3PMOA

The structure of lpxd from pseudomonas aeruginosa at 1.3 a resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
357
structure length
357
Chain Sequence
b'SSHHHHHHSSGLVPRGSHMSTLSYTLGQLAAHVGAEVRGDADLPIQGLATLQEAGPAQLSFLANPQYRKYLPESRAGAVLLTAADADGFAGTALVVANPYLAYASLSHLFDRKPKAAAGIHPTAIVAADAEVDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGEGFGFANEKGVWQKIAQIGGVTIGDDVEIGANTTIDRGALSDTLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITEPGSYSSGTAMQPAAEWKKSAARIRQLDDMARRLQQLEKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
publication title The structure of LpxD from Pseudomonas aeruginosa at 1.3 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 119
structure length 357
sequence length 357
ec nomenclature ec 2.3.1.-:
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3pmoA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 3pmoA01
5E3RA 3C8VA 3D98A 1MRLA 1FWYA 2V0JA 4FCEA 3R5CA 4J18A 3TDTA 4CVMA 1QRLA 2V0KA 3IGJA 3ZM5A 4CVKA 1YP2A 4KQLA 2AM1A 5AFUV 2WLDA 2RIJA 1S80A 3R5DA 3CJ8A 3OTZA 4M99A 1KK5A 1QRFA 3KWCA 3R0SA 4G3SA 3FTTA 5U2KA 1KRVA 4HCQA 4MFGA 1QQ0A 2AQ9A 3JQYA 3BSSA 2W0WA 3MQGA 2I5KA 3OW5A 1QREA 3TIOA 3VNPA 4N6BA 3ZL8A 4IHFA 4N69A 3BXYA 3VBKA 3VBLA 4IHGA 1YP4A 4K6RA 1XHDA 4HUSA 1FXJA 3DK5A 1TDTA 3ECTA 4E79A 2OEGA 1SSTA 3I3AA 3FWWA 3KWDA 4G87A 1SSMA 2VD4A 1HM0A 4M2AA 2ICYA 4DCLA 4CVLA 3R3IA 2GGQA 2Q4JA 3FS8A 2QKXA 1XATA 1KK6A 3VBIA 3TV0A 4C13A 1HM8A 2IU9A 1KQAA 4R7PA 2P2OA 2WLCA 1LXAA 2FKOA 3FSBA 3R3RA 1MR7A 1QRGA 4H7OA 1J2ZA 1T3DA 4R37A 5AFUU 4EA7A 3HJJA 3DJ4A 2W0VA 1GG4A 5DG3A 5ADXV 3DHOA 4QDIA 5L6VA 3FSXA 2QIVX 1OCXA 2VHEA 4AA7A 4J09A 4EA8A 5DEMA 3PMOA 4AAWA 4KNXA 2NPOA 1KRRA 3F1XA 4HZCA 3NZ2A 3D8VA 4N6AA 1Z90A 2ICXA 3P47A 2OI6A 3BFPA 4HZDA 5DEPA 2TDTA 2XATA 4MYOA 4ISXA 1KK4A 4AC3A 1HM9A 2JF2A 3IXCA 4BUBA 4KPZA 3R5BA 3EG4A 4G3PA 4E75A 2JF3A 3ST8A 4E6UA 3TISA 4EGGA 5L6SA 3KWEA 4C12A 3HSQA 1KGTA 5F42A 1KHRA 3P1BA 2IU8A 2V0IA 4EABA 4KPXA 4EQYA 1KGQA 3OUPA 2V0HA 2OI5A 3OTMA 5E3QA 4M98A 5ADXU 2IUAA 3R2WA 2WLGA 4EA9A 3MC4A 2WLFA 3BSYA 3R5AA 1THJA 1HV9A 4M28A 2V0LA 3VBMA 1E8CA 3SRTA 3TWDA 1G95A 3OU9A 3GUEA 3FSCA 2OEFA 3R1WA 2IC7A 2QIAA 3VBPA 3FSYA 3EH0A 4KNRA 4E1KA 3EEVA 4HURA 3T57A 3MQHA 2WTZA 1QRMA 3BSWA 1G97A 3I3XA 3ZM6A 3BRKX 5E3PA 4M9CA 4G3QA 2GGOA 4E6TA 4EAAA 4IHHA 4MZUA 3R8YA 4R36A 3FOQA 3Q1XA 3TK8A 2WLEA 3GVDA 4QF5A 1YP3A 1V67A 4ZIYA 1SSQA 2OI7A 3VBJA 2AM2A 2XJAA 3GOSA 3SPTA 1V3WA 1KRUA 4N27A 1MR9A 4M2BA 3V4EA 3VBNA
chains in the Genus database with same CATH superfamily
5E3RA 3C8VA 3D98A 1MRLA 1FWYA 2V0JA 4FCEA 1Z2FA 3R5CA 4J18A 3OH3A 1QRLA 2V0KA 3IGJA 3ZM5A 4CVKA 1YP2A 4KQLA 2AM1A 5AFUV 2WLDA 2RIJA 1S80A 3R5DA 3CJ8A 3OTZA 4M99A 1KK5A 1QRFA 3KWCA 3R0SA 4G3SA 3FTTA 5U2KA 1KRVA 4HCQA 4MFGA 1QQ0A 1NMPA 2AQ9A 3JQYA 3BSSA 2W0WA 3MQGA 2I5KA 3OW5A 1QREA 3OH1A 3TIOA 4N6BA 3VNPA 3ZL8A 4IHFA 4N69A 3BXYA 3VBKA 3VBLA 4IHGA 1YP4A 4K6RA 1XHDA 4HUSA 1FXJA 3DK5A 1TDTA 3ECTA 4E79A 1KNXA 2IOJA 2OEGA 1SSTA 3I3AA 3FWWA 3KWDA 4G87A 1SSMA 2VD4A 1HM0A 4M2AA 2ICYA 4DCLA 3L2BA 4CVLA 3R3IA 2GGQA 2Q4JA 3FS8A 2QKXA 1XATA 1KK6A 3OGZA 3VBIA 3TV0A 4C13A 1HM8A 3OH4A 2IU9A 1M8NA 1KQAA 4R7PA 2P2OA 3OH0A 2WLCA 1LXAA 4CVMA 2FKOA 3FSBA 1NMOA 3R3RA 1MR7A 1QRGA 4H7OA 1J2ZA 1T3DA 4R37A 5AFUU 4EA7A 3HJJA 3DJ4A 2W0VA 1GG4A 5DG3A 5ADXV 3DHOA 4QDIA 5L6VA 3WSIA 3FSXA 2QIVX 1OCXA 2VHEA 4AA7A 2FYWA 4J09A 4EA8A 5DEMA 3PMOA 4AAWA 4KNXA 3SUCA 2NPOA 1KRRA 3F1XA 4HZCA 3NZ2A 3D8VA 4N6AA 3WSHA 1Z90A 2ICXA 3P47A 2OI6A 3BFPA 4HZDA 5DEPA 2TDTA 2XATA 4MYOA 4ISXA 1KK4A 4AC3A 1HM9A 2JF2A 3GQ8A 3IXCA 4BUBA 4KPZA 3R5BA 3EG4A 3WSFA 4G3PA 4E75A 2JF3A 1L0SA 1KO7A 3ST8A 3L31A 4E6UA 3WSDA 3TISA 4EGGA 1N4IA 5L6SA 3KWEA 4C12A 3HSQA 1KGTA 5F42A 1KHRA 4IWGA 3P1BA 2IU8A 2V0IA 4EABA 4KPXA 4EQYA 1KGQA 3OUPA 2V0HA 2OI5A 3OTMA 5E3QA 4M98A 5ADXU 2IUAA 3R2WA 2WLGA 4EA9A 3MC4A 2WLFA 3BSYA 3R5AA 1THJA 1HV9A 4M28A 2V0LA 3TDTA 3VBMA 1E8CA 3SRTA 3TWDA 1G95A 3OU9A 3GUEA 3FSCA 2OEFA 3R1WA 2IC7A 2QIAA 3VBPA 2YYBA 3FSYA 3EH0A 4KNRA 4E1KA 3EEVA 4HURA 3T57A 3MQHA 2WTZA 3WSGA 1QRMA 3BSWA 1EWWA 1G97A 3I3XA 3ZM6A 3BRKX 5E3PA 4M9CA 4G3QA 2GGOA 4E6TA 4IWMA 4EAAA 4IHHA 4MZUA 3R8YA 4R36A 3EEQA 3FOQA 3GQ9A 3Q1XA 2WLEA 3GVDA 3TK8A 4QF5A 1YP3A 1V67A 4ZIYA 3WSEA 3GQ7A 1SSQA 2OI7A 3GQAA 3VBJA 2AM2A 3OH2A 2XJAA 3GOSA 3SPTA 1V3WA 1KRUA 4N27A 1MR9A 4M2BA 3V4EA 3VBNA
chains in the Genus database with same CATH topology
5E3RA 3C8VA 3D98A 1MRLA 1FWYA 2V0JA 4FCEA 3R5CA 4J18A 3TDTA 4CVMA 1QRLA 2V0KA 3IGJA 3ZM5A 4CVKA 1YP2A 4KQLA 2AM1A 5AFUV 2WLDA 2RIJA 1S80A 3R5DA 3CJ8A 3OTZA 4M99A 1KK5A 1QRFA 3KWCA 3R0SA 4G3SA 3FTTA 5U2KA 1KRVA 4HCQA 4MFGA 1QQ0A 2AQ9A 3JQYA 3BSSA 2W0WA 3MQGA 2I5KA 3OW5A 1QREA 3TIOA 3VNPA 4N6BA 3ZL8A 4IHFA 4N69A 3BXYA 3VBKA 3VBLA 4IHGA 1YP4A 4K6RA 1XHDA 4HUSA 1FXJA 3DK5A 1TDTA 3ECTA 4E79A 2OEGA 1SSTA 3I3AA 3FWWA 3KWDA 4G87A 1SSMA 2VD4A 1HM0A 4M2AA 2ICYA 4DCLA 4CVLA 3R3IA 2GGQA 2Q4JA 3FS8A 2QKXA 1XATA 1KK6A 3VBIA 3TV0A 4C13A 1HM8A 2IU9A 1KQAA 4R7PA 2P2OA 2WLCA 1LXAA 2FKOA 3FSBA 3R3RA 1MR7A 1QRGA 4H7OA 1J2ZA 1T3DA 4R37A 5AFUU 4EA7A 3HJJA 3DJ4A 2W0VA 1GG4A 5DG3A 5ADXV 3DHOA 4QDIA 5L6VA 3FSXA 2QIVX 1OCXA 2VHEA 4AA7A 4J09A 4EA8A 5DEMA 3PMOA 4AAWA 4KNXA 2NPOA 1KRRA 3F1XA 4HZCA 3NZ2A 3D8VA 4N6AA 1Z90A 2ICXA 3P47A 2OI6A 3BFPA 4HZDA 5DEPA 2TDTA 2XATA 4MYOA 4ISXA 1KK4A 4AC3A 1HM9A 2JF2A 3IXCA 4BUBA 4KPZA 3R5BA 3EG4A 4G3PA 4E75A 2JF3A 3ST8A 4E6UA 3TISA 4EGGA 5L6SA 3KWEA 4C12A 3HSQA 1KGTA 5F42A 1KHRA 3P1BA 2IU8A 2V0IA 4EABA 4KPXA 4EQYA 1KGQA 3OUPA 2V0HA 2OI5A 3OTMA 5E3QA 4M98A 5ADXU 2IUAA 3R2WA 2WLGA 4EA9A 3MC4A 2WLFA 3BSYA 3R5AA 1THJA 1HV9A 4M28A 2V0LA 3VBMA 1E8CA 3SRTA 3TWDA 1G95A 3OU9A 3GUEA 3FSCA 2OEFA 3R1WA 2IC7A 2QIAA 3VBPA 3FSYA 3EH0A 4KNRA 4E1KA 3EEVA 4HURA 3T57A 3MQHA 2WTZA 1QRMA 3BSWA 1G97A 3I3XA 3ZM6A 3BRKX 5E3PA 4M9CA 4G3QA 2GGOA 4E6TA 4EAAA 4IHHA 4MZUA 3R8YA 4R36A 3FOQA 3Q1XA 3TK8A 2WLEA 3GVDA 4QF5A 1YP3A 1V67A 4ZIYA 1SSQA 2OI7A 3VBJA 2AM2A 2XJAA 3GOSA 3SPTA 1V3WA 1KRUA 4N27A 1MR9A 4M2BA 3V4EA 3VBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3R A;  3C8V A;  3D98 A;  1MRL A;  1FWY A;  2V0J A;  4FCE A;  3R5C A;  4J18 A;  3TDT A;  4CVM A;  1QRL A;  2V0K A;  3IGJ A;  3ZM5 A;  4CVK A;  1YP2 A;  4KQL A;  2AM1 A;  5AFU V;  2WLD A;  2RIJ A;  1S80 A;  3R5D A;  3CJ8 A;  3OTZ A;  4M99 A;  1KK5 A;  1QRF A;  3KWC A;  3R0S A;  4G3S A;  3FTT A;  5U2K A;  1KRV A;  4HCQ A;  4MFG A;  1QQ0 A;  2AQ9 A;  3JQY A;  3BSS A;  2W0W A;  3MQG A;  2I5K A;  3OW5 A;  1QRE A;  3TIO A;  3VNP A;  4N6B A;  3ZL8 A;  4IHF A;  4N69 A;  3BXY A;  3VBK A;  3VBL A;  4IHG A;  1YP4 A;  4K6R A;  1XHD A;  4HUS A;  1FXJ A;  3DK5 A;  1TDT A;  3ECT A;  4E79 A;  2OEG A;  1SST A;  3I3A A;  3FWW A;  3KWD A;  4G87 A;  1SSM A;  2VD4 A;  1HM0 A;  4M2A A;  2ICY A;  4DCL A;  4CVL A;  3R3I A;  2GGQ A;  2Q4J A;  3FS8 A;  2QKX A;  1XAT A;  1KK6 A;  3VBI A;  3TV0 A;  4C13 A;  1HM8 A;  2IU9 A;  1KQA A;  4R7P A;  2P2O A;  2WLC A;  1LXA A;  2FKO A;  3FSB A;  3R3R A;  1MR7 A;  1QRG A;  4H7O A;  1J2Z A;  1T3D A;  4R37 A;  5AFU U;  4EA7 A;  3HJJ A;  3DJ4 A;  2W0V A;  1GG4 A;  5DG3 A;  5ADX V;  3DHO A;  4QDI A;  5L6V A;  3FSX A;  2QIV X;  1OCX A;  2VHE A;  4AA7 A;  4J09 A;  4EA8 A;  5DEM A;  3PMO A;  4AAW A;  4KNX A;  2NPO A;  1KRR A;  3F1X A;  4HZC A;  3NZ2 A;  3D8V A;  4N6A A;  1Z90 A;  2ICX A;  3P47 A;  2OI6 A;  3BFP A;  4HZD A;  5DEP A;  2TDT A;  2XAT A;  4MYO A;  4ISX A;  1KK4 A;  4AC3 A;  1HM9 A;  2JF2 A;  3IXC A;  4BUB A;  4KPZ A;  3R5B A;  3EG4 A;  4G3P A;  4E75 A;  2JF3 A;  3ST8 A;  4E6U A;  3TIS A;  4EGG A;  5L6S A;  3KWE A;  4C12 A;  3HSQ A;  1KGT A;  5F42 A;  1KHR A;  3P1B A;  2IU8 A;  2V0I A;  4EAB A;  4KPX A;  4EQY A;  1KGQ A;  3OUP A;  2V0H A;  2OI5 A;  3OTM A;  5E3Q A;  4M98 A;  5ADX U;  2IUA A;  3R2W A;  2WLG A;  4EA9 A;  3MC4 A;  2WLF A;  3BSY A;  3R5A A;  1THJ A;  1HV9 A;  4M28 A;  2V0L A;  3VBM A;  1E8C A;  3SRT A;  3TWD A;  1G95 A;  3OU9 A;  3GUE A;  3FSC A;  2OEF A;  3R1W A;  2IC7 A;  2QIA A;  3VBP A;  3FSY A;  3EH0 A;  4KNR A;  4E1K A;  3EEV A;  4HUR A;  3T57 A;  3MQH A;  2WTZ A;  1QRM A;  3BSW A;  1G97 A;  3I3X A;  3ZM6 A;  3BRK X;  5E3P A;  4M9C A;  4G3Q A;  2GGO A;  4E6T A;  4EAA A;  4IHH A;  4MZU A;  3R8Y A;  4R36 A;  3FOQ A;  3Q1X A;  3TK8 A;  2WLE A;  3GVD A;  4QF5 A;  1YP3 A;  1V67 A;  4ZIY A;  1SSQ A;  2OI7 A;  3VBJ A;  2AM2 A;  2XJA A;  3GOS A;  3SPT A;  1V3W A;  1KRU A;  4N27 A;  1MR9 A;  4M2B A;  3V4E A;  3VBN A; 
#chains in the Genus database with same CATH topology
 5E3R A;  3C8V A;  3D98 A;  1MRL A;  1FWY A;  2V0J A;  4FCE A;  1Z2F A;  3R5C A;  4J18 A;  3OH3 A;  1QRL A;  2V0K A;  3IGJ A;  3ZM5 A;  4CVK A;  1YP2 A;  4KQL A;  2AM1 A;  5AFU V;  2WLD A;  2RIJ A;  1S80 A;  3R5D A;  3CJ8 A;  3OTZ A;  4M99 A;  1KK5 A;  1QRF A;  3KWC A;  3R0S A;  4G3S A;  3FTT A;  5U2K A;  1KRV A;  4HCQ A;  4MFG A;  1QQ0 A;  1NMP A;  2AQ9 A;  3JQY A;  3BSS A;  2W0W A;  3MQG A;  2I5K A;  3OW5 A;  1QRE A;  3OH1 A;  3TIO A;  4N6B A;  3VNP A;  3ZL8 A;  4IHF A;  4N69 A;  3BXY A;  3VBK A;  3VBL A;  4IHG A;  1YP4 A;  4K6R A;  1XHD A;  4HUS A;  1FXJ A;  3DK5 A;  1TDT A;  3ECT A;  4E79 A;  1KNX A;  2IOJ A;  2OEG A;  1SST A;  3I3A A;  3FWW A;  3KWD A;  4G87 A;  1SSM A;  2VD4 A;  1HM0 A;  4M2A A;  2ICY A;  4DCL A;  3L2B A;  4CVL A;  3R3I A;  2GGQ A;  2Q4J A;  3FS8 A;  2QKX A;  1XAT A;  1KK6 A;  3OGZ A;  3VBI A;  3TV0 A;  4C13 A;  1HM8 A;  3OH4 A;  2IU9 A;  1M8N A;  1KQA A;  4R7P A;  2P2O A;  3OH0 A;  2WLC A;  1LXA A;  4CVM A;  2FKO A;  3FSB A;  1NMO A;  3R3R A;  1MR7 A;  1QRG A;  4H7O A;  1J2Z A;  1T3D A;  4R37 A;  5AFU U;  4EA7 A;  3HJJ A;  3DJ4 A;  2W0V A;  1GG4 A;  5DG3 A;  5ADX V;  3DHO A;  4QDI A;  5L6V A;  3WSI A;  3FSX A;  2QIV X;  1OCX A;  2VHE A;  4AA7 A;  2FYW A;  4J09 A;  4EA8 A;  5DEM A;  3PMO A;  4AAW A;  4KNX A;  3SUC A;  2NPO A;  1KRR A;  3F1X A;  4HZC A;  3NZ2 A;  3D8V A;  4N6A A;  3WSH A;  1Z90 A;  2ICX A;  3P47 A;  2OI6 A;  3BFP A;  4HZD A;  5DEP A;  2TDT A;  2XAT A;  4MYO A;  4ISX A;  1KK4 A;  4AC3 A;  1HM9 A;  2JF2 A;  3GQ8 A;  3IXC A;  4BUB A;  4KPZ A;  3R5B A;  3EG4 A;  3WSF A;  4G3P A;  4E75 A;  2JF3 A;  1L0S A;  1KO7 A;  3ST8 A;  3L31 A;  4E6U A;  3WSD A;  3TIS A;  4EGG A;  1N4I A;  5L6S A;  3KWE A;  4C12 A;  3HSQ A;  1KGT A;  5F42 A;  1KHR A;  4IWG A;  3P1B A;  2IU8 A;  2V0I A;  4EAB A;  4KPX A;  4EQY A;  1KGQ A;  3OUP A;  2V0H A;  2OI5 A;  3OTM A;  5E3Q A;  4M98 A;  5ADX U;  2IUA A;  3R2W A;  2WLG A;  4EA9 A;  3MC4 A;  2WLF A;  3BSY A;  3R5A A;  1THJ A;  1HV9 A;  4M28 A;  2V0L A;  3TDT A;  3VBM A;  1E8C A;  3SRT A;  3TWD A;  1G95 A;  3OU9 A;  3GUE A;  3FSC A;  2OEF A;  3R1W A;  2IC7 A;  2QIA A;  3VBP A;  2YYB A;  3FSY A;  3EH0 A;  4KNR A;  4E1K A;  3EEV A;  4HUR A;  3T57 A;  3MQH A;  2WTZ A;  3WSG A;  1QRM A;  3BSW A;  1EWW A;  1G97 A;  3I3X A;  3ZM6 A;  3BRK X;  5E3P A;  4M9C A;  4G3Q A;  2GGO A;  4E6T A;  4IWM A;  4EAA A;  4IHH A;  4MZU A;  3R8Y A;  4R36 A;  3EEQ A;  3FOQ A;  3GQ9 A;  3Q1X A;  2WLE A;  3GVD A;  3TK8 A;  4QF5 A;  1YP3 A;  1V67 A;  4ZIY A;  3WSE A;  3GQ7 A;  1SSQ A;  2OI7 A;  3GQA A;  3VBJ A;  2AM2 A;  3OH2 A;  2XJA A;  3GOS A;  3SPT A;  1V3W A;  1KRU A;  4N27 A;  1MR9 A;  4M2B A;  3V4E A;  3VBN A; 
#chains in the Genus database with same CATH homology
 5E3R A;  3C8V A;  3D98 A;  1MRL A;  1FWY A;  2V0J A;  4FCE A;  3R5C A;  4J18 A;  3TDT A;  4CVM A;  1QRL A;  2V0K A;  3IGJ A;  3ZM5 A;  4CVK A;  1YP2 A;  4KQL A;  2AM1 A;  5AFU V;  2WLD A;  2RIJ A;  1S80 A;  3R5D A;  3CJ8 A;  3OTZ A;  4M99 A;  1KK5 A;  1QRF A;  3KWC A;  3R0S A;  4G3S A;  3FTT A;  5U2K A;  1KRV A;  4HCQ A;  4MFG A;  1QQ0 A;  2AQ9 A;  3JQY A;  3BSS A;  2W0W A;  3MQG A;  2I5K A;  3OW5 A;  1QRE A;  3TIO A;  3VNP A;  4N6B A;  3ZL8 A;  4IHF A;  4N69 A;  3BXY A;  3VBK A;  3VBL A;  4IHG A;  1YP4 A;  4K6R A;  1XHD A;  4HUS A;  1FXJ A;  3DK5 A;  1TDT A;  3ECT A;  4E79 A;  2OEG A;  1SST A;  3I3A A;  3FWW A;  3KWD A;  4G87 A;  1SSM A;  2VD4 A;  1HM0 A;  4M2A A;  2ICY A;  4DCL A;  4CVL A;  3R3I A;  2GGQ A;  2Q4J A;  3FS8 A;  2QKX A;  1XAT A;  1KK6 A;  3VBI A;  3TV0 A;  4C13 A;  1HM8 A;  2IU9 A;  1KQA A;  4R7P A;  2P2O A;  2WLC A;  1LXA A;  2FKO A;  3FSB A;  3R3R A;  1MR7 A;  1QRG A;  4H7O A;  1J2Z A;  1T3D A;  4R37 A;  5AFU U;  4EA7 A;  3HJJ A;  3DJ4 A;  2W0V A;  1GG4 A;  5DG3 A;  5ADX V;  3DHO A;  4QDI A;  5L6V A;  3FSX A;  2QIV X;  1OCX A;  2VHE A;  4AA7 A;  4J09 A;  4EA8 A;  5DEM A;  3PMO A;  4AAW A;  4KNX A;  2NPO A;  1KRR A;  3F1X A;  4HZC A;  3NZ2 A;  3D8V A;  4N6A A;  1Z90 A;  2ICX A;  3P47 A;  2OI6 A;  3BFP A;  4HZD A;  5DEP A;  2TDT A;  2XAT A;  4MYO A;  4ISX A;  1KK4 A;  4AC3 A;  1HM9 A;  2JF2 A;  3IXC A;  4BUB A;  4KPZ A;  3R5B A;  3EG4 A;  4G3P A;  4E75 A;  2JF3 A;  3ST8 A;  4E6U A;  3TIS A;  4EGG A;  5L6S A;  3KWE A;  4C12 A;  3HSQ A;  1KGT A;  5F42 A;  1KHR A;  3P1B A;  2IU8 A;  2V0I A;  4EAB A;  4KPX A;  4EQY A;  1KGQ A;  3OUP A;  2V0H A;  2OI5 A;  3OTM A;  5E3Q A;  4M98 A;  5ADX U;  2IUA A;  3R2W A;  2WLG A;  4EA9 A;  3MC4 A;  2WLF A;  3BSY A;  3R5A A;  1THJ A;  1HV9 A;  4M28 A;  2V0L A;  3VBM A;  1E8C A;  3SRT A;  3TWD A;  1G95 A;  3OU9 A;  3GUE A;  3FSC A;  2OEF A;  3R1W A;  2IC7 A;  2QIA A;  3VBP A;  3FSY A;  3EH0 A;  4KNR A;  4E1K A;  3EEV A;  4HUR A;  3T57 A;  3MQH A;  2WTZ A;  1QRM A;  3BSW A;  1G97 A;  3I3X A;  3ZM6 A;  3BRK X;  5E3P A;  4M9C A;  4G3Q A;  2GGO A;  4E6T A;  4EAA A;  4IHH A;  4MZU A;  3R8Y A;  4R36 A;  3FOQ A;  3Q1X A;  3TK8 A;  2WLE A;  3GVD A;  4QF5 A;  1YP3 A;  1V67 A;  4ZIY A;  1SSQ A;  2OI7 A;  3VBJ A;  2AM2 A;  2XJA A;  3GOS A;  3SPT A;  1V3W A;  1KRU A;  4N27 A;  1MR9 A;  4M2B A;  3V4E A;  3VBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...