3PMMA

The crystal structure of a possible member of gh105 family from klebsiella pneumoniae subsp. pneumoniae mgh 78578
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
381
structure length
381
Chain Sequence
NAMKVWPVKHSPLLRQPERFIARSELQALIRNVTQNLVNIKDESGQFLLRLDDGRVIDTKGWAGWEWTHGVGLYGIYQYYQQTGDIEMRDIIDRWFADRFAEGATTKNVNTMAPFLTLAYRFEETGRMAYLPWLESWAEWAMHEMPRTEQGGMQHMTLAEENHQQMWDDTLMMTVLPLAKIGKLLNRPQYVEEATYQFLLHVQNLMDRETGLWFHGWNYEGRHNFARARWARGNSWLTMVIPDFLELVDLPEGNAVRRYLITVLDAQIAALAECQDDSGLWHTLLDDPHSYLEASATAGFAYGILKAVRKRYVGQHYAGVAEKAIRGIVQNISPQGELLQTSFGTGMGSDLDFYRQIPLTSMPYGQAMAILCLTEYLRKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title The crystal structure of a possible member of GH105 family from Klebsiella pneumoniae subsp. pneumoniae MGH 78578
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase
total genus 136
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3pmmA00
2GH4A 4DODA 1F9OA 1LF9A 3CIHA 1GA2A 5CD2A 3PMMA 3RSYA 3GLYA 2D5JA 4DOEA 3W5NA 2FBAA 3A3VA 3S4CA 3QRYA 1AYXA 3WIRA 3QPFA 2FV1A 1WU6A 1G9JA 2DRQA 1H12A 1V5CA 1KFGA 1FBOA 1DOGA 2WYNA 2VN4A 3GZKA 3S4BA 2DRSA 3WKHA 1WU5A 1DL2A 3RX5A 4Q2BA 1XW2A 4J5TA 3ANJA 4WVBA 1KREA 1KSDA 2AFAA 1CLCA 1L1YA 4TXTA 3W7WA 5GY3A 1G9GA 1FBWA 4AYRA 4KTRA 3GT5A 1FCEA 4WU0A 5DGRA 3H2WA 2RI8A 2DROA 2GZ6A 2RI9A 5E2JA 3RX8A 1WZZA 3D3IA 5KKBA 1G87A 1V7WA 2A8ZA 3WUXA 2Z07A 2EADA 3ACTA 3E73A 3RENA 3ON6A 1FAEA 3W7XA 2CQSA 3QT3A 4ZH5A 2OKXA 1IA6A 3WIQA 2JJBA 3E6UA 3W7SA 3W7UA 4AYQA 2FV0A 2D8LA 1IA7A 1GAIA 1UT9A 2F6DA 3RX7A 4CE7A 4KTPA 3QXFA 4WVAA 1XWQA 2CQTA 1FO2A 2B4FA 1TF4A 2JF4A 4AYOA 3ANKA 3WKFA 1RQ5A 3WC3A 4Z4JA 1ULVA 3EZ8A 1HCUA 1VD5A 3W7TA 3QFYA 3QDEA 2YIKA 5CZLA 3K11A 3S4AA 3RRSA 5CA3A 5MEHA 3EQAA 3X17A 3VW5A 4WVCA 2XFGA 1F9DA 1JS4A 1KS8A 3T33A 3W5MA 2DRRA 3WKGA 4CJ0A 1GAHA 1V7XA 2JG0A 2AHGA 2FUZA 1NC5A 5GW7A 3P2CA 1H13A 1H54A 1V7VA 3H3KA 3H7LA 1WU4A 4CJ1A 1H14A 3ANIA 1KWFA 3QG0A 1XWTA 3WKIA 3QFZA 3WIWA 3AFJA 3ACSA 1AGMA 1CEMA 2ZBLA 4Q88A 1NXCA 4L6XA 1FO3A 4Z4LA 3QWTA 4XUVA 4EL8A 1KSCA 4L0GA 3S4DA 1L2AA 2EACA 1G6IA 1FP3A 1KKTA 2P0VA 2RGKA 1KRFA 1X9DA 2ZZRA 2NVPA 3TF4A 1IS9A 1V5DA 2EABA 4AYPA 2AHFA 1GLMA 4ZG8A 2QNOA 3QSPA 4JJJA 3VXDA 5M7YA 1LF6A 3QXQA 4TF4A 2EAEA 3QT9A 4FUSA 5M7IA 1K72A 1UG9A 5DGQA 1FMIA 2VN7A
chains in the Genus database with same CATH superfamily
1F9OA 3KQ4A 3P5PA 4GTSB 3OEDA 3M73A 4OZWA 2D5JA 1X1JA 2F0YB 4V1RA 1W6JA 3T33A 4GTPB 4GL3A 1HM3A 1DL2A 3RX5A 1XW2A 2A73B 2IEJB 4J5TA 1H36A 5GY3A 5IM1A 2H6FB 4FXGB 3KLSA 5DGRA 2WY7A 2RI8A 2DROA 3RX8A 1J0MA 2BB6A 3E33B 3Q75B 3PZ3B 2A8ZA 3E73A 2CQSA 3QT3A 4GTQB 2GOXA 3WIQA 2BBCA 2F6DA 3HXDB 1JCRB 3C72B 2FUTA 3Q7FB 4YCRA 1RQ5A 3SQCA 2PN5A 3EZ8A 4D4CA 1VD5A 3M01A 4FXKB 1RWAA 4QT9A 1LTXB 5CA3A 1N7OA 1GXOA 1KZOB 4BOJA 3X17A 1F9DA 1JS4A 3W5MA 2DRRA 4C1SA 4CJ0A 1GAHA 3DSWB 1CB8A 1R76A 3SDQA 1H54A 3H7LA 2PMVA 5ILYA 1WU4A 1KWFA 1S64B 2X03A 5ILHA 1GHQA 4Q88A 1NXCA 1NL4B 4Z4LA 2BRVX 4EL8A 5EATA 4L0GA 1TNUB 1L2AA 1KKTA 1KRFA 2ZZRA 1D8DB 3PYAA 1O79A 1IS9A 3M00A 1TNYB 4OK2A 2AHFA 1LOHA 4KKIA 4MMHA 1LF6A 2V8KA 3QT9A 5M7IA 1RWCA 1I8QA 1X1HA 5AGDA 2VN7A 2GH4A 4GTRB 2ONGA 5FO9B 1GA2A 1TN8B 1QQFA 3PMMA 3DSTB 1O1SB 1C3DA 4YDEB 3QRYA 3D5RA 4D94A 3N0FA 1H12A 1W3YA 4ZH1A 1DOGA 2WYNA 2VN4A 3GZKA 5GZKA 3SDUA 2I07B 3WKHA 3M7EA 4Q2BA 3DSXB 4F13A 3ANJA 4WVBA 1KSDA 2AFAA 3DSSB 4TXTA 3W7WA 4GTOB 2ONHA 1FBWA 1HZFA 5IL8A 1N4RB 3GT5A 4OJZA 1N4SB 1RWHA 2WIIB 4V1SA 4ZRPA 3M7BA 5E2JA 3SFYB 1LD7B 4LNGB 1WZZA 4NEIA 1H35A 2Z07A 3ON6A 1FAEA 3S9VA 4ZH5A 3W7SA 1IA6A 3W7UA 1O6QA 3M75A 3M77A 5JPNB 1GAIA 5ILKA 5ILDA 3M7LA 4KTPA 3QXFA 1OJNA 4WVAA 1XWQA 2CQTA 1TF4A 4D4BA 4Z4JA 1HV6A 1HCUA 3W7TA 5CZLA 1HXCA 4OZVA 2Q1FA 1F1SA 1LXKA 3E30B 5JMFA 1O6HA 2XFGA 3PZ4B 3G4FA 2JG0A 2AHGA 1NC5A 3E80A 2V8JA 1H13A 1GXMA 3SDVA 4GTMB 4LNVA 3WKIA 1SA4B 2ZBLA 1H3BA 3M7CA 4XUVA 3DSUB 3S4DA 2EACA 3Q73B 2J5CA 1X9DA 5C05A 4DI5A 3E32B 1QBQB 1TNBB 1JCQB 3D5SA 3RJ3A 4ZG8A 5JMDA 4JJJA 3VXDA 5M7YA 2EAEA 1UG9A 3M71A 5DGQA 1FMIA 1MZCB 4DODA 1GSZA 5CD2A 3RSYA 1OJOA 2B39A 2V3PA 3W5NA 3PYBA 1HMUA 1KZPB 3EUVB 4GTVB 3S4CA 1SQCA 3Q78B 2ZIRB 3M72A 3QPFA 4L9PB 1FT2B 1WU6A 5ILZA 3AFLA 1KFGA 3KSQB 1OJPA 1S63B 4MBGB 2XWJB 1L1YA 2BRPA 1N23A 4KTRA 1UMPA 4WU0A 4D4DA 3H2WA 1N20A 1LD8B 5FO7B 1X81B 3K7XA 1N95B 2SQCA 1JCSB 1N1BA 5DHIA 1H3CA 3WUXA 2FUQA 2WY8A 3ACTA 2BRWA 3RENA 5IKHA 3W7XA 4ZRQA 2JJBA 3E6UA 2BB5A 4YDOB 4AYQA 3OXUA 2H6IB 2FV0A 3NFVA 1IA7A 4CE7A 1UT9A 2H6HB 4BOKA 5JPMB 1N24A 3PZ1B 5EAUA 4MU9A 3VSNA 1DCEB 5ILJA 3DRAB 3WKFA 5IL3A 2XWBB 1ULVA 3EU5B 4FJQA 3QDEA 3S4AA 5MEHA 3EQAA 1N22A 4WVCA 3WKGA 1V7XA 1OJMA 3P2CA 4MMIA 1H39A 3H3KA 4RNQA 1TN7B 1HX9A 3ANIA 1O1RB 5FO8B 3DSVB 1XWTA 3QG0A 3QFZA 3WIWA 3DPYB 1CEMA 1RWFA 1FT1B 1KSCA 2P0VA 1HXAA 5DHKA 1V5DA 1W6KA 3Q7AB 2BEDB 2EABA 5IK9A 1GLMA 3SDRA 5FOBB 2QNOA 3QXQA 4TF4A 4KKJA 4LNBB 3ANKA 2H6GB 3M76A 3N0GA 1LF9A 3G4DA 3CIHA 2E24A 1O1TB 3LZ9A 4ONTA 1D8EB 2XQWA 2E22A 3GLYA 4DOEA 2FBAA 1H37A 3A3VA 3M02A 1HXGA 3G6JB 1AYXA 1RW9A 3Q79B 5ILIA 3HXFB 1HMWA 3SFXB 3WIRA 1F9GA 2FV1A 1G9JA 1N4QB 1V5CA 2DRQA 1FBOA 3S4BA 2DRSA 2V3NA 3E37B 3KSLB 1WU5A 4OK4A 5IKAA 1SA5B 1N7PA 1KREA 2WDAA 1CLCA 3PZ2B 1G9GA 1TNZB 4AYRA 3NNBA 2G02A 1FCEA 4EHMB 2GZ6A 2RI9A 1EGUA 1N7QA 3D3IA 5KKBA 2G0DA 1G87A 1V7WA 3M78A 1LXMA 2EADA 2OKXA 1O5MB 2NOJA 1H3AA 1O6RA 1HN0A 3HXBB 3RX7A 2D8LA 3HXEB 4FNVA 4GTTB 1N7RA 5IK0A 1FO2A 1N94B 2B4FA 2JF4A 3SAEA 4LIXA 4AYOA 4GAXA 1C82A 3WC3A 3QFYA 2YIKA 3CU7A 3K11A 3RRSA 1RWGA 1TNOB 1QAZA 3VW5A 1N9AB 3EU8A 1KS8A 1GXNA 1X1IA 3P5RA 4D4AA 2FUZA 5GW7A 1N4PB 1TN6B 1V7VA 4F10A 2WINB 5IK6A 4M76A 4CJ1A 1H14A 1HM2A 3E34B 4E1YA 3AFJA 3ACSA 3VSMA 1AGMA 3M74A 1J0NA 2ZISB 4L6XA 1FO3A 3QWTA 2V8IA 1N1ZA 1N7NA 1G6IA 1FP3A 2RGKA 2WCOA 3HXCB 3A0OA 3SDTA 3E7JA 3TF4A 2NVPA 1QSJA 4AYPA 1N21A 1NI1B 3QSPA 2R2LB 1FPPB 4FUSA 1K72A 5EASA
chains in the Genus database with same CATH topology
1F9OA 3KQ4A 3P5PA 4GTSB 3OEDA 3M73A 2D5JA 2F0YB 4V1RA 1W6JA 3T33A 4GTPB 4GL3A 1DL2A 3RX5A 1XW2A 2A73B 2IEJB 4J5TA 1H36A 5GY3A 2H6FB 4FXGB 3KLSA 5DGRA 2WY7A 2RI8A 2DROA 3RX8A 2BB6A 3E33B 3Q75B 3PZ3B 2A8ZA 3E73A 2CQSA 3QT3A 4GTQB 2GOXA 3WIQA 2BBCA 2F6DA 3HXDB 1JCRB 3C72B 3Q7FB 4YCRA 1RQ5A 3SQCA 2PN5A 3EZ8A 4D4CA 1VD5A 4FXKB 4QT9A 1LTXB 5CA3A 1GXOA 1KZOB 4BOJA 3X17A 1F9DA 1JS4A 3W5MA 2DRRA 4C1SA 4CJ0A 1GAHA 3DSWB 1R76A 3SDQA 1H54A 3H7LA 2PMVA 1WU4A 1KWFA 1S64B 1GHQA 4Q88A 1NXCA 1NL4B 4Z4LA 4EL8A 4L0GA 1TNUB 1L2AA 1KKTA 1KRFA 2ZZRA 1D8DB 3PYAA 1O79A 1IS9A 1TNYB 2AHFA 4KKIA 1LF6A 2V8KA 3QT9A 5M7IA 5AGDA 2VN7A 2GH4A 4GTRB 5FO9B 1GA2A 1TN8B 1QQFA 3PMMA 3DSTB 1O1SB 1C3DA 4YDEB 3QRYA 3D5RA 4D94A 1H12A 4ZH1A 1DOGA 2WYNA 2VN4A 3GZKA 5GZKA 3SDUA 2I07B 3WKHA 3M7EA 4Q2BA 3DSXB 3ANJA 4WVBA 1KSDA 2AFAA 3DSSB 4TXTA 3W7WA 4GTOB 1FBWA 1HZFA 1N4RB 3GT5A 1N4SB 2WIIB 4ZRPA 4V1SA 3M7BA 5E2JA 3SFYB 1LD7B 4LNGB 1WZZA 1H35A 2Z07A 3ON6A 1FAEA 3S9VA 4ZH5A 3W7SA 1IA6A 3W7UA 1O6QA 3M75A 3M77A 5JPNB 1GAIA 3M7LA 4KTPA 3QXFA 4WVAA 1XWQA 2CQTA 1TF4A 4D4BA 4Z4JA 1HCUA 3W7TA 5CZLA 3E30B 1O6HA 2XFGA 3PZ4B 2JG0A 2AHGA 1NC5A 2V8JA 1H13A 1GXMA 3SDVA 4GTMB 4LNVA 3WKIA 1SA4B 2ZBLA 1H3BA 3M7CA 4XUVA 3DSUB 3S4DA 2EACA 3Q73B 1X9DA 3E32B 1QBQB 1TNBB 1JCQB 3D5SA 3RJ3A 4ZG8A 4JJJA 3VXDA 5M7YA 2EAEA 1UG9A 3M71A 5DGQA 1FMIA 1MZCB 4DODA 1GSZA 5CD2A 3RSYA 2B39A 2V3PA 3W5NA 3PYBA 1KZPB 3EUVB 4GTVB 3S4CA 1SQCA 3Q78B 2ZIRB 3M72A 3QPFA 4L9PB 1FT2B 1WU6A 1KFGA 3KSQB 1S63B 4MBGB 2XWJB 1L1YA 4KTRA 1UMPA 4WU0A 4D4DA 3H2WA 1LD8B 5FO7B 1X81B 3K7XA 1N95B 2SQCA 1JCSB 1H3CA 3WUXA 2WY8A 3ACTA 3RENA 3W7XA 4ZRQA 2JJBA 3E6UA 2BB5A 4YDOB 4AYQA 3OXUA 2H6IB 2FV0A 1IA7A 4CE7A 1UT9A 2H6HB 4BOKA 5JPMB 3PZ1B 4MU9A 1DCEB 3DRAB 3WKFA 2XWBB 1ULVA 3EU5B 3QDEA 3S4AA 5MEHA 3EQAA 4WVCA 3WKGA 1V7XA 3P2CA 1H39A 3H3KA 1TN7B 3ANIA 1O1RB 5FO8B 3DSVB 1XWTA 3QG0A 3QFZA 3WIWA 3DPYB 1CEMA 1FT1B 1KSCA 2P0VA 1V5DA 1W6KA 3Q7AB 2BEDB 2EABA 1GLMA 3SDRA 5FOBB 2QNOA 3QXQA 4TF4A 4KKJA 4LNBB 3ANKA 2H6GB 3M76A 1LF9A 3CIHA 1O1TB 4ONTA 1D8EB 2XQWA 3GLYA 4DOEA 2FBAA 1H37A 3A3VA 3G6JB 1AYXA 3Q79B 3HXFB 3WIRA 3SFXB 2FV1A 1N4QB 1G9JA 1V5CA 2DRQA 1FBOA 3S4BA 2DRSA 2V3NA 3E37B 3KSLB 1WU5A 1SA5B 1KREA 1CLCA 3PZ2B 1G9GA 1TNZB 4AYRA 2G02A 1FCEA 4EHMB 2GZ6A 2RI9A 3D3IA 5KKBA 2G0DA 1G87A 1V7WA 3M78A 2EADA 2OKXA 1O5MB 2NOJA 1H3AA 1O6RA 3HXBB 3RX7A 2D8LA 3HXEB 4GTTB 1FO2A 1N94B 2B4FA 2JF4A 3SAEA 4LIXA 4AYOA 3WC3A 3QFYA 2YIKA 3CU7A 3K11A 3RRSA 1TNOB 3VW5A 1N9AB 3EU8A 1KS8A 1GXNA 3P5RA 4D4AA 2FUZA 5GW7A 1N4PB 1TN6B 1V7VA 2WINB 4M76A 4CJ1A 1H14A 3E34B 3AFJA 3ACSA 1AGMA 3M74A 2ZISB 4L6XA 1FO3A 3QWTA 2V8IA 3SDTA 1G6IA 1FP3A 2RGKA 3HXCB 3TF4A 2NVPA 1QSJA 4AYPA 1NI1B 3QSPA 2R2LB 1FPPB 4FUSA 1K72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH4 A;  4DOD A;  1F9O A;  1LF9 A;  3CIH A;  1GA2 A;  5CD2 A;  3PMM A;  3RSY A;  3GLY A;  2D5J A;  4DOE A;  3W5N A;  2FBA A;  3A3V A;  3S4C A;  3QRY A;  1AYX A;  3WIR A;  3QPF A;  2FV1 A;  1WU6 A;  1G9J A;  2DRQ A;  1H12 A;  1V5C A;  1KFG A;  1FBO A;  1DOG A;  2WYN A;  2VN4 A;  3GZK A;  3S4B A;  2DRS A;  3WKH A;  1WU5 A;  1DL2 A;  3RX5 A;  4Q2B A;  1XW2 A;  4J5T A;  3ANJ A;  4WVB A;  1KRE A;  1KSD A;  2AFA A;  1CLC A;  1L1Y A;  4TXT A;  3W7W A;  5GY3 A;  1G9G A;  1FBW A;  4AYR A;  4KTR A;  3GT5 A;  1FCE A;  4WU0 A;  5DGR A;  3H2W A;  2RI8 A;  2DRO A;  2GZ6 A;  2RI9 A;  5E2J A;  3RX8 A;  1WZZ A;  3D3I A;  5KKB A;  1G87 A;  1V7W A;  2A8Z A;  3WUX A;  2Z07 A;  2EAD A;  3ACT A;  3E73 A;  3REN A;  3ON6 A;  1FAE A;  3W7X A;  2CQS A;  3QT3 A;  4ZH5 A;  2OKX A;  1IA6 A;  3WIQ A;  2JJB A;  3E6U A;  3W7S A;  3W7U A;  4AYQ A;  2FV0 A;  2D8L A;  1IA7 A;  1GAI A;  1UT9 A;  2F6D A;  3RX7 A;  4CE7 A;  4KTP A;  3QXF A;  4WVA A;  1XWQ A;  2CQT A;  1FO2 A;  2B4F A;  1TF4 A;  2JF4 A;  4AYO A;  3ANK A;  3WKF A;  1RQ5 A;  3WC3 A;  4Z4J A;  1ULV A;  3EZ8 A;  1HCU A;  1VD5 A;  3W7T A;  3QFY A;  3QDE A;  2YIK A;  5CZL A;  3K11 A;  3S4A A;  3RRS A;  5CA3 A;  5MEH A;  3EQA A;  3X17 A;  3VW5 A;  4WVC A;  2XFG A;  1F9D A;  1JS4 A;  1KS8 A;  3T33 A;  3W5M A;  2DRR A;  3WKG A;  4CJ0 A;  1GAH A;  1V7X A;  2JG0 A;  2AHG A;  2FUZ A;  1NC5 A;  5GW7 A;  3P2C A;  1H13 A;  1H54 A;  1V7V A;  3H3K A;  3H7L A;  1WU4 A;  4CJ1 A;  1H14 A;  3ANI A;  1KWF A;  3QG0 A;  1XWT A;  3WKI A;  3QFZ A;  3WIW A;  3AFJ A;  3ACS A;  1AGM A;  1CEM A;  2ZBL A;  4Q88 A;  1NXC A;  4L6X A;  1FO3 A;  4Z4L A;  3QWT A;  4XUV A;  4EL8 A;  1KSC A;  4L0G A;  3S4D A;  1L2A A;  2EAC A;  1G6I A;  1FP3 A;  1KKT A;  2P0V A;  2RGK A;  1KRF A;  1X9D A;  2ZZR A;  2NVP A;  3TF4 A;  1IS9 A;  1V5D A;  2EAB A;  4AYP A;  2AHF A;  1GLM A;  4ZG8 A;  2QNO A;  3QSP A;  4JJJ A;  3VXD A;  5M7Y A;  1LF6 A;  3QXQ A;  4TF4 A;  2EAE A;  3QT9 A;  4FUS A;  5M7I A;  1K72 A;  1UG9 A;  5DGQ A;  1FMI A;  2VN7 A; 
#chains in the Genus database with same CATH topology
 1F9O A;  3KQ4 A;  3P5P A;  4GTS B;  3OED A;  3M73 A;  4OZW A;  2D5J A;  1X1J A;  2F0Y B;  4V1R A;  1W6J A;  3T33 A;  4GTP B;  4GL3 A;  1HM3 A;  1DL2 A;  3RX5 A;  1XW2 A;  2A73 B;  2IEJ B;  4J5T A;  1H36 A;  5GY3 A;  5IM1 A;  2H6F B;  4FXG B;  3KLS A;  5DGR A;  2WY7 A;  2RI8 A;  2DRO A;  3RX8 A;  1J0M A;  2BB6 A;  3E33 B;  3Q75 B;  3PZ3 B;  2A8Z A;  3E73 A;  2CQS A;  3QT3 A;  4GTQ B;  2GOX A;  3WIQ A;  2BBC A;  2F6D A;  3HXD B;  1JCR B;  3C72 B;  2FUT A;  3Q7F B;  4YCR A;  1RQ5 A;  3SQC A;  2PN5 A;  3EZ8 A;  4D4C A;  1VD5 A;  3M01 A;  4FXK B;  1RWA A;  4QT9 A;  1LTX B;  5CA3 A;  1N7O A;  1GXO A;  1KZO B;  4BOJ A;  3X17 A;  1F9D A;  1JS4 A;  3W5M A;  2DRR A;  4C1S A;  4CJ0 A;  1GAH A;  3DSW B;  1CB8 A;  1R76 A;  3SDQ A;  1H54 A;  3H7L A;  2PMV A;  5ILY A;  1WU4 A;  1KWF A;  1S64 B;  2X03 A;  5ILH A;  1GHQ A;  4Q88 A;  1NXC A;  1NL4 B;  4Z4L A;  2BRV X;  4EL8 A;  5EAT A;  4L0G A;  1TNU B;  1L2A A;  1KKT A;  1KRF A;  2ZZR A;  1D8D B;  3PYA A;  1O79 A;  1IS9 A;  3M00 A;  1TNY B;  4OK2 A;  2AHF A;  1LOH A;  4KKI A;  4MMH A;  1LF6 A;  2V8K A;  3QT9 A;  5M7I A;  1RWC A;  1I8Q A;  1X1H A;  5AGD A;  2VN7 A;  2GH4 A;  4GTR B;  2ONG A;  5FO9 B;  1GA2 A;  1TN8 B;  1QQF A;  3PMM A;  3DST B;  1O1S B;  1C3D A;  4YDE B;  3QRY A;  3D5R A;  4D94 A;  3N0F A;  1H12 A;  1W3Y A;  4ZH1 A;  1DOG A;  2WYN A;  2VN4 A;  3GZK A;  5GZK A;  3SDU A;  2I07 B;  3WKH A;  3M7E A;  4Q2B A;  3DSX B;  4F13 A;  3ANJ A;  4WVB A;  1KSD A;  2AFA A;  3DSS B;  4TXT A;  3W7W A;  4GTO B;  2ONH A;  1FBW A;  1HZF A;  5IL8 A;  1N4R B;  3GT5 A;  4OJZ A;  1N4S B;  1RWH A;  2WII B;  4V1S A;  4ZRP A;  3M7B A;  5E2J A;  3SFY B;  1LD7 B;  4LNG B;  1WZZ A;  4NEI A;  1H35 A;  2Z07 A;  3ON6 A;  1FAE A;  3S9V A;  4ZH5 A;  3W7S A;  1IA6 A;  3W7U A;  1O6Q A;  3M75 A;  3M77 A;  5JPN B;  1GAI A;  5ILK A;  5ILD A;  3M7L A;  4KTP A;  3QXF A;  1OJN A;  4WVA A;  1XWQ A;  2CQT A;  1TF4 A;  4D4B A;  4Z4J A;  1HV6 A;  1HCU A;  3W7T A;  5CZL A;  1HXC A;  4OZV A;  2Q1F A;  1F1S A;  1LXK A;  3E30 B;  5JMF A;  1O6H A;  2XFG A;  3PZ4 B;  3G4F A;  2JG0 A;  2AHG A;  1NC5 A;  3E80 A;  2V8J A;  1H13 A;  1GXM A;  3SDV A;  4GTM B;  4LNV A;  3WKI A;  1SA4 B;  2ZBL A;  1H3B A;  3M7C A;  4XUV A;  3DSU B;  3S4D A;  2EAC A;  3Q73 B;  2J5C A;  1X9D A;  5C05 A;  4DI5 A;  3E32 B;  1QBQ B;  1TNB B;  1JCQ B;  3D5S A;  3RJ3 A;  4ZG8 A;  5JMD A;  4JJJ A;  3VXD A;  5M7Y A;  2EAE A;  1UG9 A;  3M71 A;  5DGQ A;  1FMI A;  1MZC B;  4DOD A;  1GSZ A;  5CD2 A;  3RSY A;  1OJO A;  2B39 A;  2V3P A;  3W5N A;  3PYB A;  1HMU A;  1KZP B;  3EUV B;  4GTV B;  3S4C A;  1SQC A;  3Q78 B;  2ZIR B;  3M72 A;  3QPF A;  4L9P B;  1FT2 B;  1WU6 A;  5ILZ A;  3AFL A;  1KFG A;  3KSQ B;  1OJP A;  1S63 B;  4MBG B;  2XWJ B;  1L1Y A;  2BRP A;  1N23 A;  4KTR A;  1UMP A;  4WU0 A;  4D4D A;  3H2W A;  1N20 A;  1LD8 B;  5FO7 B;  1X81 B;  3K7X A;  1N95 B;  2SQC A;  1JCS B;  1N1B A;  5DHI A;  1H3C A;  3WUX A;  2FUQ A;  2WY8 A;  3ACT A;  2BRW A;  3REN A;  5IKH A;  3W7X A;  4ZRQ A;  2JJB A;  3E6U A;  2BB5 A;  4YDO B;  4AYQ A;  3OXU A;  2H6I B;  2FV0 A;  3NFV A;  1IA7 A;  4CE7 A;  1UT9 A;  2H6H B;  4BOK A;  5JPM B;  1N24 A;  3PZ1 B;  5EAU A;  4MU9 A;  3VSN A;  1DCE B;  5ILJ A;  3DRA B;  3WKF A;  5IL3 A;  2XWB B;  1ULV A;  3EU5 B;  4FJQ A;  3QDE A;  3S4A A;  5MEH A;  3EQA A;  1N22 A;  4WVC A;  3WKG A;  1V7X A;  1OJM A;  3P2C A;  4MMI A;  1H39 A;  3H3K A;  4RNQ A;  1TN7 B;  1HX9 A;  3ANI A;  1O1R B;  5FO8 B;  3DSV B;  1XWT A;  3QG0 A;  3QFZ A;  3WIW A;  3DPY B;  1CEM A;  1RWF A;  1FT1 B;  1KSC A;  2P0V A;  1HXA A;  5DHK A;  1V5D A;  1W6K A;  3Q7A B;  2BED B;  2EAB A;  5IK9 A;  1GLM A;  3SDR A;  5FOB B;  2QNO A;  3QXQ A;  4TF4 A;  4KKJ A;  4LNB B;  3ANK A;  2H6G B;  3M76 A;  3N0G A;  1LF9 A;  3G4D A;  3CIH A;  2E24 A;  1O1T B;  3LZ9 A;  4ONT A;  1D8E B;  2XQW A;  2E22 A;  3GLY A;  4DOE A;  2FBA A;  1H37 A;  3A3V A;  3M02 A;  1HXG A;  3G6J B;  1AYX A;  1RW9 A;  3Q79 B;  5ILI A;  3HXF B;  1HMW A;  3SFX B;  3WIR A;  1F9G A;  2FV1 A;  1G9J A;  1N4Q B;  1V5C A;  2DRQ A;  1FBO A;  3S4B A;  2DRS A;  2V3N A;  3E37 B;  3KSL B;  1WU5 A;  4OK4 A;  5IKA A;  1SA5 B;  1N7P A;  1KRE A;  2WDA A;  1CLC A;  3PZ2 B;  1G9G A;  1TNZ B;  4AYR A;  3NNB A;  2G02 A;  1FCE A;  4EHM B;  2GZ6 A;  2RI9 A;  1EGU A;  1N7Q A;  3D3I A;  5KKB A;  2G0D A;  1G87 A;  1V7W A;  3M78 A;  1LXM A;  2EAD A;  2OKX A;  1O5M B;  2NOJ A;  1H3A A;  1O6R A;  1HN0 A;  3HXB B;  3RX7 A;  2D8L A;  3HXE B;  4FNV A;  4GTT B;  1N7R A;  5IK0 A;  1FO2 A;  1N94 B;  2B4F A;  2JF4 A;  3SAE A;  4LIX A;  4AYO A;  4GAX A;  1C82 A;  3WC3 A;  3QFY A;  2YIK A;  3CU7 A;  3K11 A;  3RRS A;  1RWG A;  1TNO B;  1QAZ A;  3VW5 A;  1N9A B;  3EU8 A;  1KS8 A;  1GXN A;  1X1I A;  3P5R A;  4D4A A;  2FUZ A;  5GW7 A;  1N4P B;  1TN6 B;  1V7V A;  4F10 A;  2WIN B;  5IK6 A;  4M76 A;  4CJ1 A;  1H14 A;  1HM2 A;  3E34 B;  4E1Y A;  3AFJ A;  3ACS A;  3VSM A;  1AGM A;  3M74 A;  1J0N A;  2ZIS B;  4L6X A;  1FO3 A;  3QWT A;  2V8I A;  1N1Z A;  1N7N A;  1G6I A;  1FP3 A;  2RGK A;  2WCO A;  3HXC B;  3A0O A;  3SDT A;  3E7J A;  3TF4 A;  2NVP A;  1QSJ A;  4AYP A;  1N21 A;  1NI1 B;  3QSP A;  2R2L B;  1FPP B;  4FUS A;  1K72 A;  5EAS A; 
#chains in the Genus database with same CATH homology
 1F9O A;  3KQ4 A;  3P5P A;  4GTS B;  3OED A;  3M73 A;  2D5J A;  2F0Y B;  4V1R A;  1W6J A;  3T33 A;  4GTP B;  4GL3 A;  1DL2 A;  3RX5 A;  1XW2 A;  2A73 B;  2IEJ B;  4J5T A;  1H36 A;  5GY3 A;  2H6F B;  4FXG B;  3KLS A;  5DGR A;  2WY7 A;  2RI8 A;  2DRO A;  3RX8 A;  2BB6 A;  3E33 B;  3Q75 B;  3PZ3 B;  2A8Z A;  3E73 A;  2CQS A;  3QT3 A;  4GTQ B;  2GOX A;  3WIQ A;  2BBC A;  2F6D A;  3HXD B;  1JCR B;  3C72 B;  3Q7F B;  4YCR A;  1RQ5 A;  3SQC A;  2PN5 A;  3EZ8 A;  4D4C A;  1VD5 A;  4FXK B;  4QT9 A;  1LTX B;  5CA3 A;  1GXO A;  1KZO B;  4BOJ A;  3X17 A;  1F9D A;  1JS4 A;  3W5M A;  2DRR A;  4C1S A;  4CJ0 A;  1GAH A;  3DSW B;  1R76 A;  3SDQ A;  1H54 A;  3H7L A;  2PMV A;  1WU4 A;  1KWF A;  1S64 B;  1GHQ A;  4Q88 A;  1NXC A;  1NL4 B;  4Z4L A;  4EL8 A;  4L0G A;  1TNU B;  1L2A A;  1KKT A;  1KRF A;  2ZZR A;  1D8D B;  3PYA A;  1O79 A;  1IS9 A;  1TNY B;  2AHF A;  4KKI A;  1LF6 A;  2V8K A;  3QT9 A;  5M7I A;  5AGD A;  2VN7 A;  2GH4 A;  4GTR B;  5FO9 B;  1GA2 A;  1TN8 B;  1QQF A;  3PMM A;  3DST B;  1O1S B;  1C3D A;  4YDE B;  3QRY A;  3D5R A;  4D94 A;  1H12 A;  4ZH1 A;  1DOG A;  2WYN A;  2VN4 A;  3GZK A;  5GZK A;  3SDU A;  2I07 B;  3WKH A;  3M7E A;  4Q2B A;  3DSX B;  3ANJ A;  4WVB A;  1KSD A;  2AFA A;  3DSS B;  4TXT A;  3W7W A;  4GTO B;  1FBW A;  1HZF A;  1N4R B;  3GT5 A;  1N4S B;  2WII B;  4ZRP A;  4V1S A;  3M7B A;  5E2J A;  3SFY B;  1LD7 B;  4LNG B;  1WZZ A;  1H35 A;  2Z07 A;  3ON6 A;  1FAE A;  3S9V A;  4ZH5 A;  3W7S A;  1IA6 A;  3W7U A;  1O6Q A;  3M75 A;  3M77 A;  5JPN B;  1GAI A;  3M7L A;  4KTP A;  3QXF A;  4WVA A;  1XWQ A;  2CQT A;  1TF4 A;  4D4B A;  4Z4J A;  1HCU A;  3W7T A;  5CZL A;  3E30 B;  1O6H A;  2XFG A;  3PZ4 B;  2JG0 A;  2AHG A;  1NC5 A;  2V8J A;  1H13 A;  1GXM A;  3SDV A;  4GTM B;  4LNV A;  3WKI A;  1SA4 B;  2ZBL A;  1H3B A;  3M7C A;  4XUV A;  3DSU B;  3S4D A;  2EAC A;  3Q73 B;  1X9D A;  3E32 B;  1QBQ B;  1TNB B;  1JCQ B;  3D5S A;  3RJ3 A;  4ZG8 A;  4JJJ A;  3VXD A;  5M7Y A;  2EAE A;  1UG9 A;  3M71 A;  5DGQ A;  1FMI A;  1MZC B;  4DOD A;  1GSZ A;  5CD2 A;  3RSY A;  2B39 A;  2V3P A;  3W5N A;  3PYB A;  1KZP B;  3EUV B;  4GTV B;  3S4C A;  1SQC A;  3Q78 B;  2ZIR B;  3M72 A;  3QPF A;  4L9P B;  1FT2 B;  1WU6 A;  1KFG A;  3KSQ B;  1S63 B;  4MBG B;  2XWJ B;  1L1Y A;  4KTR A;  1UMP A;  4WU0 A;  4D4D A;  3H2W A;  1LD8 B;  5FO7 B;  1X81 B;  3K7X A;  1N95 B;  2SQC A;  1JCS B;  1H3C A;  3WUX A;  2WY8 A;  3ACT A;  3REN A;  3W7X A;  4ZRQ A;  2JJB A;  3E6U A;  2BB5 A;  4YDO B;  4AYQ A;  3OXU A;  2H6I B;  2FV0 A;  1IA7 A;  4CE7 A;  1UT9 A;  2H6H B;  4BOK A;  5JPM B;  3PZ1 B;  4MU9 A;  1DCE B;  3DRA B;  3WKF A;  2XWB B;  1ULV A;  3EU5 B;  3QDE A;  3S4A A;  5MEH A;  3EQA A;  4WVC A;  3WKG A;  1V7X A;  3P2C A;  1H39 A;  3H3K A;  1TN7 B;  3ANI A;  1O1R B;  5FO8 B;  3DSV B;  1XWT A;  3QG0 A;  3QFZ A;  3WIW A;  3DPY B;  1CEM A;  1FT1 B;  1KSC A;  2P0V A;  1V5D A;  1W6K A;  3Q7A B;  2BED B;  2EAB A;  1GLM A;  3SDR A;  5FOB B;  2QNO A;  3QXQ A;  4TF4 A;  4KKJ A;  4LNB B;  3ANK A;  2H6G B;  3M76 A;  1LF9 A;  3CIH A;  1O1T B;  4ONT A;  1D8E B;  2XQW A;  3GLY A;  4DOE A;  2FBA A;  1H37 A;  3A3V A;  3G6J B;  1AYX A;  3Q79 B;  3HXF B;  3WIR A;  3SFX B;  2FV1 A;  1N4Q B;  1G9J A;  1V5C A;  2DRQ A;  1FBO A;  3S4B A;  2DRS A;  2V3N A;  3E37 B;  3KSL B;  1WU5 A;  1SA5 B;  1KRE A;  1CLC A;  3PZ2 B;  1G9G A;  1TNZ B;  4AYR A;  2G02 A;  1FCE A;  4EHM B;  2GZ6 A;  2RI9 A;  3D3I A;  5KKB A;  2G0D A;  1G87 A;  1V7W A;  3M78 A;  2EAD A;  2OKX A;  1O5M B;  2NOJ A;  1H3A A;  1O6R A;  3HXB B;  3RX7 A;  2D8L A;  3HXE B;  4GTT B;  1FO2 A;  1N94 B;  2B4F A;  2JF4 A;  3SAE A;  4LIX A;  4AYO A;  3WC3 A;  3QFY A;  2YIK A;  3CU7 A;  3K11 A;  3RRS A;  1TNO B;  3VW5 A;  1N9A B;  3EU8 A;  1KS8 A;  1GXN A;  3P5R A;  4D4A A;  2FUZ A;  5GW7 A;  1N4P B;  1TN6 B;  1V7V A;  2WIN B;  4M76 A;  4CJ1 A;  1H14 A;  3E34 B;  3AFJ A;  3ACS A;  1AGM A;  3M74 A;  2ZIS B;  4L6X A;  1FO3 A;  3QWT A;  2V8I A;  3SDT A;  1G6I A;  1FP3 A;  2RGK A;  3HXC B;  3TF4 A;  2NVP A;  1QSJ A;  4AYP A;  1NI1 B;  3QSP A;  2R2L B;  1FPP B;  4FUS A;  1K72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...