3PN1A

Novel bacterial nad+-dependent dna ligase inhibitors with broad spectrum potency and antibacterial efficacy in vivo
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Novel Bacterial NAD+-Dependent DNA Ligase Inhibitors with Broad-Spectrum Activity and Antibacterial Efficacy In Vivo.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase/ligase inhibitor
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3pn1A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3pn1A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3pn1A02
3NBZB 1TAEA 5FPRA 4DUYB 4JI6B 4DV7B 4GKKB 1I94B 4X65B 4UCOA 2OWOA 2F4VB 1CKMA 1XK5A 4LF7B 4DV3B 1N33B 4UCVA 4NXMB 2UUAB 1HNZB 4DUZB 4KHPB 3GB8B 4CC5A 3GDEA 3VNNA 1N32B 4DR6B 1CKNB 1TA8A 4TOIA 1S68A 4UCUA 1P16A 5IWAB 4X66B 3KYHC 2HVSA 4LF5B 2VQEB 3UQ8A 1HNXB 5LMNB 3JSLA 4JI0B 4EQ5A 4DR4B 2E5LB 3RR5A 1N36B 5LMUB 2ZM6B 4B3RB 4YY3B 4DR3B 1XMOB 4LFCB 1XMQB 1DGSA 4UCRA 4LFAB 3OTOB 1FVIA 4DV4B 4LH7A 1IBLB 3GJXB 2UXBB 4DV5B 4OX9B 1CKNA 4EFBA 3NBYB 3JSNA 2UXDB 3RTXA 1XNQB 4JYAB 3T1YB 4JI5B 4YHHB 3T1HB 1J5EB 4NXNB 4DR2B 4JI3B 4GKJB 3TY8A 5D1OB 3SGIA 4JI7B 2UXCB 1FJGB 4CC6A 4UCSA 4LF8B 1IBMB 1XNRB 5BR8B 4LF9B 2CFMA 4DR5B 1IBKB 2UUCB 3L2PA 4DV1B 2Q2UA 4LH6A 3W1BA 2HVRA 2UUBB 4PZ8A 4PZ6A 2HHHB 4B3SB 4JV5B 3W5OA 3S24A 5DISC 1CKOA 3PN1A 1V9PA 2UU9B 3TY9A 4DV6B 2HIVA 1VS0A 4LFBB 4JI2B 4PZ7A 4GLXA 4EFEA 4UFZA 4EEQA 4DR1B 4AQYB 4JI8B 1B04A 2HIXA 5D1PA 3W1GA 4DV2B 4UCTA 4X64B 1N34B 2HVQA 3BABA 1HNWB 3TY5A 4B3TB 1HR0B 3BAAA 3BA8A 4DV0B 2VQFB 4E6NA 4DRFA 4X62B 1XDNA 2Q2TA 1A0IA 1X9NA 3QWUA 5FPOA 4B3MB 4LF4B 3BA9A 1P8LA 3NC0B 2VUGA 5D1OA 4DR7B 4JI1B 4LF6B 4K0KB 4JI4B 1ZAUA
chains in the Genus database with same CATH superfamily
1IXMA 2QKSA 1NR7A 4O2AF 1OBDA 4J9OA 4X65B 2F4VB 3U54A 1P4RA 4ZI7B 5KS8A 1A9XA 4HR7A 3L73H 5KFIA 1R9TA 4A2AA 4X20B 5LOVA 3H1HH 4A5UB 3HPLC 3GDEA 3VNNA 3TW6A 3A0BZ 3F5WC 5JVDB 2ABJA 4ASUG 4FZ0A 5CAEB 3TXQA 3VQWA 5C3EG 3RWRD 3T1CA 4MTOA 3K08A 2L35A 5KFLA 1H2LA 4H37A 4PHZA 1TWGA 4DW1A 2KSWA 3F8NA 2LQTA 4DUYH 3GQCA 1Y76A 2WAQA 5IJ9A 2Q68A 2CDYA 1AP5A 3H1LH 4DV3O 2FK2A 1E1RG 1S77D 3AK3A 3AX6A 1OCOB 4Z2WA 1EN4A 2ZNIA 3ABKB 4L8JA 1VF7A 4DR6O 5IWAH 2R92A 1XDCA 3IJ4A 3LNNA 4QW8A 1O9GA 2HJFC 1HNXO 1AP6A 3Q4HA 1N56A 3JCZA 3GIDA 2EIJB 5EC2C 2R7LA 1NT2B 4NZOA 3FKSG 2KQXA 3H4DA 2W9CA 5C44G 1XMQO 3T4ZA 3RB6A 5KT7A 1I94O 1LUVA 4ZI7F 5B3SC 1L2ZA 2NU9B 2EJRA 4FFKA 5BY1A 3ETDA 1GRJA 3APQA 4CH5A 2YWVA 3J81W 3N43B 4ED0A 2RNBA 5LYJB 4DV1B 3LDCA 5DN6G 2JA8G 1CXZB 5JVDF 3GILA 1MZBA 2I8CA 1NKDA 3EVKA 4JI7H 4JI3O 4YIOA 1VQ9V 4GCZA 4NR1A 4AYBE 1M0WA 1TWCA 1I1MA 5D5PA 4MVSA 5KLVH 4J42A 4UFZA 5BR8H 2ZE6A 4DL7A 1RM1C 1YDXA 1JX4A 1KMIZ 3U11A 3RT3C 3ZX6A 4X64B 3JAWA 2Q8VA 2FLNA 3CWBH 4CKEA 1RPOA 3K03A 5EC1C 4B3TB 2C35B 1ORQC 1Q8IA 4WFAV 5JH7B 5JCOA 1A0IA 2H3OA 2R92G 4DV6H 2HVKC 3G71V 1Z2GA 4JTAB 4DR7B 2Q6AA 4FE2A 4MA5A 4I0XB 5IY5B 4J9SA 4YJ3B 1AR4A 5KT4A 3MDSA 3K0DA 1EZ1A 1YVWA 1IOVA 5EYPB 2W6MA 2VPSA 2JA6A 5LHIA 1UC8A 1OCZB 4CC5A 5LYJF 2GTAA 3FB6C 1GSOA 3WO0A 3GTMA 1G1XB 2E2IA 3CQZA 1Y74A 4B3MH 3QNEA 4EBEA 1SQGA 4UCUA 3DTGA 2B1IA 2EZPA 3CE2A 4TWKA 4TV8A 5IYDO 3JARB 4WBNB 2DZDA 4K0KH 1AJPA 2YZGA 3G4SV 3UCSC 1BZKA 3VPCA 2I80A 3T5KA 4RNOA 3G80A 1W96A 1SA0A 3CCMV 1PKXA 1S97A 1IX9A 4MV7A 4R8CA 4NXMH 3AG3B 3TXSA 1JR9A 1IBLB 3GJXB 1XNQH 3GIPA 4A3CG 3OMNB 3KXYT 4R8UA 4O4HB 5KG4A 2JS3A 3T99A 5I5XA 5C4XG 1XNQB 4IIJA 3CCUV 5JH7F 3E35A 1CS0A 1ZTEA 1KJIA 4KUMA 2YIAA 2XGQA 3RB3A 4IGGA 5K1PA 3ZMTA 4PDLA 2Z02A 2Z3YA 1I7FA 2G38A 4UVCA 3HOVG 4BR6A 1Q86W 4YY3O 4YJ3F 3T2MA 1LNQA 3CVZA 4U7OA 2UVWA 5CR5A 1FXHA 1M57C 3A2FA 4H13B 2R7MA 2ASJA 2GUZB 2DYSB 3P3PA 3E8HA 3B09A 3FYEB 1GKFA 4ZHQB 3GIQA 2HGSA 5L3GA 3BHPA 4CHIA 2JA6G 5LP6A 3CC2V 2PZSA 5HBRB 4YHHH 4FZ1A 4DR2H 1QR8A 5KFXA 4JI5O 2HHHB 1RSOA 5BWRA 1IXBA 4CMFA 3E2EA 4WBNF 2RCVA 2Q7EA 3NUAA 2ZDIC 2JRIA 3PW7A 5HFMA 1R6NA 5KT2A 2X7RB 3E86A 2ZXWC 4DR5H 2AW9A 2EJ7A 1CP9A 1KKDA 3HOWG 4RUFA 3WWHA 3QTCA 1Q7YW 1FKAO 5DGBA 5LHHA 2O57A 1I1LA 4O4HF 4J9QA 3EYYA 1R3IC 4QJFB 4DRFA 3ETEA 2V4QA 1BE3H 1GSHA 1NJIW 1K97A 1GN2A 3FAVB 3PJSK 4MT8A 1Q82W 5DLGA 4ECUA 1BL8A 1QLNA 4DAAA 3SPGA 2HHFB 3NBZB 2Y4UA 3LQSA 4Q45A 4O7RA 3H1JH 4BIOA 3G6VA 1FFTB 4JYYA 4I55F 2QK4A 4O4LF 5DM6V 4ZOLB 5KX5A 3KALA 4DRXA 5BPHA 4ZHQF 1M4UA 4G27B 2F1MA 3CCLV 3OMAB 3RFRA 1HR0O 3DTFA 2HKOA 4HNUA 4YAKB 1VF6A 1HWYA 4O2BA 4K8XA 1D2DA 4QWCA 1SQPH 5BXZA 2J6UA 4IR9A 2YEVA 5BMVA 1BJTA 3ZCCA 4LF6O 1Q3EA 4U3JB 1SQXH 3UM7A 5LMUB 3CRRA 1EHIA 3WWIA 2R6FA 3FMAA 1JFFA 2F23A 3WWJA 1QR9A 3CP1A 3HKDB 1OCOC 3GIMA 3RJ0A 2CH7B 1RJPA 2HFEC 5FD5A 4PA9A 4TV9A 1FFXA 4WHXA 4O4IA 4RU9A 5J9PC 3OSNA 3DAAA 4OX9H 5FNVA 5DG8A 3MR2A 3RTXA 2E74B 4FLTA 4O7ZA 2WE6A 3PR5B 3PW2A 4FJCC 4DL4A 2EIJC 5TISZ 4EYIB 4BXXG 2WLIB 3JD2A 5KFKA 3L9DA 3OEEG 2R87A 2YC0A 1XMOH 1JA8A 5IYZB 1KBLA 2P6JA 4YXWG 1SEIA 1ZHSA 5BWWA 2GSMB 3GIJA 3R5FA 4EGJA 1QLEB 1KP3A 3MAQA 3E83A 5KKNB 1VQMV 3T54A 3LDEA 3N2KB 4ZOLF 4MVUA 3BRCA 5F2VO 2GHYA 4BY1G 4UV9A 3MR5A 1D5NA 1TUBA 2DYRB 4RWUA 2WLJA 2D2CB 2UUBB 4PZ8A 2GQSA 3TIGA 2R7ZG 4KFMA 4JV5B 1QVFU 2NU7B 3S24A 4JI0O 2UXCH 3ABLB 4A3BG 1TWHA 2HVJC 5LHGA 4RB3C 5GW7A 1DK1A 3ZEDA 4ZQIA 5D1PA 3HKZE 5KFMA 1OZ0A 4I9QA 4BAYA 1WJZA 3ZMUA 5CA1B 4PA7A 2UUCO 3GTGA 3CB2A 5KFFA 1TWAA 2ATKC 1W2BU 5LGUA 4B3SH 2W0XA 1MMMA 1KC8W 2VA3A 2VUGA 1I08A 2ZQMA 4QIWE 4JI2H 3CJHA 2UU9O 4O4JB 4F6RB 2RQ6A 3PVXA 3GWKC 5IYZF 3CXHF 1ZSPA 1CE8A 5KFTA 4LSXA 5LA6B 1I94B 5KG2A 1W0JG 2A3QA 4B7EA 2QM8A 1HNWO 4DUZB 2FE3A 5JQWA 3CCEV 3I12A 5IYBO 1WA8B 4F4XA 1B06A 1M0TA 3CCVV 2ZE7A 3J80N 4JZ2A 1K5QA 1GTOA 2JGDB 5C1OA 3AG3C 3L70H 4LSAA 1QVGU 4FFPA 3OTFA 3OTOB 1HNZH 1QBZA 2Y4TA 3E89A 2OYQA 1VAJA 4LH7A 5CA1F 4K35A 3U9TA 2JK5C 5I5UA 2W6QA 4NYKA 5CBHA 5JJEB 4NYEA 2D3OW 3ZHUA 5HV6A 4MTDA 2W9AA 2VQEH 3LDDA 3B2EE 2XAGA 3TINA 1JDBB 4NXNB 3LSUA 4P9PA 5BWXA 4I9WA 4O4JF 1JVMA 2XAJA 4QPJA 1YXBA 1XI1A 4A3IG 3T9BA 3KKYA 5F9NA 2YIBD 5LA6F 3LUTB 1S10A 4YJ2A 2WLKA 3K9AA 3OT7A 3WB2A 2R8KA 1IBKB 1T3NA 2R8HA 2ITDC 4ED1A 4FLYA 2EX3A 1T94A 2AQ4A 4UB6Z 2Q0AA 2MK3A 1AUVA 4PZ6A 1NS1A 2XC9A 4GKJH 2Z5UA 1MG1A 1O75A 4R7RA 4JI7O 1FS0G 2PMZE 3OHBA 4O2AA 4WFGA 4G3IA 3SYOA 2R9AA 5CN0A 4EEQA 4AQYB 3KAKA 3E5NA 3NGDA 4LF9H 5LGNA 1S0VA 3DC6A 4I4TF 3K5LA 5B1OA 1GSAA 4IZOA 3H40A 5B3SB 1SQBH 3OAAG 2NUAB 4X62B 2CAZC 5EZYB 1P8LA 2HLDG 3T1HO 5KHKA 5H6RA 4DV6O 4Q8FA 4JI8H 1PL4A 3ZMZA 3GTPA 3UKMA 4UCOA 1BXRA 2QDOA 2PF4E 2BSKB 2FJZA 1RM1B 2CKZB 3MD0A 2HP8A 2YS8A 3TETA 4GT1A 3OR6C 1B33N 1P16A 4X66B 4B3MO 3SE7A 2ASLA 1NQTA 3MR3A 4JI1H 2Q5ZA 5KHGA 2A7WA 5IJ0A 4EQ5A 4M0JA 1OCRB 4K0KO 2VA2A 3CRQA 1WP8A 3KCXA 1XREA 5KA6A 1N33H 3ORRA 4O82A 5GONB 1PNKA 4KHPH 4NXMO 1S5JA 2WB1A 2ZDGA 2UXBB 1UFIA 3ASOB 3B77A 2P0AA 2ADPA 2FKXA 4JYAB 4DL5A 4IAJA 3JD4A 3A0HZ 5KA5A 2P90A 3T9DA 5EZYF 5LMNO 2W0FC 5KFYA 1KC7A 4DL6A 3T9FA 2ZM6H 4MVQA 3ZN0A 5L3EA 1VQNV 3G67A 4Z1MG 3CX5F 2WSSG 3U0GA 5KUMA 2GBOA 2P67A 3D36A 1XUQA 3QG5A 3ZHVA 1K1QA 5A2QW 2R85A 1GYFA 2UXDH 4IWYA 3AG4C 2FB5A 2DPJA 1ZL8B 2CTPA 1RJRA 3L71H 3BEHA 3SR2C 3J81N 3M9MB 1T36A 2HVRA 1N32O 3A0RA 3T1YO 3ABLC 3ZHRA 1VQPV 1N0JA 2HEPA 5KFGA 2ZR2A 5EWFA 5L1LA 4LFBB 1FAFA 3MFIA 4ZBMA 2J6TA 2X0SA 4DR1B 2YXHA 5CE8A 3CPWU 3HBLA 2CGOA 4DV2B 1WPBA 5GONF 3KZIZ 4O3RA 5KFRA 1RK5A 1M57B 2VQFH 4UB8Z 2C22A 5A9GA 2EILB 1L1FA 2X6CA 5EIBC 2VQFB 5KG7A 5KFCA 4FFRA 2B1GA 3N27A 4LWSB 1R1BA 4J9RA 3ZHTA 4APMA 2PI5A 4HQ6A 3RGZA 5ITZB 3P3NA 4FBTA 2EINC 1JLLB 1GO3E 4O7LA 1S5LZ 4LF7B 2CUGA 2VOBA 3RBDA 5B5EZ 2QKAA 3D3IA 5DQGA 3T9CA 4EKWA 4QNHB 2ZXWB 1Z2NX 5LGTA 4LCUC 4JAVA 3N2GB 2YL2A 4LF5B 4I0XA 1KKCA 4GUNA 1YZBA 3JSLA 3W7XA 3PR4A 2YRWA 2YI9A 4JI0B 4YJ3A 1KBHA 3FB7C 3JAKB 2DN9A 1TGOA 3RYFB 3SI8A 3RF2A 4X65H 2V4RA 2F4VH 5EYPA 2R8IA 4FM1A 3SYAA 3RGBA 4PI0A 3JCUZ 4CH4A 1YIJV 2IJIA 2WAMA 1K34A 1RFYA 3V4SA 1Y66A 1MZEA 4JAAA 1P7BA 2Y48A 3AG2C 4ED8A 1EYZA 2FLLA 2YICA 2JIZG 3JARA 4WBNA 5JJNB 5KFSA 2XNDG 5KG0A 2ZCEA 2CNQA 2X6AA 4WFBV 3GLKA 5IT9N 4DR4O 3TY8A 5DMXA 1K8AW 5D1OB 2NR5A 2ZJTA 3DSQA 5DQIA 4N21A 4HN2A 4DR3O 1XMOO 4J9PA 2WAQE 3U10A 5KAFZ 3T9EA 4ME6A 1SESA 4O7VA 2AHZA 2BTOA 2YCHA 4O4HA 4ECWA 3QO8A 5H6QA 3G6BA 2B63A 2HGXA 3VQYA 1FXKB 1NBMG 3SYCA 4A93G 4BIUA 3Q8QB 4MV3A 4CMDA 1AI6A 1VMGA 2PY5A 3AYHB 5KHJA 2DWDC 2KG7A 3RUPA 2RDJA 3LP8A 3W5OA 2ZIMA 1V4YA 2IA6A 1PV0A 4CKBA 1EZJA 3ZRXA 2CW7A 3HB9A 3N42B 4DL3A 5KT6A 2GUZA 4CS2A 4HNVA 2XCAA 1IYDA 4LFCO 3Q2OA 3N6XA 1XNRO 1JCHA 2WLLA 4UCTA 4ZHQA 4DV1H 2Y0IA 3RFCA 4KXRA 2FMLA 4QE7A 2B5UA 5DG9A 3TY5A 2Y0PA 2YSUB 1SS3A 1Y6XA 4EB6B 5L9XA 3BAAA 3H4BA 3SDLA 2JEGA 1DF4A 4LF4B 4O7TA 1JJ2U 3OGCC 3OFNG 2VR1A 4JI4H 2V4DA 3HT5A 3JD3A 3M9OB 1BCCH 1SKVA 2RF4A 4JI4B 2Z0AA 1GAXA 4JI6B 3G8CA 4C5CA 3LMLA 3BFRA 4X64H 5EWGA 1XK5A 1IBMO 4PBCA 2UUAB 1MA1A 1X4TA 4B3TH 2QJ1A 4X1IB 2IU0A 4ZIBA 3JALB 4QJFA 3FB8C 4RNMA 1WH2A 1TA8A 3H9VA 1N0NA 3FAVA 5D5QA 2HVSA 5KG5A 4JV2A 4YP3A 3B40A 3T5JA 1OCRC 2M6YA 2GLTA 2R86A 5CA0B 4DR7H 1YJWV 2R8JA 3ZIAG 1S0OA 3KG2A 2NVYA 1THZA 4G28B 2Y0SA 2HHFA 1QQCA 1SYXB 1MNGA 4FLZA 1S9FA 1CPYA 1N8RW 3RGXA 4LFAH 1LUWA 4J7KA 2DIKA 4Q4CA 2A1HA 1M5IA 3V6KA 3TK1A 4ZOLA 4LFAB 4DV4B 3BG5A 5J2TB 3R5HA 2OIEA 3BCCH 3ASOC 1G2WA 1N34O 1HNZO 4O81A 2QE7G 2XGPA 2YI8A 3B4SA 4J41A 4Q20A 2R72A 5KAIZ 2BQRA 5BWTA 2CQYA 4YB8B 5EDWA 2Q0OC 1P7GA 4NZNA 4YBZB 1VQKV 2BR0A 5EWEA 2VQEO 3TQTA 2ITCC 3JRXA 3T1HB 1DF5A 4C2MA 4U3JA 1YTFB 2CK3G 3TJTA 1F4NA 1K3EA 1MOFA 4YIPA 3K3WA 4TQDA 3HKDA 3RAQA 1WLEA 4RZQA 2RMKB 1IBLH 3TEKA 3CHXA 3EPGA 4WD3A 2HG5C 2RGVA 3R65A 1XHZA 4GC7A 2ZINA 3WU2Z 1I50A 1SZXA 5K1XA 1G6UA 1I5YA 5KFJA 4GX5A 4HYOA 2LW1A 3APOA 1YJNV 5CA0F 3N41B 3RVZA 2XTAA 1K4DC 1JMKC 5IYZA 2EJ2A 4U3FH 1TUEB 2E5LO 2HIVA 1RPRA 4A3LG 4FFNA 3OGIB 1Z5WA 3WO1A 3N2KA 3K3VA 4I55B 5J2TF 4LF9O 2EILC 3K0GA 4O4LB 2ASDA 2EULA 4OXSA 5KG6A 3DXRB 1E1QG 2QB5A 4F4ZA 3K5HA 4DV0B 2ATLA 3RYCB 2HHHH 1XDNA 3QF7A 1R3LC 4XDLA 4DIMA 4TQRA 1VQ6V 1J5EO 2R8GA 4DV7H 4FK5C 3AEIA 3TW7A 3L4JA 3MHHC 4DV7B 4QWDA 4JI8O 2VQDA 5CA1A 4GKKB 2QSAA 2F93B 3HKEB 2IBZH 2OTLV 3QQMA 1M93A 3ZJZA 4JYBA 1EUDB 3R9RA 2W71A 2DWEC 1US6A 5KG1A 5LOVF 1N32B 1CKNB 5JUMA 1VQ5V 1S68A 4O7YA 3PW4A 4XBFA 5BYAA 2DOSA 4O4JA 4X1YA 4F6RA 2V5AA 2ARHA 5DEDA 1N36B 5LA6A 1P84F 4GYCB 4UVBA 1ZUQA 4J9ZB 3JAMN 2K9PA 1U96A 5DLFA 3I5DA 4DK1A 3HKCB 4MV1A 1N33O 4IYHA 3MJFA 1E4FT 4KHPO 1WA8A 1JPXA 3JAWB 4XYMB 4DV5B 4PDVA 3E22B 3JSNA 3ABMC 1VKZA 4EBCA 4FU0A 1N4CA 4MV6A 3CCRV 3A8TA 1WNSA 1M1KW 5J2UB 1ULZA 1Y1VA 4R50A 4HNAB 5BPFA 4IL6Z 5LMUH 4X88A 1BGWA 2ZIOA 1Q6HA 2ZM6O 1VBHA 4QWEA 4AILC 3UT5B 5L1KA 4LF8B 2ZT9B 3QFFA 3T7AA 4D7TA 1EM1A 4JXUA 4LMYA 1FXKC 4YR0A 1OJHA 2XAFA 3JYCA 2AHYA 3L74H 5DAAA 3CCSV 4ICGA 2UXDO 1R6KA 2IU3A 2RN9A 5E1AC 1PX2A 4MW3A 1Y74B 3P32A 3AG1C 5B66Z 3V4ZA 3V6JA 3UYYA 3RB0A 5L3DA 4J9MA 1B6RA 4KP4A 3K5MA 3KHGA 1VS0A 4DLKA 2C2RA 4B3RO 4UVAA 2CNVA 1YJ9V 2YS6A 3R23A 1AI4A 4TM5A 3QVNA 2XUMA 5B1BC 4F4LA 3R5XA 2KB1A 2LP7A 1KJ9A 4J0MA 2QWNB 1GN3A 1AI7A 4RZRA 3PO2G 2M05A 2A0LA 1FYJA 1Z2PX 1PM9A 4RB2C 3TGUH 4F6EA 1YTFD 1C3OA 3U55A 2DLNA 2UUBH 3RBZA 2XOKG 3FKIA 4IHJB 4HZ3A 3OD4A 2RJZA 4JV5H 3AG4B 3W7TA 1J95A 4D6TH 2DWCA 1H8EG 4XX0B 5J2UF 1EUCB 3OMIB 1K92A 1Y1VG 3DTUB 2EIMC 3H1IH 1FJGO 2WPDG 3IFXA 4BBRG 4I50B 5D8DA 3GTJA 3WNZA 4DV3B 4A3FG 5I5SA 1ZWIC 4DR6H 2CW8A 2JEXA 3HKBB 3IGAC 4DR6B 5EZYA 1BGYH 1HNXB 1ROPA 5KFWA 4NLGA 3JRWA 3RYIB 3ZMSA 3CCQV 3JZ6A 5FL7G 3G6YA 1SFOA 2C2DA 1I94H 4FFBB 3K04A 4LFCB 4C7UA 1XMQB 1NVPD 1E4EB 2IH1C 3JASB 2F4VO 2BSKA 2N74A 4DUZH 1EKVA 5H2FZ 4C5BA 1RK6A 2EINB 1V55C 4MSWC 1BHAA 3AK1A 2CTQA 4EFBA 5CB4B 1TWFA 3T5HA 3SPJA 2GV9A 1SQVH 2N04A 4IHJF 5KFOA 3ASNC 2EBOA 2Q73A 3ABUA 2W9BB 2R84A 2IJKA 3FKIG 2V59A 1JOYA 4JI3B 1DAAA 3NXSA 2YUAA 2W57A 3OTOH 5GONA 4DUYO 2PI4A 4I50F 5KFAA 1IBMB 1XL6A 3BVOA 2IM9A 1K7DA 4I4TB 4IRDA 1PK8A 4HYKA 1B3QA 4CZZA 2WLMA 1BS3A 1KEEA 2YS7A 1URFA 5A2QN 1EN5A 5BWUA 3BACA 2W8KA 2AGAA 5I5WA 3RBEA 4NXNH 4TSFG 2FKLA 1VARA 5IWAO 3ABTA 3AG2B 3L75H 3N44B 3OUFA 5GTHZ 2YEVB 4RB1A 1E4GT 3BJYA 2QR4A 4JPRA 1DIKA 2KKWA 2PGGA 2AZ0A 3ZHQA 1IBKH 3SJAC 1N34B 1KUQA 1V51A 2QA4V 2DQ3A 1ZL8A 1WSCA 4TV9B 4X9QA 4OX9O 5KG3A 3T5LA 5CB4F 4ABMA 5KHIA 4QWBA 3CC7V 4IRKA 1H2SB 3BA9A 3FFQA 3TIIA 1WRVA 1Q6UA 5FLXN 4UUGA 3ZRWB 1K5SA 3UFXB 4AQYH 1K1SA 3E8FA 3OUSA 4ECZA 1TAEA 4TUYB 3T4DA 2W6OA 5BR8O 2OLSA 1DTOA 3STLC 3UO3A 1GM8A 4EBDA 4B3TO 2DABA 4I7HA 5IYCG 4ECYA 3RYHB 4H0LB 3K3PA 4X62H 4M7EA 4ETSA 3CRMA 4TOIA 3I56V 3I55V 4LWSA 3QZ7A 4DL2A 2F43G 1NTKH 1VQ7V 1ENVA 2NU6B 4FPPA 3OE7G 4DR7O 4LNUB 3CRAA 1A48A 4YY3H 4L1KA 2E5LB 4FLXA 1WP7A 2ZDIA 3W7SA 4YY3B 5LL6b 1V54C 1G4YB 1FVIA 2ZE8A 2NU8B 1R6TA 3AG7A 3AK2A 4RAZA 2JEFA 4Z1VA 1WAZA 5E79Z 4TV9F 2NVXA 2E76B 2GTSA 4BIZA 3C3TA 5JCOC 4X66H 4JI5H 1PNMA 2QYZA 3C3SA 1SCUB 2C2AA 4Q43A 3X2QB 3STZC 4JI5B 1J5EB 1X59A 3JAKA 2MW2B 3RYFA 2SCUB 1GMGA 2J9GA 1OCCC 3HO8A 4JV0A 4GC6A 5CM0A 3VA7A 4DO2A 4TUYF 5AG2A 4UCSA 3SJBC 1I7LA 3KAJA 4ZI7A 4LR3A 3WB1A 4P9OA 2HJWA 2UXBH 1FKAH 5EBMC 2PUSA 3K79A 4X20A 1IBLO 1SQFA 2XD4A 2WB1E 5EIBD 1Y4MA 3PW0A 4TT3G 3ZN1A 4PJ0Z 5JVDA 2COGA 4X1KB 1XNQO 4JYAH 4TQSA 2F95B 1AVMA 2GPSA 4NKGB 3VQVA 5C1PA 1OV9A 4PV1B 2YW2A 1S0NA 1TVKB 2YXLA 5DISC 1S03G 1Q90D 2Y69C 3M7MX 4QPKA 5BZBA 4J7JA 1GN4A 3HXLA 4TVIA 3K5IA 2FL4A 3W7UA 3CEIA 3GV8B 1HR0H 5LBQA 3L72H 1FXKA 5KMGB 2FYUH 2VWKA 2VUMA 3J80W 2B9ZA 2P4KA 1IVSA 1HR0B 3WG7B 1B6SA 3M8AA 2EJ3A 5H80A 2Q2TA 4FLVA 2I87A 1ZLZA 4BY7G 2HHHO 2YXYA 5FPOA 2V9WA 1IURA 4YHHO 4DR2O 2Q67A 4JYCA 1COWG 2XIGA 4J9NA 1K9MW 4LFBH 2W70A 3RAXA 2P06A 4LF6B 4QIWF 2DMXA 4DR1H 5B1AC 1S5HC 1OBGA 2HJDA 3HR0A 4AI8A 3J7AK 4WFFA 4DV2H 4YQWA 1KQSU 3VBBA 2P5OA 1JQ0A 4BWSC 1XILA 1L0NH 5L3CA 5LL6Y 5KT3A 1NTZH 5LYJA 4FS1A 4DR5O 4EB6A 5DG7A 3C0FB 1WB7A 3SYPA 3JATB 4XDJA 3R66A 4MAMA 4ECRA 5JQGB 3AW8A 2IH3C 3PFFA 4O83A 1YEWA 4JF3A 3CCJV 3K9SA 5HNEA 2JEJA 3GB7C 2DJVA 1DLBA 1L0LH 4B3RB 1KT8A 3VOTA 1GM9A 1VBGA 4LF7H 2C28A 5LXTB 3SYQA 3MR6A 4X1IA 2QWRB 3JALA 4E4EA 4PA3A 2WA4A 1LR1A 4MV9A 2AGQA 2EIYA 1KU9A 3SJCC 5JH7A 1A0GA 4LF5H 4O7SA 2VUMG 4A3JG 4JI0H 5KFBA 2CNUA 3Q8SB 2ILMA 1ET0A 2CTRA 5GTIZ 4JV1A 5LMUO 3MWEA 3M9NB 2V7QG 4WFHA 2QWPB 1FJGB 1XOUA 5J2TA 4PD4F 1GH6A 1WPXA 4XDKA 4PA6A 3N8DA 2QKCA 3EXAA 4LC1A 1JIHA 2QF7A 4MV4A 2UUCB 3L4KA 2EJ0A 3HOZG 1NZ6A 2AU0A 2QTSA 2QM4A 5C8YB 1VF6C 5K2MA 5CBFA 1S76D 5JQGF 3DGEA 1IDSA 3VMMA 2W6NA 3ABMB 3U9SA 4BW9A 3RVYA 2W6IG 3MFHA 1L8DA 5BWVA 2UU9B 3CXCU 1WR2A 3O9OA 1K4CC 3BPZA 1UNNC 4PZ7A 4GLXA 4HNTA 1KUTA 3JD1A 1OWTA 4Q6GA 3H20A 5DGAA 2VWJA 5LXTF 1YITV 1HNWB 3MWDA 1IYEA 4JUZA 2Q9LA 2UUBO 1YSCA 3LSSA 2QWQB 1X9NA 2BE3A 3CRCA 3IC9A 4JV5O 3KTMA 3UO2A 2GPWA 4U7NA 4ZKIA 1WCMA 4FLUA 3AG1B 2FK1A 1NTMH 3FYIB 2UXCO 4DUYB 4I55A 2XT9A 4O4LA 4RNNA 3ETGA 3O65A 4A3MG 3S3XA 1VQ8V 2LGWA 4P2ZA 3DXRA 4A3DG 4FS2A 4MW8A 3H3VH 5B1BB 3RYCA 3GVMA 5C8YF 4FBUA 2QTOA 1B6QA 5L3FA 3CEBA 2A06H 3LNMB 1VP7A 1RJQA 4LF4H 1AROP 1W0KG 2F66C 4RO2A 2OTJV 1XQ8A 5IWAB 4FIPC 3ETHA 3KYHC 4MA0A 4F4YA 1Q6IA 4B3SO 1I2LA 2C00A 3K58A 1Q81W 1M7JA 1C30A 2OCCC 2M7WA 4LBEC 4JI6H 3B8NA 4IT5A 4JI2O 4MTFA 3HKEA 4UCRA 1E79G 3K59A 4RCNA 4W4LA 2XAQA 4OGQB 5I5TA 3KHRA 2UUAH 2WDTA 2Q4PA 3K06A 2EIMB 5JWPA 4DUZO 2JDIG 1Y1WA 1WN7A 4OX9B 3VPBA 1CKNA 2Q7GA 3X2QC 4PDMA 2E3CA 2JA7A 4CBCA 2YDEA 5EBWC 3QZ8A 4NB5A 5FLMG 2B63G 4M9UA 3PZPA 3EFFK 4AYBA 1YCIA 1S3JA 3RN4A 2Y0SE 4JI7B 1SZTA 2JGUA 4N23A 3N6RA 4CC6A 3HKCA 2XCLA 4DV4H 3RB4A 1WCMG 5JVLA 3ZRVA 3OTOO 2YZNA 4Y8VB 5BR8B 3VPDA 3N40P 2CFMA 3E22A 3U0ZA 4ECVA 2EIKC 3L2PA 4FFLA 2YIBA 1AR5A 1D5AA 2UVVA 1M6VA 3Q1KA 4LH6A 4DYLA 1U97A 5CBGA 5J2UA 1V55B 2Q7DA 3W1BA 2BQUA 3T1HH 2BTQB 2FP4B 4MS2A 4HNAA 3I4MG 2JJ2G 4NXNO 1F23A 3ASNB 3PO3G 3HOYG 2EZOA 4DV6B 3UT5A 1H2MA 3ML0A 4X8AA 4CH3A 4W4KA 1KP2A 4FFOA 4MV8A 5EOYA 2H8PC 3BQ2A 2CH7A 3P30A 3E8BA 3THOA 4OPHA 3CMEV 3SJQC 3QO7A 3W1GA 2O03A 5KFQA 4MTXA 4JZGA 3WG7C 1IBKO 3ETJA 1Y14B 1YI2V 4OPAA 2V1DA 5E25A 4UXNA 3Q8RB 1H8HG 3BA8A 1Y1WG 5LOVB 1JXLA 2XAHA 4LP8A 2WLIA 4B3MB 1I7NA 3NC0B 2JA7G 4PDRA 5C93A 2CGNA 1K83A 4GKJO 2C2EA 1BHBA 1QNMA 4PI2A 2R93A 2DAAA 4K0KB 4O3OA 1H2NA 1EZVH 3D3QA 2YU9A 4AQYO 3SPCA 2Y4RA 3GTLA 3K57A 1Y76B 5I5YA 5I60A 1GO3F 2XHBA 5IJ9B 4NXMB 4O86A 4EGQA 1EBOA 3OUUA 5KT5A 4IHJA 4FM9A 4DV0H 3ZMVA 5FD6A 1QCEA 4GX2A 4O3QA 5JJJB 5IT9W 1NVPB 1SC5B 4X62O 3G6XA 5LMNH 2GQRA 2DPIA 1MABG 4J11A 1IOWA 2JS5A 4FMTA 4FFMA 5LMNB 3OUZA 5IP7G 2UVRA 3CYOA 2KG7B 3RR5A 3Q4HB 3ETQA 4I50A 4QE9A 4GKKH 4RUCA 2ZNJA 2W9CB 1AI5A 5IDJA 1BQZA 2ETNA 2WLLB 3CSWA 2AGPA 3HKBA 4EYHB 2R7NA 1DV1A 2YZLA 1N32H 3NBYB 4J7ZA 3T1YH 1NH2B 4QGPA 1Z5VA 3EHBB 4XZ3B 2PVPA 1NR1A 4X66O 5H5NA 3T1YB 2ALZA 2JEIA 3RYIA 2WWWA 4YHHB 2OH2A 4DR2B 3H01A 3PW5A 1QHTA 1N36H 1M56B 2UVUA 4FFBA 4JI1O 4DQNA 2CTWA 1E4EA 4J9LA 3JASA 3GWOA 3VOUA 3LSQA 4U6PA 1RP3B 2R93G 1BSMA 2CZGA 4IRCA 1ZX3A 4DV5H 2Q7HA 5CB4A 1GN6A 4DR5B 1KECA 2UXBO 3JD0A 5IYCO 1V54B 3K5NA 2W9BA 4NTXA 2R9IA 3JZFA 1F4MA 3DC5A 2YIDA 2WYOA 5FJ8G 4JYAO 4YAJB 3CSXA 3K5OA 3GTKA 1XBLA 2JGDA 3QO5A 4RUEA 3PN1A 1V9PA 4ECSA 3LWBA 2QGNA 4LF8H 1PPJH 4EG0A 3KCYA 1HNWH 3ICXA 3OR7C 1Y67A 4RQFA 3W7WA 1B04A 4I4TA 1H2GA 2PYJA 1OCCB 2P22C 2WTFA 2UXNA 5HFLA 4UUJC 4IWXA 1AUXA 4IYIA 2W8LA 1F51A 2IJJA 2R7ZA 2JA5A 1S72V 1JX9A 4R6ZA 2GDSA 1AR1B 1JKJB 3GTOA 2ZDQA 2ZDHA 2LO1A 2RDIA 1IZ3A 2W6ZA 4TV8B 3CC4V 4LFBO 3SNOA 2A9HA 3MHSC 5FPRA 1BQ0A 4DR1O 1MZFA 3TCUA 3D36C 2Y69B 4F50A 2IW5A 4DV2O 4IR1A 1SA0B 3ABKC 1CKMA 5KFNA 3E8GA 4K3AA 4UCVA 5IE9A 1W59A 3GB8B 3SPIA 4PA4A 3TQ1A 3OM3B 1HP8A 5F9LA 2VQFO 1BMFG 2X0LA 4R8UB 2E75B 2QEXV 4NZMA 3ZS8C 3VQXA 4IIJB 4DR4H 3OEHG 1K73W 3ZRWA 3UQ8A 4FVMA 5KHHA 5KFZA 4DR4B 4DR3H 5DECA 2COIA 4TUYA 1CQJB 2BQ3A 5FR9A 4DR3B 1XMOB 1T5EA 4DXWA 1VQ4V 4BBSG 1Q43A 2AXTZ 4DV3H 4LF7O 3F5TA 2PYLA 5B1AB 4CH6A 3RYHA 3F7YC 1BT8A 2KSDA 2UXXA 1I2KA 4MVZA 1UPGA 5L1IA 4O3SA 1VQOV 3UZOA 1I5XA 2FK3A 1HNXH 1SF9A 2BOCC 4LNUA 4LF5O 5LP6B 2JA5G 2WLHA 1AB3A 3IC7A 4AHCA 2OCHA 4UV8A 1RSOB 3SGIA 1QU7A 4TV8F 3HB3B 1XMQH 4LFCH 2JEUA 2UXCB 4FLWA 1XNRH 4GLWA 1EFRG 3ORQA 1CQIB 4A2BA 1XNRB 3HKZA 4JTCB 4O3NA 4CS4A 4X65O 4RB0A 5H9CA 2DQ0A 3KHHA 3FDSA 1Z2OX 3IAYA 3M4IA 2OIGA 1UC9A 1EKPA 2VRZA 5IY5C 4IIJF 1RYSA 4B3SB 4JI3H 4BW5A 4QIWA 2ZKOA 1R3JC 2YRXA 4X1YB 2IP4A 2FLPA 5IYDG 1KB9F 4NVPA 1K33A 4JI2B 1AJQA 2NNUA 3SPHA 1I1KA 2LJ2A 1Q5OA 1GGOA 4PWQA 1IBMH 2J6SA 1NH2D 1KD1W 3IG0A 1OCZC 5KFDA 3OW2U 4MVMA 5KFHA 3BQ0A 4WF9V 1N48A 4X1KA 1FXVA 3RV4A 4J10A 1KTAA 5KX5B 2H94A 4DRXB 3DF7A 3B8MA 1GLVA 2ZD9A 4K6NA 1TVKA 2IBKA 2R70A 4B08A 5LP6F 3GTQA 4ED3A 4PELA 4XYLB 4Q44A 4O2BB 3JAMW 4A3GG 1H38A 3GV5B 2RGRA 2K1EA 3CS5A 1VEWA 5BMVB 5CA3A 3EPIA 4QW9A 1JDEA 3FB5C 1N34H 3RW0A 2ZE5A 5KMGA 4ED6A 2X5RA 4A3EG 1BNCA 1JFFB 1HNZB 4Q0YA 4ECXA 4H33A 2FMAA 1FFXB 5DGHA 4O4IB 4DV1O 4TQFA 2ODMA 4NTWA 4KL1A 5KFVA 5FNVB 2IMWP 1PL0A 2QM7A 2Q69A 3UZBA 4LF4O 4P30A 2VQEB 4FGRA 4A3KG 2BOBC 3G6EV 2DE0X 1PD3A 4QWAA 2DYSC 4JI4O 2HR3A 4HAMA 5EBLC 4O84A 2W7PA 2FPGB 4JI6O 1AJNA 4RQEA 1DV2A 1YHQV 1DGSA 4ECTA 2BCCH 3JATA 4X64O 2UUAO 4Q8EA 1XEQA 2PTMA 5JQGA 3I4NG 1P49A 3CD6V 1MSWD 5L3BA 5KX5F 1M90W 4DW0A 2FPPB 1FPOA 2WLNA 4GX1A 3D8CA 1TUBB 2JVDA 1M56C 1YF2A 3GIKA 2E5LH 4MTGA 3LULA 3C90A 2ZR3A 4O2BF 3HOXG 4F4WA 4GKJB 2PMZA 5ITZA 2W7OA 2P4VA 5BMVF 2NLJC 3Q8PB 1AN7A 1CEZA 5LXTA 4E4TA 3GIIA 4LFAO 2HGWA 2YYAA 4DV4O 2R82A 1EN6A 2OCCB 3BQ1A 1G8MA 4LF9B 4QSHA 4H44B 2XASA 4JTDB 4O4IF 4G2KA 2PBZA 3J7AU 3N2GA 2PN1A 2E2HA 5FNVF 4WCEV 1J5EH 4L87A 2JJ1G 4NTYA 3OSPA 4GX0A 3KHLA 2L6LA 4I5SA 1CKOA 3HOUG 3TY9A 1SRYA 5T14A 2VS0A 3CJHB 4MVOA 3MWMA 3CMAV 1PP9H 4JI8B 2HIXA 4X89A 2FPIB 5DGIA 5C8YA 2LW7A 4MTEA 2IJHA 4E2LA 3RIZA 1ZQ7A 2VPQA 1XHXA 4FM0A 4PDBA 2EIKB 4E6NA 1A32A 3ZRSA 1HW7A 5KFPA 2R7KA 3QWUA 5IP9G 4B7KA 5D1OA 1I3QA 4JI1B 4FM2A 1ZAUA 4WFEA 4RUAA 2XCPA 1M9NA 1MSDA 2WA3A 4YR3A 5B1NA 5CMUA 4MVRA 1AILA 2OWOA 1N33B 4CS3A 4KHPB 1EKFA 2V58A 4JGSA 2AGOA 1R3KC 4DV0O 1FD9A 2FTKA 2AZ2A 3IN5A 1KJ8A 2HG8A 4JAUA 1PNLA 4BWAA 1UJWB 2ADQB 3BY6A 4LF6H 1NI8A 1W93A 1ZETA 1VQLV 2NN4A 1QLEC 3FD9A 2ZM6B 2LFRA 3H0GA 2W6PA 3H1KH 4DV7O 3M99B 2YZMA 5L1JA 2N05A 4GKKO 5KUKA 2CE4A 4YR2A 2DYRC 3G8DA 4U7CA 2COJA 3S3WA 4YJ2B 3ZHSA 4O7WA 4ED7A 4J9KA 2RDCA 3WFVA 2R9RB 4C5AA 2UXDB 5LP6C 4EEYA 1ZHQA 5BYBA 1GK9A 1NU1H 3V6HA 4CE5A 1I6UA 2OT5A 4I7ZB 4J9YB 4B3RH 3F7VC 1N36O 5K3WA 1S0MA 4O2AB 1A3GA 1H2KA 3RV3A 1RYRA 5EK0A 5KFEA 4RAYA 1KJJA 2ODTX 4J80A 4DV5O 1KYOF 2W6JG 2MCTA 2Q2UA 2DW4A 1SETA 1SERA 1I0HA 5IYBG 3JZIA 5C5JA 5FLXW 1O9HA 1R73A 5CA0A 1OHHG 5DQHA 1JJOA 2ZGIA 4ECQA 4O3PA 1F7YA 2Z04A 4Q4DA 4GZRB 4R7CA 3GV7B 5KFUA 1FJGH 4DK0A 2X6BA 4EFEA 1WB8A 2FB9A 4K8ZA 4LF8O 2P7TC 4ED2A 1XL4A 3H0GG 2UUCH 5I47A 2HVQA 4HBNA 1HDJA 3BABA 4O7NA 3NR7A 2A79B 4YJ2F 4JASA 3FX7A 2BTQA 3OHAA 1GM7A 2QWOB 4RAIA 3T9AA 3ZBHA 4D7SA 1SQQH 2HDKA 2UU9H 2LGQA 1KJQA 3KREA 3WB0A 5I5VA 4CKCA 1VF5B 2LFSA 5IJ0B 1VIBA
chains in the Genus database with same CATH topology
4JI8H 3K57A 4I50B 4X65B 4UCOA 2F4VB 1HNWH 4ZI7B 2XHBA 5IJ9B 4DV3B 4NXMB 4A2AA 4DR6H 4X20B 4IHJA 4FM9A 5LOVA 4DV0H 2CW8A 5FD6A 3GDEA 3HKBB 3VNNA 5JJJB 5IT9W 4DR6B 5JVDB 5EZYA 5LMNH 3VQWA 1P16A 3RWRD 4X66B 2JS5A 1HNXB 4JI1H 5LMNB 4PHZA 5KHGA 5IJ0A 4EQ5A 2KSWA 3RR5A 3RYIB 3F8NA 4DUYH 3ETQA 4I50A 4GKKH 1I94H 4FFBB 4LFCB 1XMQB 5IJ9A 2ZNJA 1N33H 3JASB 4DUZH 5GONB 4KHPH 1S5JA 3HKBA 2UXBB 2ZNIA 1N32H 4EFBA 3NBYB 5CB4B 2GV9A 1VF7A 4L8JA 3T1YH 5IWAH 1Z5VA 3LNNA 4JYAB 3T1YB 4IAJA 1O9GA 3RYIA 4YHHB 4DR2B 1N36H 1QHTA 4JI3B 2ZM6H 1NT2B 4FFBA 2W57A 3JASA 3OTOH 5GONA 1IBMB 3QG5A 4DV5H 1L2ZA 2IM9A 5A2QW 4OX9H 2Q7HA 4CH5A 5CB4A 4I4TB 4DR5B 3N43B 3J81W 2UXDH 1GYFA 5LYJB 3K5NA 4DV1B 3SR2C 2HVRA 2WYOA 4NXNH 3CSXA 3K5OA 1MZBA 4JI7H 3N44B 3PN1A 1V9PA 2HEPA 1M0WA 4RB1A 4LFBB 1E4GT 5D5PA 4LF8H 3ICXA 4UFZA 5BR8H 4DR1B 2KKWA 1KMIZ 2PGGA 1B04A 3U11A 4I4TA 1IBKH 4DV2B 1WPBA 3SJAC 4X64B 2PYJA 3JAWA 1N34B 2P22C 4TV9B 2VQFH 4B3TB 5EIBC 1Q8IA 2VQFB 5KHIA 5JH7B 5JCOA 1A0IA 1H2SB 3BA9A 3FFQA 4DV6H 4DR7B 4APMA 4TV8B 4AQYH 3RGZA 4YJ3B 5ITZB 1TAEA 5FPRA 4TUYB 1SA0B 1CKMA 5EYPB 4LF7B 2VPSA 4UCVA 2VOBA 3GB8B 4CC5A 4I7HA 3RYHB 4X62H 4M7EA 1Z2NX 4ETSA 4B3MH 4TOIA 1SQGA 4UCUA 3ZS8C 3N2GB 3VQXA 4IIJB 4LF5B 4DR4H 3UQ8A 4FVMA 5KHHA 3JSLA 4TV8A 3JARB 4LNUB 4WBNB 2YI9A 4JI0B 4YJ3A 4DR4B 2E5LB 4YY3H 4K0KH 4DR3H 4FLXA 4TUYA 3JAKB 1TGOA 3RYFB 4YY3B 1SA0A 4DR3B 1XMOB 1T5EA 5EYPA 3RF2A 4MV7A 4X65H 1Q43A 5LL6b 4DV3H 4NXMH 1FVIA 4FM1A 3RGBA 2PYLA 4CH6A 4RAZA 4PI0A 1IBLB 3RYHA 4CH4A 3GJXB 1XNQH 3KXYT 4O4HB 5JCOC 1XNQB 4IIJA 4X66H 4JI5H 1HNXH 3JARA 4LNUA 4WBNA 5JJNB 5LP6B 2YIAA 2ZCEA 4JI5B 4AHCA 1J5EB 3JAKA 5K1PA 3TY8A 3RYFA 5D1OB 3SGIA 1I7FA 2ZJTA 4LFCH 1XMQH 3DSQA 2UXCB 1XNRH 4FLWA 3CVZA 4UCSA 3SJBC 3A2FA 3KAJA 4ZI7A 3U10A 4LR3A 3WB1A 1XNRB 4A2BA 4CS4A 4RB0A 2UXBH 1FKAH 2BTOA 2PUSA 4O4HA 4X20A 2YCHA 1SQFA 5EIBD 4ZHQB 2HGSA 3VQYA 3BHPA 5JVDA 4X1KB 1Z2OX 3IAYA 3M4IA 4JYAH 5LP6A 2F95B 2PZSA 4YHHH 2PY5A 3VQVA 4DR2H 5KHJA 4JI3H 2HHHB 4B3SB 1RSOA 3W5OA 1TVKB 2ZIMA 2YXLA 5DISC 4X1YB 1S03G 2Q7EA 3M7MX 4NVPA 2CW7A 3N42B 4JI2B 1Q5OA 3HXLA 4CS2A 1IBMH 3IG0A 3N6XA 4DR5H 4UCTA 4ZHQA 4DV1H 1HR0H 5KMGB 4X1KA 3QTCA 2VWKA 3TY5A 3J80W 5KX5B 1HR0B 4EB6B 4DRXB 3BAAA 3DF7A 3EYYA 4DRFA 2Q2TA 4FLVA 1TVKA 2R70A 4B08A 5FPOA 4LF4B 4JI4H 4O2BB 2V4DA 3JAMW 4LFBH 2XIGA 2RGRA 1SKVA 4LF6B 5BMVB 4JI4B 4DR1H 3NBZB 3J7AK 4JI6B 4DV2H 3LMLA 4X64H 1N34H 4BWSC 2P5OA 5KMGA 1XK5A 5LYJA 1JFFB 4ZOLB 2UUAB 1HNZB 1X4TA 5KX5A 4EB6A 3KALA 4DRXA 3C0FB 4Q0YA 4B3TH 2QJ1A 4X1IB 4ZIBA 3JATB 1M4UA 3JALB 1FFXB 4O4IB 2F1MA 4TQFA 3RFRA 5JQGB 4KL1A 1WH2A 1TA8A 5FNVB 5D5QA 2HVSA 4O2BA 4K8XA 1YEWA 4DR7H 5CA0B 2VQEB 5BMVA 1BJTA 1QQCA 1SYXB 4FLZA 1Q3EA 3RGXA 4U3JB 4LFAH 5LMUB 4B3RB 3FMAA 1DGSA 1M5IA 4LF7H 4LFAB 1JFFA 4ZOLA 3HKDB 4DV4B 5LXTB 5J2TB 3RJ0A 4X1IA 5FD5A 3JATA 4TV9A 3JALA 1FFXA 4O4IA 2PTMA 2YI8A 5JQGA 1P49A 4MV9A 2R72A 5FNVA 1KU9A 3RTXA 3SJCC 5JH7A 4FLTA 2WE6A 4LF5H 2JVDA 1TUBB 4JI0H 2E5LH 3T1HB 4U3JA 4GKJB 5ITZA 1XMOH 5IYZB 1AN7A 4TQDA 3HKDA 1FJGB 1SEIA 5LXTA 5J2TA 1ZHSA 4RZQA 1IBLH 3MAQA 3CHXA 4LF9B 3N2KB 2UUCB 3BRCA 3L4KA 2RGVA 1XHZA 2QM4A 5C8YB 2ZINA 1TUBA 3N2GA 2UUBB 5K1XA 1G6UA 4PZ8A 1J5EH 3N41B 4JV5B 4BW9A 3S24A 1CKOA 1JMKC 5IYZA 1L8DA 2UXCH 2UU9B 3TY9A 2HIVA 3BPZA 4RB3C 4PZ7A 4GLXA 3MWMA 3ZEDA 1Z5WA 4Q6GA 4JI8B 3N2KA 2HIXA 3H20A 3K3VA 5D1PA 4I55B 2VWJA 4I9QA 5C8YA 5CA1B 4O4LB 1HNWB 4MTEA 3RIZA 3CB2A 1XHXA 4FM0A 4DV0B 4PDBA 3RYCB 2HHHH 4E6NA 4B3SH 1XDNA 3QF7A 1HW7A 1X9NA 3QWUA 2VUGA 5D1OA 4JI2H 4O4JB 4JI1B 4F6RB 4FM2A 4DV7H 4FLUA 2RQ6A 1ZAUA 3L4JA 4DUYB 4I55A 4DV7B 4LSXA 5LA6B 5CA1A 4O4LA 4GKKB 1I94B 2OWOA 2F93B 3HKEB 1N33B 4CS3A 4DUZB 1M93A 4KHPB 2FE3A 3RYCA 1N32B 1CKNB 4LF4H 2F66C 1M0TA 1S68A 3KYHC 1XQ8A 5IWAB 4O4JA 4X1YA 4BWAA 4F6RA 4LF6H 3K58A 1N36B 4JI6H 5LA6A 2ZM6B 4GYCB 4LSAA 3HKEA 4UCRA 3K59A 3OTFA 3OTOB 4DK1A 1HNZH 3HKCB 2UUAH 2WDTA 2OYQA 1E4FT 4LH7A 3JAWB 4YJ2B 1WN7A 4DV5B 4OX9B 1CKNA 2Q7GA 3E22B 3JSNA 2UXDB 5LP6C 5JJEB 2E3CA 1ZHQA 4MTDA 2VQEH 1WNSA 3B2EE 5J2UB 4NXNB 1I6UA 4HNAB 5LMUH 4B3RH 4JI7B 2JGUA 2ZIOA 1BGWA 2F4VH 1XI1A 4CC6A 3HKCA 3UT5B 4AILC 4DV4H 4O2AB 4LF8B 2YIBD 5BR8B 4D7TA 4YJ2A 4RAYA 3N40P 4LMYA 3WB2A 2CFMA 3E22A 3U0ZA 1IBKB 3L2PA 2MCTA 2Q2UA 2YIBA 1D5AA 4FLYA 4LH6A 2EX3A 3W1BA 5J2UA 5FLXW 1O9HA 5CA0A 2BTQB 3T1HH 2Q0AA 4HNAA 4PZ6A 1JJOA 4GKJH 1O75A 4R7RA 3K5MA 4DV6B 3UT5A 1FJGH 4O2AA 1VS0A 4CH3A 4DK0A 2R9AA 4EFEA 4EEQA 4K8ZA 4AQYB 3KAKA 5EOYA 3THOA 4LF9H 3W1GA 2O03A 4J0MA 2UUCH 2HVQA 4HBNA 3BABA 1Z2PX 3K5LA 4RB2C 2UUBH 2BTQA 3BA8A 4IHJB 5LOVB 4X62B 2RJZA 4JV5H 4D7SA 2CAZC 5EZYB 4B3MB 1P8LA 3NC0B 2UU9H 5KHKA 3WB0A 4PI2A 4K0KB 5IJ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBZ B;  1TAE A;  5FPR A;  4DUY B;  4JI6 B;  4DV7 B;  4GKK B;  1I94 B;  4X65 B;  4UCO A;  2OWO A;  2F4V B;  1CKM A;  1XK5 A;  4LF7 B;  4DV3 B;  1N33 B;  4UCV A;  4NXM B;  2UUA B;  1HNZ B;  4DUZ B;  4KHP B;  3GB8 B;  4CC5 A;  3GDE A;  3VNN A;  1N32 B;  4DR6 B;  1CKN B;  1TA8 A;  4TOI A;  1S68 A;  4UCU A;  1P16 A;  5IWA B;  4X66 B;  3KYH C;  2HVS A;  4LF5 B;  2VQE B;  3UQ8 A;  1HNX B;  5LMN B;  3JSL A;  4JI0 B;  4EQ5 A;  4DR4 B;  2E5L B;  3RR5 A;  1N36 B;  5LMU B;  2ZM6 B;  4B3R B;  4YY3 B;  4DR3 B;  1XMO B;  4LFC B;  1XMQ B;  1DGS A;  4UCR A;  4LFA B;  3OTO B;  1FVI A;  4DV4 B;  4LH7 A;  1IBL B;  3GJX B;  2UXB B;  4DV5 B;  4OX9 B;  1CKN A;  4EFB A;  3NBY B;  3JSN A;  2UXD B;  3RTX A;  1XNQ B;  4JYA B;  3T1Y B;  4JI5 B;  4YHH B;  3T1H B;  1J5E B;  4NXN B;  4DR2 B;  4JI3 B;  4GKJ B;  3TY8 A;  5D1O B;  3SGI A;  4JI7 B;  2UXC B;  1FJG B;  4CC6 A;  4UCS A;  4LF8 B;  1IBM B;  1XNR B;  5BR8 B;  4LF9 B;  2CFM A;  4DR5 B;  1IBK B;  2UUC B;  3L2P A;  4DV1 B;  2Q2U A;  4LH6 A;  3W1B A;  2HVR A;  2UUB B;  4PZ8 A;  4PZ6 A;  2HHH B;  4B3S B;  4JV5 B;  3W5O A;  3S24 A;  5DIS C;  1CKO A;  3PN1 A;  1V9P A;  2UU9 B;  3TY9 A;  4DV6 B;  2HIV A;  1VS0 A;  4LFB B;  4JI2 B;  4PZ7 A;  4GLX A;  4EFE A;  4UFZ A;  4EEQ A;  4DR1 B;  4AQY B;  4JI8 B;  1B04 A;  2HIX A;  5D1P A;  3W1G A;  4DV2 B;  4UCT A;  4X64 B;  1N34 B;  2HVQ A;  3BAB A;  1HNW B;  3TY5 A;  4B3T B;  1HR0 B;  3BAA A;  3BA8 A;  4DV0 B;  2VQF B;  4E6N A;  4DRF A;  4X62 B;  1XDN A;  2Q2T A;  1A0I A;  1X9N A;  3QWU A;  5FPO A;  4B3M B;  4LF4 B;  3BA9 A;  1P8L A;  3NC0 B;  2VUG A;  5D1O A;  4DR7 B;  4JI1 B;  4LF6 B;  4K0K B;  4JI4 B;  1ZAU A; 
#chains in the Genus database with same CATH topology
 1IXM A;  2QKS A;  1NR7 A;  4O2A F;  1OBD A;  4J9O A;  4X65 B;  2F4V B;  3U54 A;  1P4R A;  4ZI7 B;  5KS8 A;  1A9X A;  4HR7 A;  3L73 H;  5KFI A;  1R9T A;  4A2A A;  4X20 B;  5LOV A;  3H1H H;  4A5U B;  3HPL C;  3GDE A;  3VNN A;  3TW6 A;  3A0B Z;  3F5W C;  5JVD B;  2ABJ A;  4ASU G;  4FZ0 A;  5CAE B;  3TXQ A;  3VQW A;  5C3E G;  3RWR D;  3T1C A;  4MTO A;  3K08 A;  2L35 A;  5KFL A;  1H2L A;  4H37 A;  4PHZ A;  1TWG A;  4DW1 A;  2KSW A;  3F8N A;  2LQT A;  4DUY H;  3GQC A;  1Y76 A;  2WAQ A;  5IJ9 A;  2Q68 A;  2CDY A;  1AP5 A;  3H1L H;  4DV3 O;  2FK2 A;  1E1R G;  1S77 D;  3AK3 A;  3AX6 A;  1OCO B;  4Z2W A;  1EN4 A;  2ZNI A;  3ABK B;  4L8J A;  1VF7 A;  4DR6 O;  5IWA H;  2R92 A;  1XDC A;  3IJ4 A;  3LNN A;  4QW8 A;  1O9G A;  2HJF C;  1HNX O;  1AP6 A;  3Q4H A;  1N56 A;  3JCZ A;  3GID A;  2EIJ B;  5EC2 C;  2R7L A;  1NT2 B;  4NZO A;  3FKS G;  2KQX A;  3H4D A;  2W9C A;  5C44 G;  1XMQ O;  3T4Z A;  3RB6 A;  5KT7 A;  1I94 O;  1LUV A;  4ZI7 F;  5B3S C;  1L2Z A;  2NU9 B;  2EJR A;  4FFK A;  5BY1 A;  3ETD A;  1GRJ A;  3APQ A;  4CH5 A;  2YWV A;  3J81 W;  3N43 B;  4ED0 A;  2RNB A;  5LYJ B;  4DV1 B;  3LDC A;  5DN6 G;  2JA8 G;  1CXZ B;  5JVD F;  3GIL A;  1MZB A;  2I8C A;  1NKD A;  3EVK A;  4JI7 H;  4JI3 O;  4YIO A;  1VQ9 V;  4GCZ A;  4NR1 A;  4AYB E;  1M0W A;  1TWC A;  1I1M A;  5D5P A;  4MVS A;  5KLV H;  4J42 A;  4UFZ A;  5BR8 H;  2ZE6 A;  4DL7 A;  1RM1 C;  1YDX A;  1JX4 A;  1KMI Z;  3U11 A;  3RT3 C;  3ZX6 A;  4X64 B;  3JAW A;  2Q8V A;  2FLN A;  3CWB H;  4CKE A;  1RPO A;  3K03 A;  5EC1 C;  4B3T B;  2C35 B;  1ORQ C;  1Q8I A;  4WFA V;  5JH7 B;  5JCO A;  1A0I A;  2H3O A;  2R92 G;  4DV6 H;  2HVK C;  3G71 V;  1Z2G A;  4JTA B;  4DR7 B;  2Q6A A;  4FE2 A;  4MA5 A;  4I0X B;  5IY5 B;  4J9S A;  4YJ3 B;  1AR4 A;  5KT4 A;  3MDS A;  3K0D A;  1EZ1 A;  1YVW A;  1IOV A;  5EYP B;  2W6M A;  2VPS A;  2JA6 A;  5LHI A;  1UC8 A;  1OCZ B;  4CC5 A;  5LYJ F;  2GTA A;  3FB6 C;  1GSO A;  3WO0 A;  3GTM A;  1G1X B;  2E2I A;  3CQZ A;  1Y74 A;  4B3M H;  3QNE A;  4EBE A;  1SQG A;  4UCU A;  3DTG A;  2B1I A;  2EZP A;  3CE2 A;  4TWK A;  4TV8 A;  5IYD O;  3JAR B;  4WBN B;  2DZD A;  4K0K H;  1AJP A;  2YZG A;  3G4S V;  3UCS C;  1BZK A;  3VPC A;  2I80 A;  3T5K A;  4RNO A;  3G80 A;  1W96 A;  1SA0 A;  3CCM V;  1PKX A;  1S97 A;  1IX9 A;  4MV7 A;  4R8C A;  4NXM H;  3AG3 B;  3TXS A;  1JR9 A;  1IBL B;  3GJX B;  1XNQ H;  3GIP A;  4A3C G;  3OMN B;  3KXY T;  4R8U A;  4O4H B;  5KG4 A;  2JS3 A;  3T99 A;  5I5X A;  5C4X G;  1XNQ B;  4IIJ A;  3CCU V;  5JH7 F;  3E35 A;  1CS0 A;  1ZTE A;  1KJI A;  4KUM A;  2YIA A;  2XGQ A;  3RB3 A;  4IGG A;  5K1P A;  3ZMT A;  4PDL A;  2Z02 A;  2Z3Y A;  1I7F A;  2G38 A;  4UVC A;  3HOV G;  4BR6 A;  1Q86 W;  4YY3 O;  4YJ3 F;  3T2M A;  1LNQ A;  3CVZ A;  4U7O A;  2UVW A;  5CR5 A;  1FXH A;  1M57 C;  3A2F A;  4H13 B;  2R7M A;  2ASJ A;  2GUZ B;  2DYS B;  3P3P A;  3E8H A;  3B09 A;  3FYE B;  1GKF A;  4ZHQ B;  3GIQ A;  2HGS A;  5L3G A;  3BHP A;  4CHI A;  2JA6 G;  5LP6 A;  3CC2 V;  2PZS A;  5HBR B;  4YHH H;  4FZ1 A;  4DR2 H;  1QR8 A;  5KFX A;  4JI5 O;  2HHH B;  1RSO A;  5BWR A;  1IXB A;  4CMF A;  3E2E A;  4WBN F;  2RCV A;  2Q7E A;  3NUA A;  2ZDI C;  2JRI A;  3PW7 A;  5HFM A;  1R6N A;  5KT2 A;  2X7R B;  3E86 A;  2ZXW C;  4DR5 H;  2AW9 A;  2EJ7 A;  1CP9 A;  1KKD A;  3HOW G;  4RUF A;  3WWH A;  3QTC A;  1Q7Y W;  1FKA O;  5DGB A;  5LHH A;  2O57 A;  1I1L A;  4O4H F;  4J9Q A;  3EYY A;  1R3I C;  4QJF B;  4DRF A;  3ETE A;  2V4Q A;  1BE3 H;  1GSH A;  1NJI W;  1K97 A;  1GN2 A;  3FAV B;  3PJS K;  4MT8 A;  1Q82 W;  5DLG A;  4ECU A;  1BL8 A;  1QLN A;  4DAA A;  3SPG A;  2HHF B;  3NBZ B;  2Y4U A;  3LQS A;  4Q45 A;  4O7R A;  3H1J H;  4BIO A;  3G6V A;  1FFT B;  4JYY A;  4I55 F;  2QK4 A;  4O4L F;  5DM6 V;  4ZOL B;  5KX5 A;  3KAL A;  4DRX A;  5BPH A;  4ZHQ F;  1M4U A;  4G27 B;  2F1M A;  3CCL V;  3OMA B;  3RFR A;  1HR0 O;  3DTF A;  2HKO A;  4HNU A;  4YAK B;  1VF6 A;  1HWY A;  4O2B A;  4K8X A;  1D2D A;  4QWC A;  1SQP H;  5BXZ A;  2J6U A;  4IR9 A;  2YEV A;  5BMV A;  1BJT A;  3ZCC A;  4LF6 O;  1Q3E A;  4U3J B;  1SQX H;  3UM7 A;  5LMU B;  3CRR A;  1EHI A;  3WWI A;  2R6F A;  3FMA A;  1JFF A;  2F23 A;  3WWJ A;  1QR9 A;  3CP1 A;  3HKD B;  1OCO C;  3GIM A;  3RJ0 A;  2CH7 B;  1RJP A;  2HFE C;  5FD5 A;  4PA9 A;  4TV9 A;  1FFX A;  4WHX A;  4O4I A;  4RU9 A;  5J9P C;  3OSN A;  3DAA A;  4OX9 H;  5FNV A;  5DG8 A;  3MR2 A;  3RTX A;  2E74 B;  4FLT A;  4O7Z A;  2WE6 A;  3PR5 B;  3PW2 A;  4FJC C;  4DL4 A;  2EIJ C;  5TIS Z;  4EYI B;  4BXX G;  2WLI B;  3JD2 A;  5KFK A;  3L9D A;  3OEE G;  2R87 A;  2YC0 A;  1XMO H;  1JA8 A;  5IYZ B;  1KBL A;  2P6J A;  4YXW G;  1SEI A;  1ZHS A;  5BWW A;  2GSM B;  3GIJ A;  3R5F A;  4EGJ A;  1QLE B;  1KP3 A;  3MAQ A;  3E83 A;  5KKN B;  1VQM V;  3T54 A;  3LDE A;  3N2K B;  4ZOL F;  4MVU A;  3BRC A;  5F2V O;  2GHY A;  4BY1 G;  4UV9 A;  3MR5 A;  1D5N A;  1TUB A;  2DYR B;  4RWU A;  2WLJ A;  2D2C B;  2UUB B;  4PZ8 A;  2GQS A;  3TIG A;  2R7Z G;  4KFM A;  4JV5 B;  1QVF U;  2NU7 B;  3S24 A;  4JI0 O;  2UXC H;  3ABL B;  4A3B G;  1TWH A;  2HVJ C;  5LHG A;  4RB3 C;  5GW7 A;  1DK1 A;  3ZED A;  4ZQI A;  5D1P A;  3HKZ E;  5KFM A;  1OZ0 A;  4I9Q A;  4BAY A;  1WJZ A;  3ZMU A;  5CA1 B;  4PA7 A;  2UUC O;  3GTG A;  3CB2 A;  5KFF A;  1TWA A;  2ATK C;  1W2B U;  5LGU A;  4B3S H;  2W0X A;  1MMM A;  1KC8 W;  2VA3 A;  2VUG A;  1I08 A;  2ZQM A;  4QIW E;  4JI2 H;  3CJH A;  2UU9 O;  4O4J B;  4F6R B;  2RQ6 A;  3PVX A;  3GWK C;  5IYZ F;  3CXH F;  1ZSP A;  1CE8 A;  5KFT A;  4LSX A;  5LA6 B;  1I94 B;  5KG2 A;  1W0J G;  2A3Q A;  4B7E A;  2QM8 A;  1HNW O;  4DUZ B;  2FE3 A;  5JQW A;  3CCE V;  3I12 A;  5IYB O;  1WA8 B;  4F4X A;  1B06 A;  1M0T A;  3CCV V;  2ZE7 A;  3J80 N;  4JZ2 A;  1K5Q A;  1GTO A;  2JGD B;  5C1O A;  3AG3 C;  3L70 H;  4LSA A;  1QVG U;  4FFP A;  3OTF A;  3OTO B;  1HNZ H;  1QBZ A;  2Y4T A;  3E89 A;  2OYQ A;  1VAJ A;  4LH7 A;  5CA1 F;  4K35 A;  3U9T A;  2JK5 C;  5I5U A;  2W6Q A;  4NYK A;  5CBH A;  5JJE B;  4NYE A;  2D3O W;  3ZHU A;  5HV6 A;  4MTD A;  2W9A A;  2VQE H;  3LDD A;  3B2E E;  2XAG A;  3TIN A;  1JDB B;  4NXN B;  3LSU A;  4P9P A;  5BWX A;  4I9W A;  4O4J F;  1JVM A;  2XAJ A;  4QPJ A;  1YXB A;  1XI1 A;  4A3I G;  3T9B A;  3KKY A;  5F9N A;  2YIB D;  5LA6 F;  3LUT B;  1S10 A;  4YJ2 A;  2WLK A;  3K9A A;  3OT7 A;  3WB2 A;  2R8K A;  1IBK B;  1T3N A;  2R8H A;  2ITD C;  4ED1 A;  4FLY A;  2EX3 A;  1T94 A;  2AQ4 A;  4UB6 Z;  2Q0A A;  2MK3 A;  1AUV A;  4PZ6 A;  1NS1 A;  2XC9 A;  4GKJ H;  2Z5U A;  1MG1 A;  1O75 A;  4R7R A;  4JI7 O;  1FS0 G;  2PMZ E;  3OHB A;  4O2A A;  4WFG A;  4G3I A;  3SYO A;  2R9A A;  5CN0 A;  4EEQ A;  4AQY B;  3KAK A;  3E5N A;  3NGD A;  4LF9 H;  5LGN A;  1S0V A;  3DC6 A;  4I4T F;  3K5L A;  5B1O A;  1GSA A;  4IZO A;  3H40 A;  5B3S B;  1SQB H;  3OAA G;  2NUA B;  4X62 B;  2CAZ C;  5EZY B;  1P8L A;  2HLD G;  3T1H O;  5KHK A;  5H6R A;  4DV6 O;  4Q8F A;  4JI8 H;  1PL4 A;  3ZMZ A;  3GTP A;  3UKM A;  4UCO A;  1BXR A;  2QDO A;  2PF4 E;  2BSK B;  2FJZ A;  1RM1 B;  2CKZ B;  3MD0 A;  2HP8 A;  2YS8 A;  3TET A;  4GT1 A;  3OR6 C;  1B33 N;  1P16 A;  4X66 B;  4B3M O;  3SE7 A;  2ASL A;  1NQT A;  3MR3 A;  4JI1 H;  2Q5Z A;  5KHG A;  2A7W A;  5IJ0 A;  4EQ5 A;  4M0J A;  1OCR B;  4K0K O;  2VA2 A;  3CRQ A;  1WP8 A;  3KCX A;  1XRE A;  5KA6 A;  1N33 H;  3ORR A;  4O82 A;  5GON B;  1PNK A;  4KHP H;  4NXM O;  1S5J A;  2WB1 A;  2ZDG A;  2UXB B;  1UFI A;  3ASO B;  3B77 A;  2P0A A;  2ADP A;  2FKX A;  4JYA B;  4DL5 A;  4IAJ A;  3JD4 A;  3A0H Z;  5KA5 A;  2P90 A;  3T9D A;  5EZY F;  5LMN O;  2W0F C;  5KFY A;  1KC7 A;  4DL6 A;  3T9F A;  2ZM6 H;  4MVQ A;  3ZN0 A;  5L3E A;  1VQN V;  3G67 A;  4Z1M G;  3CX5 F;  2WSS G;  3U0G A;  5KUM A;  2GBO A;  2P67 A;  3D36 A;  1XUQ A;  3QG5 A;  3ZHV A;  1K1Q A;  5A2Q W;  2R85 A;  1GYF A;  2UXD H;  4IWY A;  3AG4 C;  2FB5 A;  2DPJ A;  1ZL8 B;  2CTP A;  1RJR A;  3L71 H;  3BEH A;  3SR2 C;  3J81 N;  3M9M B;  1T36 A;  2HVR A;  1N32 O;  3A0R A;  3T1Y O;  3ABL C;  3ZHR A;  1VQP V;  1N0J A;  2HEP A;  5KFG A;  2ZR2 A;  5EWF A;  5L1L A;  4LFB B;  1FAF A;  3MFI A;  4ZBM A;  2J6T A;  2X0S A;  4DR1 B;  2YXH A;  5CE8 A;  3CPW U;  3HBL A;  2CGO A;  4DV2 B;  1WPB A;  5GON F;  3KZI Z;  4O3R A;  5KFR A;  1RK5 A;  1M57 B;  2VQF H;  4UB8 Z;  2C22 A;  5A9G A;  2EIL B;  1L1F A;  2X6C A;  5EIB C;  2VQF B;  5KG7 A;  5KFC A;  4FFR A;  2B1G A;  3N27 A;  4LWS B;  1R1B A;  4J9R A;  3ZHT A;  4APM A;  2PI5 A;  4HQ6 A;  3RGZ A;  5ITZ B;  3P3N A;  4FBT A;  2EIN C;  1JLL B;  1GO3 E;  4O7L A;  1S5L Z;  4LF7 B;  2CUG A;  2VOB A;  3RBD A;  5B5E Z;  2QKA A;  3D3I A;  5DQG A;  3T9C A;  4EKW A;  4QNH B;  2ZXW B;  1Z2N X;  5LGT A;  4LCU C;  4JAV A;  3N2G B;  2YL2 A;  4LF5 B;  4I0X A;  1KKC A;  4GUN A;  1YZB A;  3JSL A;  3W7X A;  3PR4 A;  2YRW A;  2YI9 A;  4JI0 B;  4YJ3 A;  1KBH A;  3FB7 C;  3JAK B;  2DN9 A;  1TGO A;  3RYF B;  3SI8 A;  3RF2 A;  4X65 H;  2V4R A;  2F4V H;  5EYP A;  2R8I A;  4FM1 A;  3SYA A;  3RGB A;  4PI0 A;  3JCU Z;  4CH4 A;  1YIJ V;  2IJI A;  2WAM A;  1K34 A;  1RFY A;  3V4S A;  1Y66 A;  1MZE A;  4JAA A;  1P7B A;  2Y48 A;  3AG2 C;  4ED8 A;  1EYZ A;  2FLL A;  2YIC A;  2JIZ G;  3JAR A;  4WBN A;  5JJN B;  5KFS A;  2XND G;  5KG0 A;  2ZCE A;  2CNQ A;  2X6A A;  4WFB V;  3GLK A;  5IT9 N;  4DR4 O;  3TY8 A;  5DMX A;  1K8A W;  5D1O B;  2NR5 A;  2ZJT A;  3DSQ A;  5DQI A;  4N21 A;  4HN2 A;  4DR3 O;  1XMO O;  4J9P A;  2WAQ E;  3U10 A;  5KAF Z;  3T9E A;  4ME6 A;  1SES A;  4O7V A;  2AHZ A;  2BTO A;  2YCH A;  4O4H A;  4ECW A;  3QO8 A;  5H6Q A;  3G6B A;  2B63 A;  2HGX A;  3VQY A;  1FXK B;  1NBM G;  3SYC A;  4A93 G;  4BIU A;  3Q8Q B;  4MV3 A;  4CMD A;  1AI6 A;  1VMG A;  2PY5 A;  3AYH B;  5KHJ A;  2DWD C;  2KG7 A;  3RUP A;  2RDJ A;  3LP8 A;  3W5O A;  2ZIM A;  1V4Y A;  2IA6 A;  1PV0 A;  4CKB A;  1EZJ A;  3ZRX A;  2CW7 A;  3HB9 A;  3N42 B;  4DL3 A;  5KT6 A;  2GUZ A;  4CS2 A;  4HNV A;  2XCA A;  1IYD A;  4LFC O;  3Q2O A;  3N6X A;  1XNR O;  1JCH A;  2WLL A;  4UCT A;  4ZHQ A;  4DV1 H;  2Y0I A;  3RFC A;  4KXR A;  2FML A;  4QE7 A;  2B5U A;  5DG9 A;  3TY5 A;  2Y0P A;  2YSU B;  1SS3 A;  1Y6X A;  4EB6 B;  5L9X A;  3BAA A;  3H4B A;  3SDL A;  2JEG A;  1DF4 A;  4LF4 B;  4O7T A;  1JJ2 U;  3OGC C;  3OFN G;  2VR1 A;  4JI4 H;  2V4D A;  3HT5 A;  3JD3 A;  3M9O B;  1BCC H;  1SKV A;  2RF4 A;  4JI4 B;  2Z0A A;  1GAX A;  4JI6 B;  3G8C A;  4C5C A;  3LML A;  3BFR A;  4X64 H;  5EWG A;  1XK5 A;  1IBM O;  4PBC A;  2UUA B;  1MA1 A;  1X4T A;  4B3T H;  2QJ1 A;  4X1I B;  2IU0 A;  4ZIB A;  3JAL B;  4QJF A;  3FB8 C;  4RNM A;  1WH2 A;  1TA8 A;  3H9V A;  1N0N A;  3FAV A;  5D5Q A;  2HVS A;  5KG5 A;  4JV2 A;  4YP3 A;  3B40 A;  3T5J A;  1OCR C;  2M6Y A;  2GLT A;  2R86 A;  5CA0 B;  4DR7 H;  1YJW V;  2R8J A;  3ZIA G;  1S0O A;  3KG2 A;  2NVY A;  1THZ A;  4G28 B;  2Y0S A;  2HHF A;  1QQC A;  1SYX B;  1MNG A;  4FLZ A;  1S9F A;  1CPY A;  1N8R W;  3RGX A;  4LFA H;  1LUW A;  4J7K A;  2DIK A;  4Q4C A;  2A1H A;  1M5I A;  3V6K A;  3TK1 A;  4ZOL A;  4LFA B;  4DV4 B;  3BG5 A;  5J2T B;  3R5H A;  2OIE A;  3BCC H;  3ASO C;  1G2W A;  1N34 O;  1HNZ O;  4O81 A;  2QE7 G;  2XGP A;  2YI8 A;  3B4S A;  4J41 A;  4Q20 A;  2R72 A;  5KAI Z;  2BQR A;  5BWT A;  2CQY A;  4YB8 B;  5EDW A;  2Q0O C;  1P7G A;  4NZN A;  4YBZ B;  1VQK V;  2BR0 A;  5EWE A;  2VQE O;  3TQT A;  2ITC C;  3JRX A;  3T1H B;  1DF5 A;  4C2M A;  4U3J A;  1YTF B;  2CK3 G;  3TJT A;  1F4N A;  1K3E A;  1MOF A;  4YIP A;  3K3W A;  4TQD A;  3HKD A;  3RAQ A;  1WLE A;  4RZQ A;  2RMK B;  1IBL H;  3TEK A;  3CHX A;  3EPG A;  4WD3 A;  2HG5 C;  2RGV A;  3R65 A;  1XHZ A;  4GC7 A;  2ZIN A;  3WU2 Z;  1I50 A;  1SZX A;  5K1X A;  1G6U A;  1I5Y A;  5KFJ A;  4GX5 A;  4HYO A;  2LW1 A;  3APO A;  1YJN V;  5CA0 F;  3N41 B;  3RVZ A;  2XTA A;  1K4D C;  1JMK C;  5IYZ A;  2EJ2 A;  4U3F H;  1TUE B;  2E5L O;  2HIV A;  1RPR A;  4A3L G;  4FFN A;  3OGI B;  1Z5W A;  3WO1 A;  3N2K A;  3K3V A;  4I55 B;  5J2T F;  4LF9 O;  2EIL C;  3K0G A;  4O4L B;  2ASD A;  2EUL A;  4OXS A;  5KG6 A;  3DXR B;  1E1Q G;  2QB5 A;  4F4Z A;  3K5H A;  4DV0 B;  2ATL A;  3RYC B;  2HHH H;  1XDN A;  3QF7 A;  1R3L C;  4XDL A;  4DIM A;  4TQR A;  1VQ6 V;  1J5E O;  2R8G A;  4DV7 H;  4FK5 C;  3AEI A;  3TW7 A;  3L4J A;  3MHH C;  4DV7 B;  4QWD A;  4JI8 O;  2VQD A;  5CA1 A;  4GKK B;  2QSA A;  2F93 B;  3HKE B;  2IBZ H;  2OTL V;  3QQM A;  1M93 A;  3ZJZ A;  4JYB A;  1EUD B;  3R9R A;  2W71 A;  2DWE C;  1US6 A;  5KG1 A;  5LOV F;  1N32 B;  1CKN B;  5JUM A;  1VQ5 V;  1S68 A;  4O7Y A;  3PW4 A;  4XBF A;  5BYA A;  2DOS A;  4O4J A;  4X1Y A;  4F6R A;  2V5A A;  2ARH A;  5DED A;  1N36 B;  5LA6 A;  1P84 F;  4GYC B;  4UVB A;  1ZUQ A;  4J9Z B;  3JAM N;  2K9P A;  1U96 A;  5DLF A;  3I5D A;  4DK1 A;  3HKC B;  4MV1 A;  1N33 O;  4IYH A;  3MJF A;  1E4F T;  4KHP O;  1WA8 A;  1JPX A;  3JAW B;  4XYM B;  4DV5 B;  4PDV A;  3E22 B;  3JSN A;  3ABM C;  1VKZ A;  4EBC A;  4FU0 A;  1N4C A;  4MV6 A;  3CCR V;  3A8T A;  1WNS A;  1M1K W;  5J2U B;  1ULZ A;  1Y1V A;  4R50 A;  4HNA B;  5BPF A;  4IL6 Z;  5LMU H;  4X88 A;  1BGW A;  2ZIO A;  1Q6H A;  2ZM6 O;  1VBH A;  4QWE A;  4AIL C;  3UT5 B;  5L1K A;  4LF8 B;  2ZT9 B;  3QFF A;  3T7A A;  4D7T A;  1EM1 A;  4JXU A;  4LMY A;  1FXK C;  4YR0 A;  1OJH A;  2XAF A;  3JYC A;  2AHY A;  3L74 H;  5DAA A;  3CCS V;  4ICG A;  2UXD O;  1R6K A;  2IU3 A;  2RN9 A;  5E1A C;  1PX2 A;  4MW3 A;  1Y74 B;  3P32 A;  3AG1 C;  5B66 Z;  3V4Z A;  3V6J A;  3UYY A;  3RB0 A;  5L3D A;  4J9M A;  1B6R A;  4KP4 A;  3K5M A;  3KHG A;  1VS0 A;  4DLK A;  2C2R A;  4B3R O;  4UVA A;  2CNV A;  1YJ9 V;  2YS6 A;  3R23 A;  1AI4 A;  4TM5 A;  3QVN A;  2XUM A;  5B1B C;  4F4L A;  3R5X A;  2KB1 A;  2LP7 A;  1KJ9 A;  4J0M A;  2QWN B;  1GN3 A;  1AI7 A;  4RZR A;  3PO2 G;  2M05 A;  2A0L A;  1FYJ A;  1Z2P X;  1PM9 A;  4RB2 C;  3TGU H;  4F6E A;  1YTF D;  1C3O A;  3U55 A;  2DLN A;  2UUB H;  3RBZ A;  2XOK G;  3FKI A;  4IHJ B;  4HZ3 A;  3OD4 A;  2RJZ A;  4JV5 H;  3AG4 B;  3W7T A;  1J95 A;  4D6T H;  2DWC A;  1H8E G;  4XX0 B;  5J2U F;  1EUC B;  3OMI B;  1K92 A;  1Y1V G;  3DTU B;  2EIM C;  3H1I H;  1FJG O;  2WPD G;  3IFX A;  4BBR G;  4I50 B;  5D8D A;  3GTJ A;  3WNZ A;  4DV3 B;  4A3F G;  5I5S A;  1ZWI C;  4DR6 H;  2CW8 A;  2JEX A;  3HKB B;  3IGA C;  4DR6 B;  5EZY A;  1BGY H;  1HNX B;  1ROP A;  5KFW A;  4NLG A;  3JRW A;  3RYI B;  3ZMS A;  3CCQ V;  3JZ6 A;  5FL7 G;  3G6Y A;  1SFO A;  2C2D A;  1I94 H;  4FFB B;  3K04 A;  4LFC B;  4C7U A;  1XMQ B;  1NVP D;  1E4E B;  2IH1 C;  3JAS B;  2F4V O;  2BSK A;  2N74 A;  4DUZ H;  1EKV A;  5H2F Z;  4C5B A;  1RK6 A;  2EIN B;  1V55 C;  4MSW C;  1BHA A;  3AK1 A;  2CTQ A;  4EFB A;  5CB4 B;  1TWF A;  3T5H A;  3SPJ A;  2GV9 A;  1SQV H;  2N04 A;  4IHJ F;  5KFO A;  3ASN C;  2EBO A;  2Q73 A;  3ABU A;  2W9B B;  2R84 A;  2IJK A;  3FKI G;  2V59 A;  1JOY A;  4JI3 B;  1DAA A;  3NXS A;  2YUA A;  2W57 A;  3OTO H;  5GON A;  4DUY O;  2PI4 A;  4I50 F;  5KFA A;  1IBM B;  1XL6 A;  3BVO A;  2IM9 A;  1K7D A;  4I4T B;  4IRD A;  1PK8 A;  4HYK A;  1B3Q A;  4CZZ A;  2WLM A;  1BS3 A;  1KEE A;  2YS7 A;  1URF A;  5A2Q N;  1EN5 A;  5BWU A;  3BAC A;  2W8K A;  2AGA A;  5I5W A;  3RBE A;  4NXN H;  4TSF G;  2FKL A;  1VAR A;  5IWA O;  3ABT A;  3AG2 B;  3L75 H;  3N44 B;  3OUF A;  5GTH Z;  2YEV B;  4RB1 A;  1E4G T;  3BJY A;  2QR4 A;  4JPR A;  1DIK A;  2KKW A;  2PGG A;  2AZ0 A;  3ZHQ A;  1IBK H;  3SJA C;  1N34 B;  1KUQ A;  1V51 A;  2QA4 V;  2DQ3 A;  1ZL8 A;  1WSC A;  4TV9 B;  4X9Q A;  4OX9 O;  5KG3 A;  3T5L A;  5CB4 F;  4ABM A;  5KHI A;  4QWB A;  3CC7 V;  4IRK A;  1H2S B;  3BA9 A;  3FFQ A;  3TII A;  1WRV A;  1Q6U A;  5FLX N;  4UUG A;  3ZRW B;  1K5S A;  3UFX B;  4AQY H;  1K1S A;  3E8F A;  3OUS A;  4ECZ A;  1TAE A;  4TUY B;  3T4D A;  2W6O A;  5BR8 O;  2OLS A;  1DTO A;  3STL C;  3UO3 A;  1GM8 A;  4EBD A;  4B3T O;  2DAB A;  4I7H A;  5IYC G;  4ECY A;  3RYH B;  4H0L B;  3K3P A;  4X62 H;  4M7E A;  4ETS A;  3CRM A;  4TOI A;  3I56 V;  3I55 V;  4LWS A;  3QZ7 A;  4DL2 A;  2F43 G;  1NTK H;  1VQ7 V;  1ENV A;  2NU6 B;  4FPP A;  3OE7 G;  4DR7 O;  4LNU B;  3CRA A;  1A48 A;  4YY3 H;  4L1K A;  2E5L B;  4FLX A;  1WP7 A;  2ZDI A;  3W7S A;  4YY3 B;  5LL6 b;  1V54 C;  1G4Y B;  1FVI A;  2ZE8 A;  2NU8 B;  1R6T A;  3AG7 A;  3AK2 A;  4RAZ A;  2JEF A;  4Z1V A;  1WAZ A;  5E79 Z;  4TV9 F;  2NVX A;  2E76 B;  2GTS A;  4BIZ A;  3C3T A;  5JCO C;  4X66 H;  4JI5 H;  1PNM A;  2QYZ A;  3C3S A;  1SCU B;  2C2A A;  4Q43 A;  3X2Q B;  3STZ C;  4JI5 B;  1J5E B;  1X59 A;  3JAK A;  2MW2 B;  3RYF A;  2SCU B;  1GMG A;  2J9G A;  1OCC C;  3HO8 A;  4JV0 A;  4GC6 A;  5CM0 A;  3VA7 A;  4DO2 A;  4TUY F;  5AG2 A;  4UCS A;  3SJB C;  1I7L A;  3KAJ A;  4ZI7 A;  4LR3 A;  3WB1 A;  4P9O A;  2HJW A;  2UXB H;  1FKA H;  5EBM C;  2PUS A;  3K79 A;  4X20 A;  1IBL O;  1SQF A;  2XD4 A;  2WB1 E;  5EIB D;  1Y4M A;  3PW0 A;  4TT3 G;  3ZN1 A;  4PJ0 Z;  5JVD A;  2COG A;  4X1K B;  1XNQ O;  4JYA H;  4TQS A;  2F95 B;  1AVM A;  2GPS A;  4NKG B;  3VQV A;  5C1P A;  1OV9 A;  4PV1 B;  2YW2 A;  1S0N A;  1TVK B;  2YXL A;  5DIS C;  1S03 G;  1Q90 D;  2Y69 C;  3M7M X;  4QPK A;  5BZB A;  4J7J A;  1GN4 A;  3HXL A;  4TVI A;  3K5I A;  2FL4 A;  3W7U A;  3CEI A;  3GV8 B;  1HR0 H;  5LBQ A;  3L72 H;  1FXK A;  5KMG B;  2FYU H;  2VWK A;  2VUM A;  3J80 W;  2B9Z A;  2P4K A;  1IVS A;  1HR0 B;  3WG7 B;  1B6S A;  3M8A A;  2EJ3 A;  5H80 A;  2Q2T A;  4FLV A;  2I87 A;  1ZLZ A;  4BY7 G;  2HHH O;  2YXY A;  5FPO A;  2V9W A;  1IUR A;  4YHH O;  4DR2 O;  2Q67 A;  4JYC A;  1COW G;  2XIG A;  4J9N A;  1K9M W;  4LFB H;  2W70 A;  3RAX A;  2P06 A;  4LF6 B;  4QIW F;  2DMX A;  4DR1 H;  5B1A C;  1S5H C;  1OBG A;  2HJD A;  3HR0 A;  4AI8 A;  3J7A K;  4WFF A;  4DV2 H;  4YQW A;  1KQS U;  3VBB A;  2P5O A;  1JQ0 A;  4BWS C;  1XIL A;  1L0N H;  5L3C A;  5LL6 Y;  5KT3 A;  1NTZ H;  5LYJ A;  4FS1 A;  4DR5 O;  4EB6 A;  5DG7 A;  3C0F B;  1WB7 A;  3SYP A;  3JAT B;  4XDJ A;  3R66 A;  4MAM A;  4ECR A;  5JQG B;  3AW8 A;  2IH3 C;  3PFF A;  4O83 A;  1YEW A;  4JF3 A;  3CCJ V;  3K9S A;  5HNE A;  2JEJ A;  3GB7 C;  2DJV A;  1DLB A;  1L0L H;  4B3R B;  1KT8 A;  3VOT A;  1GM9 A;  1VBG A;  4LF7 H;  2C28 A;  5LXT B;  3SYQ A;  3MR6 A;  4X1I A;  2QWR B;  3JAL A;  4E4E A;  4PA3 A;  2WA4 A;  1LR1 A;  4MV9 A;  2AGQ A;  2EIY A;  1KU9 A;  3SJC C;  5JH7 A;  1A0G A;  4LF5 H;  4O7S A;  2VUM G;  4A3J G;  4JI0 H;  5KFB A;  2CNU A;  3Q8S B;  2ILM A;  1ET0 A;  2CTR A;  5GTI Z;  4JV1 A;  5LMU O;  3MWE A;  3M9N B;  2V7Q G;  4WFH A;  2QWP B;  1FJG B;  1XOU A;  5J2T A;  4PD4 F;  1GH6 A;  1WPX A;  4XDK A;  4PA6 A;  3N8D A;  2QKC A;  3EXA A;  4LC1 A;  1JIH A;  2QF7 A;  4MV4 A;  2UUC B;  3L4K A;  2EJ0 A;  3HOZ G;  1NZ6 A;  2AU0 A;  2QTS A;  2QM4 A;  5C8Y B;  1VF6 C;  5K2M A;  5CBF A;  1S76 D;  5JQG F;  3DGE A;  1IDS A;  3VMM A;  2W6N A;  3ABM B;  3U9S A;  4BW9 A;  3RVY A;  2W6I G;  3MFH A;  1L8D A;  5BWV A;  2UU9 B;  3CXC U;  1WR2 A;  3O9O A;  1K4C C;  3BPZ A;  1UNN C;  4PZ7 A;  4GLX A;  4HNT A;  1KUT A;  3JD1 A;  1OWT A;  4Q6G A;  3H20 A;  5DGA A;  2VWJ A;  5LXT F;  1YIT V;  1HNW B;  3MWD A;  1IYE A;  4JUZ A;  2Q9L A;  2UUB O;  1YSC A;  3LSS A;  2QWQ B;  1X9N A;  2BE3 A;  3CRC A;  3IC9 A;  4JV5 O;  3KTM A;  3UO2 A;  2GPW A;  4U7N A;  4ZKI A;  1WCM A;  4FLU A;  3AG1 B;  2FK1 A;  1NTM H;  3FYI B;  2UXC O;  4DUY B;  4I55 A;  2XT9 A;  4O4L A;  4RNN A;  3ETG A;  3O65 A;  4A3M G;  3S3X A;  1VQ8 V;  2LGW A;  4P2Z A;  3DXR A;  4A3D G;  4FS2 A;  4MW8 A;  3H3V H;  5B1B B;  3RYC A;  3GVM A;  5C8Y F;  4FBU A;  2QTO A;  1B6Q A;  5L3F A;  3CEB A;  2A06 H;  3LNM B;  1VP7 A;  1RJQ A;  4LF4 H;  1ARO P;  1W0K G;  2F66 C;  4RO2 A;  2OTJ V;  1XQ8 A;  5IWA B;  4FIP C;  3ETH A;  3KYH C;  4MA0 A;  4F4Y A;  1Q6I A;  4B3S O;  1I2L A;  2C00 A;  3K58 A;  1Q81 W;  1M7J A;  1C30 A;  2OCC C;  2M7W A;  4LBE C;  4JI6 H;  3B8N A;  4IT5 A;  4JI2 O;  4MTF A;  3HKE A;  4UCR A;  1E79 G;  3K59 A;  4RCN A;  4W4L A;  2XAQ A;  4OGQ B;  5I5T A;  3KHR A;  2UUA H;  2WDT A;  2Q4P A;  3K06 A;  2EIM B;  5JWP A;  4DUZ O;  2JDI G;  1Y1W A;  1WN7 A;  4OX9 B;  3VPB A;  1CKN A;  2Q7G A;  3X2Q C;  4PDM A;  2E3C A;  2JA7 A;  4CBC A;  2YDE A;  5EBW C;  3QZ8 A;  4NB5 A;  5FLM G;  2B63 G;  4M9U A;  3PZP A;  3EFF K;  4AYB A;  1YCI A;  1S3J A;  3RN4 A;  2Y0S E;  4JI7 B;  1SZT A;  2JGU A;  4N23 A;  3N6R A;  4CC6 A;  3HKC A;  2XCL A;  4DV4 H;  3RB4 A;  1WCM G;  5JVL A;  3ZRV A;  3OTO O;  2YZN A;  4Y8V B;  5BR8 B;  3VPD A;  3N40 P;  2CFM A;  3E22 A;  3U0Z A;  4ECV A;  2EIK C;  3L2P A;  4FFL A;  2YIB A;  1AR5 A;  1D5A A;  2UVV A;  1M6V A;  3Q1K A;  4LH6 A;  4DYL A;  1U97 A;  5CBG A;  5J2U A;  1V55 B;  2Q7D A;  3W1B A;  2BQU A;  3T1H H;  2BTQ B;  2FP4 B;  4MS2 A;  4HNA A;  3I4M G;  2JJ2 G;  4NXN O;  1F23 A;  3ASN B;  3PO3 G;  3HOY G;  2EZO A;  4DV6 B;  3UT5 A;  1H2M A;  3ML0 A;  4X8A A;  4CH3 A;  4W4K A;  1KP2 A;  4FFO A;  4MV8 A;  5EOY A;  2H8P C;  3BQ2 A;  2CH7 A;  3P30 A;  3E8B A;  3THO A;  4OPH A;  3CME V;  3SJQ C;  3QO7 A;  3W1G A;  2O03 A;  5KFQ A;  4MTX A;  4JZG A;  3WG7 C;  1IBK O;  3ETJ A;  1Y14 B;  1YI2 V;  4OPA A;  2V1D A;  5E25 A;  4UXN A;  3Q8R B;  1H8H G;  3BA8 A;  1Y1W G;  5LOV B;  1JXL A;  2XAH A;  4LP8 A;  2WLI A;  4B3M B;  1I7N A;  3NC0 B;  2JA7 G;  4PDR A;  5C93 A;  2CGN A;  1K83 A;  4GKJ O;  2C2E A;  1BHB A;  1QNM A;  4PI2 A;  2R93 A;  2DAA A;  4K0K B;  4O3O A;  1H2N A;  1EZV H;  3D3Q A;  2YU9 A;  4AQY O;  3SPC A;  2Y4R A;  3GTL A;  3K57 A;  1Y76 B;  5I5Y A;  5I60 A;  1GO3 F;  2XHB A;  5IJ9 B;  4NXM B;  4O86 A;  4EGQ A;  1EBO A;  3OUU A;  5KT5 A;  4IHJ A;  4FM9 A;  4DV0 H;  3ZMV A;  5FD6 A;  1QCE A;  4GX2 A;  4O3Q A;  5JJJ B;  5IT9 W;  1NVP B;  1SC5 B;  4X62 O;  3G6X A;  5LMN H;  2GQR A;  2DPI A;  1MAB G;  4J11 A;  1IOW A;  2JS5 A;  4FMT A;  4FFM A;  5LMN B;  3OUZ A;  5IP7 G;  2UVR A;  3CYO A;  2KG7 B;  3RR5 A;  3Q4H B;  3ETQ A;  4I50 A;  4QE9 A;  4GKK H;  4RUC A;  2ZNJ A;  2W9C B;  1AI5 A;  5IDJ A;  1BQZ A;  2ETN A;  2WLL B;  3CSW A;  2AGP A;  3HKB A;  4EYH B;  2R7N A;  1DV1 A;  2YZL A;  1N32 H;  3NBY B;  4J7Z A;  3T1Y H;  1NH2 B;  4QGP A;  1Z5V A;  3EHB B;  4XZ3 B;  2PVP A;  1NR1 A;  4X66 O;  5H5N A;  3T1Y B;  2ALZ A;  2JEI A;  3RYI A;  2WWW A;  4YHH B;  2OH2 A;  4DR2 B;  3H01 A;  3PW5 A;  1QHT A;  1N36 H;  1M56 B;  2UVU A;  4FFB A;  4JI1 O;  4DQN A;  2CTW A;  1E4E A;  4J9L A;  3JAS A;  3GWO A;  3VOU A;  3LSQ A;  4U6P A;  1RP3 B;  2R93 G;  1BSM A;  2CZG A;  4IRC A;  1ZX3 A;  4DV5 H;  2Q7H A;  5CB4 A;  1GN6 A;  4DR5 B;  1KEC A;  2UXB O;  3JD0 A;  5IYC O;  1V54 B;  3K5N A;  2W9B A;  4NTX A;  2R9I A;  3JZF A;  1F4M A;  3DC5 A;  2YID A;  2WYO A;  5FJ8 G;  4JYA O;  4YAJ B;  3CSX A;  3K5O A;  3GTK A;  1XBL A;  2JGD A;  3QO5 A;  4RUE A;  3PN1 A;  1V9P A;  4ECS A;  3LWB A;  2QGN A;  4LF8 H;  1PPJ H;  4EG0 A;  3KCY A;  1HNW H;  3ICX A;  3OR7 C;  1Y67 A;  4RQF A;  3W7W A;  1B04 A;  4I4T A;  1H2G A;  2PYJ A;  1OCC B;  2P22 C;  2WTF A;  2UXN A;  5HFL A;  4UUJ C;  4IWX A;  1AUX A;  4IYI A;  2W8L A;  1F51 A;  2IJJ A;  2R7Z A;  2JA5 A;  1S72 V;  1JX9 A;  4R6Z A;  2GDS A;  1AR1 B;  1JKJ B;  3GTO A;  2ZDQ A;  2ZDH A;  2LO1 A;  2RDI A;  1IZ3 A;  2W6Z A;  4TV8 B;  3CC4 V;  4LFB O;  3SNO A;  2A9H A;  3MHS C;  5FPR A;  1BQ0 A;  4DR1 O;  1MZF A;  3TCU A;  3D36 C;  2Y69 B;  4F50 A;  2IW5 A;  4DV2 O;  4IR1 A;  1SA0 B;  3ABK C;  1CKM A;  5KFN A;  3E8G A;  4K3A A;  4UCV A;  5IE9 A;  1W59 A;  3GB8 B;  3SPI A;  4PA4 A;  3TQ1 A;  3OM3 B;  1HP8 A;  5F9L A;  2VQF O;  1BMF G;  2X0L A;  4R8U B;  2E75 B;  2QEX V;  4NZM A;  3ZS8 C;  3VQX A;  4IIJ B;  4DR4 H;  3OEH G;  1K73 W;  3ZRW A;  3UQ8 A;  4FVM A;  5KHH A;  5KFZ A;  4DR4 B;  4DR3 H;  5DEC A;  2COI A;  4TUY A;  1CQJ B;  2BQ3 A;  5FR9 A;  4DR3 B;  1XMO B;  1T5E A;  4DXW A;  1VQ4 V;  4BBS G;  1Q43 A;  2AXT Z;  4DV3 H;  4LF7 O;  3F5T A;  2PYL A;  5B1A B;  4CH6 A;  3RYH A;  3F7Y C;  1BT8 A;  2KSD A;  2UXX A;  1I2K A;  4MVZ A;  1UPG A;  5L1I A;  4O3S A;  1VQO V;  3UZO A;  1I5X A;  2FK3 A;  1HNX H;  1SF9 A;  2BOC C;  4LNU A;  4LF5 O;  5LP6 B;  2JA5 G;  2WLH A;  1AB3 A;  3IC7 A;  4AHC A;  2OCH A;  4UV8 A;  1RSO B;  3SGI A;  1QU7 A;  4TV8 F;  3HB3 B;  1XMQ H;  4LFC H;  2JEU A;  2UXC B;  4FLW A;  1XNR H;  4GLW A;  1EFR G;  3ORQ A;  1CQI B;  4A2B A;  1XNR B;  3HKZ A;  4JTC B;  4O3N A;  4CS4 A;  4X65 O;  4RB0 A;  5H9C A;  2DQ0 A;  3KHH A;  3FDS A;  1Z2O X;  3IAY A;  3M4I A;  2OIG A;  1UC9 A;  1EKP A;  2VRZ A;  5IY5 C;  4IIJ F;  1RYS A;  4B3S B;  4JI3 H;  4BW5 A;  4QIW A;  2ZKO A;  1R3J C;  2YRX A;  4X1Y B;  2IP4 A;  2FLP A;  5IYD G;  1KB9 F;  4NVP A;  1K33 A;  4JI2 B;  1AJQ A;  2NNU A;  3SPH A;  1I1K A;  2LJ2 A;  1Q5O A;  1GGO A;  4PWQ A;  1IBM H;  2J6S A;  1NH2 D;  1KD1 W;  3IG0 A;  1OCZ C;  5KFD A;  3OW2 U;  4MVM A;  5KFH A;  3BQ0 A;  4WF9 V;  1N48 A;  4X1K A;  1FXV A;  3RV4 A;  4J10 A;  1KTA A;  5KX5 B;  2H94 A;  4DRX B;  3DF7 A;  3B8M A;  1GLV A;  2ZD9 A;  4K6N A;  1TVK A;  2IBK A;  2R70 A;  4B08 A;  5LP6 F;  3GTQ A;  4ED3 A;  4PEL A;  4XYL B;  4Q44 A;  4O2B B;  3JAM W;  4A3G G;  1H38 A;  3GV5 B;  2RGR A;  2K1E A;  3CS5 A;  1VEW A;  5BMV B;  5CA3 A;  3EPI A;  4QW9 A;  1JDE A;  3FB5 C;  1N34 H;  3RW0 A;  2ZE5 A;  5KMG A;  4ED6 A;  2X5R A;  4A3E G;  1BNC A;  1JFF B;  1HNZ B;  4Q0Y A;  4ECX A;  4H33 A;  2FMA A;  1FFX B;  5DGH A;  4O4I B;  4DV1 O;  4TQF A;  2ODM A;  4NTW A;  4KL1 A;  5KFV A;  5FNV B;  2IMW P;  1PL0 A;  2QM7 A;  2Q69 A;  3UZB A;  4LF4 O;  4P30 A;  2VQE B;  4FGR A;  4A3K G;  2BOB C;  3G6E V;  2DE0 X;  1PD3 A;  4QWA A;  2DYS C;  4JI4 O;  2HR3 A;  4HAM A;  5EBL C;  4O84 A;  2W7P A;  2FPG B;  4JI6 O;  1AJN A;  4RQE A;  1DV2 A;  1YHQ V;  1DGS A;  4ECT A;  2BCC H;  3JAT A;  4X64 O;  2UUA O;  4Q8E A;  1XEQ A;  2PTM A;  5JQG A;  3I4N G;  1P49 A;  3CD6 V;  1MSW D;  5L3B A;  5KX5 F;  1M90 W;  4DW0 A;  2FPP B;  1FPO A;  2WLN A;  4GX1 A;  3D8C A;  1TUB B;  2JVD A;  1M56 C;  1YF2 A;  3GIK A;  2E5L H;  4MTG A;  3LUL A;  3C90 A;  2ZR3 A;  4O2B F;  3HOX G;  4F4W A;  4GKJ B;  2PMZ A;  5ITZ A;  2W7O A;  2P4V A;  5BMV F;  2NLJ C;  3Q8P B;  1AN7 A;  1CEZ A;  5LXT A;  4E4T A;  3GII A;  4LFA O;  2HGW A;  2YYA A;  4DV4 O;  2R82 A;  1EN6 A;  2OCC B;  3BQ1 A;  1G8M A;  4LF9 B;  4QSH A;  4H44 B;  2XAS A;  4JTD B;  4O4I F;  4G2K A;  2PBZ A;  3J7A U;  3N2G A;  2PN1 A;  2E2H A;  5FNV F;  4WCE V;  1J5E H;  4L87 A;  2JJ1 G;  4NTY A;  3OSP A;  4GX0 A;  3KHL A;  2L6L A;  4I5S A;  1CKO A;  3HOU G;  3TY9 A;  1SRY A;  5T14 A;  2VS0 A;  3CJH B;  4MVO A;  3MWM A;  3CMA V;  1PP9 H;  4JI8 B;  2HIX A;  4X89 A;  2FPI B;  5DGI A;  5C8Y A;  2LW7 A;  4MTE A;  2IJH A;  4E2L A;  3RIZ A;  1ZQ7 A;  2VPQ A;  1XHX A;  4FM0 A;  4PDB A;  2EIK B;  4E6N A;  1A32 A;  3ZRS A;  1HW7 A;  5KFP A;  2R7K A;  3QWU A;  5IP9 G;  4B7K A;  5D1O A;  1I3Q A;  4JI1 B;  4FM2 A;  1ZAU A;  4WFE A;  4RUA A;  2XCP A;  1M9N A;  1MSD A;  2WA3 A;  4YR3 A;  5B1N A;  5CMU A;  4MVR A;  1AIL A;  2OWO A;  1N33 B;  4CS3 A;  4KHP B;  1EKF A;  2V58 A;  4JGS A;  2AGO A;  1R3K C;  4DV0 O;  1FD9 A;  2FTK A;  2AZ2 A;  3IN5 A;  1KJ8 A;  2HG8 A;  4JAU A;  1PNL A;  4BWA A;  1UJW B;  2ADQ B;  3BY6 A;  4LF6 H;  1NI8 A;  1W93 A;  1ZET A;  1VQL V;  2NN4 A;  1QLE C;  3FD9 A;  2ZM6 B;  2LFR A;  3H0G A;  2W6P A;  3H1K H;  4DV7 O;  3M99 B;  2YZM A;  5L1J A;  2N05 A;  4GKK O;  5KUK A;  2CE4 A;  4YR2 A;  2DYR C;  3G8D A;  4U7C A;  2COJ A;  3S3W A;  4YJ2 B;  3ZHS A;  4O7W A;  4ED7 A;  4J9K A;  2RDC A;  3WFV A;  2R9R B;  4C5A A;  2UXD B;  5LP6 C;  4EEY A;  1ZHQ A;  5BYB A;  1GK9 A;  1NU1 H;  3V6H A;  4CE5 A;  1I6U A;  2OT5 A;  4I7Z B;  4J9Y B;  4B3R H;  3F7V C;  1N36 O;  5K3W A;  1S0M A;  4O2A B;  1A3G A;  1H2K A;  3RV3 A;  1RYR A;  5EK0 A;  5KFE A;  4RAY A;  1KJJ A;  2ODT X;  4J80 A;  4DV5 O;  1KYO F;  2W6J G;  2MCT A;  2Q2U A;  2DW4 A;  1SET A;  1SER A;  1I0H A;  5IYB G;  3JZI A;  5C5J A;  5FLX W;  1O9H A;  1R73 A;  5CA0 A;  1OHH G;  5DQH A;  1JJO A;  2ZGI A;  4ECQ A;  4O3P A;  1F7Y A;  2Z04 A;  4Q4D A;  4GZR B;  4R7C A;  3GV7 B;  5KFU A;  1FJG H;  4DK0 A;  2X6B A;  4EFE A;  1WB8 A;  2FB9 A;  4K8Z A;  4LF8 O;  2P7T C;  4ED2 A;  1XL4 A;  3H0G G;  2UUC H;  5I47 A;  2HVQ A;  4HBN A;  1HDJ A;  3BAB A;  4O7N A;  3NR7 A;  2A79 B;  4YJ2 F;  4JAS A;  3FX7 A;  2BTQ A;  3OHA A;  1GM7 A;  2QWO B;  4RAI A;  3T9A A;  3ZBH A;  4D7S A;  1SQQ H;  2HDK A;  2UU9 H;  2LGQ A;  1KJQ A;  3KRE A;  3WB0 A;  5I5V A;  4CKC A;  1VF5 B;  2LFS A;  5IJ0 B;  1VIB A; 
#chains in the Genus database with same CATH homology
 4JI8 H;  3K57 A;  4I50 B;  4X65 B;  4UCO A;  2F4V B;  1HNW H;  4ZI7 B;  2XHB A;  5IJ9 B;  4DV3 B;  4NXM B;  4A2A A;  4DR6 H;  4X20 B;  4IHJ A;  4FM9 A;  5LOV A;  4DV0 H;  2CW8 A;  5FD6 A;  3GDE A;  3HKB B;  3VNN A;  5JJJ B;  5IT9 W;  4DR6 B;  5JVD B;  5EZY A;  5LMN H;  3VQW A;  1P16 A;  3RWR D;  4X66 B;  2JS5 A;  1HNX B;  4JI1 H;  5LMN B;  4PHZ A;  5KHG A;  5IJ0 A;  4EQ5 A;  2KSW A;  3RR5 A;  3RYI B;  3F8N A;  4DUY H;  3ETQ A;  4I50 A;  4GKK H;  1I94 H;  4FFB B;  4LFC B;  1XMQ B;  5IJ9 A;  2ZNJ A;  1N33 H;  3JAS B;  4DUZ H;  5GON B;  4KHP H;  1S5J A;  3HKB A;  2UXB B;  2ZNI A;  1N32 H;  4EFB A;  3NBY B;  5CB4 B;  2GV9 A;  1VF7 A;  4L8J A;  3T1Y H;  5IWA H;  1Z5V A;  3LNN A;  4JYA B;  3T1Y B;  4IAJ A;  1O9G A;  3RYI A;  4YHH B;  4DR2 B;  1N36 H;  1QHT A;  4JI3 B;  2ZM6 H;  1NT2 B;  4FFB A;  2W57 A;  3JAS A;  3OTO H;  5GON A;  1IBM B;  3QG5 A;  4DV5 H;  1L2Z A;  2IM9 A;  5A2Q W;  4OX9 H;  2Q7H A;  4CH5 A;  5CB4 A;  4I4T B;  4DR5 B;  3N43 B;  3J81 W;  2UXD H;  1GYF A;  5LYJ B;  3K5N A;  4DV1 B;  3SR2 C;  2HVR A;  2WYO A;  4NXN H;  3CSX A;  3K5O A;  1MZB A;  4JI7 H;  3N44 B;  3PN1 A;  1V9P A;  2HEP A;  1M0W A;  4RB1 A;  4LFB B;  1E4G T;  5D5P A;  4LF8 H;  3ICX A;  4UFZ A;  5BR8 H;  4DR1 B;  2KKW A;  1KMI Z;  2PGG A;  1B04 A;  3U11 A;  4I4T A;  1IBK H;  4DV2 B;  1WPB A;  3SJA C;  4X64 B;  2PYJ A;  3JAW A;  1N34 B;  2P22 C;  4TV9 B;  2VQF H;  4B3T B;  5EIB C;  1Q8I A;  2VQF B;  5KHI A;  5JH7 B;  5JCO A;  1A0I A;  1H2S B;  3BA9 A;  3FFQ A;  4DV6 H;  4DR7 B;  4APM A;  4TV8 B;  4AQY H;  3RGZ A;  4YJ3 B;  5ITZ B;  1TAE A;  5FPR A;  4TUY B;  1SA0 B;  1CKM A;  5EYP B;  4LF7 B;  2VPS A;  4UCV A;  2VOB A;  3GB8 B;  4CC5 A;  4I7H A;  3RYH B;  4X62 H;  4M7E A;  1Z2N X;  4ETS A;  4B3M H;  4TOI A;  1SQG A;  4UCU A;  3ZS8 C;  3N2G B;  3VQX A;  4IIJ B;  4LF5 B;  4DR4 H;  3UQ8 A;  4FVM A;  5KHH A;  3JSL A;  4TV8 A;  3JAR B;  4LNU B;  4WBN B;  2YI9 A;  4JI0 B;  4YJ3 A;  4DR4 B;  2E5L B;  4YY3 H;  4K0K H;  4DR3 H;  4FLX A;  4TUY A;  3JAK B;  1TGO A;  3RYF B;  4YY3 B;  1SA0 A;  4DR3 B;  1XMO B;  1T5E A;  5EYP A;  3RF2 A;  4MV7 A;  4X65 H;  1Q43 A;  5LL6 b;  4DV3 H;  4NXM H;  1FVI A;  4FM1 A;  3RGB A;  2PYL A;  4CH6 A;  4RAZ A;  4PI0 A;  1IBL B;  3RYH A;  4CH4 A;  3GJX B;  1XNQ H;  3KXY T;  4O4H B;  5JCO C;  1XNQ B;  4IIJ A;  4X66 H;  4JI5 H;  1HNX H;  3JAR A;  4LNU A;  4WBN A;  5JJN B;  5LP6 B;  2YIA A;  2ZCE A;  4JI5 B;  4AHC A;  1J5E B;  3JAK A;  5K1P A;  3TY8 A;  3RYF A;  5D1O B;  3SGI A;  1I7F A;  2ZJT A;  4LFC H;  1XMQ H;  3DSQ A;  2UXC B;  1XNR H;  4FLW A;  3CVZ A;  4UCS A;  3SJB C;  3A2F A;  3KAJ A;  4ZI7 A;  3U10 A;  4LR3 A;  3WB1 A;  1XNR B;  4A2B A;  4CS4 A;  4RB0 A;  2UXB H;  1FKA H;  2BTO A;  2PUS A;  4O4H A;  4X20 A;  2YCH A;  1SQF A;  5EIB D;  4ZHQ B;  2HGS A;  3VQY A;  3BHP A;  5JVD A;  4X1K B;  1Z2O X;  3IAY A;  3M4I A;  4JYA H;  5LP6 A;  2F95 B;  2PZS A;  4YHH H;  2PY5 A;  3VQV A;  4DR2 H;  5KHJ A;  4JI3 H;  2HHH B;  4B3S B;  1RSO A;  3W5O A;  1TVK B;  2ZIM A;  2YXL A;  5DIS C;  4X1Y B;  1S03 G;  2Q7E A;  3M7M X;  4NVP A;  2CW7 A;  3N42 B;  4JI2 B;  1Q5O A;  3HXL A;  4CS2 A;  1IBM H;  3IG0 A;  3N6X A;  4DR5 H;  4UCT A;  4ZHQ A;  4DV1 H;  1HR0 H;  5KMG B;  4X1K A;  3QTC A;  2VWK A;  3TY5 A;  3J80 W;  5KX5 B;  1HR0 B;  4EB6 B;  4DRX B;  3BAA A;  3DF7 A;  3EYY A;  4DRF A;  2Q2T A;  4FLV A;  1TVK A;  2R70 A;  4B08 A;  5FPO A;  4LF4 B;  4JI4 H;  4O2B B;  2V4D A;  3JAM W;  4LFB H;  2XIG A;  2RGR A;  1SKV A;  4LF6 B;  5BMV B;  4JI4 B;  4DR1 H;  3NBZ B;  3J7A K;  4JI6 B;  4DV2 H;  3LML A;  4X64 H;  1N34 H;  4BWS C;  2P5O A;  5KMG A;  1XK5 A;  5LYJ A;  1JFF B;  4ZOL B;  2UUA B;  1HNZ B;  1X4T A;  5KX5 A;  4EB6 A;  3KAL A;  4DRX A;  3C0F B;  4Q0Y A;  4B3T H;  2QJ1 A;  4X1I B;  4ZIB A;  3JAT B;  1M4U A;  3JAL B;  1FFX B;  4O4I B;  2F1M A;  4TQF A;  3RFR A;  5JQG B;  4KL1 A;  1WH2 A;  1TA8 A;  5FNV B;  5D5Q A;  2HVS A;  4O2B A;  4K8X A;  1YEW A;  4DR7 H;  5CA0 B;  2VQE B;  5BMV A;  1BJT A;  1QQC A;  1SYX B;  4FLZ A;  1Q3E A;  3RGX A;  4U3J B;  4LFA H;  5LMU B;  4B3R B;  3FMA A;  1DGS A;  1M5I A;  4LF7 H;  4LFA B;  1JFF A;  4ZOL A;  3HKD B;  4DV4 B;  5LXT B;  5J2T B;  3RJ0 A;  4X1I A;  5FD5 A;  3JAT A;  4TV9 A;  3JAL A;  1FFX A;  4O4I A;  2PTM A;  2YI8 A;  5JQG A;  1P49 A;  4MV9 A;  2R72 A;  5FNV A;  1KU9 A;  3RTX A;  3SJC C;  5JH7 A;  4FLT A;  2WE6 A;  4LF5 H;  2JVD A;  1TUB B;  4JI0 H;  2E5L H;  3T1H B;  4U3J A;  4GKJ B;  5ITZ A;  1XMO H;  5IYZ B;  1AN7 A;  4TQD A;  3HKD A;  1FJG B;  1SEI A;  5LXT A;  5J2T A;  1ZHS A;  4RZQ A;  1IBL H;  3MAQ A;  3CHX A;  4LF9 B;  3N2K B;  2UUC B;  3BRC A;  3L4K A;  2RGV A;  1XHZ A;  2QM4 A;  5C8Y B;  2ZIN A;  1TUB A;  3N2G A;  2UUB B;  5K1X A;  1G6U A;  4PZ8 A;  1J5E H;  3N41 B;  4JV5 B;  4BW9 A;  3S24 A;  1CKO A;  1JMK C;  5IYZ A;  1L8D A;  2UXC H;  2UU9 B;  3TY9 A;  2HIV A;  3BPZ A;  4RB3 C;  4PZ7 A;  4GLX A;  3MWM A;  3ZED A;  1Z5W A;  4Q6G A;  4JI8 B;  3N2K A;  2HIX A;  3H20 A;  3K3V A;  5D1P A;  4I55 B;  2VWJ A;  4I9Q A;  5C8Y A;  5CA1 B;  4O4L B;  1HNW B;  4MTE A;  3RIZ A;  3CB2 A;  1XHX A;  4FM0 A;  4DV0 B;  4PDB A;  3RYC B;  2HHH H;  4E6N A;  4B3S H;  1XDN A;  3QF7 A;  1HW7 A;  1X9N A;  3QWU A;  2VUG A;  5D1O A;  4JI2 H;  4O4J B;  4JI1 B;  4F6R B;  4FM2 A;  4DV7 H;  4FLU A;  2RQ6 A;  1ZAU A;  3L4J A;  4DUY B;  4I55 A;  4DV7 B;  4LSX A;  5LA6 B;  5CA1 A;  4O4L A;  4GKK B;  1I94 B;  2OWO A;  2F93 B;  3HKE B;  1N33 B;  4CS3 A;  4DUZ B;  1M93 A;  4KHP B;  2FE3 A;  3RYC A;  1N32 B;  1CKN B;  4LF4 H;  2F66 C;  1M0T A;  1S68 A;  3KYH C;  1XQ8 A;  5IWA B;  4O4J A;  4X1Y A;  4BWA A;  4F6R A;  4LF6 H;  3K58 A;  1N36 B;  4JI6 H;  5LA6 A;  2ZM6 B;  4GYC B;  4LSA A;  3HKE A;  4UCR A;  3K59 A;  3OTF A;  3OTO B;  4DK1 A;  1HNZ H;  3HKC B;  2UUA H;  2WDT A;  2OYQ A;  1E4F T;  4LH7 A;  3JAW B;  4YJ2 B;  1WN7 A;  4DV5 B;  4OX9 B;  1CKN A;  2Q7G A;  3E22 B;  3JSN A;  2UXD B;  5LP6 C;  5JJE B;  2E3C A;  1ZHQ A;  4MTD A;  2VQE H;  1WNS A;  3B2E E;  5J2U B;  4NXN B;  1I6U A;  4HNA B;  5LMU H;  4B3R H;  4JI7 B;  2JGU A;  2ZIO A;  1BGW A;  2F4V H;  1XI1 A;  4CC6 A;  3HKC A;  3UT5 B;  4AIL C;  4DV4 H;  4O2A B;  4LF8 B;  2YIB D;  5BR8 B;  4D7T A;  4YJ2 A;  4RAY A;  3N40 P;  4LMY A;  3WB2 A;  2CFM A;  3E22 A;  3U0Z A;  1IBK B;  3L2P A;  2MCT A;  2Q2U A;  2YIB A;  1D5A A;  4FLY A;  4LH6 A;  2EX3 A;  3W1B A;  5J2U A;  5FLX W;  1O9H A;  5CA0 A;  2BTQ B;  3T1H H;  2Q0A A;  4HNA A;  4PZ6 A;  1JJO A;  4GKJ H;  1O75 A;  4R7R A;  3K5M A;  4DV6 B;  3UT5 A;  1FJG H;  4O2A A;  1VS0 A;  4CH3 A;  4DK0 A;  2R9A A;  4EFE A;  4EEQ A;  4K8Z A;  4AQY B;  3KAK A;  5EOY A;  3THO A;  4LF9 H;  3W1G A;  2O03 A;  4J0M A;  2UUC H;  2HVQ A;  4HBN A;  3BAB A;  1Z2P X;  3K5L A;  4RB2 C;  2UUB H;  2BTQ A;  3BA8 A;  4IHJ B;  5LOV B;  4X62 B;  2RJZ A;  4JV5 H;  4D7S A;  2CAZ C;  5EZY B;  4B3M B;  1P8L A;  3NC0 B;  2UU9 H;  5KHK A;  3WB0 A;  4PI2 A;  4K0K B;  5IJ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...