3PN1A

Novel bacterial nad+-dependent dna ligase inhibitors with broad spectrum potency and antibacterial efficacy in vivo
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Bacterial NAD+-Dependent DNA Ligase Inhibitors with Broad-Spectrum Activity and Antibacterial Efficacy In Vivo.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3pn1A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3pn1A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3pn1A02
2UXBB 1FJGB 1TA8A 4JI5B 1N33B 4DR6B 3T1HB 3T1YB 4X65B 3OTOB 4GKKB 4B3MB 1XK5A 5BR8B 4DUYB 4LH7A 1B04A 4DV0B 1IBLB 4LF5B 4CC6A 4DR3B 4JI7B 3JSLA 4UCSA 4DV3B 4JI8B 4GLXA 1A0IA 4E6NA 4LF6B 4JYAB 4K0KB 4KHPB 3KYHC 3L2PA 1HNWB 1FVIA 1XMOB 2OWOA 4UCTA 2UXDB 1XNQB 4DR1B 2HHHB 2HIVA 4JI1B 3BA8A 3W5OA 3BA9A 4UCOA 3W1GA 3UQ8A 2HVQA 3NC0B 4UCRA 4X64B 4EEQA 4X62B 2UXCB 5LMUB 1IBMB 3RTXA 4DR5B 3TY9A 4LF9B 4UCUA 4JI4B 1HNZB 4NXMB 1CKOA 5FPRA 4DR4B 1CKNB 5DISC 3VNNA 1N34B 1TAEA 1HNXB 3NBYB 4UCVA 4B3TB 4JI3B 4DV7B 4JI0B 4B3RB 1V9PA 5D1OA 3W1BA 1N36B 2UUBB 2ZM6B 2HVSA 3GJXB 1J5EB 4DRFA 2Q2TA 1N32B 4DV1B 4AQYB 1XMQB 4LH6A 4GKJB 3SGIA 3BABA 4LF7B 1I94B 1DGSA 4DV6B 5D1PA 3PN1A 3BAAA 4PZ8A 4EQ5A 4EFBA 4JV5B 4TOIA 4YHHB 1S68A 4LFCB 4DR2B 1P16A 1HR0B 2UUAB 4LFAB 1ZAUA 5D1OB 4DV5B 4X66B 3QWUA 5IWAB 4DR7B 4EFEA 4LF8B 4LF4B 3JSNA 4PZ6A 1XNRB 3TY8A 2UUCB 2VUGA 4DUZB 2CFMA 4PZ7A 5LMNB 4DV4B 2HVRA 1CKNA 1P8LA 4YY3B 2VQFB 1VS0A 2E5LB 4OX9B 4LFBB 3GB8B 3TY5A 1IBKB 2HIXA 1X9NA 4UFZA 4JI2B 4CC5A 5FPOA 3RR5A 1XDNA 2UU9B 4JI6B 3S24A 4NXNB 2Q2UA 1CKMA 2F4VB 3GDEA 3NBZB 2VQEB 4DV2B 4B3SB
chains in the Genus database with same CATH superfamily
5BYBA 5DG7A 2IU0A 2F95B 5KX5A 5BWVA 1YJNV 5C8YF 2MCTA 3H0GG 1FD9A 2UXDO 3B8MA 4BIOA 1EZJA 4DV4O 4QSHA 3GTPA 4DW1A 3SI8A 3ZMSA 4JV5O 1QVFU 1Q86W 3ZMTA 2XIGA 2R92G 1C30A 4JUZA 3JCZA 2EILB 3KHHA 2E5LH 3KKYA 5LXTB 4ICGA 4UV9A 3RAQA 5BMVA 3G6EV 1K7DA 5CB4B 2FMLA 4AQYO 4LBEC 3T99A 2C2DA 4M7EA 1IDSA 4O4HA 4QPKA 5IYZF 3DTGA 4C7UA 1E4EA 3ABKB 4ASUG 3KALA 2UVUA 2VWKA 5KT7A 4X88A 3F5WC 4GKJO 2Q7GA 1JX4A 2A79B 5IJ0B 1BNCA 1V54C 3BVOA 4NZNA 3HOYG 4NXMB 2Q67A 2NU9B 2KB1A 1P4RA 2YZLA 2W6OA 5J2UF 3NBYB 3KREA 2XAFA 3O9OA 2OT5A 3WB1A 4A2AA 4JV2A 1IXBA 4BBSG 4IYIA 1HR0O 4KFMA 2LW1A 4CKCA 5FNVA 4X1IB 1IXMA 2P7TC 2VQEH 4LF4O 4DL5A 3WFVA 4DV1B 1XMQB 2GUZA 3QO8A 2FLLA 3D36A 3U10A 4X62H 1K4CC 1DGSA 1JMKC 1FXKA 1RM1C 4PWQA 4TQRA 2DIKA 4JTDB 2EINB 4EFBA 1IBKO 4QE7A 3MWMA 5FLXW 4ABMA 1HR0B 4CS3A 1HNWH 2W0XA 3SPIA 5BZBA 2H8PC 2IM9A 3FKSG 4YBZB 2Y0SE 1L8DA 2E3CA 2A9HA 5KT3A 5DQIA 5CA1B 3GIKA 1K5QA 2UVRA 2R86A 4WFAV 4TQFA 5A2QW 3GB8B 3VQYA 3TY5A 5BPHA 2YIBA 2A1HA 2Y48A 1IBKB 1Y4MA 4IRKA 4YJ2B 1AR4A 3M99B 4R50A 3TJTA 3Q4HB 4DK0A 4JI0H 3FFQA 3GDEA 5BWRA 3UKMA 1W93A 3C0FB 5FL7G 5JVDF 5JQWA 5LHGA 2JS3A 3L71H 4I4TB 5KAFZ 4J80A 1P7BA 1BGWA 4JI3H 3RAXA 1BE3H 5LOVF 1XMOO 3WO1A 4F4XA 1QR8A 3K9AA 3K79A 4B3MB 5IY5C 1VF7A 2ZR3A 3H01A 3J7AU 5I5SA 3RFRA 5BWUA 2V4QA 4CKEA 3VBBA 4DR3B 2XUMA 3CWBH 2W7OA 4Q4CA 1Q6HA 3CRMA 1S03G 2M7WA 2UXDH 1WAZA 2IH3C 2YZNA 3GTJA 3HPLC 4O82A 3STZC 4A3JG 5I5XA 4DRXA 4J9LA 3JRXA 5KHKA 4TQDA 3R5XA 2R7NA 3QZ8A 1WB8A 3NC0B 4UCRA 1IBMB 5J2UB 3KTMA 1K92A 1ZX3A 4AQYH 1M0TA 4MVOA 1I6UA 5KFJA 3CP1A 2EZPA 1KYOF 2JJ1G 4FJCC 4O4IA 4DUYH 2I8CA 2CQYA 2GDSA 4DV1H 1HDJA 1NR1A 1ROPA 1Q3EA 2CTWA 2CGOA 3HOZG 2ZKOA 1GN4A 1HWYA 1KEEA 2W8KA 2ZM6B 1K1QA 4PA3A 3K5MA 5L1IA 2OYQA 4A93G 3TK1A 3BPZA 1J5EB 3H9VA 4O7TA 4AQYB 5CBHA 2EIJC 3CD6V 3TW7A 4ECUA 4DIMA 3L73H 2QWOB 2RDCA 4E4TA 5CB4A 2W70A 1M56C 4FLZA 1JPXA 3V4ZA 1KECA 5DLFA 1PD3A 2LGWA 4LFCB 1N32O 1JVMA 2UUAB 3PZPA 3ETEA 1H2MA 1JFFA 2JA6G 4DR7B 5LMNO 3VOTA 5KUMA 4LF8B 2BOCC 2ATLA 2XAGA 1VQNV 1M6VA 4WBNB 2UUCB 4C2MA 3UM7A 3CC2V 2JA5G 4ZHQB 1HR0H 3JZ6A 4DLKA 2QA4V 4YHHO 2I80A 2V59A 2QKAA 1Q43A 4ECRA 4JTAB 3HKCB 3AG2C 2YYAA 1BS3A 3W7XA 1XHZA 4UFZA 4JI2B 4LF7H 2B63A 1MSDA 4JI6B 4KXRA 4O3OA 5LYJF 1K97A 1Q8IA 2QWRB 5KFQA 2QE7G 4JI8O 4DL3A 3JARA 3ABUA 4GT1A 2XAJA 5KG1A 4LF9H 4NXNO 3QQMA 4GKKB 3FAVB 3L9DA 1X4TA 3HB3B 4JF3A 1SERA 1SEIA 1Y67A 2P90A 1JXLA 4B08A 2GQSA 5LOVA 1GN6A 1WPXA 3QNEA 4A3CG 1XMOH 5KT4A 2V5AA 2Z02A 3L4JA 3HKDB 5CA0A 4K0KH 1VBGA 1FVIA 4UCTA 1VQLV 4DL7A 3THOA 5E25A 2DPJA 4H37A 4JI7H 3RVZA 3VQXA 5EWEA 3BA9A 4DK1A 3CCVV 3H3VH 2HVQA 2Y69C 3AG1C 3KAKA 3SJQC 5K1PA 2F4VO 2R84A 3J7AK 1SQVH 3N40P 4P9OA 3OTFA 2V58A 3OTOH 4CH3A 4PDVA 1OCRB 4NXMO 1V55C 1N33H 4QIWF 4O2BA 2R82A 3CEBA 4DV6H 3LQSA 3MD0A 5JH7B 3LWBA 2UUBH 3D8CA 3WG7B 2OTJV 1TGOA 1SZXA 4K35A 1E79G 4DR5O 3RV3A 4B3RB 4AYBE 3N27A 1PX2A 4XDJA 2J9GA 4J9MA 3JAMW 5KT5A 2ZDQA 3ZMVA 1V55B 4I50F 1ZWIC 4EBEA 4FBUA 1SQGA 2R9AA 1ZUQA 4F4LA 3LSQA 1Y14B 3SGIA 3BABA 4G28B 2PYLA 4LF7B 2A06H 4WHXA 1VF6A 4IAJA 4I5SA 4L1KA 5IP7G 2VPSA 2EIJB 3CHXA 5BR8O 3GV5B 3I4MG 1DV2A 4RAYA 1S68A 4MTOA 5KMGB 3ZEDA 1GSHA 2ZGIA 1SESA 1XOUA 2KSDA 1TWFA 2XC9A 4DL2A 3NR7A 1G8MA 1QQCA 5LGNA 5KG4A 2ZXWB 3OMIB 4O7WA 2WAQE 4J11A 4PHZA 2R70A 2V4DA 3P3PA 5K1XA 5JVLA 4FM1A 4CMDA 4KUMA 3I56V 4RWUA 3MFHA 4FFMA 3OMAB 3RUPA 2OTLV 2LFRA 3AK2A 1WP8A 3GTMA 4DR3H 4O4LF 1AILA 1O75A 2Y4UA 3WWJA 4WFEA 3CS5A 5GONA 3BG5A 4J0MA 5IYZA 4U3FH 3K04A 4A3FG 2DWCA 1FXHA 5IYDG 2JK5C 4KL1A 3EHBB 1W59A 4FFKA 4DAAA 3ZRXA 1PPJH 3GWKC 4JI2H 3I5DA 4IWXA 2DMXA 5IE9A 4RNNA 3RJ0A 2UUAO 2ZR2A 1NH2D 2HGWA 1R3KC 1GGOA 3OTOB 3LDEA 3ZHRA 3SJCC 4DUYB 4PA4A 4TSFG 3AEIA 4HBNA 2Z04A 2ZDHA 1I5YA 1OCOB 2R72A 1O9GA 5F2VO 2EIMC 1EYZA 3G6XA 1PV0A 2ASJA 4XYMB 1KJIA 3DGEA 5BWXA 1SF9A 2BSKA 4MW8A 1PM9A 1E4FT 4F4YA 1W96A 5B1BC 3I12A 4JI1B 5JH7F 4WFBV 5HFLA 5KA5A 4I9WA 4EEQA 2ARHA 1VARA 4CE5A 3E86A 2ZNJA 1Q7YW 4JYAH 3H1JH 1S77D 5HV6A 4OPAA 3BJYA 1WRVA 3SDLA 4C5AA 3RBZA 1F4NA 3H20A 4LF9O 1W0KG 3P32A 3EXAA 4B3MH 4MV7A 1DK1A 4O4HB 2QTOA 4NKGB 4B3TB 4JI3B 5B1AB 1KJ9A 1Z5WA 5D1OA 4I0XB 5IWAO 3N44B 5EOYA 5I5UA 3OUFA 3LDCA 3GTLA 1PP9H 3M7MX 3MR5A 5LOVB 5DM6V 2DW4A 5BXZA 4W4LA 4A3EG 4CH6A 4FM9A 3K5IA 1V4YA 2R92A 5IJ0A 4GKJB 4PBCA 4JI7O 1KBLA 2JEFA 2P4VA 1FPOA 3N8DA 2ETNA 1SRYA 1S5HC 3ABMC 4O4JA 5KG6A 4PDMA 2YL2A 4G3IA 1IOVA 4MVQA 5F9LA 1UPGA 1BZKA 2JJ2G 2GPWA 4LNUA 2W0FC 4JZGA 4DR7O 2NVYA 4GX0A 3CEIA 1N33O 4LFAB 2DPIA 4UB8Z 1CE8A 1R3LC 1R6NA 4MV9A 1NTKH 4X89A 3W7WA 4LF4B 2C00A 4YAJB 3K9SA 2Y0SA 2QWNB 5I5TA 4X9QA 1BGYH 5EBMC 2CFMA 2CNVA 3JZFA 4PZ7A 3VA7A 3ABMB 3KAJA 4K8XA 2B5UA 5EBLC 2EJRA 1NZ6A 5EC1C 2C2EA 3GIMA 2COJA 3G4SV 4YIOA 5L1LA 5BY1A 3L4KA 4MS2A 2C2RA 2WLLA 2P5OA 1WA8A 4CC5A 5IYCO 3IC9A 4X65O 4LFAO 2Q69A 3S24A 3IFXA 4C5BA 2JEUA 4IHJF 2F4VB 1M57B 2VPQA 3U0GA 2HEPA 2CTRA 2JEGA 3UT5B 1S3JA 2IW5A 2KSWA 4FLYA 3WO0A 4L8JA 4PDLA 2WLNA 4UVBA 4ZKIA 3OW2U 3T1YB 5KFSA 3FB8C 3JAKA 3RT3C 5KFNA 4P2ZA 1R3IC 4ZOLA 2ATKC 1M57C 4F6EA 2YU9A 4FFBA 1YHQV 1FYJA 2FJZA 4ECZA 3JSLA 4DV3B 2F43G 1A0IA 4HNUA 1XNQH 3EFFK 4PA9A 2XCPA 3ZCCA 3CVZA 2Q7EA 4X64H 2EIKB 3ASOB 2UUCH 3OFNG 1NH2B 4O7ZA 1IVSA 3K5OA 4JAVA 1GO3E 2F1MA 1I7FA 4CH5A 4FLUA 1SQXH 1XBLA 1K1SA 4RO2A 2YIAA 3RN4A 1Q90D 3RYIA 4ME6A 3CRAA 2VQEO 2BTQB 3T54A 5EIBD 3K58A 4YHHH 5BPFA 2NR5A 2J6UA 1MNGA 4A3MG 1JQ0A 3AX6A 4LF5H 3KCXA 4JZ2A 1N0NA 4GC6A 2DWEC 1RJRA 4ZI7A 1JX9A 2ZM6O 1Q5OA 4U3JB 1N36H 4MTEA 1Y1VG 2EIYA 3QO7A 1BMFG 4JI4O 4B3TO 3RGZA 5J2UA 4EEYA 2JA5A 1NVPB 1VQ6V 3K08A 4J41A 3G80A 1IBMO 2F66C 4NXNH 4MVZA 5JVDB 1I1LA 1M7JA 3IGAC 2OIGA 4O4IB 4JI1O 3MR2A 5EDWA 1JJ2U 4PZ8A 5LA6A 1XHXA 3LSSA 1VP7A 4HAMA 4RUFA 3OHAA 4FK5C 2L6LA 2OH2A 3A8TA 4NTXA 1EZ1A 3FKIA 3N42B 1VAJA 2VQFO 1K34A 5L3EA 3QWUA 1H2KA 1KP2A 3ZJZA 3T9DA 1N8RW 3M9NB 4IIJB 2NNUA 1XNRB 2DWDC 4NZMA 3ZN1A 1IX9A 1EN4A 4LP8A 4DR2O 3H1KH 1N48A 4EBCA 4JI3O 3CB2A 3LUTB 5KX5B 4J7ZA 2A7WA 1QR9A 2QWPB 4EGJA 2W8LA 4MV3A 2YS8A 4O7YA 3K3WA 5J9PC 2AW9A 3D3QA 5KA6A 2PY5A 3J81N 3UFXB 2FPPB 4UXNA 2IJHA 2WE6A 4ED6A 1QU7A 5HFMA 1EFRG 5CBFA 5KHGA 2FMAA 1N33B 3T1HB 1I94O 2AZ0A 3B4SA 2QSAA 1OBDA 3K3PA 3HKCA 1KKDA 4YY3H 1AI6A 3SPHA 1VQ8V 4NB5A 1T94A 4DUZH 1B04A 3DC5A 4LMYA 5B1NA 2PBZA 1NT2B 1GKFA 3JAWA 2E75B 2AQ4A 1K4DC 4LF6B 1SC5B 4TV8A 5DGBA 5FLXN 3UZOA 1OBGA 3DF7A 5KG3A 5IYBO 1PNLA 3E35A 3W5OA 1I3QA 3RF2A 2F93B 2D3OW 5KFOA 3ZX6A 2WLLB 1IZ3A 2HJWA 4KP4A 2UUCO 3ABKC 5FLMG 1VQ5V 4J9OA 2QYZA 3T1YH 4RZQA 2GUZB 1GSAA 1RYRA 2X6CA 3AK3A 4DV0H 3PVXA 4QWCA 4FBTA 4BY7G 3MHSC 2R87A 1DLBA 1XMQO 2X0SA 2CW8A 5LA6F 2R6FA 4J9NA 1IURA 2MW2B 2ZT9B 5ITZB 4QE9A 3ZHQA 3UO2A 2BE3A 4KHPO 1THZA 2RN9A 3TXQA 5C1OA 1V9PA 3RYHA 3ETHA 5KUKA 4AYBA 1YJ9V 2DABA 2ZE5A 4X1KB 4B3SH 4FMTA 3F7VC 1FFXA 1Y76B 5C93A 3UO3A 1J95A 3CXCU 4JAAA 5CA1A 3RGXA 2CH7A 3MDSA 1VF5B 4DV5O 1VKZA 5KHIA 3T9EA 2UU9H 1NVPD 2VOBA 2DQ0A 2W6IG 1CQJB 1IBKH 2WPDG 5B3SB 3TETA 1I7NA 1KP3A 3IN5A 4UB6Z 1HNWO 5LXTF 5IT9W 1L0NH 2JVDA 3GILA 3FD9A 2FK1A 2X7RB 1YTFB 1FS0G 2NVXA 2ZIMA 1Y1WA 4H0LB 3OE7G 2JA8G 3R5FA 3SE7A 2IJIA 2YDEA 1OCCB 5EYPA 1XDCA 2QR4A 3GIJA 2QM7A 2VWJA 4YY3B 4BXXG 1T3NA 1H8HG 1BSMA 4OX9B 5J2TB 5KFUA 5EC2C 1X9NA 4U7OA 2VS0A 4PV1B 3APOA 3HXLA 2HHFB 5FJ8G 5FPOA 1M93A 1VEWA 1K33A 3RR5A 2JA7G 4CS2A 5FNVF 5DGIA 1GM9A 1TVKA 4RUCA 1Y1VA 3WWHA 4J9SA 4R8UA 2VQEB 4JI5H 4ECYA 3OR6C 4MT8A 2ZNIA 4O84A 3KZIZ 3GIIA 4CBCA 1XL6A 2UXBB 1CEZA 1GRJA 4L87A 5LA6B 2E2IA 4ED2A 1WR2A 2R7KA 4HQ6A 3A0BZ 3K3VA 5JCOA 1Y6XA 1RSOB 1QBZA 2P22C 1SYXB 2FL4A 5L3DA 3T1HO 4MTDA 3OUZA 5DN6G 4LF5B 2EJ0A 5IYZB 4E6NA 1OCRC 3BRCA 3H1IH 5LP6C 4DV6O 3U11A 3RYCB 4CKBA 2IBKA 4J42A 4J7KA 3CMEV 2HG8A 4EBDA 1VMGA 2ZINA 4DR1B 3IAYA 1RJPA 4XDKA 2RF4A 2HIVA 4O3PA 4FFPA 4NLGA 1RM1B 3JATB 2VQDA 4Z2WA 2ZDIA 4ZOLF 1VQOV 2OCHA 3N2GA 2EBOA 4IYHA 1D2DA 3FB5C 4BW5A 1DF4A 4UCUA 3AYHB 2JIZG 5CA0F 3JD2A 4ECXA 2E5LO 4RB2C 5IYDO 2HHHO 3MFIA 3DC6A 3D3IA 4O2AA 3QG5A 5KLVH 3V6HA 1OJHA 1FJGO 4Q0YA 2G38A 1IOWA 2QKSA 1BJTA 1VQKV 3RV4A 3GJXB 4DV2H 1LNQA 1BCCH 4DRFA 3CJHA 4I55A 3NXSA 2Y4RA 4IR9A 1KBHA 3HO8A 4DR4H 2R93G 5IJ9B 2VA3A 2Q0AA 5KG7A 5FD6A 3E8GA 1JR9A 4JV5B 2R7LA 1OCOC 3SPGA 2UU9O 5LMNH 4DV5H 1XNRO 4X66B 5KFVA 4U6PA 3T1CA 5IWAB 5J2TF 4X62O 2X0LA 2HVKC 3T9AA 1HP8A 3M9OB 4FFNA 4PELA 4PZ6A 1KJQA 3JALB 4P9PA 3FDSA 4GKKH 4Q20A 2XGQA 1H2LA 4EB6A 1S76D 1SETA 3CCSV 3PFFA 4LWSB 4FM0A 1AR1B 4O4JB 5L3GA 3FAVA 2ZJTA 2ALZA 2FK2A 4IIJF 1G6UA 2R85A 2UU9B 3N2KB 1AUXA 4NYEA 4B3RH 1E1QG 4NTWA 1OWTA 2HP8A 2WA3A 4PA6A 2FLPA 5L3FA 2ZM6H 4X1YA 1CPYA 5L1KA 2CTPA 2ITCC 4GC7A 2J6SA 4DV7H 3W7SA 3CC4V 2IBZH 3E8FA 2GSMB 4YJ3F 4RB3C 1BXRA 4LC1A 5H2FZ 2KKWA 1YEWA 3DAAA 4MV6A 2AGPA 4DV0B 5LL6b 4D7SA 3LDDA 4CC6A 2EJ3A 4JI7B 5C8YB 4O7VA 4TUYA 4A3KG 4F6RB 5DAAA 1B3QA 1AP5A 5JH7A 3TINA 4JYAB 3BEHA 2NU7B 5DG8A 4U7NA 1FXKB 1JIHA 1I2LA 3ETGA 1TUBA 4FGRA 1YIJV 2DAAA 2AGOA 1EBOA 3U54A 3CCUV 3U55A 5KFBA 4HNVA 4RUEA 2EIMB 5KX5F 5JCOC 4ZOLB 2KG7A 4DR2H 2HG5C 4J9KA 1D5AA 1EM1A 2WAQA 3GV7B 1XILA 1A32A 3B40A 3LNMB 4ECQA 2COIA 2ZDGA 4BIZA 3ZBHA 1Y74B 1PL4A 4PJ0Z 1I7LA 4DR4B 1HW7A 1S10A 4PDBA 1KQSU 4O7RA 1ZQ7A 1VBHA 5EIBC 3J80N 4FVMA 3G8DA 3CX5F 1XI1A 3JCUZ 2PF4E 3LSUA 3RB4A 5L3CA 4FE2A 1HNZH 1R3JC 4NR1A 2Q6AA 4G27B 4OX9H 3STLC 4QWEA 4ZQIA 2RGVA 3VPBA 2Z5UA 4PA7A 1RFYA 1TUEB 3G67A 4CH4A 3Q8PB 3VQVA 3QO5A 2HR3A 4I4TA 5H5NA 2WSSG 4DUZO 4NYKA 3ETQA 3AW8A 2XD4A 2W6MA 2ODTX 1KJJA 5B66Z 4CHIA 1Q81W 3Q8QB 4O2BF 3JATA 2D2CB 4JASA 3CCEV 1GTOA 3X2QB 2SCUB 5LYJB 4LFAH 3HB9A 2GV9A 4IRDA 2Z0AA 4O4HF 3F8NA 3N2GB 2HHHH 1EN6A 3NGDA 1OHHG 5BMVF 3CRCA 4JTCB 4FPPA 4HYKA 3FB7C 2JGDA 5DG9A 3Q2OA 3FYEB 5IYCG 4YR3A 3MWDA 1PK8A 4LFBB 1J5EH 5C44G 1GYFA 4QW9A 4HNTA 1G1XB 3ABTA 1KKCA 2V9WA 1QCEA 5KT2A 5CA3A 4XDLA 4ZI7F 3TEKA 1EN5A 2BSKB 2XGPA 1AJPA 4F50A 3GIQA 2XASA 2FTKA 1SS3A 1FFTB 1TA8A 1C3OA 2O03A 1RPOA 2YZMA 3CQZA 3RW0A 2WAMA 3DXRB 4D6TH 1N34H 5EK0A 3VPDA 3QFFA 3TGUH 4JYBA 2XOKG 2FKLA 2YEVA 2XCAA 2CNUA 2FP4B 4NZOA 4EYIB 4FFLA 3A2FA 3EPIA 2B63G 3JALA 3L2PA 3GWOA 2OWOA 2UXDB 3E8BA 4JI8H 4LF8H 3EVKA 1M5IA 3HOXG 1N36O 2EJ2A 2FPGB 1S5JA 1K3EA 3N6RA 4MW3A 4IRCA 3ZHTA 2AHZA 3F7YC 3QVNA 1BQ0A 1JFFB 3N6XA 4M9UA 3GTOA 2PUSA 3AK1A 2HGSA 3OUSA 1W0JG 2WLIA 4TV8B 4YIPA 3EYYA 2Z3YA 1SA0A 2NU6B 2W9AA 4LF6O 1GN3A 4O81A 2Q73A 2EULA 3OHBA 4JI0B 3RGBA 4ED7A 4ETSA 4AHCA 2C22A 2UXXA 5K2MA 5DGHA 3W1BA 3H4BA 2WA4A 2VRZA 2A3QA 5C8YA 3WWIA 2VR1A 4ED3A 2P06A 3WU2Z 4QGPA 4Q8EA 2JA6A 1EUCB 1DAAA 5LBQA 3T5LA 4N23A 2PI5A 1Q6UA 3ASOC 5IYBG 2AGQA 5KG0A 1P16A 2IMWP 2LFSA 1Q6IA 1SFOA 1ZAUA 1ENVA 1OCCC 2RMKB 3T9CA 3ZHUA 2WYOA 3ZHSA 4YP3A 1WSCA 5JJNB 1MMMA 5CR5A 2QEXV 1QLEC 4O4LB 2C2AA 5GW7A 4MV4A 2Q68A 5L9XA 3MHHC 3N41B 3CXHF 1R1BA 1HNZO 4TM5A 5KS8A 2RCVA 4RNOA 3QF7A 3P30A 2QK4A 4HR7A 1XREA 5E1AC 3ZHVA 2WLJA 2YWVA 4IGGA 4OPHA 1XDNA 4GKJH 4BAYA 1GAXA 4RQFA 5KFKA 1XUQA 4Y8VB 3HBLA 2E76B 3OSNA 1EUDB 2ZIOA 4DV3O 1H2NA 3ZRWB 3LNNA 3I55V 1MZFA 4J7JA 4WF9V 3IG0A 2IJKA 2XTAA 4R7RA 1JOYA 1VF6C 2DYSC 1WP7A 1XK5A 4NTYA 1WJZA 1KU9A 2ZQMA 3PR5B 5LYJA 3JD3A 3BFRA 2PMZE 1B06A 3R23A 1NU1H 2JEJA 3B77A 2ASDA 1S9FA 1N34O 2Q5ZA 5H9CA 4ZHQF 2EILC 4TQSA 3G6VA 2AU0A 1Y1WG 3OMNB 4FLXA 4YXWG 4BR6A 2PI4A 1XMOB 1XNRH 1VQPV 1XNQB 1KUQA 1WLEA 2ILMA 4QWDA 4MTXA 5KMGA 3JASB 3G6YA 4TT3G 3ASNB 4FIPC 1I1MA 3H1HH 2HKOA 4O7SA 4B3SO 3HKBB 3SPCA 3OAAG 3WB2A 2IH1C 4HZ3A 3RVYA 3W7UA 4LF9B 2V1DA 1KT8A 4W4KA 5JVDA 2YIBD 3OGIB 4DL6A 1JJOA 2E2HA 2BQUA 5DISC 2PTMA 4J9RA 2E74B 3TIIA 2RDIA 5JQGB 2A0LA 2VA2A 2UVVA 1L1FA 1NI8A 4DV7B 3GLKA 1WN7A 2N04A 1XQ8A 4JGSA 4A5UB 2GBOA 2L35A 4MVMA 2DE0X 4H33A 4JI0O 2PZSA 2LP7A 2EJ7A 5BWTA 4O3QA 4LFBH 3T5KA 5I5VA 5GTIZ 4I7HA 1WPBA 1V51A 5KG2A 3L70H 3ABLC 3VQWA 5LMUH 1BT8A 3HKEA 3CCRV 4CS4A 1U97A 4YHHB 4DL4A 5EZYB 2FB9A 2JRIA 3JRWA 3UZBA 4IHJB 4FLWA 5LP6B 2FB5A 1QLNA 2WB1A 1OZ0A 3M8AA 1KC8W 4EFEA 3T9BA 2C28A 3T4DA 1R6TA 1E1RG 1MZBA 2LQTA 5HNEA 4DV4B 1P8LA 5DEDA 2DN9A 4QNHB 1AI5A 1I1KA 4QIWA 2V4RA 3JZIA 4FU0A 2HIXA 3TW6A 3RB6A 3K5HA 5FNVB 3E2EA 2JS5A 3HOVG 4NXNB 1B6QA 1KMIZ 3SNOA 4YR0A 1EHIA 1AVMA 4CZZA 2ABJA 2P0AA 4F4WA 5IDJA 1IBLO 2Y4TA 2FPIB 3DSQA 2EX3A 5KFTA 4HN2A 1W2BU 2Q8VA 1UJWB 4EB6B 1P7GA 1F7YA 1SCUB 1M1KW 1X59A 4Q4DA 1M56B 4RCNA 2O57A 1K83A 3LMLA 4U7CA 4I0XA 4WFGA 3KXYT 1MSWD 3BY6A 2R8KA 5DQGA 3N2KA 3CE2A 3U9SA 1BHBA 4UCSA 4K6NA 4GLXA 2YS7A 3V4SA 4M0JA 5KFRA 5B1BB 3Q8SB 5CAEB 4RAZA 1GM7A 4O4IF 1H2SB 1HNXO 1P84F 2K9PA 3MJFA 4JYCA 1I08A 2HFEC 4WFFA 3ZRSA 2W9CB 1SQPH 4X62B 1XNQO 2UXCB 3R9RA 3RTXA 3T1YO 2EINC 4X1KA 3Q8RB 4DV2O 4J9QA 1S0VA 1FFXB 1Y76A 4GX1A 3MR6A 5KFXA 3GIPA 1RP3B 2QM8A 2AXTZ 2UVWA 3FB6C 2QM4A 4DR4O 2PVPA 1ORQC 5D5QA 3OR7C 1CKOA 3E5NA 3ZRWA 3E89A 5CBGA 1HNXB 2AGAA 4A3GG 3AG4B 5JJEB 1CP9A 4I55F 1YJWV 4JYYA 4QPJA 2UUBB 5DECA 2CGNA 2ODMA 4RU9A 1NTMH 2KG7B 5CN0A 1M90W 1D5NA 5EYPB 5B5EZ 3H4DA 3J81W 2UXCH 2W57A 5KFIA 5D1PA 1IYEA 2J6TA 1M0WA 4EQ5A 3T5JA 3PO3G 2H94A 1MA1A 4ED0A 5LGTA 2IU3A 3JAKB 2HHFA 4XX0B 5C3EG 4FFRA 1VIBA 1E4GT 4DV5B 4RNMA 2DJVA 2ADQB 4JYAO 4H13B 4JI1H 4MAMA 1AUVA 1WCMA 5KHHA 4WD3A 2GHYA 3ZRVA 4QWBA 1FXVA 3VMMA 3OSPA 4EGQA 4DV7O 4B3MO 2Q7HA 1JCHA 2LJ2A 4JXUA 4GX2A 4PI0A 1YCIA 2ZD9A 2RGRA 2YCHA 3OTOO 4BWSC 2BTQA 1CKMA 1WNSA 3NBZB 5FR9A 4JV1A 1AI7A 1VQ7V 4B3SB 3RFCA 1SQBH 2DYRC 4DR6O 3K0DA 2R8JA 3ML0A 4A3BG 1I5XA 3HR0A 1SQQH 2YS6A 2JGDB 4J9YB 1JA8A 2QB5A 3D36C 1CQIB 4TUYF 1YITV 3SPJA 3R5HA 5KFFA 4ED1A 4AILC 4U3JA 1T5EA 3JYCA 4DV4H 4F4ZA 1QVGU 2LO1A 4IHJA 4I4TF 2KQXA 3RYFA 5LP6A 2CNQA 3GB7C 3AG3C 4DQNA 2YSUB 1Z2GA 4DR1H 2QF7A 4TV8F 4WBNA 3CMAV 4K0KB 5A2QN 3JD1A 1I2KA 4J9PA 1EZVH 3ORQA 2W9BB 4O2AB 3BQ1A 4P30A 3L75H 3PW5A 1AROP 2BTOA 3RB0A 3X2QC 4DUYO 3UQ8A 3EPGA 2FKXA 1I94H 4YQWA 5LMUB 4YJ2F 2N05A 1QNMA 2VUMA 5IT9N 3BQ0A 1V54B 4X65H 1ZETA 5C1PA 4PD4F 4YJ3B 3AG1B 4R7CA 3CJHB 4I55B 1B6SA 1H2GA 2JGUA 1S0MA 2CKZB 5L1JA 5LXTA 2UXBH 3NUAA 5BMVB 4H44B 1TAEA 1N32H 4O3RA 5DLGA 2W6ZA 5A9GA 1YF2A 1KB9F 4XYLB 3T9FA 1CS0A 5EWFA 2YC0A 3GVMA 1N36B 3BCCH 4I50A 2XHBA 3BACA 1GK9A 5LL6Y 4JAUA 3AG2B 2ASLA 2Q2TA 4EYHB 1HNXH 3UYYA 4Q8FA 4QJFA 4TV9B 2BOBC 5BYAA 1PNMA 2NN4A 1I94B 3M4IA 3PN1A 4LWSA 3SR2C 4XBFA 4Q6GA 4DXWA 1RK5A 4J10A 2W9CA 2ZE6A 2LW7A 3R65A 2AHYA 2Q9LA 2YXHA 4KHPH 1L2ZA 3G8CA 4B7EA 4K8ZA 2QKCA 4GLWA 4TWKA 1DV1A 4Q44A 1S5LZ 3KHGA 3K5NA 1DIKA 2EIKC 2QGNA 1GLVA 4IR1A 1M4UA 1UFIA 5EZYF 2OLSA 3CRRA 4R8CA 1SQFA 2WLHA 3K57A 4RB0A 1VS0A 3M9MB 5JWPA 1NBMG 1KC7A 3VPCA 2WLMA 3R66A 3J80W 2LGQA 3FYIB 3GTKA 3ABLB 3CCMV 5JQGF 4B3TH 2X6BA 4TUYB 4F6RA 2UXCO 1FAFA 2CK3G 1PKXA 4DV2B 1NTZH 2W9BA 5JUMA 3O65A 3G71V 3H0GA 4LSAA 1TUBB 1KJ8A 4JI5B 4Z1MG 2IP4A 1YTFD 3RIZA 2X5RA 4DR6B 5ITZA 3HOUG 2F4VH 1A3GA 3B09A 4X65B 1GSOA 4O83A 3RYHB 1H8EG 1LUWA 5BR8B 2YW2A 4QWAA 4NXMH 3FMAA 4YJ2A 2Y0PA 3Q4HA 1GM8A 3E8HA 5KFGA 2UUBO 3WNZA 2JEXA 2CH7B 1RK6A 1Y74A 1COWG 1WCMG 1HNWB 4MVSA 1EKPA 5LP6F 1SKVA 3ASNC 2YXYA 3G6BA 4LF6H 2NU8B 1MABG 2YICA 3AG7A 3JD4A 2OIEA 2W6NA 2ZCEA 4DR7H 2RNBA 3ETJA 2DOSA 2NLJC 1Q82W 2YRXA 3TY9A 3T1HH 4MSWC 4PI2A 1PNKA 3A0HZ 4BWAA 4BBRG 5BR8H 1N56A 4HYOA 1N34B 1AJNA 2R9RB 3B2EE 1G4YB 2RQ6A 5J2TA 1NKDA 2YI8A 4DRXB 5LGUA 3SYPA 5CMUA 3ICXA 4DR1O 3RYFB 1TVKB 3WB0A 4QW8A 1N32B 4R8UB 5HBRB 2EZOA 2PN1A 3JD0A 3RBDA 4UUJC 2HGXA 3OUUA 1AI4A 1RJQA 3SJAC 2RDJA 1ZL8A 3BAAA 3TCUA 4YB8B 3K03A 3ZIAG 5JQGA 2PMZA 4A3LG 1K8AW 3L74H 2W6QA 2OCCB 4HNAB 2P4KA 4DR2B 1RSOA 2XT9A 4MA5A 4GZRB 5LHHA 2QWQB 4YJ3A 4LF4H 4PDRA 2XCLA 3JSNA 5GTHZ 4JI2O 4BW9A 1JKJB 3RYCA 3TQTA 2VUGA 3AG4C 4A2BA 4ECSA 2YI9A 2UUAH 3SYAA 1XMQH 3K0GA 2VQFB 2R8GA 5E79Z 1AP6A 4QIWE 3CSXA 5I5YA 3PR4A 1K5SA 2QDOA 4ECVA 5EZYA 2GQRA 4ZBMA 4WCEV 3T7AA 3OD4A 4NVPA 4R6ZA 1NQTA 4I50B 1YSCA 1ZHSA 1BHAA 3SYQA 4UVCA 4GKKO 3A0RA 5BWWA 4K3AA 2XAQA 3F5TA 3QZ7A 4GYCB 3B8NA 5DQHA 4TV9A 3MWEA 4ZHQA 1FJGB 1SZTA 4RQEA 3MR3A 3C90A 5I5WA 2WTFA 4OXSA 2IA6A 1YXBA 1KTAA 4O7LA 4LNUB 3HKZA 4JI4H 2OCCC 3I4NG 4AI8A 2CAZC 2HJDA 3DTFA 5CA1F 2BR0A 4JI8B 1S0OA 2WLIB 4MTFA 5IJ9A 2CUGA 1UC9A 5KFYA 5CM0A 3RB3A 2Y0IA 4APMA 4LFCH 2FLNA 3SJBC 1MOFA 3BHPA 5IWAH 4X66O 2P67A 3E22A 3T5HA 1WA8B 1B33N 2H3OA 4DR5B 4A3DG 3K59A 4O7NA 4UUGA 2YZGA 4O2AF 3U0ZA 2W7PA 2ZDIC 5H6RA 3WG7C 5KFEA 5FD5A 4JI5O 3UT5A 3SYCA 4XZ3B 3FKIG 3PW0A 1CKNB 4GCZA 3K5LA 1GH6A 1US6A 5CB4F 1ZHQA 2ADPA 3AG3B 1NS1A 4WBNF 4IZOA 5GONF 2HVSA 5DGAA 2COGA 2DYSB 2FYUH 4RB1A 4FFBB 1RYSA 1NR7A 3GTGA 4O4LA 4YR2A 3PW4A 1AR5A 5EBWC 3L72H 4O2BB 2N74A 5F9NA 4X1YB 3HKZE 4RAIA 3S3WA 3K06A 3T4ZA 2GLTA 4FZ0A 4YY3O 1CXZB 2CE4A 4I7ZB 5H6QA 4LCUC 4OX9O 3LULA 3W7TA 1R6KA 4DYLA 1IYDA 1F4MA 4IWYA 3VOUA 3TY8A 2XAHA 1IBLH 5KFMA 2HLDG 4FM2A 1EKVA 1I0HA 1UNNC 1QLEB 5KKNB 2RJZA 3CPWU 5KG5A 1JLLB 4ZIBA 1PL0A 2QJ1A 4ZI7B 4TVIA 2WB1E 1FJGH 4O3NA 2UXBO 4EG0A 4WFHA 4DR3O 1AB3A 2HDKA 4FLVA 5KFZA 5H80A 2Q2UA 1GO3F 1XL4A 4E2LA 4B7KA 4O4JF 4JV0A 1JDBB 2R7ZA 1J5EO 4MV8A 2R9IA 4X20B 3MAQA 2FK3A 2VUMG 1B6RA 3HT5A 4G2KA 3JASA 1S0NA 2B1GA 4X64O 5B3SC 4O3SA 2R7ZG 5KFPA 3JAMN 2DQ3A 4LH7A 4DW0A 5AG2A 1S72V 5D8DA 2YUAA 5GONB 3KCYA 2GPSA 4IIJA 3OEHG 1BQZA 1YDXA 3C3TA 1YZBA 2V7QG 3CCQV 3GQCA 3KYHC 3HOWG 2BCCH 3KG2A 3P3NA 4LF5O 2HHHB 1DTOA 5I47A 4Q43A 4UCOA 3RWRD 4BIUA 4N21A 3T2MA 4X64B 1N0JA 3TXSA 1ZTEA 1OCZB 1JDEA 5T14A 1Z2NX 2P6JA 2ZE8A 4MV1A 4FS2A 1ET0A 1Z5VA 4JI6O 1U96A 5LHIA 5B1AC 2AZ2A 3HKEB 4K0KO 3TIGA 3VNNA 4CMFA 5L3BA 3CYOA 3UCSC 4UCVA 1AN7A 1OCZC 4E4EA 1A48A 2CDYA 4LF8O 1F23A 1OV9A 3E83A 4J9ZB 3PW7A 3FX7A 3ZN0A 2K1EA 4FS1A 3JAWB 5LMUO 4JPRA 2VQFH 4LH6A 4OGQB 1MG1A 3LP8A 1FKAH 3BQ2A 2DLNA 4EKWA 2WDTA 5KFCA 2QTSA 3DXRA 1VQMV 1Y66A 4LR3A 1LUVA 4DR5H 3E22B 5EWGA 1K9MW 2W6JG 5D1OB 2YEVB 2B1IA 2CZGA 5I60A 3U9TA 1P49A 4JV5H 1AJQA 3GIDA 5KFHA 5IY5B 1YVWA 1VQ9V 4QJFB 5KFAA 3JARB 3CCLV 2DYRB 1CKNA 1TWGA 4C5CA 2C35B 4A3IG 1NJIW 5JJJB 4ECWA 1UC8A 2B9ZA 1E4EB 4GUNA 4IL6Z 1KUTA 2CW7A 1ULZA 4Q45A 3KHRA 1DF5A 3PW2A 1LR1A 2X6AA 4DV1O 3H40A 3CSWA 2WLKA 1WB7A 4MA0A 2CTQA 3OGCC 1O9HA 2R8HA 1G2WA 4UVAA 2R7MA 1F51A 3ETDA 3GV8B 3RBEA 1R9TA 3HKDA 5CA0B 2M05A 3IC7A 1N4CA 1SA0B 2Q7DA 1R73A 2XNDG 5KFWA 4LSXA 2ITDC 4I9QA 3ZMUA 4ECTA 2YXLA 1RPRA 3V6KA 1Z2OX 4FFOA 5KT6A 4O86A 3ZS8C 1M9NA 5C5JA 4X1IA 1S97A 3C3SA 1IBLB 2ZE7A 3TQ1A 2I87A 5CE8A 4DO2A 4D7TA 3DTUB 3Q1KA 1EKFA 4X8AA 2FE3A 4KHPB 4ED8A 1TWCA 4TV9F 2HVJC 4DV3H 2YIDA 4DV0O 2Q4PA 1GMGA 3BA8A 2JDIG 5KAIZ 3W1GA 1TWHA 5IP9G 3GTQA 1ZLZA 2W71A 3V6JA 5TISZ 3S3XA 1Z2PX 1WH2A 2WWWA 1FXKC 4LF7O 3KHLA 4JI4B 1L0LH 1HNZB 5KFDA 4MVUA 5FPRA 4X20A 2JA7A 3QTCA 2MK3A 5DMXA 4FZ1A 1KD1W 4YAKB 1VQ4V 1QHTA 1TWAA 1URFA 2F23A 4JI6H 5C4XG 3OEEG 3CCJV 4BY1G 4B3RO 5KHJA 3RYIB 4MVRA 3IJ4A 3SYOA 2YRWA 2HJFC 3N43B 3ORRA 2DZDA 3CC7V 1IBMH 2Q0OC 4FLTA 4DV6B 3OT7A 4TOIA 2GTSA 1T36A 4LFBO 1XEQA 1K73W 3OM3B 2BQ3A 2R93A 1MZEA 4LFCO 2UXNA 1A0GA 3PO2G 2JEIA 4Z1VA 5K3WA 4X66H 2BQRA 2M6YA 4DUZB 2ZXWC 5LMNB 4RUAA 1ZSPA 2HVRA 1H38A 3H1LH 4IT5A 2R8IA 1ZL8B 2E5LB 1I50A 1BL8A 5B1OA 3PJSK 4MTGA 5KFLA 1A9XA 1YI2V 4HNAA 2NUAB 4GX5A 4RZRA 3HKBA 3CRQA 5D5PA 1FKAO 3ZMZA 4DR6H 2Y69B 2GTAA 2PYJA 1GN2A 4UV8A 2IJJA 2PGGA 2W6PA 3APQA
chains in the Genus database with same CATH topology
4LSAA 1TUBB 1TA8A 2O03A 4JI5B 2F95B 4L8JA 5KX5A 3RIZA 4DR6B 5ITZA 3T1YB 2MCTA 2F4VH 1N34H 3JAKA 4X65B 3RYHB 5BR8B 4NXMH 2XIGA 4ZOLA 3FMAA 4YJ2A 4FFBA 2E5LH 3JSLA 4DV3B 1A0IA 1XNQH 3A2FA 5LXTB 3JALA 5BMVA 3CVZA 2Q7EA 3L2PA 1HNWB 4X64H 5CB4B 2UUCH 1SKVA 2OWOA 2UXDB 4LF6H 4M7EA 4JI8H 4O4HA 4LF8H 3K5OA 1M5IA 2ZCEA 4DR7H 2F1MA 1I7FA 4CH5A 4FLUA 3KALA 2VWKA 1S5JA 2YIAA 3RYIA 2BTQB 1JFFB 5EIBD 2Q7GA 3K58A 3N6XA 4YHHH 2PUSA 2HGSA 3TY9A 3T1HH 4PI2A 4BWAA 5IJ0B 4LF5H 4TV8B 3EYYA 4NXMB 5BR8H 1SA0A 1N34B 3NBYB 3B2EE 4A2AA 3WB1A 2RQ6A 5J2TA 2YI8A 4ZI7A 3RGBA 4DRXB 4JI0B 4ETSA 4AHCA 1Q5OA 3W1BA 4U3JB 3ICXA 1N36H 4MTEA 5FNVA 4X1IB 3RYFB 3RGZA 5J2UA 2VQEH 1TVKB 5C8YA 3WB0A 1N32B 2F66C 4DV1B 4NXNH 1XMQB 5JVDB 3U10A 4O4IB 4X62H 1DGSA 1JMKC 3SJAC 3BAAA 4PZ8A 1XHXA 5LA6A 4EFBA 5JQGA 4HNAB 3MWMA 5FLXW 3N42B 4DR2B 1P16A 1RSOA 1HR0B 4CS3A 1HNWH 1ZAUA 2IM9A 3QWUA 2WYOA 4YJ3A 4LF4H 2E3CA 1L8DA 5JJNB 4IIJB 3JSNA 4O4LB 4BW9A 1XNRB 3RYCA 5CA1B 2VUGA 4A2BA 2YI9A 2UUAH 5KX5B 3CB2A 3N41B 1XMQH 2VQFB 4TQFA 3CSXA 5A2QW 3GB8B 3VQYA 3TY5A 3QF7A 2YIBA 1IBKB 5EZYA 4YJ2B 4NVPA 1XDNA 4GKJH 4DK0A 4I50B 1ZHSA 4JI0H 3FFQA 2PY5A 3GDEA 3C0FB 4GYCB 2WE6A 2ZIOA 4TV9A 4I4TB 5KHGA 4ZHQA 1FJGB 1BGWA 3LNNA 4JI3H 1N33B 3T1HB 3IG0A 4R7RA 4LNUB 4YY3H 3HKCA 4B3MB 1XK5A 1VF7A 1KU9A 4JI4H 3RFRA 5LYJA 4DUZH 1B04A 4DR3B 4LMYA 2CAZC 1NT2B 3JAWA 4JI8B 1S03G 4LF6B 4TV8A 2UXDH 5IJ9A 3DF7A 4FLXA 1XNRH 4APMA 1XMOB 4LFCH 3SJBC 1XNQB 4DRXA 3BHPA 3W5OA 5KHKA 5KMGA 3JASB 4TQDA 5IWAH 3RF2A 2F93B 3E22A 3NC0B 4UCRA 1IBMB 5J2UB 3HKBB 4DR5B 3WB2A 4AQYH 3K59A 1M0TA 4LF9B 3T1YH 3U0ZA 4RZQA 1I6UA 4DV0H 5FD5A 5JVDA 2YIBD 3UT5A 1JJOA 4O4IA 4DUYH 1CKNB 2CW8A 5DISC 2PTMA 4DV1H 3K5LA 5JQGB 1ZHQA 5ITZB 1Q3EA 4DV7B 1WN7A 1V9PA 3RYHA 1XQ8A 2ZM6B 2HVSA 3K5MA 2PZSA 4X1KB 2OYQA 4RB1A 4B3SH 4FFBB 1FFXA 3BPZA 1J5EB 4LFBH 4O4LA 5CA1A 4AQYB 1WPBA 4I7HA 3RGXA 2UU9H 4O2BB 5KHIA 4X1YB 3VQWA 2VOBA 5LMUH 5CB4A 1IBKH 3HKEA 4FLZA 4CS4A 4YHHB 5EZYB 5IT9W 4LFCB 2JVDA 2UUAB 4IHJB 4FLWA 5LP6B 1JFFA 4DR7B 2ZIMA 4EFEA 4LF8B 4WBNB 3TY8A 2UUCB 5EYPA 1IBLH 1MZBA 4DV4B 4ZHQB 1HR0H 4FM2A 2VWJA 1P8LA 4YY3B 2RJZA 1Q43A 4ZIBA 5J2TB 2QJ1A 4OX9B 4ZI7B 3HKCB 1XHZA 2HIXA 1X9NA 3HXLA 1FJGH 4UFZA 4JI2B 4LF7H 5FPOA 1M93A 5FNVB 3RR5A 4FLVA 2JS5A 4JI6B 4CS2A 4NXNB 2Q2UA 1KMIZ 1TVKA 1Q8IA 2VQEB 4JI5H 2ZNIA 3DSQA 3JARA 2EX3A 4X20B 2UXBB 3MAQA 5LA6B 4EB6B 4LF9H 3JASA 3LMLA 4GKKB 3K3VA 5JCOA 1X4TA 2P22C 1SYXB 3KXYT 1SEIA 4LH7A 4MTDA 4LF5B 4B08A 3N2KA 5GONB 5LOVA 5IYZB 4IIJA 4UCSA 4E6NA 3BRCA 5LP6C 4GLXA 3U11A 3RYCB 1XMOH 4RAZA 3L4JA 3HKDB 5CA0A 3KYHC 4K0KH 1H2SB 1FVIA 4UCTA 2ZINA 3THOA 4DR1B 3IAYA 2HHHB 2HIVA 4JI7H 3VQXA 3BA9A 4UCOA 3RWRD 4DK1A 2HVQA 3KAKA 3JATB 4X64B 5K1PA 4X62B 2UXCB 3J7AK 3RTXA 4X1KA 1Z2NX 3N40P 3OTFA 3OTOH 1FFXB 4CH3A 3N2GA 1Z5VA 1N33H 4UCUA 4O2BA 2QM4A 4DV6H 5D5QA 5JH7B 2UUBH 4RB2C 1CKOA 3HKEB 3VNNA 1TGOA 1HNXB 4O2AA 3QG5A 4UCVA 4Q0YA 1AN7A 5JJEB 4B3RB 2UUBB 1BJTA 3JAMW 3GJXB 4DV2H 4DRFA 1SQGA 2R9AA 3JAWB 4I55A 5EYPB 2VQFH 4LH6A 4DR4H 3J81W 3SGIA 3BABA 5IJ9B 2PYLA 4LF7B 2W57A 2Q0AA 4IAJA 1FKAH 2UXCH 5D1PA 2VPSA 5FD6A 1M0WA 3CHXA 4EQ5A 2WDTA 4JV5B 4RAYA 1S68A 5KMGB 4LR3A 4DR5H 3ZEDA 3JAKB 3E22B 5D1OB 5LMNH 4DV5H 1E4GT 4DV5B 1QQCA 4X66B 5IWAB 4JI1H 1P49A 5KHHA 4JV5H 4PHZA 4PZ6A 2R70A 2V4DA 3JALB 5K1XA 3JARB 4FM1A 1CKNA 4GKKH 2Q7HA 4EB6A 5JJJB 4FM0A 4PI0A 4O4JB 4DR3H 2ZJTA 2RGRA 1O75A 1G6UA 2CW7A 2YCHA 4BWSC 2UU9B 3N2KB 5GONA 2BTQA 4B3RH 4J0MA 5IYZA 1CKMA 1WNSA 3NBZB 1O9HA 4B3SB 4KL1A 2ZM6H 3HKDA 5CA0B 4X1YA 4JI2H 1SA0B 4DV7H 3RJ0A 4LSXA 4RB3C 4I9QA 2YXLA 2KKWA 3OTOB 4AILC 4U3JA 1Z2OX 1T5EA 1YEWA 3SJCC 4DUYB 4DV4H 3ZS8C 4HBNA 4X1IA 4IHJA 2R72A 4DV0B 1IBLB 3RYFA 4CC6A 4D7SA 1O9GA 5LP6A 5LL6b 4JI7B 5C8YB 4TUYA 4F6RB 4DR1H 5JH7A 4D7TA 4WBNA 4JYAB 4K0KB 2FE3A 4KHPB 4O2AB 1TUBA 1E4FT 4DV3H 3BA8A 2BTOA 4JI1B 3W1GA 3UQ8A 4EEQA 1I94H 5LMUB 5JCOC 2ZNJA 4ZOLB 4DR2H 4JYAH 4X65H 1D5AA 4YJ3B 4I55B 1Z2PX 1WH2A 2JGUA 3H20A 5LXTA 2UXBH 4JI4B 1HNZB 5BMVB 5FPRA 4DR4B 4B3MH 1HW7A 4X20A 3QTCA 4MV7A 4PDBA 1TAEA 1N32H 4O4HB 1QHTA 4B3TB 4JI3B 5EIBC 4FVMA 1Z5WA 1XI1A 5D1OA 4JI6H 1N36B 1HNZH 3N44B 5EOYA 5KHJA 3RYIB 4I50A 2XHBA 3M7MX 5LOVB 2Q2TA 4OX9H 4CH6A 1HNXH 4FM9A 2RGVA 3N43B 5IJ0A 4GKJB 4CH4A 4TV9B 3VQVA 1IBMH 4FLTA 1I94B 4I4TA 4DV6B 3M4IA 3PN1A 3ETQA 4O4JA 3SR2C 4Q6GA 4TOIA 4LNUA 3JATA 4LFAB 4KHPH 1L2ZA 4LFAH 4K8ZA 5LYJB 2GV9A 4MV9A 3F8NA 3N2GB 2HHHH 3K5NA 4LF4B 4X66H 1M4UA 4DUZB 2CFMA 4PZ7A 5LMNB 2HVRA 3KAJA 1SQFA 4K8XA 3K57A 4RB0A 1VS0A 2E5LB 4LFBB 1J5EH 3L4KA 4HNAA 3J80W 2P5OA 1GYFA 4CC5A 3S24A 3HKBA 5D5PA 4B3TH 4TUYB 2F4VB 4F6RA 4DR6H 2PYJA 4DV2B 2HEPA 3UT5B 2PGGA 2KSWA 4FLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB B;  1FJG B;  1TA8 A;  4JI5 B;  1N33 B;  4DR6 B;  3T1H B;  3T1Y B;  4X65 B;  3OTO B;  4GKK B;  4B3M B;  1XK5 A;  5BR8 B;  4DUY B;  4LH7 A;  1B04 A;  4DV0 B;  1IBL B;  4LF5 B;  4CC6 A;  4DR3 B;  4JI7 B;  3JSL A;  4UCS A;  4DV3 B;  4JI8 B;  4GLX A;  1A0I A;  4E6N A;  4LF6 B;  4JYA B;  4K0K B;  4KHP B;  3KYH C;  3L2P A;  1HNW B;  1FVI A;  1XMO B;  2OWO A;  4UCT A;  2UXD B;  1XNQ B;  4DR1 B;  2HHH B;  2HIV A;  4JI1 B;  3BA8 A;  3W5O A;  3BA9 A;  4UCO A;  3W1G A;  3UQ8 A;  2HVQ A;  3NC0 B;  4UCR A;  4X64 B;  4EEQ A;  4X62 B;  2UXC B;  5LMU B;  1IBM B;  3RTX A;  4DR5 B;  3TY9 A;  4LF9 B;  4UCU A;  4JI4 B;  1HNZ B;  4NXM B;  1CKO A;  5FPR A;  4DR4 B;  1CKN B;  5DIS C;  3VNN A;  1N34 B;  1TAE A;  1HNX B;  3NBY B;  4UCV A;  4B3T B;  4JI3 B;  4DV7 B;  4JI0 B;  4B3R B;  1V9P A;  5D1O A;  3W1B A;  1N36 B;  2UUB B;  2ZM6 B;  2HVS A;  3GJX B;  1J5E B;  4DRF A;  2Q2T A;  1N32 B;  4DV1 B;  4AQY B;  1XMQ B;  4LH6 A;  4GKJ B;  3SGI A;  3BAB A;  4LF7 B;  1I94 B;  1DGS A;  4DV6 B;  5D1P A;  3PN1 A;  3BAA A;  4PZ8 A;  4EQ5 A;  4EFB A;  4JV5 B;  4TOI A;  4YHH B;  1S68 A;  4LFC B;  4DR2 B;  1P16 A;  1HR0 B;  2UUA B;  4LFA B;  1ZAU A;  5D1O B;  4DV5 B;  4X66 B;  3QWU A;  5IWA B;  4DR7 B;  4EFE A;  4LF8 B;  4LF4 B;  3JSN A;  4PZ6 A;  1XNR B;  3TY8 A;  2UUC B;  2VUG A;  4DUZ B;  2CFM A;  4PZ7 A;  5LMN B;  4DV4 B;  2HVR A;  1CKN A;  1P8L A;  4YY3 B;  2VQF B;  1VS0 A;  2E5L B;  4OX9 B;  4LFB B;  3GB8 B;  3TY5 A;  1IBK B;  2HIX A;  1X9N A;  4UFZ A;  4JI2 B;  4CC5 A;  5FPO A;  3RR5 A;  1XDN A;  2UU9 B;  4JI6 B;  3S24 A;  4NXN B;  2Q2U A;  1CKM A;  2F4V B;  3GDE A;  3NBZ B;  2VQE B;  4DV2 B;  4B3S B; 
#chains in the Genus database with same CATH topology
 5BYB A;  5DG7 A;  2IU0 A;  2F95 B;  5KX5 A;  5BWV A;  1YJN V;  5C8Y F;  2MCT A;  3H0G G;  1FD9 A;  2UXD O;  3B8M A;  4BIO A;  1EZJ A;  4DV4 O;  4QSH A;  3GTP A;  4DW1 A;  3SI8 A;  3ZMS A;  4JV5 O;  1QVF U;  1Q86 W;  3ZMT A;  2XIG A;  2R92 G;  1C30 A;  4JUZ A;  3JCZ A;  2EIL B;  3KHH A;  2E5L H;  3KKY A;  5LXT B;  4ICG A;  4UV9 A;  3RAQ A;  5BMV A;  3G6E V;  1K7D A;  5CB4 B;  2FML A;  4AQY O;  4LBE C;  3T99 A;  2C2D A;  4M7E A;  1IDS A;  4O4H A;  4QPK A;  5IYZ F;  3DTG A;  4C7U A;  1E4E A;  3ABK B;  4ASU G;  3KAL A;  2UVU A;  2VWK A;  5KT7 A;  4X88 A;  3F5W C;  4GKJ O;  2Q7G A;  1JX4 A;  2A79 B;  5IJ0 B;  1BNC A;  1V54 C;  3BVO A;  4NZN A;  3HOY G;  4NXM B;  2Q67 A;  2NU9 B;  2KB1 A;  1P4R A;  2YZL A;  2W6O A;  5J2U F;  3NBY B;  3KRE A;  2XAF A;  3O9O A;  2OT5 A;  3WB1 A;  4A2A A;  4JV2 A;  1IXB A;  4BBS G;  4IYI A;  1HR0 O;  4KFM A;  2LW1 A;  4CKC A;  5FNV A;  4X1I B;  1IXM A;  2P7T C;  2VQE H;  4LF4 O;  4DL5 A;  3WFV A;  4DV1 B;  1XMQ B;  2GUZ A;  3QO8 A;  2FLL A;  3D36 A;  3U10 A;  4X62 H;  1K4C C;  1DGS A;  1JMK C;  1FXK A;  1RM1 C;  4PWQ A;  4TQR A;  2DIK A;  4JTD B;  2EIN B;  4EFB A;  1IBK O;  4QE7 A;  3MWM A;  5FLX W;  4ABM A;  1HR0 B;  4CS3 A;  1HNW H;  2W0X A;  3SPI A;  5BZB A;  2H8P C;  2IM9 A;  3FKS G;  4YBZ B;  2Y0S E;  1L8D A;  2E3C A;  2A9H A;  5KT3 A;  5DQI A;  5CA1 B;  3GIK A;  1K5Q A;  2UVR A;  2R86 A;  4WFA V;  4TQF A;  5A2Q W;  3GB8 B;  3VQY A;  3TY5 A;  5BPH A;  2YIB A;  2A1H A;  2Y48 A;  1IBK B;  1Y4M A;  4IRK A;  4YJ2 B;  1AR4 A;  3M99 B;  4R50 A;  3TJT A;  3Q4H B;  4DK0 A;  4JI0 H;  3FFQ A;  3GDE A;  5BWR A;  3UKM A;  1W93 A;  3C0F B;  5FL7 G;  5JVD F;  5JQW A;  5LHG A;  2JS3 A;  3L71 H;  4I4T B;  5KAF Z;  4J80 A;  1P7B A;  1BGW A;  4JI3 H;  3RAX A;  1BE3 H;  5LOV F;  1XMO O;  3WO1 A;  4F4X A;  1QR8 A;  3K9A A;  3K79 A;  4B3M B;  5IY5 C;  1VF7 A;  2ZR3 A;  3H01 A;  3J7A U;  5I5S A;  3RFR A;  5BWU A;  2V4Q A;  4CKE A;  3VBB A;  4DR3 B;  2XUM A;  3CWB H;  2W7O A;  4Q4C A;  1Q6H A;  3CRM A;  1S03 G;  2M7W A;  2UXD H;  1WAZ A;  2IH3 C;  2YZN A;  3GTJ A;  3HPL C;  4O82 A;  3STZ C;  4A3J G;  5I5X A;  4DRX A;  4J9L A;  3JRX A;  5KHK A;  4TQD A;  3R5X A;  2R7N A;  3QZ8 A;  1WB8 A;  3NC0 B;  4UCR A;  1IBM B;  5J2U B;  3KTM A;  1K92 A;  1ZX3 A;  4AQY H;  1M0T A;  4MVO A;  1I6U A;  5KFJ A;  3CP1 A;  2EZP A;  1KYO F;  2JJ1 G;  4FJC C;  4O4I A;  4DUY H;  2I8C A;  2CQY A;  2GDS A;  4DV1 H;  1HDJ A;  1NR1 A;  1ROP A;  1Q3E A;  2CTW A;  2CGO A;  3HOZ G;  2ZKO A;  1GN4 A;  1HWY A;  1KEE A;  2W8K A;  2ZM6 B;  1K1Q A;  4PA3 A;  3K5M A;  5L1I A;  2OYQ A;  4A93 G;  3TK1 A;  3BPZ A;  1J5E B;  3H9V A;  4O7T A;  4AQY B;  5CBH A;  2EIJ C;  3CD6 V;  3TW7 A;  4ECU A;  4DIM A;  3L73 H;  2QWO B;  2RDC A;  4E4T A;  5CB4 A;  2W70 A;  1M56 C;  4FLZ A;  1JPX A;  3V4Z A;  1KEC A;  5DLF A;  1PD3 A;  2LGW A;  4LFC B;  1N32 O;  1JVM A;  2UUA B;  3PZP A;  3ETE A;  1H2M A;  1JFF A;  2JA6 G;  4DR7 B;  5LMN O;  3VOT A;  5KUM A;  4LF8 B;  2BOC C;  2ATL A;  2XAG A;  1VQN V;  1M6V A;  4WBN B;  2UUC B;  4C2M A;  3UM7 A;  3CC2 V;  2JA5 G;  4ZHQ B;  1HR0 H;  3JZ6 A;  4DLK A;  2QA4 V;  4YHH O;  2I80 A;  2V59 A;  2QKA A;  1Q43 A;  4ECR A;  4JTA B;  3HKC B;  3AG2 C;  2YYA A;  1BS3 A;  3W7X A;  1XHZ A;  4UFZ A;  4JI2 B;  4LF7 H;  2B63 A;  1MSD A;  4JI6 B;  4KXR A;  4O3O A;  5LYJ F;  1K97 A;  1Q8I A;  2QWR B;  5KFQ A;  2QE7 G;  4JI8 O;  4DL3 A;  3JAR A;  3ABU A;  4GT1 A;  2XAJ A;  5KG1 A;  4LF9 H;  4NXN O;  3QQM A;  4GKK B;  3FAV B;  3L9D A;  1X4T A;  3HB3 B;  4JF3 A;  1SER A;  1SEI A;  1Y67 A;  2P90 A;  1JXL A;  4B08 A;  2GQS A;  5LOV A;  1GN6 A;  1WPX A;  3QNE A;  4A3C G;  1XMO H;  5KT4 A;  2V5A A;  2Z02 A;  3L4J A;  3HKD B;  5CA0 A;  4K0K H;  1VBG A;  1FVI A;  4UCT A;  1VQL V;  4DL7 A;  3THO A;  5E25 A;  2DPJ A;  4H37 A;  4JI7 H;  3RVZ A;  3VQX A;  5EWE A;  3BA9 A;  4DK1 A;  3CCV V;  3H3V H;  2HVQ A;  2Y69 C;  3AG1 C;  3KAK A;  3SJQ C;  5K1P A;  2F4V O;  2R84 A;  3J7A K;  1SQV H;  3N40 P;  4P9O A;  3OTF A;  2V58 A;  3OTO H;  4CH3 A;  4PDV A;  1OCR B;  4NXM O;  1V55 C;  1N33 H;  4QIW F;  4O2B A;  2R82 A;  3CEB A;  4DV6 H;  3LQS A;  3MD0 A;  5JH7 B;  3LWB A;  2UUB H;  3D8C A;  3WG7 B;  2OTJ V;  1TGO A;  1SZX A;  4K35 A;  1E79 G;  4DR5 O;  3RV3 A;  4B3R B;  4AYB E;  3N27 A;  1PX2 A;  4XDJ A;  2J9G A;  4J9M A;  3JAM W;  5KT5 A;  2ZDQ A;  3ZMV A;  1V55 B;  4I50 F;  1ZWI C;  4EBE A;  4FBU A;  1SQG A;  2R9A A;  1ZUQ A;  4F4L A;  3LSQ A;  1Y14 B;  3SGI A;  3BAB A;  4G28 B;  2PYL A;  4LF7 B;  2A06 H;  4WHX A;  1VF6 A;  4IAJ A;  4I5S A;  4L1K A;  5IP7 G;  2VPS A;  2EIJ B;  3CHX A;  5BR8 O;  3GV5 B;  3I4M G;  1DV2 A;  4RAY A;  1S68 A;  4MTO A;  5KMG B;  3ZED A;  1GSH A;  2ZGI A;  1SES A;  1XOU A;  2KSD A;  1TWF A;  2XC9 A;  4DL2 A;  3NR7 A;  1G8M A;  1QQC A;  5LGN A;  5KG4 A;  2ZXW B;  3OMI B;  4O7W A;  2WAQ E;  4J11 A;  4PHZ A;  2R70 A;  2V4D A;  3P3P A;  5K1X A;  5JVL A;  4FM1 A;  4CMD A;  4KUM A;  3I56 V;  4RWU A;  3MFH A;  4FFM A;  3OMA B;  3RUP A;  2OTL V;  2LFR A;  3AK2 A;  1WP8 A;  3GTM A;  4DR3 H;  4O4L F;  1AIL A;  1O75 A;  2Y4U A;  3WWJ A;  4WFE A;  3CS5 A;  5GON A;  3BG5 A;  4J0M A;  5IYZ A;  4U3F H;  3K04 A;  4A3F G;  2DWC A;  1FXH A;  5IYD G;  2JK5 C;  4KL1 A;  3EHB B;  1W59 A;  4FFK A;  4DAA A;  3ZRX A;  1PPJ H;  3GWK C;  4JI2 H;  3I5D A;  4IWX A;  2DMX A;  5IE9 A;  4RNN A;  3RJ0 A;  2UUA O;  2ZR2 A;  1NH2 D;  2HGW A;  1R3K C;  1GGO A;  3OTO B;  3LDE A;  3ZHR A;  3SJC C;  4DUY B;  4PA4 A;  4TSF G;  3AEI A;  4HBN A;  2Z04 A;  2ZDH A;  1I5Y A;  1OCO B;  2R72 A;  1O9G A;  5F2V O;  2EIM C;  1EYZ A;  3G6X A;  1PV0 A;  2ASJ A;  4XYM B;  1KJI A;  3DGE A;  5BWX A;  1SF9 A;  2BSK A;  4MW8 A;  1PM9 A;  1E4F T;  4F4Y A;  1W96 A;  5B1B C;  3I12 A;  4JI1 B;  5JH7 F;  4WFB V;  5HFL A;  5KA5 A;  4I9W A;  4EEQ A;  2ARH A;  1VAR A;  4CE5 A;  3E86 A;  2ZNJ A;  1Q7Y W;  4JYA H;  3H1J H;  1S77 D;  5HV6 A;  4OPA A;  3BJY A;  1WRV A;  3SDL A;  4C5A A;  3RBZ A;  1F4N A;  3H20 A;  4LF9 O;  1W0K G;  3P32 A;  3EXA A;  4B3M H;  4MV7 A;  1DK1 A;  4O4H B;  2QTO A;  4NKG B;  4B3T B;  4JI3 B;  5B1A B;  1KJ9 A;  1Z5W A;  5D1O A;  4I0X B;  5IWA O;  3N44 B;  5EOY A;  5I5U A;  3OUF A;  3LDC A;  3GTL A;  1PP9 H;  3M7M X;  3MR5 A;  5LOV B;  5DM6 V;  2DW4 A;  5BXZ A;  4W4L A;  4A3E G;  4CH6 A;  4FM9 A;  3K5I A;  1V4Y A;  2R92 A;  5IJ0 A;  4GKJ B;  4PBC A;  4JI7 O;  1KBL A;  2JEF A;  2P4V A;  1FPO A;  3N8D A;  2ETN A;  1SRY A;  1S5H C;  3ABM C;  4O4J A;  5KG6 A;  4PDM A;  2YL2 A;  4G3I A;  1IOV A;  4MVQ A;  5F9L A;  1UPG A;  1BZK A;  2JJ2 G;  2GPW A;  4LNU A;  2W0F C;  4JZG A;  4DR7 O;  2NVY A;  4GX0 A;  3CEI A;  1N33 O;  4LFA B;  2DPI A;  4UB8 Z;  1CE8 A;  1R3L C;  1R6N A;  4MV9 A;  1NTK H;  4X89 A;  3W7W A;  4LF4 B;  2C00 A;  4YAJ B;  3K9S A;  2Y0S A;  2QWN B;  5I5T A;  4X9Q A;  1BGY H;  5EBM C;  2CFM A;  2CNV A;  3JZF A;  4PZ7 A;  3VA7 A;  3ABM B;  3KAJ A;  4K8X A;  2B5U A;  5EBL C;  2EJR A;  1NZ6 A;  5EC1 C;  2C2E A;  3GIM A;  2COJ A;  3G4S V;  4YIO A;  5L1L A;  5BY1 A;  3L4K A;  4MS2 A;  2C2R A;  2WLL A;  2P5O A;  1WA8 A;  4CC5 A;  5IYC O;  3IC9 A;  4X65 O;  4LFA O;  2Q69 A;  3S24 A;  3IFX A;  4C5B A;  2JEU A;  4IHJ F;  2F4V B;  1M57 B;  2VPQ A;  3U0G A;  2HEP A;  2CTR A;  2JEG A;  3UT5 B;  1S3J A;  2IW5 A;  2KSW A;  4FLY A;  3WO0 A;  4L8J A;  4PDL A;  2WLN A;  4UVB A;  4ZKI A;  3OW2 U;  3T1Y B;  5KFS A;  3FB8 C;  3JAK A;  3RT3 C;  5KFN A;  4P2Z A;  1R3I C;  4ZOL A;  2ATK C;  1M57 C;  4F6E A;  2YU9 A;  4FFB A;  1YHQ V;  1FYJ A;  2FJZ A;  4ECZ A;  3JSL A;  4DV3 B;  2F43 G;  1A0I A;  4HNU A;  1XNQ H;  3EFF K;  4PA9 A;  2XCP A;  3ZCC A;  3CVZ A;  2Q7E A;  4X64 H;  2EIK B;  3ASO B;  2UUC H;  3OFN G;  1NH2 B;  4O7Z A;  1IVS A;  3K5O A;  4JAV A;  1GO3 E;  2F1M A;  1I7F A;  4CH5 A;  4FLU A;  1SQX H;  1XBL A;  1K1S A;  4RO2 A;  2YIA A;  3RN4 A;  1Q90 D;  3RYI A;  4ME6 A;  3CRA A;  2VQE O;  2BTQ B;  3T54 A;  5EIB D;  3K58 A;  4YHH H;  5BPF A;  2NR5 A;  2J6U A;  1MNG A;  4A3M G;  1JQ0 A;  3AX6 A;  4LF5 H;  3KCX A;  4JZ2 A;  1N0N A;  4GC6 A;  2DWE C;  1RJR A;  4ZI7 A;  1JX9 A;  2ZM6 O;  1Q5O A;  4U3J B;  1N36 H;  4MTE A;  1Y1V G;  2EIY A;  3QO7 A;  1BMF G;  4JI4 O;  4B3T O;  3RGZ A;  5J2U A;  4EEY A;  2JA5 A;  1NVP B;  1VQ6 V;  3K08 A;  4J41 A;  3G80 A;  1IBM O;  2F66 C;  4NXN H;  4MVZ A;  5JVD B;  1I1L A;  1M7J A;  3IGA C;  2OIG A;  4O4I B;  4JI1 O;  3MR2 A;  5EDW A;  1JJ2 U;  4PZ8 A;  5LA6 A;  1XHX A;  3LSS A;  1VP7 A;  4HAM A;  4RUF A;  3OHA A;  4FK5 C;  2L6L A;  2OH2 A;  3A8T A;  4NTX A;  1EZ1 A;  3FKI A;  3N42 B;  1VAJ A;  2VQF O;  1K34 A;  5L3E A;  3QWU A;  1H2K A;  1KP2 A;  3ZJZ A;  3T9D A;  1N8R W;  3M9N B;  4IIJ B;  2NNU A;  1XNR B;  2DWD C;  4NZM A;  3ZN1 A;  1IX9 A;  1EN4 A;  4LP8 A;  4DR2 O;  3H1K H;  1N48 A;  4EBC A;  4JI3 O;  3CB2 A;  3LUT B;  5KX5 B;  4J7Z A;  2A7W A;  1QR9 A;  2QWP B;  4EGJ A;  2W8L A;  4MV3 A;  2YS8 A;  4O7Y A;  3K3W A;  5J9P C;  2AW9 A;  3D3Q A;  5KA6 A;  2PY5 A;  3J81 N;  3UFX B;  2FPP B;  4UXN A;  2IJH A;  2WE6 A;  4ED6 A;  1QU7 A;  5HFM A;  1EFR G;  5CBF A;  5KHG A;  2FMA A;  1N33 B;  3T1H B;  1I94 O;  2AZ0 A;  3B4S A;  2QSA A;  1OBD A;  3K3P A;  3HKC A;  1KKD A;  4YY3 H;  1AI6 A;  3SPH A;  1VQ8 V;  4NB5 A;  1T94 A;  4DUZ H;  1B04 A;  3DC5 A;  4LMY A;  5B1N A;  2PBZ A;  1NT2 B;  1GKF A;  3JAW A;  2E75 B;  2AQ4 A;  1K4D C;  4LF6 B;  1SC5 B;  4TV8 A;  5DGB A;  5FLX N;  3UZO A;  1OBG A;  3DF7 A;  5KG3 A;  5IYB O;  1PNL A;  3E35 A;  3W5O A;  1I3Q A;  3RF2 A;  2F93 B;  2D3O W;  5KFO A;  3ZX6 A;  2WLL B;  1IZ3 A;  2HJW A;  4KP4 A;  2UUC O;  3ABK C;  5FLM G;  1VQ5 V;  4J9O A;  2QYZ A;  3T1Y H;  4RZQ A;  2GUZ B;  1GSA A;  1RYR A;  2X6C A;  3AK3 A;  4DV0 H;  3PVX A;  4QWC A;  4FBT A;  4BY7 G;  3MHS C;  2R87 A;  1DLB A;  1XMQ O;  2X0S A;  2CW8 A;  5LA6 F;  2R6F A;  4J9N A;  1IUR A;  2MW2 B;  2ZT9 B;  5ITZ B;  4QE9 A;  3ZHQ A;  3UO2 A;  2BE3 A;  4KHP O;  1THZ A;  2RN9 A;  3TXQ A;  5C1O A;  1V9P A;  3RYH A;  3ETH A;  5KUK A;  4AYB A;  1YJ9 V;  2DAB A;  2ZE5 A;  4X1K B;  4B3S H;  4FMT A;  3F7V C;  1FFX A;  1Y76 B;  5C93 A;  3UO3 A;  1J95 A;  3CXC U;  4JAA A;  5CA1 A;  3RGX A;  2CH7 A;  3MDS A;  1VF5 B;  4DV5 O;  1VKZ A;  5KHI A;  3T9E A;  2UU9 H;  1NVP D;  2VOB A;  2DQ0 A;  2W6I G;  1CQJ B;  1IBK H;  2WPD G;  5B3S B;  3TET A;  1I7N A;  1KP3 A;  3IN5 A;  4UB6 Z;  1HNW O;  5LXT F;  5IT9 W;  1L0N H;  2JVD A;  3GIL A;  3FD9 A;  2FK1 A;  2X7R B;  1YTF B;  1FS0 G;  2NVX A;  2ZIM A;  1Y1W A;  4H0L B;  3OE7 G;  2JA8 G;  3R5F A;  3SE7 A;  2IJI A;  2YDE A;  1OCC B;  5EYP A;  1XDC A;  2QR4 A;  3GIJ A;  2QM7 A;  2VWJ A;  4YY3 B;  4BXX G;  1T3N A;  1H8H G;  1BSM A;  4OX9 B;  5J2T B;  5KFU A;  5EC2 C;  1X9N A;  4U7O A;  2VS0 A;  4PV1 B;  3APO A;  3HXL A;  2HHF B;  5FJ8 G;  5FPO A;  1M93 A;  1VEW A;  1K33 A;  3RR5 A;  2JA7 G;  4CS2 A;  5FNV F;  5DGI A;  1GM9 A;  1TVK A;  4RUC A;  1Y1V A;  3WWH A;  4J9S A;  4R8U A;  2VQE B;  4JI5 H;  4ECY A;  3OR6 C;  4MT8 A;  2ZNI A;  4O84 A;  3KZI Z;  3GII A;  4CBC A;  1XL6 A;  2UXB B;  1CEZ A;  1GRJ A;  4L87 A;  5LA6 B;  2E2I A;  4ED2 A;  1WR2 A;  2R7K A;  4HQ6 A;  3A0B Z;  3K3V A;  5JCO A;  1Y6X A;  1RSO B;  1QBZ A;  2P22 C;  1SYX B;  2FL4 A;  5L3D A;  3T1H O;  4MTD A;  3OUZ A;  5DN6 G;  4LF5 B;  2EJ0 A;  5IYZ B;  4E6N A;  1OCR C;  3BRC A;  3H1I H;  5LP6 C;  4DV6 O;  3U11 A;  3RYC B;  4CKB A;  2IBK A;  4J42 A;  4J7K A;  3CME V;  2HG8 A;  4EBD A;  1VMG A;  2ZIN A;  4DR1 B;  3IAY A;  1RJP A;  4XDK A;  2RF4 A;  2HIV A;  4O3P A;  4FFP A;  4NLG A;  1RM1 B;  3JAT B;  2VQD A;  4Z2W A;  2ZDI A;  4ZOL F;  1VQO V;  2OCH A;  3N2G A;  2EBO A;  4IYH A;  1D2D A;  3FB5 C;  4BW5 A;  1DF4 A;  4UCU A;  3AYH B;  2JIZ G;  5CA0 F;  3JD2 A;  4ECX A;  2E5L O;  4RB2 C;  5IYD O;  2HHH O;  3MFI A;  3DC6 A;  3D3I A;  4O2A A;  3QG5 A;  5KLV H;  3V6H A;  1OJH A;  1FJG O;  4Q0Y A;  2G38 A;  1IOW A;  2QKS A;  1BJT A;  1VQK V;  3RV4 A;  3GJX B;  4DV2 H;  1LNQ A;  1BCC H;  4DRF A;  3CJH A;  4I55 A;  3NXS A;  2Y4R A;  4IR9 A;  1KBH A;  3HO8 A;  4DR4 H;  2R93 G;  5IJ9 B;  2VA3 A;  2Q0A A;  5KG7 A;  5FD6 A;  3E8G A;  1JR9 A;  4JV5 B;  2R7L A;  1OCO C;  3SPG A;  2UU9 O;  5LMN H;  4DV5 H;  1XNR O;  4X66 B;  5KFV A;  4U6P A;  3T1C A;  5IWA B;  5J2T F;  4X62 O;  2X0L A;  2HVK C;  3T9A A;  1HP8 A;  3M9O B;  4FFN A;  4PEL A;  4PZ6 A;  1KJQ A;  3JAL B;  4P9P A;  3FDS A;  4GKK H;  4Q20 A;  2XGQ A;  1H2L A;  4EB6 A;  1S76 D;  1SET A;  3CCS V;  3PFF A;  4LWS B;  4FM0 A;  1AR1 B;  4O4J B;  5L3G A;  3FAV A;  2ZJT A;  2ALZ A;  2FK2 A;  4IIJ F;  1G6U A;  2R85 A;  2UU9 B;  3N2K B;  1AUX A;  4NYE A;  4B3R H;  1E1Q G;  4NTW A;  1OWT A;  2HP8 A;  2WA3 A;  4PA6 A;  2FLP A;  5L3F A;  2ZM6 H;  4X1Y A;  1CPY A;  5L1K A;  2CTP A;  2ITC C;  4GC7 A;  2J6S A;  4DV7 H;  3W7S A;  3CC4 V;  2IBZ H;  3E8F A;  2GSM B;  4YJ3 F;  4RB3 C;  1BXR A;  4LC1 A;  5H2F Z;  2KKW A;  1YEW A;  3DAA A;  4MV6 A;  2AGP A;  4DV0 B;  5LL6 b;  4D7S A;  3LDD A;  4CC6 A;  2EJ3 A;  4JI7 B;  5C8Y B;  4O7V A;  4TUY A;  4A3K G;  4F6R B;  5DAA A;  1B3Q A;  1AP5 A;  5JH7 A;  3TIN A;  4JYA B;  3BEH A;  2NU7 B;  5DG8 A;  4U7N A;  1FXK B;  1JIH A;  1I2L A;  3ETG A;  1TUB A;  4FGR A;  1YIJ V;  2DAA A;  2AGO A;  1EBO A;  3U54 A;  3CCU V;  3U55 A;  5KFB A;  4HNV A;  4RUE A;  2EIM B;  5KX5 F;  5JCO C;  4ZOL B;  2KG7 A;  4DR2 H;  2HG5 C;  4J9K A;  1D5A A;  1EM1 A;  2WAQ A;  3GV7 B;  1XIL A;  1A32 A;  3B40 A;  3LNM B;  4ECQ A;  2COI A;  2ZDG A;  4BIZ A;  3ZBH A;  1Y74 B;  1PL4 A;  4PJ0 Z;  1I7L A;  4DR4 B;  1HW7 A;  1S10 A;  4PDB A;  1KQS U;  4O7R A;  1ZQ7 A;  1VBH A;  5EIB C;  3J80 N;  4FVM A;  3G8D A;  3CX5 F;  1XI1 A;  3JCU Z;  2PF4 E;  3LSU A;  3RB4 A;  5L3C A;  4FE2 A;  1HNZ H;  1R3J C;  4NR1 A;  2Q6A A;  4G27 B;  4OX9 H;  3STL C;  4QWE A;  4ZQI A;  2RGV A;  3VPB A;  2Z5U A;  4PA7 A;  1RFY A;  1TUE B;  3G67 A;  4CH4 A;  3Q8P B;  3VQV A;  3QO5 A;  2HR3 A;  4I4T A;  5H5N A;  2WSS G;  4DUZ O;  4NYK A;  3ETQ A;  3AW8 A;  2XD4 A;  2W6M A;  2ODT X;  1KJJ A;  5B66 Z;  4CHI A;  1Q81 W;  3Q8Q B;  4O2B F;  3JAT A;  2D2C B;  4JAS A;  3CCE V;  1GTO A;  3X2Q B;  2SCU B;  5LYJ B;  4LFA H;  3HB9 A;  2GV9 A;  4IRD A;  2Z0A A;  4O4H F;  3F8N A;  3N2G B;  2HHH H;  1EN6 A;  3NGD A;  1OHH G;  5BMV F;  3CRC A;  4JTC B;  4FPP A;  4HYK A;  3FB7 C;  2JGD A;  5DG9 A;  3Q2O A;  3FYE B;  5IYC G;  4YR3 A;  3MWD A;  1PK8 A;  4LFB B;  1J5E H;  5C44 G;  1GYF A;  4QW9 A;  4HNT A;  1G1X B;  3ABT A;  1KKC A;  2V9W A;  1QCE A;  5KT2 A;  5CA3 A;  4XDL A;  4ZI7 F;  3TEK A;  1EN5 A;  2BSK B;  2XGP A;  1AJP A;  4F50 A;  3GIQ A;  2XAS A;  2FTK A;  1SS3 A;  1FFT B;  1TA8 A;  1C3O A;  2O03 A;  1RPO A;  2YZM A;  3CQZ A;  3RW0 A;  2WAM A;  3DXR B;  4D6T H;  1N34 H;  5EK0 A;  3VPD A;  3QFF A;  3TGU H;  4JYB A;  2XOK G;  2FKL A;  2YEV A;  2XCA A;  2CNU A;  2FP4 B;  4NZO A;  4EYI B;  4FFL A;  3A2F A;  3EPI A;  2B63 G;  3JAL A;  3L2P A;  3GWO A;  2OWO A;  2UXD B;  3E8B A;  4JI8 H;  4LF8 H;  3EVK A;  1M5I A;  3HOX G;  1N36 O;  2EJ2 A;  2FPG B;  1S5J A;  1K3E A;  3N6R A;  4MW3 A;  4IRC A;  3ZHT A;  2AHZ A;  3F7Y C;  3QVN A;  1BQ0 A;  1JFF B;  3N6X A;  4M9U A;  3GTO A;  2PUS A;  3AK1 A;  2HGS A;  3OUS A;  1W0J G;  2WLI A;  4TV8 B;  4YIP A;  3EYY A;  2Z3Y A;  1SA0 A;  2NU6 B;  2W9A A;  4LF6 O;  1GN3 A;  4O81 A;  2Q73 A;  2EUL A;  3OHB A;  4JI0 B;  3RGB A;  4ED7 A;  4ETS A;  4AHC A;  2C22 A;  2UXX A;  5K2M A;  5DGH A;  3W1B A;  3H4B A;  2WA4 A;  2VRZ A;  2A3Q A;  5C8Y A;  3WWI A;  2VR1 A;  4ED3 A;  2P06 A;  3WU2 Z;  4QGP A;  4Q8E A;  2JA6 A;  1EUC B;  1DAA A;  5LBQ A;  3T5L A;  4N23 A;  2PI5 A;  1Q6U A;  3ASO C;  5IYB G;  2AGQ A;  5KG0 A;  1P16 A;  2IMW P;  2LFS A;  1Q6I A;  1SFO A;  1ZAU A;  1ENV A;  1OCC C;  2RMK B;  3T9C A;  3ZHU A;  2WYO A;  3ZHS A;  4YP3 A;  1WSC A;  5JJN B;  1MMM A;  5CR5 A;  2QEX V;  1QLE C;  4O4L B;  2C2A A;  5GW7 A;  4MV4 A;  2Q68 A;  5L9X A;  3MHH C;  3N41 B;  3CXH F;  1R1B A;  1HNZ O;  4TM5 A;  5KS8 A;  2RCV A;  4RNO A;  3QF7 A;  3P30 A;  2QK4 A;  4HR7 A;  1XRE A;  5E1A C;  3ZHV A;  2WLJ A;  2YWV A;  4IGG A;  4OPH A;  1XDN A;  4GKJ H;  4BAY A;  1GAX A;  4RQF A;  5KFK A;  1XUQ A;  4Y8V B;  3HBL A;  2E76 B;  3OSN A;  1EUD B;  2ZIO A;  4DV3 O;  1H2N A;  3ZRW B;  3LNN A;  3I55 V;  1MZF A;  4J7J A;  4WF9 V;  3IG0 A;  2IJK A;  2XTA A;  4R7R A;  1JOY A;  1VF6 C;  2DYS C;  1WP7 A;  1XK5 A;  4NTY A;  1WJZ A;  1KU9 A;  2ZQM A;  3PR5 B;  5LYJ A;  3JD3 A;  3BFR A;  2PMZ E;  1B06 A;  3R23 A;  1NU1 H;  2JEJ A;  3B77 A;  2ASD A;  1S9F A;  1N34 O;  2Q5Z A;  5H9C A;  4ZHQ F;  2EIL C;  4TQS A;  3G6V A;  2AU0 A;  1Y1W G;  3OMN B;  4FLX A;  4YXW G;  4BR6 A;  2PI4 A;  1XMO B;  1XNR H;  1VQP V;  1XNQ B;  1KUQ A;  1WLE A;  2ILM A;  4QWD A;  4MTX A;  5KMG A;  3JAS B;  3G6Y A;  4TT3 G;  3ASN B;  4FIP C;  1I1M A;  3H1H H;  2HKO A;  4O7S A;  4B3S O;  3HKB B;  3SPC A;  3OAA G;  3WB2 A;  2IH1 C;  4HZ3 A;  3RVY A;  3W7U A;  4LF9 B;  2V1D A;  1KT8 A;  4W4K A;  5JVD A;  2YIB D;  3OGI B;  4DL6 A;  1JJO A;  2E2H A;  2BQU A;  5DIS C;  2PTM A;  4J9R A;  2E74 B;  3TII A;  2RDI A;  5JQG B;  2A0L A;  2VA2 A;  2UVV A;  1L1F A;  1NI8 A;  4DV7 B;  3GLK A;  1WN7 A;  2N04 A;  1XQ8 A;  4JGS A;  4A5U B;  2GBO A;  2L35 A;  4MVM A;  2DE0 X;  4H33 A;  4JI0 O;  2PZS A;  2LP7 A;  2EJ7 A;  5BWT A;  4O3Q A;  4LFB H;  3T5K A;  5I5V A;  5GTI Z;  4I7H A;  1WPB A;  1V51 A;  5KG2 A;  3L70 H;  3ABL C;  3VQW A;  5LMU H;  1BT8 A;  3HKE A;  3CCR V;  4CS4 A;  1U97 A;  4YHH B;  4DL4 A;  5EZY B;  2FB9 A;  2JRI A;  3JRW A;  3UZB A;  4IHJ B;  4FLW A;  5LP6 B;  2FB5 A;  1QLN A;  2WB1 A;  1OZ0 A;  3M8A A;  1KC8 W;  4EFE A;  3T9B A;  2C28 A;  3T4D A;  1R6T A;  1E1R G;  1MZB A;  2LQT A;  5HNE A;  4DV4 B;  1P8L A;  5DED A;  2DN9 A;  4QNH B;  1AI5 A;  1I1K A;  4QIW A;  2V4R A;  3JZI A;  4FU0 A;  2HIX A;  3TW6 A;  3RB6 A;  3K5H A;  5FNV B;  3E2E A;  2JS5 A;  3HOV G;  4NXN B;  1B6Q A;  1KMI Z;  3SNO A;  4YR0 A;  1EHI A;  1AVM A;  4CZZ A;  2ABJ A;  2P0A A;  4F4W A;  5IDJ A;  1IBL O;  2Y4T A;  2FPI B;  3DSQ A;  2EX3 A;  5KFT A;  4HN2 A;  1W2B U;  2Q8V A;  1UJW B;  4EB6 B;  1P7G A;  1F7Y A;  1SCU B;  1M1K W;  1X59 A;  4Q4D A;  1M56 B;  4RCN A;  2O57 A;  1K83 A;  3LML A;  4U7C A;  4I0X A;  4WFG A;  3KXY T;  1MSW D;  3BY6 A;  2R8K A;  5DQG A;  3N2K A;  3CE2 A;  3U9S A;  1BHB A;  4UCS A;  4K6N A;  4GLX A;  2YS7 A;  3V4S A;  4M0J A;  5KFR A;  5B1B B;  3Q8S B;  5CAE B;  4RAZ A;  1GM7 A;  4O4I F;  1H2S B;  1HNX O;  1P84 F;  2K9P A;  3MJF A;  4JYC A;  1I08 A;  2HFE C;  4WFF A;  3ZRS A;  2W9C B;  1SQP H;  4X62 B;  1XNQ O;  2UXC B;  3R9R A;  3RTX A;  3T1Y O;  2EIN C;  4X1K A;  3Q8R B;  4DV2 O;  4J9Q A;  1S0V A;  1FFX B;  1Y76 A;  4GX1 A;  3MR6 A;  5KFX A;  3GIP A;  1RP3 B;  2QM8 A;  2AXT Z;  2UVW A;  3FB6 C;  2QM4 A;  4DR4 O;  2PVP A;  1ORQ C;  5D5Q A;  3OR7 C;  1CKO A;  3E5N A;  3ZRW A;  3E89 A;  5CBG A;  1HNX B;  2AGA A;  4A3G G;  3AG4 B;  5JJE B;  1CP9 A;  4I55 F;  1YJW V;  4JYY A;  4QPJ A;  2UUB B;  5DEC A;  2CGN A;  2ODM A;  4RU9 A;  1NTM H;  2KG7 B;  5CN0 A;  1M90 W;  1D5N A;  5EYP B;  5B5E Z;  3H4D A;  3J81 W;  2UXC H;  2W57 A;  5KFI A;  5D1P A;  1IYE A;  2J6T A;  1M0W A;  4EQ5 A;  3T5J A;  3PO3 G;  2H94 A;  1MA1 A;  4ED0 A;  5LGT A;  2IU3 A;  3JAK B;  2HHF A;  4XX0 B;  5C3E G;  4FFR A;  1VIB A;  1E4G T;  4DV5 B;  4RNM A;  2DJV A;  2ADQ B;  4JYA O;  4H13 B;  4JI1 H;  4MAM A;  1AUV A;  1WCM A;  5KHH A;  4WD3 A;  2GHY A;  3ZRV A;  4QWB A;  1FXV A;  3VMM A;  3OSP A;  4EGQ A;  4DV7 O;  4B3M O;  2Q7H A;  1JCH A;  2LJ2 A;  4JXU A;  4GX2 A;  4PI0 A;  1YCI A;  2ZD9 A;  2RGR A;  2YCH A;  3OTO O;  4BWS C;  2BTQ A;  1CKM A;  1WNS A;  3NBZ B;  5FR9 A;  4JV1 A;  1AI7 A;  1VQ7 V;  4B3S B;  3RFC A;  1SQB H;  2DYR C;  4DR6 O;  3K0D A;  2R8J A;  3ML0 A;  4A3B G;  1I5X A;  3HR0 A;  1SQQ H;  2YS6 A;  2JGD B;  4J9Y B;  1JA8 A;  2QB5 A;  3D36 C;  1CQI B;  4TUY F;  1YIT V;  3SPJ A;  3R5H A;  5KFF A;  4ED1 A;  4AIL C;  4U3J A;  1T5E A;  3JYC A;  4DV4 H;  4F4Z A;  1QVG U;  2LO1 A;  4IHJ A;  4I4T F;  2KQX A;  3RYF A;  5LP6 A;  2CNQ A;  3GB7 C;  3AG3 C;  4DQN A;  2YSU B;  1Z2G A;  4DR1 H;  2QF7 A;  4TV8 F;  4WBN A;  3CMA V;  4K0K B;  5A2Q N;  3JD1 A;  1I2K A;  4J9P A;  1EZV H;  3ORQ A;  2W9B B;  4O2A B;  3BQ1 A;  4P30 A;  3L75 H;  3PW5 A;  1ARO P;  2BTO A;  3RB0 A;  3X2Q C;  4DUY O;  3UQ8 A;  3EPG A;  2FKX A;  1I94 H;  4YQW A;  5LMU B;  4YJ2 F;  2N05 A;  1QNM A;  2VUM A;  5IT9 N;  3BQ0 A;  1V54 B;  4X65 H;  1ZET A;  5C1P A;  4PD4 F;  4YJ3 B;  3AG1 B;  4R7C A;  3CJH B;  4I55 B;  1B6S A;  1H2G A;  2JGU A;  1S0M A;  2CKZ B;  5L1J A;  5LXT A;  2UXB H;  3NUA A;  5BMV B;  4H44 B;  1TAE A;  1N32 H;  4O3R A;  5DLG A;  2W6Z A;  5A9G A;  1YF2 A;  1KB9 F;  4XYL B;  3T9F A;  1CS0 A;  5EWF A;  2YC0 A;  3GVM A;  1N36 B;  3BCC H;  4I50 A;  2XHB A;  3BAC A;  1GK9 A;  5LL6 Y;  4JAU A;  3AG2 B;  2ASL A;  2Q2T A;  4EYH B;  1HNX H;  3UYY A;  4Q8F A;  4QJF A;  4TV9 B;  2BOB C;  5BYA A;  1PNM A;  2NN4 A;  1I94 B;  3M4I A;  3PN1 A;  4LWS A;  3SR2 C;  4XBF A;  4Q6G A;  4DXW A;  1RK5 A;  4J10 A;  2W9C A;  2ZE6 A;  2LW7 A;  3R65 A;  2AHY A;  2Q9L A;  2YXH A;  4KHP H;  1L2Z A;  3G8C A;  4B7E A;  4K8Z A;  2QKC A;  4GLW A;  4TWK A;  1DV1 A;  4Q44 A;  1S5L Z;  3KHG A;  3K5N A;  1DIK A;  2EIK C;  2QGN A;  1GLV A;  4IR1 A;  1M4U A;  1UFI A;  5EZY F;  2OLS A;  3CRR A;  4R8C A;  1SQF A;  2WLH A;  3K57 A;  4RB0 A;  1VS0 A;  3M9M B;  5JWP A;  1NBM G;  1KC7 A;  3VPC A;  2WLM A;  3R66 A;  3J80 W;  2LGQ A;  3FYI B;  3GTK A;  3ABL B;  3CCM V;  5JQG F;  4B3T H;  2X6B A;  4TUY B;  4F6R A;  2UXC O;  1FAF A;  2CK3 G;  1PKX A;  4DV2 B;  1NTZ H;  2W9B A;  5JUM A;  3O65 A;  3G71 V;  3H0G A;  4LSA A;  1TUB B;  1KJ8 A;  4JI5 B;  4Z1M G;  2IP4 A;  1YTF D;  3RIZ A;  2X5R A;  4DR6 B;  5ITZ A;  3HOU G;  2F4V H;  1A3G A;  3B09 A;  4X65 B;  1GSO A;  4O83 A;  3RYH B;  1H8E G;  1LUW A;  5BR8 B;  2YW2 A;  4QWA A;  4NXM H;  3FMA A;  4YJ2 A;  2Y0P A;  3Q4H A;  1GM8 A;  3E8H A;  5KFG A;  2UUB O;  3WNZ A;  2JEX A;  2CH7 B;  1RK6 A;  1Y74 A;  1COW G;  1WCM G;  1HNW B;  4MVS A;  1EKP A;  5LP6 F;  1SKV A;  3ASN C;  2YXY A;  3G6B A;  4LF6 H;  2NU8 B;  1MAB G;  2YIC A;  3AG7 A;  3JD4 A;  2OIE A;  2W6N A;  2ZCE A;  4DR7 H;  2RNB A;  3ETJ A;  2DOS A;  2NLJ C;  1Q82 W;  2YRX A;  3TY9 A;  3T1H H;  4MSW C;  4PI2 A;  1PNK A;  3A0H Z;  4BWA A;  4BBR G;  5BR8 H;  1N56 A;  4HYO A;  1N34 B;  1AJN A;  2R9R B;  3B2E E;  1G4Y B;  2RQ6 A;  5J2T A;  1NKD A;  2YI8 A;  4DRX B;  5LGU A;  3SYP A;  5CMU A;  3ICX A;  4DR1 O;  3RYF B;  1TVK B;  3WB0 A;  4QW8 A;  1N32 B;  4R8U B;  5HBR B;  2EZO A;  2PN1 A;  3JD0 A;  3RBD A;  4UUJ C;  2HGX A;  3OUU A;  1AI4 A;  1RJQ A;  3SJA C;  2RDJ A;  1ZL8 A;  3BAA A;  3TCU A;  4YB8 B;  3K03 A;  3ZIA G;  5JQG A;  2PMZ A;  4A3L G;  1K8A W;  3L74 H;  2W6Q A;  2OCC B;  4HNA B;  2P4K A;  4DR2 B;  1RSO A;  2XT9 A;  4MA5 A;  4GZR B;  5LHH A;  2QWQ B;  4YJ3 A;  4LF4 H;  4PDR A;  2XCL A;  3JSN A;  5GTH Z;  4JI2 O;  4BW9 A;  1JKJ B;  3RYC A;  3TQT A;  2VUG A;  3AG4 C;  4A2B A;  4ECS A;  2YI9 A;  2UUA H;  3SYA A;  1XMQ H;  3K0G A;  2VQF B;  2R8G A;  5E79 Z;  1AP6 A;  4QIW E;  3CSX A;  5I5Y A;  3PR4 A;  1K5S A;  2QDO A;  4ECV A;  5EZY A;  2GQR A;  4ZBM A;  4WCE V;  3T7A A;  3OD4 A;  4NVP A;  4R6Z A;  1NQT A;  4I50 B;  1YSC A;  1ZHS A;  1BHA A;  3SYQ A;  4UVC A;  4GKK O;  3A0R A;  5BWW A;  4K3A A;  2XAQ A;  3F5T A;  3QZ7 A;  4GYC B;  3B8N A;  5DQH A;  4TV9 A;  3MWE A;  4ZHQ A;  1FJG B;  1SZT A;  4RQE A;  3MR3 A;  3C90 A;  5I5W A;  2WTF A;  4OXS A;  2IA6 A;  1YXB A;  1KTA A;  4O7L A;  4LNU B;  3HKZ A;  4JI4 H;  2OCC C;  3I4N G;  4AI8 A;  2CAZ C;  2HJD A;  3DTF A;  5CA1 F;  2BR0 A;  4JI8 B;  1S0O A;  2WLI B;  4MTF A;  5IJ9 A;  2CUG A;  1UC9 A;  5KFY A;  5CM0 A;  3RB3 A;  2Y0I A;  4APM A;  4LFC H;  2FLN A;  3SJB C;  1MOF A;  3BHP A;  5IWA H;  4X66 O;  2P67 A;  3E22 A;  3T5H A;  1WA8 B;  1B33 N;  2H3O A;  4DR5 B;  4A3D G;  3K59 A;  4O7N A;  4UUG A;  2YZG A;  4O2A F;  3U0Z A;  2W7P A;  2ZDI C;  5H6R A;  3WG7 C;  5KFE A;  5FD5 A;  4JI5 O;  3UT5 A;  3SYC A;  4XZ3 B;  3FKI G;  3PW0 A;  1CKN B;  4GCZ A;  3K5L A;  1GH6 A;  1US6 A;  5CB4 F;  1ZHQ A;  2ADP A;  3AG3 B;  1NS1 A;  4WBN F;  4IZO A;  5GON F;  2HVS A;  5DGA A;  2COG A;  2DYS B;  2FYU H;  4RB1 A;  4FFB B;  1RYS A;  1NR7 A;  3GTG A;  4O4L A;  4YR2 A;  3PW4 A;  1AR5 A;  5EBW C;  3L72 H;  4O2B B;  2N74 A;  5F9N A;  4X1Y B;  3HKZ E;  4RAI A;  3S3W A;  3K06 A;  3T4Z A;  2GLT A;  4FZ0 A;  4YY3 O;  1CXZ B;  2CE4 A;  4I7Z B;  5H6Q A;  4LCU C;  4OX9 O;  3LUL A;  3W7T A;  1R6K A;  4DYL A;  1IYD A;  1F4M A;  4IWY A;  3VOU A;  3TY8 A;  2XAH A;  1IBL H;  5KFM A;  2HLD G;  4FM2 A;  1EKV A;  1I0H A;  1UNN C;  1QLE B;  5KKN B;  2RJZ A;  3CPW U;  5KG5 A;  1JLL B;  4ZIB A;  1PL0 A;  2QJ1 A;  4ZI7 B;  4TVI A;  2WB1 E;  1FJG H;  4O3N A;  2UXB O;  4EG0 A;  4WFH A;  4DR3 O;  1AB3 A;  2HDK A;  4FLV A;  5KFZ A;  5H80 A;  2Q2U A;  1GO3 F;  1XL4 A;  4E2L A;  4B7K A;  4O4J F;  4JV0 A;  1JDB B;  2R7Z A;  1J5E O;  4MV8 A;  2R9I A;  4X20 B;  3MAQ A;  2FK3 A;  2VUM G;  1B6R A;  3HT5 A;  4G2K A;  3JAS A;  1S0N A;  2B1G A;  4X64 O;  5B3S C;  4O3S A;  2R7Z G;  5KFP A;  3JAM N;  2DQ3 A;  4LH7 A;  4DW0 A;  5AG2 A;  1S72 V;  5D8D A;  2YUA A;  5GON B;  3KCY A;  2GPS A;  4IIJ A;  3OEH G;  1BQZ A;  1YDX A;  3C3T A;  1YZB A;  2V7Q G;  3CCQ V;  3GQC A;  3KYH C;  3HOW G;  2BCC H;  3KG2 A;  3P3N A;  4LF5 O;  2HHH B;  1DTO A;  5I47 A;  4Q43 A;  4UCO A;  3RWR D;  4BIU A;  4N21 A;  3T2M A;  4X64 B;  1N0J A;  3TXS A;  1ZTE A;  1OCZ B;  1JDE A;  5T14 A;  1Z2N X;  2P6J A;  2ZE8 A;  4MV1 A;  4FS2 A;  1ET0 A;  1Z5V A;  4JI6 O;  1U96 A;  5LHI A;  5B1A C;  2AZ2 A;  3HKE B;  4K0K O;  3TIG A;  3VNN A;  4CMF A;  5L3B A;  3CYO A;  3UCS C;  4UCV A;  1AN7 A;  1OCZ C;  4E4E A;  1A48 A;  2CDY A;  4LF8 O;  1F23 A;  1OV9 A;  3E83 A;  4J9Z B;  3PW7 A;  3FX7 A;  3ZN0 A;  2K1E A;  4FS1 A;  3JAW B;  5LMU O;  4JPR A;  2VQF H;  4LH6 A;  4OGQ B;  1MG1 A;  3LP8 A;  1FKA H;  3BQ2 A;  2DLN A;  4EKW A;  2WDT A;  5KFC A;  2QTS A;  3DXR A;  1VQM V;  1Y66 A;  4LR3 A;  1LUV A;  4DR5 H;  3E22 B;  5EWG A;  1K9M W;  2W6J G;  5D1O B;  2YEV B;  2B1I A;  2CZG A;  5I60 A;  3U9T A;  1P49 A;  4JV5 H;  1AJQ A;  3GID A;  5KFH A;  5IY5 B;  1YVW A;  1VQ9 V;  4QJF B;  5KFA A;  3JAR B;  3CCL V;  2DYR B;  1CKN A;  1TWG A;  4C5C A;  2C35 B;  4A3I G;  1NJI W;  5JJJ B;  4ECW A;  1UC8 A;  2B9Z A;  1E4E B;  4GUN A;  4IL6 Z;  1KUT A;  2CW7 A;  1ULZ A;  4Q45 A;  3KHR A;  1DF5 A;  3PW2 A;  1LR1 A;  2X6A A;  4DV1 O;  3H40 A;  3CSW A;  2WLK A;  1WB7 A;  4MA0 A;  2CTQ A;  3OGC C;  1O9H A;  2R8H A;  1G2W A;  4UVA A;  2R7M A;  1F51 A;  3ETD A;  3GV8 B;  3RBE A;  1R9T A;  3HKD A;  5CA0 B;  2M05 A;  3IC7 A;  1N4C A;  1SA0 B;  2Q7D A;  1R73 A;  2XND G;  5KFW A;  4LSX A;  2ITD C;  4I9Q A;  3ZMU A;  4ECT A;  2YXL A;  1RPR A;  3V6K A;  1Z2O X;  4FFO A;  5KT6 A;  4O86 A;  3ZS8 C;  1M9N A;  5C5J A;  4X1I A;  1S97 A;  3C3S A;  1IBL B;  2ZE7 A;  3TQ1 A;  2I87 A;  5CE8 A;  4DO2 A;  4D7T A;  3DTU B;  3Q1K A;  1EKF A;  4X8A A;  2FE3 A;  4KHP B;  4ED8 A;  1TWC A;  4TV9 F;  2HVJ C;  4DV3 H;  2YID A;  4DV0 O;  2Q4P A;  1GMG A;  3BA8 A;  2JDI G;  5KAI Z;  3W1G A;  1TWH A;  5IP9 G;  3GTQ A;  1ZLZ A;  2W71 A;  3V6J A;  5TIS Z;  3S3X A;  1Z2P X;  1WH2 A;  2WWW A;  1FXK C;  4LF7 O;  3KHL A;  4JI4 B;  1L0L H;  1HNZ B;  5KFD A;  4MVU A;  5FPR A;  4X20 A;  2JA7 A;  3QTC A;  2MK3 A;  5DMX A;  4FZ1 A;  1KD1 W;  4YAK B;  1VQ4 V;  1QHT A;  1TWA A;  1URF A;  2F23 A;  4JI6 H;  5C4X G;  3OEE G;  3CCJ V;  4BY1 G;  4B3R O;  5KHJ A;  3RYI B;  4MVR A;  3IJ4 A;  3SYO A;  2YRW A;  2HJF C;  3N43 B;  3ORR A;  2DZD A;  3CC7 V;  1IBM H;  2Q0O C;  4FLT A;  4DV6 B;  3OT7 A;  4TOI A;  2GTS A;  1T36 A;  4LFB O;  1XEQ A;  1K73 W;  3OM3 B;  2BQ3 A;  2R93 A;  1MZE A;  4LFC O;  2UXN A;  1A0G A;  3PO2 G;  2JEI A;  4Z1V A;  5K3W A;  4X66 H;  2BQR A;  2M6Y A;  4DUZ B;  2ZXW C;  5LMN B;  4RUA A;  1ZSP A;  2HVR A;  1H38 A;  3H1L H;  4IT5 A;  2R8I A;  1ZL8 B;  2E5L B;  1I50 A;  1BL8 A;  5B1O A;  3PJS K;  4MTG A;  5KFL A;  1A9X A;  1YI2 V;  4HNA A;  2NUA B;  4GX5 A;  4RZR A;  3HKB A;  3CRQ A;  5D5P A;  1FKA O;  3ZMZ A;  4DR6 H;  2Y69 B;  2GTA A;  2PYJ A;  1GN2 A;  4UV8 A;  2IJJ A;  2PGG A;  2W6P A;  3APQ A; 
#chains in the Genus database with same CATH homology
 4LSA A;  1TUB B;  1TA8 A;  2O03 A;  4JI5 B;  2F95 B;  4L8J A;  5KX5 A;  3RIZ A;  4DR6 B;  5ITZ A;  3T1Y B;  2MCT A;  2F4V H;  1N34 H;  3JAK A;  4X65 B;  3RYH B;  5BR8 B;  4NXM H;  2XIG A;  4ZOL A;  3FMA A;  4YJ2 A;  4FFB A;  2E5L H;  3JSL A;  4DV3 B;  1A0I A;  1XNQ H;  3A2F A;  5LXT B;  3JAL A;  5BMV A;  3CVZ A;  2Q7E A;  3L2P A;  1HNW B;  4X64 H;  5CB4 B;  2UUC H;  1SKV A;  2OWO A;  2UXD B;  4LF6 H;  4M7E A;  4JI8 H;  4O4H A;  4LF8 H;  3K5O A;  1M5I A;  2ZCE A;  4DR7 H;  2F1M A;  1I7F A;  4CH5 A;  4FLU A;  3KAL A;  2VWK A;  1S5J A;  2YIA A;  3RYI A;  2BTQ B;  1JFF B;  5EIB D;  2Q7G A;  3K58 A;  3N6X A;  4YHH H;  2PUS A;  2HGS A;  3TY9 A;  3T1H H;  4PI2 A;  4BWA A;  5IJ0 B;  4LF5 H;  4TV8 B;  3EYY A;  4NXM B;  5BR8 H;  1SA0 A;  1N34 B;  3NBY B;  3B2E E;  4A2A A;  3WB1 A;  2RQ6 A;  5J2T A;  2YI8 A;  4ZI7 A;  3RGB A;  4DRX B;  4JI0 B;  4ETS A;  4AHC A;  1Q5O A;  3W1B A;  4U3J B;  3ICX A;  1N36 H;  4MTE A;  5FNV A;  4X1I B;  3RYF B;  3RGZ A;  5J2U A;  2VQE H;  1TVK B;  5C8Y A;  3WB0 A;  1N32 B;  2F66 C;  4DV1 B;  4NXN H;  1XMQ B;  5JVD B;  3U10 A;  4O4I B;  4X62 H;  1DGS A;  1JMK C;  3SJA C;  3BAA A;  4PZ8 A;  1XHX A;  5LA6 A;  4EFB A;  5JQG A;  4HNA B;  3MWM A;  5FLX W;  3N42 B;  4DR2 B;  1P16 A;  1RSO A;  1HR0 B;  4CS3 A;  1HNW H;  1ZAU A;  2IM9 A;  3QWU A;  2WYO A;  4YJ3 A;  4LF4 H;  2E3C A;  1L8D A;  5JJN B;  4IIJ B;  3JSN A;  4O4L B;  4BW9 A;  1XNR B;  3RYC A;  5CA1 B;  2VUG A;  4A2B A;  2YI9 A;  2UUA H;  5KX5 B;  3CB2 A;  3N41 B;  1XMQ H;  2VQF B;  4TQF A;  3CSX A;  5A2Q W;  3GB8 B;  3VQY A;  3TY5 A;  3QF7 A;  2YIB A;  1IBK B;  5EZY A;  4YJ2 B;  4NVP A;  1XDN A;  4GKJ H;  4DK0 A;  4I50 B;  1ZHS A;  4JI0 H;  3FFQ A;  2PY5 A;  3GDE A;  3C0F B;  4GYC B;  2WE6 A;  2ZIO A;  4TV9 A;  4I4T B;  5KHG A;  4ZHQ A;  1FJG B;  1BGW A;  3LNN A;  4JI3 H;  1N33 B;  3T1H B;  3IG0 A;  4R7R A;  4LNU B;  4YY3 H;  3HKC A;  4B3M B;  1XK5 A;  1VF7 A;  1KU9 A;  4JI4 H;  3RFR A;  5LYJ A;  4DUZ H;  1B04 A;  4DR3 B;  4LMY A;  2CAZ C;  1NT2 B;  3JAW A;  4JI8 B;  1S03 G;  4LF6 B;  4TV8 A;  2UXD H;  5IJ9 A;  3DF7 A;  4FLX A;  1XNR H;  4APM A;  1XMO B;  4LFC H;  3SJB C;  1XNQ B;  4DRX A;  3BHP A;  3W5O A;  5KHK A;  5KMG A;  3JAS B;  4TQD A;  5IWA H;  3RF2 A;  2F93 B;  3E22 A;  3NC0 B;  4UCR A;  1IBM B;  5J2U B;  3HKB B;  4DR5 B;  3WB2 A;  4AQY H;  3K59 A;  1M0T A;  4LF9 B;  3T1Y H;  3U0Z A;  4RZQ A;  1I6U A;  4DV0 H;  5FD5 A;  5JVD A;  2YIB D;  3UT5 A;  1JJO A;  4O4I A;  4DUY H;  1CKN B;  2CW8 A;  5DIS C;  2PTM A;  4DV1 H;  3K5L A;  5JQG B;  1ZHQ A;  5ITZ B;  1Q3E A;  4DV7 B;  1WN7 A;  1V9P A;  3RYH A;  1XQ8 A;  2ZM6 B;  2HVS A;  3K5M A;  2PZS A;  4X1K B;  2OYQ A;  4RB1 A;  4B3S H;  4FFB B;  1FFX A;  3BPZ A;  1J5E B;  4LFB H;  4O4L A;  5CA1 A;  4AQY B;  1WPB A;  4I7H A;  3RGX A;  2UU9 H;  4O2B B;  5KHI A;  4X1Y B;  3VQW A;  2VOB A;  5LMU H;  5CB4 A;  1IBK H;  3HKE A;  4FLZ A;  4CS4 A;  4YHH B;  5EZY B;  5IT9 W;  4LFC B;  2JVD A;  2UUA B;  4IHJ B;  4FLW A;  5LP6 B;  1JFF A;  4DR7 B;  2ZIM A;  4EFE A;  4LF8 B;  4WBN B;  3TY8 A;  2UUC B;  5EYP A;  1IBL H;  1MZB A;  4DV4 B;  4ZHQ B;  1HR0 H;  4FM2 A;  2VWJ A;  1P8L A;  4YY3 B;  2RJZ A;  1Q43 A;  4ZIB A;  5J2T B;  2QJ1 A;  4OX9 B;  4ZI7 B;  3HKC B;  1XHZ A;  2HIX A;  1X9N A;  3HXL A;  1FJG H;  4UFZ A;  4JI2 B;  4LF7 H;  5FPO A;  1M93 A;  5FNV B;  3RR5 A;  4FLV A;  2JS5 A;  4JI6 B;  4CS2 A;  4NXN B;  2Q2U A;  1KMI Z;  1TVK A;  1Q8I A;  2VQE B;  4JI5 H;  2ZNI A;  3DSQ A;  3JAR A;  2EX3 A;  4X20 B;  2UXB B;  3MAQ A;  5LA6 B;  4EB6 B;  4LF9 H;  3JAS A;  3LML A;  4GKK B;  3K3V A;  5JCO A;  1X4T A;  2P22 C;  1SYX B;  3KXY T;  1SEI A;  4LH7 A;  4MTD A;  4LF5 B;  4B08 A;  3N2K A;  5GON B;  5LOV A;  5IYZ B;  4IIJ A;  4UCS A;  4E6N A;  3BRC A;  5LP6 C;  4GLX A;  3U11 A;  3RYC B;  1XMO H;  4RAZ A;  3L4J A;  3HKD B;  5CA0 A;  3KYH C;  4K0K H;  1H2S B;  1FVI A;  4UCT A;  2ZIN A;  3THO A;  4DR1 B;  3IAY A;  2HHH B;  2HIV A;  4JI7 H;  3VQX A;  3BA9 A;  4UCO A;  3RWR D;  4DK1 A;  2HVQ A;  3KAK A;  3JAT B;  4X64 B;  5K1P A;  4X62 B;  2UXC B;  3J7A K;  3RTX A;  4X1K A;  1Z2N X;  3N40 P;  3OTF A;  3OTO H;  1FFX B;  4CH3 A;  3N2G A;  1Z5V A;  1N33 H;  4UCU A;  4O2B A;  2QM4 A;  4DV6 H;  5D5Q A;  5JH7 B;  2UUB H;  4RB2 C;  1CKO A;  3HKE B;  3VNN A;  1TGO A;  1HNX B;  4O2A A;  3QG5 A;  4UCV A;  4Q0Y A;  1AN7 A;  5JJE B;  4B3R B;  2UUB B;  1BJT A;  3JAM W;  3GJX B;  4DV2 H;  4DRF A;  1SQG A;  2R9A A;  3JAW B;  4I55 A;  5EYP B;  2VQF H;  4LH6 A;  4DR4 H;  3J81 W;  3SGI A;  3BAB A;  5IJ9 B;  2PYL A;  4LF7 B;  2W57 A;  2Q0A A;  4IAJ A;  1FKA H;  2UXC H;  5D1P A;  2VPS A;  5FD6 A;  1M0W A;  3CHX A;  4EQ5 A;  2WDT A;  4JV5 B;  4RAY A;  1S68 A;  5KMG B;  4LR3 A;  4DR5 H;  3ZED A;  3JAK B;  3E22 B;  5D1O B;  5LMN H;  4DV5 H;  1E4G T;  4DV5 B;  1QQC A;  4X66 B;  5IWA B;  4JI1 H;  1P49 A;  5KHH A;  4JV5 H;  4PHZ A;  4PZ6 A;  2R70 A;  2V4D A;  3JAL B;  5K1X A;  3JAR B;  4FM1 A;  1CKN A;  4GKK H;  2Q7H A;  4EB6 A;  5JJJ B;  4FM0 A;  4PI0 A;  4O4J B;  4DR3 H;  2ZJT A;  2RGR A;  1O75 A;  1G6U A;  2CW7 A;  2YCH A;  4BWS C;  2UU9 B;  3N2K B;  5GON A;  2BTQ A;  4B3R H;  4J0M A;  5IYZ A;  1CKM A;  1WNS A;  3NBZ B;  1O9H A;  4B3S B;  4KL1 A;  2ZM6 H;  3HKD A;  5CA0 B;  4X1Y A;  4JI2 H;  1SA0 B;  4DV7 H;  3RJ0 A;  4LSX A;  4RB3 C;  4I9Q A;  2YXL A;  2KKW A;  3OTO B;  4AIL C;  4U3J A;  1Z2O X;  1T5E A;  1YEW A;  3SJC C;  4DUY B;  4DV4 H;  3ZS8 C;  4HBN A;  4X1I A;  4IHJ A;  2R72 A;  4DV0 B;  1IBL B;  3RYF A;  4CC6 A;  4D7S A;  1O9G A;  5LP6 A;  5LL6 b;  4JI7 B;  5C8Y B;  4TUY A;  4F6R B;  4DR1 H;  5JH7 A;  4D7T A;  4WBN A;  4JYA B;  4K0K B;  2FE3 A;  4KHP B;  4O2A B;  1TUB A;  1E4F T;  4DV3 H;  3BA8 A;  2BTO A;  4JI1 B;  3W1G A;  3UQ8 A;  4EEQ A;  1I94 H;  5LMU B;  5JCO C;  2ZNJ A;  4ZOL B;  4DR2 H;  4JYA H;  4X65 H;  1D5A A;  4YJ3 B;  4I55 B;  1Z2P X;  1WH2 A;  2JGU A;  3H20 A;  5LXT A;  2UXB H;  4JI4 B;  1HNZ B;  5BMV B;  5FPR A;  4DR4 B;  4B3M H;  1HW7 A;  4X20 A;  3QTC A;  4MV7 A;  4PDB A;  1TAE A;  1N32 H;  4O4H B;  1QHT A;  4B3T B;  4JI3 B;  5EIB C;  4FVM A;  1Z5W A;  1XI1 A;  5D1O A;  4JI6 H;  1N36 B;  1HNZ H;  3N44 B;  5EOY A;  5KHJ A;  3RYI B;  4I50 A;  2XHB A;  3M7M X;  5LOV B;  2Q2T A;  4OX9 H;  4CH6 A;  1HNX H;  4FM9 A;  2RGV A;  3N43 B;  5IJ0 A;  4GKJ B;  4CH4 A;  4TV9 B;  3VQV A;  1IBM H;  4FLT A;  1I94 B;  4I4T A;  4DV6 B;  3M4I A;  3PN1 A;  3ETQ A;  4O4J A;  3SR2 C;  4Q6G A;  4TOI A;  4LNU A;  3JAT A;  4LFA B;  4KHP H;  1L2Z A;  4LFA H;  4K8Z A;  5LYJ B;  2GV9 A;  4MV9 A;  3F8N A;  3N2G B;  2HHH H;  3K5N A;  4LF4 B;  4X66 H;  1M4U A;  4DUZ B;  2CFM A;  4PZ7 A;  5LMN B;  2HVR A;  3KAJ A;  1SQF A;  4K8X A;  3K57 A;  4RB0 A;  1VS0 A;  2E5L B;  4LFB B;  1J5E H;  3L4K A;  4HNA A;  3J80 W;  2P5O A;  1GYF A;  4CC5 A;  3S24 A;  3HKB A;  5D5P A;  4B3T H;  4TUY B;  2F4V B;  4F6R A;  4DR6 H;  2PYJ A;  4DV2 B;  2HEP A;  3UT5 B;  2PGG A;  2KSW A;  4FLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...