3PMOA

The structure of lpxd from pseudomonas aeruginosa at 1.3 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
357
structure length
357
Chain Sequence
SSHHHHHHSSGLVPRGSHMSTLSYTLGQLAAHVGAEVRGDADLPIQGLATLQEAGPAQLSFLANPQYRKYLPESRAGAVLLTAADADGFAGTALVVANPYLAYASLSHLFDRKPKAAAGIHPTAIVAADAEVDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGEGFGFANEKGVWQKIAQIGGVTIGDDVEIGANTTIDRGALSDTLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITEPGSYSSGTAMQPAAEWKKSAARIRQLDDMARRLQQLEKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
publication title The structure of LpxD from Pseudomonas aeruginosa at 1.3 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 119
structure length 357
sequence length 357
ec nomenclature ec 2.3.1.-:
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3pmoA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 3pmoA01
4MFGA 2V0HA 3TIOA 3IXCA 3VBIA 3CJ8A 1J2ZA 5AFUU 3GUEA 3SRTA 2IU9A 3BRKX 3FSXA 1YP3A 3T57A 4E1KA 3R8YA 3FSBA 4G3PA 2WLGA 3FOQA 5F42A 1XHDA 2V0LA 4G3SA 3MQGA 5DEPA 1KRVA 1S80A 1SSQA 3BXYA 3R2WA 3KWDA 1HV9A 1FWYA 3ZM5A 1HM9A 2OI5A 4N27A 4AC3A 4CVLA 1QRGA 1OCXA 5E3RA 2OI6A 1HM0A 3VBMA 1Z90A 2JF2A 4N6BA 4R36A 5U2KA 4C12A 2WLCA 1LXAA 3TV0A 4K6RA 1QREA 1TDTA 4QF5A 2QKXA 2ICYA 3R3IA 2V0IA 3P1BA 3HSQA 4HCQA 2ICXA 5L6SA 5DEMA 3FS8A 3R1WA 4ZIYA 5E3PA 2W0VA 3BSWA 3PMOA 2NPOA 3TK8A 4EABA 3I3AA 2FKOA 1KRRA 3ST8A 2V0JA 1SSTA 4HZCA 4H7OA 4E6TA 3BSYA 4QDIA 3VBJA 2QIVX 3TWDA 2IC7A 4EA9A 4CVMA 4KPZA 1V3WA 3ECTA 4E6UA 3OUPA 3GVDA 1HM8A 1V67A 3OTMA 4HURA 4E79A 1FXJA 3TDTA 3FTTA 4KNXA 4IHHA 1QRMA 3P47A 4KNRA 4N6AA 3R5DA 1KHRA 2Q4JA 4EGGA 3HJJA 3DJ4A 4KQLA 1E8CA 1KRUA 3OTZA 2IU8A 1KGTA 2W0WA 3FSYA 3NZ2A 5DG3A 4M2AA 3F1XA 4HUSA 1MRLA 4M98A 3D8VA 1QRLA 2WLFA 3JQYA 4J18A 4DCLA 3OU9A 2AM1A 2OEFA 4M99A 5L6VA 4EQYA 4E75A 3KWEA 3VNPA 4EAAA 1G97A 1XATA 2P2OA 2V0KA 3KWCA 4KPXA 1KK6A 3IGJA 4N69A 1MR9A 5E3QA 4CVKA 4EA8A 1GG4A 4MZUA 4AAWA 3FSCA 4M9CA 2TDTA 2WLDA 3R5AA 3R3RA 2RIJA 2VD4A 3I3XA 1KK5A 3FWWA 1G95A 3VBLA 3BSSA 3GOSA 4R37A 3SPTA 2WTZA 3R0SA 1SSMA 3V4EA 2GGOA 1QQ0A 3D98A 3ZL8A 2I5KA 2GGQA 4C13A 1MR7A 3TISA 3C8VA 4IHFA 2WLEA 4J09A 4M28A 2VHEA 3R5CA 4IHGA 3OW5A 4FCEA 5ADXU 2OI7A 1KQAA 2AQ9A 3VBKA 3MQHA 1KGQA 2OEGA 4AA7A 3ZM6A 3EH0A 2JF3A 4M2BA 1YP2A 4EA7A 3EG4A 2XJAA 1KK4A 1T3DA 2AM2A 3MC4A 5AFUV 3Q1XA 4G87A 1THJA 2IUAA 4MYOA 3VBPA 3DHOA 3DK5A 3R5BA 3EEVA 4R7PA 3VBNA 4HZDA 1YP4A 1QRFA 2QIAA 2XATA 4ISXA 5ADXV 3BFPA 4G3QA 4BUBA
chains in the Genus database with same CATH superfamily
4MFGA 2V0HA 3OH0A 3TIOA 3IXCA 3VBIA 3CJ8A 1J2ZA 3OH3A 3GUEA 3SRTA 3VBPA 2IU9A 5AFUU 3BRKX 3FSXA 1YP3A 3T57A 4E1KA 3R8YA 3FSBA 4G3PA 2WLGA 3FOQA 5F42A 1XHDA 2V0LA 3OGZA 4G3SA 3MQGA 1Z2FA 1KRVA 1S80A 1SSQA 3BXYA 3OH1A 3KWDA 3R2WA 1FWYA 5DEPA 1HV9A 3ZM5A 1HM9A 2OI5A 4N27A 4AC3A 4CVLA 1QRGA 3GQ8A 1OCXA 5E3RA 2OI6A 1HM0A 3VBMA 1Z90A 2JF2A 4N6BA 4R36A 5U2KA 4C12A 2YYBA 2WLCA 1LXAA 3TV0A 1M8NA 4K6RA 1QREA 1TDTA 3GQAA 3OH2A 4QF5A 2QKXA 3OH4A 2ICYA 3R3IA 2V0IA 3P1BA 3HSQA 4HCQA 2ICXA 5L6SA 3WSGA 3WSHA 5DEMA 3FS8A 3R1WA 4IWMA 5E3PA 4ZIYA 2W0VA 3BSWA 3PMOA 2NPOA 3TK8A 4EABA 3I3AA 2FKOA 1KRRA 3ST8A 2V0JA 1SSTA 4HZCA 4H7OA 4E6TA 3BSYA 4QDIA 3VBJA 3WSFA 2QIVX 3TWDA 2IC7A 4EA9A 4CVMA 4KPZA 1V3WA 3ECTA 4E6UA 3OUPA 3GVDA 1HM8A 1V67A 3OTMA 4HURA 4E79A 1FXJA 3TDTA 3FTTA 4KNXA 1EWWA 4IHHA 1KNXA 1QRMA 3P47A 4KNRA 4N6AA 3R5DA 1KHRA 3WSIA 2Q4JA 4EGGA 3HJJA 3DJ4A 4KQLA 1E8CA 1KRUA 3L31A 3OTZA 2IU8A 1KGTA 2W0WA 3FSYA 3NZ2A 5DG3A 1NMOA 4M2AA 3L2BA 3F1XA 4HUSA 1MRLA 4M98A 3D8VA 1QRLA 2WLFA 3JQYA 4J18A 4DCLA 3GQ9A 3OU9A 2AM1A 2OEFA 4M99A 5L6VA 4EQYA 4E75A 3KWEA 3VNPA 4EAAA 1G97A 1XATA 2P2OA 2V0KA 3KWCA 4KPXA 1KK6A 3IGJA 4N69A 1MR9A 5E3QA 4CVKA 4EA8A 1GG4A 4MZUA 4AAWA 3FSCA 4M9CA 2TDTA 2WLDA 3R5AA 4IWGA 3R3RA 2RIJA 2VD4A 3I3XA 1KK5A 3FWWA 1KO7A 1G95A 3VBLA 3BSSA 3GOSA 4R37A 3SPTA 2WTZA 3R0SA 1SSMA 3V4EA 2GGOA 1QQ0A 3D98A 2IOJA 3EEQA 3ZL8A 2I5KA 2GGQA 4C13A 1MR7A 3TISA 3C8VA 4IHFA 2WLEA 4J09A 4M28A 2VHEA 3R5CA 4IHGA 3OW5A 4FCEA 5ADXU 2OI7A 1KQAA 2AQ9A 3VBKA 3WSDA 3WSEA 3MQHA 1KGQA 2OEGA 4AA7A 3ZM6A 3EH0A 2JF3A 4M2BA 1YP2A 4EA7A 3EG4A 2XJAA 1KK4A 1T3DA 1NMPA 2AM2A 2FYWA 3MC4A 5AFUV 3Q1XA 4G87A 1THJA 2IUAA 1N4IA 4MYOA 3DHOA 3DK5A 3GQ7A 3EEVA 3R5BA 4R7PA 3VBNA 4HZDA 1YP4A 1QRFA 2QIAA 2XATA 4ISXA 5ADXV 3BFPA 4G3QA 1L0SA 4BUBA 3SUCA
chains in the Genus database with same CATH topology
4MFGA 2V0HA 3TIOA 3IXCA 3VBIA 3CJ8A 1J2ZA 5AFUU 3GUEA 3SRTA 2IU9A 3BRKX 3FSXA 1YP3A 3T57A 4E1KA 3R8YA 3FSBA 4G3PA 2WLGA 3FOQA 5F42A 1XHDA 2V0LA 4G3SA 3MQGA 5DEPA 1KRVA 1S80A 1SSQA 3BXYA 3R2WA 3KWDA 1HV9A 1FWYA 3ZM5A 1HM9A 2OI5A 4N27A 4AC3A 4CVLA 1QRGA 1OCXA 5E3RA 2OI6A 1HM0A 3VBMA 1Z90A 2JF2A 4N6BA 4R36A 5U2KA 4C12A 2WLCA 1LXAA 3TV0A 4K6RA 1QREA 1TDTA 4QF5A 2QKXA 2ICYA 3R3IA 2V0IA 3P1BA 3HSQA 4HCQA 2ICXA 5L6SA 5DEMA 3FS8A 3R1WA 4ZIYA 5E3PA 2W0VA 3BSWA 3PMOA 2NPOA 3TK8A 4EABA 3I3AA 2FKOA 1KRRA 3ST8A 2V0JA 1SSTA 4HZCA 4H7OA 4E6TA 3BSYA 4QDIA 3VBJA 2QIVX 3TWDA 2IC7A 4EA9A 4CVMA 4KPZA 1V3WA 3ECTA 4E6UA 3OUPA 3GVDA 1HM8A 1V67A 3OTMA 4HURA 4E79A 1FXJA 3TDTA 3FTTA 4KNXA 4IHHA 1QRMA 3P47A 4KNRA 4N6AA 3R5DA 1KHRA 2Q4JA 4EGGA 3HJJA 3DJ4A 4KQLA 1E8CA 1KRUA 3OTZA 2IU8A 1KGTA 2W0WA 3FSYA 3NZ2A 5DG3A 4M2AA 3F1XA 4HUSA 1MRLA 4M98A 3D8VA 1QRLA 2WLFA 3JQYA 4J18A 4DCLA 3OU9A 2AM1A 2OEFA 4M99A 5L6VA 4EQYA 4E75A 3KWEA 3VNPA 4EAAA 1G97A 1XATA 2P2OA 2V0KA 3KWCA 4KPXA 1KK6A 3IGJA 4N69A 1MR9A 5E3QA 4CVKA 4EA8A 1GG4A 4MZUA 4AAWA 3FSCA 4M9CA 2TDTA 2WLDA 3R5AA 3R3RA 2RIJA 2VD4A 3I3XA 1KK5A 3FWWA 1G95A 3VBLA 3BSSA 3GOSA 4R37A 3SPTA 2WTZA 3R0SA 1SSMA 3V4EA 2GGOA 1QQ0A 3D98A 3ZL8A 2I5KA 2GGQA 4C13A 1MR7A 3TISA 3C8VA 4IHFA 2WLEA 4J09A 4M28A 2VHEA 3R5CA 4IHGA 3OW5A 4FCEA 5ADXU 2OI7A 1KQAA 2AQ9A 3VBKA 3MQHA 1KGQA 2OEGA 4AA7A 3ZM6A 3EH0A 2JF3A 4M2BA 1YP2A 4EA7A 3EG4A 2XJAA 1KK4A 1T3DA 2AM2A 3MC4A 5AFUV 3Q1XA 4G87A 1THJA 2IUAA 4MYOA 3VBPA 3DHOA 3DK5A 3R5BA 3EEVA 4R7PA 3VBNA 4HZDA 1YP4A 1QRFA 2QIAA 2XATA 4ISXA 5ADXV 3BFPA 4G3QA 4BUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFG A;  2V0H A;  3TIO A;  3IXC A;  3VBI A;  3CJ8 A;  1J2Z A;  5AFU U;  3GUE A;  3SRT A;  2IU9 A;  3BRK X;  3FSX A;  1YP3 A;  3T57 A;  4E1K A;  3R8Y A;  3FSB A;  4G3P A;  2WLG A;  3FOQ A;  5F42 A;  1XHD A;  2V0L A;  4G3S A;  3MQG A;  5DEP A;  1KRV A;  1S80 A;  1SSQ A;  3BXY A;  3R2W A;  3KWD A;  1HV9 A;  1FWY A;  3ZM5 A;  1HM9 A;  2OI5 A;  4N27 A;  4AC3 A;  4CVL A;  1QRG A;  1OCX A;  5E3R A;  2OI6 A;  1HM0 A;  3VBM A;  1Z90 A;  2JF2 A;  4N6B A;  4R36 A;  5U2K A;  4C12 A;  2WLC A;  1LXA A;  3TV0 A;  4K6R A;  1QRE A;  1TDT A;  4QF5 A;  2QKX A;  2ICY A;  3R3I A;  2V0I A;  3P1B A;  3HSQ A;  4HCQ A;  2ICX A;  5L6S A;  5DEM A;  3FS8 A;  3R1W A;  4ZIY A;  5E3P A;  2W0V A;  3BSW A;  3PMO A;  2NPO A;  3TK8 A;  4EAB A;  3I3A A;  2FKO A;  1KRR A;  3ST8 A;  2V0J A;  1SST A;  4HZC A;  4H7O A;  4E6T A;  3BSY A;  4QDI A;  3VBJ A;  2QIV X;  3TWD A;  2IC7 A;  4EA9 A;  4CVM A;  4KPZ A;  1V3W A;  3ECT A;  4E6U A;  3OUP A;  3GVD A;  1HM8 A;  1V67 A;  3OTM A;  4HUR A;  4E79 A;  1FXJ A;  3TDT A;  3FTT A;  4KNX A;  4IHH A;  1QRM A;  3P47 A;  4KNR A;  4N6A A;  3R5D A;  1KHR A;  2Q4J A;  4EGG A;  3HJJ A;  3DJ4 A;  4KQL A;  1E8C A;  1KRU A;  3OTZ A;  2IU8 A;  1KGT A;  2W0W A;  3FSY A;  3NZ2 A;  5DG3 A;  4M2A A;  3F1X A;  4HUS A;  1MRL A;  4M98 A;  3D8V A;  1QRL A;  2WLF A;  3JQY A;  4J18 A;  4DCL A;  3OU9 A;  2AM1 A;  2OEF A;  4M99 A;  5L6V A;  4EQY A;  4E75 A;  3KWE A;  3VNP A;  4EAA A;  1G97 A;  1XAT A;  2P2O A;  2V0K A;  3KWC A;  4KPX A;  1KK6 A;  3IGJ A;  4N69 A;  1MR9 A;  5E3Q A;  4CVK A;  4EA8 A;  1GG4 A;  4MZU A;  4AAW A;  3FSC A;  4M9C A;  2TDT A;  2WLD A;  3R5A A;  3R3R A;  2RIJ A;  2VD4 A;  3I3X A;  1KK5 A;  3FWW A;  1G95 A;  3VBL A;  3BSS A;  3GOS A;  4R37 A;  3SPT A;  2WTZ A;  3R0S A;  1SSM A;  3V4E A;  2GGO A;  1QQ0 A;  3D98 A;  3ZL8 A;  2I5K A;  2GGQ A;  4C13 A;  1MR7 A;  3TIS A;  3C8V A;  4IHF A;  2WLE A;  4J09 A;  4M28 A;  2VHE A;  3R5C A;  4IHG A;  3OW5 A;  4FCE A;  5ADX U;  2OI7 A;  1KQA A;  2AQ9 A;  3VBK A;  3MQH A;  1KGQ A;  2OEG A;  4AA7 A;  3ZM6 A;  3EH0 A;  2JF3 A;  4M2B A;  1YP2 A;  4EA7 A;  3EG4 A;  2XJA A;  1KK4 A;  1T3D A;  2AM2 A;  3MC4 A;  5AFU V;  3Q1X A;  4G87 A;  1THJ A;  2IUA A;  4MYO A;  3VBP A;  3DHO A;  3DK5 A;  3R5B A;  3EEV A;  4R7P A;  3VBN A;  4HZD A;  1YP4 A;  1QRF A;  2QIA A;  2XAT A;  4ISX A;  5ADX V;  3BFP A;  4G3Q A;  4BUB A; 
#chains in the Genus database with same CATH topology
 4MFG A;  2V0H A;  3OH0 A;  3TIO A;  3IXC A;  3VBI A;  3CJ8 A;  1J2Z A;  3OH3 A;  3GUE A;  3SRT A;  3VBP A;  2IU9 A;  5AFU U;  3BRK X;  3FSX A;  1YP3 A;  3T57 A;  4E1K A;  3R8Y A;  3FSB A;  4G3P A;  2WLG A;  3FOQ A;  5F42 A;  1XHD A;  2V0L A;  3OGZ A;  4G3S A;  3MQG A;  1Z2F A;  1KRV A;  1S80 A;  1SSQ A;  3BXY A;  3OH1 A;  3KWD A;  3R2W A;  1FWY A;  5DEP A;  1HV9 A;  3ZM5 A;  1HM9 A;  2OI5 A;  4N27 A;  4AC3 A;  4CVL A;  1QRG A;  3GQ8 A;  1OCX A;  5E3R A;  2OI6 A;  1HM0 A;  3VBM A;  1Z90 A;  2JF2 A;  4N6B A;  4R36 A;  5U2K A;  4C12 A;  2YYB A;  2WLC A;  1LXA A;  3TV0 A;  1M8N A;  4K6R A;  1QRE A;  1TDT A;  3GQA A;  3OH2 A;  4QF5 A;  2QKX A;  3OH4 A;  2ICY A;  3R3I A;  2V0I A;  3P1B A;  3HSQ A;  4HCQ A;  2ICX A;  5L6S A;  3WSG A;  3WSH A;  5DEM A;  3FS8 A;  3R1W A;  4IWM A;  5E3P A;  4ZIY A;  2W0V A;  3BSW A;  3PMO A;  2NPO A;  3TK8 A;  4EAB A;  3I3A A;  2FKO A;  1KRR A;  3ST8 A;  2V0J A;  1SST A;  4HZC A;  4H7O A;  4E6T A;  3BSY A;  4QDI A;  3VBJ A;  3WSF A;  2QIV X;  3TWD A;  2IC7 A;  4EA9 A;  4CVM A;  4KPZ A;  1V3W A;  3ECT A;  4E6U A;  3OUP A;  3GVD A;  1HM8 A;  1V67 A;  3OTM A;  4HUR A;  4E79 A;  1FXJ A;  3TDT A;  3FTT A;  4KNX A;  1EWW A;  4IHH A;  1KNX A;  1QRM A;  3P47 A;  4KNR A;  4N6A A;  3R5D A;  1KHR A;  3WSI A;  2Q4J A;  4EGG A;  3HJJ A;  3DJ4 A;  4KQL A;  1E8C A;  1KRU A;  3L31 A;  3OTZ A;  2IU8 A;  1KGT A;  2W0W A;  3FSY A;  3NZ2 A;  5DG3 A;  1NMO A;  4M2A A;  3L2B A;  3F1X A;  4HUS A;  1MRL A;  4M98 A;  3D8V A;  1QRL A;  2WLF A;  3JQY A;  4J18 A;  4DCL A;  3GQ9 A;  3OU9 A;  2AM1 A;  2OEF A;  4M99 A;  5L6V A;  4EQY A;  4E75 A;  3KWE A;  3VNP A;  4EAA A;  1G97 A;  1XAT A;  2P2O A;  2V0K A;  3KWC A;  4KPX A;  1KK6 A;  3IGJ A;  4N69 A;  1MR9 A;  5E3Q A;  4CVK A;  4EA8 A;  1GG4 A;  4MZU A;  4AAW A;  3FSC A;  4M9C A;  2TDT A;  2WLD A;  3R5A A;  4IWG A;  3R3R A;  2RIJ A;  2VD4 A;  3I3X A;  1KK5 A;  3FWW A;  1KO7 A;  1G95 A;  3VBL A;  3BSS A;  3GOS A;  4R37 A;  3SPT A;  2WTZ A;  3R0S A;  1SSM A;  3V4E A;  2GGO A;  1QQ0 A;  3D98 A;  2IOJ A;  3EEQ A;  3ZL8 A;  2I5K A;  2GGQ A;  4C13 A;  1MR7 A;  3TIS A;  3C8V A;  4IHF A;  2WLE A;  4J09 A;  4M28 A;  2VHE A;  3R5C A;  4IHG A;  3OW5 A;  4FCE A;  5ADX U;  2OI7 A;  1KQA A;  2AQ9 A;  3VBK A;  3WSD A;  3WSE A;  3MQH A;  1KGQ A;  2OEG A;  4AA7 A;  3ZM6 A;  3EH0 A;  2JF3 A;  4M2B A;  1YP2 A;  4EA7 A;  3EG4 A;  2XJA A;  1KK4 A;  1T3D A;  1NMP A;  2AM2 A;  2FYW A;  3MC4 A;  5AFU V;  3Q1X A;  4G87 A;  1THJ A;  2IUA A;  1N4I A;  4MYO A;  3DHO A;  3DK5 A;  3GQ7 A;  3EEV A;  3R5B A;  4R7P A;  3VBN A;  4HZD A;  1YP4 A;  1QRF A;  2QIA A;  2XAT A;  4ISX A;  5ADX V;  3BFP A;  4G3Q A;  1L0S A;  4BUB A;  3SUC A; 
#chains in the Genus database with same CATH homology
 4MFG A;  2V0H A;  3TIO A;  3IXC A;  3VBI A;  3CJ8 A;  1J2Z A;  5AFU U;  3GUE A;  3SRT A;  2IU9 A;  3BRK X;  3FSX A;  1YP3 A;  3T57 A;  4E1K A;  3R8Y A;  3FSB A;  4G3P A;  2WLG A;  3FOQ A;  5F42 A;  1XHD A;  2V0L A;  4G3S A;  3MQG A;  5DEP A;  1KRV A;  1S80 A;  1SSQ A;  3BXY A;  3R2W A;  3KWD A;  1HV9 A;  1FWY A;  3ZM5 A;  1HM9 A;  2OI5 A;  4N27 A;  4AC3 A;  4CVL A;  1QRG A;  1OCX A;  5E3R A;  2OI6 A;  1HM0 A;  3VBM A;  1Z90 A;  2JF2 A;  4N6B A;  4R36 A;  5U2K A;  4C12 A;  2WLC A;  1LXA A;  3TV0 A;  4K6R A;  1QRE A;  1TDT A;  4QF5 A;  2QKX A;  2ICY A;  3R3I A;  2V0I A;  3P1B A;  3HSQ A;  4HCQ A;  2ICX A;  5L6S A;  5DEM A;  3FS8 A;  3R1W A;  4ZIY A;  5E3P A;  2W0V A;  3BSW A;  3PMO A;  2NPO A;  3TK8 A;  4EAB A;  3I3A A;  2FKO A;  1KRR A;  3ST8 A;  2V0J A;  1SST A;  4HZC A;  4H7O A;  4E6T A;  3BSY A;  4QDI A;  3VBJ A;  2QIV X;  3TWD A;  2IC7 A;  4EA9 A;  4CVM A;  4KPZ A;  1V3W A;  3ECT A;  4E6U A;  3OUP A;  3GVD A;  1HM8 A;  1V67 A;  3OTM A;  4HUR A;  4E79 A;  1FXJ A;  3TDT A;  3FTT A;  4KNX A;  4IHH A;  1QRM A;  3P47 A;  4KNR A;  4N6A A;  3R5D A;  1KHR A;  2Q4J A;  4EGG A;  3HJJ A;  3DJ4 A;  4KQL A;  1E8C A;  1KRU A;  3OTZ A;  2IU8 A;  1KGT A;  2W0W A;  3FSY A;  3NZ2 A;  5DG3 A;  4M2A A;  3F1X A;  4HUS A;  1MRL A;  4M98 A;  3D8V A;  1QRL A;  2WLF A;  3JQY A;  4J18 A;  4DCL A;  3OU9 A;  2AM1 A;  2OEF A;  4M99 A;  5L6V A;  4EQY A;  4E75 A;  3KWE A;  3VNP A;  4EAA A;  1G97 A;  1XAT A;  2P2O A;  2V0K A;  3KWC A;  4KPX A;  1KK6 A;  3IGJ A;  4N69 A;  1MR9 A;  5E3Q A;  4CVK A;  4EA8 A;  1GG4 A;  4MZU A;  4AAW A;  3FSC A;  4M9C A;  2TDT A;  2WLD A;  3R5A A;  3R3R A;  2RIJ A;  2VD4 A;  3I3X A;  1KK5 A;  3FWW A;  1G95 A;  3VBL A;  3BSS A;  3GOS A;  4R37 A;  3SPT A;  2WTZ A;  3R0S A;  1SSM A;  3V4E A;  2GGO A;  1QQ0 A;  3D98 A;  3ZL8 A;  2I5K A;  2GGQ A;  4C13 A;  1MR7 A;  3TIS A;  3C8V A;  4IHF A;  2WLE A;  4J09 A;  4M28 A;  2VHE A;  3R5C A;  4IHG A;  3OW5 A;  4FCE A;  5ADX U;  2OI7 A;  1KQA A;  2AQ9 A;  3VBK A;  3MQH A;  1KGQ A;  2OEG A;  4AA7 A;  3ZM6 A;  3EH0 A;  2JF3 A;  4M2B A;  1YP2 A;  4EA7 A;  3EG4 A;  2XJA A;  1KK4 A;  1T3D A;  2AM2 A;  3MC4 A;  5AFU V;  3Q1X A;  4G87 A;  1THJ A;  2IUA A;  4MYO A;  3VBP A;  3DHO A;  3DK5 A;  3R5B A;  3EEV A;  4R7P A;  3VBN A;  4HZD A;  1YP4 A;  1QRF A;  2QIA A;  2XAT A;  4ISX A;  5ADX V;  3BFP A;  4G3Q A;  4BUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...