3PLYA

Structure of oxidized p96g mutant of amicyanin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHGFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
molecule tags Electron transport
source organism Paracoccus denitrificans
publication title Proline 96 of the copper ligand loop of amicyanin regulates electron transfer from methylamine dehydrogenase by positioning other residues at the protein-protein interface.
pubmed doi rcsb
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3plyA00
4E9QA 2PPAA 4NERA 2AANA 2X88A 1PLAA 1TEGA 4BDVA 4DP9X 2VW6A 5B1AB 3GDCA 1OCRB 2PP9A 1KCWA 3NJNA 3NJIA 4JHUA 4HHWA 2GHZA 1E5ZA 3NYKA 1PLCA 1PNDA 1A4CA 2Q5BA 2IH9A 1M57B 3IE9A 3FU7B 2IDTA 3WI9A 1BYPA 1ZV2A 5F7AA 4PCYA 1E5YA 3T6WA 3TBCA 2FQFA 4HCFA 1KYAA 6PCYA 1V55B 1JVLA 1JZHA 2DYRB 4UF7C 2JKWA 2HX9A 2I7SA 4N4YB 3X1NA 1JXGA 1VLXA 2CBPA 2IDSA 1AOZA 1N70A 3T71A 2J55A 2GB2A 3FU7A 1X9RA 2HX7A 1AZUA 3ASNB 1AIZA 2HX8A 2QPEB 1HFUA 1JVOA 3FU9A 4M4RB 1ID2A 2BWIA 3ERXA 2R7EA 1AQ8A 3AZUA 3NSCA 4P5SA 4HCIA 3T6XA 4ZK8A 3FYEB 4YSCA 3WNIA 2PPEA 3WKPA 1FFTB 2I7OA 2XYBA 1AAJA 5FC9A 4EF3A 1V10A 3NJMA 2AZAA 3IN0A 4YSTA 4BXSV 1NIFA 2XX0A 4F2FA 1KV7A 1NIBA 1V54B 3KW8A 4ENZA 4G7SB 1GSKA 3NJHA 2XX1A 4M3HA 1BQ5A 2FWLB 4YVNA 4GXFA 3UGEA 3X1BA 1KBWA 3OMAB 2NRDA 3AY2A 5B7EA 1PLBA 5PAZA 1KGYE 4A2HA 1I53A 4DPAX 4F2EA 2IDFA 4UANA 1DZ0A 3QJSB 1ILUA 5D4IA 4DPBX 1E65A 2W88A 2BP8A 2YAPA 4KO6A 1J9RA 3SBPA 2VMJA 2YAQA 3CZUB 1XMEB 2YAMA 5I6OA 1J5DA 1KDJA 1SF3A 1NZRA 4N8UA 4YSOA 3WG7B 3FYIB 5I28A 3NJKA 1MG2C 1HAUA 4X4KA 2FT7A 1M56B 2CAKA 3T6VA 4NAJA 2VSKB 3ABKB 3AG2B 3PAZA 4YVUA 1SF5A 5A7EA 1BXVA 2CALA 5EHFA 2EILB 1JXFA 1NIDA 1KCBA 1SDDA 4KO9A 3S8FB 4E9VA 3EHBB 1SJMA 4F7KA 2IH8A 2UXVA 3RYMA 2LLNA 3FU8A 4QKTA 1AG6A 3NJLA 3D12B 4BWUA 1URIA 2FT6A 2P80D 3BQVA 3EF4A 5I6PA 2YXWA 3CDZB 1AZBA 3ZDWA 4RH4A 5TK4A 4Q8BA 1AG0A 2OJ1A 1AANA 3IBOA 3HB3B 4YSEA 4TXVB 1ET8A 1BXAA 3NP4A 1J9SA 1IC0A 1QLEB 2PLTA 4KNUA 1UATA 2PPFA 2AVFA 1ETJA 2ZXWB 3S3DB 1SDDB 4DP6X 1ZIBA 2R7EB 1OV8A 4FAAB 4BK5C 1A3ZA 2TSBA 3HEIB 2XV0A 2DWTA 2ZONA 2VN3A 3NJFA 4HIPA 3N55A 1QNIA 3ASOB 1RZPA 1E30A 1PCSA 2XUWA 3CVBA 3ABLB 4DP8X 1CUOA 1GY2A 4FA7B 1ILSA 1XB3A 2Q9OA 2YAEA 4CSPA 2J5WA 1ZIAA 3PPSA 1IBYA 5I26A 1GYCA 8PAZA 2GIMA 2WO3B 4G7QB 2BP8B 2H5UA 1OCZB 1AZRA 3ZX1A 5I5JA 4DP4X 2UXGA 1AZNA 1JZGA 3FPYA 2XWZA 3FQYA 1J9TA 3NSDA 3QQXA 4E9YA 2FTAA 2EIKB 3ABMB 2QDWA 5B7MA 1L9TA 2CUAA 3S3CB 3WIAA 2OCCB 2XU9A 3OM3B 5AKRA 2BW5A 2BZCA 3DIVA 4A2GA 4GP5B 3NSFA 1XB6A 4YSDA 2HRHA 3G5WA 1NPNA 2YAFA 4E9RA 5B7FA 4AKPA 5I5IA 2ZOOA 3X1FA 1OE3A 3OQRA 4G70B 1T5KA 2Y69B 3S3BB 1B3IA 2PCYA 3CG8A 2I85A 2YXVA 1XB8A 3QJUB 1KBVA 1RCYA 1MG3C 1A65A 1MZYA 4NB7A 2EINB 3FSVA 3UAEA 1AR1B 1NWPA 3U25A 1L9RA 1SFHA 3EH4B 2EIJB 1FA4A 1JZFA 1EHKB 1GS6X 5AFAA 3FSWA 1OOWA 2IWFA 4JHVA 2YQBA 1SHXA 2IDUA 1A8ZA 1PZAA 1A4BA 3FQ2A 4K9JA 5E9NA 5F7BA 3NSYA 2QPDB 1L9QA 1ZDSA 4W9ZA 1RKRA 2FJSA 2XLLA 2YAHA 3H4HA 5AZUA 1JXDA 2JFCA 1PMYA 2VSMB 3SBRA 1GS8A 2HXAA 4MFHA 3T9WA 3MX0B 3NT0A 1ASOA 1GS7A 2WO2B 2A3TA 1ET7A 3JTBA 2J56A 5B1JC 4JKNA 4DP2X 3PLYA 1AS8A 1WAEA 2BO0A 1WA2X 2DV6A 4HCGA 1IKOP 7PAZA 4WKXA 2EIMB 3QJTB 4KOCA 3AG1B 1F56A 1BYOA 1GW0A 2IAAC 2GBAA 2W8CA 4YL4A 3FS9A 1AS6A 4AI7A 3MBWB 2IWKA 1DYZA 1A4AA 1NINA 1PZCA 3WKQA 3FSZA 3EH5B 4YSSA 1ASQA 1NIEA 3H4FA 1RZQA 1NWOA 1PNCA 2UX7A 1WA1X 2PP7A 1OE2A 3NP3A 1W6LA 3OMNB 1AZCA 1MDAA 1E67A 2BP0A 5D4HA 1L9PA 4P5RA 4A2DA 3TASA 2BW4A 1CC3A 5B1KA 4DP5X 5LDUA 4PAZA 4QLWA 1BQRA 3DKHA 2MRYA 1JZIA 1NPJA 3EH3B 2TSAA 1L9SA 1OCOB 4YSAA 1J9QA 2GI0A 4A2EA 2P80A 4DP0X 3WNJA 1ZDQA 4A68A 1PF3A 2QT6A 2AZUA 3ZIYA 1FWXA 1NICA 3CVCA 3QPKA 5I6NA 2HZHA 4WTQA 3ZBMA 3QJRB 1GY1A 3X1GA 4KNSA 1NDTA 2E86A 5PCYA 4BWTA 3IEAA 2UXTA 5B1JA 4AX3A 3UADA 3X2QB 4AKOA 2FQGA 3GYRA 1ADWA 2FQDA 3BVDB 4UAHA 3SBQA 3FQ1A 3NJJA 2IDQA 1BQKA 2GC4C 5ANHA 1QHQA 1BXUA 4AZUA 2VM4A 3TU6A 4YSUA 3AG3B 1N68A 1IBZA 2XXGA 1SFDA 2XV2A 2DYSB 3KW7A 3FT0A 4Q89A 4BDVB 1BAWA 1TKWA 1M9WA 1EZLA 2DY2A 3V9EA 7PCYA 3X1EA 2OV0A 2B08A 3T6ZA 2XXFA 1JERA 3DTUB 4G71B 4AKQA 2VM3A 3TBBA 1TU2A 9PCYA 5B3SB 2YARA 3JT2A 4A66A 4E9TA 4G72B 4L0PB 3QJVB 3CVDA 2J57A 2CCWA 3NJGA 1J5CA 2MTAA 3S8GB 4DP1X 3AW5A 3N2JA 1IUZA 1AACA 1OE1A 1CYWA 2IWEA 3OD3A 5B1BB 3UAAA 3TA4D 1W6WA 1KDIA 5TK2A 2H3XC 3QJQB 1X9UA 5I5MA 3PAUA 5I6MA 4HHGA 4YSPA 4A67A 4E9SA 1ZPUA 3PAVA 3PXLA 4GP8B 2B3IA 3C75A 4BXVA 2AFNA 1JZEA 1NIAA 2FT8A 3FPXA 1SNRA 2BHFA 2PP8A 2ZWNA 4KO7A 1CURA 3PCYA 1OF0A 1SHWA 1W8EA 4W1TA 1HAWA 4KOBA 3OMIB 4HZ1A 2PPCA 4G7RB 4DP7X 2PPDA 4BWWA 2YAOA 1BEXA 4KNTA 1NTDA 3UACA 5IY5B 1GR7A 4YSQA 2UX6A 4A2FA 1R1CA 1JOIA 2XVBA 2HLEB 5I6KA 1ET5A 2Y1AA 2BP0B 3UABA 2FQEA 2BZ7A 2XV3A 3H56A 2H47C 2FNWA 2PCFA 4GP4B 4HAKA 1ASPA 2GSMB 4YSRA 3GXUB 4KO5A 5I6LA 1WA0X 6PAZA 2RACA 2JXMA 3AG4B 3SQRA 4GY4A 3V9CA 4CSZA 4HALA 1CYXA 3FSAA 1PZBA 2VW7A 3CDZA 3ABGA 1PAZA 2N0MA 2QDVA 1JZJA 2GC7C 2UXFA 3L45A 1OCCB 1WS7A 2HRGA 1AS7A 4GYBA 1MZZA 1YLBB 2VW4A 5D4JA 1PY0A 3IN2A 4DPCX 1WS8A 1TEFA 2BWDA 1L9OA 2WSDA 2X87A 4E9XA 2CJ3A 4E9WA 2DWSA
chains in the Genus database with same CATH superfamily
4E9QA 3RPKA 3R0NA 2X2HA 4DP9X 4YHLH 3O6FA 4PJ6A 1V7MH 3EYVA 4JPQA 5FKPA 1CXLA 2E6JA 3KBHE 3VU1A 1RV6X 4R7NB 1E5ZA 3RG1C 3H53A 4LOVA 4K94L 5F7YC 3I75A 1S9YA 1W80A 2YA2A 3V8CA 3SJVD 1FIGL 2MCPL 4RBPH 3GSOB 4F1SA 1DDHB 3QRGL 5DUPL 3HS9A 5JUEH 2EDLA 2FH6A 4FMVA 2QR0A 6PCYA 1T1YA 3PQYA 1CE1H 4OGYH 3H9HA 4FXGB 5DHMC 1ROWA 3CSFA 1LE5A 4I87A 3BSZL 3RWJA 2J55A 3GSOA 2PW2B 5EMYA 3V2AR 1CJYA 4LLYA 5KBPA 5A2BA 3MGTA 2HX7A 4LLUB 1AZUA 4AJVA 5IEKB 2EEBA 2XTLA 2XN2A 4G8IB 2BWIA 3CGTA 2G3NA 4Z3IA 1DCEA 4AIXA 3PDOA 4PV9B 1AQ8A 4NKIL 5KJRH 1V5JA 2EDYA 3WAKA 4AYMC 3AGVA 2GJZB 3GD1C 4QJ5B 1XVSA 4J27A 2NY0C 4X6FA 1N7ML 3LRLA 2ICWI 4HIXL 2F8IA 2GK0A 1V10A 3PABB 3IN0A 4YSTA 1SHMA 3WTSA 3VTTA 4MXVE 2NXZB 4QTFA 4WI7A 1SVZA 3VD1A 3KW8A 4K71C 3RA7L 1L5GA 3P0YL 1CFQA 3FO1A 4JDVA 5IB1B 3UGEA 1S9KC 1CFTB 1MW3A 3QJOA 3QIWB 4O51B 1I9JL 3AY2A 5HYFA 1N64L 2N7AA 1NBZA 3VXSE 4YMPA 3UTZB 4JRXE 1TF4A 4K8RC 3TN0A 4GIOA 2N7SA 1T04B 2F2HA 3KXFE 4K5PA 1FYTE 3EYSH 3K2UL 5IW6A 4G1MB 3ZE0B 1MHPH 3GZPA 4QRBA 4W9KC 5D93C 2X2UA 2I24N 3QUGA 3NFSH 4FS0A 1KC5L 3BUBA 1II4E 2DLTA 2NTSP 5ID1B 1T1YB 2OJEA 1JSYA 4TSAH 4O58L 2D3JA 2W0KA 4Z7QB 4D9LL 3BVNB 1M56B 3HUJA 3ZW3A 1U3HC 2XT1B 2WXRA 4IBWA 1UA6L 1GOGA 1PBYA 2ZUTA 1SGKA 2OYMA 5IQMA 1MIEL 4HKBB 3RX8A 4XP4L 3MI6A 3ENEA 4YVUA 2QQKH 2XN9D 2B4CC 1PSKL 2HFEA 4R7NA 1ZGLP 2CO2A 1N0LA 3KWWB 2ZXCA 4GBXD 5IJVB 2XC8A 1AD0A 1RUQH 4JM2D 4OAWB 3HBZA 1YEHL 3C5SA 3WTXA 2UXVA 2Q6WA 1QUNA 5E94B 3FFCE 5EF1A 3QI9D 3FU8A 2Y1YA 5IESH 2NY2B 4IGBA 2Z4TA 1DLFL 3UEQA 3GMQB 4LHUB 2Q86B 2IXQA 3DETD 5I6PA 3R8QA 1EVTC 1MRDL 4UZGA 3L7EA 1BJMA 4NEHB 4RH4A 4IBVA 4N0UB 1M42A 1UB5A 4TL5A 3WENA 1BXAA 2WLLA 3UOAB 3MNMA 4AT6A 1LYQA 3HE7A 1NMAL 1HILA 2AABH 2ZXWB 4L9LB 3RGVC 1AHWA 4UWQB 3RGVD 4GRMA 2QMJA 4GG6B 1N2RB 5HYJB 1M1SA 3TH4T 4NZUH 4R90H 4HJ0C 5DMJB 5F0PB 2ZPKH 3TZVB 3QUZC 3MRNA 1UD3A 4AIOA 2I27N 5IM7A 4Z8FL 5E5RB 5FOJA 3UTQB 4U1JB 1QZNA 3RKDD 3N50A 1HEHC 1RZPA 2GPZA 3FRPB 3O6KL 5D8JL 2XUWA 1S7QB 1S7WB 5E4IA 1IL1B 2EXSA 2I5YL 5E08L 4RFOH 1G5GA 1EAJA 1XIWD 3D2UD 5AOZA 5F8QC 4OV5A 1KTLB 3E1ZA 1TZIA 4GXVL 4UQDA 4NZ8A 2PWFA 4FABH 4K55A 4Y4HB 3CFJA 2NUTA 2FTAA 2IV8A 2JB5H 3ABMB 1M7IA 1SLVA 4M29A 5HY9A 5DHYA 2WKLA 4JVWA 1NEZG 2XU9A 3CHOA 5E94A 4LLMB 3ZMEA 1WBZA 3KLAB 1G9NL 3RIAF 1BQHA 3FT4A 5BVPH 1RK7A 4FG2A 4LP5A 3FO2B 5EB9A 5B7FA 4LCIH 3AT0A 4ORZC 3HZYB 4QIRA 4YOKA 5I8KH 4XB8A 5FKPB 1GZPA 4UT6A 1OE3A 2D3NA 3SE4C 5DJ8A 3CBJB 2R9HD 1QKZH 5F71A 3IJ9A 3RGVB 2R9HC 3OBAA 2OMTA 1P7KA 5DHVB 3VTMA 5JPMA 5JXEC 4K3JH 2C5DC 4WGVB 2FD6L 3DBSA 5CGYC 1JZ4A 3L9RB 3EXLA 4N8VG 1YEGL 2EIJB 1QVOA 3CFCL 1HINL 1BX2A 4F7CB 1O6SA 1DE4B 2D9QB 3FTGA 4YK4B 1BVKB 3IJ7A 2F53B 5JORB 3JYCA 1CFSB 1JFQL 3CXDH 2WXNA 3JV4B 4HJUA 4D0BB 1VADA 3KPQB 4Y8DC 1RQ5A 1Q1PA 2IALB 2ZUXA 2PYFA 1XGYH 2UZIL 2V17H 3NSYA 2AQSA 3RVTD 2EDQA 1XX9C 2WQXA 3W0WB 4NNYA 2XWCA 1R5WB 1CK0L 5ESVB 3DVGA 1WIPA 4FQLH 2XKNB 1YEFL 2F5BH 4RFNB 2FO8A 2Z9TA 3KBPA 4W6WB 1ACXA 4HMEA 3EHBD 4XBEH 3VACA 3II3A 4JFDB 3NPSC 1AR2A 1X5ZA 1RH8A 4JANB 2R2HB 2P44B 2P8PB 3WFDH 4JRWA 4IHOA 1HSBB 1NCAH 4JNXA 2CNYA 4FQLL 3BZDA 5E03A 5E6ID 1E40A 2EIMB 3U4BL 1Z0NA 4PJBA 5E6IC 4X9HA 2HJFA 1Q9KB 2JKJA 5GRYA 3P4OB 4LT7A 5FGCB 2MQ3A 4LOFA 5KSVA 2BSTB 1AIFA 3MBWB 2IWKA 1Z7JA 4ZUVB 5CBAB 3HAEG 2E7BA 2QL1A 4J2XA 2ZXBA 3CQPA 1NH6A 3F6LA 3EYQC 1HYSC 4YH6A 3UP6A 2EEXA 3O0RH 5KANI 4Q6IA 3ZE1B 2X40A 3V4UL 5CGMA 2Q7NA 3TZVC 2AQ2A 3VXTA 2BSEA 3NMEA 3TZVD 2BFGA 2P24A 1OIOA 2VERN 5GSVB 5CGBA 3O2VH 2WYHA 4Y19E 4NRXA 4CKQA 3QEHA 2VKXA 4XP6L 1T83A 3BVXA 2KI6A 1H15A 1ZV9A 2BHZA 3QIBC 2P80A 4YHPA 4A2EA 5ABAA 3GSVA 4I89A 4N2BA 2QKIC 3IU3B 3VAEA 2MIZA 4UTBH 4OF8A 3LZFH 1KBGH 1FJ1B 5I17A 1NICA 3N40P 3M46A 1VJSA 2P45B 4ILDA 1ZE3C 1CBJA 5EORL 4CILA 4LCWA 5ABZA 2E7LA 4LCVA 4RZCB 2H8PB 5AZEL 3CMOH 1S3KL 1MAML 1OANA 1SOQA 4DCQA 4WU7A 4G8FB 1DVFB 1G1KA 4R0LB 2VDNL 1MVUA 4QHMB 2X1XR 3TT3L 4TNVF 2XTSA 2Z7UA 3QFGA 4YZWA 2PWHA 1HOCA 2DQCL 2AJVL 3FTSA 2FYYB 1MVFA 3HOGA 3MLVL 2O5YL 1C08B 4LEBA 4QO1A 4KJWD 2FQDA 2H8PA 5FGCE 3QDMA 3TN0D 5ESVA 4YFLI 2JJSC 1ZHLA 5ANHA 4AZUA 3ZL1A 5G55A 4NNXB 3NIFF 2G5RA 3OLEA 1SN2A 2D7QA 4XAKE 1NMBH 5JW5A 5DJAB 4N25A 5LN4A 1CWVA 3ALPA 1FFRA 3V9EA 4OLZL 1JWSB 3GBML 3QDJA 1JF5A 3ZYIA 5DWUL 4XCNA 1UJ3A 3TBSA 3GMMB 1ML0A 3QC6X 4XC3L 3MUJA 4I9WE 4NKDA 1A64A 4GJTB 4U6VH 3D08A 2OYKA 3B3BA 2JIXB 3WN5C 5T5FA 5KVGL 2DZEA 2Q20A 3C6SA 1LXMA 3W5NA 4XP1L 3SIKA 2RCSL 3AB0B 1JPST 4JRXA 3UTSE 1WT5C 4EIZC 4EI5A 1F4WH 1I1YB 5DC2A 2FUTA 3HE7D 5CBAA 3LKRA 3UAAA 3BXNA 3CLEL 1W6WA 3L5WB 2W9EH 4MCZB 1YEIL 2CNZA 4X7EC 1BF2A 4O02H 2D3VA 4DKEL 2CDEA 1CFNB 1KFAL 4HHGA 3UEZA 5CLYA 3MJ9H 3FU6A 1RY7B 2DKSA 5D1ZD 3V8OA 1N5AA 3F6IA 1NIAA 4WK0B 5I74B 1TVBB 1AE6L 4M1CD 2B16A 4YS4A 4C83B 1FQ9C 1IGJB 2AAVA 5FYLD 1OTSC 5E00A 4AG4L 4PJHF 4B7LA 1OTSD 1MPAH 3AABA 1SLXA 3L8QA 3B9DA 1GJWA 4Z7WE 3HG4A 3KYMB 5HVGB 3KBEA 3S98A 3LRGA 5DFWH 1I9RL 2EDEA 1NCDL 1IQWL 2O5ZL 4WDIA 1D5MA 4G9FD 5FOBA 4TL4A 1INDH 2FNWA 5DEGA 3K1KC 4QRPD 4L8DB 2QVFB 3P3SA 1XL4A 1QVOB 1TOXA 4U0QB 4X7DC 3C6LD 3OSVA 4YO0B 4JFEB 1GA2A 1FNAA 2JXMA 3AG4B 1JPFB 2K45A 4PJFA 4M8QB 1IAOA 1JMXA 3SDCD 2JK5B 1NUDA 5DFAA 3SDCC 3C5ZC 3NJXA 4F5CE 1KB9J 4DFHA 4RQQA 4KRPD 4X5QA 4KI5C 1NCOA 3HE7B 1NBQA 1MCLA 4QWWD 3APNA 4HXBL 4MDJB 1TJGH 3PWLA 1RK1B 3IN2A 4XMXA 3D1MC 1HDMA 3GMMA 2VXTL 4Z76B 4FNSA 4NUMA 5IHWA 1FHGA 1S9XA 3GSNH 2EXTA 3G5XA 5ACZB 4TQHA 2VQUA 4JFYA 1P84J 4N2LA 1G5AA 3RFZA 3TYGL 4PLOB 4F8NA 3PJSB 4O00A 3BO8A 1RP8A 3MLPA 3ZTNH 3O3AA 1IGFL 2XIIA 3QSKB 4ODWA 4OIAA 3F7YB 4P07A 3UXFA 3PHAA 3CFJB 1I1RA 3NJIA 5DJYB 3NVQA 4EAEA 1NOLA 2V7HB 3U7YL 1DBBH 2VLMD 3F85A 4ZYKB 3TJHC 2Q0ZX 4IW4C 4OUUA 5GGTA 5KYYB 1V8HA 2JF1A 4MXWH 4FNTA 4P5MA 5CEZL 5IT2H 1YEJL 4S1SH 4XOAA 1FVEA 2LHAA 3FHEA 3CPLA 1QI4A 4GSXA 4PCYA 3UJTH 3T6WA 1FLTX 3DJRA 1YEKL 3I9AA 3BJLA 2HRLA 2WLIA 4Y9GA 3CD4A 2HX9A 3DSNB 4WW2C 3ME0A 4CMHC 4ZXBD 4AQ1C 1HJBC 1AH1A 1N70A 5CS7A 1NGZA 3L95B 3OMZA 1ZA6B 3PHQB 4I9XA 4YQXH 4HOMA 1YJDC 3FOLA 2BDNL 4LOEA 3L3IB 3TURA 4H13C 4M6OL 4G5ZH 2E75C 2ZCHL 3FU9A 4M6AA 3CSTA 3LTVA 5IZ7A 3AZUA 3PIQB 1CD9B 1A6ZA 2GBVA 4MJIE 4K15A 5DMKA 5I15L 1LEGA 3DUSA 4WW1A 3AXHA 2E7HA 5JW4N 1KEGL 4FKKA 1LO0L 4NZUL 4R9HA 5BMFL 5FW8A 3V6FB 2KPNA 5IJKA 1E9OA 4WZ9A 1CXEA 4E9LA 5EO1B 4LO9A 5D8JH 4UOW1 3RVVD 4ZW8A 1WFOA 3G7TA 4LB8A 2RMNA 3CLWA 5DZPA 4KHTH 3GRGA 3N1FC 1G4MA 3X1BA 4YK4C 1DVTA 4LMQI 1VA9A 3NK3A 4TVPH 4C4UA 5C08A 3EZJB 1KBPA 3H55A 4HUMB 4XX5A 4J1UA 2YJLA 4NUGL 1LTXA 2X9ZA 4NOFA 4XWOD 1E65A 1A7BA 2DQTH 2OK0H 1DSWA 3N40F 4JO4L 4ANVA 1SPDA 3MA9H 2V3FA 4FQQB 5EU6A 4Z78B 3ZTDC 2ADJA 3MV11 4WAFA 1SF3A 1KDJA 2XXMB 2AXHA 1DQIA 1M7IB 2A9ML 5E99H 3G04B 5J13B 1A9BA 1QHPA 2P43B 1PGRB 2VYRE 5GS3A 4AK1A 5DMIH 2YKLL 3THMH 3MODL 4I4WB 1MFMA 4EVNA 1SF5A 2CDFB 1WHPA 2BXYA 3CUPA 3T0EB 5BUGA 1PW3A 4PWEA 3MRDB 5F72S 1YDPB 1UB6B 2UUDH 3AXLA 5D7IE 4JFFA 4OLUL 3MV9A 4ELKB 5I1LA 1K85A 4IKKA 3EJZD 4L3EE 3UH8A 5HVWA 3EFDL 4DEPB 3EJZC 3QS3A 4RSYA 3WNKA 1Q8MA 4IYKA 3EYUL 3RTQA 1WEJH 4ODSH 3ZDWA 1MW1A 3CN1A 3N43B 1OARL 4BSJA 3FO9B 1AANA 4GRLC 3APDA 3O4OC 4ONHA 4WHCA 5A6IA 2ZXGA 1ZSDA 3ARUA 3AREA 3QQ3B 4DP6X 4D2NA 2J2ZA 3HG1D 3T4AB 4OI9A 5DYOA 1N6VA 1OARH 2A6DB 3V0IA 4I0PB 4AMWA 3PL6D 2O4EA 3PAYA 1D5IH 4J8RB 4N22A 2C1OB 2VT0A 4OGAC 5JXAH 2JCCA 3D39B 2BK8A 1IEBB 3ZXAC 1KLFA 1XD0A 3N55A 5D70L 3K7UA 1HIMH 2JVUA 2FECI 1A6VH 1THAA 1DQML 1CUOA 1EK3A 3M88A 2HVKA 1XB3A 4IDJL 4P9HC 1N7MH 1JBJA 2Z7YA 2OL3L 4I8DA 1T1ZB 2QQLH 4MJIA 4PG2A 2FZ3B 3LKSA 3WS3B 8PAZA 2CUMA 4MMXB 3QULB 1MLCA 2PYEB 3IU4L 4Q6YA 5DT1L 4PJFF 3HRZC 1RZ7L 2ED7A 1KN2L 1DBJH 4XP5L 1VPOL 1KCRL 4P06A 2BM3A 4CW1B 5F9JB 4JB9H 4K5OA 3D0VA 2DMGA 1FN4B 5B7MA 1K8DA 4IOSD 3T65A 1GKEA 4LBEB 1IBFA 5EZJA 1I75A 3DC0A 5D9SA 5HI5D 3MNWA 5LAXB 3DOSB 4XXWC 4XXCA 4AYDC 1ITBB 5EU6D 1B3JA 3MRNB 5IM7B 1PX3A 4CMMA 3PHOB 5CCGE 1NPNA 3F7LA 3L4VA 4JQIA 1U91A 4E9RA 5E7BA 4NRYA 2BOBA 4PRIB 1UEYA 4NI6A 1A7RH 3QI9B 5EBLA 4XX1G 3F3HA 1PG7X 5L0QC 3QVAA 3MUZ1 2GTWA 2BIMA 2IPTH 4OBSA 4TV3A 3GT6A 1HNYA 1SEQL 4I5BB 1XB8A 2Z35B 4DZBA 3LPOA 2Y5TA 1EPFA 1F4XH 3AC0A 3CLFH 4I0PD 4MDIB 4V2CB 5EIQA 2MCMA 2M8XA 4I0PC 4X5PA 3APCA 5BZXA 3FH5A 2OPCA 4LDEB 5DO8A 3UFIA 4HJ1A 3FB8B 2B59B 4YHYB 1C9SA 2IADB 1DQLH 4Y19B 4R96B 4ZPTA 2BSRB 2CZNA 1U58A 2A77L 2LU4A 3PXJA 4YX2L 1X7QA 4FZ8H 3U0TA 3IAGC 1OP5H 3FQXA 3Q7JA 3HZMA 2F53D 1OAQH 2FJSA 3I2CH 1E5BA 4JZNA 3JWOC 4LCCC 3TJEL 4PJAF 5D7JD 4PCSA 3D4CA 3F04A 3M1BB 4HJIA 4OZFA 5CNHA 3VFSA 1Z3GH 3P9LA 4Q58C 3TPKA 4N2EA 1LO4H 3BMVA 5E2JA 4P48A 2DL9A 2MNJB 4XX1E 1YNLL 1J11A 4FEMA 4UIKL 5D2LF 2YD8A 3MRMA 1KLFB 3CVHA 3ETTA 2N7BA 1CICB 4HCGA 2QVKA 5TPWL 3DX6A 5I82A 4HKZA 4M5YH 2Y7NA 5MENA 3VB8A 5T3XL 4C56A 2NZ9C 2X9XA 3LH2H 1FORH 1I7UB 1OCWH 3MN8A 4NQDD 3I9GH 3S2CA 3QIUC 4OUOA 2HMID 3AREB 3L2LA 2WB7A 4Y5XC 4KZ0A 4IRSC 1Y0LA 2QQNL 1B0IA 1WC7B 4JFDE 3H4FA 1LE9A 3UO8B 5L7XH 4NI3A 2QGEA 1AZCA 1CGYA 2VTFA 4WHYG 2YQGA 5CUSH 4D0CB 1ONQB 1YPZF 3M7FB 3BRGC 1EEQA 4HWZB 3QG6B 4UOQA 3CZLA 5HJDA 2X4NA 4MA8H 1OSPL 4OFYD 4WI6A 5FA3B 4XVUC 2W91A 3AMKA 1JRHL 4NHUB 3S48A 3NSJA 3P9WB 1JNJA 3FAXA 5AAMC 3CN3A 4YAQA 5F0JB 2X4QA 2EYTA 2P49B 3DX2A 5DI8A 2WLNA 1LK2B 1I9EA 3FN9A 4MXQD 4WK4B 3ZIYA 5CEYA 1NDGB 3P77A 2CDFA 1EDYA 1IM3A 2XZAH 5FK9B 3MRGB 3TJPA 2P1YA 2H3NA 3MV8D 2HT3C 1PZ3A 3E3QC 2YK1L 4NZDA 4OF7A 3KLKA 2ZWZA 4M5SA 1F6AA 4XO8A 1A0QL 1BZEA 1M9SA 3WHXB 1XEUA 3L5XL 4XN8A 3UADA 1NFDF 2ATAA 3OWRA 1UXMA 4DUXA 4Z0XA 2DLHA 2DEXX 1KLUB 2OSXA 3AB0C 3BAEL 1ADWA 4G9DA 4TSBH 4WFGE 4B60A 5JQHC 2E0PA 5D2NB 5G4NA 3C2AH 3FQ1A 2Q3XA 3HI6L 1GIGH 2VDMB 4JZOA 4YPJA 1P5UB 1GC1C 4H4NA 4WNJA 4O9HL 1GCYA 3ARGA 1SOXA 3CPUA 5FCUH 4P4KD 3EGDB 1S5IL 3N1GC 3IU3A 2NNXA 4NQEB 4KVNL 3T8VA 5AOMA 5FHAL 2OTWB 4WY7H 1R3IL 3DTUB 4BFRA 2WSKA 5IB2A 1T03L 2F68X 4G2AA 4PWGA 3GTVA 4FFTA 1JD7A 4PRAB 4Z77A 4LPYA 2AJ3B 3MA9L 5EDXA 4HC1L 5TDNB 5KSAB 1GZHC 4B9FA 2OW7A 1T0MA 2VL4A 3O2WH 2QLVB 3HC3H 5H37A 4ADIA 3WS6C 5DJ2B 4N2OA 5IK3B 3N2JA 1ZVYA 4KY2A 1AACA 4IBYA 3BUQA 1NMCC 1F18A 1KTBA 1PG7L 2GJPA 5BRQA 4MNQD 2RBLA 4Q9RH 1J5OL 3NG5A 3KVPA 3EDFA 5DWUH 1PKQB 1FGVH 1KT2B 5GGTH 3ULVD 4WI3A 3BWAB 1F58H 3K80A 2IEPA 1JZEA 4JPSA 3VQLA 3CJJA 5HGGS 5E6IB 2YKKA 2K4AA 2JKRM 4AMKL 2GVYA 2IO5A 3BEWA 4HZLA 4F7MB 2ZJSH 2VUOA 3FB6B 3IDIA 3K71A 1PTZA 1Q9WB 3MV7A 4P2YA 2R2EA 2IMNA 5BMFH 2OMBA 4JN1L 2F0CA 3C60D 3RUGE 1IBBA 3VFUB 4UAOC 3LXBA 1ORQA 4OZGF 4EO5A 2R69A 1M71B 2LVEA 2VLKB 3HB3D 1JOIA 4YHML 1JDCA 3X13A 5KEZA 3V55A 4HWEL 1GKOA 3DSFL 3CSYA 3I6KA 3TEXA 1NCBL 2N3JA 5I76B 2PCFA 3R1GH 1NOFA 3MGOA 3CFKA 4YSRA 1JPSL 4KO5A 4P46C 2KLRA 5F6HJ 3FONA 3L4WA 4HX1A 1KCKA 1EAQA 1OTTD 2R0WL 1KJMB 3G5ZB 4PM1A 4XBMA 1NAMA 3KCPA 4I48B 3R7RA 1AD9A 3RURA 2N0MA 4IMLA 3V0JA 4TMPA 2EADA 2JV6A 4LDOB 3L2NA 5TQ0H 1AS7A 1F8TL 2WQWA 4X99A 4BFJA 5A6MA 1K4CB 2NOYA 3CHSA 2OQJB 3LY6A 2ENYA 3QQDA 2V33A 5LGJB 2A9NH 1NUFA 2WQ8A 1SUJA 3ISYA 4LDLB 5HHXL 1U8NA 1VEOA 2XETA 3AY4C 5HHOD 4QT5A 1NAML 4WO4A 1FO0B 3Q5TA 4Z7UA 4YDLC 1N8ZB 3B6SB 4PV1C 3TBTA 3TM6A 1JJUA 3W2DL 1ZLWK 1T4KA 5A2IH 4GG6F 2P8PA 1FFPB 3L16A 2LLGA 5FOBB 5JW5B 1TEGA 1QA9A 1UM4H 3MYJA 1I3RB 3GDCA 1MCFA 4L4TA 3H42L 5BVJB 4AENB 1OQOA 3EAKA 1JL8A 2GT9B 4C47A 4QHUB 3BIAX 3F05A 3QDMB 4JZJB 1RSYA 1U8IB 5DGRA 4L4TB 1IKFH 4HCFA 5DJCB 5CSBA 4OGXH 3V10A 3IXAA 1NL0L 1VLXA 3VSTA 2BNUA 3FRPA 4X4YA 5IBLD 3SO5A 1F3RB 4PTTA 1X9RA 1B0WA 5DK2A 1JGVH 3MGAA 4QNPE 3K6FA 1MY7A 3TZVA 3G08A 1NSNH 1QWUA 4WWNA 5ABDE 1GYAA 4HWZA 1XSOA 2Z4QB 3S88H 1QYGH 5GRUL 1X5JA 4LGPB 3RWIB 4F58L 2EE6A 2ITDA 1WV7T 2YMTA 2NY6B 2ZOWA 5IMLB 2PPEA 4HG4J 3P40A 1WWAX 4BXSV 2CHXA 2ADFH 4M9OA 1QI3A 4ERSL 3CMGA 5CZXC 2WXIA 1E8YA 1UYWH 4PJ8A 1ZEAL 5CZXD 3KPLB 1MCIA 4GKNB 4GQQA 4MX7A 3QT2A 4IRJB 5D71L 4ODUA 4ZMVA 1FNSH 5K93A 2O93L 4WHTB 2DLFH 3L4UA 4CGTA 3A47A 1G6RH 2HJKB 5CLWA 4BK8A 1BZDA 5KVDL 4JM2F 5I1CH 5KVMC 1M71A 3B1TA 4GAJL 1H6FA 1KN2H 3ARFA 4BFEA 1P9MC 4Z3GA 1BG9A 3RB7A 5HPOA 3P2TA 1JK8B 3QEUB 2AKRA 2EH7H 1TO5A 3QULA 1GL4B 4RCAA 4F33A 1U41A 3GS0A 1GC1L 4G7VL 5JQIB 1AKJD 3L3OC 4B53A 1U8OA 3MA7B 3TO4A 2VC2L 4FZEH 1AFVH 1DQMH 1LNUB 2A6KA 5CD5C 3FYIB 1MG2C 2OSLA 3G5VB 4ZPVA 2AI0L 3BFWA 2FT7A 3GBMH 5DZOA 3BX7C 3F58H 2XKNA 2CUHA 2GQHA 4LP4A 1S7XB 2EYSB 2WNKA 2ZKHH 3S5LG 3FCTB 5KS9E 2H1PH 3Q6FB 4QRRE 5D7JA 1BWWA 1KELH 2XVKA 4PRHD 1MXDA 4ZXBB 4PLJC 1S78D 5I17B 3KDMA 1DO5A 2K3HA 3W0WD 1JCVA 4FKHA 1XFPA 3ARFD 3HC0A 2EDRA 4AEEA 5C0AB 4E9VA 1CI3M 4MA1C 5IB5B 3BP6A 2X05A 3TEZA 2A1WH 2NTFB 3RYMA 3FXIC 5TDNA 2FK9A 4HU2A 2FHCA 3EFFB 3KXFB 3FTYA 1CL7I 3MLVH 1SQMA 5EU5B 4AV5A 3GTNA 4N2AA 5I1KL 3W9DB 4G6AC 3WELA 5LBGA 1NLDL 4G6AD 2VLKD 1QWNA 2DM4A 2YPKA 3HB3B 3T3MF 3V52L 4NWUL 4XBPA 2CO7B 5IB4B 4LXFA 4KDVA 3SGKA 15C8H 5DS8B 2PPFA 2BY0A 1LLAA 3IJHA 1XV8A 4M8VA 1OGTB 4TVPE 1UB6A 4DGWC 5DZNA 3VNZA 3KS0J 5GS1C 2F54D 4RISH 4R7XA 3RL1A 4BK5C 4KXDA 4U6YA 2R0WH 3QDMD 3B2PA 3FT4B 3QQ4A 4PY8J 3TVMB 1HSAA 5IHBA 1QFUH 5BZDB 2ZONA 1JF1B 1CDGA 1QNIA 1OD7A 1T21B 1E8ZA 3RY5A 2XHNA 3DSFH 2ZOUA 3D39D 4TULH 7FABH 3A24A 1XF5B 4ZFGL 3FB5A 3MXWH 2HCZX 2CIIA 2NSMA 5F1IB 2F7RA 4UT9L 3N1PC 4KMLB 3UG5A 2O6EA 4DP4X 3O6FD 2V9UA 4NUGH 4H0GA 2EE9A 3BUDA 4ZW6A 5LNDA 3NSDA 4MAUH 4NQTA 4YHZH 5TQ2H 4CBPA 1CLVA 3VFGL 4O02B 3SO3C 4TSAL 1ZT1B 2HFFB 2FR4B 1BG1A 4MZRA 3B9AA 3D50A 4GUOA 3ZDXE 1NCAL 3HPJA 5J11C 2FAUA 1UCBH 4TUOB 2VJ8A 4KVCL 1BJ8A 2VIRB 4PJXB 4BA8A 1J5OH 2YUXA 4H2CA 1N12A 3MNVB 3B9EA 2FE0A 1D9KB 3F7RA 4BCXA 4PR5B 1JZ5A 4G70B 3BAXA 4KZEL 4B9JA 5KVFH 2AMGA 1HILB 3C8DA 3CC5B 4FG0A 2BHYA 3FCSB 4NKQB 1EIBA 4GPVA 4G80A 5EUOF 3E2HB 1TZAA 1UEMA 1MG3C 2A83A 1CL7H 1S7RB 5KW9H 2XN9A 1FRGL 2RB8A 4ONGL 1ADQA 1HEZB 5HYJD 1IX2A 2YFNA 5FM8A 3PGCA 4LSSH 4EVNB 4M7ZC 5BRZB 3TF7C 2ZX8A 3GINA 5KSBB 3L3JB 3MBEA 2OMWA 4PMEA 3WMPA 1CCZA 5C0DB 2X9WA 3L95A 3PHQA 2YN3A 4W9GC 1ZHBB 3G6DH 3ZJAA 4N86A 3NFNA 4BUGA 5F9WB 3MLZH 1HCYA 4U05A 1XF4B 2LABA 3D30A 4O9HH 1RKRA 2EKSB 3KPTA 3OTTA 4C58B 5JA9A 3LIZA 2JKTM 4AEIL 2JFCA 1UOKA 4MXWL 4JHWL 2X5PA 4LPWA 4MAZA 1RZ8A 4Y2OB 1HL5A 2X4TA 2F19H 3FB7A 1P69B 3ROLB 1FH5H 2C9AA 1GS7A 1IAKB 1CE1L 3RI5F 8FABB 1G94A 3GSRB 3BUTA 3DMMC 1KIUB 2D73A 4Z18A 4JG5A 4R83A 4A7GA 3A6CH 1QAWA 4JHWH 1MWAL 1ULVA 2F7IA 3QJTB 3F7QA 3N06B 4PJBF 3WBDA 3IDNA 2AJYH 4LPUA 3LNHA 1R3HA 3V6FA 1YNTA 2Z35A 4PJGB 1G7PA 3UPRB 4ZZKA 1AKJB 1J12A 3G6DL 3ZDXF 5FHBL 1FVDA 5IOPB 4YHLL 2DB8A 2EACA 1RZQA 1WA1X 3LAFA 1OGSA 3CC5A 3MTXA 5E9DE 1F45A 4ALAL 2I25N 3B2DC 2X1PA 3IKKA 1L9PA 4J23A 4GOSA 1E4XI 2X3BA 5HVHB 3ZOAA 2JK5A 1X5AA 3HMXH 5AZ2L 1KENH 1A8JH 3DKHA 2UZXA 4YO0A 1SDAB 1P5UC 4Z7VB 5A16A 3QBTB 4KFZC 3LN5B 4ADGA 2GI0A 5E6YA 5SWQA 1ZDQA 1X9LA 2NY6D 4H0HB 1A7PH 2H9GB 4MMXC 1C8PA 1X5GA 3BQUD 4RMVA 2FGWL 4H8WH 3WTVA 2IPUG 4WTQA 4PJIB 4UOJA 5BS0E 2NY5H 2VR5A 2WQSA 1U33A 4TUJA 1RMFL 5TPWH 4MJIB 4NQCD 3KVQA 4HSAC 2VMFA 3AVEA 1XCTA 4ZFQA 1JNNH 4UIMA 4XO3A 3OV6A 3CFBB 1IGCH 2G4EA 1EXGA 1RK0B 3P4LA 2CG9X 4IOSA 1YN7A 2VABB 3ARZA 4UUJB 2K8MA 5IW1B 5C0DA 2H1LM 5BJTB 5I1HL 4J6IA 2Q2LA 3OHXA 4YDKH 2OR8A 4LLVA 3CFKB 2B9AA 5L0QB 2IDQA 4OZIF 3S3PA 3MXWL 5JOPD 2Z8WC 5HI4C 5A40E 4WUUE 4FLQA 3TU6A 1QPPA 1NC2B 3LXUX 3ZPDA 3RUGB 4Z3TA 1XZWA 1LMKA 2A83B 5LGJA 4JO2L 1VACA 2A77H 4P2QA 3FT0A 3W82A 5BPPA 4BE6A 5C86A 4U31A 5GGQL 3RGHA 3HZKB 2K3TA 1R5VB 3QHFL 2ESVB 1BZ8A 2BIIA 5KBNC 2MHAB 3VXSA 1F1DA 3T6ZA 2XXFA 3KPPB 3N0AA 5F2FA 4Z7OF 4D9RD 2R2EB 3RKPA 3C9NB 5ESAA 5ETUA 1HHKB 3FU5A 2V3EA 3NFSL 2YGQA 5F21B 4G9FE 1MFBH 2CCWA 1YMME 1ERNA 1VZHA 2Z6FA 2OA9A 3PWNB 1CF8H 5CD3B 5HGDA 1U8KA 4R26H 2D8KA 1BVOA 1B0RB 3SGJA 2AEQL 2HLFD 4JQVA 4OTXH 4I77H 4MJID 5I6MA 1M6OB 1MI5A 4LCYA 4YSPA 4F37F 4MSWB 3FB5B 3PAVA 5E6UB 1MCDA 2O72A 2XA3A 3E9TA 1BBJB 1ZXKA 3W56A 1PD1A 5CAYB 4FZEL 3KH3A 1JWMA 1MWAH 1Q9LA 1SUHA 2D4DA 2VZ3A 1A5FH 3G5YB 1HNGA 4G3YH 1FFPA 5DQ9B 2ZTBA 3WHE1 4HZ1A 4TUKH 2Y07L 4M6NH 2VC2B 1N8OE 4PJHA 2DRUA 3T4YB 4BWWA 1BEXA 5LJYH 3H6AA 5JLZB 5IF0B 4PI0A 4C4BA 3GS4A 1M53A 1MQKH 1TJHL 4HFUL 4B5ZA 2XVBA 3FN0L 2HLEB 1JWUA 1VFBB 2XN1A 4HQQL 3SZ6A 5EBMA 5D1XE 2VDKH 1S7SB 2RA1A 1FNSL 2BX5A 2CGRL 1D3CA 4U7MA 4YHNA 1C16B 2ICEA 2XWEA 1T89C 2GSMB 4YEEA 3MLZL 4OZIE 4GKNA 1BYNA 1UYWL 4I77L 5MEOB 2D9CA 1NGXB 1L3WA 2FX9L 4P2RB 1E5AA 5EU5A 3WKNA 1A6TB 5B38A 3Q44A 4N2NA 1TETL 1G6RL 1B4JL 3BPLC 3NOIA 5C0CB 2J72A 3KR3L 1MZZA 2YGVA 2X38A 4M93B 3K72B 4AJYV 4AQ1B 3BKML 3C8KB 2VQ1A 1MHHB 2HG5A 3QJHA 3VCLA 4ATTA 1IT9L 5E2UL 1TQVA 3QUMB 2VLKA 2WSDA 3P73B 5LUMA 4OKVB 5JOEA 4GUCA 3W5MA 3IVKB 1GMIA 4IK7A 1E2VA 4JFEA 1A4JA 4FXKC 3W1ZA 1F3DH 1WWWX 2BLFA 3NK4A 4PBVC 4F37K 2HT2C 4Z0BL 3A67L 1DP0A 1J5HA 5JOPE 5TF1L 5JO5A 1FVCB 8CGTA 1AZVA 5JW3L 4P2QE 3TN0C 4HF5H 4K23L 3MO1A 3LEYL 5BQ7A 3FQUA 1K6QH 3MRFB 1BM7A 3RTQC 4AH2A 3ARBC 4NQED 2VXVH 1LE9B 3P3YA 1PX8A 2RAMA 3HZKA 3KWUA 2H2PD 3GKWH 4MAUL 4RAUB 4OI8A 1R9FA 1JZHA 4ISVB 4NIKB 1MI5D 2JKWA 4EOWL 4JY6B 1QA9B 3L1FA 5LCVA 2HVBA 3IDJA 3N1QC 4KUCD 2NY5L 4IBTA 4OLVL 4XN9A 2BFVH 3HAEA 4OV6F 3B2UD 3NSCA 4O5LH 1D9KC 3BZ4B 1HEJC 3K4AA 4U1MA 4AQ8C 1A21A 4WEMB 3RBSA 2G3MA 4HEME 2W9EL 4A2LA 1P4LB 2XN9E 1MJJB 1FG2B 4LFHG 5E70A 2EDNA 5EBMB 1ZLUH 5JOFA 1ZSHA 4NKDB 4FQHB 3JV6B 5EN2B 3RDTC 3WJMA 4DIXA 4FMFA 5LKNA 2EE2A 2CHDA 1M7XA 4FXKB 2CE6A 4MBRA 2P42B 3C87A 4G8GB 5MENB 4BH8B 5D7LA 2AEPH 4WI5A 5D1QA 4GXFA 1GOFA 4KUCF 4X5WB 5LVEA 4ODXB 4YXHH 3MLYL 2VMEA 3CDCA 2QSCL 3PUCA 2FVNA 1UENA 2DQEL 3N85L 4J3OG 4PB0L 2O61B 3TESA 4AGNA 2NX5B 4WWPA 2ZXEB 4YBLB 1IMHC 3WNPA 3KLDA 2W88A 1Z9PA 4H8PA 4U1NB 3L7FB 4M7KL 2W0FA 4H1LH 4JVUA 3EH2A 2YN5A 4JL2A 4X8JA 1NZRA 2ZCZA 3ARGC 2F19L 4UU9A 4S1QL 2PCPA 1HAUA 4HUCA 1O6VA 3H9SD 3OWEA 2X4QB 2WVUA 3MPCA 4DCQB 3BDYH 1Q90A 2KKQA 3AG2B 3BGFC 1HX0A 4PV8A 5HGHB 4PJ7A 5HGBB 1BXVA 2RJMA 1ITCA 3DGGB 2EILB 4JQXA 3LQMA 3BAIA 3NSXA 3HI5H 3BP5B 4NZRH 4HJGB 3EHBB 1W16A 4KRPC 3SDAD 4GUPA 5FR3A 4U1MB 4U49A 5BQDA 3HC3L 1L7TH 2LLNA 4HDIB 4QHKI 3ZHKA 5FLUA 1AG6A 4UM9D 3V4PH 2HG0A 1E4XL 5I1CL 1T0MB 1MFNA 3C08H 3REWA 4FTVA 3RI5K 1LO5B 4DW2L 3ZE0F 3FO2A 1MRDH 5JHMA 3L7EB 3BP7A 1J8HD 1OZUA 2OJ1A 3IBOA 3QXVA 3QR1A 4G8GD 3GO1H 4NT6A 4CMMB 1ZEAH 2Y2WA 5FYKU 3JTTA 4KVNH 5IEHB 1AP2A 1HI6B 2BMKA 4NQDB 3L5IA 2WYZA 3HVNA 3STLA 5EZJB 1ZLUK 4JLRA 1RURH 1I8IA 4UIMB 4UV4L 4MDRA 1OV8A 1FL5B 1DR9A 4H40A 4ZODA 5T3XE 4EE2A 3RJOA 5TE4H 5E8OA 2P5EA 2RGSA 3MU3A 5T1KD 1T03H 4OM1H 1SJVA 2HB0A 3S88L 1Z9MA 4NNPL 1KTRL 2DYPD 1DJHA 1MCWM 5DD3H 3ZO9A 1UD8A 4WFHE 1S7VB 3AQDA 5KOVC 4RWYL 2YO3A 1DQQA 1Z5YD 3QPXL 3OGOE 2YSSA 4ZPTB 4YBHA 4ZX3A 3E38A 1A9EB 1GYCA 1MHPL 2GIMA 2WO3B 4G7QB 3VFVB 3TO4D 5C8JB 2DWDB 4NUPA 2H26A 3NEXA 3FQYA 1J9TA 5CCKL 2WWOA 2F7PA 3CSPA 3HPLA 2WSPA 3ZGHA 3RWEB 1D7DA 1KYOJ 3OG6B 4YDIL 3DO4A 4Z7NE 4Y9FA 5M7QA 3QORB 5I75C 2AW2A 4LLAA 2AK4D 1W72A 3MOAL 2WNGA 4O02L 3VDAA 1BVNT 3CSGA 3WY3A 1C7SA 4EI0A 4HULB 5I1EH 1HKLL 1YMMA 4UDUA 4MA8L 3L17A 4MQXD 4AKPA 4GAYA 2ODIA 4CVZA 1BGXH 1CT8B 1IFGA 2WZ6A 4HUVA 2HUEA 3JZ7A 3S3BB 1TJMA 4WO4C 2GJZA 2LAGB 3RGVA 3DIFA 3UX9B 5AYQA 2I85A 1HH9A 1YYMH 3GXFA 3ZTJH 2A74C 3SCMD 3BCDA 5BZDA 2OMXB 4O4YL 3LQAH 1KYFA 1R24B 2NXZC 4J3OF 5DXWA 2ZCLL 3HZYA 3OKYA 4JO8A 4Q74A 5T3ZL 1MCKA 3U25A 5I9QC 5IROA 2EEFA 4I2XB 5EZIL 1OP5K 2ADYA 4NN7C 1JRHI 5E8EB 4ZNEA 2Y36L 4RIRB 3AS2A 2WLHA 2W9LA 4PIRF 5FO7B 1B4LA 3MRMB 4S0TD 4PSPA 3WN5B 2YQBA 4JFVA 4ZXBC 5EO1A 1QI5A 5INCA 1X6LA 3PV6A 4FFYA 1B4RA 3AS1A 3D9AL 1MJ8L 4N1CA 1ZDSA 1FORL 2YAHA 3LH2L 4K7PL 3D39A 1JXDA 2GUYA 3DIDA 1JV5A 3EH1A 4ZTPH 1BQLL 1D2OA 4RAVB 3L6FB 3ZDYE 4OFDA 2WLYA 4YZFF 1J86A 4EOWH 3RWEA 1KLGB 4V1DB 2WO2B 3VSVA 3VFRA 4XPFL 5BXFA 5JIIA 2JKLA 1TZ8A 5A43C 1EAPA 1S7UB 2BO0A 2QV4A 1F3JA 3GBNH 4CUCA 5C8JA 3JWNH 1N6UA 1AR1C 2EDTA 4YXLL 3FB8A 1P84K 1MREL 4UTCA 4YL4A 2GBAA 2YPLD 3OKOB 1NBYB 4N24A 3ME0B 3S4SG 1FPTL 4QY8B 3LV3B 1YG9A 1COBA 1ZRUA 2Y5TB 4W81A 4EDXB 2GABA 2WTPA 2J43A 2VXQA 1QOKA 1L9MA 2G2PA 3CFUA 4X98A 2EKSA 2IAMD 3LVEA 4A2DA 3VMOA 2YOCA 1DSFL 2NZIA 4JS7A 4MJ4A 4PSRA 4JJ5A 5LDUA 4J5VA 5E2UH 3H3BC 3Q5OA 4RGNB 1CD0A 2OTPA 4FNRA 3HJ0A 4R5VA 3EJYC 1L9SA 3L3IA 3WHE0 4LIQL 1E4KC 4UBDD 1ZT7A 3KR3H 5C0AE 4UBDC 2YIHA 4B9KC 1CG9A 1KTCA 4NENB 4EI5C 3MC0A 2AZUA 4Q6KA 2IBGA 1T21A 3CX5J 4YLQT 1N0LB 3KWWA 4APQB 3L3GA 1OT2A 3H6JA 3TO2A 3ULVH 4UB0H 3ZBMA 3ILDA 3VFMA 1OVZA 5E8EA 4AGOA 3KL3A 4CVUA 3US0A 4HJJH 5EC1B 4XVTL 4AQEA 1EV2E 1HS6A 1X7QB 2C8NA 4OGXL 5TF1H 2ETWA 2PABA 4EQ2A 1RZGB 3DROA 1JPFA 5SWQB 3WKML 5HGBA 4JDTH 4UCFA 5JMOC 3PJSA 3H9SE 3Q13A 3SQBB 3RE0A 2WLKA 4YJZL 5ESQB 1NEUA 3TBYA 1LL1A 4XBPB 1CT8A 1CICD 2O30A 1IC5H 5SWZA 4UQBA 1XSIA 4L23A 1F3DJ 2DWEA 5E1AA 1FE8H 5B38G 3PFQA 3ECWA 4NZJA 4V1DA 2X6AA 1SFDA 1QEWB 1SZNA 3F7VA 1MLBA 4PRNB 4H25A 3HCVA 4AL8C 2YS4A 4WUUA 1T5XA 1EZLA 2BERA 4GO8A 1GH7A 2OV0A 1IGIL 2ZX9A 4RGNE 1UOVA 5CR8A 4QUOA 3FT2A 3DBXA 3TBBA 1URZA 4BA0A 1DCLA 1WEJL 2W65A 2VXQL 2GYSA 2A73A 4UT7H 4E9TA 2ESVD 2EDFA 3O9WA 3S5LB 4P9HL 1E42A 1GGIL 2KL6A 3FCTA 1UTDA 3O0LA 2J57A 1PYWA 1G7HA 3QIBA 3SDCA 1OF2A 5TQ0L 2KT6A 5D7LB 5ALBH 3AW5A 3T2LA 5KS9B 2HJLB 3HKZA 4X2UA 5H4YA 2CWRA 3Q48A 3T0VA 4XNMA 1BAGA 4ANKA 2ZG2A 1IC5L 4F7EA 2WYIA 2NXYD 1NGWB 4OZHB 3CVIH 1A6UL 1ZPUA 5HYIA 1NLBL 1U3HA 1A9VA 3WFBL 5JPNC 5DJXB 3SDYL 2YQ3A 4HG4K 4KJQD 5IB4A 5ANMB 1BOGB 3G6JB 2KYIA 3QR2A 4KJPD 1BIHA 3ZHFA 5TH2A 3FU3A 2BJMH 4WFED 1J1OH 2XFXB 1SN5A 5J1TC 3ZKND 1D2PA 1OGPA 3FQNB 2G5BA 1E43A 2YAOA 4KNTA 1GGYA 3IDJB 5C0BE 3BE1H 2OMYA 4HK3N 2L7UA 3JVFC 4YHIB 1EJFA 2A6DA 3R19A 4CSTA 2GAZB 4JPWH 5CN2A 2OR7A 1LO5A 2QVMA 4ZMAT 1JUFA 2YXMA 1S7RA 3OLIA 4PJ8C 3SDDC 2A9MH 3UABA 3HJEA 3OAZH 3KLHD 2B4CH 3HAEH 4ZSOB 4DWHA 2BZ7A 2XV6B 1FIGH 2YGPA 4BK4A 3H56A 1RVFL 3RX5A 3FOMB 5IV2B 4NKOA 4Y1TA 1WFJA 3IKCB 2XWRA 2BVEA 4D3CL 4YL9A 3ZU8A 1KXTB 3V9CA 4TN9A 3QIUB 4HALA 2UV3A 3PABA 1F1GA 2ZAGA 2J73A 1AGBA 5DHDA 1RZFH 43C9A 1KWGA 3E3QE 3CHXA 3EFFA 1WS7A 1CLOL 3MRJA 3QXDA 3L3OA 1PIFA 1PU0A 3IXAB 1X44A 1I8AA 2NT0A 4XPGH 2MKWA 4O02A 3RL2B 4APQD 4DPCX 4FXGC 1QFWM 1TEFA 1UACH 4PS3A 1X4ZA 1A7OH 2X87A 4P2CG 5INDA 3QDGD 1MREH 1YEEH 4E9WA 3O6LH 5D7JB 3QFJA 4Y16A 2Z1KA 4L1DA 3DPDA 3AQZA 5DJ2A 3JXAA 1WCBB 2VLRB 4JPIB 1OPOA 5ES4B 4KAQH 2HN7B 3VD4A 5I15H 1TVBA 3DK0A 5EC2A 2CHZA 1MUJA 1P5VA 3ARPA 2ZOTA 2BC4B 2LVCA 2XG5B 4WEBH 3V0DA 5HVFB 1FSKC 1NGXA 3EBIA 3VWJD 4I1RA 1N3NB 4QYOA 3DK2A 3KL0A 2X10A 3L5WA 2FQFA 1VPOH 1ESOA 4AM0Q 5F89B 5DJYA 1JVLA 3P2DA 2RQ8A 3GM8A 3Q2WA 3D69A 5D2NC 4MB3A 3ATDA 3PP3H 3SYQA 1JYXA 4S2SB 4Y16D 4A2MA 2QQLL 3LHAA 3QXWA 1ZLDA 4HUVB 3BAYA 1QPXA 3JWDH 1IEAA 3BLBA 5F0MB 5D55A 1JK9B 2G5UA 2D03H 3K91A 4L1LA 4YDVB 4XPBH 1RIUH 2GSIA 1IGFH 1RP9A 3F00A 1H8SA 4PW3A 4FQCL 5IG7A 4EMZA 5IQLA 2M2DA 3EOBA 4F93B 4WW1B 5I1IH 2VAAA 3FYEB 2NY0D 5KVGE 1Q38A 5DZ9A 3LNFA 1AAJA 1DBMH 3LZRA 4X6EA 2V0AA 1XXDC 2AJYL 1KYDA 2AZAA 3CZGA 1F1AA 1OSPH 4Z7NB 5DFVD 5JPNB 3Q6FA 1X5YA 2DPKA 3UC0H 4AGPA 2X2JA 2IQ9L 3NJHA 5DCCA 1KFGA 3TNMB 2YUWA 5FDYA 2W1NA 1TFPA 3OMAB 4XP9L 2GCYB 3PNWB 1W0WB 4NKIH 2Y72A 2AQTA 4QXWA 3B7YA 5D96B 4HGKC 4BQ8A 1EHNA 4QRSB 1I53A 1DVFA 1U8NB 4JFDA 4WTWA 1U8IA 3JWDL 3ZZQA 4JM2A 3BT2L 5T3XH 2NY2C 4AEIH 3C60C 4X8CA 1MFCH 3GUTA 4CN6A 4JHAH 3HB3C 2ZF9A 4TNFA 2EXWC 2K6ZA 4NJ9H 4AZ8A 2EXWD 4KQ0A 2MPVA 3F7YA 1IGJA 4DETA 3D87B 2WUCH 3VGDA 4AQ1A 4G1EA 4EXKA 4M3KB 2F54E 5CLZA 1WIUA 3RJQB 2I07B 2B2XH 3DJ9A 4RA0C 5T5FL 2HT4D 4UT9H 2F74A 1OAQL 3I2CL 1PIGA 3LJ3A 4OCNC 4K94H 4RGMC 1MPAL 4U1LA 3PRZA 1S9VB 3INOA 3VH8G 5HY9B 2Q1EA 5HDQL 4LPVA 3QHTC 4BINA 1BFVL 2DQGH 1OZTG 1KTDA 1T83C 1ORQB 1B0GB 2JB6B 2FX7H 5TGBB 5KYXA 4QRRA 4L1TA 2YC1A 2ZYSA 4HJSA 4UQCA 5AALA 2WINB 5DK0A 1NAMB 4I48A 4GQPH 1YEIH 3IETB 1IVTA 3H2PA 3ETBJ 2HJLA 1XF3B 4XMPL 4QTIH 1VDGA 3MLTB 4XCCL 1H0DB 3INUH 1T7YA 1XGRB 1H0DA 5HGAB 4PB9H 4LZKA 5T1MB 5AAPA 2B4CL 2G3ZA 2X4UA 4YXLH 4MCYA 4NZRL 2MQ0A 4Z5RA 3RY4A 3L9EA 3DMMA 1KBBA 2L7JA 2VB5A 3NZ8B 3Q9QA 3MFFB 1U3NA 5L8JB 4Y9BA 3U46A 1LDPH 2NYYC 3RZWA 4YIQA 4FG6C 3GC3A 3BW9B 4HCRL 3CFMA 5EBGA 5KANG 4ES9A 1SMDA 2BJML 4ZUWA 4BM7A 2UY6B 4X83A 2UZYB 4FQJL 4R4BA 4YR6A 1E30A 5KWYC 4ZMPA 2BINA 2IALA 2E8ZA 3MNDA 3SB3A 5ERWB 3H0TA 2LU3A 3TS8A 2QGDA 3U4AA 3VGEA 1GZQA 4FP8H 1WTLA 2YD7A 1UXWB 2VDNB 1JPTH 2X1OA 1FL3B 4F1ZA 1AZNA 2OJZL 3VG9C 1C16A 2ICEB 3BRDA 4WTXA 1ZKAA 5CF3A 1CXFA 4EJ1C 5AW8B 5B22A 2WBJB 1Z5HA 3QG6A 5D5MA 5BJTA 4PBWD 2MTPA 3S3CB 3MLYH 4YXHL 1ZJBA 4S1DD 5BS0D 1ZHKA 3WLWD 1KZYA 4DKTA 3LD8B 4XCFL 1PKQE 5H8DA 4GW5A 1MOEA 1NCWH 3R8BB 2FBOJ 2OW6A 5C07D 1OOAA 3N1MC 4U3SA 2CRIA 4WJG3 4NPJA 3SBWC 4XCNB 3TBSB 2WNXA 3DV6B 4XN1A 3TYGH 4B0MB 1IZJA 2K7PA 1ETB1 5ID1A 3ULUH 4GQRA 4AE0A 1J8HA 2CDGA 3L3KB 3F5WB 5AD0B 3KWTA 1PYWB 1CPUA 1ZT7B 5A3IC 4PU2A 3RPIB 1L0YA 4X9BA 4LU5L 1I8LA 4HV8A 2K7QA 3PWPB 3D8MA 1CR9H 5DTFA 5CGYD 1G0XA 1A1NA 4KK6C 4U3XA 3LOWA 1SM3H 1JMZA 1YPZB 4KK6D 5BS0A 3QDGE 4LF3A 5CCKH 2EUWA 1ND0A 1GS6X 1ID5I 3F58L 4G6MH 4WVRA 3VYPA 4ZW7A 4AYGA 4PLNC 4MD5B 4K9EH 4TSCL 5D1XB 3GQFA 3UGUA 4FLHA 1AFVL 2BRRH 5C0RL 1PZAA 1VEPA 3HIZA 4HUNB 1NBVH 1IEAB 1B88A 2G2RB 1L9QA 4JAMB 2C7UB 4KNQA 3B56A 2GSGB 1PJ9A 2B59A 1DL7L 1XCWA 5DLML 4ODTL 5DLMH 5C08E 1RZJC 3BZFA 3ULVF 4S2SA 2VSMB 3SBRA 4UNTA 3EHBC 3KM1A 1GS8A 4Z95H 5IVXF 1OPGH 4LKCA 4OM1L 2VLRD 3T9WA 2F6AA 3CDGB 4R4NC 4H7VA 3MBXL 5FA4A 4OLWH 3P54A 3NIFE 1JI1A 1G7QB 5DJDA 4XXWA 5EV7A 4D0BA 1D5ZA 1RURL 4KH2A 5GGUA 1LEIA 4OCSH 1HZKA 1A3QA 3LIZH 2E5EA 4FLOA 3DX6B 1F4YH 4JBSA 5FUZL 4AQ8A 3IGKA 4MJJA 1AHMA 1XF4A 2VDQB 1HCVA 3AG1B 5IBUG 3WNOA 3F2LA 2OULB 2VABA 4NRYB 1NM9A 1A6AB 3FCBA 1A4AA 3QUYC 3SOBH 4GLRH 3GXDA 4OJDH 1ZANL 4LARH 3NZHH 3TA3B 3FSZA 2IGFH 1QNZL 1HT6A 1QKZL 2PP7A 4KHTL 2BY1A 1UH2A 4YPGA 1MCBA 1ZLEA 4Q7DA 5C7ZA 4F7PB 3QR0A 4HW6A 4RMWA 4CN1A 2ID5A 4J3XA 1OK0A 1SYSB 4ZFOB 1I1AD 5HHXH 2MRYA 4PJBB 4JFOB 5D4QA 1AXSB 2VDKB 3WXVL 1GZHA 2VDQH 3HUJB 3OKLB 4XPFH 5CD5D 2G75B 2VDKL 3T0EE 3O3DA 2QT6A 3EF7A 3WHXA 4ZMLA 4KRLB 2CXGA 2QR0B 5I6NA 5GRVL 2NT1A 3V5HB 4LLDB 1T89A 2E8YA 3ARQA 3S37L 2GY5A 4N26A 2RALA 4M93C 2EDBA 1NJ9A 1Y1DA 2XY1A 3C6LA 4F2MA 4Z7WF 5IWLA 5I2IA 2FSEB 4HLZH 4IIQA 4WU5A 4BWTA 2XPYA 1UCTA 5EU7C 2P8MB 1W2KT 3DRQA 3PWNA 2Q2EB 4HIIA 4JFDD 2EABA 1YEJH 4S1SL 1E7VA 1T5WB 2VITB 4WWID 1SMOA 5TH2B 1QHQA 4X6DB 3QIUA 4LBEA 4AJWA 5EF3A 1O5PA 4IRJD 4L9DA 3WDIA 4A1RA 4Z6AT 1S3KH 2HKHL 5J1SC 4GG6A 3IJYA 3KW7A 1AY1L 5T1LB 1U3HB 5FYLE 2E27H 2H4EA 3INUL 4HZAA 2R23A 4OD3L 4OFIA 3AU1A 2ISDA 5L88H 3MMEA 4NQSA 2J3SA 2DJ4A 5F7WC 3VFMB 1RJZB 2GJ6E 3N42F 3MLXL 3G9VA 2R0LH 2HPTA 3JT2A 4XC1H 4HOXA 4F80A 2VXTH 4LVEA 3ZT6A 4IK6A 1AGFB 2R4RL 4KKBC 4L0PB 3MGTB 5D1XC 5E1GA 5FUOL 5AAMA 3SOBL 3Q05A 3ECUA 1DJIA 5D1XD 3ARBA 4XNXH 2QADC 3NJGA 1J5CA 5DZLA 4HWBL 2P28B 2DQGL 4GW4A 2JCCB 1OGAD 3WE1A 1OE1A 3B5HA 4MJHA 5EA0L 5DDHB 3N43F 4FI8A 1FYTA 3ARTA 1E2ZA 3D34A 4R7DB 3S34H 1Q94A 2FEDC 2H3XC 4OLWL 3V4UH 3QO0A 1QSVA 2JJTC 1CD1B 4FHBD 3U1PA 5CR1A 1LQBC 3AY4A 4KXZI 4YDLB 4A63A 2WXQA 1QW8A 4H88H 5F70A 5EEZA 2JQAA 1IE5A 1F42A 4EDXA 4R4FH 4GI6A 5DD3L 5IMOA 2G60L 4B0MM 3D6GA 3D7PA 1VKXB 3ILEA 4KXAA 1NBVL 2CRMA 4OZIB 4XNZB 3FQTB 4IOFC 1FFQA 1PSKH 4YC2B 1FGVL 5FPIA 4W6YB 4G7RB 4DP7X 2V5YA 3I6LE 1GIGL 5TE4L 2B15A 1GJIA 3QDJE 2BSDA 1XR8B 1T2XA 3LKQA 1E27A 2HUHA 3KPMB 1AKPA 1Z6JT 4N0FB 3S36H 3VWKB 2FO1A 5J4MA 3QFJE 4DZBB 5D1QD 2AQ1A 1HXMA 3IGUA 4HT1L 3WE6A 3SJVE 3MAWA 5D1QC 1L4IA 2W0FB 1WBYB 2OMUA 3AAZA 4GP4B 4J3WA 4JFSA 4TRPH 2FBJL 4Y4FC 2WLLB 3WV0A 1MWAB 4FFVC 4G8EB 5C0IA 3PP4L 5AVUB 3ARED 2O61A 4FNLH 3B8YA 5AZ2H 3QQNA 5F9OH 4AQOA 3HR5A 5T3ZE 2MQCA 4HV8B 1AXTH 4LL4A 4WI0B 4XE0A 1Q0YH 4NC1E 3ZK0A 5I0XA 2HTLC 1KGUA 4XN5A 1SLWA 4ALAH 3K8LA 2IPKA 5T33H 1RZKC 4XP1H 1BEYL 2JKXA 4IRZH 4LEEA 4GS7B 2OSLB 3G5VA 1CFNA 2WLIB 3FUHA 1Y18B 3BQUC 3QJXA 1RJYB 3IMUA 3NIFB 4KZDH 1OM3L 4XMUA 2VR3A 3MLXH 1XCQA 2LTQC 3AUVA 4GO6B 5DJ0B 4KKLC 3AU1B 4OJCA 3Q2NA 4O2EA 4POYA 4WCYH 5DR5H 2FZ3A 3WS3A 1J05B 4PG2C 1Q1JH 1G6VK 2VR4A 3N9GL 4RFNC 3ZDXB 1NMBL 3BZ4A 3EJTA 1QSEE 2B1HH 5IUCA 4QRPA 1KCWA 2ZCKL 3OKOA 1UJ3B 3QAZB 2X44D 4NO0A 5TTRA 3HVDA 4R2GD 2WIIB 4YDZA 1E0OB 1GZQB 1QX1A 1VFAB 1BYPA 3MRPA 1EFQA 4GKZB 3F64A 4N5ED 1XH2A 4OD2A 3TBCA 5J6HA 3VXUA 4BZ2H 3U6RB 2JKIS 5KN5A 2DM3A 4GNKB 3QIWA 4O51A 4XNBA 2IDSA 3S37X 1SBSL 4I0CC 3T71A 3VGBA 1UG9A 4I0KA 1YN6B 2EDDA 2C9UA 3ZHDA 1CF8L 1OKEA 3LDBB 2HX8A 2QPEB 4LBAA 1CDIA 1MFBL 3IDIB 1FRGH 1NCJA 4ANXA 1CXHA 1UACL 5E2TL 1AGEB 4P2RD 3ERXA 3O3DB 2YD9A 4MNHA 2R7EA 3IMVA 3ZLQC 4G6KL 1EZVX 2A4EA 2P7TA 4QJ3B 4ELKA 4GKLA 1BQUA 3GS7A 2X4RB 3WXVH 4E0RB 1AXSA 3QC5X 1G0YR 5DK3A 3T2OA 1XBRA 1KLGA 1FFTB 4YFDB 1FAIH 4L4VE 3NJMA 5DK0B 2GEEA 1HL8A 3QUMA 5A2JH 3O2VL 3TIDB 5DTFB 2DQJH 3CN0A 1T6WA 3H3PL 4HA1A 3RILA 1GSKA 4ODWB 5JR1L 5FFOA 3J7HA 3VD3A 5KYXB 4V1DE 2BCMA 4P5TD 1RUPL 1I3VA 3QEGL 1TMQA 2ZKXA 4X6DE 2Z65C 1XO8A 3LRSA 1SEQH 5E00B 1AVAA 1BD2E 1NMCB 2AK4E 2IGFL 4XNZC 3D4ZA 4EBQH 2LR4A 1PLBA 5JQ6H 1AI1H 1IGYB 1SXNA 2QVTA 5C09B 5E51A 2DQIH 1PDKA 4MS8C 3GGWB 3U2SA 4RIRA 1K8IB 1ILUA 1CE6B 1N8ZA 3BESR 4Y1AB 2Z1PA 1XGZA 4HKJA 5HI4D 2BP8A 3TVMD 1SY6H 4RMQA 1OWRM 1LEIB 2VQTA 4JY6A 2H32H 4WENB 2ZP0T 2BNRE 4LSUH 2XDHA 3IFOA 5FECB 2PO6C 3NCYS 5D5MB 2AAAA 3NJKA 5EIIB 3SPVB 4MHHG 3QDME 4A7SA 4E2OA 5FECA 2QELA 1FAIL 3S36X 4G43B 2F1BA 5HD8C 3VDBA 4L9LC 3VFUA 2YEZA 2ZICA 4BFGA 1MXGA 2JIXA 5DT1H 1YY9D 5FS5A 4Y88A 4L8DA 3WIHL 1J88A 2DKUA 3VXMA 5GRJH 5JW3H 1OT1A 1TQCC 1JWMB 4IBLT 3C2SA 4IDJH 2DN7A 3PNWA 3U30C 4KO9A 3VXNA 1M2VB 3GBLA 4KK8C 5ALBL 4IJ3B 4K9EL 3HMWH 3HMXL 2UZYA 1UD6A 2ZXQA 4JZJA 2L04A 4LF3B 4LSPH 1TNNA 3SDAB 5E8OB 4N90D 1URIA 4U1IB 1BJ1J 2QLYA 4K7FB 4DTGL 1DUZA 2FH8A 5I1KH 1IT9H 3HG5A 4UNUA 5B39G 1NDGA 4GAGH 1H3PL 2IJ0C 4JN2A 4GW1A 5L2KE 3V5KB 2X4RA 4JO1L 3ULUF 5LG6A 3FO0L 1G7LA 2QTEA 4PJ5B 2EDXA 2C4XA 2FLMA 3TNNB 4K0OA 2VL5B 4KK9D 1E6JL 2R7EB 4NGHH 1RFDL 4AUUA 2P5WE 3II1A 5AVTB 2NW3A 3V6OC 5BO0D 2XZQH 1KELL 3Q01A 3OLGA 2NY7H 2D7TH 2W60B 4OUUB 4U2ZA 1CLYL 4POZC 3GSNA 2V5SA 4PJAE 5IV2A 4JDTL 2H2PC 4TTDC 1PCSA 3B9KA 1A3RH 1R3LA 3IFOB 1TTFA 3GSUA 1UD4A 1OM3H 5KZCD 1KF9B 4NQCA 1UA7A 4YHPB 5DD5L 4MD0B 4AUJA 2A9CA 1JFHA 5I8OH 3BSZH 2C3VA 5D7SL 4GXVH 4OM0H 2OYLA 4FL4B 1YCSA 3MODH 3D0AA 1TVDA 4OCRH 4ECNA 4QHNA 3QQXA 1RUML 2OI9B 4WI4A 4FF9A 3B3IA 3PWLB 4GBXB 3KPOB 2OCCB 4L4VB 5HJGA 1TIUA 4HWUA 2EVJA 3QIBD 4FQJH 1XR9A 5MI0B 1IO4C 4QRFA 2NYKA 4LLWB 5KYWB 1BDYA 1PX4A 2OXHB 3ZDZB 5ADPH 4YSDA 2DQTL 4OZGA 4L48A 2YAFA 1YPZE 4PJIA 4KJYA 5JZ7D 5DS1A 5EF0A 2O6PA 1RJYA 5T3ZD 1S7QA 4R26L 1VENA 3PG2A 4MLIA 5EO9B 3V4VB 4W6XB 1QBMH 3FF8A 4G8FA 1JWSA 3PGDA 5ICXB 4PB9L 3FC8A 4F58H 4P23A 4JO2H 4XXDB 1KT2A 3U0PA 3TNMA 4D3CH 4UTAA 1T20B 2Z93A 4EI6A 5IFHL 2EINB 2AS5M 4OB5H 2Z64C 4AK2A 2MOVA 2F18A 3IWUA 5IVOA 3MLUL 4UQ9A 4HPYH 4DJMA 2BNRB 4ZW3A 3G9AB 1E3ZA 3IKCA 4XMKH 1EEZB 4U3HA 4XMWA 5DRWB 3QXTA 2EIBA 5DD1H 4C56D 3BE1L 1NCIA 3MLWL 4PWFA 4U4IA 3L3HB 1ZTXH 3VXRB 5GS0L 5KZCB 4AIZA 1IBDA 1A8ZA 5CILH 2F58L 3UTPD 3H2QA 1N6QL 4N0FA 3VWKA 4P57A 1NFDE 4NZTL 5TFSH 4HIHA 2WOYA 2G9HA 4K3DL 4P3CH 3P4MA 1XIWA 4U1KA 1BVLA 1MIEH 4TM9A 5FGSA 3VI3F 2Q3ZA 3KEHA 2VR6A 1E6OL 2DBJA 1B4TA 4MFHA 5JQ6L 3GJFK 2KHAA 3F7PC 5E8NA 1P7KB 2V9TA 5DHVA 5GIRA 4DUVA 1C5DB 2YEVB 2X12A 4N20A 3WNLA 3GK8H 4EI5B 5JIDA 3OSKA 4MTMA 1KC5H 3KPSA 3I85A 4AH2B 3PLYA 4N2GA 2CPUA 1AGCA 1IKOP 4JM4L 3B9KD 4QR7A 5GGRB 1DBAH 1QQDB 5E4AA 3IFLL 4APQA 2BC4A 2XG5A 1AS6A 3SY0A 4D8PB 4F91B 3CQQA 4PJ5E 1X7SA 2W07A 4NO5B 4AEHH 3BVVA 4U7KA 1G7LB 3LS4L 4UT7L 3WKQA 5HYJE 5ICZB 4JGMA 1U93A 2VJ0A 3OZKA 4XMVA 3ARDD 4I18A 1KJ2A 5A16B 2I69A 1MF2H 5C0BD 3RGBA 1DVSA 1RHHB 1QLEH 2LV4A 1S5HB 2A1WL 3ATAA 3V7MA 2CBOA 3DLQR 4QF1B 3MRKB 1J48A 3M1BA 4OZFB 3VFSB 5CZVL 5ITBH 3ECQA 1IKNA 4OQTL 5C3IA 3ZDZF 3WAJA 3SY6A 1WCQA 3HZMB 4OCMC 1QSEA 4FN0A 3ARGD 4YDIH 1P7QD 1QEWA 2MOGA 1N5YL 4Y0GA 5DYFA 2Y24A 4PR5A 2R29H 2XVGA 3LKQB 3I50L 1NBYA 5AYUL 3B1UA 2AJUL 3UTQA 2OI9C 2VC2H 2PUQT 1MH5B 4KX7A 4RSVA 3VXUE 4BSVA 5TJWK 1UM5L 3UBXI 4J3OC 5I1LB 3P73A 1EAPB 4I7ZC 5L9DH 1TQTA 5DQJA 2B1HL 1O6TA 3FB7B 4HAFA 4KX9A 4U1GC 1GPOL 4KKPA 4QHPA 2WMPA 4NNPH 1I7UA 1VFMA 3VI3E 3MKKA 3T4YA 3SGDH 4L1SA 4FULA 3NJJA 1KGXA 4UAOB 4OW6A 1UWXK 4R7DA 1GAFH 5DU7A 3MSPA 1CMOA 4PI2A 4FRWA 3VWJB 4ZUTA 4A7QA 2FYVA 4I13B 3HFMH 3MV7E 4WO4D 3DA0A 3S7GA 2X89D 1HH6B 1NA8A 4LSDA 4F8QA 5T33L 1M9WA 5DJXA 4YHNB 4O2FB 2C1OA 4ZX5A 2BXZA 2YWZA 1M05B 1MHCB 2CRYA 4MVBC 1WSST 1EEUA 2MH4A 2VM3A 3I75B 3OLDA 4G6FD 4PQXA 5FWQA 4AW7A 2HWZL 3UTPE 2RQEA 4K73A 4Z23A 5KSVB 1HXYB 2MNUA 4Y2DD 3MV8E 1P5UA 4LOUC 1KOAA 2ADIA 1OPGL 5F3HB 4TOYH 4LOUD 4QEGA 4RDBA 3WXWL 4HS3B 3S8GB 5DJ6A 3DXAB 4LASL 4WI9A 5KJ7E 2FWOB 1S5IH 3H9SB 3JQOB 4W93A 5I9QB 4L3FA 5SWZD 1BBJA 5SX4H 1G7IA 4IS6B 3IPBA 1LO3L 3TO4C 4N8CH 4XPAH 3ZDZE 5E4EC 1IKFL 3ZE1F 4G11A 2M83A 5EU3A 4A67A 4E9SA 3A3YB 4G6ML 4ZTPL 1R46A 4N85A 4UT6L 5EOCJ 4TLSA 3SGDI 3GMLB 4NT6B 4XRCA 2LU7A 3VXUB 3GB7B 1SNRA 3D9AH 2PP8A 4KO7A 3HC4L 4PFEA 5IHZA 1SXAA 1HAWA 3KL5A 2J6EH 2AK4B 2AC0A 2WIIA 2Q8AH 5HYEA 4HD9A 3EW3B 4BRJA 4GXUM 1DLHB 3MNWB 1E9QB 3GJFH 3MRRA 1D7BA 4JKLA 1BAFL 1DQJA 2O5XH 1CGWA 8FABA 4YGAB 5BRZE 3SBWA 3AMLA 1ONQA 3MV9E 1WE5A 3SGEI 3K74B 5GGVL 5IBTH 2A9NL 4YBQC 3IFPB 1IGMH 2Q3AA 2NXZD 3WJJC 1WAAA 3DYOA 4F7EB 1OTTC 4GQZA 4NO3B 4OGZA 1OEZW 2YRLA 4W68A 4C55A 4G6JL 2APWA 5CSZB 4YDJA 2RFXB 4OZ4A 3LZNA 1WBZB 2ZP8A 3KLAA 1RU9H 5B8CC 4IGBB 3GIZL 4IU3B 5IQ7L 4B9ZA 5DRXA 2HKHH 4KY1L 4EI5D 3V4PB 2OMWB 3G04A 4QXUH 2B1AL 4OAWA 5D7LD 5CIPA 1WS8A 4MD4A 5E2VH 4YDJB 1H5BA 5L4MA 3FDWA 1AZZC 2H1PL 3TBVB 4G8EA 1JCKA 3REWB 4CKVX 3P9MA 4H2AA 1TYEB 3OKEB 2ED8A 1PZ2A 1XF2A 2JCWA 2X1WL 1HXMB 4L0YA 32C2B 5I1DB 4DQOH 3N44B 5DLLA 3P69A 1UHVA 4U6HB 3P3RA 3SE3A 1A1MA 2KMWA 4LKCB 4TPRL 3ZE1E 4U2YA 2OL3A 1V3LA 3FUFA 5F96H 2W80C 3FU7B 3KYKH 3UDWC 3UCQA 2YPLB 1NM4A 3N6YA 2ITEA 3HPJB 3CK0L 2WWKT 5EUKA 5KS9F 5F7AA 3U9UA 3D09A 5ERWA 1WGOA 3T2PA 1EJ8A 4YX2H 2XFGB 4XE5B 2VUYA 1QBLL 3X1NA 3F8UB 4Z0BH 5IFJA 3M1OA 4DKFH 2J20A 3BI9X 5IMKB 2PW2A 3NPSB 5G4OA 5FLVA 4P49A 4UB0L 4X0NA 2APTA 4X6BB 4D0DB 4OGAD 3SDXB 3EJYD 3STLB 2ZX5A 5E56A 5MP6L 1QATA 1KMGA 3O0RL 3BVUA 4IU3A 4CVXB 3T0DA 3QEQE 4NLAA 5DD6A 3L3JA 4YSCA 3V0VA 2J5LB 5DUMH 5DA0B 3T65B 1QRNE 2PO6B 3LKNA 4Z3FA 3CFCH 4EF3A 4LL9A 1OSEA 1I7RB 3NDZE 4XWGH 4RGMB 4CC0A 2EH8L 4NJ9L 2BRQA 4DZ8B 1GAFL 2DM7A 2XWJB 4IRZA 4HMCA 3RFRA 4UTAH 1UM5H 4YC2C 3X12A 5DS8A 4ZYKA 1ZTXE 3BSHA 4ODVH 3MJ9A 3NESA 1I9IH 5C0BB 4YGVB 3VM5A 3I50H 4BCZA 1PEWA 5HI5C 3O6MH 4NLHA 4ALAC 2ZYRA 4X6DA 4DN4H 3BEVB 4S1QH 4X8XA 1WP6A 2IDFA 4HUKB 4U1LB 1H6TA 4ODTH 2F8OA 5BVPL 1T66C 3E1F1 2QKIB 2ZKMX 1WO2A 3ABZA 4YDMA 4OF5A 1EO8L 3CZUB 4KK5D 3PUUA 4DQOL 1EFXA 5T3XD 4LAQL 3EYFA 3CXDL 3HBGA 4XO5A 2L0DA 1YUHB 1MRCL 2R29L 3T6VA 3T4AC 1XGUB 2VSKB 4AE1A 1XSKA 3HG1B 1AOHA 1DBKH 2FD6H 3NZ8A 4PLJD 1E50A 3PY9A 5EPMA 4PGZA 4JAMA 3KNBA 2NCMA 5E2VL 4FFWD 2K8QA 2W0LA 1JRHH 1MFAH 3BUYB 3VVVA 4MCYB 5K5YA 3S8FB 3SPIA 4QRQA 1UM4L 1ZV5A 2A0LC 2IH1B 3ZHNA 4FFZL 5D1XA 2ZOKA 5LGHH 3PGDB 4DO5A 1W0VA 3RTLA 3IYLW 3CZEA 2YJQA 3TYFA 3REVB 3NACL 1HN1A 1MF2L 2LTQB 2Z3FA 2X0UA 5IVZA 1I8KB 4FTVD 3ZR5A 4ZS6C 5DJZB 1D5XA 1DJSA 1D5BA 1TPXC 2HJKA 2OCJA 3AJ7A 4MNQB 4HIJB 4F8LA 4WSJA 3NP4A 4Q4EA 4A04A 1F8TH 1Q9OB 2AVFA 2AABL 3JTTB 1U4FA 1CGVA 1UWFA 4KJPC 1DVQA 1BREA 1XDTT 4GBXA 4K3DH 4M5TA 3FQRB 4MB5A 1S9XB 1EUTA 1K5NA 4KKAC 5AAWC 2VXSH 5E5LA 3TBWA 1AGDB 1M7DB 3HEIB 2J6EL 2AERT 3QO1B 1GMEA 1UOLA 2YD2A 3L2MA 1AJ7H 4BSWB 1N19A 1RIHL 3HC0B 25C8L 2HMIC 1NCBH 2J25A 2NX5E 2XZCL 3BHBA 3MLUH 4FLRA 1HTYA 3X13B 1EO7A 4ZXBA 1WAAF 1KG0B 2DOCA 1LDPL 5E9AA 5D7EA 3QEQD 4HIEB 2DH3A 4HK0B 3O6FC 4XPAL 5E6ZA 2DLIA 4TYUA 2NR6D 4WI2A 4AM0A 3BDXA 4ZO6A 1KB9K 4NFBA 1TCRB 1P5VB 3Q8CA 4O58H 4AMKH 1AQMA 1FDLH 2EYRB 5CU9A 2F53E 3ZQXA 4IEFA 5C0NC 6FABH 3IGFA 4MD5A 1UZ8A 1KGCD 4ACPA 3NBNA 4GSQA 4P4RA 2GJ6B 5DMKB 3TL5A 2YBGA