3PN1A

Novel bacterial nad+-dependent dna ligase inhibitors with broad spectrum potency and antibacterial efficacy in vivo
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Novel Bacterial NAD+-Dependent DNA Ligase Inhibitors with Broad-Spectrum Activity and Antibacterial Efficacy In Vivo.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase/ligase inhibitor
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3pn1A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3pn1A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3pn1A02
2Q2TA 4YY3B 4YHHB 4GLXA 4DUYB 1FJGB 2HVRA 4DV4B 3GDEA 3TY8A 1XNQB 5D1OB 4DRFA 1VS0A 4DR5B 2HIVA 4B3SB 4NXMB 4DV7B 5BR8B 4X66B 3JSLA 4NXNB 5D1PA 4CC5A 4PZ7A 5LMUB 4B3RB 2F4VB 2UXCB 3UQ8A 1IBLB 3PN1A 4UCVA 3RTXA 4JI3B 1S68A 4DR3B 3BA8A 4EEQA 3QWUA 3L2PA 4DR1B 1CKMA 3S24A 3BABA 4GKKB 4LFCB 1DGSA 2VQEB 4X64B 4LF4B 4DR6B 1HNWB 4LFBB 3T1HB 4DR2B 1XMQB 2UXBB 1XDNA 4UCRA 1N33B 2HIXA 4UCOA 4DV3B 4UCSA 4DUZB 1B04A 4EFBA 1HNXB 4JI0B 3SGIA 1V9PA 3OTOB 3NBYB 5DISC 4LFAB 2VUGA 4PZ8A 3GJXB 4DR7B 4LF8B 1XMOB 4LF5B 4JI8B 2HHHB 2UUAB 5FPRA 4DV1B 1HNZB 3W1BA 4DV2B 4JI5B 2CFMA 3BA9A 4JI4B 4DR4B 1N34B 4K0KB 4X62B 2HVQA 2UUCB 1CKNA 3RR5A 4LF6B 2HVSA 4LH7A 2UU9B 1ZAUA 4JI7B 3TY5A 4GKJB 3BAAA 1N36B 3VNNA 2UXDB 4DV5B 1XK5A 4DV6B 4JI1B 1CKOA 1IBMB 2OWOA 1N32B 4JV5B 3GB8B 4DV0B 4KHPB 1J5EB 1X9NA 5LMNB 5FPOA 1FVIA 1I94B 4E6NA 4EFEA 1TAEA 1HR0B 1P8LA 4LF9B 1TA8A 4LH6A 4B3MB 4UFZA 1A0IA 4OX9B 4PZ6A 3NC0B 1IBKB 3T1YB 3W1GA 3W5OA 2E5LB 1CKNB 4B3TB 4LF7B 3JSNA 2VQFB 1XNRB 2Q2UA 4AQYB 5IWAB 2UUBB 1P16A 3TY9A 4TOIA 2ZM6B 4JYAB 4JI6B 4JI2B 4UCUA 5D1OA 4EQ5A 4CC6A 3NBZB 4X65B 3KYHC 4UCTA
chains in the Genus database with same CATH superfamily
3SYCA 3GDEA 5I5YA 4K0KH 3K0GA 2F93B 3OSNA 2IBZH 1FXVA 4DK0A 4BIZA 5BYAA 4QJFA 3L4JA 1CQIB 3RB0A 5FNVF 2JA8G 3T9BA 4QPKA 5LMUB 2GPSA 3FB7C 4ABMA 4H37A 3UCSC 1EN5A 1NH2B 2PYJA 4W4KA 2YS6A 3K3WA 5JVDA 2EJ2A 1HP8A 4IWXA 1Y67A 3AG4C 3HKCA 1K73W 1RYSA 3B8NA 3TCUA 4EEQA 2V4QA 2RGRA 3WG7C 1J5EH 4GX1A 3BABA 4D7TA 4GX2A 3GWOA 2Z0AA 4GZRB 5KAIZ 1TWCA 1NQTA 3W7WA 3KAJA 3CD6V 4UCOA 4F50A 4TQFA 4B3MH 3SNOA 3R5XA 1E4GT 3G4SV 1EZ1A 1BGWA 4I55F 1UC9A 2ABJA 2P7TC 2HHHB 4IR1A 2FJZA 4F6EA 3CC4V 1NR1A 2H8PC 3RT3C 1MG1A 3U11A 2RDJA 1N34B 5FNVA 3ZRXA 2DWEC 2UUCB 5KFMA 2F66C 5HV6A 3ETGA 5FD6A 2ZD9A 5C5JA 3S3XA 2FB9A 1KECA 3CYOA 4MAMA 3TXSA 4DW0A 1JPXA 3N43B 4E4EA 2HEPA 1CKOA 2HHFB 4R6ZA 3RB4A 4WCEV 4IRCA 2Z3YA 2EJ0A 2YU9A 3AG4B 2X0LA 1O9HA 3FB6C 1OCZB 2VWJA 1AB3A 1N48A 3MR2A 2P22C 2UXCH 1FPOA 5JQWA 2HJFC 1ULZA 2IU3A 5CB4B 5KKNB 3FDSA 4FFBA 1IXMA 1B06A 3QO8A 4I55A 2C2DA 3N6XA 3WWIA 4QGPA 3AG3C 5KFDA 1FXHA 2ZE6A 4RQFA 4DR6O 1HNWH 2I80A 2DABA 3TINA 1ZL8A 3TIIA 5J9PC 4HNUA 1SA0A 1PKXA 1Y74B 2IMWP 3UZBA 3K5OA 5C4XG 3M8AA 4YB8B 2D3OW 2WLLB 4JI6B 5BWRA 2N05A 3TETA 1JFFB 4MVMA 4DV1O 5L9XA 3G8CA 3TGUH 3E83A 1ENVA 1CS0A 2IH3C 3HKBA 3TY8A 5KFEA 3KZIZ 4JYBA 5IYZF 1BJTA 5JJEB 2P4KA 4DR1O 5I5VA 4HYOA 4X66B 2R9RB 1YEWA 4QIWF 4A2BA 1WA8B 4RWUA 3ZBHA 1Q82W 1Z2NX 4TV8F 1KU9A 2V7QG 1QLEC 1K8AW 1IVSA 3OUZA 5L1JA 4FS2A 2E2HA 4U3JA 3UO3A 5EC2C 4PA3A 2AXTZ 4H33A 1I7FA 4HNVA 2AZ0A 3H4BA 2LFRA 4O3NA 2R7ZG 2ZIOA 1PP9H 2RDCA 3W7UA 3HOZG 4LF5O 1TWFA 4O3PA 5KFCA 1CEZA 1U96A 5IYCG 4NZMA 3SJAC 2FK1A 4JI5O 4CKCA 3AG3B 5AG2A 5JVLA 1RJPA 5DECA 3GIDA 4DR2B 1FS0G 4MVRA 1CQJB 4O7LA 4ED7A 3OD4A 1Y66A 4J9ZB 1PL0A 1E4EB 1MZBA 1XUQA 2QDOA 4J9SA 3ZMVA 5EIBD 2O03A 3K04A 1ZHQA 2LP7A 1XMOB 3LSQA 4JI8B 3KALA 3CXCU 3JARB 5IYZA 3M4IA 2FLLA 5DQGA 1S5JA 4DV2B 2WB1A 1RP3B 5KX5F 3KKYA 1NH2D 4DR4B 3LUTB 2HVQA 2DN9A 4BWAA 2W0XA 4QIWA 3F8NA 4O83A 4TV8A 1H2MA 2W6OA 2KSDA 2V59A 1S3JA 5EDWA 3L71H 2LQTA 2COIA 2GQSA 2OIGA 2QE7G 4CMFA 1I2LA 1DTOA 1L8DA 2W6MA 2E74B 2W9BB 1FKAO 5CA1B 4DV5B 2EZPA 4CHIA 2IH1C 1R6NA 1F7YA 4EGQA 5LGNA 5KFLA 4FS1A 4O4IF 2XASA 2W57A 3G6EV 5DAAA 3Q8PB 1EHIA 5KFFA 3H0GA 2F4VO 1W96A 3DC5A 1I94B 2AU0A 3N2GA 1G6UA 5KHJA 4H0LB 3CCRV 2P06A 2GUZA 1OCCC 1L2ZA 4BWSC 3ZMZA 5IJ9B 4PZ6A 3VPCA 4UV8A 2J6TA 1E79G 3HKDB 4KL1A 3OHBA 1NVPD 4O3OA 3B4SA 2UXBO 1K5QA 5KX5A 1EKFA 2GSMB 4QWDA 3RYHA 4HNAB 5DG7A 4DV7O 1RK5A 2QM8A 5LGTA 1B6RA 1VMGA 4UCUA 3H01A 1VKZA 3A8TA 2CGNA 5LA6B 3OR7C 2XGPA 3KYHC 4O4HF 1FJGB 1QR9A 3CCMV 2OYQA 4O4IA 1VS0A 3RYIB 1QVFU 3QQMA 1IOVA 3T5KA 2YEVA 2VQEO 4ZBMA 1N0NA 3J80N 3UKMA 4X64H 4WFHA 3UYYA 5EBLC 2YSUB 4MSWC 1WRVA 3GTQA 4MVZA 1WH2A 2YZLA 1VQ9V 2QM7A 3RW0A 3SPCA 3PN1A 2X6AA 4FFKA 2Y4TA 1KQSU 1OCCB 5CBHA 4BBRG 5D8DA 3CCJV 1AUVA 2O57A 1HR0H 4IIJB 4LF9O 1Z2GA 4I50F 3SGIA 1V9PA 3Q8QB 4O4HA 3RJ0A 4A3IG 1BGYH 2E5LH 1NTMH 1NBMG 3AYHB 4PELA 2DWDC 2OH2A 5I5WA 2BSKB 2R8IA 5D5PA 3PO2G 4FM2A 2AHZA 4R8UA 1NR7A 3HBLA 2DJVA 1Q6HA 1WB8A 1I1MA 2FLNA 1BT8A 3JASB 5KT4A 5B3SC 3KHLA 5ITZB 3HKCB 2W9AA 3RVZA 2UXDB 3JALB 4PDRA 1GO3F 3SYAA 2RQ6A 2DZDA 1KJ9A 2VQDA 2ODMA 3DXRA 3L70H 3TW6A 4YJ3B 4ED2A 1Y14B 4NKGB 2AGAA 1VQMV 5LMUO 4JAVA 4B3TO 4JV5B 4DV0B 4KHPB 3OSPA 2YDEA 5LMNB 4XX0B 1AN7A 5B1BC 4I50A 2W6NA 4O81A 3VMMA 1SQQH 3LP8A 4FM1A 4LH6A 2RMKB 4DR1H 2XD4A 1VAJA 3MR3A 3CX5F 1W0JG 2LW1A 3DTUB 3CHXA 5FNVB 3JD3A 3GILA 4NTXA 5KG5A 3ABLC 5CAEB 5IJ0B 2CH7A 4JYCA 2YCHA 4YAKB 5EZYB 4LFAH 4JYAB 2YICA 3CEIA 2Y69C 5DGBA 3J7AU 1GK9A 5L3DA 4X65B 2K1EA 2XT9A 4DUYB 4JI5H 2KQXA 3E35A 3DC6A 1JA8A 4X62H 4MV8A 4J7JA 2UUCO 1NZ6A 3V4SA 4DR5B 2ADQB 4GKKO 2QK4A 3K3VA 3GVMA 4YBZB 4PZ7A 4GKJH 2FPPB 4EBEA 4WFGA 4XDJA 5J2UB 2EIKC 3T4DA 4MVQA 1SQXH 3FYIB 3UQ8A 4XDLA 2HVJC 2CW7A 4AYBE 4DR3B 4RB0A 1K4DC 5CB4F 2RDIA 2N04A 3OFNG 4Q6GA 1CP9A 2JGUA 2ATKC 4X64B 5CE8A 1KYOF 1KUQA 2LGWA 5KHGA 4DUZB 4O3RA 4OX9H 1SQPH 4O7NA 5DISC 1Y1VG 1K1SA 1I5XA 2R7NA 2C22A 3ZX6A 3LDDA 5L3FA 4FIPC 3ZRSA 4O82A 2Y69B 4X89A 2WAQE 2VOBA 4FBUA 2E75B 2GLTA 5IWAH 1F51A 4MA5A 3ETQA 5KS8A 1N32H 4JI6O 3T7AA 3J80W 4PBCA 1Q5OA 4PDBA 1KMIZ 3ZHRA 5I47A 1SFOA 2JA6G 2HHFA 4DL7A 2VA2A 1JQ0A 5FLMG 3AEIA 2AGOA 2ZQMA 1Q8IA 1JKJB 1VF6C 2HKOA 2PY5A 4Q4CA 2PBZA 3T9CA 4ZI7B 1Z5WA 2WPDG 5BMVB 2W71A 2NLJC 5EC1C 2PN1A 1ROPA 2EIKB 3SDLA 2VRZA 1SERA 4QE7A 1IBMB 1RJQA 4X66O 5CB4A 4NXNH 3ASOC 1RYRA 2C2EA 3ZHTA 2ZE8A 1G1XB 2Q73A 1H8EG 2R7KA 4DO2A 4F6RA 4XZ3B 4F4XA 1GLVA 2EBOA 4FLXA 5KFHA 4JZGA 2HG5C 1OBDA 2X5RA 5B5EZ 2YZGA 1Y74A 2PTMA 2BQUA 1IBKB 4D7SA 4MW8A 5KFKA 1N8RW 4DR2O 3KXYT 3KCXA 5C1OA 2WLLA 4JYYA 1N33H 3MR6A 3HOYG 4LF7B 1XNRB 2YS8A 5KFZA 4JV0A 4ETSA 3OTOH 1SQVH 3RUPA 3TY9A 2YRWA 2CTPA 4RUEA 4J9NA 4JI2B 4LF8H 1JDBB 5H80A 1XMOO 3LWBA 3I4NG 3KHHA 4B3RH 4TQSA 2QWPB 4JI8O 4K35A 4ZQIA 1G8MA 3JAKB 3JRXA 4GLXA 4DV2O 2I8CA 3FMAA 2HGWA 5B1OA 2N74A 4DR4O 1WA8A 4MV6A 4IYHA 1IOWA 3RF2A 2ZINA 1P7BA 2A0LA 4J9LA 2XNDG 5LYJB 2Y0SA 1F23A 3KG2A 3HO8A 1SQBH 2EILC 3K06A 1ET0A 3WB0A 3ASOB 4MTGA 3JD2A 4GX0A 2R86A 4EB6B 3WNZA 1I3QA 4DV5O 3CCQV 5H6RA 3QG5A 5KHKA 2XCPA 2XCAA 1VQ6V 3AG2B 4JI3B 4DR7O 5KG7A 4RO2A 5KX5B 4DLKA 2XC9A 4TSFG 3CQZA 3RYHB 4PD4F 1MMMA 1E4EA 1BXRA 1V4YA 4LSXA 1I94O 1VQNV 2R7LA 4JI4O 1KB9F 3T1HB 1SZXA 3CCLV 1XMQB 1NTKH 2Q4PA 2NU7B 1KBHA 4J7KA 3ABKC 1C3OA 3JARA 1BQZA 4X1KB 1Q6UA 2R85A 4JI7O 1EYZA 3MD0A 4O4IB 4ECVA 3VQVA 3T1YH 4N21A 2FKXA 1BNCA 4B3TH 4JI1O 3W1BA 4BW5A 2OTLV 1ZSPA 3H0GG 5IYDO 2DPJA 3SYOA 2F23A 5LA6F 4ED0A 2WLMA 1WAZA 5CA1A 1JCHA 4ED3A 3F7VC 2FYUH 3W7TA 2FPIB 1XHXA 2QA4V 2YIDA 1R3LC 4LH7A 1FJGO 4YHHH 2EILB 4HZ3A 1JJ2U 5FD5A 2Q8VA 2ZGIA 5LOVF 1PNKA 4JTCB 3TQ1A 2UVRA 1N32B 2YZMA 5H2FZ 3Q4HA 2YXLA 2G38A 4RZRA 4RZQA 3JATB 5IJ9A 2PUSA 4JASA 5H9CA 4D6TH 3U55A 3HKDA 2WB1E 5IP7G 3ABMC 2ZM6O 2R8HA 3HOWG 4O7YA 1M0TA 1VQPV 3R5HA 4R50A 3KCYA 4QIWE 2XGQA 4I9QA 3ABKB 4LCUC 3N8DA 4HNAA 4RB3C 3RN4A 4FM0A 4QWAA 4GKKH 3U9TA 4LF4H 2BCCH 3CCSV 3HXLA 2YW2A 3AW8A 3JSNA 1QBZA 1F4MA 4GC6A 5LA6A 5BR8O 2LO1A 2GTSA 1UJWB 2P5OA 3AK1A 1V55C 4F4WA 2P67A 4LP8A 3WO0A 4FFLA 3RYIA 5F2VO 5I5XA 1XL4A 2FTKA 1B3QA 2IJJA 5A9GA 3N44B 5LOVA 4DV4B 4DIMA 1OCOB 4DRFA 4U7OA 4WBNB 4I50B 4FLWA 1IYDA 1H2KA 1N4CA 5F9NA 3H4DA 4YQWA 5E25A 1WB7A 1U97A 3H1IH 4CC5A 4DV3O 1GYFA 2UXDO 4B3RB 1I7LA 4Q8EA 4L8JA 3TJTA 4DV6H 1BS3A 4YJ3F 5KFTA 2XTAA 3E86A 3OMNB 2ITDC 2JRIA 2RJZA 3ABMB 1IBLB 3O65A 1EKVA 4RUAA 3QWUA 4DV0O 5KUMA 2CH7B 4KHPO 5LMNO 1TWHA 1T3NA 1P4RA 4RAYA 4A3LG 4Z2WA 4LFCB 3QO5A 3RAQA 1TVKB 4TQDA 3SPGA 3PW4A 3C3SA 3K0DA 3FYEB 1JOYA 4HNTA 5LXTB 2NU9B 3F7YC 4LSAA 1B04A 2A3QA 3E22B 3RBEA 3JCUZ 3N27A 1K92A 2ZXWC 2UU9H 2BSKA 1R3IC 5JWPA 4TV9B 1V55B 3HKEB 4HBNA 4O2BB 2NNUA 3PR4A 5EZYF 2VQFH 2RN9A 2ADPA 3HOUG 1R3KC 4FBTA 4FE2A 2C2AA 3JASA 4TUYB 3GTJA 3CPWU 4L87A 3BA9A 5ITZA 1M0WA 3SPHA 4JYAO 3JZFA 3FB8C 4QPJA 1RM1B 1CPYA 3BHPA 3JALA 4QNHB 5BWTA 1P49A 4MTDA 4YJ3A 4DUYO 4RAZA 1I2KA 1K7DA 3LSSA 2R7MA 2XAJA 4FJCC 4L1KA 1YITV 1NS1A 4DR5O 5FL7G 2HGSA 1V54C 1CXZB 3CCUV 2ZNJA 3PR5B 4U7NA 2OWOA 4EGJA 4DAAA 5J2UF 2JA7A 2QGNA 2WLIB 3GB8B 1UPGA 2Q7HA 4J10A 3RGBA 2XOKG 3BJYA 3RVYA 2CNUA 2ZDGA 3AG1C 3DAAA 5GONB 2PI5A 4WFAV 1KBLA 5KG3A 4DR3O 4IWYA 4UVCA 3C90A 5IJ0A 1M7JA 5DN6G 4FLVA 4YY3O 5EZYA 2ZDHA 3CRMA 2ZXWB 1YTFB 1I50A 2QWNB 3GV8B 3G8DA 3E8HA 3RGXA 3PW0A 3CMEV 4NLGA 4NTYA 5J2TB 3ZN1A 4B3SO 1SCUB 2UUBB 4GYCB 2DMXA 1GSOA 5FR9A 3JZIA 3TQTA 4BY7G 3WG7B 4CC6A 4Z1MG 2W7PA 2UUAH 3FD9A 3ORRA 5HFMA 1J95A 4JZ2A 4IGGA 4JI4H 2XAGA 3OEEG 4CH6A 4ECUA 5J2UA 4Z1VA 2FKLA 4JTAB 4F6RB 1S0VA 1WNSA 4PI0A 4YIOA 4NXMB 4LF6H 4EYIB 4ZI7F 1PNMA 2ZIMA 5BMVF 4LFBH 3HT5A 4JI7H 5D1PA 2CGOA 4QWCA 3I12A 2QJ1A 3E8GA 2GPWA 2P90A 4Q44A 2R84A 4GC7A 3K5IA 4JI1H 4JAAA 1KT8A 1NU1H 1IBMO 2I87A 1GM9A 3E8FA 3AG1B 2E3CA 2ITCC 3NGDA 1XOUA 5KFXA 4A3JG 1HNZO 1GO3E 3C0FB 2PVPA 2WDTA 5KG4A 2QKAA 4MV7A 4Q8FA 3G6XA 3SPJA 4AHCA 2PI4A 2R93A 1S5LZ 3CC2V 5BZBA 4FZ0A 2X6CA 2ZDIC 1IBKO 1S0MA 3SYQA 3LMLA 1TUBB 2NVYA 2R92G 3BQ0A 2EIJC 4ED6A 3RGZA 1H2GA 1XNRO 1W0KG 4AQYH 3L9DA 4C7UA 4PHZA 3GIMA 1B33N 4CS4A 4K0KB 2R8KA 2F43G 4ZI7A 5BMVA 3E2EA 5HBRB 1ZETA 1S0OA 3ORQA 2UU9B 3HOVG 3DTGA 3HKZA 5KFWA 4FFOA 1NT2B 5C93A 1XNQH 5LYJF 3JD1A 5EBWC 3H40A 4NZNA 1RJRA 5LHHA 4YXWG 1VQ8V 4LMYA 3CMAV 2Q69A 4O7VA 1A32A 5K1XA 2A06H 3H1LH 1J5EB 1KJJA 3AX6A 2R9AA 1JR9A 3MWDA 2IM9A 2DAAA 2GHYA 2QTOA 4HQ6A 1P8LA 3M7MX 4JI3O 2CKZB 5C8YB 3GTMA 4B3MB 1NJIW 2BTOA 3R66A 5JJNB 5JH7B 3RFCA 3CRCA 3RV4A 3GIPA 1GSAA 3W5OA 1QU7A 1LNQA 2EIJB 1QLEB 2YXYA 1EZVH 1YJWV 1HNXH 3D36C 1WR2A 3JAKA 2JS3A 1GM7A 4UV9A 2CZGA 5E1AC 5BWUA 1MZEA 5IDJA 1DV2A 1VF6A 5EWGA 3KHGA 1PL4A 4FU0A 4RNMA 3TK1A 3MAQA 5LYJA 2CNQA 3QNEA 1X9NA 1M90W 2FK2A 4A3GG 3D3IA 2ZJTA 4BIUA 4DRXB 1K9MW 1YSCA 1EKPA 3Q4HB 4EB6A 4X1YB 3L73H 4FVMA 2HIVA 3MDSA 3BG5A 1PNLA 1YDXA 1DV1A 1AILA 1K83A 2QEXV 1JMKC 4CH3A 2QSAA 2J9GA 1YTFD 2B1IA 4JI0O 2FMAA 5L3EA 2V1DA 4BIOA 2UXCB 5KFYA 1RFYA 4ECZA 4P30A 3V6JA 4YR0A 5DMXA 5L3BA 5KFSA 4UCVA 1Z2PX 2HG8A 2Z04A 4CS3A 2WLKA 2R72A 1CKMA 2Z5UA 4X1KA 2XIGA 2OCHA 1QR8A 1ZWIC 1HNWB 4LFBB 1WP7A 3B2EE 2ASDA 4UCSA 3X2QC 4APMA 3BQ1A 1JVMA 3RBDA 2AHYA 4R8CA 2Y0SE 4EEYA 1PV0A 2LJ2A 5LOVB 4GX5A 2B63A 2JA5A 1JXLA 2VUGA 4ZIBA 4DK1A 1N36O 3Q1KA 3CE2A 4O2AB 3L75H 2W0FC 2YI9A 2IBKA 2COGA 3LNMB 1US6A 2YIAA 3PJSK 5KMGB 5IT9N 3PZPA 4PV1B 4G2KA 1KJIA 2HP8A 2PMZA 4DV4O 1IXBA 3ETDA 2HDKA 3VNNA 1FFTB 3AG7A 4WBNF 4FLYA 4OXSA 3MWMA 5IYDG 3JATA 1M57C 3F5WC 1KTAA 3OT7A 3ASNC 3H1HH 4X1IB 2P0AA 2OTJV 4ICGA 1UFIA 4WD3A 1FVIA 3VPDA 4MW3A 1IBLO 1K5SA 1X4TA 3QVNA 3IAYA 4EBDA 4FMTA 2R8JA 3GIJA 5TISZ 2DYRC 4LFCO 5T14A 5LXTF 4DR6H 4NZOA 4IAJA 3ZHQA 1BCCH 1VQ7V 2Q2UA 4TV9F 2R8GA 1C30A 1WJZA 4O2BF 4P9OA 5LGUA 3DSQA 2EIMC 1MA1A 3A0RA 4TUYF 4WBNA 2E76B 3WB1A 3MFIA 4DV1H 4J9KA 4O7WA 1ZUQA 4JV1A 3ML0A 4A3DG 5KT6A 2R87A 3B77A 3LSUA 3P3NA 2XHBA 2NR5A 2DW4A 3ASNB 4JUZA 1KKCA 1ZHSA 1Q81W 3JSLA 3M9NB 1G4YB 3OGIB 1MNGA 5IP9G 3PO3G 3VBBA 3ETJA 1NTZH 2Q7EA 3AK3A 1TVKA 1D5AA 4MVUA 1M1KW 1COWG 5KFJA 2MW2B 3K58A 5LXTA 4YAJB 4LF5H 1KC8W 2HHHO 4RCNA 3E22A 2YYAA 3S24A 2DYRB 5GONF 2XCLA 5B3SB 3WO1A 4NYEA 1GH6A 1N34O 2AGQA 1AP6A 5I60A 4RUFA 5FLXN 4MV9A 4TV9A 3CSWA 3HKEA 4O2BA 2W8KA 2FP4B 5JCOC 3K9AA 4R7RA 4ZOLB 1I0HA 2E2IA 3NBYB 1SKVA 2VS0A 4TUYA 4PZ8A 5J2TF 3GJXB 3M99B 5LP6C 3BCCH 5KFGA 5B1BB 1OCRC 2AZ2A 3A2FA 2JA7G 3C3TA 4IL6Z 3CP1A 4C2MA 5LHGA 2WAMA 1XEQA 1H2SB 1QVGU 1CKNA 2JJ2G 3RR5A 3I4MG 2EJ7A 4A3BG 1TUEB 2V5AA 3TY5A 3CEBA 5IY5C 3ZCCA 4ZKIA 2WLIA 3ABLB 1FKAH 1AI7A 4PA9A 3GTPA 1W2BU 2EJRA 2VR1A 1AROP 3MR5A 2GTAA 4NXMO 5KFOA 4BW9A 2OT5A 4RAIA 5GONA 4J7ZA 2YZNA 4X88A 1BHAA 4DW1A 4GT1A 2VPQA 4MTFA 3SJCC 2F4VH 5BYBA 1VARA 1H8HG 4EFEA 2EINC 2CK3G 1HR0B 3STZC 5BY1A 5J2TA 3ZJZA 1Q6IA 5I5UA 1T36A 2JVDA 1SRYA 4QWEA 3E89A 2ZE5A 2UXBH 3N42B 4LR3A 4KUMA 5LP6B 2E5LB 2BR0A 2UXXA 4FGRA 4UB8Z 1VF7A 3GIIA 4CH4A 2CW8A 1OCRB 4DV7H 5IT9W 1EZJA 5H6QA 4O7RA 5KA5A 4EG0A 3EXAA 5DLFA 2DOSA 1WCMA 3K5MA 1RPOA 1QLNA 3KHRA 2GDSA 3EPIA 3U9SA 1K1QA 1M56C 3K59A 1TWGA 5IY5B 3B8MA 2H94A 1YJNV 3TXQA 2VQEH 1FXKC 2R93G 3P3PA 3ZHSA 4FLTA 4ECYA 2CTWA 3OUSA 4DL6A 2JIZG 2X0SA 1FAFA 1KUTA 1N36H 2XAHA 3OE7G 3EPGA 2WA3A 1PD3A 1Q43A 4MVOA 2EINB 3K5NA 5DG9A 5IYBO 3NUAA 2KKWA 3V6KA 1J5EO 4DR1B 5HNEA 2CE4A 3R65A 1N56A 5BWXA 4WHXA 5C44G 4ECTA 3EYYA 1TUBA 4B7KA 5C8YF 1VQKV 4UCRA 3H20A 1DAAA 4LF9H 1Y76B 4AILC 1RPRA 5JH7F 4J42A 2DIKA 1H38A 1R6TA 1VF5B 4LFAB 3IFXA 1GN6A 3L72H 4FFPA 4IT5A 4LF5B 3VPBA 3R5FA 2OCCC 4HYKA 3AK2A 4NB5A 2YRXA 1O75A 3FKIA 3ZRWB 1AI5A 2YIBD 4MA0A 1M56B 4JI5B 1E4FT 2KSWA 1I1LA 3T4ZA 3H3VH 2XAQA 3F5TA 1IDSA 3ICXA 4X62B 2F1MA 4NR1A 1FFXA 2BQRA 1BZKA 4A93G 1FXKB 2DQ0A 4Q43A 4KP4A 1YZBA 1M6VA 4GKJB 3J81N 2EULA 2JGDB 1XQ8A 4O7SA 4J0MA 4IRDA 3GIQA 3P32A 1I1KA 4IYIA 3JRWA 1T5EA 3MFHA 1Y4MA 1AR1B 3TIGA 5LMUH 5C8YA 4K6NA 4MS2A 5BPFA 5FLXW 5FPOA 3UT5B 4RQEA 3RYCB 5KFNA 2ZDIA 5JH7A 4FK5C 2IA6A 3TEKA 1SZTA 4MTEA 2WSSG 1SEIA 2YL2A 4UUGA 2W6IG 3G6BA 4YP3A 4OX9B 4FFNA 1EUDB 3HR0A 5KFBA 3HKZE 1WN7A 3ETEA 1GTOA 3STLC 2M05A 2Q0OC 4O3QA 3K3PA 5IWAB 3CVZA 1MOFA 2DLNA 4KFMA 4DRXA 2BQ3A 4O2AF 5D5QA 3SPIA 3ZRVA 2ATLA 4X1YA 1Q90D 3NBZB 3I55V 4UCTA 1VIBA 2LGQA 5DGAA 1N34H 2IJKA 4UUJC 3W7SA 5DM6V 3MJFA 5KG0A 2UUCH 3WU2Z 3RB6A 3GTOA 1VBHA 4DV7B 1R9TA 2HVKC 4TT3G 5EYPB 4K8XA 2ODTX 4GUNA 4NXNB 1MABG 1Z5VA 2B63G 4W4LA 3JAMN 1X59A 2W7OA 2ILMA 3JD4A 2NU6B 1GRJA 2BE3A 4QW8A 1XILA 4FPPA 1GM8A 2WLJA 4MV1A 1R3JC 3D36A 3GB7C 2KG7A 4HAMA 3SYPA 2VQEB 3FKSG 2M6YA 4H13B 4WFBV 1N33B 2J6UA 1AP5A 4IRKA 3IC9A 4CKBA 3VOTA 4O2AA 1DIKA 4PDMA 3OTOB 3JAWB 2HFEC 5F9LA 5KMGA 4JPRA 3T5LA 3K57A 4LF8B 1S0NA 2NN4A 5KFQA 2LW7A 1AR5A 2PGGA 3LQSA 2JEJA 2Q6AA 3GTKA 1KP3A 3OUUA 1I7NA 5KHHA 3LULA 1JX4A 1V51A 3MHHC 4O84A 1S5HC 4JV5O 4JI6H 2X7RB 2R82A 5EWFA 4X1IA 3G71V 2VUMA 1W93A 4LWSB 1I5YA 1K33A 3APQA 1WPXA 1S76D 3RV3A 4ZHQF 3UM7A 3HPLC 1KP2A 1A0GA 2NU8B 4J9YB 1AR4A 4JF3A 2PYLA 4X66H 3L4KA 1RSOA 1UNNC 5DG8A 2IP4A 1GN4A 3U0ZA 4AYBA 5L1LA 5B1NA 3O9OA 3GWKC 1YJ9V 2AW9A 1R6KA 3RFRA 5DQHA 1ZTEA 3ZMUA 5I5TA 2EZOA 1B6SA 4Y8VB 3QFFA 2WLNA 2WA4A 4Q20A 4UFZA 3A0HZ 4X65O 2KB1A 4X9QA 2PMZE 5JQGB 1R73A 4FFRA 3T1YB 1VQOV 4DR2H 4I9WA 2PZSA 4ZOLF 4PA6A 1CKNB 4B3TB 5KUKA 4UVBA 4DL3A 4O4LB 1VQLV 3UZOA 5KFIA 2WAQA 3V4ZA 4TOIA 5KG1A 2JEIA 2A9HA 4DYLA 3R23A 3BFRA 3ABUA 1XMOH 1OCZC 4JI8H 3OMAB 4I0XB 1DF4A 4OPAA 3J81W 5CM0A 4C5AA 1YVWA 4YHHB 4ZHQA 2SCUB 4BBSG 4DV2H 3LDCA 3HOXG 4YJ2B 4DR4H 2W9CB 1XDCA 4J11A 4YR2A 4QE9A 2YIBA 1QHTA 1IYEA 4C5CA 3G67A 1YCIA 4Q45A 4X64O 2EX3A 1CE8A 1Y1WA 4ECWA 4GLWA 4CKEA 4DUZO 4DV5H 2DYSC 1Q86W 3BEHA 3B09A 5KFUA 5A2QN 4G3IA 2YUAA 4HN2A 4DR7H 1OWTA 3T99A 1O9GA 4ZOLA 4YIPA 4GKKB 1NVPB 1I94H 4XYLB 4LF4B 2DWCA 1L0LH 1HR0O 4P9PA 4B08A 2WTFA 3SI8A 3H1JH 1BQ0A 1Y1VA 1BL8A 1V54B 3OUFA 2K9PA 1A9XA 1AJNA 1SS3A 4O3SA 5LP6F 4O7TA 3CJHB 2E5LO 3FX7A 1KC7A 2Y0PA 3K79A 4ASUG 2Q5ZA 2L6LA 3QZ7A 1YIJV 2CTQA 2NUAB 3GTGA 2C28A 3WFVA 1WSCA 3M9OB 4P2ZA 2CFMA 1S97A 2JA6A 4C5BA 2R6FA 4DXWA 2B9ZA 1FJGH 3JAMW 5KAFZ 5EOYA 2CNVA 1VEWA 4DV6B 3ZS8C 1K97A 2DYSB 1XBLA 1S03G 3VQYA 1IZ3A 1M4UA 4LF7O 2UXNA 5JCOA 3SJBC 4TQRA 1JJOA 4E6NA 4LNUB 1WCMG 3K5LA 2ZM6H 1MSWD 4JI2O 3QZ8A 5LP6A 4BR6A 3EHBB 2YS7A 3FAVB 3ZHUA 4WFFA 4PJ0Z 1I08A 1P84F 1JX9A 2IW5A 2RGVA 5DGIA 3W1GA 4BAYA 3SR2C 1FFXB 2VQFB 4O4JB 3GQCA 5BR8H 2GV9A 1EM1A 4LFAO 4I4TB 2MCTA 4RU9A 1S72V 3R9RA 2QR4A 3RYFB 1S77D 4TWKA 5BWVA 3GV5B 2B5UA 5IE9A 2Z02A 4DQNA 4G28B 2V4RA 4CZZA 3OMIB 4X62O 5KFPA 4NYKA 3BACA 2YXHA 3CXHF 3T1HO 3S3WA 1XMQO 4X20A 4GKJO 4DV3H 1R1BA 1DLBA 2UXDH 5DGHA 3OM3B 3VOUA 2CQYA 4RB2C 1BSMA 3QO7A 2JJ1G 4MV3A 2QB5A 1PM9A 4JXUA 3RTXA 1SYXB 2W70A 3FKIG 1GMGA 1WP8A 2QM4A 1Y76A 4X8AA 4JV5H 4DV0H 2VWKA 3DTFA 4KHPH 5LMNH 1YI2V 5CMUA 1DGSA 2GQRA 1PPJH 3OGCC 4J80A 1YXBA 1FYJA 3L74H 2QWOB 1XHZA 1AVMA 2A7WA 5IYBG 4OX9O 1HDJA 2W6JG 3W7XA 3ZRWA 3N6RA 2D2CB 4FLUA 4DR7B 2BTQB 4JAUA 1KKDA 4XBFA 3T5JA 2UUAB 3WB2A 3LDEA 2CAZC 5LL6Y 1FXKA 5IWAO 1UC8A 2FE3A 4JI4B 1N32O 1T94A 4JYAH 5DLGA 1DK1A 2Y4RA 2UVWA 4BY1G 2JGDA 5KFAA 2HJWA 4LF6B 2JEXA 3BQ2A 4X65H 4J9MA 3RB3A 5B66Z 3ABTA 4DUYH 3KAKA 1ZAUA 3FFQA 1Q7YW 4JI7B 2KG7B 5A2QW 4PWQA 5DQIA 2ARHA 2R9IA 4JGSA 4PDVA 4JI1B 2P4VA 3UT5A 4MVSA 3RYCA 3N40P 3Q8RB 4DR5H 1HWYA 1WPBA 4NXNO 1A48A 3ZEDA 5CA0B 2X6BA 4ECXA 3E8BA 2VPSA 3GV7B 1EN6A 3T1CA 3RWRD 1OJHA 1TA8A 4DR3H 2MK3A 4U6PA 2ZKOA 1A0IA 4WFEA 4YY3H 2ZR2A 2UVUA 3T9DA 1LR1A 5BXZA 4ED1A 2C35B 1EN4A 5CA3A 1N33O 3CRQA 4F4ZA 1N0JA 2YWVA 2FB5A 4DUZH 1VBGA 3I56V 2Y0IA 4AQYB 4B3SH 2ALZA 1M93A 3OTOO 1AUXA 3PW7A 3CCEV 3ETHA 3FB5C 3CSXA 2ZM6B 3GLKA 4LF8O 1VQ5V 4B3RO 3U0GA 1SQFA 1AJQA 2UVVA 3T9AA 2FL4A 1KJQA 1HW7A 1RSOB 3N2KA 5EYPA 2HVRA 2JEGA 2BOCC 3X2QB 2H3OA 1XNQB 5D1OB 2R70A 1FD9A 3SJQC 1MZFA 4DL5A 3IC7A 1P7GA 1PK8A 2ETNA 1OV9A 4FM9A 2FPGB 2PF4E 5BR8B 2CDYA 5L1KA 3H1KH 3T5HA 1MSDA 4A3KG 4OGQB 4QJFB 3IJ4A 2CTRA 4IHJF 1IBMH 5FJ8G 2JS5A 3K03A 1JLLB 5CBGA 3IN5A 2W8LA 2Q7DA 1ZX3A 3QTCA 3L2PA 1I6UA 1EBOA 2DQ3A 4U3FH 1HNZH 1XI1A 3JAWA 5JVDB 4FLZA 2QF7A 2RNBA 1GKFA 2LFSA 4DV3B 2HIXA 1Q3EA 1HNXB 2VUMG 3CRAA 1M57B 3CB2A 5JQGF 2WWWA 4JTDB 2OLSA 5KFRA 3NR7A 4ZHQB 1IBKH 1EFRG 5KLVH 3TW7A 3T1YO 2W6ZA 4O4LF 3JZ6A 2YI8A 5HFLA 3ZMSA 4LF7H 2JK5C 1XNRH 5FPRA 1GSHA 4UB6Z 2XAFA 4EYHB 2GBOA 4LWSA 5DEDA 4JI2H 4M7EA 1D5NA 5LL6b 4MTXA 3M9MB 4R7CA 2W6PA 4YJ2F 1EUCB 4YHHO 2ASJA 2AGPA 4IHJA 3Q8SB 4XDKA 1AI4A 1KD1W 1WLEA 4TM5A 3U54A 1IURA 1XK5A 3Q2OA 2FMLA 2WE6A 2QWQB 2YC0A 2V58A 3PFFA 2EIMB 3J7AK 4A3MG 4MTOA 2UUBO 3D8CA 2FK3A 3K9SA 1M9NA 2Q9LA 5JQGA 4IR9A 2RCVA 4O86A 4QW9A 4JI3H 1BMFG 1S10A 4O4LA 1URFA 4EKWA 3UO2A 4BXXG 3I5DA 3NC0B 4NTWA 1SESA 4LF4O 2CUGA 4N23A 4CBCA 4FFBB 3T1HH 1E1QG 4QSHA 1XMQH 4PI2A 4YR3A 4I55B 4LBEC 4M9UA 1Y1WG 4I0XA 2B1GA 4FZ1A 1TWAA 2Q67A 2RF4A 3V6HA 1P16A 2L35A 4Q4DA 4YJ2A 2VA3A 2W9CA 4ME6A 4A5UB 1ZL8B 4F4LA 1A3GA 2W6QA 4RB1A 1M5IA 1W59A 3OW2U 3SE7A 2NVXA 3A0BZ 1SA0B 4Q0YA 1ZLZA 4YY3B 2M7WA 2HJDA 3IGAC 3NXSA 1S9FA 3U10A 1H2LA 4B3SB 2V9WA 3EFFK 5IYCO 3HKBB 3N41B 2J6SA 4PA4A 5L1IA 4A3EG 4JI0H 1L0NH 4JV2A 4DV6O 4RUCA 4J9PA 3T9FA 3OR6C 4PDLA 3IG0A 1SETA 4UVAA 2ZR3A 4AI8A 2ZDQA 2AQ4A 4ECSA 3B40A 5EK0A 4U3JB 4DL2A 3D3QA 3JCZA 5JJJB 4GCZA 5GTHZ 3ZIAG 1OHHG 4DR6B 4K0KO 1B6QA 5LBQA 1XDNA 2Q0AA 3CJHA 4UXNA 4J9QA 3ZHVA 2HLDG 3CCVV 1K3EA 2R92A 2UU9O 1XL6A 5L3CA 2A1HA 5CR5A 5K2MA 4O4JF 2VQFO 2R7ZA 1D2DA 4DV1B 3EVKA 4I4TF 1HNZB 3WWJA 2HGXA 5KG2A 4CE5A 1BE3H 3OTFA 4X20B 3AG2C 5KG6A 2FLPA 4E4TA 2ZCEA 2XUMA 3CWBH 3ZN0A 4A3FG 5IYZB 2HVSA 5KA6A 4ECRA 4DV4H 4OPHA 3BAAA 1IX9A 3MHSC 2HR3A 4WF9V 4B3MO 4A3CG 1JFFA 3G80A 4A2AA 3K08A 4TV8B 3UFXB 4LNUA 4F4YA 5LHIA 3CC7V 3KREA 3FAVA 1QQCA 1XREA 1THZA 1K34A 2Q7GA 2Y48A 3OHAA 3GTLA 2OIEA 1IBLH 2QKSA 3DGEA 5KT3A 2IU0A 1OZ0A 1QCEA 3APOA 2A79B 1TGOA 4O4JA 2C00A 1GN3A 3VQXA 4LFCH 5H5NA 3N2GB 1GGOA 4O7ZA 3P30A 5BPHA 4I4TA 4CMDA 2V4DA 5CA1F 2GUZB 3BVOA 2EIYA 5L3GA 1KJ8A 2F95B 3RYFA 3G6YA 1BHBA 1Z2OX 4K8ZA 1PX2A 2UXCO 2UUAO 3VA7A 5JUMA 2Q2TA 3GIKA 1G2WA 1VQ4V 1AJPA 2COJA 2BOBC 1NKDA 3LNNA 4FFMA 1LUVA 2Y4UA 2C2RA 3T54A 4LF6O 5GW7A 1NI8A 3OEHG 1LUWA 1HNWO 4LFBO 3DF7A 4RNNA 3QF7A 1GAXA 4MV4A 2OCCB 4U7CA 2F4VB 4M0JA 5K3WA 1SQGA 2YEVB 5KT2A 4RNOA 1L1FA 5CA0F 3WWHA 1QNMA 5KT5A 1S68A 2QTSA 3T9EA 2W9BA 3BA8A 3T2MA 2HHHH 3RIZA 1H2NA 1ORQC 2WLHA 3K5HA 5CN0A 4CS2A 5I5SA 2UXBB 2QKCA 2BTQA 4LC1A 3E5NA 4QWBA 1OCOC 5B1AC 4CH5A 4EFBA 5K1PA 4JI0B 4G27B 4B7EA 3OAAG 5KFVA 4J9RA 3N2KB 3CRRA 2ZNIA 3KTMA 3PW5A 3G6VA 2JA5G 1Y6XA 4XYMB 4K3AA 4AQYO 5BWWA 4I5SA 2IJIA 2QWRB 2UUBH 3ZMTA 3BPZA 1YHQV 1E1RG 4O4HB 4I7HA 4J41A 3PW2A 3JD0A 2ZT9B 3JYCA 1JIHA 2JDIG 4DL4A 1RK6A 3BY6A 1F4NA 3THOA 4IIJF 1GN2A 2IJHA 5CA0A 1SF9A 4H44B 1N36B 3RAXA 4R8UB 3PVXA 4PA7A 1XNQO 3BRCA 5EIBC 3HB3B 2JEFA 3VQWA 1VP7A 4NXMH 1KEEA 1DF5A 4TVIA 4J9OA 2ASLA 3CS5A 1YF2A 4KXRA 2EJ3A 5C1PA 5KT7A 5E79Z 1AI6A 4ECQA 3DXRB 1TAEA 3MWEA 4LF9B 5CBFA 5C3EG 1K4CC 3RBZA 5B1AB 3HB9A 2DPIA 1RM1C 4ED8A 5JVDF 4EBCA 1SC5B 1ZQ7A 2ZE7A 2QYZA 4I7ZB 5KHIA 4NVPA 5GTIZ 2Q68A 5EWEA 1HNXO 2WYOA 1JDEA 5EBMC 4HR7A 3H9VA 4E2LA 4IHJB 4IIJA 4IZOA 4MT8A 5D1OA 1OBGA 4EQ5A 2DE0X 2JEUA 2P6JA
chains in the Genus database with same CATH topology
4GLXA 3FMAA 3GDEA 4K0KH 3RF2A 2F93B 2ZINA 4DK0A 2XHBA 3L4JA 5LYJB 1ZHSA 3JSLA 4X20A 3WB0A 4DV3H 5LMUB 2UXDH 4EB6B 4RB2C 3QG5A 5KHKA 2PYJA 2Q7EA 1TVKA 5JVDA 1D5AA 3RTXA 4JI3B 1SYXB 3HKCA 3K58A 5KX5B 5LXTA 4LF5H 4JV5H 2QM4A 4EEQA 3RYHB 2VWKA 4DV0H 1J5EH 5LMNH 2RGRA 3E22A 4KHPH 3S24A 3BABA 4D7TA 4LSXA 1DGSA 3T1HB 3KAJA 1XMQB 4MV9A 4TV9A 3HKEA 4O2BA 4UCOA 5JCOC 4TQFA 4R7RA 1XHZA 4B3MH 4ZOLB 3JARA 3NBYB 4X1KB 1E4GT 1SKVA 4TUYA 4PZ8A 1BGWA 4O4IB 4FLUA 3VQVA 3GJXB 3T1YH 4DR7B 2BTQB 5LP6C 4B3TH 2HHHB 2UUAB 3WB2A 3A2FA 2CAZC 3W1BA 3U11A 2FE3A 4JI4B 1N34B 5FNVA 4JYAH 1H2SB 2UUCB 5CA1A 1CKNA 2F66C 5FD6A 3RR5A 4LF6B 1XHXA 4X65H 4LH7A 4YHHH 4DUYH 3KAKA 1ZAUA 3FFQA 4JI7B 3TY5A 5FD5A 3N43B 1FKAH 5A2QW 3N40P 4JI1B 2HEPA 3UT5A 1CKOA 4DR5H 3RYCA 1WPBA 4BW9A 5GONA 3ZEDA 5CA0B 1N32B 1O9HA 2VPSA 2YXLA 2VWJA 2F4VH 3SJCC 4RZQA 2P22C 3JATB 5IJ9A 2UXCH 2PUSA 4EFEA 3HKDA 3RWRD 5CB4B 4FFBA 1M0TA 1HR0B 1TA8A 5J2TA 4I9QA 4I55A 4DR3H 4HNAA 3N6XA 1A0IA 4RB3C 2JVDA 4FM0A 4YY3H 4GKKH 4LF4H 1HNWH 3HXLA 2UXBH 3N42B 4LR3A 5LP6B 2E5LB 4DUZH 3JSNA 1VF7A 4CH4A 1SA0A 5LA6A 4AQYB 2CW8A 4B3SH 4DV7H 5IT9W 1M93A 3K5OA 3CSXA 2ZM6B 2P5OA 4JI6B 1SQFA 1JFFB 3RYIA 3K5MA 1HW7A 3N44B 2HVRA 3N2KA 5EYPA 5LOVA 3K59A 4DV4B 3HKBA 3TY8A 1XNQB 5D1OB 2R70A 4DRFA 1BJTA 5JJEB 4WBNB 4FM9A 4I50B 2VQEH 4FLWA 5BR8B 4X66B 4FLTA 1YEWA 4A2BA 4CC5A 1N36H 1GYFA 1Z2NX 4B3RB 1KU9A 4L8JA 4DV6H 4U3JA 1I7FA 1Q43A 1IBMH 2JS5A 2RJZA 1IBLB 3K5NA 2ZIOA 2KKWA 3QTCA 3QWUA 3L2PA 1I6UA 4DR1B 4RAYA 1HNZH 4LFCB 3SJAC 3JAWA 1XI1A 1TVKB 5JVDB 4TQDA 3EYYA 1TUBA 4DR2B 4FLZA 4UCRA 4LSAA 2HIXA 4DV3B 5LXTB 3H20A 4LF9H 1Q3EA 1B04A 1HNXB 4AILC 3CB2A 3E22B 1MZBA 4ZHQB 4LFAB 1IBKH 2UU9H 5EIBD 4TV9B 3HKEB 4HBNA 4O2BB 1ZHQA 1XMOB 4LF5B 2YI8A 4LF7H 4JI8B 2VQFH 3KALA 1XNRH 5FPRA 3JARB 1O75A 5IYZA 3M4IA 2YIBD 1S5JA 3JASA 4TUYB 4JI5B 4DV2B 1E4FT 2KSWA 3BA9A 4DR4B 5ITZA 1M0WA 3ICXA 4JI2H 4X62B 4M7EA 2F1MA 2HVQA 4BWAA 3BHPA 3JALA 3F8NA 1FFXA 1P49A 5LL6b 4TV8A 4MTDA 4YJ3A 4IHJA 4RAZA 2O03A 4GKJB 1L8DA 5CA1B 4DV5B 1XK5A 1XQ8A 4J0MA 2HGSA 2WE6A 2ZNJA 2W57A 2OWOA 1T5EA 5LMUH 3GB8B 5C8YA 3J7AK 2Q7HA 3RGBA 5FLXW 5FPOA 3UT5B 3RYCB 1I94B 3N2GA 1G6UA 5JH7A 5JQGA 5KHJA 5GONB 4JI3H 4MTEA 1SEIA 1L2ZA 4O4LA 5IJ0A 4BWSC 4FLVA 4OX9B 5IJ9B 4PZ6A 5EZYA 3NC0B 3HKDB 4KL1A 1WN7A 4FFBB 3RGXA 3T1HH 1XMQH 4PI2A 5KX5A 5J2TB 4I55B 3RYHA 4HNAB 5IWAB 2UUBB 3CVZA 4GYCB 1P16A 4DRXA 4YJ2A 5D5QA 4UCUA 4RB1A 1M5IA 4X1YA 4CC6A 2UUAH 1SA0B 5LA6B 3NBZB 4Q0YA 3KYHC 4UCTA 4YY3B 1FJGB 2OYQA 4JI4H 1N34H 4O4IA 4CH6A 1VS0A 3RYIB 2UUCH 5J2UA 3U10A 4B3SB 4F6RB 4LF6H 1WNSA 4PI0A 4DV7B 4NXMB 4X64H 5EYPB 4K8XA 2ZIMA 4LFBH 4NXNB 3HKBB 4JI7H 5D1PA 3N41B 2QJ1A 4JI0H 1Z5VA 1WH2A 4JI1H 3IG0A 2E3CA 3PN1A 4U3JB 5JJJB 3C0FB 2VQEB 2WDTA 4DR6B 4MV7A 1HR0H 4IIJB 4AHCA 1N33B 2Q0AA 1XDNA 4O2AA 3SGIA 1V9PA 3OTOB 3JAWB 3LMLA 4O4HA 1TUBB 3RJ0A 5KMGA 3K57A 4LF8B 2E5LH 2PGGA 3RGZA 4AQYH 5KHHA 4DV1B 1HNZB 4PHZA 3OTFA 4X20B 5D5PA 4CS4A 4FM2A 4K0KB 4JI6H 4ZI7A 5BMVA 2ZCEA 5IYZB 2HVSA 3JASB 4X1IA 2UU9B 4DV4H 5ITZB 3HKCB 3BAAA 1NT2B 2UXDB 1XNQH 3JALB 1JFFA 4A2AA 2RQ6A 4TV8B 2PYLA 4YJ3B 4LNUA 4X66H 3L4KA 4LMYA 1RSOA 4JV5B 5K1XA 4DV0B 3U0ZA 1QQCA 1J5EB 5LMNB 4KHPB 1AN7A 2R9AA 4I50A 2Q7GA 3RFRA 2IM9A 1IBLH 1P8LA 3M7MX 4FM1A 4LH6A 5C8YB 4B3MB 1TGOA 2BTOA 4UFZA 4DR1H 4O4JA 3VQXA 4LFCH 3N2GB 5JJNB 5JH7B 5JQGB 3CHXA 4I4TA 2V4DA 5FNVB 3T1YB 4DR2H 2PZSA 3W5OA 1CKNB 4B3TB 1HNXH 4O4LB 5IJ0B 2YCHA 3JAKA 2F95B 3RYFA 5EZYB 4LFAH 4TOIA 1Z2OX 4JYAB 1XMOH 4K8ZA 3MAQA 4JI8H 5LYJA 4X65B 1X9NA 3J81W 2Q2TA 4YHHB 4ZHQA 4DUYB 4DV2H 4JI5H 2ZJTA 4DRXB 4YJ2B 4DR4H 3LNNA 4X62H 4EB6A 2YIBA 1QHTA 4X1YB 4DR5B 4FVMA 2HIVA 3K3VA 2EX3A 3DF7A 1JMKC 3QF7A 4PZ7A 4GKJH 4CH3A 4DV5H 5J2UB 2F4VB 2UXCB 1SQGA 3UQ8A 4UCVA 4DR7H 1S68A 2CW7A 1Z2PX 4DR3B 3BA8A 4RB0A 4CS3A 2HHHH 1O9GA 4ZOLA 2R72A 1CKMA 3RIZA 4Q6GA 4GKKB 2JGUA 4X1KA 1I94H 2XIGA 4X64B 4LF4B 1HNWB 4LFBB 4CS2A 2UXBB 3B2EE 2BTQA 4B08A 4UCSA 5KHGA 4DUZB 4CH5A 4EFBA 4JI0B 5K1PA 4APMA 4OX9H 5DISC 3N2KB 5LOVB 2VUGA 4ZIBA 2ZNIA 4DK1A 2VOBA 4O2AB 2YI9A 5IWAH 2UUBH 3BPZA 3ETQA 2YIAA 2CFMA 4O4HB 1N32H 5KMGB 4I7HA 3J80W 1Q5OA 4PDBA 1KMIZ 1FJGH 3THOA 3JAMW 1Q8IA 5CA0A 2PY5A 1N36B 3VNNA 5EOYA 4ZI7B 1Z5WA 5BMVB 3BRCA 4DV6B 4FLYA 3ZS8C 3MWMA 3JATA 5EIBC 3VQWA 1S03G 1IBMB 4NXMH 4X1IB 5CB4A 3VQYA 4NXNH 1M4UA 5JCOA 3SJBC 4DV1H 1FVIA 1JJOA 4E6NA 4F6RA 4LNUB 1TAEA 3K5LA 2ZM6H 4FLXA 1X4TA 4LF9B 5LP6A 3IAYA 2PTMA 1IBKB 2RGVA 4D7SA 4DR6H 3KXYT 5KHIA 3W1GA 4NVPA 1N33H 4IAJA 4LF7B 3SR2C 1FFXB 2VQFB 1XNRB 2WYOA 2Q2UA 4O4JB 4ETSA 5BR8H 3OTOH 2GV9A 4IHJB 3TY9A 4I4TB 2MCTA 4JI2B 4IIJA 4LF8H 4B3RH 5D1OA 3DSQA 4EQ5A 4WBNA 3WB1A 3JAKB 3RYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2T A;  4YY3 B;  4YHH B;  4GLX A;  4DUY B;  1FJG B;  2HVR A;  4DV4 B;  3GDE A;  3TY8 A;  1XNQ B;  5D1O B;  4DRF A;  1VS0 A;  4DR5 B;  2HIV A;  4B3S B;  4NXM B;  4DV7 B;  5BR8 B;  4X66 B;  3JSL A;  4NXN B;  5D1P A;  4CC5 A;  4PZ7 A;  5LMU B;  4B3R B;  2F4V B;  2UXC B;  3UQ8 A;  1IBL B;  3PN1 A;  4UCV A;  3RTX A;  4JI3 B;  1S68 A;  4DR3 B;  3BA8 A;  4EEQ A;  3QWU A;  3L2P A;  4DR1 B;  1CKM A;  3S24 A;  3BAB A;  4GKK B;  4LFC B;  1DGS A;  2VQE B;  4X64 B;  4LF4 B;  4DR6 B;  1HNW B;  4LFB B;  3T1H B;  4DR2 B;  1XMQ B;  2UXB B;  1XDN A;  4UCR A;  1N33 B;  2HIX A;  4UCO A;  4DV3 B;  4UCS A;  4DUZ B;  1B04 A;  4EFB A;  1HNX B;  4JI0 B;  3SGI A;  1V9P A;  3OTO B;  3NBY B;  5DIS C;  4LFA B;  2VUG A;  4PZ8 A;  3GJX B;  4DR7 B;  4LF8 B;  1XMO B;  4LF5 B;  4JI8 B;  2HHH B;  2UUA B;  5FPR A;  4DV1 B;  1HNZ B;  3W1B A;  4DV2 B;  4JI5 B;  2CFM A;  3BA9 A;  4JI4 B;  4DR4 B;  1N34 B;  4K0K B;  4X62 B;  2HVQ A;  2UUC B;  1CKN A;  3RR5 A;  4LF6 B;  2HVS A;  4LH7 A;  2UU9 B;  1ZAU A;  4JI7 B;  3TY5 A;  4GKJ B;  3BAA A;  1N36 B;  3VNN A;  2UXD B;  4DV5 B;  1XK5 A;  4DV6 B;  4JI1 B;  1CKO A;  1IBM B;  2OWO A;  1N32 B;  4JV5 B;  3GB8 B;  4DV0 B;  4KHP B;  1J5E B;  1X9N A;  5LMN B;  5FPO A;  1FVI A;  1I94 B;  4E6N A;  4EFE A;  1TAE A;  1HR0 B;  1P8L A;  4LF9 B;  1TA8 A;  4LH6 A;  4B3M B;  4UFZ A;  1A0I A;  4OX9 B;  4PZ6 A;  3NC0 B;  1IBK B;  3T1Y B;  3W1G A;  3W5O A;  2E5L B;  1CKN B;  4B3T B;  4LF7 B;  3JSN A;  2VQF B;  1XNR B;  2Q2U A;  4AQY B;  5IWA B;  2UUB B;  1P16 A;  3TY9 A;  4TOI A;  2ZM6 B;  4JYA B;  4JI6 B;  4JI2 B;  4UCU A;  5D1O A;  4EQ5 A;  4CC6 A;  3NBZ B;  4X65 B;  3KYH C;  4UCT A; 
#chains in the Genus database with same CATH topology
 3SYC A;  3GDE A;  5I5Y A;  4K0K H;  3K0G A;  2F93 B;  3OSN A;  2IBZ H;  1FXV A;  4DK0 A;  4BIZ A;  5BYA A;  4QJF A;  3L4J A;  1CQI B;  3RB0 A;  5FNV F;  2JA8 G;  3T9B A;  4QPK A;  5LMU B;  2GPS A;  3FB7 C;  4ABM A;  4H37 A;  3UCS C;  1EN5 A;  1NH2 B;  2PYJ A;  4W4K A;  2YS6 A;  3K3W A;  5JVD A;  2EJ2 A;  1HP8 A;  4IWX A;  1Y67 A;  3AG4 C;  3HKC A;  1K73 W;  1RYS A;  3B8N A;  3TCU A;  4EEQ A;  2V4Q A;  2RGR A;  3WG7 C;  1J5E H;  4GX1 A;  3BAB A;  4D7T A;  4GX2 A;  3GWO A;  2Z0A A;  4GZR B;  5KAI Z;  1TWC A;  1NQT A;  3W7W A;  3KAJ A;  3CD6 V;  4UCO A;  4F50 A;  4TQF A;  4B3M H;  3SNO A;  3R5X A;  1E4G T;  3G4S V;  1EZ1 A;  1BGW A;  4I55 F;  1UC9 A;  2ABJ A;  2P7T C;  2HHH B;  4IR1 A;  2FJZ A;  4F6E A;  3CC4 V;  1NR1 A;  2H8P C;  3RT3 C;  1MG1 A;  3U11 A;  2RDJ A;  1N34 B;  5FNV A;  3ZRX A;  2DWE C;  2UUC B;  5KFM A;  2F66 C;  5HV6 A;  3ETG A;  5FD6 A;  2ZD9 A;  5C5J A;  3S3X A;  2FB9 A;  1KEC A;  3CYO A;  4MAM A;  3TXS A;  4DW0 A;  1JPX A;  3N43 B;  4E4E A;  2HEP A;  1CKO A;  2HHF B;  4R6Z A;  3RB4 A;  4WCE V;  4IRC A;  2Z3Y A;  2EJ0 A;  2YU9 A;  3AG4 B;  2X0L A;  1O9H A;  3FB6 C;  1OCZ B;  2VWJ A;  1AB3 A;  1N48 A;  3MR2 A;  2P22 C;  2UXC H;  1FPO A;  5JQW A;  2HJF C;  1ULZ A;  2IU3 A;  5CB4 B;  5KKN B;  3FDS A;  4FFB A;  1IXM A;  1B06 A;  3QO8 A;  4I55 A;  2C2D A;  3N6X A;  3WWI A;  4QGP A;  3AG3 C;  5KFD A;  1FXH A;  2ZE6 A;  4RQF A;  4DR6 O;  1HNW H;  2I80 A;  2DAB A;  3TIN A;  1ZL8 A;  3TII A;  5J9P C;  4HNU A;  1SA0 A;  1PKX A;  1Y74 B;  2IMW P;  3UZB A;  3K5O A;  5C4X G;  3M8A A;  4YB8 B;  2D3O W;  2WLL B;  4JI6 B;  5BWR A;  2N05 A;  3TET A;  1JFF B;  4MVM A;  4DV1 O;  5L9X A;  3G8C A;  3TGU H;  3E83 A;  1ENV A;  1CS0 A;  2IH3 C;  3HKB A;  3TY8 A;  5KFE A;  3KZI Z;  4JYB A;  5IYZ F;  1BJT A;  5JJE B;  2P4K A;  4DR1 O;  5I5V A;  4HYO A;  4X66 B;  2R9R B;  1YEW A;  4QIW F;  4A2B A;  1WA8 B;  4RWU A;  3ZBH A;  1Q82 W;  1Z2N X;  4TV8 F;  1KU9 A;  2V7Q G;  1QLE C;  1K8A W;  1IVS A;  3OUZ A;  5L1J A;  4FS2 A;  2E2H A;  4U3J A;  3UO3 A;  5EC2 C;  4PA3 A;  2AXT Z;  4H33 A;  1I7F A;  4HNV A;  2AZ0 A;  3H4B A;  2LFR A;  4O3N A;  2R7Z G;  2ZIO A;  1PP9 H;  2RDC A;  3W7U A;  3HOZ G;  4LF5 O;  1TWF A;  4O3P A;  5KFC A;  1CEZ A;  1U96 A;  5IYC G;  4NZM A;  3SJA C;  2FK1 A;  4JI5 O;  4CKC A;  3AG3 B;  5AG2 A;  5JVL A;  1RJP A;  5DEC A;  3GID A;  4DR2 B;  1FS0 G;  4MVR A;  1CQJ B;  4O7L A;  4ED7 A;  3OD4 A;  1Y66 A;  4J9Z B;  1PL0 A;  1E4E B;  1MZB A;  1XUQ A;  2QDO A;  4J9S A;  3ZMV A;  5EIB D;  2O03 A;  3K04 A;  1ZHQ A;  2LP7 A;  1XMO B;  3LSQ A;  4JI8 B;  3KAL A;  3CXC U;  3JAR B;  5IYZ A;  3M4I A;  2FLL A;  5DQG A;  1S5J A;  4DV2 B;  2WB1 A;  1RP3 B;  5KX5 F;  3KKY A;  1NH2 D;  4DR4 B;  3LUT B;  2HVQ A;  2DN9 A;  4BWA A;  2W0X A;  4QIW A;  3F8N A;  4O83 A;  4TV8 A;  1H2M A;  2W6O A;  2KSD A;  2V59 A;  1S3J A;  5EDW A;  3L71 H;  2LQT A;  2COI A;  2GQS A;  2OIG A;  2QE7 G;  4CMF A;  1I2L A;  1DTO A;  1L8D A;  2W6M A;  2E74 B;  2W9B B;  1FKA O;  5CA1 B;  4DV5 B;  2EZP A;  4CHI A;  2IH1 C;  1R6N A;  1F7Y A;  4EGQ A;  5LGN A;  5KFL A;  4FS1 A;  4O4I F;  2XAS A;  2W57 A;  3G6E V;  5DAA A;  3Q8P B;  1EHI A;  5KFF A;  3H0G A;  2F4V O;  1W96 A;  3DC5 A;  1I94 B;  2AU0 A;  3N2G A;  1G6U A;  5KHJ A;  4H0L B;  3CCR V;  2P06 A;  2GUZ A;  1OCC C;  1L2Z A;  4BWS C;  3ZMZ A;  5IJ9 B;  4PZ6 A;  3VPC A;  4UV8 A;  2J6T A;  1E79 G;  3HKD B;  4KL1 A;  3OHB A;  1NVP D;  4O3O A;  3B4S A;  2UXB O;  1K5Q A;  5KX5 A;  1EKF A;  2GSM B;  4QWD A;  3RYH A;  4HNA B;  5DG7 A;  4DV7 O;  1RK5 A;  2QM8 A;  5LGT A;  1B6R A;  1VMG A;  4UCU A;  3H01 A;  1VKZ A;  3A8T A;  2CGN A;  5LA6 B;  3OR7 C;  2XGP A;  3KYH C;  4O4H F;  1FJG B;  1QR9 A;  3CCM V;  2OYQ A;  4O4I A;  1VS0 A;  3RYI B;  1QVF U;  3QQM A;  1IOV A;  3T5K A;  2YEV A;  2VQE O;  4ZBM A;  1N0N A;  3J80 N;  3UKM A;  4X64 H;  4WFH A;  3UYY A;  5EBL C;  2YSU B;  4MSW C;  1WRV A;  3GTQ A;  4MVZ A;  1WH2 A;  2YZL A;  1VQ9 V;  2QM7 A;  3RW0 A;  3SPC A;  3PN1 A;  2X6A A;  4FFK A;  2Y4T A;  1KQS U;  1OCC B;  5CBH A;  4BBR G;  5D8D A;  3CCJ V;  1AUV A;  2O57 A;  1HR0 H;  4IIJ B;  4LF9 O;  1Z2G A;  4I50 F;  3SGI A;  1V9P A;  3Q8Q B;  4O4H A;  3RJ0 A;  4A3I G;  1BGY H;  2E5L H;  1NTM H;  1NBM G;  3AYH B;  4PEL A;  2DWD C;  2OH2 A;  5I5W A;  2BSK B;  2R8I A;  5D5P A;  3PO2 G;  4FM2 A;  2AHZ A;  4R8U A;  1NR7 A;  3HBL A;  2DJV A;  1Q6H A;  1WB8 A;  1I1M A;  2FLN A;  1BT8 A;  3JAS B;  5KT4 A;  5B3S C;  3KHL A;  5ITZ B;  3HKC B;  2W9A A;  3RVZ A;  2UXD B;  3JAL B;  4PDR A;  1GO3 F;  3SYA A;  2RQ6 A;  2DZD A;  1KJ9 A;  2VQD A;  2ODM A;  3DXR A;  3L70 H;  3TW6 A;  4YJ3 B;  4ED2 A;  1Y14 B;  4NKG B;  2AGA A;  1VQM V;  5LMU O;  4JAV A;  4B3T O;  4JV5 B;  4DV0 B;  4KHP B;  3OSP A;  2YDE A;  5LMN B;  4XX0 B;  1AN7 A;  5B1B C;  4I50 A;  2W6N A;  4O81 A;  3VMM A;  1SQQ H;  3LP8 A;  4FM1 A;  4LH6 A;  2RMK B;  4DR1 H;  2XD4 A;  1VAJ A;  3MR3 A;  3CX5 F;  1W0J G;  2LW1 A;  3DTU B;  3CHX A;  5FNV B;  3JD3 A;  3GIL A;  4NTX A;  5KG5 A;  3ABL C;  5CAE B;  5IJ0 B;  2CH7 A;  4JYC A;  2YCH A;  4YAK B;  5EZY B;  4LFA H;  4JYA B;  2YIC A;  3CEI A;  2Y69 C;  5DGB A;  3J7A U;  1GK9 A;  5L3D A;  4X65 B;  2K1E A;  2XT9 A;  4DUY B;  4JI5 H;  2KQX A;  3E35 A;  3DC6 A;  1JA8 A;  4X62 H;  4MV8 A;  4J7J A;  2UUC O;  1NZ6 A;  3V4S A;  4DR5 B;  2ADQ B;  4GKK O;  2QK4 A;  3K3V A;  3GVM A;  4YBZ B;  4PZ7 A;  4GKJ H;  2FPP B;  4EBE A;  4WFG A;  4XDJ A;  5J2U B;  2EIK C;  3T4D A;  4MVQ A;  1SQX H;  3FYI B;  3UQ8 A;  4XDL A;  2HVJ C;  2CW7 A;  4AYB E;  4DR3 B;  4RB0 A;  1K4D C;  5CB4 F;  2RDI A;  2N04 A;  3OFN G;  4Q6G A;  1CP9 A;  2JGU A;  2ATK C;  4X64 B;  5CE8 A;  1KYO F;  1KUQ A;  2LGW A;  5KHG A;  4DUZ B;  4O3R A;  4OX9 H;  1SQP H;  4O7N A;  5DIS C;  1Y1V G;  1K1S A;  1I5X A;  2R7N A;  2C22 A;  3ZX6 A;  3LDD A;  5L3F A;  4FIP C;  3ZRS A;  4O82 A;  2Y69 B;  4X89 A;  2WAQ E;  2VOB A;  4FBU A;  2E75 B;  2GLT A;  5IWA H;  1F51 A;  4MA5 A;  3ETQ A;  5KS8 A;  1N32 H;  4JI6 O;  3T7A A;  3J80 W;  4PBC A;  1Q5O A;  4PDB A;  1KMI Z;  3ZHR A;  5I47 A;  1SFO A;  2JA6 G;  2HHF A;  4DL7 A;  2VA2 A;  1JQ0 A;  5FLM G;  3AEI A;  2AGO A;  2ZQM A;  1Q8I A;  1JKJ B;  1VF6 C;  2HKO A;  2PY5 A;  4Q4C A;  2PBZ A;  3T9C A;  4ZI7 B;  1Z5W A;  2WPD G;  5BMV B;  2W71 A;  2NLJ C;  5EC1 C;  2PN1 A;  1ROP A;  2EIK B;  3SDL A;  2VRZ A;  1SER A;  4QE7 A;  1IBM B;  1RJQ A;  4X66 O;  5CB4 A;  4NXN H;  3ASO C;  1RYR A;  2C2E A;  3ZHT A;  2ZE8 A;  1G1X B;  2Q73 A;  1H8E G;  2R7K A;  4DO2 A;  4F6R A;  4XZ3 B;  4F4X A;  1GLV A;  2EBO A;  4FLX A;  5KFH A;  4JZG A;  2HG5 C;  1OBD A;  2X5R A;  5B5E Z;  2YZG A;  1Y74 A;  2PTM A;  2BQU A;  1IBK B;  4D7S A;  4MW8 A;  5KFK A;  1N8R W;  4DR2 O;  3KXY T;  3KCX A;  5C1O A;  2WLL A;  4JYY A;  1N33 H;  3MR6 A;  3HOY G;  4LF7 B;  1XNR B;  2YS8 A;  5KFZ A;  4JV0 A;  4ETS A;  3OTO H;  1SQV H;  3RUP A;  3TY9 A;  2YRW A;  2CTP A;  4RUE A;  4J9N A;  4JI2 B;  4LF8 H;  1JDB B;  5H80 A;  1XMO O;  3LWB A;  3I4N G;  3KHH A;  4B3R H;  4TQS A;  2QWP B;  4JI8 O;  4K35 A;  4ZQI A;  1G8M A;  3JAK B;  3JRX A;  4GLX A;  4DV2 O;  2I8C A;  3FMA A;  2HGW A;  5B1O A;  2N74 A;  4DR4 O;  1WA8 A;  4MV6 A;  4IYH A;  1IOW A;  3RF2 A;  2ZIN A;  1P7B A;  2A0L A;  4J9L A;  2XND G;  5LYJ B;  2Y0S A;  1F23 A;  3KG2 A;  3HO8 A;  1SQB H;  2EIL C;  3K06 A;  1ET0 A;  3WB0 A;  3ASO B;  4MTG A;  3JD2 A;  4GX0 A;  2R86 A;  4EB6 B;  3WNZ A;  1I3Q A;  4DV5 O;  3CCQ V;  5H6R A;  3QG5 A;  5KHK A;  2XCP A;  2XCA A;  1VQ6 V;  3AG2 B;  4JI3 B;  4DR7 O;  5KG7 A;  4RO2 A;  5KX5 B;  4DLK A;  2XC9 A;  4TSF G;  3CQZ A;  3RYH B;  4PD4 F;  1MMM A;  1E4E A;  1BXR A;  1V4Y A;  4LSX A;  1I94 O;  1VQN V;  2R7L A;  4JI4 O;  1KB9 F;  3T1H B;  1SZX A;  3CCL V;  1XMQ B;  1NTK H;  2Q4P A;  2NU7 B;  1KBH A;  4J7K A;  3ABK C;  1C3O A;  3JAR A;  1BQZ A;  4X1K B;  1Q6U A;  2R85 A;  4JI7 O;  1EYZ A;  3MD0 A;  4O4I B;  4ECV A;  3VQV A;  3T1Y H;  4N21 A;  2FKX A;  1BNC A;  4B3T H;  4JI1 O;  3W1B A;  4BW5 A;  2OTL V;  1ZSP A;  3H0G G;  5IYD O;  2DPJ A;  3SYO A;  2F23 A;  5LA6 F;  4ED0 A;  2WLM A;  1WAZ A;  5CA1 A;  1JCH A;  4ED3 A;  3F7V C;  2FYU H;  3W7T A;  2FPI B;  1XHX A;  2QA4 V;  2YID A;  1R3L C;  4LH7 A;  1FJG O;  4YHH H;  2EIL B;  4HZ3 A;  1JJ2 U;  5FD5 A;  2Q8V A;  2ZGI A;  5LOV F;  1PNK A;  4JTC B;  3TQ1 A;  2UVR A;  1N32 B;  2YZM A;  5H2F Z;  3Q4H A;  2YXL A;  2G38 A;  4RZR A;  4RZQ A;  3JAT B;  5IJ9 A;  2PUS A;  4JAS A;  5H9C A;  4D6T H;  3U55 A;  3HKD A;  2WB1 E;  5IP7 G;  3ABM C;  2ZM6 O;  2R8H A;  3HOW G;  4O7Y A;  1M0T A;  1VQP V;  3R5H A;  4R50 A;  3KCY A;  4QIW E;  2XGQ A;  4I9Q A;  3ABK B;  4LCU C;  3N8D A;  4HNA A;  4RB3 C;  3RN4 A;  4FM0 A;  4QWA A;  4GKK H;  3U9T A;  4LF4 H;  2BCC H;  3CCS V;  3HXL A;  2YW2 A;  3AW8 A;  3JSN A;  1QBZ A;  1F4M A;  4GC6 A;  5LA6 A;  5BR8 O;  2LO1 A;  2GTS A;  1UJW B;  2P5O A;  3AK1 A;  1V55 C;  4F4W A;  2P67 A;  4LP8 A;  3WO0 A;  4FFL A;  3RYI A;  5F2V O;  5I5X A;  1XL4 A;  2FTK A;  1B3Q A;  2IJJ A;  5A9G A;  3N44 B;  5LOV A;  4DV4 B;  4DIM A;  1OCO B;  4DRF A;  4U7O A;  4WBN B;  4I50 B;  4FLW A;  1IYD A;  1H2K A;  1N4C A;  5F9N A;  3H4D A;  4YQW A;  5E25 A;  1WB7 A;  1U97 A;  3H1I H;  4CC5 A;  4DV3 O;  1GYF A;  2UXD O;  4B3R B;  1I7L A;  4Q8E A;  4L8J A;  3TJT A;  4DV6 H;  1BS3 A;  4YJ3 F;  5KFT A;  2XTA A;  3E86 A;  3OMN B;  2ITD C;  2JRI A;  2RJZ A;  3ABM B;  1IBL B;  3O65 A;  1EKV A;  4RUA A;  3QWU A;  4DV0 O;  5KUM A;  2CH7 B;  4KHP O;  5LMN O;  1TWH A;  1T3N A;  1P4R A;  4RAY A;  4A3L G;  4Z2W A;  4LFC B;  3QO5 A;  3RAQ A;  1TVK B;  4TQD A;  3SPG A;  3PW4 A;  3C3S A;  3K0D A;  3FYE B;  1JOY A;  4HNT A;  5LXT B;  2NU9 B;  3F7Y C;  4LSA A;  1B04 A;  2A3Q A;  3E22 B;  3RBE A;  3JCU Z;  3N27 A;  1K92 A;  2ZXW C;  2UU9 H;  2BSK A;  1R3I C;  5JWP A;  4TV9 B;  1V55 B;  3HKE B;  4HBN A;  4O2B B;  2NNU A;  3PR4 A;  5EZY F;  2VQF H;  2RN9 A;  2ADP A;  3HOU G;  1R3K C;  4FBT A;  4FE2 A;  2C2A A;  3JAS A;  4TUY B;  3GTJ A;  3CPW U;  4L87 A;  3BA9 A;  5ITZ A;  1M0W A;  3SPH A;  4JYA O;  3JZF A;  3FB8 C;  4QPJ A;  1RM1 B;  1CPY A;  3BHP A;  3JAL A;  4QNH B;  5BWT A;  1P49 A;  4MTD A;  4YJ3 A;  4DUY O;  4RAZ A;  1I2K A;  1K7D A;  3LSS A;  2R7M A;  2XAJ A;  4FJC C;  4L1K A;  1YIT V;  1NS1 A;  4DR5 O;  5FL7 G;  2HGS A;  1V54 C;  1CXZ B;  3CCU V;  2ZNJ A;  3PR5 B;  4U7N A;  2OWO A;  4EGJ A;  4DAA A;  5J2U F;  2JA7 A;  2QGN A;  2WLI B;  3GB8 B;  1UPG A;  2Q7H A;  4J10 A;  3RGB A;  2XOK G;  3BJY A;  3RVY A;  2CNU A;  2ZDG A;  3AG1 C;  3DAA A;  5GON B;  2PI5 A;  4WFA V;  1KBL A;  5KG3 A;  4DR3 O;  4IWY A;  4UVC A;  3C90 A;  5IJ0 A;  1M7J A;  5DN6 G;  4FLV A;  4YY3 O;  5EZY A;  2ZDH A;  3CRM A;  2ZXW B;  1YTF B;  1I50 A;  2QWN B;  3GV8 B;  3G8D A;  3E8H A;  3RGX A;  3PW0 A;  3CME V;  4NLG A;  4NTY A;  5J2T B;  3ZN1 A;  4B3S O;  1SCU B;  2UUB B;  4GYC B;  2DMX A;  1GSO A;  5FR9 A;  3JZI A;  3TQT A;  4BY7 G;  3WG7 B;  4CC6 A;  4Z1M G;  2W7P A;  2UUA H;  3FD9 A;  3ORR A;  5HFM A;  1J95 A;  4JZ2 A;  4IGG A;  4JI4 H;  2XAG A;  3OEE G;  4CH6 A;  4ECU A;  5J2U A;  4Z1V A;  2FKL A;  4JTA B;  4F6R B;  1S0V A;  1WNS A;  4PI0 A;  4YIO A;  4NXM B;  4LF6 H;  4EYI B;  4ZI7 F;  1PNM A;  2ZIM A;  5BMV F;  4LFB H;  3HT5 A;  4JI7 H;  5D1P A;  2CGO A;  4QWC A;  3I12 A;  2QJ1 A;  3E8G A;  2GPW A;  2P90 A;  4Q44 A;  2R84 A;  4GC7 A;  3K5I A;  4JI1 H;  4JAA A;  1KT8 A;  1NU1 H;  1IBM O;  2I87 A;  1GM9 A;  3E8F A;  3AG1 B;  2E3C A;  2ITC C;  3NGD A;  1XOU A;  5KFX A;  4A3J G;  1HNZ O;  1GO3 E;  3C0F B;  2PVP A;  2WDT A;  5KG4 A;  2QKA A;  4MV7 A;  4Q8F A;  3G6X A;  3SPJ A;  4AHC A;  2PI4 A;  2R93 A;  1S5L Z;  3CC2 V;  5BZB A;  4FZ0 A;  2X6C A;  2ZDI C;  1IBK O;  1S0M A;  3SYQ A;  3LML A;  1TUB B;  2NVY A;  2R92 G;  3BQ0 A;  2EIJ C;  4ED6 A;  3RGZ A;  1H2G A;  1XNR O;  1W0K G;  4AQY H;  3L9D A;  4C7U A;  4PHZ A;  3GIM A;  1B33 N;  4CS4 A;  4K0K B;  2R8K A;  2F43 G;  4ZI7 A;  5BMV A;  3E2E A;  5HBR B;  1ZET A;  1S0O A;  3ORQ A;  2UU9 B;  3HOV G;  3DTG A;  3HKZ A;  5KFW A;  4FFO A;  1NT2 B;  5C93 A;  1XNQ H;  5LYJ F;  3JD1 A;  5EBW C;  3H40 A;  4NZN A;  1RJR A;  5LHH A;  4YXW G;  1VQ8 V;  4LMY A;  3CMA V;  2Q69 A;  4O7V A;  1A32 A;  5K1X A;  2A06 H;  3H1L H;  1J5E B;  1KJJ A;  3AX6 A;  2R9A A;  1JR9 A;  3MWD A;  2IM9 A;  2DAA A;  2GHY A;  2QTO A;  4HQ6 A;  1P8L A;  3M7M X;  4JI3 O;  2CKZ B;  5C8Y B;  3GTM A;  4B3M B;  1NJI W;  2BTO A;  3R66 A;  5JJN B;  5JH7 B;  3RFC A;  3CRC A;  3RV4 A;  3GIP A;  1GSA A;  3W5O A;  1QU7 A;  1LNQ A;  2EIJ B;  1QLE B;  2YXY A;  1EZV H;  1YJW V;  1HNX H;  3D36 C;  1WR2 A;  3JAK A;  2JS3 A;  1GM7 A;  4UV9 A;  2CZG A;  5E1A C;  5BWU A;  1MZE A;  5IDJ A;  1DV2 A;  1VF6 A;  5EWG A;  3KHG A;  1PL4 A;  4FU0 A;  4RNM A;  3TK1 A;  3MAQ A;  5LYJ A;  2CNQ A;  3QNE A;  1X9N A;  1M90 W;  2FK2 A;  4A3G G;  3D3I A;  2ZJT A;  4BIU A;  4DRX B;  1K9M W;  1YSC A;  1EKP A;  3Q4H B;  4EB6 A;  4X1Y B;  3L73 H;  4FVM A;  2HIV A;  3MDS A;  3BG5 A;  1PNL A;  1YDX A;  1DV1 A;  1AIL A;  1K83 A;  2QEX V;  1JMK C;  4CH3 A;  2QSA A;  2J9G A;  1YTF D;  2B1I A;  4JI0 O;  2FMA A;  5L3E A;  2V1D A;  4BIO A;  2UXC B;  5KFY A;  1RFY A;  4ECZ A;  4P30 A;  3V6J A;  4YR0 A;  5DMX A;  5L3B A;  5KFS A;  4UCV A;  1Z2P X;  2HG8 A;  2Z04 A;  4CS3 A;  2WLK A;  2R72 A;  1CKM A;  2Z5U A;  4X1K A;  2XIG A;  2OCH A;  1QR8 A;  1ZWI C;  1HNW B;  4LFB B;  1WP7 A;  3B2E E;  2ASD A;  4UCS A;  3X2Q C;  4APM A;  3BQ1 A;  1JVM A;  3RBD A;  2AHY A;  4R8C A;  2Y0S E;  4EEY A;  1PV0 A;  2LJ2 A;  5LOV B;  4GX5 A;  2B63 A;  2JA5 A;  1JXL A;  2VUG A;  4ZIB A;  4DK1 A;  1N36 O;  3Q1K A;  3CE2 A;  4O2A B;  3L75 H;  2W0F C;  2YI9 A;  2IBK A;  2COG A;  3LNM B;  1US6 A;  2YIA A;  3PJS K;  5KMG B;  5IT9 N;  3PZP A;  4PV1 B;  4G2K A;  1KJI A;  2HP8 A;  2PMZ A;  4DV4 O;  1IXB A;  3ETD A;  2HDK A;  3VNN A;  1FFT B;  3AG7 A;  4WBN F;  4FLY A;  4OXS A;  3MWM A;  5IYD G;  3JAT A;  1M57 C;  3F5W C;  1KTA A;  3OT7 A;  3ASN C;  3H1H H;  4X1I B;  2P0A A;  2OTJ V;  4ICG A;  1UFI A;  4WD3 A;  1FVI A;  3VPD A;  4MW3 A;  1IBL O;  1K5S A;  1X4T A;  3QVN A;  3IAY A;  4EBD A;  4FMT A;  2R8J A;  3GIJ A;  5TIS Z;  2DYR C;  4LFC O;  5T14 A;  5LXT F;  4DR6 H;  4NZO A;  4IAJ A;  3ZHQ A;  1BCC H;  1VQ7 V;  2Q2U A;  4TV9 F;  2R8G A;  1C30 A;  1WJZ A;  4O2B F;  4P9O A;  5LGU A;  3DSQ A;  2EIM C;  1MA1 A;  3A0R A;  4TUY F;  4WBN A;  2E76 B;  3WB1 A;  3MFI A;  4DV1 H;  4J9K A;  4O7W A;  1ZUQ A;  4JV1 A;  3ML0 A;  4A3D G;  5KT6 A;  2R87 A;  3B77 A;  3LSU A;  3P3N A;  2XHB A;  2NR5 A;  2DW4 A;  3ASN B;  4JUZ A;  1KKC A;  1ZHS A;  1Q81 W;  3JSL A;  3M9N B;  1G4Y B;  3OGI B;  1MNG A;  5IP9 G;  3PO3 G;  3VBB A;  3ETJ A;  1NTZ H;  2Q7E A;  3AK3 A;  1TVK A;  1D5A A;  4MVU A;  1M1K W;  1COW G;  5KFJ A;  2MW2 B;  3K58 A;  5LXT A;  4YAJ B;  4LF5 H;  1KC8 W;  2HHH O;  4RCN A;  3E22 A;  2YYA A;  3S24 A;  2DYR B;  5GON F;  2XCL A;  5B3S B;  3WO1 A;  4NYE A;  1GH6 A;  1N34 O;  2AGQ A;  1AP6 A;  5I60 A;  4RUF A;  5FLX N;  4MV9 A;  4TV9 A;  3CSW A;  3HKE A;  4O2B A;  2W8K A;  2FP4 B;  5JCO C;  3K9A A;  4R7R A;  4ZOL B;  1I0H A;  2E2I A;  3NBY B;  1SKV A;  2VS0 A;  4TUY A;  4PZ8 A;  5J2T F;  3GJX B;  3M99 B;  5LP6 C;  3BCC H;  5KFG A;  5B1B B;  1OCR C;  2AZ2 A;  3A2F A;  2JA7 G;  3C3T A;  4IL6 Z;  3CP1 A;  4C2M A;  5LHG A;  2WAM A;  1XEQ A;  1H2S B;  1QVG U;  1CKN A;  2JJ2 G;  3RR5 A;  3I4M G;  2EJ7 A;  4A3B G;  1TUE B;  2V5A A;  3TY5 A;  3CEB A;  5IY5 C;  3ZCC A;  4ZKI A;  2WLI A;  3ABL B;  1FKA H;  1AI7 A;  4PA9 A;  3GTP A;  1W2B U;  2EJR A;  2VR1 A;  1ARO P;  3MR5 A;  2GTA A;  4NXM O;  5KFO A;  4BW9 A;  2OT5 A;  4RAI A;  5GON A;  4J7Z A;  2YZN A;  4X88 A;  1BHA A;  4DW1 A;  4GT1 A;  2VPQ A;  4MTF A;  3SJC C;  2F4V H;  5BYB A;  1VAR A;  1H8H G;  4EFE A;  2EIN C;  2CK3 G;  1HR0 B;  3STZ C;  5BY1 A;  5J2T A;  3ZJZ A;  1Q6I A;  5I5U A;  1T36 A;  2JVD A;  1SRY A;  4QWE A;  3E89 A;  2ZE5 A;  2UXB H;  3N42 B;  4LR3 A;  4KUM A;  5LP6 B;  2E5L B;  2BR0 A;  2UXX A;  4FGR A;  4UB8 Z;  1VF7 A;  3GII A;  4CH4 A;  2CW8 A;  1OCR B;  4DV7 H;  5IT9 W;  1EZJ A;  5H6Q A;  4O7R A;  5KA5 A;  4EG0 A;  3EXA A;  5DLF A;  2DOS A;  1WCM A;  3K5M A;  1RPO A;  1QLN A;  3KHR A;  2GDS A;  3EPI A;  3U9S A;  1K1Q A;  1M56 C;  3K59 A;  1TWG A;  5IY5 B;  3B8M A;  2H94 A;  1YJN V;  3TXQ A;  2VQE H;  1FXK C;  2R93 G;  3P3P A;  3ZHS A;  4FLT A;  4ECY A;  2CTW A;  3OUS A;  4DL6 A;  2JIZ G;  2X0S A;  1FAF A;  1KUT A;  1N36 H;  2XAH A;  3OE7 G;  3EPG A;  2WA3 A;  1PD3 A;  1Q43 A;  4MVO A;  2EIN B;  3K5N A;  5DG9 A;  5IYB O;  3NUA A;  2KKW A;  3V6K A;  1J5E O;  4DR1 B;  5HNE A;  2CE4 A;  3R65 A;  1N56 A;  5BWX A;  4WHX A;  5C44 G;  4ECT A;  3EYY A;  1TUB A;  4B7K A;  5C8Y F;  1VQK V;  4UCR A;  3H20 A;  1DAA A;  4LF9 H;  1Y76 B;  4AIL C;  1RPR A;  5JH7 F;  4J42 A;  2DIK A;  1H38 A;  1R6T A;  1VF5 B;  4LFA B;  3IFX A;  1GN6 A;  3L72 H;  4FFP A;  4IT5 A;  4LF5 B;  3VPB A;  3R5F A;  2OCC C;  4HYK A;  3AK2 A;  4NB5 A;  2YRX A;  1O75 A;  3FKI A;  3ZRW B;  1AI5 A;  2YIB D;  4MA0 A;  1M56 B;  4JI5 B;  1E4F T;  2KSW A;  1I1L A;  3T4Z A;  3H3V H;  2XAQ A;  3F5T A;  1IDS A;  3ICX A;  4X62 B;  2F1M A;  4NR1 A;  1FFX A;  2BQR A;  1BZK A;  4A93 G;  1FXK B;  2DQ0 A;  4Q43 A;  4KP4 A;  1YZB A;  1M6V A;  4GKJ B;  3J81 N;  2EUL A;  2JGD B;  1XQ8 A;  4O7S A;  4J0M A;  4IRD A;  3GIQ A;  3P32 A;  1I1K A;  4IYI A;  3JRW A;  1T5E A;  3MFH A;  1Y4M A;  1AR1 B;  3TIG A;  5LMU H;  5C8Y A;  4K6N A;  4MS2 A;  5BPF A;  5FLX W;  5FPO A;  3UT5 B;  4RQE A;  3RYC B;  5KFN A;  2ZDI A;  5JH7 A;  4FK5 C;  2IA6 A;  3TEK A;  1SZT A;  4MTE A;  2WSS G;  1SEI A;  2YL2 A;  4UUG A;  2W6I G;  3G6B A;  4YP3 A;  4OX9 B;  4FFN A;  1EUD B;  3HR0 A;  5KFB A;  3HKZ E;  1WN7 A;  3ETE A;  1GTO A;  3STL C;  2M05 A;  2Q0O C;  4O3Q A;  3K3P A;  5IWA B;  3CVZ A;  1MOF A;  2DLN A;  4KFM A;  4DRX A;  2BQ3 A;  4O2A F;  5D5Q A;  3SPI A;  3ZRV A;  2ATL A;  4X1Y A;  1Q90 D;  3NBZ B;  3I55 V;  4UCT A;  1VIB A;  2LGQ A;  5DGA A;  1N34 H;  2IJK A;  4UUJ C;  3W7S A;  5DM6 V;  3MJF A;  5KG0 A;  2UUC H;  3WU2 Z;  3RB6 A;  3GTO A;  1VBH A;  4DV7 B;  1R9T A;  2HVK C;  4TT3 G;  5EYP B;  4K8X A;  2ODT X;  4GUN A;  4NXN B;  1MAB G;  1Z5V A;  2B63 G;  4W4L A;  3JAM N;  1X59 A;  2W7O A;  2ILM A;  3JD4 A;  2NU6 B;  1GRJ A;  2BE3 A;  4QW8 A;  1XIL A;  4FPP A;  1GM8 A;  2WLJ A;  4MV1 A;  1R3J C;  3D36 A;  3GB7 C;  2KG7 A;  4HAM A;  3SYP A;  2VQE B;  3FKS G;  2M6Y A;  4H13 B;  4WFB V;  1N33 B;  2J6U A;  1AP5 A;  4IRK A;  3IC9 A;  4CKB A;  3VOT A;  4O2A A;  1DIK A;  4PDM A;  3OTO B;  3JAW B;  2HFE C;  5F9L A;  5KMG A;  4JPR A;  3T5L A;  3K57 A;  4LF8 B;  1S0N A;  2NN4 A;  5KFQ A;  2LW7 A;  1AR5 A;  2PGG A;  3LQS A;  2JEJ A;  2Q6A A;  3GTK A;  1KP3 A;  3OUU A;  1I7N A;  5KHH A;  3LUL A;  1JX4 A;  1V51 A;  3MHH C;  4O84 A;  1S5H C;  4JV5 O;  4JI6 H;  2X7R B;  2R82 A;  5EWF A;  4X1I A;  3G71 V;  2VUM A;  1W93 A;  4LWS B;  1I5Y A;  1K33 A;  3APQ A;  1WPX A;  1S76 D;  3RV3 A;  4ZHQ F;  3UM7 A;  3HPL C;  1KP2 A;  1A0G A;  2NU8 B;  4J9Y B;  1AR4 A;  4JF3 A;  2PYL A;  4X66 H;  3L4K A;  1RSO A;  1UNN C;  5DG8 A;  2IP4 A;  1GN4 A;  3U0Z A;  4AYB A;  5L1L A;  5B1N A;  3O9O A;  3GWK C;  1YJ9 V;  2AW9 A;  1R6K A;  3RFR A;  5DQH A;  1ZTE A;  3ZMU A;  5I5T A;  2EZO A;  1B6S A;  4Y8V B;  3QFF A;  2WLN A;  2WA4 A;  4Q20 A;  4UFZ A;  3A0H Z;  4X65 O;  2KB1 A;  4X9Q A;  2PMZ E;  5JQG B;  1R73 A;  4FFR A;  3T1Y B;  1VQO V;  4DR2 H;  4I9W A;  2PZS A;  4ZOL F;  4PA6 A;  1CKN B;  4B3T B;  5KUK A;  4UVB A;  4DL3 A;  4O4L B;  1VQL V;  3UZO A;  5KFI A;  2WAQ A;  3V4Z A;  4TOI A;  5KG1 A;  2JEI A;  2A9H A;  4DYL A;  3R23 A;  3BFR A;  3ABU A;  1XMO H;  1OCZ C;  4JI8 H;  3OMA B;  4I0X B;  1DF4 A;  4OPA A;  3J81 W;  5CM0 A;  4C5A A;  1YVW A;  4YHH B;  4ZHQ A;  2SCU B;  4BBS G;  4DV2 H;  3LDC A;  3HOX G;  4YJ2 B;  4DR4 H;  2W9C B;  1XDC A;  4J11 A;  4YR2 A;  4QE9 A;  2YIB A;  1QHT A;  1IYE A;  4C5C A;  3G67 A;  1YCI A;  4Q45 A;  4X64 O;  2EX3 A;  1CE8 A;  1Y1W A;  4ECW A;  4GLW A;  4CKE A;  4DUZ O;  4DV5 H;  2DYS C;  1Q86 W;  3BEH A;  3B09 A;  5KFU A;  5A2Q N;  4G3I A;  2YUA A;  4HN2 A;  4DR7 H;  1OWT A;  3T99 A;  1O9G A;  4ZOL A;  4YIP A;  4GKK B;  1NVP B;  1I94 H;  4XYL B;  4LF4 B;  2DWC A;  1L0L H;  1HR0 O;  4P9P A;  4B08 A;  2WTF A;  3SI8 A;  3H1J H;  1BQ0 A;  1Y1V A;  1BL8 A;  1V54 B;  3OUF A;  2K9P A;  1A9X A;  1AJN A;  1SS3 A;  4O3S A;  5LP6 F;  4O7T A;  3CJH B;  2E5L O;  3FX7 A;  1KC7 A;  2Y0P A;  3K79 A;  4ASU G;  2Q5Z A;  2L6L A;  3QZ7 A;  1YIJ V;  2CTQ A;  2NUA B;  3GTG A;  2C28 A;  3WFV A;  1WSC A;  3M9O B;  4P2Z A;  2CFM A;  1S97 A;  2JA6 A;  4C5B A;  2R6F A;  4DXW A;  2B9Z A;  1FJG H;  3JAM W;  5KAF Z;  5EOY A;  2CNV A;  1VEW A;  4DV6 B;  3ZS8 C;  1K97 A;  2DYS B;  1XBL A;  1S03 G;  3VQY A;  1IZ3 A;  1M4U A;  4LF7 O;  2UXN A;  5JCO A;  3SJB C;  4TQR A;  1JJO A;  4E6N A;  4LNU B;  1WCM G;  3K5L A;  2ZM6 H;  1MSW D;  4JI2 O;  3QZ8 A;  5LP6 A;  4BR6 A;  3EHB B;  2YS7 A;  3FAV B;  3ZHU A;  4WFF A;  4PJ0 Z;  1I08 A;  1P84 F;  1JX9 A;  2IW5 A;  2RGV A;  5DGI A;  3W1G A;  4BAY A;  3SR2 C;  1FFX B;  2VQF B;  4O4J B;  3GQC A;  5BR8 H;  2GV9 A;  1EM1 A;  4LFA O;  4I4T B;  2MCT A;  4RU9 A;  1S72 V;  3R9R A;  2QR4 A;  3RYF B;  1S77 D;  4TWK A;  5BWV A;  3GV5 B;  2B5U A;  5IE9 A;  2Z02 A;  4DQN A;  4G28 B;  2V4R A;  4CZZ A;  3OMI B;  4X62 O;  5KFP A;  4NYK A;  3BAC A;  2YXH A;  3CXH F;  3T1H O;  3S3W A;  1XMQ O;  4X20 A;  4GKJ O;  4DV3 H;  1R1B A;  1DLB A;  2UXD H;  5DGH A;  3OM3 B;  3VOU A;  2CQY A;  4RB2 C;  1BSM A;  3QO7 A;  2JJ1 G;  4MV3 A;  2QB5 A;  1PM9 A;  4JXU A;  3RTX A;  1SYX B;  2W70 A;  3FKI G;  1GMG A;  1WP8 A;  2QM4 A;  1Y76 A;  4X8A A;  4JV5 H;  4DV0 H;  2VWK A;  3DTF A;  4KHP H;  5LMN H;  1YI2 V;  5CMU A;  1DGS A;  2GQR A;  1PPJ H;  3OGC C;  4J80 A;  1YXB A;  1FYJ A;  3L74 H;  2QWO B;  1XHZ A;  1AVM A;  2A7W A;  5IYB G;  4OX9 O;  1HDJ A;  2W6J G;  3W7X A;  3ZRW A;  3N6R A;  2D2C B;  4FLU A;  4DR7 B;  2BTQ B;  4JAU A;  1KKD A;  4XBF A;  3T5J A;  2UUA B;  3WB2 A;  3LDE A;  2CAZ C;  5LL6 Y;  1FXK A;  5IWA O;  1UC8 A;  2FE3 A;  4JI4 B;  1N32 O;  1T94 A;  4JYA H;  5DLG A;  1DK1 A;  2Y4R A;  2UVW A;  4BY1 G;  2JGD A;  5KFA A;  2HJW A;  4LF6 B;  2JEX A;  3BQ2 A;  4X65 H;  4J9M A;  3RB3 A;  5B66 Z;  3ABT A;  4DUY H;  3KAK A;  1ZAU A;  3FFQ A;  1Q7Y W;  4JI7 B;  2KG7 B;  5A2Q W;  4PWQ A;  5DQI A;  2ARH A;  2R9I A;  4JGS A;  4PDV A;  4JI1 B;  2P4V A;  3UT5 A;  4MVS A;  3RYC A;  3N40 P;  3Q8R B;  4DR5 H;  1HWY A;  1WPB A;  4NXN O;  1A48 A;  3ZED A;  5CA0 B;  2X6B A;  4ECX A;  3E8B A;  2VPS A;  3GV7 B;  1EN6 A;  3T1C A;  3RWR D;  1OJH A;  1TA8 A;  4DR3 H;  2MK3 A;  4U6P A;  2ZKO A;  1A0I A;  4WFE A;  4YY3 H;  2ZR2 A;  2UVU A;  3T9D A;  1LR1 A;  5BXZ A;  4ED1 A;  2C35 B;  1EN4 A;  5CA3 A;  1N33 O;  3CRQ A;  4F4Z A;  1N0J A;  2YWV A;  2FB5 A;  4DUZ H;  1VBG A;  3I56 V;  2Y0I A;  4AQY B;  4B3S H;  2ALZ A;  1M93 A;  3OTO O;  1AUX A;  3PW7 A;  3CCE V;  3ETH A;  3FB5 C;  3CSX A;  2ZM6 B;  3GLK A;  4LF8 O;  1VQ5 V;  4B3R O;  3U0G A;  1SQF A;  1AJQ A;  2UVV A;  3T9A A;  2FL4 A;  1KJQ A;  1HW7 A;  1RSO B;  3N2K A;  5EYP A;  2HVR A;  2JEG A;  2BOC C;  3X2Q B;  2H3O A;  1XNQ B;  5D1O B;  2R70 A;  1FD9 A;  3SJQ C;  1MZF A;  4DL5 A;  3IC7 A;  1P7G A;  1PK8 A;  2ETN A;  1OV9 A;  4FM9 A;  2FPG B;  2PF4 E;  5BR8 B;  2CDY A;  5L1K A;  3H1K H;  3T5H A;  1MSD A;  4A3K G;  4OGQ B;  4QJF B;  3IJ4 A;  2CTR A;  4IHJ F;  1IBM H;  5FJ8 G;  2JS5 A;  3K03 A;  1JLL B;  5CBG A;  3IN5 A;  2W8L A;  2Q7D A;  1ZX3 A;  3QTC A;  3L2P A;  1I6U A;  1EBO A;  2DQ3 A;  4U3F H;  1HNZ H;  1XI1 A;  3JAW A;  5JVD B;  4FLZ A;  2QF7 A;  2RNB A;  1GKF A;  2LFS A;  4DV3 B;  2HIX A;  1Q3E A;  1HNX B;  2VUM G;  3CRA A;  1M57 B;  3CB2 A;  5JQG F;  2WWW A;  4JTD B;  2OLS A;  5KFR A;  3NR7 A;  4ZHQ B;  1IBK H;  1EFR G;  5KLV H;  3TW7 A;  3T1Y O;  2W6Z A;  4O4L F;  3JZ6 A;  2YI8 A;  5HFL A;  3ZMS A;  4LF7 H;  2JK5 C;  1XNR H;  5FPR A;  1GSH A;  4UB6 Z;  2XAF A;  4EYH B;  2GBO A;  4LWS A;  5DED A;  4JI2 H;  4M7E A;  1D5N A;  5LL6 b;  4MTX A;  3M9M B;  4R7C A;  2W6P A;  4YJ2 F;  1EUC B;  4YHH O;  2ASJ A;  2AGP A;  4IHJ A;  3Q8S B;  4XDK A;  1AI4 A;  1KD1 W;  1WLE A;  4TM5 A;  3U54 A;  1IUR A;  1XK5 A;  3Q2O A;  2FML A;  2WE6 A;  2QWQ B;  2YC0 A;  2V58 A;  3PFF A;  2EIM B;  3J7A K;  4A3M G;  4MTO A;  2UUB O;  3D8C A;  2FK3 A;  3K9S A;  1M9N A;  2Q9L A;  5JQG A;  4IR9 A;  2RCV A;  4O86 A;  4QW9 A;  4JI3 H;  1BMF G;  1S10 A;  4O4L A;  1URF A;  4EKW A;  3UO2 A;  4BXX G;  3I5D A;  3NC0 B;  4NTW A;  1SES A;  4LF4 O;  2CUG A;  4N23 A;  4CBC A;  4FFB B;  3T1H H;  1E1Q G;  4QSH A;  1XMQ H;  4PI2 A;  4YR3 A;  4I55 B;  4LBE C;  4M9U A;  1Y1W G;  4I0X A;  2B1G A;  4FZ1 A;  1TWA A;  2Q67 A;  2RF4 A;  3V6H A;  1P16 A;  2L35 A;  4Q4D A;  4YJ2 A;  2VA3 A;  2W9C A;  4ME6 A;  4A5U B;  1ZL8 B;  4F4L A;  1A3G A;  2W6Q A;  4RB1 A;  1M5I A;  1W59 A;  3OW2 U;  3SE7 A;  2NVX A;  3A0B Z;  1SA0 B;  4Q0Y A;  1ZLZ A;  4YY3 B;  2M7W A;  2HJD A;  3IGA C;  3NXS A;  1S9F A;  3U10 A;  1H2L A;  4B3S B;  2V9W A;  3EFF K;  5IYC O;  3HKB B;  3N41 B;  2J6S A;  4PA4 A;  5L1I A;  4A3E G;  4JI0 H;  1L0N H;  4JV2 A;  4DV6 O;  4RUC A;  4J9P A;  3T9F A;  3OR6 C;  4PDL A;  3IG0 A;  1SET A;  4UVA A;  2ZR3 A;  4AI8 A;  2ZDQ A;  2AQ4 A;  4ECS A;  3B40 A;  5EK0 A;  4U3J B;  4DL2 A;  3D3Q A;  3JCZ A;  5JJJ B;  4GCZ A;  5GTH Z;  3ZIA G;  1OHH G;  4DR6 B;  4K0K O;  1B6Q A;  5LBQ A;  1XDN A;  2Q0A A;  3CJH A;  4UXN A;  4J9Q A;  3ZHV A;  2HLD G;  3CCV V;  1K3E A;  2R92 A;  2UU9 O;  1XL6 A;  5L3C A;  2A1H A;  5CR5 A;  5K2M A;  4O4J F;  2VQF O;  2R7Z A;  1D2D A;  4DV1 B;  3EVK A;  4I4T F;  1HNZ B;  3WWJ A;  2HGX A;  5KG2 A;  4CE5 A;  1BE3 H;  3OTF A;  4X20 B;  3AG2 C;  5KG6 A;  2FLP A;  4E4T A;  2ZCE A;  2XUM A;  3CWB H;  3ZN0 A;  4A3F G;  5IYZ B;  2HVS A;  5KA6 A;  4ECR A;  4DV4 H;  4OPH A;  3BAA A;  1IX9 A;  3MHS C;  2HR3 A;  4WF9 V;  4B3M O;  4A3C G;  1JFF A;  3G80 A;  4A2A A;  3K08 A;  4TV8 B;  3UFX B;  4LNU A;  4F4Y A;  5LHI A;  3CC7 V;  3KRE A;  3FAV A;  1QQC A;  1XRE A;  1THZ A;  1K34 A;  2Q7G A;  2Y48 A;  3OHA A;  3GTL A;  2OIE A;  1IBL H;  2QKS A;  3DGE A;  5KT3 A;  2IU0 A;  1OZ0 A;  1QCE A;  3APO A;  2A79 B;  1TGO A;  4O4J A;  2C00 A;  1GN3 A;  3VQX A;  4LFC H;  5H5N A;  3N2G B;  1GGO A;  4O7Z A;  3P30 A;  5BPH A;  4I4T A;  4CMD A;  2V4D A;  5CA1 F;  2GUZ B;  3BVO A;  2EIY A;  5L3G A;  1KJ8 A;  2F95 B;  3RYF A;  3G6Y A;  1BHB A;  1Z2O X;  4K8Z A;  1PX2 A;  2UXC O;  2UUA O;  3VA7 A;  5JUM A;  2Q2T A;  3GIK A;  1G2W A;  1VQ4 V;  1AJP A;  2COJ A;  2BOB C;  1NKD A;  3LNN A;  4FFM A;  1LUV A;  2Y4U A;  2C2R A;  3T54 A;  4LF6 O;  5GW7 A;  1NI8 A;  3OEH G;  1LUW A;  1HNW O;  4LFB O;  3DF7 A;  4RNN A;  3QF7 A;  1GAX A;  4MV4 A;  2OCC B;  4U7C A;  2F4V B;  4M0J A;  5K3W A;  1SQG A;  2YEV B;  5KT2 A;  4RNO A;  1L1F A;  5CA0 F;  3WWH A;  1QNM A;  5KT5 A;  1S68 A;  2QTS A;  3T9E A;  2W9B A;  3BA8 A;  3T2M A;  2HHH H;  3RIZ A;  1H2N A;  1ORQ C;  2WLH A;  3K5H A;  5CN0 A;  4CS2 A;  5I5S A;  2UXB B;  2QKC A;  2BTQ A;  4LC1 A;  3E5N A;  4QWB A;  1OCO C;  5B1A C;  4CH5 A;  4EFB A;  5K1P A;  4JI0 B;  4G27 B;  4B7E A;  3OAA G;  5KFV A;  4J9R A;  3N2K B;  3CRR A;  2ZNI A;  3KTM A;  3PW5 A;  3G6V A;  2JA5 G;  1Y6X A;  4XYM B;  4K3A A;  4AQY O;  5BWW A;  4I5S A;  2IJI A;  2QWR B;  2UUB H;  3ZMT A;  3BPZ A;  1YHQ V;  1E1R G;  4O4H B;  4I7H A;  4J41 A;  3PW2 A;  3JD0 A;  2ZT9 B;  3JYC A;  1JIH A;  2JDI G;  4DL4 A;  1RK6 A;  3BY6 A;  1F4N A;  3THO A;  4IIJ F;  1GN2 A;  2IJH A;  5CA0 A;  1SF9 A;  4H44 B;  1N36 B;  3RAX A;  4R8U B;  3PVX A;  4PA7 A;  1XNQ O;  3BRC A;  5EIB C;  3HB3 B;  2JEF A;  3VQW A;  1VP7 A;  4NXM H;  1KEE A;  1DF5 A;  4TVI A;  4J9O A;  2ASL A;  3CS5 A;  1YF2 A;  4KXR A;  2EJ3 A;  5C1P A;  5KT7 A;  5E79 Z;  1AI6 A;  4ECQ A;  3DXR B;  1TAE A;  3MWE A;  4LF9 B;  5CBF A;  5C3E G;  1K4C C;  3RBZ A;  5B1A B;  3HB9 A;  2DPI A;  1RM1 C;  4ED8 A;  5JVD F;  4EBC A;  1SC5 B;  1ZQ7 A;  2ZE7 A;  2QYZ A;  4I7Z B;  5KHI A;  4NVP A;  5GTI Z;  2Q68 A;  5EWE A;  1HNX O;  2WYO A;  1JDE A;  5EBM C;  4HR7 A;  3H9V A;  4E2L A;  4IHJ B;  4IIJ A;  4IZO A;  4MT8 A;  5D1O A;  1OBG A;  4EQ5 A;  2DE0 X;  2JEU A;  2P6J A; 
#chains in the Genus database with same CATH homology
 4GLX A;  3FMA A;  3GDE A;  4K0K H;  3RF2 A;  2F93 B;  2ZIN A;  4DK0 A;  2XHB A;  3L4J A;  5LYJ B;  1ZHS A;  3JSL A;  4X20 A;  3WB0 A;  4DV3 H;  5LMU B;  2UXD H;  4EB6 B;  4RB2 C;  3QG5 A;  5KHK A;  2PYJ A;  2Q7E A;  1TVK A;  5JVD A;  1D5A A;  3RTX A;  4JI3 B;  1SYX B;  3HKC A;  3K58 A;  5KX5 B;  5LXT A;  4LF5 H;  4JV5 H;  2QM4 A;  4EEQ A;  3RYH B;  2VWK A;  4DV0 H;  1J5E H;  5LMN H;  2RGR A;  3E22 A;  4KHP H;  3S24 A;  3BAB A;  4D7T A;  4LSX A;  1DGS A;  3T1H B;  3KAJ A;  1XMQ B;  4MV9 A;  4TV9 A;  3HKE A;  4O2B A;  4UCO A;  5JCO C;  4TQF A;  4R7R A;  1XHZ A;  4B3M H;  4ZOL B;  3JAR A;  3NBY B;  4X1K B;  1E4G T;  1SKV A;  4TUY A;  4PZ8 A;  1BGW A;  4O4I B;  4FLU A;  3VQV A;  3GJX B;  3T1Y H;  4DR7 B;  2BTQ B;  5LP6 C;  4B3T H;  2HHH B;  2UUA B;  3WB2 A;  3A2F A;  2CAZ C;  3W1B A;  3U11 A;  2FE3 A;  4JI4 B;  1N34 B;  5FNV A;  4JYA H;  1H2S B;  2UUC B;  5CA1 A;  1CKN A;  2F66 C;  5FD6 A;  3RR5 A;  4LF6 B;  1XHX A;  4X65 H;  4LH7 A;  4YHH H;  4DUY H;  3KAK A;  1ZAU A;  3FFQ A;  4JI7 B;  3TY5 A;  5FD5 A;  3N43 B;  1FKA H;  5A2Q W;  3N40 P;  4JI1 B;  2HEP A;  3UT5 A;  1CKO A;  4DR5 H;  3RYC A;  1WPB A;  4BW9 A;  5GON A;  3ZED A;  5CA0 B;  1N32 B;  1O9H A;  2VPS A;  2YXL A;  2VWJ A;  2F4V H;  3SJC C;  4RZQ A;  2P22 C;  3JAT B;  5IJ9 A;  2UXC H;  2PUS A;  4EFE A;  3HKD A;  3RWR D;  5CB4 B;  4FFB A;  1M0T A;  1HR0 B;  1TA8 A;  5J2T A;  4I9Q A;  4I55 A;  4DR3 H;  4HNA A;  3N6X A;  1A0I A;  4RB3 C;  2JVD A;  4FM0 A;  4YY3 H;  4GKK H;  4LF4 H;  1HNW H;  3HXL A;  2UXB H;  3N42 B;  4LR3 A;  5LP6 B;  2E5L B;  4DUZ H;  3JSN A;  1VF7 A;  4CH4 A;  1SA0 A;  5LA6 A;  4AQY B;  2CW8 A;  4B3S H;  4DV7 H;  5IT9 W;  1M93 A;  3K5O A;  3CSX A;  2ZM6 B;  2P5O A;  4JI6 B;  1SQF A;  1JFF B;  3RYI A;  3K5M A;  1HW7 A;  3N44 B;  2HVR A;  3N2K A;  5EYP A;  5LOV A;  3K59 A;  4DV4 B;  3HKB A;  3TY8 A;  1XNQ B;  5D1O B;  2R70 A;  4DRF A;  1BJT A;  5JJE B;  4WBN B;  4FM9 A;  4I50 B;  2VQE H;  4FLW A;  5BR8 B;  4X66 B;  4FLT A;  1YEW A;  4A2B A;  4CC5 A;  1N36 H;  1GYF A;  1Z2N X;  4B3R B;  1KU9 A;  4L8J A;  4DV6 H;  4U3J A;  1I7F A;  1Q43 A;  1IBM H;  2JS5 A;  2RJZ A;  1IBL B;  3K5N A;  2ZIO A;  2KKW A;  3QTC A;  3QWU A;  3L2P A;  1I6U A;  4DR1 B;  4RAY A;  1HNZ H;  4LFC B;  3SJA C;  3JAW A;  1XI1 A;  1TVK B;  5JVD B;  4TQD A;  3EYY A;  1TUB A;  4DR2 B;  4FLZ A;  4UCR A;  4LSA A;  2HIX A;  4DV3 B;  5LXT B;  3H20 A;  4LF9 H;  1Q3E A;  1B04 A;  1HNX B;  4AIL C;  3CB2 A;  3E22 B;  1MZB A;  4ZHQ B;  4LFA B;  1IBK H;  2UU9 H;  5EIB D;  4TV9 B;  3HKE B;  4HBN A;  4O2B B;  1ZHQ A;  1XMO B;  4LF5 B;  2YI8 A;  4LF7 H;  4JI8 B;  2VQF H;  3KAL A;  1XNR H;  5FPR A;  3JAR B;  1O75 A;  5IYZ A;  3M4I A;  2YIB D;  1S5J A;  3JAS A;  4TUY B;  4JI5 B;  4DV2 B;  1E4F T;  2KSW A;  3BA9 A;  4DR4 B;  5ITZ A;  1M0W A;  3ICX A;  4JI2 H;  4X62 B;  4M7E A;  2F1M A;  2HVQ A;  4BWA A;  3BHP A;  3JAL A;  3F8N A;  1FFX A;  1P49 A;  5LL6 b;  4TV8 A;  4MTD A;  4YJ3 A;  4IHJ A;  4RAZ A;  2O03 A;  4GKJ B;  1L8D A;  5CA1 B;  4DV5 B;  1XK5 A;  1XQ8 A;  4J0M A;  2HGS A;  2WE6 A;  2ZNJ A;  2W57 A;  2OWO A;  1T5E A;  5LMU H;  3GB8 B;  5C8Y A;  3J7A K;  2Q7H A;  3RGB A;  5FLX W;  5FPO A;  3UT5 B;  3RYC B;  1I94 B;  3N2G A;  1G6U A;  5JH7 A;  5JQG A;  5KHJ A;  5GON B;  4JI3 H;  4MTE A;  1SEI A;  1L2Z A;  4O4L A;  5IJ0 A;  4BWS C;  4FLV A;  4OX9 B;  5IJ9 B;  4PZ6 A;  5EZY A;  3NC0 B;  3HKD B;  4KL1 A;  1WN7 A;  4FFB B;  3RGX A;  3T1H H;  1XMQ H;  4PI2 A;  5KX5 A;  5J2T B;  4I55 B;  3RYH A;  4HNA B;  5IWA B;  2UUB B;  3CVZ A;  4GYC B;  1P16 A;  4DRX A;  4YJ2 A;  5D5Q A;  4UCU A;  4RB1 A;  1M5I A;  4X1Y A;  4CC6 A;  2UUA H;  1SA0 B;  5LA6 B;  3NBZ B;  4Q0Y A;  3KYH C;  4UCT A;  4YY3 B;  1FJG B;  2OYQ A;  4JI4 H;  1N34 H;  4O4I A;  4CH6 A;  1VS0 A;  3RYI B;  2UUC H;  5J2U A;  3U10 A;  4B3S B;  4F6R B;  4LF6 H;  1WNS A;  4PI0 A;  4DV7 B;  4NXM B;  4X64 H;  5EYP B;  4K8X A;  2ZIM A;  4LFB H;  4NXN B;  3HKB B;  4JI7 H;  5D1P A;  3N41 B;  2QJ1 A;  4JI0 H;  1Z5V A;  1WH2 A;  4JI1 H;  3IG0 A;  2E3C A;  3PN1 A;  4U3J B;  5JJJ B;  3C0F B;  2VQE B;  2WDT A;  4DR6 B;  4MV7 A;  1HR0 H;  4IIJ B;  4AHC A;  1N33 B;  2Q0A A;  1XDN A;  4O2A A;  3SGI A;  1V9P A;  3OTO B;  3JAW B;  3LML A;  4O4H A;  1TUB B;  3RJ0 A;  5KMG A;  3K57 A;  4LF8 B;  2E5L H;  2PGG A;  3RGZ A;  4AQY H;  5KHH A;  4DV1 B;  1HNZ B;  4PHZ A;  3OTF A;  4X20 B;  5D5P A;  4CS4 A;  4FM2 A;  4K0K B;  4JI6 H;  4ZI7 A;  5BMV A;  2ZCE A;  5IYZ B;  2HVS A;  3JAS B;  4X1I A;  2UU9 B;  4DV4 H;  5ITZ B;  3HKC B;  3BAA A;  1NT2 B;  2UXD B;  1XNQ H;  3JAL B;  1JFF A;  4A2A A;  2RQ6 A;  4TV8 B;  2PYL A;  4YJ3 B;  4LNU A;  4X66 H;  3L4K A;  4LMY A;  1RSO A;  4JV5 B;  5K1X A;  4DV0 B;  3U0Z A;  1QQC A;  1J5E B;  5LMN B;  4KHP B;  1AN7 A;  2R9A A;  4I50 A;  2Q7G A;  3RFR A;  2IM9 A;  1IBL H;  1P8L A;  3M7M X;  4FM1 A;  4LH6 A;  5C8Y B;  4B3M B;  1TGO A;  2BTO A;  4UFZ A;  4DR1 H;  4O4J A;  3VQX A;  4LFC H;  3N2G B;  5JJN B;  5JH7 B;  5JQG B;  3CHX A;  4I4T A;  2V4D A;  5FNV B;  3T1Y B;  4DR2 H;  2PZS A;  3W5O A;  1CKN B;  4B3T B;  1HNX H;  4O4L B;  5IJ0 B;  2YCH A;  3JAK A;  2F95 B;  3RYF A;  5EZY B;  4LFA H;  4TOI A;  1Z2O X;  4JYA B;  1XMO H;  4K8Z A;  3MAQ A;  4JI8 H;  5LYJ A;  4X65 B;  1X9N A;  3J81 W;  2Q2T A;  4YHH B;  4ZHQ A;  4DUY B;  4DV2 H;  4JI5 H;  2ZJT A;  4DRX B;  4YJ2 B;  4DR4 H;  3LNN A;  4X62 H;  4EB6 A;  2YIB A;  1QHT A;  4X1Y B;  4DR5 B;  4FVM A;  2HIV A;  3K3V A;  2EX3 A;  3DF7 A;  1JMK C;  3QF7 A;  4PZ7 A;  4GKJ H;  4CH3 A;  4DV5 H;  5J2U B;  2F4V B;  2UXC B;  1SQG A;  3UQ8 A;  4UCV A;  4DR7 H;  1S68 A;  2CW7 A;  1Z2P X;  4DR3 B;  3BA8 A;  4RB0 A;  4CS3 A;  2HHH H;  1O9G A;  4ZOL A;  2R72 A;  1CKM A;  3RIZ A;  4Q6G A;  4GKK B;  2JGU A;  4X1K A;  1I94 H;  2XIG A;  4X64 B;  4LF4 B;  1HNW B;  4LFB B;  4CS2 A;  2UXB B;  3B2E E;  2BTQ A;  4B08 A;  4UCS A;  5KHG A;  4DUZ B;  4CH5 A;  4EFB A;  4JI0 B;  5K1P A;  4APM A;  4OX9 H;  5DIS C;  3N2K B;  5LOV B;  2VUG A;  4ZIB A;  2ZNI A;  4DK1 A;  2VOB A;  4O2A B;  2YI9 A;  5IWA H;  2UUB H;  3BPZ A;  3ETQ A;  2YIA A;  2CFM A;  4O4H B;  1N32 H;  5KMG B;  4I7H A;  3J80 W;  1Q5O A;  4PDB A;  1KMI Z;  1FJG H;  3THO A;  3JAM W;  1Q8I A;  5CA0 A;  2PY5 A;  1N36 B;  3VNN A;  5EOY A;  4ZI7 B;  1Z5W A;  5BMV B;  3BRC A;  4DV6 B;  4FLY A;  3ZS8 C;  3MWM A;  3JAT A;  5EIB C;  3VQW A;  1S03 G;  1IBM B;  4NXM H;  4X1I B;  5CB4 A;  3VQY A;  4NXN H;  1M4U A;  5JCO A;  3SJB C;  4DV1 H;  1FVI A;  1JJO A;  4E6N A;  4F6R A;  4LNU B;  1TAE A;  3K5L A;  2ZM6 H;  4FLX A;  1X4T A;  4LF9 B;  5LP6 A;  3IAY A;  2PTM A;  1IBK B;  2RGV A;  4D7S A;  4DR6 H;  3KXY T;  5KHI A;  3W1G A;  4NVP A;  1N33 H;  4IAJ A;  4LF7 B;  3SR2 C;  1FFX B;  2VQF B;  1XNR B;  2WYO A;  2Q2U A;  4O4J B;  4ETS A;  5BR8 H;  3OTO H;  2GV9 A;  4IHJ B;  3TY9 A;  4I4T B;  2MCT A;  4JI2 B;  4IIJ A;  4LF8 H;  4B3R H;  5D1O A;  3DSQ A;  4EQ5 A;  4WBN A;  3WB1 A;  3JAK B;  3RYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...