3PN1A

Novel bacterial nad+-dependent dna ligase inhibitors with broad spectrum potency and antibacterial efficacy in vivo
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Novel Bacterial NAD+-Dependent DNA Ligase Inhibitors with Broad-Spectrum Activity and Antibacterial Efficacy In Vivo.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase/ligase inhibitor
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3pn1A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3pn1A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3pn1A02
2F4VB 3RR5A 1HNWB 5IWAB 2UXBB 1A0IA 3SGIA 1TAEA 4E6NA 1VS0A 1P8LA 1J5EB 2UXCB 4JI8B 1IBKB 4KHPB 4UCTA 1HNXB 2HIXA 3KYHC 3TY9A 4X66B 4CC6A 4DR3B 4B3MB 1I94B 4JI2B 4B3RB 4DV6B 1CKMA 4EFBA 4JI5B 4OX9B 1HNZB 3W1BA 4UCSA 2HHHB 4DV7B 4JV5B 4EEQA 4LF9B 3TY5A 2CFMA 4X65B 1N36B 2VQEB 4DUYB 2ZM6B 4GLXA 4TOIA 4LFAB 4LFCB 4UFZA 4JI3B 1P16A 1TA8A 1XMQB 4LFBB 2Q2UA 3BA9A 4LH7A 1HR0B 5BR8B 1CKNB 4PZ6A 4NXNB 4YHHB 3PN1A 4LF7B 4UCRA 1IBLB 4B3TB 4DR4B 4DV1B 4DRFA 2VUGA 3BABA 5D1OB 3T1YB 4LF6B 4PZ8A 1V9PA 4DV3B 4DUZB 2UU9B 2UUBB 2HVSA 4JI4B 2UXDB 1N33B 1XNRB 1N32B 5LMUB 4X64B 1FJGB 3S24A 5FPRA 4DV2B 1N34B 4LH6A 1CKNA 4DV0B 3TY8A 3L2PA 3GDEA 1XK5A 3W1GA 4JI0B 3UQ8A 3JSNA 3W5OA 1ZAUA 5D1OA 1B04A 4EQ5A 4EFEA 1FVIA 2E5LB 4CC5A 4NXMB 4GKJB 4YY3B 4JI7B 4DR7B 1X9NA 3JSLA 3QWUA 3NBZB 4DV4B 4DR5B 2VQFB 2HVQA 1CKOA 2HIVA 4JI1B 4DV5B 3RTXA 1XNQB 4B3SB 4DR2B 4UCUA 3VNNA 3BA8A 3NC0B 4UCVA 2UUCB 1IBMB 4AQYB 1S68A 3NBYB 5LMNB 4GKKB 4JI6B 4X62B 4LF4B 2Q2TA 3GJXB 4DR1B 3T1HB 4PZ7A 4UCOA 4JYAB 4DR6B 1DGSA 3GB8B 1XDNA 1XMOB 3BAAA 5DISC 2HVRA 3OTOB 2UUAB 4LF5B 4LF8B 4K0KB 5FPOA 5D1PA 2OWOA
chains in the Genus database with same CATH superfamily
4K6NA 2VA3A 4FBUA 4A5UB 2JA7G 3CS5A 1IURA 3H9VA 1RM1B 2UXBB 4ED8A 2R8GA 1W59A 4P9PA 3SGIA 1VS0A 3RYFB 3OUFA 2V4DA 3RBDA 3K3PA 4RUEA 4JI2O 4NYEA 5LA6A 1NZ6A 1H2KA 4KHPB 5LP6F 4IRKA 1JJOA 4BBSG 4JV5H 4DV7O 1DIKA 2R84A 2Z3YA 3K5LA 3E2EA 3CCUV 2JRIA 2HHHB 2HJFC 3K0DA 3AK3A 4QWAA 2Z02A 4APMA 2EULA 4O7WA 3P3PA 5KFGA 2ZE8A 2JA8G 4TOIA 3A0RA 3ETGA 4QE9A 5DN6G 4O4IB 5DGBA 2DWCA 4B3TH 2D2CB 2AGQA 4LH7A 1SETA 4K3AA 3O9OA 2KG7A 4U6PA 2XUMA 1KKDA 2A1HA 2LFRA 3RV3A 4JV2A 1Y74A 1N32H 1FJGH 4X64H 2VQEO 4FIPC 1WRVA 1AJPA 4J7ZA 2I80A 2PYLA 4O4HA 2W70A 2B63G 1VIBA 2IMWP 1A9XA 4JI0H 4A3KG 1LNQA 3DXRB 4FFOA 4KP4A 3JD1A 1YTFB 1G1XB 4LBEC 4MVSA 4QNHB 4U3JB 3WG7C 1ET0A 3DTUB 4IT5A 1WB8A 1I1KA 3CWBH 1VARA 3HR0A 4UVCA 2EINB 1Z2GA 2JEFA 1AI5A 2RJZA 4X1KA 1YITV 1M9NA 4JI7O 2J6UA 1NJIW 1BE3H 1I6UA 5C1OA 4MVOA 5EZYF 4Q44A 4O2BB 2IU0A 1MZFA 2HP8A 5HFMA 3DTFA 3QZ8A 3NGDA 4ECTA 3QTCA 1WP7A 3ZIAG 3UZOA 2HFEC 4DV4B 3MWEA 1EM1A 2AQ4A 2H94A 2WDTA 3DC6A 5E1AC 4DV5B 3TQTA 3QO8A 4LF4H 4JV1A 2HGXA 4R50A 1W96A 1ZL8A 3UT5A 3ZHUA 3KTMA 1IBMB 1AR4A 4MV3A 3SPHA 1T94A 1SQGA 1K33A 2DYSC 3CCJV 2W9CB 4FGRA 3RB4A 2BE3A 3L4JA 4LF5H 3DGEA 4TQDA 1GN6A 3LDDA 1EKFA 1RYSA 5LA6F 3T1HB 3MR2A 2R72A 3H01A 5CB4B 1ZSPA 1P4RA 1HNWH 4PHZA 5DISC 3ZN0A 3SJCC 1FFXA 4ME6A 1D5NA 2UUAB 5EYPB 3WWHA 1J5EH 4A3GG 3ETQA 4JI8H 5FNVA 1IBKH 1WP8A 4BW9A 3SPJA 4PDRA 4CH3A 4X1YB 5JVDA 4RZRA 4FBTA 4X66O 2HGWA 1TGOA 5IYZA 2UXCB 3L75H 4MV1A 2ZIOA 1S5HC 1UC8A 2R9AA 4MV4A 1QU7A 2IM9A 4MA0A 2OIEA 4MA5A 1UFIA 4B3RB 5IJ9B 1I7NA 3PR4A 1G8MA 1N36O 1P84F 4EBDA 4U7OA 2EILB 2W6ZA 1DTOA 3BFRA 3GWKC 2F4VO 4UV9A 3W7UA 1R9TA 4G28B 4LFBH 2QA4V 1PL4A 4BY1G 3HPLC 4NXNH 1H2SB 4FS2A 4PJ0Z 4O4HF 4LWSB 5KA5A 5C8YB 3JYCA 3HOYG 4MVQA 3N2KB 1M4UA 3AYHB 3M99B 1FXHA 3T1YH 3ZRWB 5I5VA 4JI4H 4EG0A 1IBLB 1Y1VA 2W6IG 2WA3A 3G6XA 5EOYA 2DAAA 5CBFA 3KHGA 1WNSA 4F4XA 2E3CA 5DG8A 4TVIA 2C28A 3Q8QB 4YQWA 5KMGB 4NR1A 2DYRC 4IHJA 1JKJB 3CJHB 4O4JB 4OGQB 3SYQA 4EEYA 2R70A 2WE6A 5KG1A 3ABTA 4NB5A 4FM9A 1IZ3A 2RMKB 1R1BA 1R6KA 3J81N 2E5LO 1ZAUA 1Z5WA 5KFDA 1SYXB 3T99A 2YXYA 4DR7O 5EWGA 4MVZA 4DL5A 4LR3A 1B3QA 2RGRA 4CKEA 2X5RA 1M7JA 1V54C 3RAXA 1GN4A 2ILMA 3OM3B 2HVQA 5DQIA 1S77D 5EC2C 1GMGA 1ZETA 1JFFB 4HZ3A 2QWQB 2CK3G 1FXKB 5KFJA 4I9QA 5FNVF 4ASUG 3NXSA 2C35B 4U3FH 3G6VA 4YXWG 5KFMA 2J6TA 5JVDF 4I0XB 1XMOO 3OTOH 3B8MA 5IYZF 1I7LA 2Y0IA 4MVUA 1Q90D 3R5FA 3CRAA 2W6OA 2V7QG 2KSDA 5KUMA 2UVWA 3EHBB 2OCCC 3FKIA 1ZHQA 3HO8A 3WWJA 3WB1A 2LW7A 3A0HZ 3WFVA 1T3NA 5LYJB 4AILC 2R9RB 3CEBA 4UXNA 2W6PA 3OTFA 2WLIA 1Q6HA 1XHXA 4JI5O 4YB8B 2QWNB 4CS2A 2FTKA 5IYBG 2CUGA 2EIMB 4JI2B 1SCUB 3V4SA 4ED6A 2GDSA 3STLC 1S5LZ 3K57A 2MCTA 4Q20A 4DV7B 5IYDO 2JJ1G 2KKWA 2EJ3A 4MAMA 4NZMA 1ZTEA 1FYJA 2O57A 1K4DC 3N2GA 4IYIA 4YHHH 4C5BA 3RAQA 1NR7A 1KBHA 3M4IA 1Z2PX 1Y67A 4PA3A 4BY7G 4UFZA 3J80W 3ORQA 1UPGA 5FLMG 5CAEB 3THOA 4O4LB 1H38A 4IHJF 4TV9A 1T5EA 4Q45A 3ZEDA 3K04A 1N33H 1W0KG 3RF2A 4PI0A 3WO0A 5KHHA 2R7NA 4TUYA 1M6VA 4CMDA 2VOBA 4DV2H 3FYEB 3MD0A 1T36A 1MSWD 2V5AA 2HVJC 4M0JA 4OPHA 2XHBA 4PA4A 2HG5C 4XYMB 4MSWC 1RJPA 4RB3C 2ZJTA 4Q4CA 1SZTA 2MK3A 3UQ8A 5K2MA 3GTKA 1DAAA 4BR6A 1TUBA 3TIGA 3BPZA 4WFGA 1E4FT 2AZ0A 3K5HA 2ALZA 2P7TC 1AVMA 3RYCB 2VUMA 4ZIBA 2CZGA 3FB8C 4JI7B 3E86A 1XNQH 5JWPA 5LXTA 2CKZB 3EFFK 4AQYH 3SYCA 5LMNH 2QKCA 1MABG 1XL4A 4F4LA 4CS3A 3I4MG 5GONB 2AGPA 3SJAC 1VF7A 1Y1WG 4J10A 1A3GA 5J2UB 2HLDG 4LF9H 2L6LA 2C2RA 4LF8H 4EB6A 5B1AC 2WLJA 3BG5A 3H4BA 1NTMH 1BSMA 3N6XA 2H3OA 3GV7B 3BRCA 4JGSA 1I5XA 1OBDA 5IWAO 2XGPA 2W8LA 3OUSA 2OWOA 4H37A 2HHFA 4YJ3A 3VPBA 5IYCG 4LF7H 2JA7A 3JAWB 4E6NA 3H1KH 4H33A 4TSFG 1QQCA 2LO1A 2EIKB 4DR3O 5LP6B 4FU0A 4B3MO 1TWGA 3JARB 2FMLA 4DV6O 2VQDA 1QR9A 2HEPA 2W8KA 4X66B 1BQ0A 1O9GA 5BWVA 1V55C 2BSKB 1PNMA 2LGWA 1OCOB 2I8CA 4ECZA 3G6EV 4DW0A 4TV9F 1D5AA 4N21A 4HBNA 2O03A 4LFCO 3TY5A 1XMQH 5ITZA 1N36B 3QNEA 1NTZH 2X6BA 3JD3A 4TUYF 3Q8SB 1WSCA 1EUDB 3FDSA 1IYDA 3ZHVA 1BL8A 4O3NA 1H2LA 4ZKIA 1CKNB 4EBCA 2RGVA 4XX0B 4ZOLA 1PPJH 4GUNA 2QB5A 2OH2A 2NUAB 4IAJA 2UXDH 2Q9LA 4ZBMA 4MV8A 3ZMUA 5A9GA 1BZKA 5I60A 3DAAA 3VQWA 1TWAA 1BGWA 5LYJA 1BQZA 4HNTA 1TVKB 5FLXW 2W7OA 2PMZE 3VOUA 4UVBA 2AHZA 4TWKA 2F1MA 2GPWA 3BY6A 1S9FA 2H8PC 5LXTF 1E1RG 2WLLB 1Q82W 4IYHA 2W7PA 5C1PA 5B1BB 3JRXA 5KFPA 4J9ZB 4EFEA 5EZYB 1XI1A 1KMIZ 2CGNA 2YZNA 4DR5H 3GTMA 2E5LB 3AG1B 5DLGA 2W0FC 4JI1H 3T7AA 4DR7B 4YAJB 2GV9A 1AJQA 1CEZA 2XGQA 4O2AA 1JX4A 4X62H 3CPWU 2IP4A 3CMEV 1AI6A 1Z2OX 4YJ3F 4A3LG 2P5OA 4DR6O 3MR6A 4IRDA 2ITDC 1SZXA 4JI6B 2JJ2G 5LA6B 1QLEB 1JDEA 4K0KO 4F4WA 3A8TA 5L3EA 1SESA 1XMOB 2QSAA 2ZD9A 3OHAA 1SEIA 4IIJA 5FPOA 4DV5O 3N40P 2OTLV 4B7KA 3DF7A 1HNXH 5DEDA 2YZMA 2OTJV 1IBMO 4CH5A 1TAEA 5H5NA 3SPGA 2OYQA 4A3JG 5BWTA 2ARHA 4YR0A 4YJ2A 3SJQC 3SNOA 3K9AA 1YJ9V 4DIMA 1YXBA 1COWG 3CCVV 4JV5O 4RZQA 3OEEG 2KG7B 4ZI7A 1MZEA 1R73A 4DUYH 1M90W 4C2MA 2E2HA 3IN5A 3E22A 4JI5B 3N41B 4ZOLF 3G67A 5I5UA 2XIGA 1XREA 1Y74B 3CRQA 3AX6A 5D8DA 4TV8A 2ZINA 2I87A 1E79G 3FX7A 5LHIA 3M8AA 2WAQA 1VQ6V 4O4HB 3K03A 3IC7A 4GX0A 4J9KA 3GTLA 4RAIA 2JA5A 3MFHA 1E4EA 4IR9A 4B3TO 5I5WA 5LYJF 4J9SA 2HJDA 4CBCA 2R7KA 2UUBH 4W4KA 1WLEA 4ECQA 4R8UA 4JAVA 3Q2OA 4MW8A 1N32O 4O7RA 1FJGO 3PW2A 2PTMA 2YSUB 4X1KB 4U7NA 3B4SA 1ZWIC 5DGAA 1S03G 5H80A 4NLGA 4PA7A 2XAFA 4JI0O 4ECSA 2HVKC 4PA6A 1NI8A 4MTGA 5LL6b 3ZMZA 3BVOA 2DZDA 1Q86W 2Q7GA 2CTWA 1K4CC 2WLHA 3CCEV 4GKJH 2XASA 4O2AF 4EKWA 1ZL8B 3GV5B 3G80A 2F23A 3UT5B 3JRWA 4CMFA 1K7DA 1YZBA 2JGDA 3TEKA 1LR1A 1QBZA 4H13B 4RB1A 3DTGA 1KJ8A 3O65A 1AI7A 4JV0A 2IU3A 4QIWA 4IRCA 3LSUA 3LULA 4B3SH 1GRJA 4KHPH 1I2KA 2VQFB 2Q73A 1FFXB 1MG1A 3H0GG 3WG7B 1L0LH 3OHBA 5DGHA 5F9LA 4IIJF 5FNVB 2YU9A 4LC1A 4LF4O 4FLVA 2ZE7A 4D7TA 2V1DA 3OW2U 2HHHH 5IYZB 1DK1A 1NH2B 3T1CA 3F5TA 3CC7V 4LF5O 3GJXB 2FPPB 4KUMA 3UFXB 4YJ2F 2C2EA 5KG6A 2CTQA 1HNWO 5KT4A 2JEUA 5BWXA 1XDCA 1XILA 4P9OA 3JZFA 4ZI7F 3GV8B 3MHHC 1R3IC 1KC7A 1J5EO 4RNNA 4K8XA 2ZDGA 4JI8O 4P2ZA 1IBKO 5IWAB 4Q0YA 3U10A 1HDJA 1S72V 2IH1C 3R65A 1SQVH 4TV8F 3T5JA 2DYSB 2FLLA 4RAYA 5J2TA 1SQFA 2B1GA 4UCTA 4FLZA 2NU9B 1YI2V 3RYHA 2CH7A 4DR3B 4B3MB 3J80N 4X65H 3W7WA 3E8HA 3ZHSA 3OR6C 2P22C 3OUUA 4DV6B 1CKMA 2PN1A 2R7ZG 4K8ZA 3K9SA 1NR1A 1VF6A 5GTIZ 1DLBA 5KFSA 4LFBO 2Q7DA 2FYUH 2NVYA 1Q3EA 3MR3A 2DQ3A 4LFCB 2YC0A 3B2EE 4IWYA 4A93G 3S3XA 2DWEC 4IHJB 5I5TA 4R7CA 4DV1H 3K5IA 1S0NA 5A2QW 4DV3H 1K97A 2EBOA 2X6AA 3T1YO 3IGAC 4DUZH 1XBLA 3S3WA 2BTQA 1S0VA 4JI4O 1M56C 3T2MA 1G2WA 1XNRH 5LMUH 4O86A 1BXRA 4OXSA 2VUGA 3BCCH 1B06A 3QO5A 1CP9A 2CNVA 4O7VA 1Q6IA 2PGGA 2FB9A 3I12A 3GIKA 4WCEV 2XCAA 5TISZ 1QVGU 4G2KA 3ABMB 3QG5A 1PD3A 4F50A 5EWEA 4YR3A 4ABMA 5KAIZ 4QIWF 2R86A 2RQ6A 4YP3A 3ZBHA 1THZA 1GSAA 4DL7A 3W7TA 4R6ZA 4Q8EA 4YY3H 1B04A 4N23A 1VQPV 1FAFA 3AG4C 3L74H 3CC4V 2ETNA 2JS3A 5L3BA 2Y69C 2DYRB 2EIJC 3AK1A 5EBMC 3UZBA 5EC1C 1NVPD 4O82A 3N8DA 1SS3A 1PX2A 1C30A 2CTRA 4DK1A 1Y6XA 4NTXA 2DOSA 1JMKC 3CRMA 2YEVA 3N44B 1AR5A 4JYAH 5KFUA 4EGQA 3ZMTA 4WF9V 4X88A 3MJFA 5KFAA 3OTOO 2FPIB 2IJJA 1HWYA 2WLIB 3G71V 2ZDQA 5DQHA 3SYOA 3OFNG 4WFBV 4KFMA 3GTPA 4DR6B 2FK2A 1KU9A 5KFZA 3HOZG 3BAAA 4XDKA 5CM0A 1L1FA 3V6KA 1FXVA 1K3EA 1BHBA 4AHCA 4K0KB 4FLTA 5CR5A 3EPIA 1F4NA 3T9AA 5EBLC 3TGUH 4HNAA 3JAKA 1IBLH 4EYHB 3D36C 2ZR3A 3N2GB 1P8LA 2BOBC 2FKLA 1SKVA 4GT1A 4D7SA 2DIKA 3BQ0A 4ZQIA 3ASOB 5K1PA 1IYEA 2YI8A 3ETHA 4TV9B 4ECUA 3IFXA 3K08A 2Y48A 2YZGA 3TETA 4FM1A 1K1SA 4JV5B 2YCHA 5B3SC 1JLLB 2VS0A 4TUYB 2WLMA 1HR0H 3G4SV 1Y66A 4YHHO 5H9CA 3ZHQA 1Y76A 3Q1KA 4F4ZA 2P4KA 4A3FG 1VQLV 4D6TH 2PF4E 4DR4H 1K9MW 4R7RA 4MW3A 5FLXN 2B9ZA 5H2FZ 2EJ7A 4QSHA 3HT5A 1AR1B 1VBGA 1RJQA 4B3TB 1GAXA 5KFTA 1N33O 4ED2A 2DPJA 3N43B 2E2IA 3WO1A 2JK5C 1N34H 1TUBB 2OT5A 4DV2O 3CP1A 3D36A 3R66A 3STZC 2BQUA 2WWWA 1WR2A 3BQ2A 1N32B 1FJGB 4X64B 2JEGA 2ITCC 5L3DA 4JF3A 1JA8A 2YRWA 3CSWA 4A2BA 4HQ6A 5LXTB 5BXZA 1HP8A 1KECA 5DECA 4JI0B 1BCCH 4FVMA 2XT9A 2XC9A 3AW8A 4IR1A 3K3WA 5E79Z 3V6HA 3ZN1A 2YI9A 1OJHA 1FVIA 1EFRG 3LSSA 5FD5A 5IDJA 2WLNA 4EB6B 2RNBA 4HNVA 3CMAV 1XNQO 3NBZB 2F43G 4FFMA 4BW5A 3LWBA 4AQYO 4KL1A 5LMNO 3KAJA 3MWDA 1X59A 2HHFB 4YJ3B 4J0MA 3RIZA 4UCUA 1OWTA 1QLNA 3EYYA 2ASDA 3ORRA 2ZKOA 5BMVA 4LF4B 1EZVH 4LF8O 4QWBA 2AXTZ 5LL6Y 2Y4UA 3APOA 1DGSA 3GB8B 3KAKA 1TWCA 1S97A 1DF5A 5JUMA 5L3CA 2EZOA 3UYYA 3G6BA 4LF5B 5KT3A 4O7TA 5KFBA 2V58A 1GKFA 5FR9A 5CN0A 1HNWB 3L9DA 4CKBA 3CXCU 5ITZB 3RFCA 1J5EB 2NR5A 4JI6O 5KFHA 4JI8B 1OZ0A 1IBKB 1WAZA 3K5OA 3BJYA 3JATA 1HNZH 2IJHA 5KS8A 1CE8A 1W2BU 2Z0AA 1H2MA 2VQEH 1AILA 4ZOLB 1KJIA 1YEWA 4PDLA 4XBFA 4UUGA 3W1BA 4LFAH 2P4VA 5KHKA 4JI3H 2ATKC 3SYAA 3UO2A 1XMQO 2QEXV 3ML0A 1QCEA 2UXNA 5C4XG 2AW9A 1GTOA 4LFBB 2DQ0A 3W7XA 2BOCC 1NBMG 4I7ZB 1V55B 2VWJA 4NXNB 1EZJA 4GX5A 2UU9H 1SC5B 4O3SA 4UCRA 2PMZA 2BTOA 4BWSC 2RDJA 2UXDO 3P3NA 4FPPA 2P67A 3KCXA 2W6NA 3T1YB 3OSNA 1V9PA 3JCUZ 4JI4B 2FP4B 3ABUA 1FFTB 1M1KW 1OCRB 2Z5UA 4LCUC 3CC2V 2FK3A 1MNGA 2DWDC 1VF5B 2GTAA 4GZRB 3L70H 4EBEA 2A79B 4QWDA 5L1IA 3P32A 3TW6A 5DM6V 2R92A 4O2AB 4NYKA 4NXMH 5CA0A 5D1OA 1GN2A 5CBHA 5L3GA 4F6RA 2VA2A 4MTXA 4I50A 4J41A 3B09A 4DR5O 3JASA 2DPIA 2Q7HA 4PDMA 3E5NA 4HR7A 5BMVF 1WA8A 2Q67A 3Q8PB 3AG2B 5H6RA 4A3MG 3HKBA 1KJJA 4IIJB 4IL6Z 2Q7EA 4CE5A 3RJ0A 1Q6UA 4X62O 4DR1H 1NKDA 3JZIA 1MOFA 3UM7A 2VRZA 4X89A 4DRXA 5L9XA 3UKMA 2PBZA 3ABLC 2R6FA 2HDKA 4GKKH 4H0LB 4YJ2B 1FKAO 4JAAA 4LSXA 2F4VH 1UNNC 5DGIA 5KG7A 3FAVA 2XOKG 3QQMA 2VQFO 1WB7A 3WWIA 1R3JC 4ZI7B 1AUXA 3OTOB 3E22B 3V4ZA 1O75A 3H1JH 3WU2Z 5IJ0A 4QWEA 3L4KA 3RR5A 4TV8B 3N6RA 5B66Z 1HNXO 1MMMA 5B1NA 1I94H 1M57B 2XCPA 2UVVA 3HKEA 3VQVA 3TXQA 5BPFA 3TIIA 1E4EB 4LMYA 1NQTA 2BQ3A 1IOVA 3OMNB 3VQXA 1KKCA 1VBHA 2FLNA 5C93A 3TINA 2VR1A 3RB3A 2P90A 4QPJA 2JVDA 5IP7G 2R7ZA 5IYDG 4FJCC 5IY5C 4R8UB 5A2QN 1H2NA 4GX1A 1ULZA 4TM5A 3TK1A 5BR8H 5JJNB 3ABKB 3VOTA 5HNEA 4MV6A 2PI5A 5JCOC 1I1MA 2SCUB 1YTFD 2GQSA 1N8RW 3ZX6A 1FXKC 3RGBA 3A0BZ 4YHHB 2YXLA 1CS0A 2WB1E 4LF6H 3CYOA 2UUBO 1JPXA 3RN4A 3CSXA 3RB0A 2DN9A 1M0TA 4RNOA 1GYFA 4FLXA 1L8DA 5CA0F 2JGDB 1EKPA 4J9MA 1W0JG 4Z1VA 2MW2B 3LP8A 5KFKA 1N33B 2Q0OC 4I50F 3A2FA 2Y0SA 4DV2B 1KD1W 2R93G 2VPSA 3GIJA 5K3WA 5KFRA 3L2PA 3VA7A 2GUZA 1VQNV 3HOXG 4JZGA 4GC6A 2GBOA 1IVSA 1KUTA 3M9NB 3SPIA 4GKJO 4GCZA 5FJ8G 3VMMA 1VQ9V 3L72H 2Q4PA 4UVAA 4A3BG 2CDYA 4A2AA 1G4YB 3GLKA 2GSMB 3R9RA 3KZIZ 4DR2H 4B3SO 2L35A 2B63A 4DO2A 4RU9A 3M9MB 1XNQB 3AG3C 5KFWA 2X0SA 1ZX3A 2D3OW 3GWOA 3IG0A 3F8NA 5JQGA 4AQYB 1P49A 3Q8RB 1K83A 1N4CA 5LMNB 4JASA 5LGUA 5J2TB 4O3PA 5I47A 3RB6A 3TW7A 2Q2TA 3HOWG 2X6CA 4FZ1A 3RWRD 2CH7B 2QKSA 3RYHB 1RK5A 2CE4A 3VPCA 1GM8A 3TJTA 1N48A 5KKNB 3T5KA 3SR2C 4LF8B 2VPQA 4M7EA 3JALA 3MFIA 2DLNA 1I0HA 4DYLA 5I5SA 3N42B 1AP6A 4FFLA 4O3RA 5CA3A 4LNUA 1EZ1A 4OX9H 1SRYA 5LGNA 4JTDB 3R23A 1EBOA 3TY9A 1QNMA 1EYZA 3HBLA 5KT7A 3SPCA 3MDSA 4X65O 3C3SA 2ZM6H 1QR8A 3GIMA 3CE2A 4O81A 1BT8A 2BTQB 1YJWV 1JOYA 4UCSA 4RB2C 3GIIA 2X7RB 5JQWA 3GIDA 1SFOA 5L1LA 1ZQ7A 2Y4RA 2EZPA 1OBGA 4CS4A 2R8IA 4H44B 4DL2A 1UJWB 3LNMB 2GPSA 1PL0A 2FE3A 1XMQB 5EWFA 2Q2UA 1E4GT 3PO2G 4X8AA 1LUVA 3Q4HA 2COJA 2EJ0A 4BIOA 1OCZC 2QWPB 4DV3O 4DUZO 1WH2A 2NN4A 5C5JA 2PY5A 1Q81W 1XNRO 5LMUO 4IZOA 1I50A 2HG8A 4DV0H 1GO3E 1GK9A 2UXDB 1K34A 3K79A 4FFBA 4OPAA 5DAAA 4LH6A 4FFNA 1X4TA 2YIBD 1K5QA 1A48A 4FMTA 1AROP 3U9SA 3LDEA 1VQKV 3W1GA 2YWVA 2EIKC 1M56B 1E1QG 5KHJA 3W5OA 2A06H 5H6QA 5HBRB 2YEVB 2JEIA 4ETSA 3FKSG 4YY3O 2PUSA 5EK0A 3C3TA 4CC5A 2WLKA 5JQGF 4X64O 1OCOC 1Z2NX 1AP5A 4FS1A 3X2QC 1EN5A 3V6JA 4MTEA 3FKIG 2CQYA 5LOVB 3HXLA 2XNDG 4DR5B 2UUCH 1SQPH 4ECYA 5JJJB 4JI1B 3PFFA 5C44G 4AYBE 4DQNA 2UVRA 3K3VA 4K35A 2ADPA 3BA8A 2HR3A 4Y8VB 3NC0B 4HNAB 4JYAO 1DF4A 3JAKB 4J42A 3ZRXA 4X62B 5K1XA 5IT9W 2JGUA 4WFFA 5KT6A 3CXHF 4ICGA 4UCOA 2GQRA 1IXBA 4O3OA 2UXBH 3F7YC 3GTOA 3JD4A 3H1HH 3CD6V 3KHLA 3K58A 5CMUA 4JPRA 5GW7A 3PJSK 5KFOA 3JD0A 4HN2A 2ODTX 3DSQA 2HGSA 3J7AK 1A32A 2N05A 4FZ0A 1Y76B 5KG5A 4JUZA 1HNXB 1RJRA 4L87A 5BWRA 1CXZB 2ASLA 4HNUA 2LW1A 3T4ZA 4I55A 2COGA 5KHGA 5HFLA 3E8BA 4JTCB 5JJEB 1SQBH 1Q7YW 4MV9A 2ABJA 3CB2A 4MT8A 4C7UA 4DUYB 3I4NG 3RYIA 1HR0O 1VQ7V 2LGQA 4QWCA 2IW5A 2CAZC 2WTFA 3T9BA 4QPKA 2YS7A 5JH7A 3OGIB 2JA6G 2W9BA 1WPBA 3PN1A 4J7JA 1R6NA 2ZGIA 5LHGA 2GTSA 3LMLA 2VUMG 4DRFA 3HKDA 1QLEC 1KBLA 2UUBB 1N34O 2PI4A 3KHRA 4B08A 2BR0A 1O9HA 5JVLA 1SA0A 2ZE5A 1HW7A 3HKCA 3QFFA 3EXAA 1Q5OA 1KP3A 4NXNO 3H20A 2AHYA 2DJVA 3T4DA 4WBNA 1S10A 4ECXA 2FJZA 5BY1A 1FS0G 2NU7B 2V4RA 1LUWA 2ZXWC 3FB7C 1NS1A 3LQSA 5DMXA 2KSWA 3KG2A 2X0LA 4EQ5A 3CRRA 4DV4H 1VQ4V 2RN9A 3OT7A 2YS8A 2W57A 5BMVB 2QKAA 4GKJB 4XZ3B 4O3QA 3K59A 4DV5H 3UO3A 3RGXA 4ED7A 2Q69A 2EJRA 1IBMH 3SE7A 1CKOA 3W7SA 3RFRA 5IE9A 4PD4F 4GLWA 2YL2A 1VQMV 4B3SB 1UC9A 3T1HH 2NNUA 1M0WA 2BQRA 3CCMV 2UUAH 1OCCC 3E89A 1XUQA 5BWWA 4QW9A 1K8AW 3JATB 3RGZA 1JVMA 3ASNC 3SJBC 1PM9A 3SDLA 2LP7A 3T5LA 4QE7A 2LFSA 2AGAA 1F7YA 4I55F 2UXCH 1L2ZA 1WN7A 1L0NH 3FYIB 2VWKA 4ED3A 1IOWA 2W6QA 5E25A 3GIQA 3RBEA 1GN3A 5BZBA 5GTHZ 1J95A 4F4YA 2F93B 3TQ1A 3CCQV 4B3RH 4FFPA 5KFLA 1P7GA 3U9TA 2NVXA 1NU1H 1YJNV 3RV4A 5BPHA 1Y1WA 3RVZA 4RQFA 1HNZO 3GTQA 2WAQE 1BJTA 2LQTA 5J2TF 5KFNA 1TUEB 2DW4A 2HKOA 2YDEA 5JH7F 5KG2A 1VMGA 4FFKA 4A3CG 5CA1A 1IDSA 1Y4MA 1V54B 4MVRA 1KJQA 1V51A 4Q6GA 4Z1MG 5LOVA 4LFAO 4JI3O 4A3EG 4X65B 2JEJA 2V9WA 2ZCEA 4XDLA 4FE2A 3I55V 3L71H 3ZS8C 4DAAA 1FD9A 1SQQH 1RFYA 2XAGA 2EJ2A 1VQ5V 4X1IA 5BYBA 4RUCA 2PVPA 1JIHA 4ECWA 2IA6A 1P16A 2QTSA 1YCIA 5KFVA 3KREA 2E74B 2QM4A 3GVMA 1K73W 3U0ZA 4JYCA 2UU9O 4WBNF 1SQXH 3QO7A 3CCSV 4O7LA 2XAQA 4Q43A 4DV1B 5CA0B 3FB6C 5D1OB 4QJFA 2OCCB 4X20A 4DV3B 3B40A 4DUZB 1GGOA 4G3IA 5L1KA 3H1IH 4F6RB 5D5QA 4I50B 1XNRB 3JASB 3KKYA 5LMUB 4A3IG 4E4EA 1WA8B 3S24A 3U11A 2R93A 2ZT9B 3HKBB 3QVNA 3CQZA 2R85A 3R5HA 3GTGA 4BAYA 1VP7A 1KTAA 4QIWE 4QW8A 2CW7A 3PW0A 3KXYT 5B1OA 4NXMO 5B5EZ 2QGNA 2AU0A 2IBZH 1VQ8V 3GB7C 2R8HA 2PYJA 3E35A 4DRXB 3JAMW 2R8JA 4YY3B 3UCSC 3JSLA 3GQCA 5KX5A 3E8FA 3FAVB 3WB2A 3ZMVA 3D3IA 4J9QA 3I5DA 2R7LA 1BGYH 2EX3A 2HIVA 1MA1A 2FMAA 3IJ4A 5IJ0B 2XAHA 5KFFA 3OEHG 2YW2A 1EUCB 2RDCA 2RCVA 3LSQA 1RM1C 2R9IA 4DR1O 2Y4TA 5CE8A 3T5HA 1US6A 3VPDA 3HKEB 2FL4A 4GKKO 3L73H 1JCHA 3OAAG 4JYAB 4RUAA 2UXXA 4ZHQA 1B6QA 4C5AA 5DG7A 2F66C 2YUAA 1R3KC 3HKZE 3ZCCA 4YAKB 1FPOA 4R8CA 3TCUA 1AN7A 3CRCA 2JA5G 1OHHG 3ABMC 5CA1F 2GHYA 1A0IA 5LOVF 2P06A 4CHIA 5L1JA 2Q6AA 1NT2B 2ADQB 1H2GA 4JI2H 1I94O 3ABLB 4FM0A 4I4TA 3QZ7A 1RSOA 2CNQA 1GLVA 2UVUA 4DV7H 4G27B 5KG3A 1KB9F 1PP9H 5IYBO 4LF9O 5KG4A 2OIGA 2WAMA 2M05A 3KHHA 2W9AA 2WPDG 4TT3G 5BWUA 3BHPA 5D5PA 1YF2A 4EEQA 2WB1A 2CFMA 1G6UA 4I7HA 3RYFA 1JXLA 2RDIA 5BR8O 4KXRA 3CHXA 2FLPA 2KQXA 3H4DA 4LF7O 1TA8A 5I5XA 4W4LA 1HR0B 4NZOA 4F6EA 4LSAA 2AZ2A 5B1AB 2OCHA 1I5YA 3G6YA 1U97A 1B33N 4LF6O 2GUZB 5DQGA 4MS2A 3SYPA 4MVMA 3K5MA 1R6TA 5IY5B 4DR4B 4O7SA 2EINC 2Z04A 2IH3C 3BABA 3M9OB 4LP8A 2QR4A 4B7EA 2WA4A 3AK2A 4QGPA 4O4IA 1GSOA 3D3QA 2ZNJA 1I3QA 1N34B 3CVZA 2W6MA 3CX5F 5KX5F 1WCMG 2W0XA 1XK5A 2HJWA 3KCYA 1RK6A 2JDIG 4J9RA 3PR5B 3E83A 4PA9A 1N56A 3G8DA 4JI7H 4HAMA 1AI4A 5JQGB 2YRXA 3ASOC 2R8KA 4J9LA 3VQYA 1NH2D 1DV2A 2CNUA 2C2DA 2A3QA 3DXRA 1AJNA 1ZUQA 3JD2A 3ZHTA 3RUPA 4DR2O 4TQSA 5IT9N 1GM9A 4U3JA 1RPOA 4ZHQF 1CPYA 3JALB 4J80A 3E8GA 2QWOB 1PKXA 4MTOA 5FD6A 3LNNA 1JDBB 3H3VH 5J9PC 2R87A 3HB3B 2DABA 5KFCA 4O2BA 1I7FA 4LNUB 3PW5A 1S0MA 1VAJA 3K06A 2XD4A 4I4TF 4NZNA 4PWQA 2IBKA 4WFEA 1B6SA 4JI1O 4O84A 2AGOA 2EILC 1WJZA 4ECVA 2OLSA 2DMXA 3AG3B 3BQ1A 2V4QA 5IYCO 4DXWA 5KLVH 1KT8A 4X66H 3H0GA 5IP9G 2BCCH 1EN6A 2CW8A 2W9CA 4RUFA 1GH6A 1YHQV 5LBQA 2JS5A 1K1QA 3OMAB 5L3FA 4MV7A 5CB4A 4OX9O 3KYHC 1IXMA 3PZPA 3CCRV 3Q4HB 3NUAA 1N36H 5KFYA 3APQA 2DE0X 5EYPA 2ZM6O 4FLWA 1HNZB 4HYKA 3AG7A 1SERA 4UV8A 1JQ0A 4RO2A 5KT2A 4X1YA 2VQEB 3FB5C 3OE7G 2IJIA 4JYBA 2YXHA 2NLJC 4LFAB 3T9CA 4JI3B 1VEWA 4O4IF 4FFBB 4J9YB 3OGCC 5IJ9A 3ZHRA 2JA6A 1QVFU 4PV1B 3JZ6A 4YBZB 1GM7A 4P30A 2P0AA 2RF4A 3C0FB 2Q0AA 5BYAA 4X9QA 1M5IA 1F23A 4JTAB 4DUYO 4ECRA 2W6JG 4FK5C 4PZ8A 3RT3C 2UU9B 4DV0O 1EHIA 4GX2A 4LWSA 1S0OA 5C8YA 3CEIA 4MTDA 3EPGA 3N2KA 4U7CA 4IGGA 2J6SA 4BIUA 4PBCA 1OCZB 2N04A 2QE7G 1ROPA 4WD3A 1IX9A 3AEIA 4JYYA 2K1EA 3ZRWA 2E5LH 2W71A 4M9UA 2M7WA 2QM8A 3PO3G 4JAUA 1BS3A 3ETDA 2YS6A 1NTKH 4DR7H 5KHIA 2YICA 3PW4A 3U55A 2YIAA 4AYBA 1XL6A 1GSHA 1RYRA 4NXMB 2V59A 3FFQA 5KMGA 1KYOF 4O2BF 1K5SA 3CJHA 2QDOA 4UB6Z 3BEHA 2FKXA 4O4JA 3WNZA 3F7VC 3OR7C 1XEQA 2UUCO 1Q43A 1B6RA 5FL7G 3H1LH 2XTAA 4JI6H 3RTXA 5AG2A 3VNNA 2GLTA 1H8EG 4UCVA 3PW7A 3NR7A 1S68A 2XCLA 3NBYB 4DL6A 1XMOH 4DW1A 4FM2A 4DLKA 1EN4A 2ZDIC 4UUJC 1DV1A 1R3LC 2QWRB 4I9WA 3X2QB 4DR1B 4PZ7A 2XAJA 1NVPB 1MZBA 2YIBA 1ORQC 4O7YA 2EIMC 1XDNA 5CB4F 5T14A 5JCOA 2UXBO 3I56V 4I55B 4HYOA 4GKKB 1JFFA 1KC8W 1MSDA 5D1PA 1RP3B 2K9PA 2F4VB 1FXKA 4KHPO 1OCRC 2QYZA 1KP2A 3RYIB 4I0XA 4ED0A 3DC5A 5DLFA 1F4MA 4NVPA 4WFAV 1W93A 4JI5H 3K5NA 5F2VO 5KFQA 2HHHO 2C22A 3EVKA 4CH6A 5JH7B 1I94B 3SI8A 2W9BB 3HOUG 1GO3F 2YIDA 4PDBA 4EFBA 4DL4A 2IJKA 1YIJV 1F51A 4Z2WA 4LF9B 4ED1A 1S3JA 2JEXA 2ZIMA 3HKDB 5DG9A 4E2LA 1PNLA 2A9HA 4UB8Z 4GLXA 4E4TA 4RQEA 3AG2C 4JXUA 1ENVA 3IAYA 2ZDIA 4YIPA 1SA0B 1S5JA 3HKCB 2QM7A 2A0LA 3CCLV 1TWHA 3BA9A 2N74A 3HB9A 4RWUA 2E76B 5BR8B 4PZ6A 1AB3A 5C8YF 1V4YA 1Z5VA 2ASJA 4WBNB 3OD4A 1D2DA 4LF7B 4A3DG 1Y1VG 4WHXA 1KEEA 4GYCB 4IWXA 3U0GA 5KFXA 4I5SA 4O7ZA 4O83A 1ZHSA 4LF6B 3MWMA 3MR5A 1C3OA 4J9OA 1BHAA 5KFEA 1JJ2U 4FLUA 3N27A 3FD9A 3MAQA 1YDXA 4DL3A 1PK8A 4O4LA 2YZLA 3JAMN 3TY8A 5KA6A 4O7NA 1URFA 3GDEA 1BMFG 2WYOA 4O4JF 5EIBC 3QF7A 1YVWA 4RNMA 1M57C 4PDVA 4DV1O 2PZSA 5KUKA 4PI2A 2Y0PA 1FKAH 1QHTA 5F9NA 3BACA 2C2AA 2FB5A 4L8JA 4NTWA 2R82A 4DV4O 2VQFH 3RW0A 2F95B 4NKGB 2KB1A 2COIA 1X9NA 2Q8VA 4CZZA 2CGOA 3QWUA 3OSPA 1BNCA 1CQIB 3J81W 2QJ1A 3ICXA 2FK1A 3VBBA 1A0GA 1M93A 3ABKC 2ZXWB 4EGJA 4CKCA 1EKVA 2ODMA 4DR2B 3ZJZA 3B77A 4RCNA 2CTPA 3T1HO 3ZRSA 1PV0A 4XYLB 1OV9A 1KJ9A 5LP6C 3M7MX 3RYCA 2UUAO 4JZ2A 2QTOA 5EBWC 1JR9A 3LDCA 5KG0A 1JX9A 1I2LA 2NU6B 5HV6A 2C00A 3D8CA 5IWAH 3P30A 2HVRA 3IC9A 3FMAA 1WPXA 3PVXA 1VKZA 5GONA 5CA1B 4BBRG 2UXCO 1KUQA 3RVYA 3WB0A 3JCZA 1PNKA 2ZNIA 2Q5ZA 4J9PA 5J2UA 1XHZA 4DR3H 1YSCA 4B3MH 3ETEA 5LGTA 4B3RO 4X1IB 4DK0A 1OCCB 4DV6H 4TQFA 4BIZA 2HIXA 3T54A 1N0JA 3ASNB 3MHSC 2QF7A 4TQRA 2ZQMA 3AG4B 4PELA 4CC6A 4J11A 1I08A 5LHHA 2Y69B 2EIJB 4OX9B 3KALA 2ZR2A 4LFCH 2WSSG 4RB0A 2LJ2A 3JAWA 4QJFB 2ZM6B 4X20B 2E75B 5I5YA 5LP6A 1VQOV 4FFRA 1Q8IA 3T9DA 1Y14B 2NU8B 3GILA 3JARA 3K0GA 2R92G 3OUZA 1IBLO 1N0NA 2BSKA 2YYAA 4EYIB 4O4LF 3G8CA 2FPGB 1XQ8A 2B5UA 2Y0SE 3TXSA 5KAFZ 5B1BC 1XOUA 2P6JA 4L1KA 1S76D 2HVSA 2M6YA 3AG1C 4J7KA 4Q8FA 4FLYA 2Q68A 1TWFA 3GIPA 5FPRA 5KX5B 1CKNA 3T9FA 5KFIA 5C3EG 4YR2A 4DV0B 1VF6C 2ZDHA 4AI8A 1RPRA 5JVDB 1WCMA 4GC7A 4DR4O 3JSNA 3ETJA 4BWAA 3HOVG 2B1IA 2G38A 3T9EA 4MTFA 3J7AU 5B3SB 4WFHA 2EIYA 1SF9A 1TVKA 4ZHQB 3OMIB 3F5WC 3RBZA 2J9GA 1ZLZA 3LUTB 3C90A 1U96A 4CH4A 5CBGA 2WLLA 2ATLA 3B8NA 5GONF 2ZE6A 3HKZA 1KQSU 4XDJA 2UUCB 2QK4A 3U54A 1AUVA 4DR6H 5EZYA 5EIBD 3ZRVA 4C5CA 1K92A 4BXXG 5J2UF 2JIZG 1H8HG 3ZMSA 4K0KH 4I4TB 1P7BA 3GTJA 1RSOB 4NTYA 4Q4DA 4J9NA 5KT5A 1I1LA 2R7MA 5EDWA 4YIOA 1CQJB 4RAZA 2A7WA 3R5XA 3H40A
chains in the Genus database with same CATH topology
3DF7A 3L4KA 3RR5A 1AN7A 1HNXH 4TV8B 2UXBB 1A0IA 4CH5A 3SGIA 1TAEA 1VS0A 3RYFB 2OYQA 2V4DA 1NT2B 4JI2H 1I94H 3HKEA 3VQVA 5LA6A 4FM0A 4KHPB 4YJ2A 4I4TA 1RSOA 4LMYA 1JJOA 4DV7H 4JV5H 3VQXA 4RZQA 4ZI7A 3K5LA 4DUYH 3E22A 4JI5B 3N41B 2JVDA 3BHPA 2XIGA 2HHHB 5D5PA 4EEQA 4TV8A 2ZINA 2CFMA 1G6UA 4APMA 4I7HA 3RYFA 5BR8H 5JJNB 4O4HB 3CHXA 4TOIA 4O4IB 5JCOC 1TA8A 4B3TH 4LH7A 1HR0B 4LSAA 4YHHB 3RGBA 2YXLA 4LF6H 2UUBH 3K5MA 3CSXA 1N32H 4DR4B 1FJGH 4X64H 2PTMA 3BABA 4X1KB 1M0TA 1GYFA 4FLXA 1L8DA 1S03G 2PYLA 4O4HA 1N33B 4O4IA 2ZNJA 4JI0H 3A2FA 4DV2B 1N34B 3CVZA 2VPSA 5LL6b 3L2PA 4U3JB 1XK5A 2Q7GA 4GKJH 2RJZA 3UT5B 4X1KA 4JI7H 5JQGB 1I6UA 3VQYA 4RB1A 4O2BB 4A2AA 3QTCA 4B3SH 4DR2H 4DV4B 4KHPH 2VQFB 1FFXB 4U3JA 2WDTA 3JALB 4DV5B 4LF4H 5FNVB 1XNQB 5FD6A 4FLVA 3LNNA 3UT5A 1IBMB 4D7TA 3F8NA 5JQGA 3IG0A 1SQGA 1P49A 4AQYB 2HHHH 5LMNB 5IYZB 5J2TB 3L4JA 4O2BA 4LF5H 1I7FA 4LNUB 4TQDA 2Q2TA 3GJXB 3T1HB 2R72A 5CB4B 3RWRD 3RYHB 1HNWH 4PHZA 5DISC 3SJCC 1FFXA 3SR2C 2UUAB 5EYPB 4LF8B 4M7EA 3JALA 1J5EH 3ETQA 4JI8H 5FNVA 4K8XA 1IBKH 4BW9A 5IWAB 4Q0YA 3U10A 4CH3A 4X1YB 5JVDA 3N42B 4X66H 2CW8A 1TGOA 5IYZA 4RAYA 5J2TA 2UXCB 2JS5A 2ZIOA 4LNUA 1SQFA 4UCTA 2R9AA 4FLZA 4MV7A 2IM9A 4OX9H 5CB4A 3KYHC 3RYHA 3TY9A 4DR3B 4B3MB 4B3RB 4X65H 5IJ9B 1N36H 2P22C 2ZM6H 4DV6B 5EYPA 1CKMA 4FLWA 1HNZB 4K8ZA 4RB2C 2BTQB 4UCSA 4LFBH 4X1YA 2VQEB 4CS4A 1Q3EA 4NXNH 1H2SB 4LFAB 4LFCB 3B2EE 4JI3B 2FE3A 1XMQB 5C8YB 4IHJB 2Q2UA 1E4GT 4FFBB 3N2KB 1M4UA 4DV1H 5IJ9A 3T1YH 5A2QW 4DV3H 4DUZH 1WH2A 4JI4H 2BTQA 2PY5A 1IBLB 3C0FB 1XNRH 2Q0AA 5EOYA 5LMUH 1M5IA 2VUGA 1WNSA 4PZ8A 2PGGA 2UU9B 4DV0H 2E3CA 2UXDB 3QG5A 5C8YA 5KMGB 4MTDA 4IHJA 4FFBA 3N2KA 4LH6A 2RQ6A 4O4JB 1X4TA 2YIBD 2R70A 2WE6A 4FM9A 3W1GA 2E5LH 5KHJA 3W5OA 1ZAUA 1Z5WA 1SYXB 4YY3H 4DR7H 5KHIA 1B04A 4ETSA 2PUSA 2YIAA 4CC5A 4LR3A 1Z2NX 4NXMB 3FFQA 5KMGA 2RGRA 4MTEA 4O4JA 5LOVB 3HXLA 4DR5B 2HVQA 2UUCH 4DK1A 1Q43A 5JJJB 4JI1B 1JFFB 4JI6H 1JMKC 3RTXA 3K3VA 3VNNA 3BA8A 4I9QA 3N44B 3NC0B 4UCVA 4HNAB 4JYAH 3JAKB 1S68A 3NBYB 1XMOH 3OTOH 4FM2A 4X62B 5K1XA 5IT9W 2JGUA 4DR1B 4PZ7A 4UCOA 4DR6B 2YIBA 1MZBA 1KU9A 1XDNA 2UXBH 3BAAA 5JCOA 4I55B 4AHCA 3K58A 4K0KB 4GKKB 1JFFA 4FLTA 5D1PA 1ZHQA 2F4VB 3WB1A 4HNAA 3JAKA 3DSQA 5LYJB 4AILC 1IBLH 2HGSA 3RYIB 1P8LA 3N2GB 3J7AK 4NVPA 1SKVA 3OTFA 4JI5H 4D7SA 1XHXA 1HNXB 3K5NA 5K1PA 4CS2A 2YI8A 4CH6A 4TV9B 5JH7B 1I94B 4JI2B 4I55A 4PDBA 5KHGA 4EFBA 3K57A 2MCTA 4FM1A 4DV7B 4JV5B 4LF9B 5JJEB 2YCHA 2KKWA 4MV9A 3HKDB 2ZIMA 3CB2A 4TUYB 4DUYB 1HR0H 3RYIA 3N2GA 4GLXA 4YHHH 3M4IA 1Z2PX 3IAYA 4UFZA 3J80W 1SA0B 1S5JA 2CAZC 3HKCB 3THOA 3BA9A 4DR4H 4O4LB 5BR8B 4PZ6A 5JH7A 4TV9A 4R7RA 1Z5VA 1T5EA 4WBNB 1WPBA 3PN1A 4LF7B 3ZEDA 1N33H 4B3TB 3LMLA 4GYCB 4PI0A 3RF2A 5KHHA 4DRFA 3HKDA 1ZHSA 3N43B 4TUYA 2VOBA 4DV2H 4LF6B 1TUBB 1N34H 2UUBB 3MWMA 4B08A 1O9HA 1N32B 1SA0A 1FJGB 1HW7A 4X64B 2XHBA 3HKCA 4FLUA 3MAQA 4O4LA 1Q5OA 3H20A 3TY8A 4A2BA 4WBNA 5LXTB 3GDEA 4RB3C 2WYOA 2ZJTA 5EIBC 4JI0B 3QF7A 3UQ8A 4FVMA 2PZSA 4PI2A 2KSWA 1FKAH 1QHTA 4EQ5A 1TUBA 3BPZA 4DV4H 4L8JA 1E4FT 2YI9A 1FVIA 2VQFH 5FD5A 3RYCB 2W57A 2F95B 4EB6B 5BMVB 4ZIBA 4GKJB 4DV5H 3K59A 4JI7B 1X9NA 3QWUA 1XNQH 3NBZB 3RGXA 3J81W 5LXTA 2QJ1A 3ICXA 1IBMH 4AQYH 1CKOA 5LMNH 4KL1A 3KAJA 4CS3A 5GONB 1M93A 3SJAC 1VF7A 3RFRA 4YJ3B 4B3SB 4DR2B 4UCUA 4J0MA 3RIZA 3T1HH 1M0WA 5J2UB 3EYYA 5LP6C 4LF9H 3M7MX 2UUAH 3RYCA 4LF8H 4EB6A 5BMVA 4LF4B 3JATB 3RGZA 3SJBC 3N6XA 1DGSA 3GB8B 3KAKA 3BRCA 5IWAH 2HVRA 4LF5B 3FMAA 1L2ZA 2UXCH 5GONA 5CA1B 1WN7A 2OWOA 4YJ3A 2VWKA 1HNWB 4LF7H 3WB0A 3JAWB 2F93B 5ITZB 2ZNIA 4E6NA 5J2UA 1XHZA 4DR3H 1QQCA 4B3MH 4B3RH 5LP6B 1J5EB 4JI8B 4X1IB 4DK0A 4DV6H 3JARB 1IBKB 4TQFA 3K5OA 2HEPA 3JATA 2HIXA 1HNZH 4X66B 1O9GA 4CC6A 1BJTA 2VQEH 4ZOLB 1D5AA 1YEWA 4OX9B 5CA1A 4HBNA 3W1BA 2O03A 3KALA 4LFAH 4Q6GA 5KHKA 5LOVA 4RB0A 4JI3H 4LFCH 3TY5A 1XMQH 4X65B 3JAWA 5ITZA 1N36B 2ZM6B 2ZCEA 4X20B 3ZS8C 5LP6A 1Q8IA 4X1IA 3JARA 1P16A 4LFBB 2VWJA 1CKNB 2QM4A 4NXNB 2RGVA 4ZOLA 2UU9H 3U0ZA 1XQ8A 4IAJA 4UCRA 4BWSC 2BTOA 2UXDH 4DV1B 5CA0B 5D1OB 3T1YB 1V9PA 4X20A 3VQWA 4DUZB 4DV3B 2HVSA 4F6RB 4JI4B 1BGWA 5D5QA 4I50B 1XNRB 3JASB 4FLYA 5LMUB 5LYJA 5FLXW 1TVKB 3S24A 5FPRA 5KX5B 1CKNA 3U11A 4DV0B 2F1MA 3HKBB 5JVDB 2CW7A 4O2AB 3JSNA 3KXYT 4NXMH 5CA0A 4BWAA 5D1OA 4EFEA 5EZYB 1XI1A 1KMIZ 4F6RA 4DR5H 2E5LB 4DRXB 2PYJA 4I50A 3JAMW 3JASA 2Q7HA 4JI1H 1TVKA 4YY3B 4DR7B 3JSLA 2GV9A 5KX5A 4ZHQB 3WB2A 3HKBA 2EX3A 4CH4A 2HIVA 4IIJB 2Q7EA 4O2AA 5IJ0B 3RJ0A 4X62H 4DR1H 1Z2OX 2UUCB 4DR6H 5EZYA 5EIBD 2P5OA 4DRXA 3HKEB 4JI6B 5LA6B 4GKKH 4YJ2B 4I4TB 4K0KH 4JYAB 4LSXA 2F4VH 4ZHQA 1XMOB 4ZI7B 2F66C 3OTOB 4RAZA 1SEIA 3E22B 4IIJA 5FPOA 1O75A 5IJ0A 3N40P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V B;  3RR5 A;  1HNW B;  5IWA B;  2UXB B;  1A0I A;  3SGI A;  1TAE A;  4E6N A;  1VS0 A;  1P8L A;  1J5E B;  2UXC B;  4JI8 B;  1IBK B;  4KHP B;  4UCT A;  1HNX B;  2HIX A;  3KYH C;  3TY9 A;  4X66 B;  4CC6 A;  4DR3 B;  4B3M B;  1I94 B;  4JI2 B;  4B3R B;  4DV6 B;  1CKM A;  4EFB A;  4JI5 B;  4OX9 B;  1HNZ B;  3W1B A;  4UCS A;  2HHH B;  4DV7 B;  4JV5 B;  4EEQ A;  4LF9 B;  3TY5 A;  2CFM A;  4X65 B;  1N36 B;  2VQE B;  4DUY B;  2ZM6 B;  4GLX A;  4TOI A;  4LFA B;  4LFC B;  4UFZ A;  4JI3 B;  1P16 A;  1TA8 A;  1XMQ B;  4LFB B;  2Q2U A;  3BA9 A;  4LH7 A;  1HR0 B;  5BR8 B;  1CKN B;  4PZ6 A;  4NXN B;  4YHH B;  3PN1 A;  4LF7 B;  4UCR A;  1IBL B;  4B3T B;  4DR4 B;  4DV1 B;  4DRF A;  2VUG A;  3BAB A;  5D1O B;  3T1Y B;  4LF6 B;  4PZ8 A;  1V9P A;  4DV3 B;  4DUZ B;  2UU9 B;  2UUB B;  2HVS A;  4JI4 B;  2UXD B;  1N33 B;  1XNR B;  1N32 B;  5LMU B;  4X64 B;  1FJG B;  3S24 A;  5FPR A;  4DV2 B;  1N34 B;  4LH6 A;  1CKN A;  4DV0 B;  3TY8 A;  3L2P A;  3GDE A;  1XK5 A;  3W1G A;  4JI0 B;  3UQ8 A;  3JSN A;  3W5O A;  1ZAU A;  5D1O A;  1B04 A;  4EQ5 A;  4EFE A;  1FVI A;  2E5L B;  4CC5 A;  4NXM B;  4GKJ B;  4YY3 B;  4JI7 B;  4DR7 B;  1X9N A;  3JSL A;  3QWU A;  3NBZ B;  4DV4 B;  4DR5 B;  2VQF B;  2HVQ A;  1CKO A;  2HIV A;  4JI1 B;  4DV5 B;  3RTX A;  1XNQ B;  4B3S B;  4DR2 B;  4UCU A;  3VNN A;  3BA8 A;  3NC0 B;  4UCV A;  2UUC B;  1IBM B;  4AQY B;  1S68 A;  3NBY B;  5LMN B;  4GKK B;  4JI6 B;  4X62 B;  4LF4 B;  2Q2T A;  3GJX B;  4DR1 B;  3T1H B;  4PZ7 A;  4UCO A;  4JYA B;  4DR6 B;  1DGS A;  3GB8 B;  1XDN A;  1XMO B;  3BAA A;  5DIS C;  2HVR A;  3OTO B;  2UUA B;  4LF5 B;  4LF8 B;  4K0K B;  5FPO A;  5D1P A;  2OWO A; 
#chains in the Genus database with same CATH topology
 4K6N A;  2VA3 A;  4FBU A;  4A5U B;  2JA7 G;  3CS5 A;  1IUR A;  3H9V A;  1RM1 B;  2UXB B;  4ED8 A;  2R8G A;  1W59 A;  4P9P A;  3SGI A;  1VS0 A;  3RYF B;  3OUF A;  2V4D A;  3RBD A;  3K3P A;  4RUE A;  4JI2 O;  4NYE A;  5LA6 A;  1NZ6 A;  1H2K A;  4KHP B;  5LP6 F;  4IRK A;  1JJO A;  4BBS G;  4JV5 H;  4DV7 O;  1DIK A;  2R84 A;  2Z3Y A;  3K5L A;  3E2E A;  3CCU V;  2JRI A;  2HHH B;  2HJF C;  3K0D A;  3AK3 A;  4QWA A;  2Z02 A;  4APM A;  2EUL A;  4O7W A;  3P3P A;  5KFG A;  2ZE8 A;  2JA8 G;  4TOI A;  3A0R A;  3ETG A;  4QE9 A;  5DN6 G;  4O4I B;  5DGB A;  2DWC A;  4B3T H;  2D2C B;  2AGQ A;  4LH7 A;  1SET A;  4K3A A;  3O9O A;  2KG7 A;  4U6P A;  2XUM A;  1KKD A;  2A1H A;  2LFR A;  3RV3 A;  4JV2 A;  1Y74 A;  1N32 H;  1FJG H;  4X64 H;  2VQE O;  4FIP C;  1WRV A;  1AJP A;  4J7Z A;  2I80 A;  2PYL A;  4O4H A;  2W70 A;  2B63 G;  1VIB A;  2IMW P;  1A9X A;  4JI0 H;  4A3K G;  1LNQ A;  3DXR B;  4FFO A;  4KP4 A;  3JD1 A;  1YTF B;  1G1X B;  4LBE C;  4MVS A;  4QNH B;  4U3J B;  3WG7 C;  1ET0 A;  3DTU B;  4IT5 A;  1WB8 A;  1I1K A;  3CWB H;  1VAR A;  3HR0 A;  4UVC A;  2EIN B;  1Z2G A;  2JEF A;  1AI5 A;  2RJZ A;  4X1K A;  1YIT V;  1M9N A;  4JI7 O;  2J6U A;  1NJI W;  1BE3 H;  1I6U A;  5C1O A;  4MVO A;  5EZY F;  4Q44 A;  4O2B B;  2IU0 A;  1MZF A;  2HP8 A;  5HFM A;  3DTF A;  3QZ8 A;  3NGD A;  4ECT A;  3QTC A;  1WP7 A;  3ZIA G;  3UZO A;  2HFE C;  4DV4 B;  3MWE A;  1EM1 A;  2AQ4 A;  2H94 A;  2WDT A;  3DC6 A;  5E1A C;  4DV5 B;  3TQT A;  3QO8 A;  4LF4 H;  4JV1 A;  2HGX A;  4R50 A;  1W96 A;  1ZL8 A;  3UT5 A;  3ZHU A;  3KTM A;  1IBM B;  1AR4 A;  4MV3 A;  3SPH A;  1T94 A;  1SQG A;  1K33 A;  2DYS C;  3CCJ V;  2W9C B;  4FGR A;  3RB4 A;  2BE3 A;  3L4J A;  4LF5 H;  3DGE A;  4TQD A;  1GN6 A;  3LDD A;  1EKF A;  1RYS A;  5LA6 F;  3T1H B;  3MR2 A;  2R72 A;  3H01 A;  5CB4 B;  1ZSP A;  1P4R A;  1HNW H;  4PHZ A;  5DIS C;  3ZN0 A;  3SJC C;  1FFX A;  4ME6 A;  1D5N A;  2UUA B;  5EYP B;  3WWH A;  1J5E H;  4A3G G;  3ETQ A;  4JI8 H;  5FNV A;  1IBK H;  1WP8 A;  4BW9 A;  3SPJ A;  4PDR A;  4CH3 A;  4X1Y B;  5JVD A;  4RZR A;  4FBT A;  4X66 O;  2HGW A;  1TGO A;  5IYZ A;  2UXC B;  3L75 H;  4MV1 A;  2ZIO A;  1S5H C;  1UC8 A;  2R9A A;  4MV4 A;  1QU7 A;  2IM9 A;  4MA0 A;  2OIE A;  4MA5 A;  1UFI A;  4B3R B;  5IJ9 B;  1I7N A;  3PR4 A;  1G8M A;  1N36 O;  1P84 F;  4EBD A;  4U7O A;  2EIL B;  2W6Z A;  1DTO A;  3BFR A;  3GWK C;  2F4V O;  4UV9 A;  3W7U A;  1R9T A;  4G28 B;  4LFB H;  2QA4 V;  1PL4 A;  4BY1 G;  3HPL C;  4NXN H;  1H2S B;  4FS2 A;  4PJ0 Z;  4O4H F;  4LWS B;  5KA5 A;  5C8Y B;  3JYC A;  3HOY G;  4MVQ A;  3N2K B;  1M4U A;  3AYH B;  3M99 B;  1FXH A;  3T1Y H;  3ZRW B;  5I5V A;  4JI4 H;  4EG0 A;  1IBL B;  1Y1V A;  2W6I G;  2WA3 A;  3G6X A;  5EOY A;  2DAA A;  5CBF A;  3KHG A;  1WNS A;  4F4X A;  2E3C A;  5DG8 A;  4TVI A;  2C28 A;  3Q8Q B;  4YQW A;  5KMG B;  4NR1 A;  2DYR C;  4IHJ A;  1JKJ B;  3CJH B;  4O4J B;  4OGQ B;  3SYQ A;  4EEY A;  2R70 A;  2WE6 A;  5KG1 A;  3ABT A;  4NB5 A;  4FM9 A;  1IZ3 A;  2RMK B;  1R1B A;  1R6K A;  3J81 N;  2E5L O;  1ZAU A;  1Z5W A;  5KFD A;  1SYX B;  3T99 A;  2YXY A;  4DR7 O;  5EWG A;  4MVZ A;  4DL5 A;  4LR3 A;  1B3Q A;  2RGR A;  4CKE A;  2X5R A;  1M7J A;  1V54 C;  3RAX A;  1GN4 A;  2ILM A;  3OM3 B;  2HVQ A;  5DQI A;  1S77 D;  5EC2 C;  1GMG A;  1ZET A;  1JFF B;  4HZ3 A;  2QWQ B;  2CK3 G;  1FXK B;  5KFJ A;  4I9Q A;  5FNV F;  4ASU G;  3NXS A;  2C35 B;  4U3F H;  3G6V A;  4YXW G;  5KFM A;  2J6T A;  5JVD F;  4I0X B;  1XMO O;  3OTO H;  3B8M A;  5IYZ F;  1I7L A;  2Y0I A;  4MVU A;  1Q90 D;  3R5F A;  3CRA A;  2W6O A;  2V7Q G;  2KSD A;  5KUM A;  2UVW A;  3EHB B;  2OCC C;  3FKI A;  1ZHQ A;  3HO8 A;  3WWJ A;  3WB1 A;  2LW7 A;  3A0H Z;  3WFV A;  1T3N A;  5LYJ B;  4AIL C;  2R9R B;  3CEB A;  4UXN A;  2W6P A;  3OTF A;  2WLI A;  1Q6H A;  1XHX A;  4JI5 O;  4YB8 B;  2QWN B;  4CS2 A;  2FTK A;  5IYB G;  2CUG A;  2EIM B;  4JI2 B;  1SCU B;  3V4S A;  4ED6 A;  2GDS A;  3STL C;  1S5L Z;  3K57 A;  2MCT A;  4Q20 A;  4DV7 B;  5IYD O;  2JJ1 G;  2KKW A;  2EJ3 A;  4MAM A;  4NZM A;  1ZTE A;  1FYJ A;  2O57 A;  1K4D C;  3N2G A;  4IYI A;  4YHH H;  4C5B A;  3RAQ A;  1NR7 A;  1KBH A;  3M4I A;  1Z2P X;  1Y67 A;  4PA3 A;  4BY7 G;  4UFZ A;  3J80 W;  3ORQ A;  1UPG A;  5FLM G;  5CAE B;  3THO A;  4O4L B;  1H38 A;  4IHJ F;  4TV9 A;  1T5E A;  4Q45 A;  3ZED A;  3K04 A;  1N33 H;  1W0K G;  3RF2 A;  4PI0 A;  3WO0 A;  5KHH A;  2R7N A;  4TUY A;  1M6V A;  4CMD A;  2VOB A;  4DV2 H;  3FYE B;  3MD0 A;  1T36 A;  1MSW D;  2V5A A;  2HVJ C;  4M0J A;  4OPH A;  2XHB A;  4PA4 A;  2HG5 C;  4XYM B;  4MSW C;  1RJP A;  4RB3 C;  2ZJT A;  4Q4C A;  1SZT A;  2MK3 A;  3UQ8 A;  5K2M A;  3GTK A;  1DAA A;  4BR6 A;  1TUB A;  3TIG A;  3BPZ A;  4WFG A;  1E4F T;  2AZ0 A;  3K5H A;  2ALZ A;  2P7T C;  1AVM A;  3RYC B;  2VUM A;  4ZIB A;  2CZG A;  3FB8 C;  4JI7 B;  3E86 A;  1XNQ H;  5JWP A;  5LXT A;  2CKZ B;  3EFF K;  4AQY H;  3SYC A;  5LMN H;  2QKC A;  1MAB G;  1XL4 A;  4F4L A;  4CS3 A;  3I4M G;  5GON B;  2AGP A;  3SJA C;  1VF7 A;  1Y1W G;  4J10 A;  1A3G A;  5J2U B;  2HLD G;  4LF9 H;  2L6L A;  2C2R A;  4LF8 H;  4EB6 A;  5B1A C;  2WLJ A;  3BG5 A;  3H4B A;  1NTM H;  1BSM A;  3N6X A;  2H3O A;  3GV7 B;  3BRC A;  4JGS A;  1I5X A;  1OBD A;  5IWA O;  2XGP A;  2W8L A;  3OUS A;  2OWO A;  4H37 A;  2HHF A;  4YJ3 A;  3VPB A;  5IYC G;  4LF7 H;  2JA7 A;  3JAW B;  4E6N A;  3H1K H;  4H33 A;  4TSF G;  1QQC A;  2LO1 A;  2EIK B;  4DR3 O;  5LP6 B;  4FU0 A;  4B3M O;  1TWG A;  3JAR B;  2FML A;  4DV6 O;  2VQD A;  1QR9 A;  2HEP A;  2W8K A;  4X66 B;  1BQ0 A;  1O9G A;  5BWV A;  1V55 C;  2BSK B;  1PNM A;  2LGW A;  1OCO B;  2I8C A;  4ECZ A;  3G6E V;  4DW0 A;  4TV9 F;  1D5A A;  4N21 A;  4HBN A;  2O03 A;  4LFC O;  3TY5 A;  1XMQ H;  5ITZ A;  1N36 B;  3QNE A;  1NTZ H;  2X6B A;  3JD3 A;  4TUY F;  3Q8S B;  1WSC A;  1EUD B;  3FDS A;  1IYD A;  3ZHV A;  1BL8 A;  4O3N A;  1H2L A;  4ZKI A;  1CKN B;  4EBC A;  2RGV A;  4XX0 B;  4ZOL A;  1PPJ H;  4GUN A;  2QB5 A;  2OH2 A;  2NUA B;  4IAJ A;  2UXD H;  2Q9L A;  4ZBM A;  4MV8 A;  3ZMU A;  5A9G A;  1BZK A;  5I60 A;  3DAA A;  3VQW A;  1TWA A;  1BGW A;  5LYJ A;  1BQZ A;  4HNT A;  1TVK B;  5FLX W;  2W7O A;  2PMZ E;  3VOU A;  4UVB A;  2AHZ A;  4TWK A;  2F1M A;  2GPW A;  3BY6 A;  1S9F A;  2H8P C;  5LXT F;  1E1R G;  2WLL B;  1Q82 W;  4IYH A;  2W7P A;  5C1P A;  5B1B B;  3JRX A;  5KFP A;  4J9Z B;  4EFE A;  5EZY B;  1XI1 A;  1KMI Z;  2CGN A;  2YZN A;  4DR5 H;  3GTM A;  2E5L B;  3AG1 B;  5DLG A;  2W0F C;  4JI1 H;  3T7A A;  4DR7 B;  4YAJ B;  2GV9 A;  1AJQ A;  1CEZ A;  2XGQ A;  4O2A A;  1JX4 A;  4X62 H;  3CPW U;  2IP4 A;  3CME V;  1AI6 A;  1Z2O X;  4YJ3 F;  4A3L G;  2P5O A;  4DR6 O;  3MR6 A;  4IRD A;  2ITD C;  1SZX A;  4JI6 B;  2JJ2 G;  5LA6 B;  1QLE B;  1JDE A;  4K0K O;  4F4W A;  3A8T A;  5L3E A;  1SES A;  1XMO B;  2QSA A;  2ZD9 A;  3OHA A;  1SEI A;  4IIJ A;  5FPO A;  4DV5 O;  3N40 P;  2OTL V;  4B7K A;  3DF7 A;  1HNX H;  5DED A;  2YZM A;  2OTJ V;  1IBM O;  4CH5 A;  1TAE A;  5H5N A;  3SPG A;  2OYQ A;  4A3J G;  5BWT A;  2ARH A;  4YR0 A;  4YJ2 A;  3SJQ C;  3SNO A;  3K9A A;  1YJ9 V;  4DIM A;  1YXB A;  1COW G;  3CCV V;  4JV5 O;  4RZQ A;  3OEE G;  2KG7 B;  4ZI7 A;  1MZE A;  1R73 A;  4DUY H;  1M90 W;  4C2M A;  2E2H A;  3IN5 A;  3E22 A;  4JI5 B;  3N41 B;  4ZOL F;  3G67 A;  5I5U A;  2XIG A;  1XRE A;  1Y74 B;  3CRQ A;  3AX6 A;  5D8D A;  4TV8 A;  2ZIN A;  2I87 A;  1E79 G;  3FX7 A;  5LHI A;  3M8A A;  2WAQ A;  1VQ6 V;  4O4H B;  3K03 A;  3IC7 A;  4GX0 A;  4J9K A;  3GTL A;  4RAI A;  2JA5 A;  3MFH A;  1E4E A;  4IR9 A;  4B3T O;  5I5W A;  5LYJ F;  4J9S A;  2HJD A;  4CBC A;  2R7K A;  2UUB H;  4W4K A;  1WLE A;  4ECQ A;  4R8U A;  4JAV A;  3Q2O A;  4MW8 A;  1N32 O;  4O7R A;  1FJG O;  3PW2 A;  2PTM A;  2YSU B;  4X1K B;  4U7N A;  3B4S A;  1ZWI C;  5DGA A;  1S03 G;  5H80 A;  4NLG A;  4PA7 A;  2XAF A;  4JI0 O;  4ECS A;  2HVK C;  4PA6 A;  1NI8 A;  4MTG A;  5LL6 b;  3ZMZ A;  3BVO A;  2DZD A;  1Q86 W;  2Q7G A;  2CTW A;  1K4C C;  2WLH A;  3CCE V;  4GKJ H;  2XAS A;  4O2A F;  4EKW A;  1ZL8 B;  3GV5 B;  3G80 A;  2F23 A;  3UT5 B;  3JRW A;  4CMF A;  1K7D A;  1YZB A;  2JGD A;  3TEK A;  1LR1 A;  1QBZ A;  4H13 B;  4RB1 A;  3DTG A;  1KJ8 A;  3O65 A;  1AI7 A;  4JV0 A;  2IU3 A;  4QIW A;  4IRC A;  3LSU A;  3LUL A;  4B3S H;  1GRJ A;  4KHP H;  1I2K A;  2VQF B;  2Q73 A;  1FFX B;  1MG1 A;  3H0G G;  3WG7 B;  1L0L H;  3OHB A;  5DGH A;  5F9L A;  4IIJ F;  5FNV B;  2YU9 A;  4LC1 A;  4LF4 O;  4FLV A;  2ZE7 A;  4D7T A;  2V1D A;  3OW2 U;  2HHH H;  5IYZ B;  1DK1 A;  1NH2 B;  3T1C A;  3F5T A;  3CC7 V;  4LF5 O;  3GJX B;  2FPP B;  4KUM A;  3UFX B;  4YJ2 F;  2C2E A;  5KG6 A;  2CTQ A;  1HNW O;  5KT4 A;  2JEU A;  5BWX A;  1XDC A;  1XIL A;  4P9O A;  3JZF A;  4ZI7 F;  3GV8 B;  3MHH C;  1R3I C;  1KC7 A;  1J5E O;  4RNN A;  4K8X A;  2ZDG A;  4JI8 O;  4P2Z A;  1IBK O;  5IWA B;  4Q0Y A;  3U10 A;  1HDJ A;  1S72 V;  2IH1 C;  3R65 A;  1SQV H;  4TV8 F;  3T5J A;  2DYS B;  2FLL A;  4RAY A;  5J2T A;  1SQF A;  2B1G A;  4UCT A;  4FLZ A;  2NU9 B;  1YI2 V;  3RYH A;  2CH7 A;  4DR3 B;  4B3M B;  3J80 N;  4X65 H;  3W7W A;  3E8H A;  3ZHS A;  3OR6 C;  2P22 C;  3OUU A;  4DV6 B;  1CKM A;  2PN1 A;  2R7Z G;  4K8Z A;  3K9S A;  1NR1 A;  1VF6 A;  5GTI Z;  1DLB A;  5KFS A;  4LFB O;  2Q7D A;  2FYU H;  2NVY A;  1Q3E A;  3MR3 A;  2DQ3 A;  4LFC B;  2YC0 A;  3B2E E;  4IWY A;  4A93 G;  3S3X A;  2DWE C;  4IHJ B;  5I5T A;  4R7C A;  4DV1 H;  3K5I A;  1S0N A;  5A2Q W;  4DV3 H;  1K97 A;  2EBO A;  2X6A A;  3T1Y O;  3IGA C;  4DUZ H;  1XBL A;  3S3W A;  2BTQ A;  1S0V A;  4JI4 O;  1M56 C;  3T2M A;  1G2W A;  1XNR H;  5LMU H;  4O86 A;  1BXR A;  4OXS A;  2VUG A;  3BCC H;  1B06 A;  3QO5 A;  1CP9 A;  2CNV A;  4O7V A;  1Q6I A;  2PGG A;  2FB9 A;  3I12 A;  3GIK A;  4WCE V;  2XCA A;  5TIS Z;  1QVG U;  4G2K A;  3ABM B;  3QG5 A;  1PD3 A;  4F50 A;  5EWE A;  4YR3 A;  4ABM A;  5KAI Z;  4QIW F;  2R86 A;  2RQ6 A;  4YP3 A;  3ZBH A;  1THZ A;  1GSA A;  4DL7 A;  3W7T A;  4R6Z A;  4Q8E A;  4YY3 H;  1B04 A;  4N23 A;  1VQP V;  1FAF A;  3AG4 C;  3L74 H;  3CC4 V;  2ETN A;  2JS3 A;  5L3B A;  2Y69 C;  2DYR B;  2EIJ C;  3AK1 A;  5EBM C;  3UZB A;  5EC1 C;  1NVP D;  4O82 A;  3N8D A;  1SS3 A;  1PX2 A;  1C30 A;  2CTR A;  4DK1 A;  1Y6X A;  4NTX A;  2DOS A;  1JMK C;  3CRM A;  2YEV A;  3N44 B;  1AR5 A;  4JYA H;  5KFU A;  4EGQ A;  3ZMT A;  4WF9 V;  4X88 A;  3MJF A;  5KFA A;  3OTO O;  2FPI B;  2IJJ A;  1HWY A;  2WLI B;  3G71 V;  2ZDQ A;  5DQH A;  3SYO A;  3OFN G;  4WFB V;  4KFM A;  3GTP A;  4DR6 B;  2FK2 A;  1KU9 A;  5KFZ A;  3HOZ G;  3BAA A;  4XDK A;  5CM0 A;  1L1F A;  3V6K A;  1FXV A;  1K3E A;  1BHB A;  4AHC A;  4K0K B;  4FLT A;  5CR5 A;  3EPI A;  1F4N A;  3T9A A;  5EBL C;  3TGU H;  4HNA A;  3JAK A;  1IBL H;  4EYH B;  3D36 C;  2ZR3 A;  3N2G B;  1P8L A;  2BOB C;  2FKL A;  1SKV A;  4GT1 A;  4D7S A;  2DIK A;  3BQ0 A;  4ZQI A;  3ASO B;  5K1P A;  1IYE A;  2YI8 A;  3ETH A;  4TV9 B;  4ECU A;  3IFX A;  3K08 A;  2Y48 A;  2YZG A;  3TET A;  4FM1 A;  1K1S A;  4JV5 B;  2YCH A;  5B3S C;  1JLL B;  2VS0 A;  4TUY B;  2WLM A;  1HR0 H;  3G4S V;  1Y66 A;  4YHH O;  5H9C A;  3ZHQ A;  1Y76 A;  3Q1K A;  4F4Z A;  2P4K A;  4A3F G;  1VQL V;  4D6T H;  2PF4 E;  4DR4 H;  1K9M W;  4R7R A;  4MW3 A;  5FLX N;  2B9Z A;  5H2F Z;  2EJ7 A;  4QSH A;  3HT5 A;  1AR1 B;  1VBG A;  1RJQ A;  4B3T B;  1GAX A;  5KFT A;  1N33 O;  4ED2 A;  2DPJ A;  3N43 B;  2E2I A;  3WO1 A;  2JK5 C;  1N34 H;  1TUB B;  2OT5 A;  4DV2 O;  3CP1 A;  3D36 A;  3R66 A;  3STZ C;  2BQU A;  2WWW A;  1WR2 A;  3BQ2 A;  1N32 B;  1FJG B;  4X64 B;  2JEG A;  2ITC C;  5L3D A;  4JF3 A;  1JA8 A;  2YRW A;  3CSW A;  4A2B A;  4HQ6 A;  5LXT B;  5BXZ A;  1HP8 A;  1KEC A;  5DEC A;  4JI0 B;  1BCC H;  4FVM A;  2XT9 A;  2XC9 A;  3AW8 A;  4IR1 A;  3K3W A;  5E79 Z;  3V6H A;  3ZN1 A;  2YI9 A;  1OJH A;  1FVI A;  1EFR G;  3LSS A;  5FD5 A;  5IDJ A;  2WLN A;  4EB6 B;  2RNB A;  4HNV A;  3CMA V;  1XNQ O;  3NBZ B;  2F43 G;  4FFM A;  4BW5 A;  3LWB A;  4AQY O;  4KL1 A;  5LMN O;  3KAJ A;  3MWD A;  1X59 A;  2HHF B;  4YJ3 B;  4J0M A;  3RIZ A;  4UCU A;  1OWT A;  1QLN A;  3EYY A;  2ASD A;  3ORR A;  2ZKO A;  5BMV A;  4LF4 B;  1EZV H;  4LF8 O;  4QWB A;  2AXT Z;  5LL6 Y;  2Y4U A;  3APO A;  1DGS A;  3GB8 B;  3KAK A;  1TWC A;  1S97 A;  1DF5 A;  5JUM A;  5L3C A;  2EZO A;  3UYY A;  3G6B A;  4LF5 B;  5KT3 A;  4O7T A;  5KFB A;  2V58 A;  1GKF A;  5FR9 A;  5CN0 A;  1HNW B;  3L9D A;  4CKB A;  3CXC U;  5ITZ B;  3RFC A;  1J5E B;  2NR5 A;  4JI6 O;  5KFH A;  4JI8 B;  1OZ0 A;  1IBK B;  1WAZ A;  3K5O A;  3BJY A;  3JAT A;  1HNZ H;  2IJH A;  5KS8 A;  1CE8 A;  1W2B U;  2Z0A A;  1H2M A;  2VQE H;  1AIL A;  4ZOL B;  1KJI A;  1YEW A;  4PDL A;  4XBF A;  4UUG A;  3W1B A;  4LFA H;  2P4V A;  5KHK A;  4JI3 H;  2ATK C;  3SYA A;  3UO2 A;  1XMQ O;  2QEX V;  3ML0 A;  1QCE A;  2UXN A;  5C4X G;  2AW9 A;  1GTO A;  4LFB B;  2DQ0 A;  3W7X A;  2BOC C;  1NBM G;  4I7Z B;  1V55 B;  2VWJ A;  4NXN B;  1EZJ A;  4GX5 A;  2UU9 H;  1SC5 B;  4O3S A;  4UCR A;  2PMZ A;  2BTO A;  4BWS C;  2RDJ A;  2UXD O;  3P3N A;  4FPP A;  2P67 A;  3KCX A;  2W6N A;  3T1Y B;  3OSN A;  1V9P A;  3JCU Z;  4JI4 B;  2FP4 B;  3ABU A;  1FFT B;  1M1K W;  1OCR B;  2Z5U A;  4LCU C;  3CC2 V;  2FK3 A;  1MNG A;  2DWD C;  1VF5 B;  2GTA A;  4GZR B;  3L70 H;  4EBE A;  2A79 B;  4QWD A;  5L1I A;  3P32 A;  3TW6 A;  5DM6 V;  2R92 A;  4O2A B;  4NYK A;  4NXM H;  5CA0 A;  5D1O A;  1GN2 A;  5CBH A;  5L3G A;  4F6R A;  2VA2 A;  4MTX A;  4I50 A;  4J41 A;  3B09 A;  4DR5 O;  3JAS A;  2DPI A;  2Q7H A;  4PDM A;  3E5N A;  4HR7 A;  5BMV F;  1WA8 A;  2Q67 A;  3Q8P B;  3AG2 B;  5H6R A;  4A3M G;  3HKB A;  1KJJ A;  4IIJ B;  4IL6 Z;  2Q7E A;  4CE5 A;  3RJ0 A;  1Q6U A;  4X62 O;  4DR1 H;  1NKD A;  3JZI A;  1MOF A;  3UM7 A;  2VRZ A;  4X89 A;  4DRX A;  5L9X A;  3UKM A;  2PBZ A;  3ABL C;  2R6F A;  2HDK A;  4GKK H;  4H0L B;  4YJ2 B;  1FKA O;  4JAA A;  4LSX A;  2F4V H;  1UNN C;  5DGI A;  5KG7 A;  3FAV A;  2XOK G;  3QQM A;  2VQF O;  1WB7 A;  3WWI A;  1R3J C;  4ZI7 B;  1AUX A;  3OTO B;  3E22 B;  3V4Z A;  1O75 A;  3H1J H;  3WU2 Z;  5IJ0 A;  4QWE A;  3L4K A;  3RR5 A;  4TV8 B;  3N6R A;  5B66 Z;  1HNX O;  1MMM A;  5B1N A;  1I94 H;  1M57 B;  2XCP A;  2UVV A;  3HKE A;  3VQV A;  3TXQ A;  5BPF A;  3TII A;  1E4E B;  4LMY A;  1NQT A;  2BQ3 A;  1IOV A;  3OMN B;  3VQX A;  1KKC A;  1VBH A;  2FLN A;  5C93 A;  3TIN A;  2VR1 A;  3RB3 A;  2P90 A;  4QPJ A;  2JVD A;  5IP7 G;  2R7Z A;  5IYD G;  4FJC C;  5IY5 C;  4R8U B;  5A2Q N;  1H2N A;  4GX1 A;  1ULZ A;  4TM5 A;  3TK1 A;  5BR8 H;  5JJN B;  3ABK B;  3VOT A;  5HNE A;  4MV6 A;  2PI5 A;  5JCO C;  1I1M A;  2SCU B;  1YTF D;  2GQS A;  1N8R W;  3ZX6 A;  1FXK C;  3RGB A;  3A0B Z;  4YHH B;  2YXL A;  1CS0 A;  2WB1 E;  4LF6 H;  3CYO A;  2UUB O;  1JPX A;  3RN4 A;  3CSX A;  3RB0 A;  2DN9 A;  1M0T A;  4RNO A;  1GYF A;  4FLX A;  1L8D A;  5CA0 F;  2JGD B;  1EKP A;  4J9M A;  1W0J G;  4Z1V A;  2MW2 B;  3LP8 A;  5KFK A;  1N33 B;  2Q0O C;  4I50 F;  3A2F A;  2Y0S A;  4DV2 B;  1KD1 W;  2R93 G;  2VPS A;  3GIJ A;  5K3W A;  5KFR A;  3L2P A;  3VA7 A;  2GUZ A;  1VQN V;  3HOX G;  4JZG A;  4GC6 A;  2GBO A;  1IVS A;  1KUT A;  3M9N B;  3SPI A;  4GKJ O;  4GCZ A;  5FJ8 G;  3VMM A;  1VQ9 V;  3L72 H;  2Q4P A;  4UVA A;  4A3B G;  2CDY A;  4A2A A;  1G4Y B;  3GLK A;  2GSM B;  3R9R A;  3KZI Z;  4DR2 H;  4B3S O;  2L35 A;  2B63 A;  4DO2 A;  4RU9 A;  3M9M B;  1XNQ B;  3AG3 C;  5KFW A;  2X0S A;  1ZX3 A;  2D3O W;  3GWO A;  3IG0 A;  3F8N A;  5JQG A;  4AQY B;  1P49 A;  3Q8R B;  1K83 A;  1N4C A;  5LMN B;  4JAS A;  5LGU A;  5J2T B;  4O3P A;  5I47 A;  3RB6 A;  3TW7 A;  2Q2T A;  3HOW G;  2X6C A;  4FZ1 A;  3RWR D;  2CH7 B;  2QKS A;  3RYH B;  1RK5 A;  2CE4 A;  3VPC A;  1GM8 A;  3TJT A;  1N48 A;  5KKN B;  3T5K A;  3SR2 C;  4LF8 B;  2VPQ A;  4M7E A;  3JAL A;  3MFI A;  2DLN A;  1I0H A;  4DYL A;  5I5S A;  3N42 B;  1AP6 A;  4FFL A;  4O3R A;  5CA3 A;  4LNU A;  1EZ1 A;  4OX9 H;  1SRY A;  5LGN A;  4JTD B;  3R23 A;  1EBO A;  3TY9 A;  1QNM A;  1EYZ A;  3HBL A;  5KT7 A;  3SPC A;  3MDS A;  4X65 O;  3C3S A;  2ZM6 H;  1QR8 A;  3GIM A;  3CE2 A;  4O81 A;  1BT8 A;  2BTQ B;  1YJW V;  1JOY A;  4UCS A;  4RB2 C;  3GII A;  2X7R B;  5JQW A;  3GID A;  1SFO A;  5L1L A;  1ZQ7 A;  2Y4R A;  2EZP A;  1OBG A;  4CS4 A;  2R8I A;  4H44 B;  4DL2 A;  1UJW B;  3LNM B;  2GPS A;  1PL0 A;  2FE3 A;  1XMQ B;  5EWF A;  2Q2U A;  1E4G T;  3PO2 G;  4X8A A;  1LUV A;  3Q4H A;  2COJ A;  2EJ0 A;  4BIO A;  1OCZ C;  2QWP B;  4DV3 O;  4DUZ O;  1WH2 A;  2NN4 A;  5C5J A;  2PY5 A;  1Q81 W;  1XNR O;  5LMU O;  4IZO A;  1I50 A;  2HG8 A;  4DV0 H;  1GO3 E;  1GK9 A;  2UXD B;  1K34 A;  3K79 A;  4FFB A;  4OPA A;  5DAA A;  4LH6 A;  4FFN A;  1X4T A;  2YIB D;  1K5Q A;  1A48 A;  4FMT A;  1ARO P;  3U9S A;  3LDE A;  1VQK V;  3W1G A;  2YWV A;  2EIK C;  1M56 B;  1E1Q G;  5KHJ A;  3W5O A;  2A06 H;  5H6Q A;  5HBR B;  2YEV B;  2JEI A;  4ETS A;  3FKS G;  4YY3 O;  2PUS A;  5EK0 A;  3C3T A;  4CC5 A;  2WLK A;  5JQG F;  4X64 O;  1OCO C;  1Z2N X;  1AP5 A;  4FS1 A;  3X2Q C;  1EN5 A;  3V6J A;  4MTE A;  3FKI G;  2CQY A;  5LOV B;  3HXL A;  2XND G;  4DR5 B;  2UUC H;  1SQP H;  4ECY A;  5JJJ B;  4JI1 B;  3PFF A;  5C44 G;  4AYB E;  4DQN A;  2UVR A;  3K3V A;  4K35 A;  2ADP A;  3BA8 A;  2HR3 A;  4Y8V B;  3NC0 B;  4HNA B;  4JYA O;  1DF4 A;  3JAK B;  4J42 A;  3ZRX A;  4X62 B;  5K1X A;  5IT9 W;  2JGU A;  4WFF A;  5KT6 A;  3CXH F;  4ICG A;  4UCO A;  2GQR A;  1IXB A;  4O3O A;  2UXB H;  3F7Y C;  3GTO A;  3JD4 A;  3H1H H;  3CD6 V;  3KHL A;  3K58 A;  5CMU A;  4JPR A;  5GW7 A;  3PJS K;  5KFO A;  3JD0 A;  4HN2 A;  2ODT X;  3DSQ A;  2HGS A;  3J7A K;  1A32 A;  2N05 A;  4FZ0 A;  1Y76 B;  5KG5 A;  4JUZ A;  1HNX B;  1RJR A;  4L87 A;  5BWR A;  1CXZ B;  2ASL A;  4HNU A;  2LW1 A;  3T4Z A;  4I55 A;  2COG A;  5KHG A;  5HFL A;  3E8B A;  4JTC B;  5JJE B;  1SQB H;  1Q7Y W;  4MV9 A;  2ABJ A;  3CB2 A;  4MT8 A;  4C7U A;  4DUY B;  3I4N G;  3RYI A;  1HR0 O;  1VQ7 V;  2LGQ A;  4QWC A;  2IW5 A;  2CAZ C;  2WTF A;  3T9B A;  4QPK A;  2YS7 A;  5JH7 A;  3OGI B;  2JA6 G;  2W9B A;  1WPB A;  3PN1 A;  4J7J A;  1R6N A;  2ZGI A;  5LHG A;  2GTS A;  3LML A;  2VUM G;  4DRF A;  3HKD A;  1QLE C;  1KBL A;  2UUB B;  1N34 O;  2PI4 A;  3KHR A;  4B08 A;  2BR0 A;  1O9H A;  5JVL A;  1SA0 A;  2ZE5 A;  1HW7 A;  3HKC A;  3QFF A;  3EXA A;  1Q5O A;  1KP3 A;  4NXN O;  3H20 A;  2AHY A;  2DJV A;  3T4D A;  4WBN A;  1S10 A;  4ECX A;  2FJZ A;  5BY1 A;  1FS0 G;  2NU7 B;  2V4R A;  1LUW A;  2ZXW C;  3FB7 C;  1NS1 A;  3LQS A;  5DMX A;  2KSW A;  3KG2 A;  2X0L A;  4EQ5 A;  3CRR A;  4DV4 H;  1VQ4 V;  2RN9 A;  3OT7 A;  2YS8 A;  2W57 A;  5BMV B;  2QKA A;  4GKJ B;  4XZ3 B;  4O3Q A;  3K59 A;  4DV5 H;  3UO3 A;  3RGX A;  4ED7 A;  2Q69 A;  2EJR A;  1IBM H;  3SE7 A;  1CKO A;  3W7S A;  3RFR A;  5IE9 A;  4PD4 F;  4GLW A;  2YL2 A;  1VQM V;  4B3S B;  1UC9 A;  3T1H H;  2NNU A;  1M0W A;  2BQR A;  3CCM V;  2UUA H;  1OCC C;  3E89 A;  1XUQ A;  5BWW A;  4QW9 A;  1K8A W;  3JAT B;  3RGZ A;  1JVM A;  3ASN C;  3SJB C;  1PM9 A;  3SDL A;  2LP7 A;  3T5L A;  4QE7 A;  2LFS A;  2AGA A;  1F7Y A;  4I55 F;  2UXC H;  1L2Z A;  1WN7 A;  1L0N H;  3FYI B;  2VWK A;  4ED3 A;  1IOW A;  2W6Q A;  5E25 A;  3GIQ A;  3RBE A;  1GN3 A;  5BZB A;  5GTH Z;  1J95 A;  4F4Y A;  2F93 B;  3TQ1 A;  3CCQ V;  4B3R H;  4FFP A;  5KFL A;  1P7G A;  3U9T A;  2NVX A;  1NU1 H;  1YJN V;  3RV4 A;  5BPH A;  1Y1W A;  3RVZ A;  4RQF A;  1HNZ O;  3GTQ A;  2WAQ E;  1BJT A;  2LQT A;  5J2T F;  5KFN A;  1TUE B;  2DW4 A;  2HKO A;  2YDE A;  5JH7 F;  5KG2 A;  1VMG A;  4FFK A;  4A3C G;  5CA1 A;  1IDS A;  1Y4M A;  1V54 B;  4MVR A;  1KJQ A;  1V51 A;  4Q6G A;  4Z1M G;  5LOV A;  4LFA O;  4JI3 O;  4A3E G;  4X65 B;  2JEJ A;  2V9W A;  2ZCE A;  4XDL A;  4FE2 A;  3I55 V;  3L71 H;  3ZS8 C;  4DAA A;  1FD9 A;  1SQQ H;  1RFY A;  2XAG A;  2EJ2 A;  1VQ5 V;  4X1I A;  5BYB A;  4RUC A;  2PVP A;  1JIH A;  4ECW A;  2IA6 A;  1P16 A;  2QTS A;  1YCI A;  5KFV A;  3KRE A;  2E74 B;  2QM4 A;  3GVM A;  1K73 W;  3U0Z A;  4JYC A;  2UU9 O;  4WBN F;  1SQX H;  3QO7 A;  3CCS V;  4O7L A;  2XAQ A;  4Q43 A;  4DV1 B;  5CA0 B;  3FB6 C;  5D1O B;  4QJF A;  2OCC B;  4X20 A;  4DV3 B;  3B40 A;  4DUZ B;  1GGO A;  4G3I A;  5L1K A;  3H1I H;  4F6R B;  5D5Q A;  4I50 B;  1XNR B;  3JAS B;  3KKY A;  5LMU B;  4A3I G;  4E4E A;  1WA8 B;  3S24 A;  3U11 A;  2R93 A;  2ZT9 B;  3HKB B;  3QVN A;  3CQZ A;  2R85 A;  3R5H A;  3GTG A;  4BAY A;  1VP7 A;  1KTA A;  4QIW E;  4QW8 A;  2CW7 A;  3PW0 A;  3KXY T;  5B1O A;  4NXM O;  5B5E Z;  2QGN A;  2AU0 A;  2IBZ H;  1VQ8 V;  3GB7 C;  2R8H A;  2PYJ A;  3E35 A;  4DRX B;  3JAM W;  2R8J A;  4YY3 B;  3UCS C;  3JSL A;  3GQC A;  5KX5 A;  3E8F A;  3FAV B;  3WB2 A;  3ZMV A;  3D3I A;  4J9Q A;  3I5D A;  2R7L A;  1BGY H;  2EX3 A;  2HIV A;  1MA1 A;  2FMA A;  3IJ4 A;  5IJ0 B;  2XAH A;  5KFF A;  3OEH G;  2YW2 A;  1EUC B;  2RDC A;  2RCV A;  3LSQ A;  1RM1 C;  2R9I A;  4DR1 O;  2Y4T A;  5CE8 A;  3T5H A;  1US6 A;  3VPD A;  3HKE B;  2FL4 A;  4GKK O;  3L73 H;  1JCH A;  3OAA G;  4JYA B;  4RUA A;  2UXX A;  4ZHQ A;  1B6Q A;  4C5A A;  5DG7 A;  2F66 C;  2YUA A;  1R3K C;  3HKZ E;  3ZCC A;  4YAK B;  1FPO A;  4R8C A;  3TCU A;  1AN7 A;  3CRC A;  2JA5 G;  1OHH G;  3ABM C;  5CA1 F;  2GHY A;  1A0I A;  5LOV F;  2P06 A;  4CHI A;  5L1J A;  2Q6A A;  1NT2 B;  2ADQ B;  1H2G A;  4JI2 H;  1I94 O;  3ABL B;  4FM0 A;  4I4T A;  3QZ7 A;  1RSO A;  2CNQ A;  1GLV A;  2UVU A;  4DV7 H;  4G27 B;  5KG3 A;  1KB9 F;  1PP9 H;  5IYB O;  4LF9 O;  5KG4 A;  2OIG A;  2WAM A;  2M05 A;  3KHH A;  2W9A A;  2WPD G;  4TT3 G;  5BWU A;  3BHP A;  5D5P A;  1YF2 A;  4EEQ A;  2WB1 A;  2CFM A;  1G6U A;  4I7H A;  3RYF A;  1JXL A;  2RDI A;  5BR8 O;  4KXR A;  3CHX A;  2FLP A;  2KQX A;  3H4D A;  4LF7 O;  1TA8 A;  5I5X A;  4W4L A;  1HR0 B;  4NZO A;  4F6E A;  4LSA A;  2AZ2 A;  5B1A B;  2OCH A;  1I5Y A;  3G6Y A;  1U97 A;  1B33 N;  4LF6 O;  2GUZ B;  5DQG A;  4MS2 A;  3SYP A;  4MVM A;  3K5M A;  1R6T A;  5IY5 B;  4DR4 B;  4O7S A;  2EIN C;  2Z04 A;  2IH3 C;  3BAB A;  3M9O B;  4LP8 A;  2QR4 A;  4B7E A;  2WA4 A;  3AK2 A;  4QGP A;  4O4I A;  1GSO A;  3D3Q A;  2ZNJ A;  1I3Q A;  1N34 B;  3CVZ A;  2W6M A;  3CX5 F;  5KX5 F;  1WCM G;  2W0X A;  1XK5 A;  2HJW A;  3KCY A;  1RK6 A;  2JDI G;  4J9R A;  3PR5 B;  3E83 A;  4PA9 A;  1N56 A;  3G8D A;  4JI7 H;  4HAM A;  1AI4 A;  5JQG B;  2YRX A;  3ASO C;  2R8K A;  4J9L A;  3VQY A;  1NH2 D;  1DV2 A;  2CNU A;  2C2D A;  2A3Q A;  3DXR A;  1AJN A;  1ZUQ A;  3JD2 A;  3ZHT A;  3RUP A;  4DR2 O;  4TQS A;  5IT9 N;  1GM9 A;  4U3J A;  1RPO A;  4ZHQ F;  1CPY A;  3JAL B;  4J80 A;  3E8G A;  2QWO B;  1PKX A;  4MTO A;  5FD6 A;  3LNN A;  1JDB B;  3H3V H;  5J9P C;  2R87 A;  3HB3 B;  2DAB A;  5KFC A;  4O2B A;  1I7F A;  4LNU B;  3PW5 A;  1S0M A;  1VAJ A;  3K06 A;  2XD4 A;  4I4T F;  4NZN A;  4PWQ A;  2IBK A;  4WFE A;  1B6S A;  4JI1 O;  4O84 A;  2AGO A;  2EIL C;  1WJZ A;  4ECV A;  2OLS A;  2DMX A;  3AG3 B;  3BQ1 A;  2V4Q A;  5IYC O;  4DXW A;  5KLV H;  1KT8 A;  4X66 H;  3H0G A;  5IP9 G;  2BCC H;  1EN6 A;  2CW8 A;  2W9C A;  4RUF A;  1GH6 A;  1YHQ V;  5LBQ A;  2JS5 A;  1K1Q A;  3OMA B;  5L3F A;  4MV7 A;  5CB4 A;  4OX9 O;  3KYH C;  1IXM A;  3PZP A;  3CCR V;  3Q4H B;  3NUA A;  1N36 H;  5KFY A;  3APQ A;  2DE0 X;  5EYP A;  2ZM6 O;  4FLW A;  1HNZ B;  4HYK A;  3AG7 A;  1SER A;  4UV8 A;  1JQ0 A;  4RO2 A;  5KT2 A;  4X1Y A;  2VQE B;  3FB5 C;  3OE7 G;  2IJI A;  4JYB A;  2YXH A;  2NLJ C;  4LFA B;  3T9C A;  4JI3 B;  1VEW A;  4O4I F;  4FFB B;  4J9Y B;  3OGC C;  5IJ9 A;  3ZHR A;  2JA6 A;  1QVF U;  4PV1 B;  3JZ6 A;  4YBZ B;  1GM7 A;  4P30 A;  2P0A A;  2RF4 A;  3C0F B;  2Q0A A;  5BYA A;  4X9Q A;  1M5I A;  1F23 A;  4JTA B;  4DUY O;  4ECR A;  2W6J G;  4FK5 C;  4PZ8 A;  3RT3 C;  2UU9 B;  4DV0 O;  1EHI A;  4GX2 A;  4LWS A;  1S0O A;  5C8Y A;  3CEI A;  4MTD A;  3EPG A;  3N2K A;  4U7C A;  4IGG A;  2J6S A;  4BIU A;  4PBC A;  1OCZ B;  2N04 A;  2QE7 G;  1ROP A;  4WD3 A;  1IX9 A;  3AEI A;  4JYY A;  2K1E A;  3ZRW A;  2E5L H;  2W71 A;  4M9U A;  2M7W A;  2QM8 A;  3PO3 G;  4JAU A;  1BS3 A;  3ETD A;  2YS6 A;  1NTK H;  4DR7 H;  5KHI A;  2YIC A;  3PW4 A;  3U55 A;  2YIA A;  4AYB A;  1XL6 A;  1GSH A;  1RYR A;  4NXM B;  2V59 A;  3FFQ A;  5KMG A;  1KYO F;  4O2B F;  1K5S A;  3CJH A;  2QDO A;  4UB6 Z;  3BEH A;  2FKX A;  4O4J A;  3WNZ A;  3F7V C;  3OR7 C;  1XEQ A;  2UUC O;  1Q43 A;  1B6R A;  5FL7 G;  3H1L H;  2XTA A;  4JI6 H;  3RTX A;  5AG2 A;  3VNN A;  2GLT A;  1H8E G;  4UCV A;  3PW7 A;  3NR7 A;  1S68 A;  2XCL A;  3NBY B;  4DL6 A;  1XMO H;  4DW1 A;  4FM2 A;  4DLK A;  1EN4 A;  2ZDI C;  4UUJ C;  1DV1 A;  1R3L C;  2QWR B;  4I9W A;  3X2Q B;  4DR1 B;  4PZ7 A;  2XAJ A;  1NVP B;  1MZB A;  2YIB A;  1ORQ C;  4O7Y A;  2EIM C;  1XDN A;  5CB4 F;  5T14 A;  5JCO A;  2UXB O;  3I56 V;  4I55 B;  4HYO A;  4GKK B;  1JFF A;  1KC8 W;  1MSD A;  5D1P A;  1RP3 B;  2K9P A;  2F4V B;  1FXK A;  4KHP O;  1OCR C;  2QYZ A;  1KP2 A;  3RYI B;  4I0X A;  4ED0 A;  3DC5 A;  5DLF A;  1F4M A;  4NVP A;  4WFA V;  1W93 A;  4JI5 H;  3K5N A;  5F2V O;  5KFQ A;  2HHH O;  2C22 A;  3EVK A;  4CH6 A;  5JH7 B;  1I94 B;  3SI8 A;  2W9B B;  3HOU G;  1GO3 F;  2YID A;  4PDB A;  4EFB A;  4DL4 A;  2IJK A;  1YIJ V;  1F51 A;  4Z2W A;  4LF9 B;  4ED1 A;  1S3J A;  2JEX A;  2ZIM A;  3HKD B;  5DG9 A;  4E2L A;  1PNL A;  2A9H A;  4UB8 Z;  4GLX A;  4E4T A;  4RQE A;  3AG2 C;  4JXU A;  1ENV A;  3IAY A;  2ZDI A;  4YIP A;  1SA0 B;  1S5J A;  3HKC B;  2QM7 A;  2A0L A;  3CCL V;  1TWH A;  3BA9 A;  2N74 A;  3HB9 A;  4RWU A;  2E76 B;  5BR8 B;  4PZ6 A;  1AB3 A;  5C8Y F;  1V4Y A;  1Z5V A;  2ASJ A;  4WBN B;  3OD4 A;  1D2D A;  4LF7 B;  4A3D G;  1Y1V G;  4WHX A;  1KEE A;  4GYC B;  4IWX A;  3U0G A;  5KFX A;  4I5S A;  4O7Z A;  4O83 A;  1ZHS A;  4LF6 B;  3MWM A;  3MR5 A;  1C3O A;  4J9O A;  1BHA A;  5KFE A;  1JJ2 U;  4FLU A;  3N27 A;  3FD9 A;  3MAQ A;  1YDX A;  4DL3 A;  1PK8 A;  4O4L A;  2YZL A;  3JAM N;  3TY8 A;  5KA6 A;  4O7N A;  1URF A;  3GDE A;  1BMF G;  2WYO A;  4O4J F;  5EIB C;  3QF7 A;  1YVW A;  4RNM A;  1M57 C;  4PDV A;  4DV1 O;  2PZS A;  5KUK A;  4PI2 A;  2Y0P A;  1FKA H;  1QHT A;  5F9N A;  3BAC A;  2C2A A;  2FB5 A;  4L8J A;  4NTW A;  2R82 A;  4DV4 O;  2VQF H;  3RW0 A;  2F95 B;  4NKG B;  2KB1 A;  2COI A;  1X9N A;  2Q8V A;  4CZZ A;  2CGO A;  3QWU A;  3OSP A;  1BNC A;  1CQI B;  3J81 W;  2QJ1 A;  3ICX A;  2FK1 A;  3VBB A;  1A0G A;  1M93 A;  3ABK C;  2ZXW B;  4EGJ A;  4CKC A;  1EKV A;  2ODM A;  4DR2 B;  3ZJZ A;  3B77 A;  4RCN A;  2CTP A;  3T1H O;  3ZRS A;  1PV0 A;  4XYL B;  1OV9 A;  1KJ9 A;  5LP6 C;  3M7M X;  3RYC A;  2UUA O;  4JZ2 A;  2QTO A;  5EBW C;  1JR9 A;  3LDC A;  5KG0 A;  1JX9 A;  1I2L A;  2NU6 B;  5HV6 A;  2C00 A;  3D8C A;  5IWA H;  3P30 A;  2HVR A;  3IC9 A;  3FMA A;  1WPX A;  3PVX A;  1VKZ A;  5GON A;  5CA1 B;  4BBR G;  2UXC O;  1KUQ A;  3RVY A;  3WB0 A;  3JCZ A;  1PNK A;  2ZNI A;  2Q5Z A;  4J9P A;  5J2U A;  1XHZ A;  4DR3 H;  1YSC A;  4B3M H;  3ETE A;  5LGT A;  4B3R O;  4X1I B;  4DK0 A;  1OCC B;  4DV6 H;  4TQF A;  4BIZ A;  2HIX A;  3T54 A;  1N0J A;  3ASN B;  3MHS C;  2QF7 A;  4TQR A;  2ZQM A;  3AG4 B;  4PEL A;  4CC6 A;  4J11 A;  1I08 A;  5LHH A;  2Y69 B;  2EIJ B;  4OX9 B;  3KAL A;  2ZR2 A;  4LFC H;  2WSS G;  4RB0 A;  2LJ2 A;  3JAW A;  4QJF B;  2ZM6 B;  4X20 B;  2E75 B;  5I5Y A;  5LP6 A;  1VQO V;  4FFR A;  1Q8I A;  3T9D A;  1Y14 B;  2NU8 B;  3GIL A;  3JAR A;  3K0G A;  2R92 G;  3OUZ A;  1IBL O;  1N0N A;  2BSK A;  2YYA A;  4EYI B;  4O4L F;  3G8C A;  2FPG B;  1XQ8 A;  2B5U A;  2Y0S E;  3TXS A;  5KAF Z;  5B1B C;  1XOU A;  2P6J A;  4L1K A;  1S76 D;  2HVS A;  2M6Y A;  3AG1 C;  4J7K A;  4Q8F A;  4FLY A;  2Q68 A;  1TWF A;  3GIP A;  5FPR A;  5KX5 B;  1CKN A;  3T9F A;  5KFI A;  5C3E G;  4YR2 A;  4DV0 B;  1VF6 C;  2ZDH A;  4AI8 A;  1RPR A;  5JVD B;  1WCM A;  4GC7 A;  4DR4 O;  3JSN A;  3ETJ A;  4BWA A;  3HOV G;  2B1I A;  2G38 A;  3T9E A;  4MTF A;  3J7A U;  5B3S B;  4WFH A;  2EIY A;  1SF9 A;  1TVK A;  4ZHQ B;  3OMI B;  3F5W C;  3RBZ A;  2J9G A;  1ZLZ A;  3LUT B;  3C90 A;  1U96 A;  4CH4 A;  5CBG A;  2WLL A;  2ATL A;  3B8N A;  5GON F;  2ZE6 A;  3HKZ A;  1KQS U;  4XDJ A;  2UUC B;  2QK4 A;  3U54 A;  1AUV A;  4DR6 H;  5EZY A;  5EIB D;  3ZRV A;  4C5C A;  1K92 A;  4BXX G;  5J2U F;  2JIZ G;  1H8H G;  3ZMS A;  4K0K H;  4I4T B;  1P7B A;  3GTJ A;  1RSO B;  4NTY A;  4Q4D A;  4J9N A;  5KT5 A;  1I1L A;  2R7M A;  5EDW A;  4YIO A;  1CQJ B;  4RAZ A;  2A7W A;  3R5X A;  3H40 A; 
#chains in the Genus database with same CATH homology
 3DF7 A;  3L4K A;  3RR5 A;  1AN7 A;  1HNX H;  4TV8 B;  2UXB B;  1A0I A;  4CH5 A;  3SGI A;  1TAE A;  1VS0 A;  3RYF B;  2OYQ A;  2V4D A;  1NT2 B;  4JI2 H;  1I94 H;  3HKE A;  3VQV A;  5LA6 A;  4FM0 A;  4KHP B;  4YJ2 A;  4I4T A;  1RSO A;  4LMY A;  1JJO A;  4DV7 H;  4JV5 H;  3VQX A;  4RZQ A;  4ZI7 A;  3K5L A;  4DUY H;  3E22 A;  4JI5 B;  3N41 B;  2JVD A;  3BHP A;  2XIG A;  2HHH B;  5D5P A;  4EEQ A;  4TV8 A;  2ZIN A;  2CFM A;  1G6U A;  4APM A;  4I7H A;  3RYF A;  5BR8 H;  5JJN B;  4O4H B;  3CHX A;  4TOI A;  4O4I B;  5JCO C;  1TA8 A;  4B3T H;  4LH7 A;  1HR0 B;  4LSA A;  4YHH B;  3RGB A;  2YXL A;  4LF6 H;  2UUB H;  3K5M A;  3CSX A;  1N32 H;  4DR4 B;  1FJG H;  4X64 H;  2PTM A;  3BAB A;  4X1K B;  1M0T A;  1GYF A;  4FLX A;  1L8D A;  1S03 G;  2PYL A;  4O4H A;  1N33 B;  4O4I A;  2ZNJ A;  4JI0 H;  3A2F A;  4DV2 B;  1N34 B;  3CVZ A;  2VPS A;  5LL6 b;  3L2P A;  4U3J B;  1XK5 A;  2Q7G A;  4GKJ H;  2RJZ A;  3UT5 B;  4X1K A;  4JI7 H;  5JQG B;  1I6U A;  3VQY A;  4RB1 A;  4O2B B;  4A2A A;  3QTC A;  4B3S H;  4DR2 H;  4DV4 B;  4KHP H;  2VQF B;  1FFX B;  4U3J A;  2WDT A;  3JAL B;  4DV5 B;  4LF4 H;  5FNV B;  1XNQ B;  5FD6 A;  4FLV A;  3LNN A;  3UT5 A;  1IBM B;  4D7T A;  3F8N A;  5JQG A;  3IG0 A;  1SQG A;  1P49 A;  4AQY B;  2HHH H;  5LMN B;  5IYZ B;  5J2T B;  3L4J A;  4O2B A;  4LF5 H;  1I7F A;  4LNU B;  4TQD A;  2Q2T A;  3GJX B;  3T1H B;  2R72 A;  5CB4 B;  3RWR D;  3RYH B;  1HNW H;  4PHZ A;  5DIS C;  3SJC C;  1FFX A;  3SR2 C;  2UUA B;  5EYP B;  4LF8 B;  4M7E A;  3JAL A;  1J5E H;  3ETQ A;  4JI8 H;  5FNV A;  4K8X A;  1IBK H;  4BW9 A;  5IWA B;  4Q0Y A;  3U10 A;  4CH3 A;  4X1Y B;  5JVD A;  3N42 B;  4X66 H;  2CW8 A;  1TGO A;  5IYZ A;  4RAY A;  5J2T A;  2UXC B;  2JS5 A;  2ZIO A;  4LNU A;  1SQF A;  4UCT A;  2R9A A;  4FLZ A;  4MV7 A;  2IM9 A;  4OX9 H;  5CB4 A;  3KYH C;  3RYH A;  3TY9 A;  4DR3 B;  4B3M B;  4B3R B;  4X65 H;  5IJ9 B;  1N36 H;  2P22 C;  2ZM6 H;  4DV6 B;  5EYP A;  1CKM A;  4FLW A;  1HNZ B;  4K8Z A;  4RB2 C;  2BTQ B;  4UCS A;  4LFB H;  4X1Y A;  2VQE B;  4CS4 A;  1Q3E A;  4NXN H;  1H2S B;  4LFA B;  4LFC B;  3B2E E;  4JI3 B;  2FE3 A;  1XMQ B;  5C8Y B;  4IHJ B;  2Q2U A;  1E4G T;  4FFB B;  3N2K B;  1M4U A;  4DV1 H;  5IJ9 A;  3T1Y H;  5A2Q W;  4DV3 H;  4DUZ H;  1WH2 A;  4JI4 H;  2BTQ A;  2PY5 A;  1IBL B;  3C0F B;  1XNR H;  2Q0A A;  5EOY A;  5LMU H;  1M5I A;  2VUG A;  1WNS A;  4PZ8 A;  2PGG A;  2UU9 B;  4DV0 H;  2E3C A;  2UXD B;  3QG5 A;  5C8Y A;  5KMG B;  4MTD A;  4IHJ A;  4FFB A;  3N2K A;  4LH6 A;  2RQ6 A;  4O4J B;  1X4T A;  2YIB D;  2R70 A;  2WE6 A;  4FM9 A;  3W1G A;  2E5L H;  5KHJ A;  3W5O A;  1ZAU A;  1Z5W A;  1SYX B;  4YY3 H;  4DR7 H;  5KHI A;  1B04 A;  4ETS A;  2PUS A;  2YIA A;  4CC5 A;  4LR3 A;  1Z2N X;  4NXM B;  3FFQ A;  5KMG A;  2RGR A;  4MTE A;  4O4J A;  5LOV B;  3HXL A;  4DR5 B;  2HVQ A;  2UUC H;  4DK1 A;  1Q43 A;  5JJJ B;  4JI1 B;  1JFF B;  4JI6 H;  1JMK C;  3RTX A;  3K3V A;  3VNN A;  3BA8 A;  4I9Q A;  3N44 B;  3NC0 B;  4UCV A;  4HNA B;  4JYA H;  3JAK B;  1S68 A;  3NBY B;  1XMO H;  3OTO H;  4FM2 A;  4X62 B;  5K1X A;  5IT9 W;  2JGU A;  4DR1 B;  4PZ7 A;  4UCO A;  4DR6 B;  2YIB A;  1MZB A;  1KU9 A;  1XDN A;  2UXB H;  3BAA A;  5JCO A;  4I55 B;  4AHC A;  3K58 A;  4K0K B;  4GKK B;  1JFF A;  4FLT A;  5D1P A;  1ZHQ A;  2F4V B;  3WB1 A;  4HNA A;  3JAK A;  3DSQ A;  5LYJ B;  4AIL C;  1IBL H;  2HGS A;  3RYI B;  1P8L A;  3N2G B;  3J7A K;  4NVP A;  1SKV A;  3OTF A;  4JI5 H;  4D7S A;  1XHX A;  1HNX B;  3K5N A;  5K1P A;  4CS2 A;  2YI8 A;  4CH6 A;  4TV9 B;  5JH7 B;  1I94 B;  4JI2 B;  4I55 A;  4PDB A;  5KHG A;  4EFB A;  3K57 A;  2MCT A;  4FM1 A;  4DV7 B;  4JV5 B;  4LF9 B;  5JJE B;  2YCH A;  2KKW A;  4MV9 A;  3HKD B;  2ZIM A;  3CB2 A;  4TUY B;  4DUY B;  1HR0 H;  3RYI A;  3N2G A;  4GLX A;  4YHH H;  3M4I A;  1Z2P X;  3IAY A;  4UFZ A;  3J80 W;  1SA0 B;  1S5J A;  2CAZ C;  3HKC B;  3THO A;  3BA9 A;  4DR4 H;  4O4L B;  5BR8 B;  4PZ6 A;  5JH7 A;  4TV9 A;  4R7R A;  1Z5V A;  1T5E A;  4WBN B;  1WPB A;  3PN1 A;  4LF7 B;  3ZED A;  1N33 H;  4B3T B;  3LML A;  4GYC B;  4PI0 A;  3RF2 A;  5KHH A;  4DRF A;  3HKD A;  1ZHS A;  3N43 B;  4TUY A;  2VOB A;  4DV2 H;  4LF6 B;  1TUB B;  1N34 H;  2UUB B;  3MWM A;  4B08 A;  1O9H A;  1N32 B;  1SA0 A;  1FJG B;  1HW7 A;  4X64 B;  2XHB A;  3HKC A;  4FLU A;  3MAQ A;  4O4L A;  1Q5O A;  3H20 A;  3TY8 A;  4A2B A;  4WBN A;  5LXT B;  3GDE A;  4RB3 C;  2WYO A;  2ZJT A;  5EIB C;  4JI0 B;  3QF7 A;  3UQ8 A;  4FVM A;  2PZS A;  4PI2 A;  2KSW A;  1FKA H;  1QHT A;  4EQ5 A;  1TUB A;  3BPZ A;  4DV4 H;  4L8J A;  1E4F T;  2YI9 A;  1FVI A;  2VQF H;  5FD5 A;  3RYC B;  2W57 A;  2F95 B;  4EB6 B;  5BMV B;  4ZIB A;  4GKJ B;  4DV5 H;  3K59 A;  4JI7 B;  1X9N A;  3QWU A;  1XNQ H;  3NBZ B;  3RGX A;  3J81 W;  5LXT A;  2QJ1 A;  3ICX A;  1IBM H;  4AQY H;  1CKO A;  5LMN H;  4KL1 A;  3KAJ A;  4CS3 A;  5GON B;  1M93 A;  3SJA C;  1VF7 A;  3RFR A;  4YJ3 B;  4B3S B;  4DR2 B;  4UCU A;  4J0M A;  3RIZ A;  3T1H H;  1M0W A;  5J2U B;  3EYY A;  5LP6 C;  4LF9 H;  3M7M X;  2UUA H;  3RYC A;  4LF8 H;  4EB6 A;  5BMV A;  4LF4 B;  3JAT B;  3RGZ A;  3SJB C;  3N6X A;  1DGS A;  3GB8 B;  3KAK A;  3BRC A;  5IWA H;  2HVR A;  4LF5 B;  3FMA A;  1L2Z A;  2UXC H;  5GON A;  5CA1 B;  1WN7 A;  2OWO A;  4YJ3 A;  2VWK A;  1HNW B;  4LF7 H;  3WB0 A;  3JAW B;  2F93 B;  5ITZ B;  2ZNI A;  4E6N A;  5J2U A;  1XHZ A;  4DR3 H;  1QQC A;  4B3M H;  4B3R H;  5LP6 B;  1J5E B;  4JI8 B;  4X1I B;  4DK0 A;  4DV6 H;  3JAR B;  1IBK B;  4TQF A;  3K5O A;  2HEP A;  3JAT A;  2HIX A;  1HNZ H;  4X66 B;  1O9G A;  4CC6 A;  1BJT A;  2VQE H;  4ZOL B;  1D5A A;  1YEW A;  4OX9 B;  5CA1 A;  4HBN A;  3W1B A;  2O03 A;  3KAL A;  4LFA H;  4Q6G A;  5KHK A;  5LOV A;  4RB0 A;  4JI3 H;  4LFC H;  3TY5 A;  1XMQ H;  4X65 B;  3JAW A;  5ITZ A;  1N36 B;  2ZM6 B;  2ZCE A;  4X20 B;  3ZS8 C;  5LP6 A;  1Q8I A;  4X1I A;  3JAR A;  1P16 A;  4LFB B;  2VWJ A;  1CKN B;  2QM4 A;  4NXN B;  2RGV A;  4ZOL A;  2UU9 H;  3U0Z A;  1XQ8 A;  4IAJ A;  4UCR A;  4BWS C;  2BTO A;  2UXD H;  4DV1 B;  5CA0 B;  5D1O B;  3T1Y B;  1V9P A;  4X20 A;  3VQW A;  4DUZ B;  4DV3 B;  2HVS A;  4F6R B;  4JI4 B;  1BGW A;  5D5Q A;  4I50 B;  1XNR B;  3JAS B;  4FLY A;  5LMU B;  5LYJ A;  5FLX W;  1TVK B;  3S24 A;  5FPR A;  5KX5 B;  1CKN A;  3U11 A;  4DV0 B;  2F1M A;  3HKB B;  5JVD B;  2CW7 A;  4O2A B;  3JSN A;  3KXY T;  4NXM H;  5CA0 A;  4BWA A;  5D1O A;  4EFE A;  5EZY B;  1XI1 A;  1KMI Z;  4F6R A;  4DR5 H;  2E5L B;  4DRX B;  2PYJ A;  4I50 A;  3JAM W;  3JAS A;  2Q7H A;  4JI1 H;  1TVK A;  4YY3 B;  4DR7 B;  3JSL A;  2GV9 A;  5KX5 A;  4ZHQ B;  3WB2 A;  3HKB A;  2EX3 A;  4CH4 A;  2HIV A;  4IIJ B;  2Q7E A;  4O2A A;  5IJ0 B;  3RJ0 A;  4X62 H;  4DR1 H;  1Z2O X;  2UUC B;  4DR6 H;  5EZY A;  5EIB D;  2P5O A;  4DRX A;  3HKE B;  4JI6 B;  5LA6 B;  4GKK H;  4YJ2 B;  4I4T B;  4K0K H;  4JYA B;  4LSX A;  2F4V H;  4ZHQ A;  1XMO B;  4ZI7 B;  2F66 C;  3OTO B;  4RAZ A;  1SEI A;  3E22 B;  4IIJ A;  5FPO A;  1O75 A;  5IJ0 A;  3N40 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...