HS3B 1BV8A 3DNKA 3KDMB 4PRPA 1JYNA 1EIBA 1P84J 3TEXA 1IM9A 5DFTA 3MRDB 3FBQA 3LMJH 4H25A 4PLJD 5KVDL 2DZEA 1MQ8A 4HC1A 4AUJA 4LLVA 4R96B 3RX5A 1ZWIB 4Q97A 3L16A 3PL6A 4M7LH 4CSPA 3SDXB 5C9JA 1X6NA 1RV6X 5AW1B 1BEXA 1U92B 3G7TA 4XVTH 1PDKA 3V4LA 3V0GA 3BKMH 2W65A 1DVFC 3CE1A 4GRWE 2H2PD 4ZMXA 2JJUA 2G3ZA 1LWJA 4QTHB 4EF3A 4Y19A 5BOPA 3SGDH 2E47A 4ALAC 2VXVL 2HX8A 1J0KA 3DUHA 1TVDA 4NN5C 3ILEA 4OY9A 1I8AA 1LWHA 4GXVH 5IEKA 3ABKB 1FQ9C 4EI6A 2JJTA 4KTYA 1X5GA 3LSOA 4OSUH 3UADA 1IEHA 3DO7A 2OMTA 2PF6A 3E3QC 5GHWH 4BKLB 1V55B 4MAYB 1OGAA 4LU5L 2DJ4A 2BOCB 2EQDA 2IXQB 4XPFH 4BFNA 2NW2A 4BZ1A 5DJ0A 3BP7A 1U4EA 1TT6A 3CPUA 4PV9B 1F1AA 3HKZA 5J06A 1DDHB 4X83A 4FXKC 3SKOB 1S7SB 2L0DA 5KVDH 3AS3A 2XBDA 4LRIA 1A9EA 1MFNA 2Q9OA 4JKPH 3EOAA 3CK0H 4Z7QB 3WIHL 3F6JA 5F9DC 4OCMC 4HMCA 2EEFA 4GMSL 3I9PA 3IRZA 2X1XR 4KO5A 4HC1H 2F15A 4OFIA 1KSRA 3OLEA 5IMKB 3MAWA 1EUUA 3LNIA 4WDIA 4X9FA 4FXKA 5E5RB 4N5EC 5KYNA 4ABUA 4S1RL 3RJDA 3PXJA 2VR9A 4NRYB 1LMKA 5LBVA 2DL2A 4LLAA 4J3XA 1A6WL 3U7YL 1BBJB 2CO1A 2R8SH 1KJ2H 5E00A 4AG4L 3WFCL 2VLRE 3U25A 4Z7UA 5E1QA 4GFXA 5D55A 3HRPA 4HCIA 1ICTA 1UZ6E 4QI3A 3IU4H 5ALBH 3DK0A 2X6MA 3KZ8A 1VZHA 3ULSB 2VN4A 2C3VB 3Q6FA 4PS7A 5D71H 1TSHA 1TKWB 4RMUA 3KDPB 3RWCB 3UG4A 4UUJA 3SKOA 4XC1L 1ND0A 2NYYC 2BVUA 1R3JB 1V3JA 4H26B 4HALA 1SBBA 3GLAA 3SPJA 3SOBL 4TVPL 1FP5A 3Q5OA 2XWTA 3NFPB 2OMZA 1VZIA 2IMNA 4UTBL 4QJ4B 3EJPA 4OZ4A 3T6XA 4HYTB 1BF8A 2FL5A 4B0MM 3DX8A 2F53D 1D5MA 4KHXH 3VSUA 1A4JA 1MW2A 1U3HA 2JJWA 4PG9A 1OCRB 2YQ3A 5E23A 5IBLD 2AHIA 3L7EB 3BP4A 1HCVA 1AQ8A 1EGJH 1CG9A 2A9NH 4DKEL 3O6ML 3NCJL 1D6EB 1NPUA 1UXLA 1YG9A 2WY3B 1UQSA 4F15B 3MV9A 4G6KL 4Y19B 4WNSA 5AOZA 1V27A 2FBJL 3KPPA 1NDTA 3L3GA 2KZWA 2D4FA 4WTZG 1PDKB 2VXUL 1E3FA 1MG3C 3GXUB 3ZT7A 1KOAA 5GS2H 1G6RA 3RGVA 5BS0A 2IPKA 3V4PL 1N70A 5FHBL 2VW7A 1MCJA 2APBA 4PS3A 4OZGF 3NIDF 3EUUA 2O26U 2NUPB 4EVNB 2WUCH 3DIDA 1UVQB 2VQUA 3DVNB 4LSVH 1IV8A 1I8LC 3CLFL 4EUPB 3CQPA 3UTSB 4HEPG 4ZFZA 4QCIB 5JNYA 3BH9B 4IBQA 1YPZE 2IOMA 4NPKA 1E6JL 4I3SH 2CNZA 3RTQC 2DWEA 4W9IC 1BXAA 4Y1TA 4H1LH 2O6EA 2JH2A 4NC0B 5ILTH 2LT9A 2IO5A 3O2WH 4ZUWA 5I6PA 3VQ2C 1EFXB 3CIQA 4ZMTA 5DJ0B 5KSAC 1OL0A 1WGOA 2IALB 3O3AB 1UENA 3GMPA 4YDJB 3CHXA 3MLZH 1WT5C 4NQCE 1WA0X 1QQDB 3CDGA 4HLJA 3L7FB 4R7VA 1EHKB 1OALA 3U7YH 1DBAH 1VGKA 3Q6GH 2WINA 3P9LB 3TA3D 4L8SB 1AJ7H 4PY8I 2W1NA 4Y5XA 2HLAB 1W15A 1L0XA 4H2CA 4LSSH 5F1OB 5GS0L 5I8CB 5JIQA 4J3VA 1S7RA 1J1PL 4OAWB 2FGZA 1XB6A 4RX4D 3FFCA 1MPAL 4GG8B 3SDDA 3SDDB 2QKSA 3TT3H 4L18A 2KMWA 2PR9A 1JK8B 2L7UA 2A6KA 1QEWA 4G9FD 5DZOA 4LFHG 2XHNA 4GFTB 3BKYH 1MZZA 1G7JA 3AAZB 5EOQH 5FYKD 1KIPA 3PV7A 1E4XL 1INDH 1OE2A 1USQA 2XG5A 4IBWA 4M6OL 1T80A 3FOLB 1G7QA 4P2QA 4PLNC 1JRHH 4Z5RA 3QG6B 2IIJA 3HRZA 3QA3B 2WZPD 5T1KD 1L0YA 4KO6A 1SPDA 3GMPB 5CO1A 2YHGA 3RZCD 4PRHA 2V6HA 3UZQB 1BZ9A 2Q1EA 5TDOA 4A55A 4FCHA 3MDJA 1TFHA 2W60B 1WBYB 3P4LA 5GS1A 32C2A 3CCHA 3VRLF 2YMTA 4R7DB 3KEHA 4RA0C 4ORGA 1DP0A 1T1YA 3NK4A 2AK4B 3EF4A 3MLZL 1NKGA 3LQAH 4OQTL 5FB8B 5E9DE 2WSDA 2OXHA 3CDZA 3PWVA 4WI3A 1WBXA 3B6SA 4WKZA 1AR1D 3O2WL 4X99A 3PHOA 3I3BA 4PRNA 4CADB 1W0VB 4L1LA 1CLZH 3MGOA 1CC3A 3O2VH 3VAEA 4C4KO 1FZOB 4FXGA 4HOMA 3NJJA 4FKHA 5DU7A 3IDIB 4I4WA 1IZJA 2FLRT 5EC2A 3WDHA 1U8MB 2CK0H 3EOBB 1E6OL 4Y16B 3G6DH 2LFEA 2BRRL 3LN5B 5KSAD 5J7CC 3APCA 3LS4H 3L2LA 4N6RA 4YSQA 2OMUB 4HJJH 4Y1AA 3CFCL 3VRJB 3B3IB 4TNVK 4PRDA 3OG4B 1ZANL 2VABA 2FNWA 5C0CB 3QUKB 3SB3A 4Y2LA 4W6XB 2PCPA 3MBEC 4I88A 3V4PA 2K70A 3L4VA 1A21A 3HE6D 3AACA 3LOWA 4JFOA 1PYWB 1W72L 2ZAIA 2RCSL 5I5JA 3K4DA 1QBAA 2FYVA 3ZHFA 1AGFB 3B2VL 3DX2A 4FG4A 1RZIA 4R0LB 3FBKA 3VFGL 4F2ME 4ZG1A 4UUJB 4WFFD 5I8EA 5C0DA 1YNTF 3MBWA 3P40A 2GEEA 3K4AA 1IJNA 2E7HA 3IYLW 5F7EH 3TEUA 5GPRA 5KS9E 3EXLA 4PW4A 3UMTA 4F7TA 2ZPKH 3VCLA 3PG2A 5HJ3B 5AB0A 4IS6B 2VLJB 5F9OL 5F7WC 1JV2B 1RI8A 4M61A 4AVKA 1MFAH 1P5VA 2CAKA 1WAAE 4PW9A 4XX5A 3H9SE 1A6AA 2Q8BH 3R1GH 5I71B 3IDNB 5LGHH 4IKNA 3V6FA 5AD0B 1O6SA 4QRRB 3HIZA 3S35L 3GS0A 2XRAL 5D7SH 4LNVA 2ED7A 3TBYA 1B9KA 5D5MA 4G70B 5F7NC 3ZTCC 4K3JH 1MFBH 3GUTA 2IWKA 2Y25A 3MNWA 4JPIB 4OLVH 4FC3E 2NZ1A 5E99L 3FB8A 4IU2A 2R2EA 2WLIB 5JHDB 1KXQE 3QQDB 4LGSB 5DD0L 2B0SH 4C56A 5IVXB 3SD5A 1CLOL 1SVZA 2ZOLA 3OHXC 4DOHE 4Z7OF 1CMOA 1JNJA 2X3AA 3HC2A 1IBYA 1JDCA 1GAFH 3L2NA 2FECI 4CC1A 2A9AA 2NXYC 2R0LL 4UQ3B 2BNUB 4PSRA 2Q6WA 1T0NB 5J12C 3EGSA 5D1ZC 2EYRB 2CHDA 4G6FB 4UV4H 4UM9B 3HCVB 4QD2E 4X6BA 3OPZH 4NDMB 2ICWB 1QP1A 2PXYA 2CLVA 4ZMAT 4XPBL 1RULL 4M43H 1JZ8A 3GO1H 2Q5BA 5HHMB 3S0PA 4HUWA 5K69A 4ZYKA 4CU8A 1XAUA 3TWCH 3OKYA 4PS8A 3GI9H 1JDDA 2FQDA 4GH7B 5AEAA 1CFTB 1GRWA 5SV3A 1ZSDA 5DHYA 2OJZH 5J56B 1RVFL 2LABA 3CZGA 3DX1A 3UJIH 4LCIL 4EDXA 2O5ZL 4PJHB 4OGZA 2W59A 5CFAA 3BRDA 5DUBB 2EE2A 3L3DB 4GP4B 3STZA 4X5LA 2ED8A 4D0DB 1DQTA 4PJGB 1WWWX 1UT1A 3BT2L 1F3JA 3KDMA 2QKIC 4JUSA 2B9BA 4NUJB 5EO9A 4Z7VA 2WWMC 3TPUA 2B2XH 5J3HD 5BCAA 3JTSA 2VAAA 1EK3A 5IB3A 2R83A 3KBEA 2QV4A 4HIQA 4ODSH 4K5NA 4UILH 5D5ME 3V5HA 3VVVA 1ILUA 2ZOWA 1TJXA 2DD8H 2E6QA 1EH9A 4NIKB 4UIKL 2EDQA 3RUGF 2B0SL 1XZ0A 3TZVA 5C09E 1BFOA 3ZTJH 4WFED 3IDIA 4ATWA 2H1LM 4K71B 3ULVD 4B53A 2J8UA 1UKSA 4MDJA 4KPHH 4BH8B 1H9VA 4RRPA 3WAKA 1N7MH 1OAUH 2P8PB 3BKCH 3ZZSA 4GQQA 4A6YL 3RVUC 4ZUSA 4HHAA 1FCGA 2P7TA 3OJVC 4MJ2A 2YPVL 3BPLC 2BWDA 2E7CA 4IYKA 2QKIB 5EF3A 4AW7A 1A25A 4PV8A 5F7LB 3BWSA 3VXNA 4O51B 1WBYA 4PH8A 4V33A 1JYVA 1JZGA 1UEMA 3VI4F 1ITBB 5E2VH 4PN6A 1S8DB 3ROLB 1JPTL 3EYVB 4Z6AT 4PJBA 5DVPA 5IB5A 4I0KA 1OK8A 4OKVB 4HWZB 2QT6A 3S4SA 2WBJD 1NGWA 4PTUA 4IU2B 1MNUH 1QSFE 5JIIA 5HYFA 3WN5C 1LEGB 1EEZB 2CM6A 4OCYH 3K6IA 4Y89A 3VFGH 1M53A 1FZMA 1CE6B 2FHCA 4ZFFA 5DEGA 3BIAX 4CVZA 2D3LA 5D5MB 2NR6C 1O9ZA 3NFNA 4XP4H 4WEEA 5MI0C 4WWNA 2E9IA 5F7AA 3MNZA 4F7CA 4WUUB 4IRJC 4JO3H 4R4FH 2ZWNA 1QSVA 2A0LC 3OKEB 1TZAA 5TGBA 4NQVB 5I8CA 1WIUA 4MVBC 4F2EA 1MCEA 2TRYA 5L0QB 1MVYA 2O5YL 3MREB 4Z3HA 3ULVH 3OXRB 4N8CH 4U05A 3AZUA 3C2SA 5AB2A 1YEEH 3CQFA 1T66D 1MHPH 2AJYH 2DQFA 3DUUA 3QWOB 2BIMA 2OA9A 4OCLC 1H5BC 4ZQKA 4LBEA 4XP6L 2JJSC 3BIKB 2X1WL 4JKNA 4P59L 1XF2A 2X40A 3CLEL 2W94A 5JMOC 1KYDA 1MKFA 2UWEB 3ZHKA 1RZIB 1FFRA 2P5EB 4GEJA 1TVHA 5GS3A 3NQKA 2ARJQ 1N8ZA 4XAWH 3ZYZA 4EXPX 1ETZA 5EU6D 1KGYE 1CICA 2IGFH 2PTTA 4P0DA 4PJCB 5KSUA 1TTAA 1N0LA 1W6LA 2GIYA 1NWOA 2AABH 4JQXA 3FONA 3S48A 3SHSA 4K5MA 2WQSA 4O02B 3BH9A 2JJSA 4XO3A 3HMWL 1MNUL 1T20A 3W1ZA 2QLVB 1QNIA 3VXUD 2OZ4H 5MEPB 5TF1L 2FX7H 4H8VA 5HGDA 1FDLL 1CT8B 3HZYA 3B1UA 4GQRA 3A24A 4MHHI 2DW5A 3VMNA 1FSKB 1YRKA 4LEXL 1F13A 4HSQA 4JPVL 3VXUA 4HKBB 2KHAA 5TDPA 3GSVB 1TJGH 2C3WA 4YGVB 1FZKB 4PJCF 4Q52A 1PEWA 1D6EA 4J3BA 4KO9A 5E6RB 3MTXA 1DVXA 5IMMB 1S7VA 3OAZK 4LXFA 5IJKA 1QEXA 2WO3B 5B38G 1MLCB 4O02H 2HT4C 3GIZL 3FB5B 2F5BH 4X5WB 2R4SL 3EJCA 4M4RB 4JKLA 1FGVL 2H3NB 4OZ4B 3HHSB 3WEXA 1CI5A 3QNZB 1I53A 3GTTA 2O5YH 5E8OB 2EAEA 1OY3B 1N8ZB 1T5XB 2CRYA 2VKXA 3N85L 5B1AB 1HAUA 2V3FA 3JV5A 2I5YH 1B2WL 2JKTM 2Q86A 3AG4B 1ND0B 2HCZX 3LZFL 3UG5A 1CTOA 1SMAA 2H0FA 1CFNA 3D3VE 3FTGA 2G5UA 3ORJA 4FYTA 3C60B 1MQKH 3PABB 3PGDA 5DD6B 1FN4B 1T4KB 2GFBA 1Z9NA 1CFSB 5JHLH 2H32B 4R4BB 2D9QB 1CL7L 4BFFA 4CC0A 1MCCA 2VLJD 3NJMA 4OZFA 4D8PB 3MLPA 1HZHH 3ZDZB 1FBIH 2GSGB 1ZHNB 1YJDL 4LKXB 3VFUA 2DMGA 5FUOL 2ZKWA 1JK8A 2AVFA 2ZXWB 4NT6B 1QOKA 5D7IA 5FA3A 1IQDA 4F1ZA 4X0NA 1YZZA 2BC4A 4PR5B 2OSWA 1ZMYA 4XH2B 1UA6L 4M7ZC 4UWQB 1KG0B 1UG9A 2FJGB 3N2JA 3IAPA 4OUUB 4WHTB 2F7RA 5IUCA 2DTMH 4DUWA 4HAGA 4PJEE 1A6ZA 1FZMB 3IMRA 4NGHH 5F7UA 1PKOA 2EEXA 5BQ7A 5GZNA 3CD4A 4K3DH 4GW1B 2GTZB 2WWOA 5D1ZI 5IQLA 4ENZA 2P24A 2QELA 1DDHA 1HHKB 3BD4A 4MB3A 4U3SB 4L4VA 3EDDA 2VLKA 2BSEA 2XICA 3ARYA 4PJBB 4BQCA 4BWTA 5G55A 3D7PA 5AUMA 1G9NL 3QH3B 2GAZA 3GSRB 5ANME 3WN5A 4J3OH 4PJ9C 3RL1B 4XE5B 4L4VD 5DDHB 1NEZB 1AHMA 3MOAH 3BN9C 5ERWA 1GOHA 3PWPA 3QPQC 3FQ2A 4YIQA 2UXVA 3EAKA 4J27A 2BVPA 2DYPB 4GSXA 1OB0A 1BF5A 3IMWA 3VXMA 4PRHD 4L1TA 3ZIMA 3HMXH 5IB1B 3R19A 3HG5A 1KIUB 4AVJA 1QA9A 1NDMB 5EF2A 2FT7A 4YDKL 5IG7A 5IG7B 5AW5B 2Z8SA 4YPJA 4A04A 5IVOA 3SE6A 1IBGH 3FMGL 4W68A 5AZUA 2C1PA 3JWDH 4N2GA 1JRHI 1K5NA 5CSBA 4HZAA 2D0HA 2WKLA 4GPVA 3SYAA 3VWKB 1AD9B 3WMQA 1ZHLA 3R1GL 3L8QA 3L3KA 1RZ7L 3QFJD 1FVDA 3LZPA 1PG7X 3DRQB 3BE1L 3F12B 4TNGA 1KJ2L 3FU7B 2DM3A 4XB3A 4LLYA 3BSZH 1RY7B 2BZDA 3TJHD 3RWFA 4GT7A 4GAYB 3ETBF 2BFVH 1PG7W 1B9ZA 4YOKA 5I1KH 3L9BA 4H5SA 4B9PA 3BRFA 3IB4A 2NTFB 3LZOA 3L5XH 1FNHA 1GSMA 1KV3A 4PJGA 5C0BB 2M8XA 3ZTNH 3FQRB 1A0QH 1X7QB 3B34A 1ET8A 2OMXA 2X4OB 1NIBA 3ZE2B 5I2IA 2QQKL 5DF0A 4ZXBD 1BVZA 1U8JA 1YY8A 1PJWA 2CPUA 4R5XA 3HUJA 4X5XB 3HG4A 1A7PH 2CDFB 5IFAH 3CMOH 4OUUA 2HB0A 5FM4A 4APQD 2PYEA 2X4QB 2B1OA 2V5RA 5TDPB 2E75C 3BLPX 2R51A 3KWXA 5FYJH 1B0RA 2VDRL 4WHYG 1KTDA 3UPCA 7CGTA 2YPKA 3QJZA 3MXWL 3S8WA 1LMIA 4ZUVB 4UT9H 4I0PC 2WQUA 1CFSA 5T33L 3Q3GB 4DGYH 1IBDA 1XGPB 1GH7A 2OJEB 2KUTA 4FHBD 5EBMA 5F6IC 3N41F 5A16B 2LQRA 5ENWA 4MXQC 2WVTA 3KLKA 1ODAA 3QUXC 3LQAC 1CFVH 1HHHA 1KTJA 1PZSA 2XY2A 3B37A 3CSTA 5DWUL 3HKFA 2JB6A 5JHDA 1BREA 3G04A 5KS9B 4PV9A 2P5EA 3KW8A 3HHRB 3VDAA 2Z31A 4ZMVA 5BPPA 2Q87A 2QMJA 4BSWA 4NQEB 4HKXA 4OT1H 1FV1A 5EEZA 1V54B 2ZG3A 3RWDA 2FX8L 2AQRA 5IQNA 1L3WA 3QIBC 4B60A 3TTSA 2VQTA 4RISL 5B8CA 5HXMA 5B3NA 2P5ED 1Z7JA 2QSCH 2WM0A 4FABH 4YLCA 5JYLA 3BJ91 3LSOB 3QDHA 3F64A 1IC7L 2BOBB 5GRWA 1T2QL 3OR6B 4F2MA 3WTUA 1TEFA 4IRZA 2GK2A 3NGBC 3MACH 4TUOB 5DMJB 4AQZA 1PNDA 5LN4A 1TCMA 3WKPA 2QGDA 5AZ2L 2DN7A 1ZHKB 3IVKA 3NCYP 1UM5L 2F58L 4IQHA 3TBVB 3VXUB 1XR9A 2EDBA 2CPCA 5DRNA 15C8L 1CVRA 2A74B 3PUUA 4RAVB 3QUMA 4CVZB 5HGDB 2JKJA 1N7ML 3QDJE 4I2XA 5E4EC 2FGWH 2HRPL 5CBAB 5DTFA 2ZZUT 4LLVB 3FJTA 4R96A 3CAFA 3T08A 5IP4A 4FG0A 4JPWL 3LRLA 1WUNT 4YEEA 4LPUA 4MZIA 3VI3A 1I85C 2BRQA 3AT8A 4H25B 1NCNA 2CO3A 2RTTA 4JFOB 3ZKQD 2YQBA 1EMTH 1PLGL 2HKFH 4NQTA 5F93C 4IKIA 3V10A 4EUPH 4QRPE 4MXVF 1KBGH 3IBEA 3RY4A 3VFSB 2YEZB 3S3JA 4Z7WB 2MOGA 4LO9A 1VFMA 4YHLH 1NCDH 5JW3H 5L2KA 1RZGB 1JNLH 4LEEA 3MRRB 4H8WL 4XWOC 3QRFM 2YD6A 4HD5A 2BX5A 3VUAA 5F96H 3F04A 3RFZA 3UERA 3KYOA 1CGVA 3NP4A 4PAZA 3ZL2A 5A6MA 2UX6A 2LFGA 3V0DA 5CWSA 5T33H 3QORC 4DP8X 3QHFH 4OLUH 3QUXD 4ZD3L 1NCOA 4AYBA 5AKSA 1DCLA 1YEEL 1RZKL 2YBRA 3CFKB 3FO9B 3OMZA 2R0ZH 3FQWB 3QDGB 5TE7H 3PHOB 4OZIF 2PWFA 1U93A 1XT5A 4M62L 2G4EA 2UXGA 1JGVH 1KJMB 1HYSC 4J3UA 4XTRC 5KVGH 4XXWC 4PRAA 1F8TL 2AK4A 3RJQB 4DSYA 4P2RA 1EXUA 5IB3B 2VAAB 3D34A 1UWEL 3M17A 2ENJA 4A7VA 5AW0B 1QG3A 3TOPA 3WTXA 4FFWD 1TMQA 1URLA 1HQ4B 3SDDC 2AVGA 2Y7MA 4MNQE 4AXWB 3G5ZB 2VDNH 1CDUA 3FFDB 3QJFB 3QUMH 3TO4D 3VFVA 4F8QA 3Q05A 1LO3H 5IFJB 3MRJB 1K4CA 1BJ1J 1RUAL 3L3DA 3L54A 3X13B 2PNDA 1OGTB 1QTSA 4B41A 4X7FC 4NN6B 2YJLA 2ADYA 1BM7A 1NC2A 2H7WA 3FOLA 1ZJBA 4JFQB 4XPHH 2AXWA 4FRWA 3ARBA 4HJSA 3ZBMA 1QI5A 3RIFK 3WFDH 1BHGA 2J73A 4ZUUA 2P7TB 2F5AL 3EO9L 3MYJA 3G5WA 3NCWA 5T1JA 5DVNA 2XQBL 4J8RA 3MROA 2DLEA 4FI7A 3SY0A 1FPTH 3CC5B 4H8HA 4DKFH 2APXA 4HPYH 1DFBL 1X5JA 2A6JA 5KBMA 2F53B 2WLHA 4WGWB 1DBKH 4L8SA 3QCVL 5C9KA 1YDPA 4KKRA 5I15L 3QCTH 1I8MB 1OGSA 3BIBX 5LAXB 4BELD 3X12A 4HIIB 1G9HA 4AGOA 2YEVB 3H55A 4JMXA 1BJ1H 3JWNC 3VFWB 3VXSA 4HCRL 1JE6A 1HNFA 2CU9A 4XWOD 5HDBB 5HDBF 2DPKA 1G7IA 2Z35B 3C8KB 2BVQA 3Q8CA 3QULA 1O6TA 4PRIE 3F62A 1E9QA 4UTCA 5C08D 4WTZA 5F7EL 4G8GA 1EAPB 4ODVL 1IGIL 1PQZB 4I3RL 3FFCD 2V5MA 3K0YA 3MN8A 4UQIM 4Y2OB 1XGUB 4D2NA 4PJAF 2ADGA 3ZDXE 3BP6B 4ZFZB 5JNYB 5DK3A 4FQXC 4OBSA 1E5ZA 5DHDA 3EUDA 1H0DA 4TL4A 2QQKH 4P05A 3U4BL 3V6ZB 2YAMA 4ALAH 3OGCA 2OQJA 4L5FL 4PJ9D 1KULA 2DLHA 3ZOAA 2M1KA 2C3HA 4G6KH 1Q9WB 3G6AA 3H53A 4KUCF 3ARFB 3U30C 1QI4A 1TEYA 5AVRB 3GMRB 2NR6A 4G11A 5I28A 2XNAA 2DYSB 3FW6A 3GXMA 3X3GL 3WHE1 3KPRE 5IFHH 3L4ZA 4TUKH 1YO4A 2BY3A 3ASWA 4ZMNA 3LH8A 2XX1A 4GXVL 1R6VA 1TZIA 4C54A 4MSWA 4FXTA 1ACCA 3UBXB 2H26B 4RMQA 4I9WD 4POZD 4Y88A 4BINA 1M71B 4PU2A 1J12A 4FJYA 3PIQB 2ZSWA 5AENA 2VDPL 4UDTB 2WQRA 3QEGH 1H0DB 2G3MA 3DV6B 3HBQA 1U8IB 1SJVA 4Z7QE 5JLZB 3HJEA 5D4JA 4JKWA 3UJTL 3QEQE 4JAMA 5ISZD 5E4IA 3CZNA 3POHA 5IMLA 3LHAA 4ZDHB 2WLIA 3MV9D 3CZSA 1T7VA 4GOSA 3QUKA 1VJSA 4XMKL 2I85A 3PJSA 2AKRA 3P11H 4ONHB 3LKNB 3OM3B 5L2KE 3RPIA 2DQGH 2Q10A 4U1MB 4FGMA 5DQ9A 4L3EB 2X6AA 4XZ4A 3QYCA 2EDMA 4NM4H 2VLMD 4J3OC 4KJWC 3US0A 4NKDB 5ABZA 4BH7A 1EBPA 1YDPB 2CZNA 4KKAC 1WFNA 4U1NB 4MBOA 4JFDE 3MGOB 2KBGA 2VDQB 4Y9FA 5EF1A 3QZLA 4UOW1 1JI2A 3B6SB 4G5ZH 4PJEB 2FRGP 1CDGA 2PP9A 2K8MA 2NX5E 2KERA 2TAAA 2EH8H 3C08L 3P69A 4PJBF 3ARUA 5KEZA 4FQIH 5F3BB 2X2YA 4NQCA 2BRRH 5B1KA 2Y1VA 1SXBA 4KTEH 1M4KA 1L3NA 1J1XH 3MBWB 3MJGX 4WK0B 4OTXL 32C2B 1VIWA 3FUMA 4K3EL 2YN5A 3MV11 4B27A 1CQYA 3ABLB 1TVBA 5ETUB 4MMXB 3O9WC 1HHGB 1DN2A 4WJ5A 5T1LB 1KELH 2G5RA 4CMHC 3F01A 3SSGA 4OJYA 1ET5A 2NW2B 4NO2B 4AIEA 1TG8A 3ZW3A 5F89B 5TQ2H 1C7SA 4Y4FC 4P23B 3RQ3A 4FCAA 1TLKA 3X14A 2YARA 4QXUH 3W2DH 2C9UA 4PGCB 4WSGA 4KRPB 5IJCC 3S35X 4WK4B 1I9IL 3IKKA 1SBSL 2G60L 3N5AA 4OJCA 1PIGA 1D5BA 2WYTA 2DB8A 1WA2X 5L4FA 4ZOEA 3V7MA 4Y16A 1NAMA 5GGUB 5TF0A 4ZMQA 5H4ZA 4MJ6A 2DLFH 3PQYB 5IJVB 1C1EL 2GJ6E 4JE0A 3IFLL 3BGMB 4YN3A 4AEFA 1F4YH 4P5TC 1BQLL 4GRLC 4J1UA 4DK3A 4HJTA 3V4PH 5EV7A 3HFML 2Q3ZA 1EEYA 1HSAA 4GG6A 1MAKA 2H6PB 2J55A 3C5ZD 2GCYB 1P6AB 4L4TE 4BKTC 5ICZB 1S7UB 1LDPL 2PXYC 2VDOL 3DVFA 2PYFB 2EIZA 4RGNE 3REVA 3IAQA 3W38A 1DQMH 4G2AA 3QP3A 1ZV5A 5CJ8A 3ULVF 1R1CA 5CZVL 2D7TL 3QARA 2FSEB 3DSNB 4X7TB 5DJXB 1I1YB 2ZUQB 3VH8B 2O4EA 3C5JA 4LDCA 3MODH 4V1DA 5I17B 3I02B 3CZLA 1NOLA 5I9QC 1Z1WA 1DANT 1GGUA 4J2XA 4DP1X 3BZFB 3POCA 1A14H 1ES0A 2DEWX 4QRRD 5INCA 5TQ2L 1LK3L 4AENB 2QGCA 3T0EB 5CEZL 4CMMA 4RRPM 3LXBA 4JG1L 3QO0A 3K71A 1P6FA 3BLKA 4TRPL 1OAKL 2YMOA 3PIQA 4YLQT 2OXGB 4XNYL 2CA3A 3IXTB 2G2RB 3SE4A 3RBGA 2R1YA 4GMTL 5A40E 3I84A 3NQIA 4P2YA 1X5KA 2VJXA 1BM3L 2ORBH 4G72B 3OJDB 3DX9A 4HGMA 2V33A 1NGYA 5I16B 3ME0A 5DJ6B 2Y69B 1JGEA 5LCVL 1XR8B 3A0OA 1CG9B 4K73A 4KFMA 3S96A 1NCBL 4FNRA 1IJ9A 5DRWB 3HTLX 3BD3A 5E51A 5C6TH 1D9KC 1NC4A 5D7IE 1VGEL 4JGNA 1JGDA 3DX7B 3LEYL 2IWFA 4IMKC 2DM4A 1A6VH 1M1XB 2JKSA 5J6GB 5LN8A 5GSRB 1H15B 2WVVB 3VNYA 2HMID 2X53A 5JIMA 4QXTA 4S0TD 1BYOA 1UFUA 3IDYB 3DV4B 3L4YA 5BV7B 2XX0A 5CINL 3G04B 5LXVA 5DS8B 1KB3A 5DJZB 4JZNA 3IDUA 2FJHB 2H1PL 2BY2A 3MRFB 3F7QA 2DV6A 4ELME 4Q2ZA 1N4XH 4PCTA 3BEVB 4XNZB 2Z1PA 1FNSH 1R5WA 3UTSA 5JW4Q 1F4AA 3DPDA 1IAOA 1TQWA 1DQKA 2VC2H 3MA9L 1YEWA 4CL7A 1KYAA 1YAIA 1T22A 3FRUB 1OEZW 4R26H 1U0QA 4XXDA 4JRYE 1WUZA 3SKJL 3SPVB 4HDIB 2DI9A 1GCYA 1QZ1A 1CD9B 2XACC 4P5TB 3ZHDA 4EBQL 2A4EA 4O00A 1AP2A 1IGTA 4BUGA 3QR0A 3U1SL 1JG9A 5HGHA 2Y1ZA 3EF7A 4D9LH 2H0PA 3AMLA 3U2IA 2R1WB 1A7QH 3HUJB 1EFQA 5H37A 3RVTC 1CD1A 3S2CA 5GGQL 3TO2B 3D50A 1YN6B 4QY8A 4YDVB 1N3NA 5EPMB 1P4BL 3CSBA 1NIFA 2XVKA 1T0MB 4QRFA 3US9A 5CD5C 5CP7A 1NC2B 3ZYJA 1DEDA 4CU7A 4XCFH 3V6BR 1CR9H 2YGQA 4A6YH 4BSVA 1IT9L 1WWCA 1WK0A 1JDAA 1WRFA 1AE6H 1UWGH 4D0BA 2XG4B 4ACPA 3ZTNL 2OMZB 1KFAL 2R2BB 5GRXG 5FF6B 3SJVD 3EOTL 2JJVA 1CLOH 4HWNA 1F45A 2O6CA 3VXSE 4AC4A 4XHJC 1A0QL 5HDQL 4X8XA 4EZMA 1YEDA 2CHNA 2EH7L 3NRPA 4IHOA 4MD4A 3P11L 3RWGB 5I75C 4AJ0A 2NQCA 5KUMA 2H3XC 4R84A 1T2QH 3GF8A 3IS1X 3DJ9A 2DQIH 2X1PA 3ULSA 2F54D 3ME0B 5DJ6A 1DFBH 1HXYA 2NNAB 5E5LA 4KI5E 4AM0A 4BE6A 3HRZC 1TDQA 3L4WA 4ZSOB 2JE8A 4Q7DA 2Y6SC 5DD3H 3FQWA 4D7PA 4WW2F 3BWAB 3SZKC 4G6AC 3JWNG 3TBTA 1U8NA 1LILA 4HMEA 1FNSL 3RKPA 4JRYA 5CD3B 1KFGA 1NGXB 3LDBB 3P0YH 4B95C 1TQVA 2ITDA 1U92A 3ZPDA 3RWIB 3QQ4B 4KWUA 4XOCA 4TKWA 5IB1A 5SWQB 1G0DA 4DKAA 1P4LA 2BJML 4OSUL 2I25N 2WXQA 1XFPA 1HCFX 1AZVA 5IW6B 3GSQB 3MRIA 1N5AA 3CVDA 4U6VH 1BSIA 4YDKH 4LP5A 3DGDA 5G2NA 2J44A 2F18A 3B9KD 4BXSV 2EDDA 2DLIA 3EH1A 5E4OA 1E4JA 5EUKA 2V2XB 1X5YA 4X5PA 5D70H 5M94B 2CSPA 4U1IA 1XIWD 3SE9L 1ZLSL 4KY2A 4KROD 1O6VA 1CR9L 4LPXA 4AYEC 1V05A 4Z7VE 2EVGA 4KQ4H 1QASA 1PAZA 3H3PL 4MMZC 4L5FH 2AC0A 1LE9A 2GY5A 2DMBA 4JFEB 3AWFA 4XCFL 5GISH 4M4PA 4FL4C 5FO9A 4ZS6D 2N7SA 3HG2A 3MRLB 1T7YA 2PO6C 3HR5A 3DO7B 1JPFB 3FCSB 3QUMB 5JOFB 1YMME 2WLYA 3ESOA 4WHTA 3ULVL 3EYQD 3APMA 3WLWD 5D2NA 1PL3A 4NRXA 3S37H 1RZKH 1KCBA 2BC4B 1B0IA 1Q0YH 1XEDA 2JCWA 3FZUD 3G6JA 4PJ5A 4PR5A 5DURD 4HCRH 2ZCHL 4NNYB 4YDLB 1XB3A 1J9RA 5SX4I 1G9EA 4GRLA 1JF6A 1I1AD 5CM1A 4I3GA 4MLIA 2CLRB 3M1OA 1T1WB 4W4OC 4BK5C 4J5VA 2DWTA 4TUJB 2EDYA 3OQ3B 5IM7B 3LNDA 5F8RC 2E4FA 3PDOA 1CFNB 4RWYL 1SEBB 2RIKA 4ANUA 1FV1B 1NMAH 4CKVX 4D0BB 4BE5A 5FKPA 3GRWH 3MRDA 4H0GA 1TF4A 2PO6B 1AGBB 4LLMA 1O0VA 1FHNA 2BNQD 3QNZA 2ZOOA 3KPLB 4LSPL 3VWKC 4IRZH 4XP5H 2WO2B 4LB8A 5A16A 3C9NB 4JR9H 3LRMA 4R9HA 4X5WA 1FGVH 1MHHA 4FA8A 1MHCA 3AFLA 3FHQA 3KG5A 3LMJL 4R83A 2DJSA 1FZJB 1QPKA 2IH1B 3KJ6L 1JTOA 2FJFA 1MZYA 2WNKA 3CFEB 3WS3A 5HHXL 4DCQB 1PU0A 3HG1A 5JXAL 1TCRB 4PJ8B 4PJ9A 1JUFA 5T3ZL 2RJMA 3GXPA 2VRAA 1ZVHA 1Y18A 1K2DA 2XFXA 5MHSD 3KXFB 3T0ED 3CXDH 4DNLA 5DT1L 3EFDL 2DH3A 2X38A 1I8IB 3GZQA 2WZ5A 2P44B 1KTBA 1QLFA 2YR3A 4AV0A 1T1XB 3ATAA 5TE7L 1UFGA 3GKWH 1INEH 2LAGB 5EF0A 3JYCA 4JCWA 2FATH 2ZXAA 5DJCB 2VITB 4OJFH 1ZVSB 4P4KA 5F1NB 2J12B 3F00A 1N6UA 4OT1L 4RMRA 1OT4A 4MS8C 5H35B 4OI9A 1GGIH 3PNRB 1D6VL 5LO7A 5DJZA 2YRLA 1KCSH 1JWUB 3F3HA 1HXMA 4QXWA 4TSAH 3DIFA 3UAAA 3ZE2F 5INDB 1TUPA 3WNMA 2D31B 4LL1A 3PV6A 4NQSB 4TLTA 3IJYB 3MOBH 3GRWL 3B9KC 4GXUN 2YS4A 2ZX7A 3NRFA 2DDQH 2WNWA 1IGYA 2N7AA 2XA3A 4HJEA 4LEOA 3PWNB 1Q90A 1JPGB 3AXHA 3O6KH 4YWGH 1EDQA 3DTXA 1V8HA 4WI2A 4LK4A 3VD1A 4WW1A 1M9SA 3D2UB 4NC1E 3U6XA 2Z93A 1CGTA 3ZKXC 5J57B 3QYMA 4HBCH 5EUOB 3OXRA 1BQLH 2RB8A 4HD9A 5EBWA 1MAML 5AB9A 1K5NB 4HH9A 2N0MA 5F0LB 3WY4A 4M29A 3QUYD 2MKLC 3ARGA 3DHMA 4YNYA 4HSAC 4XVUC 4HEPA 2J3SA 1X9UA 2EDWA 5B22A 1OE3A 1MWAA 1G87A 4Q14A 4HWEL 3TTYA 5E2UL 5KJRH 4N8CL 3EH5B 4C58B 1SMDA 4JGJA 4KJPD 4OFDA 3VXMB 5BO0D 2WYZA 5KANG 4U0QB 1FG9C 1VRSA 1KYOK 2AGJL 1SHXA 2AJSH 5DT1H 5K9OB 3NZ8A 4F7MB 2J8OA 5LCVA 2XTJB 2ERJB 2NY3C 4YHMH 5ICUA 1NEZA 2BP3A 4XNMB 2ODIA 3S4SB 3LKSA 5K5YA 5MEOA 3FF7A 1G7MB 1UUSA 3WCYA 4GAAA 4PBWD 3WNPA 2A9DA 3H6AA 1OLLA 1M7IB 3TH4T 1R3LB 3BE1H 3HMXA 3SJVE 2VLKB 4XNYH 5E6YA 5M95B 1PF3A 2V2WB 1YUHA 3QIUD 5CR8A 3BZ4B 1Z9MA 5HHOD 1XMWA 1KIQA 3W9EA 3WHXA 1N59B 4ZO9A 1MEXL 2Z91A 4DP4X 3GM0A 5JUEH 6TAAA 4DZBB 1L9OA 3KPMB 3N9GL 2PMZA 2Z8WC 1MJJB 3NABH 4XNDA 2BVOB 3VI3E 3EYSH 2A6IB 1PKQB 1SXAA 3FTXA 3ILPA 1HH6B 3ZMEA 5I24A 2APFA 1QD0A 5LWYH 4KGJA 2A9BA 3WFDL 2WSPA 4W9DC 3I6LE 2A1WH 5L6YL 2CO7A 4L9LC 1H5BB 4KPHL 2VR7A 5LBSL 4ABWA 2WUCL 4LL9A 2E7MA 4H40A 4KK5C 4QEGA 4QRUA 2GKIA 4U1JA 3EYFB 3PL6C 4XVOA 5CEYA 2EUWA 3VXOB 4JO1H 4JQIH 4P57A 3TN0A 1FLRH 1LP9E 1LO4L 2CBQA 1R3LA 2A74C 3IMSA 3TGXA 1JHLH 2OSYA 2HYMA 2B3IA 2ZUWA 2D9CA 5FWRA 3TNNA 3OKDB 3LH2H 2YXVA 1NMBL 4RGNB 3AGVA 4HUKB 5I1JH 5IB2B 3UYRL 5K9QI 3P4NA 1ZTMA 3ULUE 1S46A 4LCYB 2BSTB 2RQ8A 1AZBA 3SCMA 2YD1A 4LARH 4OLEA 3MRHB 4U6HA 1ID2A 3E8UL 2RD0A 2L7EA 3FQXA 1XIWB 3PLYA 5JQHC 2QFRA 3KLDA 1VDGA 3NA9H 1UTDA 1A4CA 4MRBA 1U8KA 5DHYB 2O6FA 5DI8B 1PY0A 3SZ6A 3RUGA 3NJGA 4AQEA 1H5BA 5K39B 1DDTA 1QRNB 4N9GA 2E74C 4F8LA 3DK2A 3AB0C 2F1BA 3GUFA 4XR8C 2B1AH 1QBMH 4A7SA 2CLVB 1UD2A 1HIMH 5MEND 1Q0YL 1WWAX 4TYUA 1AC0A 5CGTA 1PKQA 1KWGA 4L3FA 1JZFA 4R26L 5T1MB 5JHBA 2FT8A 2JXMA 4YHOH 1MJJA 3BPOC 2HUEA 1KZYA 2CLZA 4D0CB 3AWGA 4HUVA 4WSJA 3GSXA 2V2TA 1OXYA 3BKJL 2JKIS 2FJSA 2XBTA 4NCC1 4UZSA 2EDOA 3R4RA 4U1HB 4YSRA 3GMQB 4YHPB 2CR3A 3GBMH 5EC1B 3GYRA 4HWBA 3QDJD 3U4BH 4EEEA 4K94C 1Z32X 2OCJA 3J8F7 3J07A 3QBTB 4L3CB 4X6CA 5DJAA 4YO0B 5C0AD 3SGKA 1M2VA 1EPFA 1VFUA 2G3XA 4LMQI 5AYTA 4LSUL 4XNMA 1D5XB 1EHLH 3ALPA 4NNXA 1M05B 4PVMA 3VWJA 2UYLB 2NW3A 4UTAA 3CUPB 4EE2A 4RBPH 2FLMA 4N2LA 3PL6D 3X1EA 3IJEA 5LDSA 3EW3B 5AW6B 4Y5XC 2EVIA 1O6SB 4L8BA 1MVUA 4IMLB 4IMLA 1CGYA 1UOVA 3AG3B 3G6AB 1FDLH 1XEUA 1C9SA 1JN6A 2XZAH 3G6DL 3T0XA 2EABA 5TF1H 1RP9A 1GS8A 2O6PA 2X89D 3O8XB 3BVUA 3RI5K 4QRQA 2VLJA 5FO8A 1NLBH 2P4AB 1N26A 3V6ZA 1TJGL 2ZUSA 4LQFL 1HZKA 4Q9RL 2JB5H 4P9HC 3DPBA 2AERT 3PREA 3UBFA 3BVNB 5KVFE 1AGDA 1KZQA 4EKJA 5C0FB 4E5XB 2QHRH 2Y5EA 4Z7NE 3MJ8B 3QUZD 2J6WA 2CBTA 2PO6D 2GITB 3U82B 3IJYA 2C4FT 1JOIA 3B2VH 1IAIL 1SEBA 4X6CB 1IBFA 3EYVA 5IF0A 2R0WH 3TESA 5HYJE 1UWEH 4B3EA 1BF2A 3MOAL 2JIXB 4Z7OB 3DHJA 3GXDA 2EUXA 4JRXB 2XOTA 4R7XA 3VXNB 1QATA 3BQVA 4HV8B 4MNQD 3BFWA 4JPQA 3WHE0 1DVFB 4R5TA 2KQMA 3PAVA 4UDUB 4OU3A 1IGMH 2HKHH 3BYYA 4UM8B 2APTA 4PWKA 3KXFD 4NOBA 3QNXB 1PD0A 3OXSA 2WBWB 5SV4A 2CO6A 2Z7WA 3TA4D 1OP5H 3Q8BA 3UZEC 5IW1A 3KXFA 2YAOA 2DOCA 2EYSA 3RHWF 1HE8A 4N9GB 4D8OA 4KKPA 1O9WA 1OF0A 4LCWB 2F7OA 4PRNB 4YBQD 2WUBH 4ODWA 4YSEA 4MJIB 3CFEA 3LNHA 3D0LA 4EMZA 4WI4A 4LOEA 4K3JL 2A9CA 1D7BA 3SO3B 3IFOA 3HJ0A 1W2KT 5F7FA 2P8MA 3WKYA 2FD6L 4L4JA 1FG2A 2X4TA 4QT5A 4APXB 2Q3AA 2DEXX 5I1KL 3G5ZA 2LTQC 1NCIA 4IRSC 2K3TA 4XCNA 3Q9PA 1A3ZA 4PJFB 4GAYA 5CR1A 3MRCB 3HMWH 3QEUA 3S8GB 4YVUA 3AQYA 5HYJB 2JCCA 4D0DA 5AOLA 5EIIG 4POZC 2ZE0A 2YC1A 2HTKC 1AHWC 3WNIA 4W9KC 1GHFH 4HGWA 3L3HA 4UBDD 4XRCB 3HG3A 2ATKA 4M5TA 4NQXA 3GWJA 4JRYB 1OSZB 3EHBB 2VDOH 4JG0H 2E7BA 1U58A 1MRFL 1EA9C 3FFCB 1NFIA 2GC4C 4UIKH 1R3HB 4KKBD 1A7OH 1LP9A 5D7LE 5EOQL 3N42F 4F8PA 5BVJA 5CJXA 2Z4QB 3WG7B 1FFTB 4IHOB 4MD4B 2EYRA 3OMIB 3VXRB 2H2PC 3ISWA 1SDAB 2YD9A 2PWHA 3K7UA 1X4XA 2ATPB