3PLYA

Structure of oxidized p96g mutant of amicyanin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHGFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Proline 96 of the copper ligand loop of amicyanin regulates electron transfer from methylamine dehydrogenase by positioning other residues at the protein-protein interface.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3plyA00
3QJRB 2UXFA 1MG3C 2OCCB 1NICA 4AZUA 2XV0A 3PAVA 3QJTB 4E9TA 3ASOB 1CURA 4G71B 3NSYA 3JTBA 2AANA 1AG6A 2BWIA 3ASNB 5B1BB 3IBOA 1OF0A 1PLCA 4DPBX 2PP9A 4E9XA 3FS9A 3FU7B 5B7MA 1AZRA 4YL4A 1NDTA 2GHZA 3U25A 1FWXA 3ZBMA 2OV0A 3G5WA 1ASQA 2DV6A 1ZDSA 2XLLA 3PXLA 6PCYA 4F7KA 3ABKB 9PCYA 1PNDA 1WAEA 1TU2A 1IC0A 2YAFA 4E9VA 3EH5B 3NT0A 4BXVA 2XV3A 1WA2X 5I6OA 4JKNA 2IH8A 1L9SA 2EILB 1SFDA 3QJVB 4G7QB 3EH4B 4L0PB 1ET5A 1IKOP 2BP0A 2E86A 1F56A 4CSZA 3FPXA 4PCYA 3PAZA 3NJNA 3T9WA 4HALA 5ANHA 5AFAA 3PPSA 2A3TA 2J57A 1B3IA 1PZAA 1JXGA 4G7RB 2FT8A 1KV7A 2VW6A 1ILUA 3QQXA 3HEIB 4YSTA 2CCWA 2XU9A 3AG3B 3N55A 3WNIA 2YQBA 4YSCA 4DPCX 1AS8A 1WA0X 3ERXA 4MFHA 4A67A 1OE3A 2AZUA 3MBWB 1BYPA 1NIAA 5B1KA 2PP7A 2X88A 1V55B 2UX7A 4GP8B 2DY2A 1DYZA 3D12B 3FSVA 4KNTA 1XMEB 3AY2A 3ZX1A 3MX0B 1OCZB 5B7EA 2CALA 4YSEA 4E9YA 3PCYA 2ZWNA 4KNUA 1M56B 1PCSA 1ADWA 1A4CA 1AAJA 2GB2A 4AKQA 1SJMA 1JXDA 5I5JA 2BZCA 1OE1A 2HLEB 4EF3A 1PLBA 1EHKB 4ZK8A 3X1GA 1OCRB 4UAHA 1AANA 1ZDQA 5I6KA 1QNIA 3EH3B 4P5RA 1W6LA 1SF3A 5TK2A 3FQ2A 4W1TA 5I26A 3CVBA 2BW4A 3QJQB 4QLWA 1J5DA 5AKRA 1SHWA 4E9WA 1GW0A 4YVUA 1AS7A 2J55A 3NP4A 4GY4A 1A4BA 2XUWA 3L45A 5I5MA 2XYBA 4DP7X 2XWZA 1V10A 3X1NA 2IAAC 3OQRA 1OV8A 1RKRA 1EZLA 2IDQA 2VMJA 1J9TA 4BDVB 1BXUA 4JHVA 2R7EA 4P5SA 2MTAA 1L9QA 3UABA 4A2EA 1FFTB 3AG4B 3UADA 4DP2X 1BEXA 2XXGA 2WO2B 1E30A 2QDVA 3UAAA 5IY5B 2HX7A 2VW7A 3WKPA 1E65A 2YXVA 3WG7B 1OE2A 1ASPA 4Q8BA 1PF3A 1MDAA 2PPEA 3OMIB 2UXTA 2JXMA 2DWTA 7PCYA 4KO7A 2X87A 1AZBA 1JOIA 3FPYA 4CSPA 3S3BB 2DYSB 4HHGA 1HAUA 4JHUA 1L9RA 3WIAA 1E5YA 3PLYA 1L9PA 1NPNA 4BK5C 2JKWA 4YSSA 2YAHA 2YAMA 1NPJA 2YXWA 3X1FA 5B3SB 2GC7C 2AFNA 2HXAA 3OM3B 4DP4X 3T71A 1AOZA 2CBPA 4NERA 1NIFA 4Q89A 1ZPUA 3NJMA 4YSOA 4ENZA 2HZHA 4YVNA 1NWOA 4A2HA 1MZYA 1JZEA 2FT6A 1JERA 4DP8X 1N70A 2XX1A 2PPDA 3CDZA 4E9QA 1SDDA 3CVCA 3FU8A 3NP3A 1BQ5A 1PLAA 1QHQA 2BP8A 2IDFA 2YAPA 3NJFA 4AI7A 1RCYA 3T6WA 2YAOA 3AW5A 3IE9A 1TKWA 3QJUB 3GXUB 4UF7C 1BQKA 1JVOA 4UANA 2B3IA 1KDJA 4F2FA 2PPCA 2I7OA 1BYOA 1WS8A 3OMAB 2ZONA 1KCWA 4KOCA 1R1CA 5PAZA 2Y1AA 2BO0A 4BXSV 1JZGA 2GBAA 1A8ZA 1VLXA 2VM4A 2AVFA 1CYWA 1XB6A 1UATA 3NJJA 1SF5A 3S8FB 4AX3A 2YAEA 4G72B 2QT6A 3TBCA 2VW4A 3FSAA 5LDUA 2UXVA 2EINB 2R7EB 3AG1B 1X9UA 4M3HA 3ABMB 4A2GA 4GP4B 4WTQA 2QPDB 1TEGA 3WI9A 2FQDA 2WO3B 4FAAB 3CVDA 2FWLB 3S3DB 2FT7A 1PNCA 2I7SA 5B1AB 2GC4C 3FYIB 1NIBA 2XX0A 3SBQA 4FA7B 4K9JA 1GS7A 1ILSA 1AZCA 4A2DA 4W9ZA 4HCIA 1NZRA 4DP5X 1CYXA 2FNWA 1IBZA 3EHBB 1RZPA 3H56A 2FJSA 2IWEA 1IUZA 2OJ1A 5TK4A 4DP6X 5EHFA 4DP0X 1JVLA 3DKHA 1AZUA 1NWPA 2FTAA 4YSDA 4X4KA 2FQFA 2WSDA 4BWUA 2PP8A 1MG2C 4KNSA 2UXGA 1ASOA 1NTDA 2BW5A 1IBYA 3IN0A 1PAZA 3AG2B 3NSCA 3UGEA 2DWSA 4YSQA 5A7EA 2GSMB 1E67A 1W8EA 2Q5BA 3X1BA 4M4RB 3C75A 1MZZA 5I6LA 2VSKB 2BWDA 3NYKA 4N4YB 1SDDB 3ZDWA 2BZ7A 1E5ZA 2QDWA 2VM3A 3KW8A 4YSUA 1KGYE 4WKXA 3TA4D 3OD3A 5D4JA 3NJGA 2BP0B 4GYBA 4G7SB 1JZFA 2HX9A 2XVBA 1I53A 2PPAA 2YARA 1W6WA 2VN3A 4HIPA 5B1JC 2H5UA 1ET7A 4E9SA 1ET8A 4E9RA 3EF4A 1BXVA 1ID2A 1JZJA 2HRGA 4KOBA 5AZUA 1BAWA 1KCBA 5FC9A 1X9RA 4HZ1A 3WKQA 1V54B 2I85A 3CZUB 1OCCB 3ABLB 1PZBA 1URIA 1XB8A 1AG0A 2EIJB 2RACA 3AZUA 3FSZA 1J9QA 1M9WA 3FT0A 2IDSA 1KBWA 3JT2A 3T6VA 3PAUA 3S8GB 3NJIA 4KO5A 1SHXA 1OOWA 1GSKA 4F2EA 1CC3A 2NRDA 1KBVA 4GXFA 1JZIA 1HFUA 5E9NA 4YSRA 4BDVA 1WA1X 6PAZA 3SBPA 3DIVA 4PAZA 1DZ0A 2IDTA 3IEAA 1AACA 1L9TA 2W8CA 1BQRA 2IWFA 1XB3A 1RZQA 2BHFA 2H3XC 1BXAA 4KO6A 4DPAX 1PMYA 5I6NA 2PCYA 1J9SA 5B7FA 8PAZA 3DTUB 4HHWA 2H47C 4HAKA 5I28A 2QPEB 1GY1A 2MRYA 4TXVB 3RYMA 2JFCA 3OMNB 2UX6A 2HX8A 3S3CB 2J5WA 3FU7A 4QKTA 4DP1X 3BQVA 2GI0A 2P80D 3FU9A 2XXFA 1SNRA 2CAKA 1ZIAA 1A3ZA 4KO9A 1ZV2A 4HCFA 3ABGA 4HCGA 1GY2A 1CUOA 2Y69B 4BWWA 1A65A 1ZIBA 5I6PA 3NSFA 3T6XA 1AR1B 2PCFA 3NSDA 3BVDB 3TASA 1A4AA 1KDIA 5F7BA 1GR7A 2B08A 4GP5B 4AKPA 4N8UA 2EIKB 4NB7A 3QJSB 1HAWA 2N0MA 2YAQA 1ETJA 3H4FA 3UAEA 4YSAA 1N68A 3TBBA 2GIMA 2XV2A 1M57B 2P80A 3WNJA 4G70B 3H4HA 2Q9OA 3FQ1A 1AQ8A 1AIZA 3FQYA 1J9RA 3GDCA 3UACA 3X1EA 1NIEA 3GYRA 2LLNA 3HB3B 2CUAA 5D4IA 1NINA 1GYCA 4A66A 3QPKA 7PAZA 3FSWA 5I5IA 3SQRA 2FQEA 3TU6A 3V9CA 4A2FA 1J5CA 1PZCA 2J56A 1QLEB 1FA4A 1WS7A 2CJ3A 4RH4A 3IN2A 2DYRB 4DP9X 2PLTA 3CG8A 5F7AA 2AZAA 4AKOA 2EIMB 3NJHA 1GS8A 3T6ZA 3NJLA 3N2JA 3NJKA 5PCYA 3CDZB 2FQGA 1L9OA 2VSMB 4A68A 1GS6X 4BWTA 2HRHA 4YSPA 5I6MA 2ZOOA 1SFHA 1OCOB 2IDUA 5B1JA 2PPFA 3ZIYA 2BP8B 2IH9A 2TSBA 1JZHA 1NIDA 3FYEB 3KW7A 5D4HA 1KYAA 2ZXWB 1YLBB 2IWKA 3SBRA 1JXFA 2W88A 2TSAA 1AS6A 1PY0A 1T5KA 3V9EA 1TEFA 4NAJA 3X2QB 1AZNA
chains in the Genus database with same CATH superfamily
1QVOA 1QO3A 3L3JB 2DI9A 1MPAH 4D7PA 2AK1H 5I1AB 1JNNH 1NDMA 2C9QA 1S5IH 2FEEI 4Y5XA 3T3MF 1K4CA 3PAVA 3QJTB 1GHFH 4DK3A 4JM4H 4PJEA 3NRFA 3KL5A 2BWIA 1N59B 3UPRA 2PW1A 2R9HC 1K4DA 1PLCA 1ZWIB 4P5MA 5DVOA 4P2QB 2HKAA 3A47A 4PLJC 4YHPB 4C4KO 5JPNB 2IPTH 1VZIA 3NCBB 2BSRB 1CB4A 5F9AC 4PGDA 4FFTA 1I85C 4JG1H 5DFVC 2Z31B 4M1GH 1ITCA 4B97A 4P2OB 2UY6A 1WAEA 4N9OB 2BMKA 3R7QA 4XGZA 1RL1A 5EF2A 3BAIA 4OCXL 3EW3B 4O02A 3RLSA 1WAAA 1MCBA 3JYBA 3BP4B 4N2EA 2Q8AH 1F90H 1T7VA 2B1AH 5I15H 1A6ZA 4GW5B 1ET5A 4OU3A 3CCHB 3HS0A 2HKFL 3DRTA 4OGXL 2IANB 3V6ZB 3L13A 5T5NF 5D93B 3BD3A 5HHNA 1HI6B 3VDBA 4OUOA 4K9EH 5IHWA 1I7RA 2GJRA 3HVNA 1ZV9A 1JXGA 3WKNA 2Y22A 3G6AA 3F5WA 3KEDA 1F58L 1CGSH 3EDJA 1F11B 4RIRB 1Y0LB 1HHJA 2LABA 1WA0X 1E9PB 3IDNA 2OYKA 1HOCA 2AQQA 3D39D 3LPWA 3QEQA 5BZXA 4AE0A 1IB5A 4WGKA 3RNQB 3SDCA 1DYZA 4JQXC 1TTCA 1YPZB 5HYSA 2PWEA 4B9KC 1FFRA 4KKLC 1LEGA 1WGVA 4I3RH 4BZ1A 3MX0B 5J1AA 1GGCL 2E47A 5GGTA 5F88A 3DURA 5BPPA 1UVQB 3O0RH 4YLCA 4E9YA 3ZR6A 3WFCH 4NRZA 5DRZA 4X0NA 2FIRT 2XNAB 1F41A 1URLA 5T1LA 2HSIA 4FTVB 2WPGA 3NQIA 1UB5A 3SPHA 3EYUL 4KJQC 4TRPH 5FGSA 4DKAA 3B2UC 4ADGA 1KGCD 5F0PB 4FYRA 3PUCA 1I3RA 4HUMB 1L7TH 4HFWA 1XGZA 1IAKA 4ZTPH 1NCWH 5IF0B 1QHPA 2C7FA 4MCZA 5A1AA 4WUUD 3VFGH 4P2QE 3VW3L 3FQRA 3EOTH 3MROB 1NAMA 4HMEA 3VXMB 5AG9A 2Q2LA 3CZGA 1A4BA 4WI2A 1G7IB 3MRJB 3R06A 1YNLH 5E1AA 5JPMA 2OMTA 4PJ7A 3ARBC 3X14B 2ZSVB 5E9DD 4W4OA 2IDQA 5KTEH 2A9NL 3UAJD 1MNUH 5EZIH 1BXUA 2EDYA 2MTAA 3FFDA 2AEIT 3QUZC 1G1YA 3UADA 3AABA 4I77L 3UYRH 3MYJB 1JCVA 1N64H 3MUGB 4OV6F 4Q9RH 1P1VA 3ES6A 1S7SA 2VDQB 5GS0H 3GHBL 5AVVB 2AP2A 4KVNL 2IANE 1U95B 2HLFC 1OGAE 4JDZA 4CSPA 1B2WL 3HNVL 3ET9F 3LKRA 3OLGA 3QJOA 4K8RC 3VD4A 1P4LA 1HAUA 4JHUA 1FV1A 1L9RA 2WXOA 3HLAB 2HT2C 2VSDA 5ICXB 5D1QB 5E99L 4C54A 1VFBB 3IDYB 1NPNA 1BJMA 3MRBB 2PABA 4KJYA 4PV1C 1L6PA 2HCZX 2KPWA 2FH6A 3L3OB 2Y7NA 4EBQL 1OD9A 1O7VA 5A7BA 3VFUA 5KEZA 1YPZE 2DICA 1FHNA 1YECL 2OSXA 4MVBD 4WVRA 1YEKH 1EAOA 1KC5H 2ZG2A 7FABL 4FQHA 2YO3A 4S1RL 1KB9K 3CVCA 5DZLA 3K6OA 4PJDF 3QNYB 4OZGF 2VR7A 3DX4A 1S7RA 5DMGD 3VCLA 1R5WA 4O5LL 2RCSH 1PLAA 5IJDC 5B3JE 4PB9L 4UZUA 3ULUF 4FTVE 4PJBA 5KSAC 4M93B 2YHGA 3TIEA 4FG6C 4AV4A 5MEOA 4UF7C 1T04A 4Y2LA 3PPEA 2AV1B 1BW8A 1W2KT 3MRGA 3KPOA 3NCJL 2B3IA 1AYOA 4R9HA 3H85A 4QOKD 4CVZB 1A1NA 4ZOAA 3KCPB 1OARL 3I6SA 1BGXH 4PJAA 1VJSA 3R0NA 2VUKA 3GI8L 4P4KA 1TVHA 1WFOA 4KMTH 4XPGL 3VXOA 5E03A 4K23H 4LP4A 1IFHH 3HG5A 5MI0C 1UATA 2CKBL 5DMIL 1JDAA 2O5ZH 3VXTB 3DV6A 2ICEA 2GUOA 1GCYA 2J2ZA 2WJ5A 2HFGL 1HN1A 5JHLA 5DRNB 4Z3GA 4Y16B 3RDTC 2WXGA 4P5TD 1P7HL 1X9UA 3HJ0A 2AV7A 2IH1B 1HCZA 4PJGF 2QPDB 4UB0H 4WDIA 5BV7B 5IW6A 2R1YA 5D7KE 2BOBB 3EJCA 3U1QA 1RK0B 2GSGA 1EV2E 4IMLB 5BQ7A 3LXCA 4OJFL 4YGVA 1INEL 5GZOC 3MRPA 3L5XL 1YEGL 5K9KB 4FJ6A 4FLOA 1H8NA 5EOTA 4K3JH 1RIUL 5KG9B 4OZIF 4X4ME 3LKQB 2F19L 3FQXB 3TBTA 2ATAA 2H6PA 3DX2A 5D1QE 4XWGL 4J4PA 1AGDA 2JJSC 2JKRM 5TFSH 1RZPA 4LSSL 4AQEA 3D0LA 1JN6A 4WU7B 1FI8C 3L3GA 1J8HB 2NUTA 1LWHA 1TZHB 5DJ6A 4EJ1C 4OI9A 4XOEA 3IMBA 1N0XL 2CO6A 5AVRB 2J71A 2L7QA 3L08A 2X4PB 4XVTH 1CR9H 3GHPA 3O4LE 1MG2C 3ZKNC 3GXMA 3RTLA 4ZUSB 3BUDA 3VD5A 1J10A 4FEMA 3NSCA 2MCMA 3AG2B 5K59F 4Y9BA 3CHPA 4NQEB 4XTRD 4B5EA 1ZHNB 3EBAA 2J6EH 1XX9C 3ULVH 3MR9B 1TQCC 4K71B 2KYIA 4AT6A 1N6QH 5L88L 4EI6A 4CN1A 2WB1A 4C56A 4ERSL 4JFFD 3CHSA 5E94B 1XF2A 4ZAKB 3I50H 3HBGA 1UM5L 1O9VA 1R19A 4N2FA 4UT9H 3ILQC 5SWSA 1T7XA 2X4RA 3KJ6H 1IGIL 2VR6A 2A1WH 4XBMA 3VXMD 1MHEA 2VL5B 4IRJB 3T4YA 1C5BL 4AIXA 1P4UA 3RY4A 3WY3A 4AH2A 3MC0A 1EZVX 4W9KC 2HJKA 2CO7B 3TV3L 2XT1B 5HPOA 4JHWL 3CLWA 1EBPA 3QHTC 4EDXA 4OGZA 4NM4H 2KUTA 2GSIA 3BT2H 3FB6A 4N90D 3WKQA 2P49B 1T80A 5F1IB 4IOIB 1KBBA 1D6EA 3L3HB 1U58A 1WZ1H 4TSAL 3U1SH 4V1DB 3M17A 2VJXA 1DQQA 3QUYA 4GO8A 2AK4A 3ZPDA 3TBSA 4H1LH 4RBPH 3WFEL 5E08L 2OL3A 2WCPA 4I2XB 4XB3A 3SKMB 4WUKH 1PZ5A 5FK9A 4AQ8A 5IB1B 2P48B 2X9ZA 3B9EA 5ITFB 3D08A 4R5TA 3GLDA 2Q76A 4J39A 4AZ8B 1JGDA 3CXDL 4U1GB 4G80B 3DIVA 5D1QD 1QA9B 4WNJA 2R2EB 1AACA 1P84K 2Q8BL 4XPTL 1U92A 4WEEA 1U9KA 3VSQA 5E6YA 1KIRB 4BH8B 1IE5A 2VZ1A 4G3YL 1NKOA 4MZ2A 4ZMOA 3PE9A 3HZMA 4I13B 5LQBL 3H42L 4K0OA 3T8XB 5EF3A 4K2UL 4KTDL 4TULH 4DGUA 5BUPA 2WHVA 2BP3A 2ISDA 2N7SA 4TYUA 3CXHJ 3UPAA 2WIIA 4UIMB 2XOTA 1ERNA 2OZNA 3QCVH 2ZQKA 1DBMH 4XAWL 3DHPA 3L5WA 1XO8A 1HIMH 3GMMA 5A2LH 4RESB 1PL3A 4S2SA 2ZKXA 2K70A 4NQEE 1J1OL 4XN2A 2IV8A 4NC0B 1G9NH 3BPNC 1UT9A 2E7BA 5ACMA 5GHWL 5TGBB 1EHLH 2BVTA 3WEAA 3UTZA 3GJEA 2OW6A 1IBBA 3V95A 1FNSH 1QAWA 1FL3A 2CRYA 3LRKA 3H9HB 4OF3A 3PJSA 1UEMA 5DC9B 5ISZD 2A6JA 2Q1EA 4Y2DB 3D48R 4AIZB 3VI4B 3DECA 1R3LA 4KZEH 2WZPA 4EDWH 1JVKA 1CTOA 3UC0H 1FFPA 2LVEA 3QFDB 4IDJH 3RZCC 5JZ7D 4LLWA 1QYGL 4LSPL 2KHAA 5IROA 5DO8A 2V3EA 4JY6B 4OKVB 5IJBC 3BRFA 1NGPL 3GSXA 1ZLVK 3THML 5DK0A 3DUUB 4QR7A 1YYML 3D34A 3QPKA 2DI7A 3QRBA 1P6WA 4PD4J 4Y16D 4N0FB 3ECWA 3GMNB 3NIGB 5EDSA 2DQIL 2QVFB 2NSMA 2XTJC 3QJZA 4IIQC 3QAZC 1DL7L 1MI5A 2NMSA 4DP9X 1B4LA 3RVWD 2J72A 4LRNL 2AZAA 2EZ0D 4V1DE 4WWKA 4OQ1A 2EIMB 1YMHA 3L5IA 4YGAB 3T5WA 1LO0L 5D70H 1F2QA 4JFPA 1T66D 1ORSB 4OM0L 3CDZB 3GD1C 4F9LC 1SY6H 4YLBA 2LW3A 1ZLSH 1NCHA 1ZS2A 2XQ0A 2PPFA 2VITB 2ZZUT 3AM8A 3N6YA 5GRJH 3MLTB 3TCXA 3HKZA 3K1DA 1JYXA 3NN8B 1RUMH 1PS3A 3V8OA 1JPEA 1CGYA 4LAJH 4X4YB 2ZOTA 1J8HD 1HSAA 4GBXC 3ZMNA 3F01A 4LL9A 4AMKL 5I0ZA 1E4XI 5ID0B 3IDMB 3QWOB 5TD4A 5JDJA 2ZP9A 2CUHA 5D1ZI 2UXFA 4CNIA 3G3LA 3QK0A 4I8DA 4OV5A 1EH9A 3F7KA 2Q20A 4RAHA 1P6FA 1DSYA 4OFYD 3PP3H 4XO4A 1B88A 5J57B 2BOLA 5DHVA 5DRWB 1MJ8H 3JTBA 4NC1C 3DHMA 3S35X 3X17A 2YSSB 5C08B 1OF0A 2YKLL 2YC1A 1MFCH 5BV7L 1I4FB 5E70A 3LB6C 4NQDD 3DGDA 1G9MH 3U25A 1FIGL 1BREA 1WBZA 3FO1A 1XSIA 1RERA 5FLUA 1ZDSA 4MB3A 2XLLA 5J12B 3PWPE 4JK0D 4Q7DA 4MXQD 2OULB 1OTSD 3CPLA 1PG7W 2ZCHH 3ZHNA 2XV3A 3VI4E 4KZEL 2AXWA 4L0YA 3HC2A 3NZHL 4IW4C 4JJ5B 3WXVH 2UYLB 2I69A 4HWZA 4I18B 3COOA 3B1TA 1T5XA 1OCWL 3KPRB 4CSZA 3H8NA 3TBWB 4TVPE 4X5XB 4W9JC 3HC4L 4OLYL 5C07D 4GKSA 5AB1A 2J57A 3KYMA 4DZ8A 1OK8A 4ENED 4DVRH 4JFZH 3NIGE 2NUPA 2ZP0T 3HAEH 5FV2A 4AG4L 4Y89A 4DFHA 2FWSA 4TVUA 4Z76B 1ONQB 1TETH 2WKOA 4OCSL 4PY7A 1AXSA 3I75B 1CLOH 4Y8DC 15C8H 2E27L 3CK0H 3MBWB 3SOBH 4ODHL 4YDJA 1J1PH 1OXYA 3MRIA 5FXCH 5BRQA 2LAAA 3CVHB 4AGPA 3ZKMD 1KJVB 4ZDHB 2VOTA 1CMOA 1KXQA 4X7FC 4BKLB 4RETB 1MAML 2EUWA 3H0TA 3Q5YA 3B3IA 3AY2A 3G6JE 4OT1H 4MD5A 5E6IC 4KNUA 4MAZA 4YXKL 1JZ3A 2Y7QA 1OQXA 5IBLC 1RFDL 4L1TA 1NDGB 3DOSA 1A4KB 4PJ8B 5MP6L 1QZNA 5IFJB 2IMNA 1H6FA 1PYWA 4FCHA 1YPZF 5BVJB 5L6YH 3BOVA 4PJAF 4IRSC 3UCQA 3DBSA 5F2FA 1ZDQA 3GMQB 3CSYB 1CQYA 1RIVH 1CYGA 1QNIA 4YHMH 2NNFA 1AHWB 3STZA 5TE4H 3ZE2B 2FGZA 1GYUA 2I27N 1UKQA 1DANU 1DSFL 2IQAA 3QJQB 1J5DA 4IK6A 1W72B 5B3JF 2F5BH 4RWHA 1M6OB 3EYSL 4E9WA 2DQTH 3FTXA 3BKML 1UFUA 3MSPA 4OBRA 3CSFA 3V6OA 4I48A 1ANUA 4OLVL 4Y2DD 5I1JH 2DQDH 1J05B 2WWMD 1JF1A 1QFUH 1NCDH 1MCNA 3B7YA 3ILDA 2GJ6B 4ZXBA 3QJXA 1RJYB 3HI1A 5KYYA 3HG1E 1I1RA 3PWLB 1IGTB 2OYLA 2R7EA 1AQMA 4QRBA 4A2EA 1CE1L 2C26A 4TVPD 1M7IB 4APXB 4MDIB 2B4CL 1E7UA 1Z0NA 3GSNH 2FIKA 4G42B 1MCSA 1KCLA 3OB8A 3GM8A 2F61A 3LNHA 3BDYH 3ME0A 4KH9A 1TZ8A 4P2CG 3UIZA 1MVYA 3P9MA 3U2IA 1DVFD 5T33H 4JFDD 1TYEB 1S7XA 4CU7A 2HAZA 3T6QC 3IU4L 1FZKA 1PD6A 5F9JB 2KLRA 3ULUH 3NEXA 4YK4B 5D1XC 5G4OA 5GZNA 4PW3A 3WNKA 1DVUA 4P8QA 4G8AC 3RPKA 3OKEA 4XXCA 1F1AA 1U8QA 1W15A 3F3HA 4P57A 2IV9A 4GXVH 2MCPL 4ABUA 4F5CE 5DURB 2EE2A 4HCRL 1L3WA 1S3KL 1MRFH 3PU7A 4NT6A 4X8XA 3WS3B 3VVVA 2ADJB 3VE0A 2MOVA 4K7FB 4KK8D 4DP8X 1PZSA 1FJ1A 5A2AA 4K15A 3VFOB 4TVPL 4Z7AA 4OF5A 5SV4A 4XMXA 4OW6A 3BMWA 4GRMA 2J8OA 1IZKA 4NKQB 2RQEA 4LSVH 3LEXB 4HIJA 4NXKA 1Z9MA 4YDLB 2PYFA 3QJUB 4HV8A 2RA1A 5C08D 1JWSB 1KTBA 1JYVA 2UZYB 4N9GA 5AVUB 5AW1B 3QFJB 4AIOA 1KDJA 2RR3A 5B39A 2JCCB 2EDQA 3HPJA 3ZE2E 4GEIA 3TA3B 1PDKA 4P9ML 5G4NA 1DDTA 1EO8H 3RWHB 5JYLA 4O2CA 4XNYH 3QCUL 2ITCB 2AEPL 4WEMB 3LSOB 3VXQA 1CCZA 2FO4B 4WW2C 4BZ2H 1E40A 2IADB 4JRXE 3S8FB 5EF0A 2W9LA 2YAEA 2F8VA 4XI5D 1IEBA 4H13C 5I16B 3SYPA 2G60L 3KPRD 2EKSA 4GXUN 3Q13A 3ZE0B 2H3KA 1MVUA 1RJZA 4BKTC 3T0EA 4C57C 5JORA 1I8IB 1TMCB 3J7HA 2WO3B 4KUZH 4G7VH 2FE0A 3RKPA 4CGUB 1M3JA 4CN6A 1NLBL 4WHYH 3OKNA 1NBVH 2OCJA 4U1MA 4XMTA 3FYIB 5IW1B 2ZNXA 4BV1A 1NIBA 2LR4A 3OJMB 5BJTA 3OGOE 2E8YA 2ZAIA 1VRSA 4WKZA 2E6QA 2D0FA 3B9KB 5EEXA 4A2DA 3O6LH 2FATL 4Z6AT 3M8OH 4O2EB 4C8XA 2OJ1A 2HKFH 2EDOA 4NN5C 4OGXH 3GSRB 5BQDA 3UL4A 3RL2B 4RGMC 4HWNA 8CGTA 2RIKA 4PJ6A 4XP4L 3DROB 1LYQA 4M5YL 3BZEA 3QI9C 3GSVA 3VUAA 1U41A 3MRQB 1F58H 5TE7H 4LOVA 4PJ8D 4DQOL 2FL5B 2Y7SA 3CZSA 2Q5BA 1DVYA 3SJVD 2X4NA 3HS9A 4UI2A 3QRGH 3K8MA 2BSCA 2H32H 1PZUB 4OI8A 5LXGL 4L23A 1QEWA 2H1LM 4TUOB 5CN2A 2C3HA 3OD3A 3WNPA 5D4JA 4MDJA 3BSGA 4HS6B 4G7SB 4DEPC 3AS2A 1W0VA 4G1MA 4U1KB 4B60A 3QIWC 4JHAH 1G9EA 3UTSA 5T5FL 4KKZA 4Z7OF 3DK2A 4LZKA 1WV7T 4PRBB 2JCCE 1BOGB 3CVHL 5HHMB 3ESMA 2XZCL 1M42A 4OBSA 1KG0B 5F8QC 2I60L 2HJFB 2GJ6D 4KJWD 4TQEH 1PZ2A 5DUBA 1JJUA 5I1KH 2HFEA 3HOGA 3N40P 5J3HD 2R0ZL 3B2VL 5CJ8A 4YFLF 4HETA 1MAKA 1R17A 4ZMWA 3JVGC 1FGVH 3C6LB 1SXAA 2ESVE 1S7WB 4JQIL 4I9WD 4HX1B 4PREA 5AL0A 1CFVL 5DI8B 3ENEA 1KBWA 4RDBA 1A7BA 4IKIA 2F5AH 2L0DA 4J23A 5T8IA 4DO5A 4I3GA 1GSKA 4MXWL 2X3CA 3LH8A 4R26L 3UAJC 5TDOA 4ZMTA 4APQB 1CGWA 4DVBB 4BDVA 2FBRA 3FQWA 1A25A 1LLAA 3LS5H 3I6LD 3TBYA 2OJEB 2PUQT 3IEAA 3TEWA 3FB5B 1W72L 5F6IC 2CNZA 4JFEB 1AY1H 2BNQE 2ZOUA 5HYJD 3PQYA 5LGJA 2DF3A 4L3EA 4HIIB 1V3KA 4NFCA 4GS7B 4U33A 3DX7A 5BXFA 1Q72H 4LAQL 5I1JL 4AVIA 4LVNB 2NCEA 2H47C 3NEOA 5DURD 3GHBH 3LZOA 5DZAA 3I3BA 1IVTA 2PYEA 2AJ3A 3FTSA 3LRHA 2BSTB 3CX5J 2JFCA 5KSUA 1HHHB 2GCYA 2P28B 1LHZA 2NY4B 3HNVH 3V8CA 4LBEB 3QEHA 4ZRGA 3L9RB 1OAYH 5E99H 1OGTA 3P2TA 2HFFB 3S36X 2W0FA 5I9QC 2W38A 5IQMA 4U6VL 3O41B 3F7LA 1CL7I 2I25N 1TQTA 3QFJD 1YEDA 5DUJA 3ARFC 3HIZA 4PTUB 3NVQA 2Y1ZA 4ZG1A 4IHOA 5DJAB 4YBQC 1WT5C 1YMMA 5DMGC 3H4FA 4MNGA 4OF6A 1U8JA 2NLJA 1U3JA 3QB7C 3HCVA 7FABH 3SE8L 1KCSL 4XNQB 1DEDA 4ELKB 1KIUB 4S1RH 2XIBA 3SPCA 3H4HA 3GUTB 2DMGA 2VDOB 5HHME 2OK0L 1WHOA 3CHOA 1JGEA 1ZHKA 2WM0A 4TNVF 4IBVA 2XJKA 1S8DA 3OKOB 3RWCB 1TTBA 2HPTA 1XGRA 1H8LA 5AW3B 3VI4F 3FCSB 1WC7A 2X0WA 4J3UA 3ZR5A 1UWXK 4M7KH 1IKNA 4GAJL 5ID1A 1XH0A 1AKJD 2OMWA 1S7VB 3OSVA 1OARH 1JHLL 2DM2A 3HE7B 3GI8H 5DD6A 3VQ1C 2DRUA 3TNMA 2B15A 4PRPB 1G7JA 4TLSA 2CR3A 4YL9A 4JRYB 1Z9SA 1LK2B 3FRUB 2CZNA 3NIGF 4QO1B 4XPFH 2PWFA 2CKBH 4DESA 4RAUA 2WLLB 4P5TC 4GRWB 3MJGX 2WD0A 3BFWA 4MD0A 2FJGB 4OLWL 4OGYL 3PL6A 5BVPH 5EA0H 1IFGA 2E7LC 4TF4A 3QARA 3QH3A 2EIZB 3U0TB 3CVIL 1A7OL 2H0PA 3M7OA 4NAJA 4PMFA 4R4BA 5GSRB 2EC8A 4Q6IC 4JUTA 4PGBA 2R2BB 3W0WA 4BE6A 4MCMA 4GG8A 4JDVB 2JLPA 5CMAB 3B5HA 4AZUA 3KNBA 4EN3C 4F27A 2QKIB 3VRJA 5DA4A 3SSGA 1M1XA 3N9GL 3ZHFA 1YEGH 2AANA 1E3ZA 5KSAA 2X0VA 4KTYA 4BQ6A 4AV5A 4JO3L 2J88L 5HVFB 2F54A 4KKBD 2PW2B 3IE4A 2WXFA 2CCLA 3DVFA 4MWFA 4XWGH 4X8JA 4IU2A 4UILH 2G3ZA 3S98A 3US1A 3SYQA 2WBJC 3V0HA 1XCTA 5L2JB 1T2QL 3VXUA 2RALA 1NGWB 3DMMA 1N0XH 3PG2A 5EOCL 4F7KA 1X5LA 1EEZA 4XTRC 3MA9L 5EU6A 4F9PC 3W56A 1CT8B 2CGZA 3FZUC 4QYOA 5JHAA 1OSZB 3ESOA 4IBYA 2KMWA 3SDYL 2WGNB 1FUNA 2UWEB 3WNLA 2IH8A 4XN8A 4WI5A 2GFBB 4N22A 3G5YB 2V7HA 3FCBA 2I07A 2J6EA 2VZOA 3GSQA 3U4KA 4MCNA 5HY9B 1G9HA 5H94B 5TTRA 1IKOP 4RZKA 1DCLA 5L88H 2O6FA 5I1DA 2X4SA 3FO2B 1K6QL 3II3A 1CJYA 4U1SB 3LMJL 3ARGA 1JCKA 2FT8A 1UM5H 2P5WB 2XZZA 4UT9A 2VLMD 4PRHA 5I82A 4FKEA 5DMKB 2NY6B 3AXHA 2XU9A 3BVTA 3N55A 1IGIH 4HKXB 1WHPA 2X89D 3CIQA 3HG2A 1JWMA 1C5BH 3VSVA 4A67A 3DOIA 3ALXA 1P2CB 2AZUA 4ZSOA 4L18A 4LPCA 2ZJSL 4MSWA 2QVMA 4F7PA 1N9PA 1U36A 2GTWB 2Z0BA 4JHWH 1LE9B 2CNYA 1QW8A 4JFED 1RZGB 1CICC 1XMEB 2VISA 4NO5A 3UERA 4JRYE 4Z7VA 3KBHE 4LOEA 4H20L 2O5XH 4F58L 4TSAH 3P2DA 2R27A 3EO1B 5DEZA 3F7QA 3WFEH 2GJPA 4MLSA 2VB5A 4NS0A 1U3HA 2NY4D 4BFIA 2X9YA 1I7ZA 1S6NA 4HVBA 4RWYH 3K4AA 1X4YA 3EGDB 3C6SB 5HYQB 4NUJA 4XP5L 4PS4L 4BELD 4NUPA 5DSCA 4ANVA 3O3DB 2X70B 3SO3C 3BZFB 3MBED 1HSBA 5AKRA 1G4RA 4HOXA 3EJQA 4G3YH 1FO0B 3HN8A 4H8WL 4XBPA 1GJIA 2OMXA 3MUHL 5LQBH 3H42H 2J55A 4A7GF 1HYSD 1HTYA 2A4CA 1BX2B 5JTWA 1D7DA 1V10A 1YSOA 2IAAC 1TO5A 2MNJB 1EEYA 2EADA 3EYFA 3ZE2F 2CJSA 2D7NA 1KCRL 5TE6L 5DVPA 2VQ1A 2QKSA 2VDQH 1JI1A 1IGCL 3HFML 2EEDA 1A8JH 4DQAA 1J1OH 1ZEAL 2YQGA 5EV7A 2R1WA 1FZJB 4HD9A 3DJZA 1ASPA 1H6EA 1IM9B 4HT1L 3VA2C 5EU5A 2OI9C 2ZX7A 5GHWH 5SWZB 1E2ZA 5JZ7C 1KYDA 3BIAX 3WHE0 5HYIA 2R0KL 5CZVL 1ZHLB 1D7CA 3DO4A 1FL5B 3FB7B 4R4FH 1MJUL 5ENWA 1N0LA 2P5WE 3HE7D 2WBKA 4JKWA 5AVXB 3N50A 3DIFB 1QFPA 1ZSHA 4PRPD 1E2VA 4ZS6D 3AXLB 5F97E 4ATWA 2C1OA 4D0CB 2WTRB 3AAZA 4LXFA 4YSSA 5KVDE 5HDWA 5FO9B 3THMH 3P3UA 2BC4B 2HXAA 1YYMH 1NGYA 2D7PA 4M3JA 4HH9A 3I3DA 4FNPA 3RVWC 2EZ0C 4HJTA 1QACA 1A6TB 2DQIH 2O6CA 5DD5L 4N0UA 3QQDA 1B0GA 1DL7H 4N24A 4DGVH 5JO5A 1T66C 1KN2L 2YPLA 2VDOL 4U4BA 4AUUA 1MN4A 1JE6A 1JZ8A 1EUUA 1GGBL 5K9QI 4F1SA 3SDAD 4MQTB 3T3PB 5I1IH 2HP4A 1BQ5A 4OLXL 5GRUL 5C8JA 1HCFX 2FWOA 4L4TE 2ZOWA 5T1KB 5I8OL 4NNXB 4OM0H 1E8ZA 1SY6A 3IJHB 4GAAA 1DLFL 1YA5A 5ALBH 2WZ5A 5JQIB 1TKWA 3TCLB 5KJRL 2ZPKH 4X8CA 3MVSA 1INQB 1I7TB 4JCLA 1D5ZB 4PW9A 4NN6C 1MJJB 4ZO6A 1A21A 1RZ8A 2VGLM 3V0VB 5DJXB 3BAJA 1BVNT 2VERA 5IQ7L 3PGFH 5HI3D 1Q9OB 1SN5A 4A63A 5EUOB 2X28A 1JZGA 3RZCA 1BZDA 1ETZB 3S88L 3KPPA 3RGVD 4PV8B 2FYYA 3O6FD 1TZOA 1UG9A 4FLQA 5C0DA 5B8CC 3V0JA 5FO8B 2ALWA 5DS8B 2P8MA 2JCCF 3QYCA 5DHEA 3GFUA 4R7DA 1T1XB 3D52A 5DQDL 4OZFA 2YKLH 5D96C 3PP4L 1LWRA 3MLUL 5BV7H 1CD0A 2IO5A 3WD5H 4H5SB 2KT6A 2DH3A 4ABWA 2P5WD 1TNNA 3DRQA 4OH2A 5CP7A 1OTSC 2HRPL 1HXYB 2NY6D 4O9HL 3QT2A 3CWGA 5SWZE 3VGGA 3EDDA 3KPLA 3ARUA 1C16B 3ZDZE 3LPPA 2FO1A 4RGNC 1SVBA 3P73B 1QSEB 3QXAB 4BCYA 1LO2L 2J1KA 3H2PA 1M71B 3ZE0F 3U7WL 4CVUA 1LMIA 3HMWL 4QXTB 3VTTA 4IBZA 43C9A 3BRDA 4GAYA 4RVBA 3SGEI 4ENEC 5DHXB 1AJ7L 1UZ6E 1OCWH 4GQPH 3RFZB 1PAMA 1OM9A 3CSPA 5ADPL 3SE3C 4ZOEA 3CH1A 4GBXA 5DYOA 3UH8A 5EEYA 5FFGA 5KVGE 3HAEA 5DT1L 1RP8A 4X9IA 3IN0A 5C0JA 3DXAE 4OCSH 1X5ZA 4ODVL 3ZKMC 3QXWA 5C1MB 5J56B 1F1GA 4LNRB 3PNWA 1R5VA 4HW6A 2BWDA 1ZJAA 4KROD 4L29B 1MY5A 1K8IB 2HJLB 2OSYA 2XKSA 5HGDA 1SDDB 3VTAA 2PTVA 2CDGB 2K7QA 1RP9A 3V6BR 2R8SL 3KW8A 4E41B 5LNGA 1MAMH 3NJGA 2BP0B 3L2MA 2CMRL 4AC4A 4DO4A 5DJ0B 2HVKB 2XVBA 2GITA 4G8GE 4L8BB 5KVDL 1MCOL 1RUAL 2NYKA 4WRLA 5KSBA 1N7MH 1W6WA 2NDFA 4PJIB 4NYLA 2VH5H 3GDBA 1PJWA 4XVSL 4YDKL 4E9SA 3T2QA 1RFDH 5BS0A 4L1BA 2CHWA 2N7AA 4GW4B 4N5UA 2LQRA 4NQXA 3BEWB 5EUOE 1HEZA 3U46A 4ZNEE 1ID2A 1Q9WB 1KPUA 1EVTC 3QQ9D 4EQ3A 4FHBD 1AD0B 3MNWA 5AVWB 3ABLB 1FG2B 2DMBA 4ONOA 1A22B 5IV2B 2GK0B 4X9FA 2IOIA 3CDGB 1MHCA 3T65B 1WD8A 1XB8A 3RWJB 2EIJB 1Q94A 1SM3H 5A3ID 3FSZA 2DH2A 1DEEA 3A6OA 5EBWA 5KSVB 1IM9D 5SWZD 3TPUA 2E9BA 1D7BA 4TQIA 3PAUA 2WWMC 3E2HC 3EYSH 5DD0H 4JVWA 3BKMH 2MKWA 3F12A 4G6FD 2PO6C 4XBEL 2R0WH 3O6KL 1H3WM 1UJTA 4H88H 3MI6A 1HK6A 1XH3B 4B9FA 5EZOH 5L2KB 1BIIB 4MMXC 1CDIA 4UINL 3WBDA 3ATBA 3W82A 5BOJA 4ETQA 1A1OB 2IWFA 1ZGLP 3DUSA 1FO0L 1OLLA 1CE1H 3NFNB 4MNQE 2X1XR 3A6BL 4S1SL 5AOKA 5EO0A 4KNQA 4N8VA 3RX5A 3CAFA 4YAQB 4XNXH 5L0QC 3GSNA 3V2AR 4GRLA 3I6GA 4AM0B 4P9HH 1DVFC 5LAXB 2YBGA 3ETBJ 3MGOB 4H0HB 4HZAA 4ZX6A 2ILLA 3JWNC 4HXAL 1UWXH 2NXYB 4XCNB 4NRYB 1DQJB 2X4OB 1AGFA 3GMPA 5T1KD 5ACZA 4IRSA 4PJDA 3B56A 4BUGA 1UWFA 3FU9A 1JGVL 4XH2B 1QASA 4L1HA 2FX7H 2ZE0A 3BSZL 4QTIL 4UM9A 2F08A 1HL9A 5C6PB 3IU4H 4Y4HB 2R4SH 3OBAA 2AJSL 3MOBL 5L7XH 1HHKB 5F9OH 3L1OL 5D2NA 4RMSA 1MCPL 3C8KB 4JZNB 4P0DA 4E41E 4A6YB 2OJZL 4TQPA 3GO1L 3PV6B 2ATPB 3APDA 1HDMB 4UT7H 3OAUL 4LLVA 3BE1L 4PBWD 1KYFA 1D7FA 4MJIB 5GJSH 4RFOL 1JF6A 1QKZL 1IGJB 4WO4C 2QFPA 1VAHA 2P80A 3GBEA 1KACB 3GXDA 3NCCB 5HHQB 2Z4QB 1J0IA 4TVPH 4A7SA 1ORQA 2BWQA 2Q9OA 3BAYA 4NENA 4PJIE 3TYFB 3T2NH 3PGDA 1MFEH 3TWYA 3OR7B 1RLBA 3WIIH 5KVGL 1OP5K 2NY1D 3O9WB 1KZYA 3S5ZA 1UTDA 3K6SB 5F7DB 3VD3A 4PJ5A 4QHLB 1C9SA 2F1BA 3ZDYB 1AIFA 3K72A 2J56A 5E23A 4DPRA 4RH4A 3NTCL 2ZSWB 3MO1A 4JN1H 2YOAA 2FBJH 3S37H 4QF1B 1GOHA 2AF2A 4AKOA 4PJGA 1YQVH 2BRRL 3QVAA 3HMXL 4BQCA 3GMOB 3QCUH 3S4SB 2AEPH 2HFTA 2DYPA 4P05A 5HTSA 3ZHDA 3FAXA 4X6EB 3APMA 1QSED 4KKAD 4EPSA 2I9LA 4BZ2A 3DK0A 1O0VA 1YN6B 3IXAA 3MV01 2C9UA 4OZIA 5JR1H 5L2KE 2XN1A 4GT0A 1PVHA 1MLCA 1TZGL 1GJWA 3CMOH 4ELME 4JNXA 2WLKA 4OI7A 2KI6A 2G60H 2OYMA 2EDRA 3FJTA 4FL4C 1T21A 1WCQA 1FLRL 3U4BH 2GT9B 1BZ8A 4IKLA 3DYOA 4GW1B 5I18L 2LT9A 4P3CL 2BSSA 4DZBB 4R8WL 1ZMYA 1M3IA 3VU1A 1NLDH 1TJXA 3MRKA 5EBLA 5GGVY 3VFTA 1GZPB 4WTZG 3CNKA 5FUZL 3WIHL 4P46A 5DUPH 4JFQA 4GRWF 4G71B 4UNUA 1QQDB 2A6IB 4FHKA 4UZSA 4YDNA 5KS9B 3UBXA 1E27B 5MHSE 2CO2A 3MHZA 4E41D 1T89C 4J3TA 2AQSA 1X5GA 2XWJA 5DXWA 3L3IB 2CDFA 1EPFA 1YQ2A 4HPYL 3Q06A 4OM1L 3ILPB 3S3JA 4W9DC 2APSA 3JWOC 4MTMA 3SPJA 3TEYA 6PCYA 2C9VA 3PABA 1S9YB 5IBTL 1CG9B 4M5TA 1AO7E 1AGEA 3WUWG 2V0AA 2YEQA 1AGCA 3D2TA 2QPSA 4F8PA 1BQUA 4E2OA 2JB5L 2X2IA 2B14A 3KLDA 1G7PA 4RISL 4XNAA 5DEGA 3C5ZB 1SFDA 3QJVB 2JLLA 3JTTB 4BH7B 2X4TA 2H32A 2E86A 1PD0A 3DTDA 4LDOB 3MLSH 3ARDD 5LXGH 4JO4L 5DHMC 3PAZA 3FCTB 3NJNA 3NMEA 5EMYA 1BM7A 3ZE1B 2E6PA 2H1PH 4PR5A 3MBXH 25C8L 2ROYA 1F4HA 3FO0L 1IVLA 2BVEA 2UWEF 5T5FH 3ZDYE 4N3UA 4QWWC 4KJWC 2VR3A 4XN4A 3CVHH 4M6ML 2H2SD 2XZCH 5F7EH 1QLRA 1E9QB 2DDQL 4JG0L 1OAKL 5EUKA 4OTXH 3WENA 5I76A 1V55B 2Y2YA 3MGTB 4Q4IA 4WFHD 3NCXA 2XRAL 1VZHA 4ZPVA 3VB8A 3PWNA 1AQDA 3PDDA 4FFWD 4P59L 4KKPA 4LRIC 4Z3EA 4V11A 3IVKA 1CFVH 5FYLD 3STBA 2GB2A 2VXSH 1WDAA 4YO0B 1JTOA 2G2RA 2VSCA 1Q9KA 3VWJD 3KJ4C 5C0AE 5F44A 1FL6B 4GXUM 3UP1A 3E6HB 4UAHA 5DD3L 2OXHB 3Q01A 4X42A 3K71A 3DX9B 4H26B 3MGAA 2EH7L 3ZRSA 1XXFC 4GEJA 3GK8H 1KJ2B 4Q9CA 1W72H 3FQ2A 5KVMC 3CN1A 4M7ZB 4K3GA 5SX4H 4PJEB 2D03L 5KS9E 1T22A 4B9PA 1WICA 3UPRB 3E8UH 2GAZB 1K4DB 1HS6A 4FQIL 3SZKC 2EC9T 3I85A 4HUUB 4U49A 4HWEL 4LARL 4FA6A 4ZX4A 1GTNA 3WUWB 3QIBB 3V5DB 2EXYC 4FNLL 4MYWB 3NFSL 4MJID 2XYBA 4BINA 1S9WA 5EIIG 2XWZA 5DJ8A 1T6WA 4F20A 5GGRY 3NIDB 3LKNB 2J21A 4QXUL 2CM5A 2FHCA 1BOYA 4JHVA 1ZANL 2UY6B 1Z9LA 2BMKB 1XR9A 1DVZA 4PY8I 5EWIH 3WL9B 4O02B 4R7NB 2QDVA 4WUUA 3V52L 1T1WB 4XODA 1YG9A 4HOZA 4WHTB 4AW4A 1A6ZB 4EXKA 1XGTA 5AAWC 4KO7A 1K2DA 2X7LA 2HVJA 4HZLB 5E9DA 1KYOK 2OR7A 4KQ3L 3UAJA 4NJ9L 1YEJL 3JXAA 2QTVA 3F58L 5AZEH 1FNEA 1PIGA 4PJ9C 1SVZA 3SE8H 1RK1A 3BQUD 4NPYA 5I2IB 4G7YL 1JRHL 4ONGL 5AW0B 4A6YL 3UYPA 3BH4A 4ORGB 3WEXA 5HHVH 3QEQB 1MXGA 3BIKA 3D87B 5IJCC 1GJUA 1KWKA 4HJGA 3MRHB 3HVDA 5LGKA 1PBYA 3LN4A 2FT6A 3CMGA 5GRVL 1RZ7L 1ZVHA 4GAJH 1EBAA 5IOPA 3VD1A 1N70A 3HRZA 4E9QA 5F1SA 3IYLW 3FTYA 4KI5D 2HUHA 5AD0A 3BH8A 1E8XA 4KK5D 3KAAA 4JLRA 5A43C 4MHHI 3VI3B 4XMWA 4X5RA 4ZX3A 1XGYH 5ABAA 3VFWB 5KBKA 1LDPL 3BWAB 5T1LB 4HSCX 2CKBA 4WHDA 2YGOA 3VH8A 1BZOA 4N2NA 3IT8D 3TNNB 1DR9A 3IETA 4HIXL 4KV5E 1E3XA 4OLUL 5CJQL 2G2PA 5A2KH 1HU8A 4L3CA 3B5TA 3CFTA 4IJ3C 4OGYH 4PG9A 3T3PF 1JGLL 3UBHA 3L3JA 1EFQA 4HFWB 4LCVA 4PJEE 1IAKB 2XN9B 5I1AA 1A7OH 5BNXD 1G6RH 3MJ8B 2H1XA 4X7CC 4Y9GA 3FQRB 3L2NA 4TLTA 4TNGA 1JK9B 1N59A 1ZWIA 1ADQL 1P5UC 3C5ZD 4YHPA 4OIBA 3R06B 3NIDE 5KYWA 6FABH 2QT6A 2YLKA 3ZHLA 3GIVA 2BSRA 4JO3H 5A2CA 2IAMB 3B43A 5EUOF 3Q9PA 3FFDB 4N2LA 4NOBA 3TCTA 1LTXA 1U0QA 1WAAE 4GP4B 4P2OA 1TEGA 3ZTNH 4GB9A 2UVFA 4FZEL 3MLYL 4EUPG 4YXLH 2RB8A 5EOCH 2I7SA 4NZRL 1VDGA 1P6AB 3BP4A 4JJHA 1VFAB 3MA9H 1E8WA 1GGYA 1ETB1 3BPOB 4N2MA 3FQTB 1LNUB 4JDZB 4OCMC 4ZUVB 4GW5A 1S3RA 2NNCA 4IKJA 3SDYH 3CCHA 2IANA 2Q0ZX 4RNRB 3V6ZA 4DP5X 4IM8A 4DN3L 4HBQA 1HI6A 5AWNL 3SYCA 1BFTA 32C2A 4YNYB 1AXTL 3MRLA 2WXIA 3OV6A 4OFDA 3A21A 1H5BC 3WMQA 1OSPL 1CDUA 3Q43A 1MIEL 1NJ9A 1ODUA 3OB0H 1F11A 2NY0B 2W0KA 4EZLA 1Y0LA 3LMJH 3QEQE 4Q6IA 1GGIL 1ASOA 1E9PA 3VFUB 3CFJB 2DWSA 3MRDB 3CC5A 1TU2B 3SGJC 3QHZL 3X1BA 1E50A 2EACA 4M4RB 1VZGA 3VRIB 3RNQA 4KXZH 2HPOA 3RG1C 3ROOB 1YPZA 4H25B 5L9DL 2ZJSH 1W8NA 5AW7B 1U3ZA 3CBJB 5H2BB 3MX0A 3GSOB 3VCLB 5TF1H 1UVQA 4OB5H 4GYBA 4NCC2 3ARTA 4PJBB 1HXMB 1PLGH 3BUTA 3FKUS 3EYVB 3VVWA 5MEOB 4A38A 2RHEA 2JMRA 2XNAA 4F58H 3O6MH 5CCGE 1T04B 4XXDB 1JZ4A 3MOAH 2E75C 3UX9B 3S9DB 3K0WA 3EDEA 5C3TA 3QIBD 1ET7A 4F9PA 1P5VA 4JDTL 1XH2A 1KT2B 4PJHA 1UADC 7CGTA 1BXVA 4LP8A 4OF8A 2GBTA 1FH5L 3SQOL 3HPLB 4DKFL 3D3VD 1L5GA 4JFFA 4XP5H 3MBEC 4PS4H 4NEHB 2VLRD 4JPWL 3MROA 3S97C 3ULSA 4PJIF 1YEEL 3MLVL 4NC2B 5SWQA 2GUOB 3VXMA 4CDHA 1TYJA 3QUMB 1MFBL 3BVWA 1G7IA 3MRJA 1TQBB 3D1MC 4IDLA 4EUPB 3VM7A 3LDBB 1B0IA 1CC3A 4GIPD 4D9LH 3X14A 4LLDB 2E7HA 2QL1A 4LB8A 4TUUA 1A5FL 4B3EA 1D5RA 2W59A 3RU8L 2J1WA 6PAZA 2R1YB 4NJAL 2IDTA 4LKXA 3MYJA 3MUGA 3VRLF 4F15B 3VWKC 5TE6H 1S7TB 4OF7A 3HR5A 4KGLA 1P7BA 2CBQA 4N8CH 3EH1A 4C83A 5JIMA 4DPAX 1IGCH 4WTXA 5KUMA 3W1ZA 1U95A 1HILB 2BIMA 3D5OF 1OP5H 1JTPA 1DQLL 3BI9X 3G9AB 5MEQB 3IJ9A 5DLLA 3LS4L 4OD3H 3T04D 2QTEA 2LTQB 2NUTB 2R0KH 1HWHB 1X3DA 5D1QA 4ZS6C 1VFBA 4JO1L 4O02L 5KVFE 3FFCD 4CA4A 1IM3D 4FFVD 3VXRD 3F7YA 3OKLA 3L3OA 4GOSA 1FC1A 1N5AB 5AVYB 1Y6MR 3MPCA 2XETA 5CF3A 5HHPA 5ICZA 4LQFL 2BDNH 3QUXB 1AR1B 1D5BB 4IIZA 2A5UA 2D4DA 4EI6B 3SDAC 1DVSA 2WSKA 5DD5H 2YSTA 5T1DL 4PJBE 2B7DT 5FGBC 3P69A 2XN9D 4X4XB 3RX7A 2WO4A 1KN2H 2VDOH 4ZPTB 3MXVH 4HJ1A 4HMCA 2Q10A 4XN9A 3CXFA 3AT0A 4R97C 2X4RB 3L4XA 4OLXH 5GRUH 4ECNA 1L0QA 3HNTL 3O3EB 3T4YB 5I8OH 1DJWA 5JUEL 5CXPA 5CZKA 5DQJA 1BM3H 4M7LT 4CVZA 4BZ1L 2BJML 4UV4H 5JOFB 3DGCR 2IAMD 1QLEB 5GGTL 5ISZA 4XNDA 1FA4A 3I9AA 3WE1A 2IDCA 3Q8EA 1D6EB 1F8TH 3RGVC 3O6FC 3M17B 5IQ7H 3QUYB 5I73C 2A38A 2AK4B 2FSEB 3TBSB 1LM8V 2V5TA 3VXTA 2IDUA 4Z1PA 3W3BA 5DRNA 2P5ED 4GRWH 1RUPL 4Y16A 3ZDYF 4O58H 2TSBA 2YD1A 1OHZA 3FYEB 1INDH 3SE4C 3ARSA 3E6FA 3FCUB 4G6KL 1YLBB 4M9OA 5EOQH 5GRVK 5DQDH 1QFWL 2IH1A 3NACL 3PP4H 2VWEE 4FKHA 1MELA 2VTFA 1RK0A 2NY0D 4XX1E 4IMLA 4LHUG 5ICUA 1I1YB 3K4ZA 3WSQL 5C9JB 2NTSP 3JV4B 5K9KA 1UJ3C 2DM3A 1FAKT 1MWAB 4FNUA 2ERJC 4L8DA 3UO1L 4HU8A 3GGWB 3QSKB 3LKQA 4EVNB 2JNZA 3T1WA 3NEEA 2R29L 5JHDB 2VKWA 3RIFF 4HOWA 3DO3A 4WU7A 1J8HA 3P0YL 1TZHA 3L5WB 1AZRA 3NUKA 2WXRA 2G3NA 1HKFA 5D72L 5AW5B 4S2SB 2DB8A 3EJUA 1ASQA 3WJJC 1F3JA 1F4WL 2ROXA 3GXTA 4R4ND 3QS2A 1FP5A 4LMQE 4D7BA 1XCQB 3SCMB 3UTZB 4AYBA 3ZLQC 1TYRA 3TPKA 3RIFK 3QIUC 4C56E 3MR9A 5IMKB 1OIOA 5E2TL 4KROC 5KS9F 3PJSB 2CO4A 3AQYA 3LY6A 4Z18A 3QR1A 5SWSE 5FKPB 4XMKL 4L0PB 1UD6A 4NHUB 5E94A 4ALAL 2IJ0C 3OJDA 4YOKA 4X6CB 5KVFL 2R8SH 3P4MB 3GSXB 2A3TA 3PPSA 5DVNA 2CMRH 3IMVA 2VL5A 4H8VA 2DKMA 1I3VA 4EMZA 1UT2A 2WKGA 1MFMA 2NZ9D 2A73B 3C60B 1RUAH 1DO6A 1D6VL 2VM9A 4AYSA 1Z2KA 3NAAL 3LZLA 1S46A 4YDKH 2DQGH 4G6ML 4DOHB 4FXTA 4Z7NB 2X88A 4P4RA 2XQYK 1NUNB 4MAUL 5F1IA 3II1A 2AK4E 3KLSA 4IOIA 1Q38A 3ZE1F 3L3HA 5CBAA 2ARJQ 4UQ3B 4V1DA 3ZGHA 1GVIA 2R15A 4PWHA 3HI5H 2V5SA 4DTGH 1OCZB 1PZDA 3VGHA 4KBPA 4YSEA 3APNA 4CGTA 2EP6A 4I2XA 4Z7QE 1WIOA 1A9BB 3MV9B 5ITFA 2ZUQC 3C09C 5EULV 1X6NA 1L7IL 2BZCA 4JFSA 4AZ8A 4BHUA 3FTZA 4EI0A 1IT9L 1HL8A 4G80A 1HSAB 5G2NA 4YHLL 1QA9A 1HH6A 2FGWL 2R2EA 4JM2D 1IAOB 2JKTM 2W91A 1KGIA 4OV5B 5BO1H 5D7JC 4UINH 2EIBA 3ZKSD 1KXTB 2MQGA 3IM1A 4F7MB 1KCKA 5JHLL 3EOBB 1N8ZB 1I8MB 1ZY9A 3QAQA 5FW8A 2B5IC 4FX5A 4S1SH 1AYRA 3A6BH 4TUJB 3QUXD 2EUZA 1IRAY 4WEBL 4FQ2L 4FYQA 3LPFA 3P77B 2VJ0A 2OM5A 4UIMA 3HZYB 4PP1D 1T0MB 4YC2C 3S35L 1V5JA 4LCUB 4YHKL 1OWWA 1YJDC 4YPGA 1QI5A 3RTQC 4L1SA 2UUDK 1TMQA 2ICWI 4HXAH 1ULVA 3GB7A 4UU9A 3AGVA 3UABA 4PJEF 1LO3H 3CDCA 4F57L 4DP2X 4QTIH 3BSZH 2K8QA 5TGBA 3UAAA 1SGKA 2M83A 3EJZC 3KGUA 2NNRA 4A7UA 3H9HA 4YUEL 2WW8A 1GAFH 4Y2DA 5DJYB 4AIZA 3VI4A 4N5ED 1MCPH 3NIDF 3G6DL 3QFDA 2C9AA 2OJZH 3FPYA 3GO1H 4N0CD 3QDMB 5JQ6H 2O5YL 3U7YL 4U1LA 2XFGB 1RPUA 4OKVA 4RFOH 1QKZH 1T7ZA 3QEUB 3SHSA 3HNSL 2NUPB 3DUUA 2NY1C 4FNQA 4L3FA 4LCCC 1EDHA 3DX8B 4N0FA 1QNZL 1YEFH 4K94C 1NPJA 2Z0UA 3GMNA 5F96H 5KVGH 4Z7NE 1OSEA 4YDJB 2BNUB 3MRIB 5CJXA 2HTKD 4TTDD 3NJMA 2PR4L 1T4KB 2HZHA 3LNDA 1I8LC 2C3GA 3V4UL 2APWA 3ABZA 3H0TB 3NTCH 3Q6GH 4KJPD 1E4KA 2WY3B 1ORSA 3WAJA 3VG0L 2PPDA 3CDZA 2QVTA 5CFHA 2YD2A 2BRRH 1JMXA 1ACYH 2IOOA 2VITA 3MV9E 3ZL4L 4KKRA 4MDRA 3MYZA 3HC3H 1LL1A 3MLTA 4AI7A 4M5SA 1N18A 1QLEL 1DVXA 3NN8A 5JHDD 4N25A 4MASA 1JVOA 3WLBA 1PFCA 4X4YA 2AS5M 4NXSA 1ICTA 5IHUH 1DQVA 5A6LA 3MLWL 5ID0A 3QWOA 4WJ5B 1A6WH 4S0TD 3FT1A 5D7EA 3VI3F 5FA4B 1BD2B 4FEIA 4U7SA 1DFBL 1CBJA 4Z95L 3ZT6A 2COVD 3SCMD 4ZTOL 5DRWA 3ECVA 4V2BA 4IGBB 1ZHBB 2VM4A 1WTLA 1CYWA 3WTTA 3SOTA 2YSSA 4B50A 5FUZH 3ELAT 2C1PB 1SF5A 5C08A 1AQKH 3WIHH 1ESOA 1MY7A 1GZHA 2WXKA 1I4FA 5CGTA 1BFSA 3ML8A 3D4GA 2APXA 2QBWA 4ZXBB 3FOLB 5FR3A 1CDHA 4XCFL 5C6WH 5KYYB 1IBFA 4EIGB 4WWPA 4YE4H 2EINB 2R7EB 4CAGA 5F0LB 1AQHA 5DO2D 5CEYB 4A2GA 2DBLH 4PVNA 4JG9A 4OM1H 1UFGA 3S3DB 1BHGA 4BGLA 2E46A 2VZSA 4Y4KB 1I3GL 3C60D 4H4NA 4XCCL 3FMGH 2XWTB 3SGKC 5DC0A 4AENB 4JJ5A 2FEEL 2CHXA 2UYLA 1S78D 4IOSD 4I18A 3SBQA 3QDME 3IJ8A 5HVHC 3RPIA 3IXTB 1BMWA 1AZCA 2JB5H 4UOW0 1OAZH 3ARDC 1IAIH 4FQPA 3KPRA 4RISH 2AQ2A 3TT3L 4X8GA 4D8PB 1KOAA 4X5XA 3EHBB 4AV0A 4OFVA 2FJSA 3M1OA 2X9XA 4JO4H 1QRKA 1IU1A 2FQFA 2W9DL 5CR8A 5CFAA 4Z76A 1SN0A 1ONQA 5JW4Q 3QG7L 25C8H 4LHUD 2FZ3B 1DBBL 2UZPA 3SDDB 3FO0H 5T5FA 3W39A 2CD0A 1NTDA 5ELIA 1TJGL 1KXQE 3MBWA 4P2AA 2D3JA 4GIAA 4ZFQA 3Q2WA 3CVHA 5H4YA 3RPBA 1HZHL 5DFAA 4M6MH 4O51A 4ZDHA 4GLRH 1RUQL 4BKLA 1HINH 1KNOB 2DDQH 2FB4L 4JG0H 3FDWA 5JDSB 4FFWC 4X6DA 1E5ZA 2MQ0A 4JFHE 3P3TA 4YSUA 4GRMB 3TA4D 2MPVA 1MCWM 2G3MA 2XRAH 3ZKXC 1RMFL 4HV8B 1N6UA 3VWJC 1KBGL 3FNKA 1TCRB 4KITB 1A4KA 3K7UA 4PJ8A 4N9GB 5B1JC 2CUMA 1EO7A 5B39B 5BVJA 3HPJB 3SJVA 4HGWB 3F83A 3EJTA 1BD2E 3GMQA 3CSYA 4Z3FA 1AHWA 1FQ9C 2QSTA 5HI5D 4HXBL 4O2CB 3NDZE 1F6FB 4HZ1A 4PJBF 1OCCB 2X0UA 1OB0A 3V6OE 1PZBA 3U6XS 5BMFL 2MHAB 2GK2A 2WYIA 1RZFH 3B9DA 1AG0A 1M6OA 4AMWA 1U2CA 5F7HA 1OPGH 2FR4A 2OZ4H 3FT0A 3WLWC 3WHE1 3OZKA 2D03H 1YZZA 1J05A 3HG3A 1P7QD 2GJ6A 3JBG7 3TOPA 3QDMD 4HWEH 1O6TA 1RJYA 4AEHL 4KMLB 2C3XA 2R51A 3PWLA 1IGTA 3C5JB 3T0EB 5JORB 1RZKH 4CILA 2IQ9H 3QUHA 3I2CL 1M7IA 4APXA 4QXUH 1HE7A 1T83A 1RK7A 5CGBA 5IJKC 2NT0A 2OMNA 4MDIA 3RVXD 3VG9C 4FJYA 2DQ6A 2QHRL 4KO6A 5BJTB 2D73A 3RWGB 1PMYA 2YZ8A 2LU7A 3HE6D 4MAYB 2VLLB 5FEBA 2DQUL 5GIRA 1ZT7A 4N2AA 1OK0A 4HAKA 2FD6L 4QRUB 1DCEA 5EFIB 1AP2B 2WXJA 5DZPA 4UNVA 1FORL 2B20A 3ZYJA 1W91A 4Q52A 5J0BA 4OR1A 2NR6D 3RYMA 2BOCB 3BQUC 1A47A 5DTFB 5F9JA 1YEJH 2XXFA 5G55A 3F58H 1IC1A 2HKHL 3DVGB 5C2UB 4HPHA 2ADYA 1OTTC 3DV4A 4HCFA 4G7YH 2Y7MA 4ONGH 2UZXA 2X38A 3ILEA 1A65A 4PG2C 4PRNB 2X2YA 3T6XA 4PM1A 2DW5A 5K9JL 3BWZA 2X4NB 3TASA 3WS3A 2B08A 1WG3A 2ADJA 4K7FA 3WU1A 1CQKA 2NW2B 4KI5C 2JB6A 4KK5C 3UMTA 3VFOA 2Y23A 4BE5A 1KXHA 1D5MA 1RQ5A 4GI6A 4MDJB 1RZ7H 3BDXA 4EI5D 3WFHB 2GIMA 3B34A 3WNOA 3LRSB 3LEXA 2DN7A 3Q1SL 2EECA 3K2IA 3QPXH 1FDLL 3KYKL 1F18A 3MREA 1CXFA 1WD9A 5C6TL 4YHIB 4AL8L 1NIEA 1JWSA 3SYAA 4J6RL 4NLAA 3MRNA 1CD8A 2CUAA 2UZYA 4JY4A 4WI6A 3NK4A 1PKQB 3QFJA 2WWNA 3VX0A 2JCCA 1G5GA 5FF6B 3HHRB 5J6SA 3TA3A 4X80L 2Y5QA 5DUBB 4J3XA 5IGXH 2HFEB 4Z3TA 3RWHA 4XC3H 1IGFH 2O6DA 4P99A 2EDXA 2FNBA 5AAWA 3G08A 1KENH 2WQAA 4A7VA 4Y4KD 3LSOA 4L2YA 5GS1C 4KDWA 1OB1B 2DIJA 1G6RA 4X99A 1ZT1B 2IADA 3BAWA 3WKYA 3P2BA 5IQLA 5I6MA 1AZVA 2AQTA 3SKJL 5I16A 4KI1A 3T0EE 4Y1AB 2JQAA 1FSKC 2EYTB 3U2JA 3KDMA 3ZMEA 3FQWB 1OF2B 3FN0L 2MIZA 2HTLD 4HIQA 4X7SL 5E1HB 1AKJA 3TBYB 5A2IH 1I8IA 4TMPA 1ZVYA 3IFLL 1I1CA 4AGNA 4FC3E 5FHBL 1KV3A 1CTMA 2YR3A 4UTAH 5IW1A 4FZEH 1V05A 4X7TB 1ZA6B 1KTDB 5E8OA 3HZKB 4LLUA 4NZRH 4DSYA 2D2CC 4GSRA 2ZWZA 1ZLWK 3TN0D 3PUUA 3B9KA 3TZVD 1N5YH 1FN4B 2AJ3B 1OW0A 4O2EA 3AWGA 5C71A 4M1DL 2PP9A 3W11D 3GSRA 4NP9A 3RL2A 1NDTA 2GHZA 5AWNH 1FWXA 2YPKB 5IW3A 3DROA 5B4MD 1AXTH 1CZ8H 3VGAB 3VD2A 1MIEH 1J5OL 3KWVA 4MMZC 2XIDA 2IALA 1UZ8B 2NNAB 1HNGA 5IJVB 2ICWJ 3S36L 3DPBA 3CFEB 4PJFB 3HUJB 3B7SA 4XMPL 5E2VH 1NANH 4R90L 4PGCA 4PV9B 5EN3A 4TLUA 3QHZH 3GHEL 4MS6A 1P5UA 1M2VA 4MNGB 5G4MA 2LU5A 2NTFB 4FCAA 3MODL 1UQSB 3FHEA 4JE4B 3EAKA 5L9DH 4DKTA 3ARBB 3GIZH 4U1KA 1IAIM 3ARPA 3VFVB 4A7TA 4HALA 5AYUH 1ZHKB 1MRCL 4KFMA 1PKQE 3K6FA 1USQA 3LPOA 1HVXA 2CH8A 1S8DB 1BOGA 3EO0B 3QUZB 3K5SA 4OCYH 4PRBA 2LLLA 4F92B 2VW6A 1BVKB 2E0PA 4LGPB 4YH6A 1XGRB 1ZLUH 3CXHK 4HK3J 3NPZB 1KG0A 2QQLH 2HJFA 4PHXA 5C9KA 2CK0H 1AS8A 4KVCH 4MFHA 1XCXA 5AOIA 2VKXA 2VO8A 1MWOA 3KLLA 4JDTH 4DT2A 4JY5H 2EEBA 4X6CF 5J9PA 1GTFA 2AJXH 4LFHG 1FH5H 3D12B 3C6LA 3DX6B 2BVQB 1S7WA 3QNXA 5JMRA 2UUDH 1V27A 4HX1A 3TNMB 1A3QA 5DI8A 1KXVC 1QR1B 2VDLB 4MAYD 4Y1AE 4JPWH 1H5BA 1Z9SB 4R2GD 4NZUL 2XIIA 1BDYA 1YEEH 3MLVH 2EICA 2IGFH 4XZUB 4ZJ9A 4F3FA 3TVMD 1MFBH 2VN6A 4MD0B 3UBFA 4APQA 4Z7NF 1OE1A 2XYCA 3HC0A 3PQYE 4ZK8A 5IM7A 3QH3B 1PEZA 1MPAL 2YOCA 3SGJA 4L3EE 2WLIB 3ZO0A 1KB5B 1KJ2H 2OJEA 1A5FH 2YUZA 3FB5A 1S5IL 1QSFD 4HHAB 4OY9A 1KGUA 3RU8H 4JFEA 1Q0YH 3EH3B 4HIIA 4PD4K 1FZMB 2PYEE 5C0RL 3IK2A 3GC3A 3OKKB 4JR9L 5KSAB 4H2CA 4WSJA 2OX5A 4GG6A 2R9HD 2BSTA 2PR9A 2F54B 5H37G 1AS7A 2GEQA 1HHHA 3W81A 3O4OC 4JG1L 1DQLH 1IC5L 3L45A 4FNRA 4M1GL 4I9XA 5I5MA 5JQHC 2KZWA 3EGSB 4LBEA 3LS4H 1M1SA 1EFXD 3L9RA 3W2DH 1H3PL 1EZLA 5CJ5A 4JO1H 2EE3A 1EEZB 4O02H 4YQXH 2HFFA 3HUJE 4PJFE 5AAMA 1F90L 2H8PB 1F4XL 3Q48A 1NEPA 3O41A 5I15L 4HUNB 2CLVB 1YMME 1OZUA 2VL4A 5MI0B 1D2OA 4MNGE 2I07B 1MIML 1JP5A 2XWCA 5I8CB 1MDAA 2QMJA 4QKXB 3RY6A 5D9SB 5F89A 5CGYD 2A0LD 4UOZA 4G83A 1CGSL 4XNQA 3G5XA 3RDTB 1HNFA 1KIUA 1WEJL 4ELKA 3Q8AA 5AALA 3GUTA 1BZ9A 3WIAA 4PRHB 4XO8A 1FF5A 2BK8A 2Z1KA 3OKOA 4D9RD 3VXSD 2YFNA 4RX4A 2YXWA 4M7JL 4Y4FC 5JUEH 2CHDA 3FCSA 2DD8H 4YPJA 2CBPA 4HEPG 4NERA 2MQ3A 2IPUG 1ZPUA 5IB5B 4W81A 4I3RL 4YVNA 1KB9J 1S7VA 1UXMA 3MRRB 3MNMA 3NFPB 4FG0A 4U6HA 3HE7A 3NZSA 3EFFB 3WY2A 4KKLD 1H3XA 1WO2A 1Z3GH 4XZ4A 5F6HI 2ZX9A 3T0AA 4PRPA 1PQZA 3PAYA 2QJDA 3WKMH 4BQBA 4QO1A 3FRUA 5IMMB 4HJ0C 5D1ZD 3VTMA 2EYRB 1XSKA 2ITFA 3IE9A 1CFQB 5E9AA 3K2MC 3SY0B 2FJGA 2HRLA 1E90A 1I7ZB 1DJIA 4KUCD 5JOPD 1EXUB 5DZNA 1L7TL 3W0WE 5DC2A 2EIZA 4G6KH 3U0TA 1TQCB 2NX5B 2NY0C 4XNUL 4ZTPL 3B2UD 2WWOA 3U4EB 1I31A 2R56L 4Q74A 5GSRA 4QRPB 4NQVB 4U0RC 3SDAA 3TJEH 2IBGA 5DSCB 2R1XB 5CMAA 2QKIA 5IIEB 1HSBB 4MZRA 4GUCA 1MCHA 2F54E 1YNLL 4I1PA 3IF1B 4XBPB 2DMKA 3CZKA 1TJMA 4FS0A 2RJMA 4G72B 5EZIL 4BRJA 1A0QL 3ARWA 3IMUA 3G5ZB 2R29H 3H9ZA 3BHBB 3ARBD 3RIKA 1FNFA 2XFXA 1K3ZA 4AYFB 1N64L 2WNKA 2HH0H 2HVBA 5EU6E 5L2JA 4Q9RL 2A99A 1NFDA 4NO0B 3AG1B 1NGWA 5I1GL 2VQ1B 4OCWL 1I3UA 3D6GA 5GS0L 3QUZD 2KH2B 3BLBA 4DCQB 3WDIA 1F4WH 1UWEH 2DKUA 3RGVA 1OSZA 3O6FA 3NCWA 2V2WB 2UWEA 4AXWB 2EXTA 2H41A 3OAZK 5HY9A 5E2TH 2G0KA 5FCSH 5H94A 1DUYA 4KDVA 5ENWB 1Q90A 1X5FA 2AC0A 1ITBB 3FO2A 4K8RD 4PRHE 3SE4A 4XMKH 1QI4A 2FNWA 3B2XA 3LYRA 2NY2D 4OD1L 2Z91A 2IWEA 4ALAH 3F6LA 1DVTA 4U1SA 2P5WA 5KVFH 5AZ2H 1X44A 4GINA 5DMKA 2NZ9C 3GZQA 4WWID 4ZSOE 3B1UA 1I9IL 4HKXA 1LJMA 3O2VL 4KKCD 3V0EA 4KNSA 3Q5TA 2XG5A 1KC5L 4NLHA 3VNYA 1P2CA 3VYNA 2JI3A 1IBYA 1XF1A 2AJVL 5A7EA 1D6VH 3QQDB 3BFOA 2ORBL 3NAAH 2GTWA 1LE9A 2VSKB 4G6MH 1RZGA 4FQXC 5KG9A 3TO4D 2FLBT 3LKSB 4F8QA 3INUH 1BWMA 4WKXA 4NUQA 4BK5A 3I6KB 4AQ1C 1KEML 3EO1A 4LCWD 2NXZD 1HNYA 4J12A 1FCGA 2ADGB 4FG6D 4NCDA 4QGTA 3EG9B 3BPNB 3FXIC 3S5YA 2Y25A 2NX5E 3K2KA 2H5UA 4JM2C 4E9RA 3EGDA 1JS4A 2QPFA 3C6SA 3D85D 5C2BH 1BQHG 2PXYC 3JUZA 4KMTL 1IT9H 3B4NA 2WXQA 5GISL 3LH2L 4K23L 4YHLH 2VDLL 1UURA 1DJXA 2VXVH 4NO3B 3O3DA 2X70A 4MA8H 4G43B 3RZCB 2BVOB 5IWLC 4L3AA 3I3EA 3TL5A 1IL1B 2FYYB 2W1NA 3IJYB 3JWDC 3QUMH 4WK2B 3ZT7A 4EUPH 4PP1C 5JA8B 3DLQR 4X5WB 2BY3A 3R1GL 4WEBH 1TVDA 4FYSA 4OZFB 3MKKA 4ZUWB 4AJVA 1U8OB 4C58B 4UB0L 5IHBA 1OP4A 3NIFB 4XHJC 3UYOD 3CQPA 4J27A 3S35H 3DARA 4TL4A 2XTJB 1BZQK 1WZAA 4IIQB 4IHBA 4GXFA 3QAZB 3RDTD 3TP4A 4QJ4B 4GQRA 4YSRA 3WJMB 4FQQB 2HB0A 1NH6A 4N0RA 2AKRB 1RY7B 3O81A 4LFHD 4WI8A 1J11A 3KPLB 4N3TA 2VLJD 2X1QA 1FZJA 5FHAH 4F57H 2J73A 4FABL 1U2HA 1IM9A 2YA2A 3PIQB 5SWZA 5E4AA 3SE9L 3OF6A 4HHWA 2C5DC 1OEZW 1L0PA 1KEGH 1ZHLA 1FL5A 1A7PH 4W9GC 4K3DH 3S5LG 1BQLH 1KCVH 4GAYB 4XVTL 5FW7A 5AW9B 3CFUA 2MRYA 5BRZB 3G6DH 3D9AH 4B9GA 4BFNA 1CK0H 3DIFA 5H4ZA 3IRPX 3CH1B 2O5YH 4GBXB 5D7HA 2VMCA 2VN7A 2ZIDA 1X6LA 3AXLA 5EZLB 4Q0XL 2WTRA 4U6YB 4OGAC 4WJKB 5FO9A 2BC4A 2J44A 3PWUB 4ABQA 2YD7A 3NJVA 2HTKC 1CUOA 3T2OA 4FN0A 4TTDC 2HT4D 5HHOB 2KZBA 3C12A 1A6TA 4NKDB 1S7QB 4X9BA 1GXEA 1HZKA 5AYTA 3PDGA 4KJPC 1GR7A 1WWAX 2VZUA 4IBSA 4GP5B 2ATKA 1ZTMA 3I50L 4PCSA 2OMUA 3Q5OA 2ZG1A 2X6MA 4QRPD 4L1LA 4UQ2B 4UT9L 5A2FA 4BSVB 5L8LB 3T3ME 1I8KB 3V4UH 5KYXB 2A1WL 1J1XL 5T1KA 1BQHB 4NNXA 2EXWC 3MCYA 1MQ8A 4G70B 4H8PA 5KSBB 4NIKB 1ODAA 2A6KA 3DI2B 3ZL4H 3VB9A 1RU9L 1CBVH 1INQA 5BS0B 1NC4D 1F0LA 3Q0HA 4NM4L 2CRZA 1YEIL 1ZLWH 3WN5C 3E0GA 4GKNB 5DJXA 4MA7H 3LRMA 1WZ1L 1MF2L 4NO0D 2WUBL 3IN2A 3U1SL 5TH2A 1A9EB 4B9IA 1EDQA 1Q9OA 3D69B 3MLWH 2JQZA 2Z7ZA 1SHMA 3FOMB 5LJYH 3P9LB 1ETZA 3POHA 1VADB 2RMNA 4PIBA 2DTML 3RJQB 4Z77B 3WFBH 1DEEB 4YFLI 1KJ3L 4G8EB 4WUKL 5PCYA 2VSMB 1CFNB 3OC5A 5FO8A 3SIKA 1KIQB 1LP9B 3CHQA 5D7SL 1X7SA 5DS8A 3U4AA 2GKIA 1O7DE 3WIHA 1T1XA 1U2YA 3U2SB 5E6UB 5D4HA 3QG6B 4TQ8A 2G75B 5HPMB 4QHPA 5DO2C 4DNLA 5F9WC 4BIKA 4H5SA 3IDUA 2TSAA 3FFOA 3V4VB 1R3JB 5IMLA 4TNWK 3NZ8B 3G04B 1HXYA 1QPXA 3S5LB 3ECBB 4WGWB 1MWAH 3T2LA 1XR8B 3OAWA 1MCRA 4RMTA 3ESPA 4CC4A 2AAVA 5FYKD 5E6IB 3DOHA 3P73A 1UH2A 1QSEA 2Z7WA 3QXAA 4MLIA 4GQQA 4XOCA 3FRPG 3QCVL 3S34H 2K1MA 1NCJA 1DBML 1Z3RA 5FX3A 5I1HH 1TSRA 5DR5L 1U8CB 4XVUD 4Z3IA 2Y5TA 5D7IA 3Q05A 1EDYA 3RFZA 3TT3H 2WAQA 5CCJA 3GMPB 5DCCA 4IRSB 2QEJA 1JIBA 4P23D 4Z8FL 2VDPH 4YEEA 2Q3ZA 1NPUA 4X2UA 3GZOA 4WSKA 4LVHC 2W9DH 1O9WA 1ZOXA 4MA1C 3QG7H 1G43A 1DBBH 3NT0A 2X4QA 3GWJA 2ADFH 1A02N 3DI3B 4GPVA 4LNRA 4CADB 2WANA 3KXFD 4JFYA 1TJGH 4JKNA 1I1AD 5T3XD 3U0WH 4E68A 2V5MA 4KUCF 2HJLA 1K8IA 3CSBA 4L29A 3V55A 4LLVB 1JMZA 2WLHA 2CDGA 1HZHH 3VYOA 3EH4B 2VDRB 1HEJC 4E41A 1RUQH 2FB4H 2BP0A 5KSBE 2DPKA 5LN4A 1B4TA 1ORQB 1GMEA 1DN0B 2HA1A 1PSKL 1T1ZA 4NENB 5DJ0A 4D2NA 2UVEA 3KG5A 4L8BA 5BS0E 5J5EA 1WWCA 4JHBA 4LDLB 2NOYA 4M7LH 4PJFF 3HUJF 4QGYA 4A2LA 4OZHA 2EVJA 3EXJA 4P3DB 2J8UA 3CX5K 2H7WA 3V0GA 4GW4A 4YSCA 1AIFB 3K72B 5LLIC 2XTJD 3BEWA 1E5CA 1Q9WA 5HI5C 1E4WH 5D70L 3QZPA 5IR1B 5EIVA 2RTTA 1NIAA 4AEIH 1SY6L 1A6VL 1FG2A 1HCYA 5FWQA 1ZLSL 5KW9L 5IV2A 2GK0A 3MOQA 5GRJL 3CDGA 1P9MC 1LP9E 3RWJA 3M6DA 4DIXA 1OALA 5F0MB 5KSVA 4J3BA 1SN2A 2I9LB 3PCYA 5GGUB 3ZYIA 1QTPA 1SEBB 1D5XB 2ZXGA 2OZ4A 5ICYB 4WZ9A 5D1XB 1ZSDB 1MLCB 4V2CB 2C9PA 2WXNA 5BRZD 2KQNA 1PLBA 4MGXA 5L2KA 5FA3B 2COQA 3CLEH 3VD0A 5EG6C 3RVXC 2JQMA 4JAMA 4BJLA 3U1PA 1A1OA 5DGRA 4OFIA 5I6KA 1MJ8L 3NFNA 3RBGA 1CTNA 1PX4A 4HH8A 5EBLB 3HE6C 1YY8B 5K9QG 5TK2A 1BJ8A 3ECUA 3D30A 2QV2A 3QWQB 4M8VA 5HHOD 5K9OB 2QHRH 2WXHA 4JFQB 1IV8A 5BRPA 1MFCL 4AM0A 2WOYA 2NR6C 5LAXA 1REIA 3B7RL 5I30H 2FD6H 3ZL1A 3UTTB 1WBXB 2CJTA 4XXWA 1FORH 1X5HA 4XCNA 4NRYA 1DQJA 4DP7X 2BLFA 2P3YA 2X4OA 4YJZL 3ULUE 3X1NA 3NGBC 3IMRA 1FBIH 3QA3A 4OCLC 4ZX5A 2ZCHL 3IMSA 5AOZA 1HZLA 4PYHA 3MV7D 4Y4HA 4FKKA 5LG1A 1BEXA 1EIBA 4POZD 2IWGA 4HQQH 3MNVB 3CDFA 3C8KA 2EVFA 4WW2B 2Z34A 2WVUA 3PV6A 3RVTC 2ATPA 4U2ZA 4JFOB 3GTNA 2Y3NA 5C0CB 4YE0A 2X4TB 4MJIA 4EI5C 2XWBA 4ZYKA 1IGJA 4DVRL 4JFZL 3GI9H 5CNHA 5HHQA 2Z4QA 3PDOA 2AJYL 3OTTA 3OR7A 3VDCA 4PJ5E 4KK9D 4LLQA 1XL6A 3Q1SH 5I5RA 1CLOL 1VGKB 15C8L 1FDLH 3SOBL 1CD9B 5C6TH 4B27A 1IILE 5F7DA 2AERT 4U7MA 4QHLA 5ITBL 4XE5B 4HUCA 1EUTA 3QGVA 4MB1A 4PJGE 1NIFA 2ZSWA 3PFUA 1T6VN 4WI9A 1FVEB 1URZA 4X80H 2Y06H 3EBIA 5E5UB 1SDYA 4ZPVB 1AQDB 3GMOA 4G8IA 4NN5B 2J1XA 3NP3A 4DUVA 3H54A 2MJWA 4PU2A 3SBWC 3IVKB 5E6ID 4X6EA 4RGMB 4PVLA 1J0ZA 3P54A 1YN6A 3SDCD 5B1CA 3QI9B 1KY6A 1ZVSB 1KGJA 3D39B 1RIVL 2HTLC 4K55A 4YHML 3A24A 4NQCB 5TE4L 1ZE3C 4G59C 2DQJL 3L4YA 2NY5C 4GW1A 5GRXG 4UYPA 2XN2A 2C7UB 1YYCA 1TPXC 5GGRB 4DZBA 4RQQB 1FPTL 5K59E 3IFLH 4JZJC 1NKGA 2FLRT 1GZPA 2DQTL 4M6AA 4N20A 2YGQA 1MCDA 1Q0EA 1U8PB 4UTAA 3TN0C 4DEPB 3P0VL 1JBJA 3TZVC 4MKMA 3QIWB 3J07A 1QQDA 1QFUL 2A6IA 1NCDL 3UTTE 4L2LA 5FO7B 2VDNB 4NM8H 3V0AC 1U91B 4ICXA 3WJLC 5KS9A 3V4VL 3F64A 1E27A 1EAPB 4XN7A 1S9WB 5KAQG 5DJ8B 1A66A