3PN1A

Novel bacterial nad+-dependent dna ligase inhibitors with broad spectrum potency and antibacterial efficacy in vivo
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Bacterial NAD+-Dependent DNA Ligase Inhibitors with Broad-Spectrum Activity and Antibacterial Efficacy In Vivo.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase/ligase inhibitor
molecule keywords DNA ligase
total genus 110
structure length 318
sequence length 318
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2010-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3pn1A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3pn1A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3pn1A02
4DV4B 4LF4B 3UQ8A 4JI3B 1HR0B 3RR5A 1HNXB 3VNNA 3GJXB 2Q2UA 4DV0B 4LF5B 4CC5A 1S68A 1A0IA 4NXMB 1N36B 4UCVA 4JI8B 3JSNA 1IBLB 4LFAB 1B04A 3BA9A 3T1YB 2HVQA 4UCSA 2ZM6B 2OWOA 2HIXA 1TAEA 4DR7B 2UXBB 3NBZB 3TY8A 1P8LA 1HNWB 3NC0B 4E6NA 2UUCB 5IWAB 1FVIA 3W1GA 3NBYB 4EQ5A 4PZ8A 4B3SB 1XMQB 4LH7A 1J5EB 4DUZB 4JI7B 4B3RB 4YY3B 4UCTA 5D1PA 4LF9B 4EEQA 4DV3B 4K0KB 4NXNB 2VUGA 4JV5B 3W5OA 3S24A 2UU9B 3QWUA 1HNZB 4LF8B 3TY9A 4JI0B 3GDEA 2HVRA 4JI6B 1ZAUA 4DV5B 2VQFB 1X9NA 4DR1B 3PN1A 3BAAA 4YHHB 3T1HB 5LMNB 1N34B 1VS0A 3L2PA 1XK5A 2E5LB 4PZ7A 3W1BA 4DUYB 4AQYB 2UXCB 1XDNA 5D1OA 1CKMA 4GKJB 3BA8A 3SGIA 4EFEA 1IBKB 4DR4B 1CKOA 5LMUB 4DR6B 5D1OB 1CKNA 4DR3B 3KYHC 4CC6A 2UUAB 1CKNB 2HIVA 2HHHB 1XMOB 2VQEB 4DV2B 1XNRB 4LF6B 4X64B 1N32B 5FPOA 4EFBA 4UCOA 4DV6B 4KHPB 2Q2TA 2UXDB 4LFCB 5DISC 4X62B 1FJGB 4UCRA 4UCUA 1IBMB 4DV1B 4TOIA 4JYAB 1XNQB 4JI2B 3TY5A 5BR8B 4GKKB 4B3TB 3OTOB 4LH6A 5FPRA 2CFMA 3BABA 4LF7B 1V9PA 4OX9B 4JI5B 1I94B 1TA8A 2F4VB 1P16A 4DR2B 4LFBB 4X66B 3JSLA 2UUBB 1DGSA 4X65B 4DRFA 4B3MB 4JI1B 4UFZA 4GLXA 4DV7B 3RTXA 2HVSA 3GB8B 4PZ6A 4DR5B 1N33B 4JI4B
chains in the Genus database with same CATH superfamily
3V6HA 2BTQB 4LF4H 3JATB 1O75A 4J9RA 3ZRXA 5KMGA 1AI7A 4DV0B 1T5EA 3EHBB 2LGQA 3RT3C 4OX9O 2EJ7A 2F93B 1ROPA 2JS3A 4WCEV 4DV3H 4K0KH 3N42B 4C5BA 1YJNV 4LFAB 2YEVA 3N27A 2YCHA 3RJ0A 4HNAA 3CCUV 3AEIA 2NVYA 2OCCC 1I2KA 3SYOA 4DL5A 4UUGA 4QIWA 1CS0A 1AUXA 1ZHSA 1JFFA 2Y4TA 4ED1A 1IBLO 2WB1A 4AYBE 3T1YH 1SQGA 3THOA 3MJFA 1VKZA 3ML0A 2ZR2A 3K57A 1RM1C 4RNMA 1M5IA 2FB9A 1UC9A 3AX6A 4JI7B 3M9NB 1WCMA 3RB4A 3Q8RB 1N56A 2AZ0A 4GX0A 4DR7O 2EJRA 2E74B 2K1EA 4H37A 1N32O 4ZIBA 4ZKIA 1CQJB 4I50B 1ORQC 3BG5A 4ZOLA 1YZBA 2QM7A 2QEXV 5LOVB 3H1JH 1X9NA 3FYIB 4MV3A 3FD9A 2W6QA 4JI7O 2HVJC 5FNVF 5JQGF 4DR1H 2A7WA 4J42A 2R7ZA 2QJ1A 3OHAA 5KFJA 5LMNB 3BQ1A 4FBTA 2ZE6A 2X0SA 2D3OW 3VBBA 4O7RA 1SZXA 3FAVB 3IAYA 4FM9A 1THZA 3ZMUA 4FFLA 3CVZA 3T4DA 1KKCA 3V6JA 4EFEA 5B66Z 3CD6V 1DK1A 2COGA 5F9LA 3MDSA 4MAMA 1BCCH 1SQFA 2N04A 2DLNA 5I5YA 4O84A 3OR6C 3OMAB 4B3MO 2Z0AA 4ETSA 2JDIG 3RF2A 1XMOB 5H6QA 1Y74B 4DV2B 3QO5A 5J2TF 3K5HA 5DN6G 3PW7A 5DLFA 4TWKA 4JV0A 4IYIA 1QR9A 1WPBA 1QQCA 2NNUA 5DECA 1Q82W 2CW8A 2FTKA 5LA6B 1T36A 4EBEA 1S77D 3KKYA 4D7TA 4YJ3F 4DUZO 1XHXA 3G8DA 5EDWA 5BMVA 2W6PA 3MWEA 5L1IA 2E2IA 5KT4A 4CS3A 1YDXA 3E2EA 2WLIB 1I94B 2W9BA 2W9AA 2F4VB 2Q8VA 3JSLA 5LYJB 3FFQA 5LL6Y 2W70A 5DG7A 5CAEB 3JAWA 2DW4A 2EIJB 3CP1A 3ETJA 3M8AA 2Y69C 2XOKG 1N0NA 4CC5A 3M4IA 3JALA 3MHHC 2NUAB 4B3SO 1N36H 2R70A 1D5NA 1N33H 2FE3A 3CJHA 4JAUA 2WLLB 3T1YB 2IP4A 2ZM6B 2PVPA 4CH3A 4LNUB 2IU3A 3HOVG 4NTYA 3TY8A 5BR8O 1BHBA 1HNWB 4J9SA 2ZCEA 1I1LA 2JEIA 1FXKA 1C30A 4YXWG 1VEWA 4JZ2A 4I55F 1I6UA 4QWDA 1WH2A 1TVKB 3ZX6A 5L3GA 2AGQA 4K8ZA 4YY3O 3VOUA 3L72H 5KHKA 3MWMA 5BWTA 4U7OA 5LYJA 1XMQO 1FAFA 1H8HG 5DG9A 4DV3B 4K0KB 2JA8G 1DF5A 2DWEC 1ULZA 3S3XA 4JI0B 5KG2A 1P7GA 1Q6UA 4EGJA 4I50A 5GONF 5D5QA 2ATLA 2R87A 5FNVB 2VA2A 1SRYA 3KZIZ 3HOWG 2GPWA 3ABLB 2V59A 5L9XA 5KFNA 2RCVA 4RAYA 2E5LH 1P84F 3CMEV 2ZD9A 3OFNG 2DYRC 3CRRA 1UJWB 3K9AA 1QNMA 4FPPA 1KJ8A 5CB4F 5LMUB 1N33O 5ITZB 3T9AA 5FLMG 4JI4H 3KYHC 4NTXA 1K92A 4I0XB 1V4YA 1IYEA 1XUQA 5C1PA 1US6A 2DQ3A 5EYPA 1RM1B 2VQEB 3TIGA 3KHRA 5CBGA 4OXSA 2XHBA 1SQXH 2J6UA 4EFBA 5KFPA 3TIIA 2ZGIA 3SJQC 3GTMA 4FIPC 1FJGB 4MV9A 3UCSC 4WBNA 5L3BA 4NXMH 4FS2A 1J95A 5JH7B 3DGEA 1B33N 1T94A 1Y4MA 4JI3O 4FBUA 2FL4A 2Q5ZA 1JJOA 5FPRA 4MV6A 4W4KA 2JA6A 3LP8A 4LF7B 2P06A 3HKCA 4J41A 4JI5B 3UO2A 1P16A 2XT9A 2IJKA 3QZ8A 1Y1WA 5DM6V 1L2ZA 3FYEB 1SYXB 4RB3C 3IC9A 3VQXA 2V1DA 4YQWA 3K59A 2W0FC 4GX5A 4DR6O 3QTCA 5H9CA 5B1AC 4OPAA 1HNXB 2HHHH 2EIYA 4A3KG 2Q7HA 1YTFD 3NXSA 5DGAA 4QSHA 3ZHUA 2KSDA 2E5LO 1AB3A 4PHZA 3F8NA 1D5AA 2W6IG 1F4NA 2ALZA 2ZXWB 3JSNA 2C28A 3GIPA 2JEUA 4H0LB 4D7SA 4MW3A 1KBLA 1KT8A 5DQGA 3P32A 1I94H 3B77A 4GKKO 5BWUA 2WLKA 3BVOA 4A3IG 4I7ZB 2R7KA 2UVWA 2JA6G 2WAQA 5KAFZ 1HR0O 1I08A 4ZQIA 1TWFA 1OJHA 3UM7A 4U3FH 4TUYF 1J5EH 4EBCA 3ZMVA 1XMQB 4ECSA 5IJ9B 1J5EB 1RK6A 4FVMA 4MVMA 2ZE5A 5I5WA 5C5JA 2GQSA 4M7EA 4UCTA 5IYZA 2QE7G 3OMIB 4CHIA 3VA7A 4IRDA 2OCCB 3ZS8C 1MSWD 1PKXA 4JV5B 3TY9A 1DF4A 3H1KH 3G6EV 4DL3A 2Q0AA 1QR8A 2PTMA 2DOSA 3RGZA 1RJRA 2M05A 4CZZA 1R73A 3HOUG 1URFA 3K79A 3AG3C 1W2BU 3PW2A 4QWEA 4JI0H 2A3QA 2JJ1G 3GV5B 2R93G 2LFSA 1N34B 1TGOA 4JYYA 2YZMA 1VQ4V 3UKMA 3JAWB 3PW4A 3AYHB 3SPCA 4IGGA 2WYOA 3A8TA 3GTQA 1U96A 4TQRA 2P4VA 1NU1H 5D1OB 1L1FA 4EEYA 1HNZH 5B1BB 2R7NA 3CSWA 1NTZH 2KQXA 5KHIA 4LFCO 3PFFA 4IHJF 3V6KA 2HJDA 3TW6A 1M56C 5IJ0A 3RYCB 3T7AA 2UUAO 5IYZB 2VQDA 3DAAA 1XEQA 3RGBA 3H1LH 5EIBC 4X20B 4U7CA 4O7TA 4JUZA 4X66H 4LF6H 4C2MA 4WBNB 1AJQA 5LHIA 1IBKO 2CW7A 5I5SA 1LUWA 1CPYA 3NGDA 4ECXA 2UUBO 1RP3B 4GC6A 3EYYA 4QIWF 2V4QA 1W96A 3GIIA 4I9QA 5BMVB 2XUMA 1OBDA 1W93A 3JASB 4FM2A 4NVPA 3HOZG 1AVMA 2DQ0A 1CEZA 2Q68A 2UUCH 3TQ1A 1FXVA 2C35B 1NKDA 1AI5A 3FAVA 3N2GB 4O2BA 5JWPA 4I4TF 4HNUA 3GVMA 3D36C 3RBEA 3OW2U 4LP8A 1HR0B 5I5VA 3AG4C 1W0KG 1P4RA 4JV1A 2VUMA 2QM4A 4NXMB 4CH6A 3ZHTA 2GQRA 1VF5B 2IM9A 2RGVA 4JI8H 4UCVA 3IG0A 5KT3A 4RB0A 4J7JA 3RBDA 2G38A 3BA9A 1E4GT 3KHGA 4P2ZA 5JCOC 4IWXA 4PA7A 5JQGA 4PJ0Z 4J9LA 4HNAB 5KFXA 3U10A 3M99B 3OUSA 4EYIB 3E22B 5EC2C 4DV6O 2ZNJA 1NH2B 5KFKA 1M57B 1VQNV 1FXKC 3OTFA 4J9YB 5KFSA 3IN5A 3Q2OA 2RMKB 1G6UA 1JVMA 2GDSA 4AQYO 3GTJA 3AG1B 2VR1A 3T5KA 5D8DA 2BCCH 1VQPV 4GKJO 5CA1A 4Q43A 2V5AA 2YIAA 2Y0IA 4MV7A 2BR0A 2VUGA 3DF7A 1O9HA 5DGHA 4E2LA 2UU9B 4KHPH 3GIJA 1WCMG 4ASUG 4LF7O 3T1HH 5KFTA 5FR9A 2EULA 3NR7A 3TW7A 4Q6GA 4Y8VB 3FKIA 4AHCA 4DK1A 2W9CB 3JD4A 2FPIB 4Q0YA 3KTMA 2NU9B 1R3IC 1IOVA 4FLVA 2COIA 3KALA 4DUYB 2DWDC 2Y0PA 1IOWA 4AQYB 4F50A 3N6RA 4TUYA 3CC7V 2Q7DA 2N74A 2A1HA 1S03G 2BQ3A 3OTOO 3GQCA 4J7KA 4DR3B 1F7YA 4DR3H 2CKZB 3PVXA 1OCCB 3ZN1A 3V4SA 1XHZA 3HPLC 4DW1A 5CA0B 2V4RA 2RN9A 2CNQA 2HGXA 1G4YB 4DV6H 1H2LA 4KUMA 2DZDA 4XZ3B 3MFHA 2PF4E 4O4JA 4UCUA 1EN5A 2L35A 2EIKC 5KG0A 2HGSA 2E2HA 4DK0A 1JOYA 2EJ0A 2DMXA 3LMLA 2W8KA 2RDIA 3JARB 3JD3A 5EZYA 2AGAA 1CE8A 4MVOA 2GV9A 3WWJA 5LA6F 4J80A 3TINA 4LFBB 5JCOA 4X66B 1BQZA 1PNKA 2Y4RA 1NI8A 4QIWE 2HHHO 2QR4A 4JI1B 4EYHB 1AI6A 1AROP 2ATKC 3TXQA 1Z2GA 1FFXA 1Q81W 3IC7A 2DAAA 1DV2A 2AHYA 3GV7B 1EKFA 3ZEDA 4O2AA 1MG1A 3GJXB 5CA0F 4JTCB 1AN7A 5KFRA 3CS5A 3CJHB 3LSUA 1PD3A 4QW9A 3OEHG 1WNSA 3N2KA 1M56B 1HWYA 2KB1A 1I50A 4FFMA 3DXRB 4RWUA 1XILA 3UFXB 4UVAA 1FXKB 3ETQA 1S72V 1EZJA 1XL4A 3K03A 1YJ9V 2QGNA 1B06A 5L3EA 4LF9H 1T3NA 4MSWC 3SPGA 3I4NG 3FKIG 1SC5B 1K1QA 4LH7A 5D5PA 2OIGA 1JCHA 4PA4A 4ECVA 2WLIA 1B6QA 4BAYA 5D1PA 4BIZA 2CAZC 4A3LG 3GTLA 4MTEA 2ZKOA 4BWAA 4HNTA 1GK9A 2YZGA 3GTGA 2LW1A 1ZL8A 2WSSG 1TUBB 2JGDB 1Y6XA 2UVRA 1Q5OA 3JD1A 4LF4O 5KFLA 4YHHB 1ZQ7A 5A2QW 1KTAA 3T1HB 1VARA 5J2UB 4EB6A 1XMOO 1SQVH 1R6TA 3E83A 1JA8A 2Y4UA 1UNNC 1WR2A 4JYCA 3UO3A 1SZTA 3VPCA 1KJ9A 3T99A 3HBLA 1XMQH 1H2KA 2YXHA 1PNMA 4TV9B 3WG7B 4CS4A 1QCEA 3T1HO 1XNRB 2ADPA 2FPGB 5J9PC 1M4UA 1R6KA 4LNUA 4FMTA 4DXWA 3RYIB 1PL0A 4M0JA 2Q2TA 5KFIA 3WO0A 3B4SA 2QSAA 4LCUC 2CK3G 4TQDA 3RYIA 1V55C 5LHGA 3WNZA 4JYAB 3JZFA 1BGYH 1EBOA 4B3TO 1KP2A 3OD4A 3T9FA 4ZOLB 1N32H 5LA6A 4JI1H 5DQHA 3GIMA 4FFOA 4DR5H 1QBZA 4ZHQF 2CTWA 2V9WA 1JX4A 2I8CA 4IL6Z 3T1CA 1MABG 1RFYA 2XD4A 4DRFA 1TWAA 3T1YO 3DC6A 1K73W 2YW2A 4JI5O 1R1BA 4EB6B 5J2UA 2DYSB 2PBZA 2R8KA 1Q43A 3RWRD 2F43G 1N36O 4O2AB 4YJ3A 1KECA 4A3GG 4JI3B 2B1GA 3ZMTA 1R3LC 3CYOA 1SQPH 2JGUA 4A3DG 4RUCA 5IE9A 4UVBA 4JXUA 2A79B 1IBLB 2HJFC 4LFAO 2YL2A 4FFBB 2PYJA 1TAEA 3L70H 2UXBB 3TEKA 1SEIA 2H94A 4WFEA 4IAJA 4JI7H 3N8DA 4E6NA 1I1KA 5LXTB 2EIMC 4O7YA 4DV0O 3EPGA 2IA6A 2MW2B 4R50A 1Z5VA 4ZI7F 4GKJH 2V58A 4ZI7B 3PJSK 4TV9A 2X5RA 1H38A 3A0BZ 5C44G 1Y14B 4CMDA 4ED8A 2R84A 3OT7A 4DUZH 1TWHA 2YU9A 4JAVA 4WFHA 5KFMA 3HOYG 3AW8A 4XDKA 3ZHRA 4DUYO 5KFBA 5K1PA 4EEQA 4FM1A 1BNCA 5KFFA 3GTOA 1COWG 3WO1A 2JA7A 5B3SB 2LQTA 3BJYA 1VF7A 1ZAUA 4IT5A 2JRIA 3PN1A 5H6RA 2QWQB 4NR1A 1K9MW 3JZIA 3EVKA 4A3JG 4LF7H 4YHHO 1SESA 3RYFB 1A3GA 3L2PA 2KKWA 1EN4A 4UV8A 4WFBV 4DRXA 1K4DC 2YZNA 5KFHA 1OZ0A 5IT9W 4MV4A 1KD1W 3BACA 5KLVH 4APMA 1LNQA 4J9MA 3SI8A 3B8MA 1AP6A 1N4CA 2ASLA 3APOA 4E4EA 4ED6A 4PDLA 2W0XA 4ABMA 4ZOLF 5DG8A 4A3CG 3L75H 5C1OA 4GX1A 5BPFA 4X64O 3PR4A 3SJCC 1XI1A 3RYHB 3G6XA 1HR0H 4Q8FA 3RV3A 2Q73A 1PX2A 1Y1WG 2EINB 1RJPA 2W71A 2PUSA 4DR4O 3E5NA 2EJ3A 4JF3A 1VF6C 2R7LA 2QWOB 1TVKA 2COJA 2ZM6H 2ZE7A 4YP3A 1PM9A 3EXAA 1FD9A 3VPDA 4Z2WA 3PO2G 1K3EA 1RPRA 2HFEC 2YDEA 1FJGO 3G8CA 4UFZA 1KUQA 4DV7B 2Z04A 2RQ6A 1SFOA 2F4VH 3I56V 2YXLA 1MMMA 4FFRA 5GW7A 4FGRA 1JPXA 4I4TA 4B3TH 5L1KA 3R9RA 4N21A 1K7DA 4IHJA 3J80N 2CGOA 3JRWA 4O4LF 4QWBA 2EIMB 3ABKC 5GTHZ 2WLJA 4O4JB 2YICA 2VUMG 2YS6A 5B1OA 1IX9A 4D6TH 2IH3C 4RB1A 3MFIA 3CRAA 1XNRO 4XBFA 1S5LZ 3G67A 4O86A 4A3BG 3JAKB 4IRKA 3L4JA 4J9PA 4MVUA 4JI3H 2YZLA 1DV1A 1HDJA 4F6RB 5C93A 4BXXG 1SETA 1PV0A 4GZRB 2F1MA 5F2VO 4O4LA 3E89A 2VPQA 2C00A 1ZWIC 2GTSA 2ZT9B 4RQEA 1VBHA 2YS8A 5CM0A 1ZUQA 4IR9A 2UXBH 3CRMA 1EKVA 3KAKA 5H80A 3K04A 4EG0A 1S10A 3OM3B 3VQWA 3RB0A 2ZR3A 1L8DA 5DQIA 1NS1A 3FMAA 4NB5A 4UUJC 3DTGA 4ICGA 4DRXB 3TETA 4O7ZA 4CBCA 4Q4CA 1R3KC 4YJ3B 2W6JG 2NU8B 1CKMA 2OCHA 3ZRVA 1WN7A 4DR4B 4ED0A 4RCNA 1H2GA 4YR0A 2IBKA 3WWIA 2F66C 5KS8A 4HAMA 1Q7YW 3ABMB 3FB6C 1XMOH 3ETHA 3V4ZA 4O4IF 2JA5G 5KX5A 4TQFA 1B6RA 3TXSA 2ILMA 3ABUA 4X20A 5LL6b 4DR3O 2CH7A 5JUMA 5IYDG 3CCLV 4G3IA 4DV1B 5KUKA 4DV5O 4Z1MG 2ZDIA 3CE2A 4DO2A 4R8UA 2EILB 3SYAA 4DYLA 4GC7A 1I7LA 3A0HZ 3Q1KA 4DV7H 1KMIZ 2WWWA 3RUPA 1V9PA 2XC9A 3OSNA 3JD2A 4YAJB 4DR2H 4DR2B 5AG2A 1K97A 5IY5C 1GGOA 2FPPB 1IVSA 5EBMC 3BY6A 2UXBO 2R9RB 4O2BB 4B3MH 4WD3A 2AHZA 2IW5A 3CPWU 1DIKA 5KFWA 3L74H 1XQ8A 2D2CB 3CCVV 3R5XA 1FFXB 1OCOC 3DC5A 1D2DA 3HO8A 3AG2B 3LULA 4L1KA 2Q2UA 1MZBA 3BQ0A 1OCZB 4LF5B 4U7NA 4YAKB 3ICXA 1F51A 2B63G 4JI2O 1QU7A 1P49A 4RNOA 1QLEB 4WFFA 2R93A 2CNVA 1Q90D 2Q9LA 2E3CA 2HIXA 5JVDB 3RAXA 2KSWA 2FLLA 4EBDA 2HLDG 2AU0A 3T5JA 5IYCG 4CE5A 4GLWA 2WLMA 2EINC 3E86A 3E35A 4FFNA 3RN4A 3ORRA 4GCZA 4F6RA 5DEDA 2NN4A 4QGPA 3JD0A 2FK2A 2SCUB 2QWPB 1GMGA 3TQTA 1YXBA 4JYAO 2ZM6O 1YCIA 3OUFA 4TSFG 3DTUB 4HYOA 4HNVA 4LF8B 1ZL8B 4NXNO 3RV4A 1KC7A 4JI6H 4LFCH 1EHIA 4RAIA 2OLSA 1VQ8V 3U9SA 1YJWV 4FLXA 1BSMA 3GTKA 1SF9A 4YIPA 4FLZA 4A3FG 2QA4V 4B7KA 3D3IA 2UXDH 4O7WA 1JR9A 1LR1A 1E4FT 2JEXA 2QWRB 2P0AA 1VS0A 1RSOB 2UVVA 1M1KW 1XK5A 3W1BA 4IZOA 4XDJA 5A9GA 2UXCB 2UUBH 4BBSG 1E4EB 2W6ZA 2I80A 3FB8C 5B3SC 3CC4V 1NH2D 1Y1VG 3M7MX 4ED2A 3RGXA 4GKJB 3RIZA 3SGIA 4MVZA 3UZBA 1Q8IA 3X2QB 3OE7G 3AK3A 3RVZA 4IRCA 1TWGA 1I7NA 2E76B 2W6MA 2C2DA 4PD4F 2UUAB 3ZRWA 3TJTA 3TCUA 2WPDG 1S0MA 3K06A 1MNGA 3FB5C 2C2AA 5EIBD 1MOFA 5FPOA 1IXBA 1QLNA 4MVQA 4UCOA 4FZ0A 2YWVA 4A93G 1JQ0A 2OTLV 5J2TA 3L73H 2XIGA 4FK5C 5JJJB 4X1KA 2A0LA 1Y76A 3OGCC 4J9OA 4GKKB 3TK1A 3PZPA 5DLGA 4QNHB 3UT5A 5KFUA 2Q69A 3JASA 2PY5A 4F6EA 2VPSA 3C3TA 4IIJB 1DGSA 4X65B 3J7AK 5KFZA 2HVKC 2EZPA 2AXTZ 2I87A 1HNXO 4IWYA 2HVSA 1G8MA 2R8GA 2ADQB 2YXYA 2BTOA 4P9OA 3VNNA 1WB7A 2X6AA 1M0TA 2VQEH 3Q8QB 3IJ4A 4J11A 5FL7G 4BIUA 1AJNA 2LFRA 3AG4B 4BIOA 2HHFA 3NUAA 3MHSC 4K35A 2IJHA 2OWOA 4DR7B 1SA0B 4XYLB 4JI2H 1VQ9V 1YTFB 4FLWA 1I1MA 2VOBA 3NC0B 2YI8A 2B5UA 2YS7A 2HGWA 4O3SA 5CE8A 3R66A 3IFXA 5EYPB 1EFRG 2CNUA 1I2LA 4CH5A 4B3RB 2NVXA 4G2KA 3D8CA 1GN4A 4LF5H 1NTMH 4XYMB 4K3AA 4DR2O 3R5HA 2W7OA 1KB9F 3N2GA 1EYZA 1JDEA 2FK1A 2CUGA 4MW8A 4FU0A 3JATA 4DIMA 2X7RB 5JJNB 3U9TA 3HKCB 1OCOB 3CRCA 2DABA 5IP9G 3U0ZA 1OCZC 5B1BC 1VP7A 2GTAA 1N0JA 5KHHA 3T9EA 5I5UA 3GTPA 4O81A 4DV2O 5KG1A 1O9GA 1JLLB 3BQ2A 4LFBO 2FMAA 3CCJV 2WDTA 5H2FZ 2L6LA 2WAQE 4B08A 4Z1VA 1CQIB 2ZDQA 4RO2A 3LWBA 4X88A 5KAIZ 4QW8A 1SERA 3GILA 3O65A 3FKSG 4BWSC 1M7JA 4LFBH 2C2EA 1K8AW 3OR7C 1NBMG 3LDDA 4A3MG 1H2NA 1JJ2U 2YC0A 2HIVA 4PI0A 3RYCA 4I0XA 1A0GA 2Y48A 4ZI7A 1GN3A 1KJQA 1FYJA 4GKKH 3GIQA 1EUCB 4O4IB 1CP9A 1UFIA 2UXDB 3F7YC 3HKZE 1YI2V 4UCRA 4JASA 4CKEA 3HKEA 1KBHA 5LGTA 4QE7A 3R23A 5LP6F 3CWBH 4O3QA 2QTSA 2J6TA 4B3TB 4PBCA 2ITDC 5JJEB 1FS0G 3ABMC 3CB2A 4L8JA 4PA3A 2PI5A 4BW5A 1KUTA 3U55A 3T5HA 4PWQA 4GLXA 1Y66A 3SE7A 2XGPA 5BYAA 3W7TA 5IYDO 1BT8A 4PZ8A 2W6OA 2JA5A 2OIEA 3H4DA 3ETEA 2BTQA 1G1XB 2E75B 5LHHA 3W7WA 1WP8A 3KG2A 2ABJA 1TWCA 4O7VA 1GLVA 4I7HA 4JI8B 3AG1C 5IY5B 2N05A 4LF9O 1ZHQA 2ZNIA 3D3QA 2PYLA 2PGGA 3JAMW 2X0LA 4H33A 1HNZO 2FLPA 3EPIA 1S0NA 5KT2A 5CB4B 5A2QN 5GONA 4I50F 4Q44A 3WG7C 4LMYA 2P90A 5IYCO 1QLEC 4LR3A 2DIKA 3FX7A 2JS5A 5CN0A 3QO7A 1I5YA 1FKAO 1S5HC 3SPJA 2ZJTA 4B3SH 1GTOA 1WB8A 5BY1A 4KFMA 1QVFU 1PK8A 2Q0OC 4FFKA 4DL2A 4ED7A 2ZDGA 4TV8A 2UU9O 3J80W 3JCZA 2F23A 2IBZH 3BAAA 4KHPO 4O7SA 1S97A 2ZINA 5L1LA 1XDCA 2Z02A 5B1NA 4DL4A 3ETGA 2VS0A 2DYSC 4ECQA 3KREA 5HNEA 4G27B 5JVDA 4AQYH 2LP7A 2ZQMA 5CBHA 2XGQA 2W8LA 5FD6A 2CTQA 1N34O 3MR6A 3B40A 2IJJA 4O3NA 3S3WA 2IJIA 4I4TB 1SCUB 2RDCA 3BPZA 3U54A 3RW0A 4NYKA 1Y1VA 3HKBA 4MA5A 5KA6A 2GSMB 2HHFB 2RDJA 3W7SA 5BR8H 3T9DA 4WFAV 4JV5O 1P7BA 3RFRA 3ZCCA 4KHPB 3I5DA 3A2FA 1S0OA 2UU9H 4LFCB 2HP8A 1F23A 3ETDA 1IBMB 3O9OA 4YBZB 3QZ7A 5J2TB 3LNNA 1XNQB 4NZMA 4I5SA 4MTFA 5K1XA 2RGRA 2JK5C 4AI8A 1Z2OX 3I12A 5KFVA 3W7UA 1KEEA 4TV8B 4U6PA 4X9QA 1IZ3A 2ZXWC 3GLKA 3B2EE 3ASNB 3RVYA 4PDBA 5BXZA 1KYOF 3RBZA 4QJFB 4PZ6A 3SYQA 4DV1O 3LUTB 4JI4B 2P22C 1E4EA 5BWXA 4RQFA 4NZOA 4LF4B 4RZRA 3K08A 3BEHA 5CA1F 3HXLA 1Y67A 3HKZA 4RNNA 1MSDA 2FYUH 1L0NH 5KMGB 4WFGA 4CKBA 4A5UB 2FMLA 3HKBB 2WA3A 3LSSA 4BR6A 3OAAG 1WPXA 2RJZA 2XNDG 1GAXA 3OUUA 1VQLV 3ZIAG 4KXRA 3P3NA 1S76D 3CHXA 2YYAA 1YITV 3ZHVA 1J5EO 3NBZB 2B63A 4O83A 1P8LA 4XDLA 3H40A 3K3WA 4J9QA 4LSXA 1K5QA 1Y76B 1S3JA 4J9ZB 1DTOA 4X62O 4R7RA 3JYCA 1AILA 2LW7A 4B3SB 5C8YF 5J2UF 2XAHA 5BYBA 3K0DA 4JI6O 1K1SA 4IIJA 2H8PC 3ABTA 5KT6A 3RB6A 3RB3A 4F4ZA 1AP5A 2FLNA 4F4WA 3K58A 4O4JF 2VQFO 3APQA 4DR1B 4C5CA 3TGUH 1NQTA 1PNLA 2AQ4A 2ARHA 2HEPA 2B1IA 4ZHQB 2BQUA 2W57A 4LBEC 4O4HA 4MTGA 4O3OA 1XDNA 3T5LA 1AI4A 1V55B 2B9ZA 3PR5B 5IT9N 3G71V 2DWCA 3J81W 3PO3G 3SJBC 3BRCA 1FKAH 2QB5A 1VMGA 1W59A 3CEBA 1U97A 3OHBA 2F95B 3KXYT 4YR3A 2Z3YA 3A0RA 2WLLA 4PDRA 5CA0A 5B5EZ 1JIHA 5KHGA 3MAQA 2RNBA 1V54B 3C0FB 3HKEB 3VPBA 5DISC 1VBGA 4TV8F 3CXCU 3BCCH 4O7NA 5GTIZ 2Q7GA 1JFFB 2DN9A 1VQ6V 3VOTA 4E4TA 4HQ6A 3TY5A 4ECTA 3STLC 3CRQA 4F4XA 5I5XA 1ZX3A 3F7VC 5JH7F 1R9TA 1AR5A 4CKCA 3K3PA 4A2AA 4R7CA 4GYCB 4OX9B 1E79G 1N34H 2CZGA 1MZEA 4FJCC 1GKFA 5HFLA 5LGNA 4IIJF 5T14A 4TVIA 5C4XG 3KAJA 4DR5O 5FD5A 1GSAA 2YI9A 5IWAO 3K5LA 4A3EG 5IDJA 4HZ3A 4JZGA 1IBMH 3P30A 2EJ2A 2PZSA 1N36B 3K5OA 4FS1A 4PELA 3N2KB 3M9MB 3G4SV 4BBRG 3G80A 1KP3A 5CBFA 4YJ2F 1IBLH 4LSAA 2VQEO 4JV2A 1VQMV 2CTPA 2VRZA 2OTJV 1S5JA 1GSHA 4J0MA 3FB7C 4Q8EA 3HOXG 2WA4A 1KU9A 3AG2C 3HR0A 1FVIA 1I5XA 2CGNA 3NBYB 1HNWO 3D36A 3R65A 4DUZB 4X65O 5KX5B 2W6NA 2XAFA 3E8GA 5LOVF 4JI1O 3N40P 4UB6Z 2FP4B 3Q8PB 4B7EA 1DLBA 1GYFA 3J7AU 4ZBMA 1HNZB 1SKVA 2UXXA 3GDEA 3I55V 3R5FA 2FB5A 4BW9A 1WAZA 5KHJA 1A9XA 5L3FA 4R6ZA 2GLTA 2XAGA 2JGDA 3C90A 2HKOA 3RYFA 4DV4O 1NJIW 1OCRC 3K5MA 4DV1H 2DJVA 2E5LB 3KHHA 1M90W 4MV8A 2FKLA 1IBMO 3LSQA 2PMZA 3H3VH 5KA5A 4F4YA 3B09A 4U3JA 5LMNO 3SYCA 3ORQA 3UZOA 3BA8A 1SS3A 4F4LA 2WTFA 1VQOV 4DR6B 3SPIA 5I5TA 3PW0A 2HG8A 1OBGA 5IYBO 1N8RW 3AK1A 3T9BA 2DPJA 4K8XA 2QDOA 1V51A 1I3QA 5IYBG 1KJIA 3MR3A 3AK2A 3DXRA 4X62H 4DV7O 2DYRB 4X1KB 4RZQA 5F9NA 4QWAA 1YEWA 5JH7A 4RUEA 1PPJH 4DW0A 3ASOB 4JI2B 4TQSA 5EZYB 4LF5O 1WJZA 5H5NA 5EK0A 3BABA 3QF7A 2CFMA 2R85A 1OCCC 3HB3B 1S9FA 4BY1G 1JMKC 5KUMA 3UT5B 5KG7A 2XCLA 5BMVF 4UB8Z 4A2BA 5KG4A 2JEJA 3SDLA 2XTAA 4TV9F 3WWHA 3WFVA 3GV8B 1NVPD 4JPRA 5LMUO 1N33B 1BHAA 5FLXN 4Q45A 2KG7A 3RR5A 4ED3A 2UVUA 5L3CA 1WA8B 3STZC 5CR5A 4X66O 4ECYA 3CCQV 3Q4HA 3ZRWB 4TM5A 1AUVA 1B04A 2R92G 2HVQA 1HP8A 5KFGA 1XNQH 4U3JB 4JI8O 1K33A 1YVWA 1GSOA 3CSXA 5GONB 1ENVA 1NZ6A 1SA0A 2XASA 3KCXA 4MVSA 5E79Z 1NTKH 2ZIOA 1UPGA 4X1YB 4MA0A 4JI0O 3W1GA 1C3OA 4X1YA 2BOBC 4J7ZA 3ZHSA 4PI2A 4R8UB 3GIKA 5EC1C 5JVDF 1XNQO 4B3RO 1I0HA 3LNMB 5EOYA 2IH1C 3H4BA 4YY3B 2JIZG 1BJTA 5DMXA 4IR1A 3QQMA 4JAAA 2WB1E 3H0GG 4AYBA 5E1AC 1GM9A 4Q20A 5DAAA 3HT5A 4WHXA 4DR1O 2YIBD 1R3JC 5HBRB 4GX2A 2XAQA 2Q6AA 2QM8A 1RYRA 4DV5B 4RUAA 3OMNB 5I60A 2W9BB 5BPHA 5KG3A 1FFTB 5LBQA 1K34A 1B6SA 1ZLZA 1VIBA 3RFCA 3CCRV 2XAJA 5EWGA 4MS2A 4MTXA 1GO3F 3B8NA 4FLTA 4ME6A 1HW7A 4MV1A 2X6CA 1AR4A 5D1OA 4O2AF 4YJ2B 4X1IB 3QG5A 3OSPA 2R9AA 4X1IA 1E1QG 2FK3A 3AG3B 2EILC 1Y74A 1FJGH 4GUNA 3Q8SB 2YRWA 3WU2Z 1EZVH 4X64B 2VA3A 4IHJB 1IXMA 2F4VO 3WB2A 3G6BA 2WLHA 3CCSV 5E25A 5IJ0B 1RK5A 4J9NA 2R7ZG 4H13B 3P3PA 1Z5WA 2VWKA 1PL4A 3IGAC 5LXTA 2UXNA 5EZYF 1ZTEA 4DLKA 2EIJC 5BWVA 4X65H 3ZHQA 1H2SB 3LQSA 4FE2A 2GPSA 1IDSA 2A06H 2M6YA 1K83A 5LMNH 4DR6H 3SJAC 5KG6A 1GM7A 2R8JA 1OCRB 2CE4A 5DGBA 4B3MB 1V54C 2PN1A 3KCYA 2AZ2A 3RAQA 3J81N 3WB0A 1QVGU 2AGPA 5LP6A 3JCUZ 4NLGA 2VWJA 4O7LA 5IYZF 1SQQH 4DV4H 4FFPA 4DV4B 1WRVA 3UQ8A 1WSCA 4DAAA 5KFOA 1WLEA 4DR7H 4LWSA 3QNEA 2WLNA 5KFCA 1YSCA 2QK4A 4MTDA 1X59A 1XL6A 2YIDA 2GHYA 5HFMA 5LGUA 4CMFA 2Y0SE 2JEFA 4DQNA 5IWAH 2XCAA 4NYEA 4FFBA 4N23A 5JQGB 4UCSA 4PDMA 4KL1A 4TUYB 5BWRA 3UYYA 1HNWH 1OHHG 2C22A 4LF8O 2MCTA 1IURA 2WE6A 4QE9A 2R8HA 3JAMN 1XREA 4NKGB 3MD0A 4YHHH 4UXNA 3OGIB 5TISZ 5KT5A 3ASOC 3KHLA 3EFFK 1BL8A 2HJWA 4TT3G 3AG7A 2Q67A 2GUZB 4RU9A 3N41B 4DV5H 4DL7A 2QKCA 3ABLC 2O57A 2HR3A 2YSUB 1NVPB 2QKAA 1XOUA 5CA1B 3QWUA 2M7WA 2J9GA 5KX5F 1CXZB 4YY3H 5FNVA 5FLXW 4JI6B 2P7TC 2ZIMA 2IU0A 2NU6B 4I55A 2ETNA 2EZOA 4LWSB 2J6SA 1Q6IA 2Q4PA 2W9CA 4YIOA 4HN2A 4X8AA 2R9IA 5L1JA 4PA6A 3G6VA 2VQFH 3W7XA 5K2MA 3E8BA 3ZJZA 2UXCH 3F5WC 5FJ8G 2R8IA 1A32A 1H8EG 1OV9A 5ITZA 2OT5A 2EX3A 3K3VA 3GWKC 5EWFA 3CCMV 1EM1A 2NR5A 1FXHA 2ZDIC 3L71H 1WA8A 4FLYA 1CKNB 1I94O 2R86A 4O2BF 2ODMA 3VQYA 2P4KA 4LF6B 3CEIA 3OTOH 4I9WA 1VQKV 4JI4O 1IYDA 2V7QG 1Q6HA 4DV6B 4O4IA 2XCPA 3ZN0A 3E22A 1F4MA 2H3OA 3RYHA 4AILC 3GWOA 4YR2A 5JQWA 2EBOA 4DL6A 4LH6A 1E1RG 5IJ9A 3SYPA 2FJZA 4NXMO 3T9CA 1I7FA 3F5TA 5LYJF 1GH6A 1N48A 2UUBB 2MK3A 3OEEG 3CC2V 3CQZA 1DAAA 2ODTX 1EUDB 4HBNA 3ABKB 1AR1B 2BE3A 3JRXA 4RB2C 2YIBA 1NR1A 2BSKA 5LOVA 3VMMA 4QJFA 2C2RA 1M0WA 2UUAH 5LP6B 3OUZA 2V4DA 2OH2A 1FPOA 1M6VA 2LGWA 1X4TA 1A0IA 4WF9V 1JXLA 2CTRA 3ASNC 4NXNH 3U0GA 3N6XA 5BWWA 1BMFG 2OYQA 2HDKA 3PW5A 5DGIA 2ASJA 5KG5A 5CB4A 4YJ2A 3E8FA 2JJ2G 5BZBA 1VQ7V 5IWAB 2UUCB 4Q4DA 1GO3E 2ASDA 1SQBH 2UUCO 3ZMSA 4EQ5A 4JI5H 3QO8A 3E8HA 2ZDHA 1GN2A 4JTDB 1ZSPA 2P6JA 4CS2A 1EN6A 4NTWA 1W0JG 2GUZA 4IYHA 2DPIA 1XNRH 1IBKH 1ET0A 3GIDA 1K4CC 2PMZE 3W5OA 3M9OB 5CMUA 1GM8A 1Q3EA 1TUBA 2HG5C 2HVRA 2X6BA 1G2WA 3QFFA 5C8YB 4P30A 2VQFB 4JYBA 1R6NA 4C7UA 5C8YA 1Z2NX 5HV6A 2NLJC 1NT2B 1KQSU 4PA9A 1WP7A 4FM0A 1Z2PX 4PZ7A 1BXRA 4MT8A 2DE0X 3H1HH 2AW9A 3LDCA 3H20A 2A9HA 1VF6A 4LC1A 4L87A 1CKNA 4FZ1A 3JALB 4CC6A 3CX5F 3DSQA 1M57C 4LF8H 4ECRA 5JVLA 1OWTA 1NR7A 3CMAV 1RPOA 2JA7G 3GB7C 4W4LA 5K3WA 2LJ2A 3G6YA 4RAZA 3N44B 2FKXA 2R7MA 5KFQA 5EBWC 4TOIA 3VQVA 4QPJA 5IP7G 2R6FA 4ECWA 4JYAH 5BR8B 2K9PA 4DUYH 4O82A 3OTOB 2QTOA 4R8CA 3MWDA 4LFAH 1MA1A 4OPHA 2QWNB 3HKDA 2GBOA 5LMUH 2W7PA 5KT7A 2JVDA 4KP4A 4DV0H 2JEGA 1GN6A 3H9VA 1RSOA 3DTFA 4YB8B 4BY7G 2UXDO 3RTXA 4O4HB 2RF4A 3BFRA 5LP6C 1XBLA 5CA3A 3GB8B 3L9DA 2R72A 1GRJA 3K5NA 2KG7B 4HYKA 1KC8W 3WB1A 1BZKA 1VAJA 2IMWP 1S68A 4QPKA 2BQRA 3ZBHA 1MZFA 4CH4A 4UVCA 2YEVB 4WBNF 1EKPA 1L0LH 4P9PA 4J9KA 4C5AA 4XX0B 3MR2A 2Q7EA 4O3RA 1H2MA 1VQ5V 4RUFA 2YRXA 2QF7A 2R82A 1B3QA 3SR2C 3CCEV 2UXCO 3HKDB 3QVNA 2PI4A 4MTOA 2WAMA 4FLUA 4EKWA 1QHTA 2QKSA 4NZNA 5KKNB 1RYSA 1AJPA 1Q86W 1BS3A 4LF9B 4DR4H 3JZ6A 5KFEA 4PDVA 4NXNB 1M93A 3S24A 5C3EG 4JGSA 4O3PA 1BGWA 5KFYA 2LO1A 5EBLC 1S0VA 3CXHF 4I55B 5KFAA 4DV2H 4PV1B 5EWEA 4X64H 1K5SA 4JTAB 5LXTF 5I47A 1JKJB 1YHQV 1RJQA 4K6NA 3Q4HB 3MR5A 1M9NA 4MVRA 3SPHA 1PP9H 3SNOA 4B3RH 4ZHQA 3K5IA 2ITCC 3N43B 4DV3O 2BSKB 4K0KO 3K0GA 5L3DA 2Y69B 1TUEB 2BOCC 1CKOA 1IBKB 2EIKB 1KKDA 3H01A 3K9SA 3L4KA 4JV5H 2Z5UA 4HR7A 4ECUA 1KJJA 1LUVA 3ZRSA 4OGQB 2HHHB 3HB9A 4QWCA 1ZETA 1HNXH 1BQ0A 2CQYA 3C3SA 3U11A 1N32B 2P67A 2CH7B 3T54A 1JX9A 2O03A 3H0GA 1A48A 2P5OA 4O4LB 3LDEA 4X62B 4M9UA 4OX9H 4X89A 3ZMZA 3I4MG 1BE3H 3H1IH 5B1AB 2CDYA 4G28B 3X2QC 4UV9A 1EZ1A 3JAKA 3BHPA 4O4HF 4H44B 3T2MA 2YUAA 1UC8A 2Y0SA 4GT1A 2AGOA 1TA8A 1YIJV 3JARA 4LF6O 2NU7B 4EGQA 4J10A 2R92A 1JDBB 3T4ZA 3FDSA 4ECZA 2ZE8A 1YF2A 4DR5B 5KFDA 2QYZA
chains in the Genus database with same CATH topology
4LF4H 2BTQB 2BTOA 3JATB 1O75A 3RR5A 3ZEDA 5KMGA 4O2AA 3GJXB 3VNNA 4DV0B 1T5EA 1AN7A 1M0TA 2VQEH 2F93B 4DV3H 4K0KH 3N42B 4LFAB 1B04A 1WNSA 3N2KA 2HVQA 2YCHA 3RJ0A 4HNAA 2OWOA 4DR7B 1SA0B 1XNQH 4U3JB 4JI2H 3CSXA 5GONB 1SA0A 4FLWA 2VOBA 3ETQA 3NC0B 1ZHSA 2ZIOA 4X1YB 2YI8A 1JFFA 3W1GA 3T1YH 1SQGA 3THOA 4LF9H 4X1YA 4PI2A 3K57A 5EYPB 1M5IA 4LH7A 5EOYA 5D5PA 4JI7B 4CH5A 4YY3B 4B3RB 5D1PA 1BJTA 4LF5H 2CAZC 4MTEA 4ZIBA 4BWAA 4I50B 4ZOLA 2YIBD 3N2GA 5LOVB 4DV5B 3JATA 1X9NA 1TUBB 5JJNB 3HKCB 1Q5OA 3U0ZA 4DR1H 4YHHB 5KHHA 2QJ1A 5A2QW 3T1HB 5LMNB 4FLTA 1O9GA 5J2UB 4EB6A 2WDTA 3IAYA 4B08A 4FM9A 1HW7A 5D1OA 3CVZA 4YJ2B 4X1IB 4EFEA 3QG5A 4BWSC 1XMQH 4LFBH 2R9AA 4X1IA 1SQFA 1FJGH 2HIVA 4PI0A 3RYCA 4ETSA 4ZI7A 3RF2A 4TV9B 4CS4A 1XMOB 4DV2B 1XNRB 4GKKH 4X64B 4IHJB 4O4IB 3WB2A 1M4UA 4LNUA 5IJ0B 3RYIB 2Q2TA 2UXDB 1WPBA 1QQCA 4UCRA 3RYIA 4TQDA 1Z5WA 4JYAB 3HKEA 2VWKA 5LXTA 2CW8A 5LA6B 4ZOLB 4X65H 4B3TB 4D7TA 1N32H 1H2SB 1XHXA 5LA6A 4JI1H 5JJEB 5BMVA 4L8JA 3CB2A 4DR5H 4CS3A 5LMNH 1I94B 4DR6H 3SJAC 2F4VB 3JSLA 5LYJB 3FFQA 4DRFA 4B3MB 4GLXA 4EB6B 5J2UA 3WB0A 3JAWA 5LP6A 4PZ8A 3RWRD 1Q43A 2VWJA 4O2AB 4DV4H 4YJ3A 4DV4B 3UQ8A 4JI3B 2BTQA 4DR7H 4CC5A 3M4IA 2JGUA 3JALA 4MTDA 1N36H 2R70A 4I7HA 4JI8B 1N33H 5IWAH 2FE3A 1IBLB 4FFBA 3T1YB 5JQGB 4UCSA 2ZM6B 1ZHQA 4FFBB 4KL1A 4TUYB 4LNUB 1TAEA 4CH3A 2PYJA 2PYLA 2ZNIA 2PGGA 2UXBB 1SEIA 3JAMW 1HNWH 3TY8A 2MCTA 4IAJA 4JI7H 1HNWB 2ZCEA 2WE6A 4E6NA 5CB4B 5LXTB 4YHHH 5GONA 1Z5VA 4GKJH 4ZI7B 4TV9A 4LMYA 1I6UA 1WH2A 3N41B 1TVKB 4LR3A 4DUZH 2JS5A 4K8ZA 4DV5H 5KHKA 3MWMA 5LYJA 5K1PA 4EEQA 4FM1A 2ZJTA 4DV3B 4K0KB 4B3SH 5CA1B 3QWUA 4JI0B 4YY3H 4I50A 5FNVA 1VF7A 4JI6B 5FLXW 5D5QA 1ZAUA 2ZIMA 5FNVB 4TV8A 4I55A 3PN1A 3J80W 3BAAA 2ZINA 4LF7H 3RYFB 3L2PA 2KKWA 2VQFH 4RAYA 2E5LH 4DRXA 5JVDA 4AQYH 2UXCH 5IT9W 5FD6A 4APMA 5ITZA 3K3VA 2EX3A 5LMUB 5ITZB 4JI4H 3KYHC 4I4TB 3BPZA 4FLYA 1CKNB 3HKBA 5EYPA 3VQYA 2VQEB 2XHBA 4LF6B 5BR8H 3OTOH 4EFBA 3SJCC 4DV6B 3RFRA 4KHPB 2UU9H 3A2FA 4O4IA 3RYHB 4LFCB 1XI1A 1HR0H 1FJGB 4MV9A 1IBMB 3E22A 4WBNA 3RYHA 4AILC 4NXMH 5J2TB 3LNNA 5JH7B 1XNQB 2PUSA 4LH6A 1JJOA 5FPRA 5K1XA 2RGRA 1Z2OX 5IJ9A 4LF7B 3HKCA 4TV8B 1TVKA 2ZM6H 4JI5B 1P16A 1I7FA 3B2EE 2UUBB 4PDBA 1L2ZA 1SYXB 4RB3C 4UFZA 4HBNA 3VQXA 4DV7B 3K59A 4PZ6A 4RB2C 2YIBA 2RQ6A 4JI4B 2P22C 5LOVA 2F4VH 2YXLA 3QTCA 4LF4B 1M0WA 2UUAH 5LP6B 1HNXB 2V4DA 3HXLA 2HHHH 2Q7HA 1A0IA 1X4TA 4I4TA 5KMGB 3F8NA 4PHZA 4B3TH 1D5AA 3HKBB 3JSNA 4NXNH 2RJZA 3N6XA 4D7SA 4IHJA 2OYQA 3CHXA 1I94H 3NBZB 5CB4A 1P8LA 4O4JB 4YJ2A 4LSXA 2UUCB 5IWAB 4RB1A 4EQ5A 4R7RA 4JI5H 4B3SB 3JAKB 1J5EH 1XMQB 3L4JA 5IJ9B 1J5EB 4FVMA 4CS2A 4JI3H 4M7EA 4UCTA 4F6RB 5IYZA 2F1MA 4IIJA 4O4LA 1XNRH 1IBKH 3ZS8C 4JV5B 3W5OA 3TY9A 1Q3EA 2Q0AA 1TUBA 2HVRA 2PTMA 5C8YB 2UXBH 3RGZA 2VQFB 3KAKA 3K58A 3VQWA 5C8YA 4DR1B 1L8DA 1Z2NX 1NT2B 3FMAA 2HEPA 4JI0H 4FM0A 4DRXB 1N34B 1TGOA 4ZHQB 1Z2PX 4PZ7A 2W57A 4O4HA 3JAWB 1XDNA 2WYOA 4YJ3B 3H20A 1CKMA 4DR4B 1WN7A 5D1OB 1CKNA 3J81W 3JALB 3SJBC 2F66C 3BRCA 4CC6A 3DSQA 1FKAH 1HNZH 4LF8H 2F95B 3KXYT 1XMOH 5KHIA 5IJ0A 3RYCB 5KX5A 4TQFA 5CA0A 5IYZB 5KHGA 3MAQA 4X20A 3RGBA 5LL6b 3C0FB 4RAZA 3HKEB 3N44B 5DISC 5EIBC 4X20B 4DV1B 3VQVA 4TOIA 2Q7GA 1JFFB 4X66H 4JYAH 3TY5A 5BR8B 4DUYH 4LF6H 4WBNB 3OTOB 2CW7A 1N33B 4A2AA 4DV7H 4LFAH 1KMIZ 3HKDA 1V9PA 4GYCB 4OX9B 3EYYA 4DR2H 1N34H 5LMUH 4I9QA 5BMVB 4DR2B 3JASB 4FM2A 4NVPA 2JVDA 4DV0H 2UUCH 1RSOA 4O2BB 3KAJA 4B3MH 3RTXA 4O4HB 3GB8B 5LP6C 3N2GB 2R72A 3K5NA 4O2BA 5FD5A 2YI9A 3WB1A 3K5LA 1XQ8A 1FFXB 1HR0B 2Q2UA 1MZBA 1IBMH 4LF5B 1S68A 2QM4A 3ICXA 2PZSA 4NXMB 4CH6A 1N36B 3K5OA 4CH4A 2RGVA 2IM9A 4JI8H 4UCVA 3IG0A 4RB0A 1P49A 3N2KB 3BA9A 1E4GT 1IBLH 2E3CA 4LSAA 2HIXA 5JCOC 5JVDB 2KSWA 5JQGA 1S5JA 4J0MA 4HNAB 3U10A 2Q7EA 3E22B 1KU9A 2ZNJA 1FVIA 3NBYB 3OTFA 4F6RA 1G6UA 3SR2C 4DUZB 3HKDB 5KX5B 4FLUA 1QHTA 3N40P 5CA1A 4LF9B 4DR4H 2YIAA 4MV7A 1GYFA 4NXNB 2VUGA 3DF7A 1M93A 1O9HA 2UU9B 3S24A 1HNZB 1SKVA 4LF8B 4KHPH 1BGWA 3GDEA 4JI6H 4LFCH 3T1HH 4I55B 4DV2H 4BW9A 4Q6GA 4X64H 4AHCA 5KHJA 4FLXA 4DK1A 4FLZA 3RYFA 4Q0YA 2UXDH 1E4FT 3K5MA 4DV1H 1VS0A 4FLVA 1XK5A 2E5LB 3W1BA 3KALA 4DUYB 4AQYB 2UXCB 2UUBH 4B3RH 4ZHQA 4TUYA 3N43B 4U3JA 1S03G 3M7MX 3RGXA 4GKJB 3BA8A 3RIZA 3SGIA 1CKOA 1IBKB 1Q8IA 4DR6B 4DR3B 3L4KA 4JV5H 4DR3H 2UUAB 2HHHB 1HNXH 1XHZA 5CA0B 3U11A 4K8XA 5EIBD 1N32B 5FPOA 4DV6H 2O03A 4UCOA 4X62H 4X1KB 2P5OA 4RZQA 4O4LB 4O4JA 5J2TA 4X62B 5JH7A 1YEWA 4UCUA 2XIGA 4OX9H 5JJJB 4X1KA 4JI2B 4GKKB 2HGSA 4DK0A 5EZYB 3LMLA 3JAKA 2CFMA 3BHPA 3BABA 3QF7A 3UT5A 3JARB 5EZYA 1JMKC 3JASA 2PY5A 2GV9A 1TA8A 3JARA 3UT5B 4LFBB 5JCOA 4X66B 2VPSA 4IIJB 1DGSA 4X65B 3J7AK 4A2BA 4JI1B 2HVSA 4DR5B 1FFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 B;  4LF4 B;  3UQ8 A;  4JI3 B;  1HR0 B;  3RR5 A;  1HNX B;  3VNN A;  3GJX B;  2Q2U A;  4DV0 B;  4LF5 B;  4CC5 A;  1S68 A;  1A0I A;  4NXM B;  1N36 B;  4UCV A;  4JI8 B;  3JSN A;  1IBL B;  4LFA B;  1B04 A;  3BA9 A;  3T1Y B;  2HVQ A;  4UCS A;  2ZM6 B;  2OWO A;  2HIX A;  1TAE A;  4DR7 B;  2UXB B;  3NBZ B;  3TY8 A;  1P8L A;  1HNW B;  3NC0 B;  4E6N A;  2UUC B;  5IWA B;  1FVI A;  3W1G A;  3NBY B;  4EQ5 A;  4PZ8 A;  4B3S B;  1XMQ B;  4LH7 A;  1J5E B;  4DUZ B;  4JI7 B;  4B3R B;  4YY3 B;  4UCT A;  5D1P A;  4LF9 B;  4EEQ A;  4DV3 B;  4K0K B;  4NXN B;  2VUG A;  4JV5 B;  3W5O A;  3S24 A;  2UU9 B;  3QWU A;  1HNZ B;  4LF8 B;  3TY9 A;  4JI0 B;  3GDE A;  2HVR A;  4JI6 B;  1ZAU A;  4DV5 B;  2VQF B;  1X9N A;  4DR1 B;  3PN1 A;  3BAA A;  4YHH B;  3T1H B;  5LMN B;  1N34 B;  1VS0 A;  3L2P A;  1XK5 A;  2E5L B;  4PZ7 A;  3W1B A;  4DUY B;  4AQY B;  2UXC B;  1XDN A;  5D1O A;  1CKM A;  4GKJ B;  3BA8 A;  3SGI A;  4EFE A;  1IBK B;  4DR4 B;  1CKO A;  5LMU B;  4DR6 B;  5D1O B;  1CKN A;  4DR3 B;  3KYH C;  4CC6 A;  2UUA B;  1CKN B;  2HIV A;  2HHH B;  1XMO B;  2VQE B;  4DV2 B;  1XNR B;  4LF6 B;  4X64 B;  1N32 B;  5FPO A;  4EFB A;  4UCO A;  4DV6 B;  4KHP B;  2Q2T A;  2UXD B;  4LFC B;  5DIS C;  4X62 B;  1FJG B;  4UCR A;  4UCU A;  1IBM B;  4DV1 B;  4TOI A;  4JYA B;  1XNQ B;  4JI2 B;  3TY5 A;  5BR8 B;  4GKK B;  4B3T B;  3OTO B;  4LH6 A;  5FPR A;  2CFM A;  3BAB A;  4LF7 B;  1V9P A;  4OX9 B;  4JI5 B;  1I94 B;  1TA8 A;  2F4V B;  1P16 A;  4DR2 B;  4LFB B;  4X66 B;  3JSL A;  2UUB B;  1DGS A;  4X65 B;  4DRF A;  4B3M B;  4JI1 B;  4UFZ A;  4GLX A;  4DV7 B;  3RTX A;  2HVS A;  3GB8 B;  4PZ6 A;  4DR5 B;  1N33 B;  4JI4 B; 
#chains in the Genus database with same CATH topology
 3V6H A;  2BTQ B;  4LF4 H;  3JAT B;  1O75 A;  4J9R A;  3ZRX A;  5KMG A;  1AI7 A;  4DV0 B;  1T5E A;  3EHB B;  2LGQ A;  3RT3 C;  4OX9 O;  2EJ7 A;  2F93 B;  1ROP A;  2JS3 A;  4WCE V;  4DV3 H;  4K0K H;  3N42 B;  4C5B A;  1YJN V;  4LFA B;  2YEV A;  3N27 A;  2YCH A;  3RJ0 A;  4HNA A;  3CCU V;  3AEI A;  2NVY A;  2OCC C;  1I2K A;  3SYO A;  4DL5 A;  4UUG A;  4QIW A;  1CS0 A;  1AUX A;  1ZHS A;  1JFF A;  2Y4T A;  4ED1 A;  1IBL O;  2WB1 A;  4AYB E;  3T1Y H;  1SQG A;  3THO A;  3MJF A;  1VKZ A;  3ML0 A;  2ZR2 A;  3K57 A;  1RM1 C;  4RNM A;  1M5I A;  2FB9 A;  1UC9 A;  3AX6 A;  4JI7 B;  3M9N B;  1WCM A;  3RB4 A;  3Q8R B;  1N56 A;  2AZ0 A;  4GX0 A;  4DR7 O;  2EJR A;  2E74 B;  2K1E A;  4H37 A;  1N32 O;  4ZIB A;  4ZKI A;  1CQJ B;  4I50 B;  1ORQ C;  3BG5 A;  4ZOL A;  1YZB A;  2QM7 A;  2QEX V;  5LOV B;  3H1J H;  1X9N A;  3FYI B;  4MV3 A;  3FD9 A;  2W6Q A;  4JI7 O;  2HVJ C;  5FNV F;  5JQG F;  4DR1 H;  2A7W A;  4J42 A;  2R7Z A;  2QJ1 A;  3OHA A;  5KFJ A;  5LMN B;  3BQ1 A;  4FBT A;  2ZE6 A;  2X0S A;  2D3O W;  3VBB A;  4O7R A;  1SZX A;  3FAV B;  3IAY A;  4FM9 A;  1THZ A;  3ZMU A;  4FFL A;  3CVZ A;  3T4D A;  1KKC A;  3V6J A;  4EFE A;  5B66 Z;  3CD6 V;  1DK1 A;  2COG A;  5F9L A;  3MDS A;  4MAM A;  1BCC H;  1SQF A;  2N04 A;  2DLN A;  5I5Y A;  4O84 A;  3OR6 C;  3OMA B;  4B3M O;  2Z0A A;  4ETS A;  2JDI G;  3RF2 A;  1XMO B;  5H6Q A;  1Y74 B;  4DV2 B;  3QO5 A;  5J2T F;  3K5H A;  5DN6 G;  3PW7 A;  5DLF A;  4TWK A;  4JV0 A;  4IYI A;  1QR9 A;  1WPB A;  1QQC A;  2NNU A;  5DEC A;  1Q82 W;  2CW8 A;  2FTK A;  5LA6 B;  1T36 A;  4EBE A;  1S77 D;  3KKY A;  4D7T A;  4YJ3 F;  4DUZ O;  1XHX A;  3G8D A;  5EDW A;  5BMV A;  2W6P A;  3MWE A;  5L1I A;  2E2I A;  5KT4 A;  4CS3 A;  1YDX A;  3E2E A;  2WLI B;  1I94 B;  2W9B A;  2W9A A;  2F4V B;  2Q8V A;  3JSL A;  5LYJ B;  3FFQ A;  5LL6 Y;  2W70 A;  5DG7 A;  5CAE B;  3JAW A;  2DW4 A;  2EIJ B;  3CP1 A;  3ETJ A;  3M8A A;  2Y69 C;  2XOK G;  1N0N A;  4CC5 A;  3M4I A;  3JAL A;  3MHH C;  2NUA B;  4B3S O;  1N36 H;  2R70 A;  1D5N A;  1N33 H;  2FE3 A;  3CJH A;  4JAU A;  2WLL B;  3T1Y B;  2IP4 A;  2ZM6 B;  2PVP A;  4CH3 A;  4LNU B;  2IU3 A;  3HOV G;  4NTY A;  3TY8 A;  5BR8 O;  1BHB A;  1HNW B;  4J9S A;  2ZCE A;  1I1L A;  2JEI A;  1FXK A;  1C30 A;  4YXW G;  1VEW A;  4JZ2 A;  4I55 F;  1I6U A;  4QWD A;  1WH2 A;  1TVK B;  3ZX6 A;  5L3G A;  2AGQ A;  4K8Z A;  4YY3 O;  3VOU A;  3L72 H;  5KHK A;  3MWM A;  5BWT A;  4U7O A;  5LYJ A;  1XMQ O;  1FAF A;  1H8H G;  5DG9 A;  4DV3 B;  4K0K B;  2JA8 G;  1DF5 A;  2DWE C;  1ULZ A;  3S3X A;  4JI0 B;  5KG2 A;  1P7G A;  1Q6U A;  4EGJ A;  4I50 A;  5GON F;  5D5Q A;  2ATL A;  2R87 A;  5FNV B;  2VA2 A;  1SRY A;  3KZI Z;  3HOW G;  2GPW A;  3ABL B;  2V59 A;  5L9X A;  5KFN A;  2RCV A;  4RAY A;  2E5L H;  1P84 F;  3CME V;  2ZD9 A;  3OFN G;  2DYR C;  3CRR A;  1UJW B;  3K9A A;  1QNM A;  4FPP A;  1KJ8 A;  5CB4 F;  5LMU B;  1N33 O;  5ITZ B;  3T9A A;  5FLM G;  4JI4 H;  3KYH C;  4NTX A;  1K92 A;  4I0X B;  1V4Y A;  1IYE A;  1XUQ A;  5C1P A;  1US6 A;  2DQ3 A;  5EYP A;  1RM1 B;  2VQE B;  3TIG A;  3KHR A;  5CBG A;  4OXS A;  2XHB A;  1SQX H;  2J6U A;  4EFB A;  5KFP A;  3TII A;  2ZGI A;  3SJQ C;  3GTM A;  4FIP C;  1FJG B;  4MV9 A;  3UCS C;  4WBN A;  5L3B A;  4NXM H;  4FS2 A;  1J95 A;  5JH7 B;  3DGE A;  1B33 N;  1T94 A;  1Y4M A;  4JI3 O;  4FBU A;  2FL4 A;  2Q5Z A;  1JJO A;  5FPR A;  4MV6 A;  4W4K A;  2JA6 A;  3LP8 A;  4LF7 B;  2P06 A;  3HKC A;  4J41 A;  4JI5 B;  3UO2 A;  1P16 A;  2XT9 A;  2IJK A;  3QZ8 A;  1Y1W A;  5DM6 V;  1L2Z A;  3FYE B;  1SYX B;  4RB3 C;  3IC9 A;  3VQX A;  2V1D A;  4YQW A;  3K59 A;  2W0F C;  4GX5 A;  4DR6 O;  3QTC A;  5H9C A;  5B1A C;  4OPA A;  1HNX B;  2HHH H;  2EIY A;  4A3K G;  2Q7H A;  1YTF D;  3NXS A;  5DGA A;  4QSH A;  3ZHU A;  2KSD A;  2E5L O;  1AB3 A;  4PHZ A;  3F8N A;  1D5A A;  2W6I G;  1F4N A;  2ALZ A;  2ZXW B;  3JSN A;  2C28 A;  3GIP A;  2JEU A;  4H0L B;  4D7S A;  4MW3 A;  1KBL A;  1KT8 A;  5DQG A;  3P32 A;  1I94 H;  3B77 A;  4GKK O;  5BWU A;  2WLK A;  3BVO A;  4A3I G;  4I7Z B;  2R7K A;  2UVW A;  2JA6 G;  2WAQ A;  5KAF Z;  1HR0 O;  1I08 A;  4ZQI A;  1TWF A;  1OJH A;  3UM7 A;  4U3F H;  4TUY F;  1J5E H;  4EBC A;  3ZMV A;  1XMQ B;  4ECS A;  5IJ9 B;  1J5E B;  1RK6 A;  4FVM A;  4MVM A;  2ZE5 A;  5I5W A;  5C5J A;  2GQS A;  4M7E A;  4UCT A;  5IYZ A;  2QE7 G;  3OMI B;  4CHI A;  3VA7 A;  4IRD A;  2OCC B;  3ZS8 C;  1MSW D;  1PKX A;  4JV5 B;  3TY9 A;  1DF4 A;  3H1K H;  3G6E V;  4DL3 A;  2Q0A A;  1QR8 A;  2PTM A;  2DOS A;  3RGZ A;  1RJR A;  2M05 A;  4CZZ A;  1R73 A;  3HOU G;  1URF A;  3K79 A;  3AG3 C;  1W2B U;  3PW2 A;  4QWE A;  4JI0 H;  2A3Q A;  2JJ1 G;  3GV5 B;  2R93 G;  2LFS A;  1N34 B;  1TGO A;  4JYY A;  2YZM A;  1VQ4 V;  3UKM A;  3JAW B;  3PW4 A;  3AYH B;  3SPC A;  4IGG A;  2WYO A;  3A8T A;  3GTQ A;  1U96 A;  4TQR A;  2P4V A;  1NU1 H;  5D1O B;  1L1F A;  4EEY A;  1HNZ H;  5B1B B;  2R7N A;  3CSW A;  1NTZ H;  2KQX A;  5KHI A;  4LFC O;  3PFF A;  4IHJ F;  3V6K A;  2HJD A;  3TW6 A;  1M56 C;  5IJ0 A;  3RYC B;  3T7A A;  2UUA O;  5IYZ B;  2VQD A;  3DAA A;  1XEQ A;  3RGB A;  3H1L H;  5EIB C;  4X20 B;  4U7C A;  4O7T A;  4JUZ A;  4X66 H;  4LF6 H;  4C2M A;  4WBN B;  1AJQ A;  5LHI A;  1IBK O;  2CW7 A;  5I5S A;  1LUW A;  1CPY A;  3NGD A;  4ECX A;  2UUB O;  1RP3 B;  4GC6 A;  3EYY A;  4QIW F;  2V4Q A;  1W96 A;  3GII A;  4I9Q A;  5BMV B;  2XUM A;  1OBD A;  1W93 A;  3JAS B;  4FM2 A;  4NVP A;  3HOZ G;  1AVM A;  2DQ0 A;  1CEZ A;  2Q68 A;  2UUC H;  3TQ1 A;  1FXV A;  2C35 B;  1NKD A;  1AI5 A;  3FAV A;  3N2G B;  4O2B A;  5JWP A;  4I4T F;  4HNU A;  3GVM A;  3D36 C;  3RBE A;  3OW2 U;  4LP8 A;  1HR0 B;  5I5V A;  3AG4 C;  1W0K G;  1P4R A;  4JV1 A;  2VUM A;  2QM4 A;  4NXM B;  4CH6 A;  3ZHT A;  2GQR A;  1VF5 B;  2IM9 A;  2RGV A;  4JI8 H;  4UCV A;  3IG0 A;  5KT3 A;  4RB0 A;  4J7J A;  3RBD A;  2G38 A;  3BA9 A;  1E4G T;  3KHG A;  4P2Z A;  5JCO C;  4IWX A;  4PA7 A;  5JQG A;  4PJ0 Z;  4J9L A;  4HNA B;  5KFX A;  3U10 A;  3M99 B;  3OUS A;  4EYI B;  3E22 B;  5EC2 C;  4DV6 O;  2ZNJ A;  1NH2 B;  5KFK A;  1M57 B;  1VQN V;  1FXK C;  3OTF A;  4J9Y B;  5KFS A;  3IN5 A;  3Q2O A;  2RMK B;  1G6U A;  1JVM A;  2GDS A;  4AQY O;  3GTJ A;  3AG1 B;  2VR1 A;  3T5K A;  5D8D A;  2BCC H;  1VQP V;  4GKJ O;  5CA1 A;  4Q43 A;  2V5A A;  2YIA A;  2Y0I A;  4MV7 A;  2BR0 A;  2VUG A;  3DF7 A;  1O9H A;  5DGH A;  4E2L A;  2UU9 B;  4KHP H;  3GIJ A;  1WCM G;  4ASU G;  4LF7 O;  3T1H H;  5KFT A;  5FR9 A;  2EUL A;  3NR7 A;  3TW7 A;  4Q6G A;  4Y8V B;  3FKI A;  4AHC A;  4DK1 A;  2W9C B;  3JD4 A;  2FPI B;  4Q0Y A;  3KTM A;  2NU9 B;  1R3I C;  1IOV A;  4FLV A;  2COI A;  3KAL A;  4DUY B;  2DWD C;  2Y0P A;  1IOW A;  4AQY B;  4F50 A;  3N6R A;  4TUY A;  3CC7 V;  2Q7D A;  2N74 A;  2A1H A;  1S03 G;  2BQ3 A;  3OTO O;  3GQC A;  4J7K A;  4DR3 B;  1F7Y A;  4DR3 H;  2CKZ B;  3PVX A;  1OCC B;  3ZN1 A;  3V4S A;  1XHZ A;  3HPL C;  4DW1 A;  5CA0 B;  2V4R A;  2RN9 A;  2CNQ A;  2HGX A;  1G4Y B;  4DV6 H;  1H2L A;  4KUM A;  2DZD A;  4XZ3 B;  3MFH A;  2PF4 E;  4O4J A;  4UCU A;  1EN5 A;  2L35 A;  2EIK C;  5KG0 A;  2HGS A;  2E2H A;  4DK0 A;  1JOY A;  2EJ0 A;  2DMX A;  3LML A;  2W8K A;  2RDI A;  3JAR B;  3JD3 A;  5EZY A;  2AGA A;  1CE8 A;  4MVO A;  2GV9 A;  3WWJ A;  5LA6 F;  4J80 A;  3TIN A;  4LFB B;  5JCO A;  4X66 B;  1BQZ A;  1PNK A;  2Y4R A;  1NI8 A;  4QIW E;  2HHH O;  2QR4 A;  4JI1 B;  4EYH B;  1AI6 A;  1ARO P;  2ATK C;  3TXQ A;  1Z2G A;  1FFX A;  1Q81 W;  3IC7 A;  2DAA A;  1DV2 A;  2AHY A;  3GV7 B;  1EKF A;  3ZED A;  4O2A A;  1MG1 A;  3GJX B;  5CA0 F;  4JTC B;  1AN7 A;  5KFR A;  3CS5 A;  3CJH B;  3LSU A;  1PD3 A;  4QW9 A;  3OEH G;  1WNS A;  3N2K A;  1M56 B;  1HWY A;  2KB1 A;  1I50 A;  4FFM A;  3DXR B;  4RWU A;  1XIL A;  3UFX B;  4UVA A;  1FXK B;  3ETQ A;  1S72 V;  1EZJ A;  1XL4 A;  3K03 A;  1YJ9 V;  2QGN A;  1B06 A;  5L3E A;  4LF9 H;  1T3N A;  4MSW C;  3SPG A;  3I4N G;  3FKI G;  1SC5 B;  1K1Q A;  4LH7 A;  5D5P A;  2OIG A;  1JCH A;  4PA4 A;  4ECV A;  2WLI A;  1B6Q A;  4BAY A;  5D1P A;  4BIZ A;  2CAZ C;  4A3L G;  3GTL A;  4MTE A;  2ZKO A;  4BWA A;  4HNT A;  1GK9 A;  2YZG A;  3GTG A;  2LW1 A;  1ZL8 A;  2WSS G;  1TUB B;  2JGD B;  1Y6X A;  2UVR A;  1Q5O A;  3JD1 A;  4LF4 O;  5KFL A;  4YHH B;  1ZQ7 A;  5A2Q W;  1KTA A;  3T1H B;  1VAR A;  5J2U B;  4EB6 A;  1XMO O;  1SQV H;  1R6T A;  3E83 A;  1JA8 A;  2Y4U A;  1UNN C;  1WR2 A;  4JYC A;  3UO3 A;  1SZT A;  3VPC A;  1KJ9 A;  3T99 A;  3HBL A;  1XMQ H;  1H2K A;  2YXH A;  1PNM A;  4TV9 B;  3WG7 B;  4CS4 A;  1QCE A;  3T1H O;  1XNR B;  2ADP A;  2FPG B;  5J9P C;  1M4U A;  1R6K A;  4LNU A;  4FMT A;  4DXW A;  3RYI B;  1PL0 A;  4M0J A;  2Q2T A;  5KFI A;  3WO0 A;  3B4S A;  2QSA A;  4LCU C;  2CK3 G;  4TQD A;  3RYI A;  1V55 C;  5LHG A;  3WNZ A;  4JYA B;  3JZF A;  1BGY H;  1EBO A;  4B3T O;  1KP2 A;  3OD4 A;  3T9F A;  4ZOL B;  1N32 H;  5LA6 A;  4JI1 H;  5DQH A;  3GIM A;  4FFO A;  4DR5 H;  1QBZ A;  4ZHQ F;  2CTW A;  2V9W A;  1JX4 A;  2I8C A;  4IL6 Z;  3T1C A;  1MAB G;  1RFY A;  2XD4 A;  4DRF A;  1TWA A;  3T1Y O;  3DC6 A;  1K73 W;  2YW2 A;  4JI5 O;  1R1B A;  4EB6 B;  5J2U A;  2DYS B;  2PBZ A;  2R8K A;  1Q43 A;  3RWR D;  2F43 G;  1N36 O;  4O2A B;  4YJ3 A;  1KEC A;  4A3G G;  4JI3 B;  2B1G A;  3ZMT A;  1R3L C;  3CYO A;  1SQP H;  2JGU A;  4A3D G;  4RUC A;  5IE9 A;  4UVB A;  4JXU A;  2A79 B;  1IBL B;  2HJF C;  4LFA O;  2YL2 A;  4FFB B;  2PYJ A;  1TAE A;  3L70 H;  2UXB B;  3TEK A;  1SEI A;  2H94 A;  4WFE A;  4IAJ A;  4JI7 H;  3N8D A;  4E6N A;  1I1K A;  5LXT B;  2EIM C;  4O7Y A;  4DV0 O;  3EPG A;  2IA6 A;  2MW2 B;  4R50 A;  1Z5V A;  4ZI7 F;  4GKJ H;  2V58 A;  4ZI7 B;  3PJS K;  4TV9 A;  2X5R A;  1H38 A;  3A0B Z;  5C44 G;  1Y14 B;  4CMD A;  4ED8 A;  2R84 A;  3OT7 A;  4DUZ H;  1TWH A;  2YU9 A;  4JAV A;  4WFH A;  5KFM A;  3HOY G;  3AW8 A;  4XDK A;  3ZHR A;  4DUY O;  5KFB A;  5K1P A;  4EEQ A;  4FM1 A;  1BNC A;  5KFF A;  3GTO A;  1COW G;  3WO1 A;  2JA7 A;  5B3S B;  2LQT A;  3BJY A;  1VF7 A;  1ZAU A;  4IT5 A;  2JRI A;  3PN1 A;  5H6R A;  2QWQ B;  4NR1 A;  1K9M W;  3JZI A;  3EVK A;  4A3J G;  4LF7 H;  4YHH O;  1SES A;  3RYF B;  1A3G A;  3L2P A;  2KKW A;  1EN4 A;  4UV8 A;  4WFB V;  4DRX A;  1K4D C;  2YZN A;  5KFH A;  1OZ0 A;  5IT9 W;  4MV4 A;  1KD1 W;  3BAC A;  5KLV H;  4APM A;  1LNQ A;  4J9M A;  3SI8 A;  3B8M A;  1AP6 A;  1N4C A;  2ASL A;  3APO A;  4E4E A;  4ED6 A;  4PDL A;  2W0X A;  4ABM A;  4ZOL F;  5DG8 A;  4A3C G;  3L75 H;  5C1O A;  4GX1 A;  5BPF A;  4X64 O;  3PR4 A;  3SJC C;  1XI1 A;  3RYH B;  3G6X A;  1HR0 H;  4Q8F A;  3RV3 A;  2Q73 A;  1PX2 A;  1Y1W G;  2EIN B;  1RJP A;  2W71 A;  2PUS A;  4DR4 O;  3E5N A;  2EJ3 A;  4JF3 A;  1VF6 C;  2R7L A;  2QWO B;  1TVK A;  2COJ A;  2ZM6 H;  2ZE7 A;  4YP3 A;  1PM9 A;  3EXA A;  1FD9 A;  3VPD A;  4Z2W A;  3PO2 G;  1K3E A;  1RPR A;  2HFE C;  2YDE A;  1FJG O;  3G8C A;  4UFZ A;  1KUQ A;  4DV7 B;  2Z04 A;  2RQ6 A;  1SFO A;  2F4V H;  3I56 V;  2YXL A;  1MMM A;  4FFR A;  5GW7 A;  4FGR A;  1JPX A;  4I4T A;  4B3T H;  5L1K A;  3R9R A;  4N21 A;  1K7D A;  4IHJ A;  3J80 N;  2CGO A;  3JRW A;  4O4L F;  4QWB A;  2EIM B;  3ABK C;  5GTH Z;  2WLJ A;  4O4J B;  2YIC A;  2VUM G;  2YS6 A;  5B1O A;  1IX9 A;  4D6T H;  2IH3 C;  4RB1 A;  3MFI A;  3CRA A;  1XNR O;  4XBF A;  1S5L Z;  3G67 A;  4O86 A;  4A3B G;  3JAK B;  4IRK A;  3L4J A;  4J9P A;  4MVU A;  4JI3 H;  2YZL A;  1DV1 A;  1HDJ A;  4F6R B;  5C93 A;  4BXX G;  1SET A;  1PV0 A;  4GZR B;  2F1M A;  5F2V O;  4O4L A;  3E89 A;  2VPQ A;  2C00 A;  1ZWI C;  2GTS A;  2ZT9 B;  4RQE A;  1VBH A;  2YS8 A;  5CM0 A;  1ZUQ A;  4IR9 A;  2UXB H;  3CRM A;  1EKV A;  3KAK A;  5H80 A;  3K04 A;  4EG0 A;  1S10 A;  3OM3 B;  3VQW A;  3RB0 A;  2ZR3 A;  1L8D A;  5DQI A;  1NS1 A;  3FMA A;  4NB5 A;  4UUJ C;  3DTG A;  4ICG A;  4DRX B;  3TET A;  4O7Z A;  4CBC A;  4Q4C A;  1R3K C;  4YJ3 B;  2W6J G;  2NU8 B;  1CKM A;  2OCH A;  3ZRV A;  1WN7 A;  4DR4 B;  4ED0 A;  4RCN A;  1H2G A;  4YR0 A;  2IBK A;  3WWI A;  2F66 C;  5KS8 A;  4HAM A;  1Q7Y W;  3ABM B;  3FB6 C;  1XMO H;  3ETH A;  3V4Z A;  4O4I F;  2JA5 G;  5KX5 A;  4TQF A;  1B6R A;  3TXS A;  2ILM A;  3ABU A;  4X20 A;  5LL6 b;  4DR3 O;  2CH7 A;  5JUM A;  5IYD G;  3CCL V;  4G3I A;  4DV1 B;  5KUK A;  4DV5 O;  4Z1M G;  2ZDI A;  3CE2 A;  4DO2 A;  4R8U A;  2EIL B;  3SYA A;  4DYL A;  4GC7 A;  1I7L A;  3A0H Z;  3Q1K A;  4DV7 H;  1KMI Z;  2WWW A;  3RUP A;  1V9P A;  2XC9 A;  3OSN A;  3JD2 A;  4YAJ B;  4DR2 H;  4DR2 B;  5AG2 A;  1K97 A;  5IY5 C;  1GGO A;  2FPP B;  1IVS A;  5EBM C;  3BY6 A;  2UXB O;  2R9R B;  4O2B B;  4B3M H;  4WD3 A;  2AHZ A;  2IW5 A;  3CPW U;  1DIK A;  5KFW A;  3L74 H;  1XQ8 A;  2D2C B;  3CCV V;  3R5X A;  1FFX B;  1OCO C;  3DC5 A;  1D2D A;  3HO8 A;  3AG2 B;  3LUL A;  4L1K A;  2Q2U A;  1MZB A;  3BQ0 A;  1OCZ B;  4LF5 B;  4U7N A;  4YAK B;  3ICX A;  1F51 A;  2B63 G;  4JI2 O;  1QU7 A;  1P49 A;  4RNO A;  1QLE B;  4WFF A;  2R93 A;  2CNV A;  1Q90 D;  2Q9L A;  2E3C A;  2HIX A;  5JVD B;  3RAX A;  2KSW A;  2FLL A;  4EBD A;  2HLD G;  2AU0 A;  3T5J A;  5IYC G;  4CE5 A;  4GLW A;  2WLM A;  2EIN C;  3E86 A;  3E35 A;  4FFN A;  3RN4 A;  3ORR A;  4GCZ A;  4F6R A;  5DED A;  2NN4 A;  4QGP A;  3JD0 A;  2FK2 A;  2SCU B;  2QWP B;  1GMG A;  3TQT A;  1YXB A;  4JYA O;  2ZM6 O;  1YCI A;  3OUF A;  4TSF G;  3DTU B;  4HYO A;  4HNV A;  4LF8 B;  1ZL8 B;  4NXN O;  3RV4 A;  1KC7 A;  4JI6 H;  4LFC H;  1EHI A;  4RAI A;  2OLS A;  1VQ8 V;  3U9S A;  1YJW V;  4FLX A;  1BSM A;  3GTK A;  1SF9 A;  4YIP A;  4FLZ A;  4A3F G;  2QA4 V;  4B7K A;  3D3I A;  2UXD H;  4O7W A;  1JR9 A;  1LR1 A;  1E4F T;  2JEX A;  2QWR B;  2P0A A;  1VS0 A;  1RSO B;  2UVV A;  1M1K W;  1XK5 A;  3W1B A;  4IZO A;  4XDJ A;  5A9G A;  2UXC B;  2UUB H;  4BBS G;  1E4E B;  2W6Z A;  2I80 A;  3FB8 C;  5B3S C;  3CC4 V;  1NH2 D;  1Y1V G;  3M7M X;  4ED2 A;  3RGX A;  4GKJ B;  3RIZ A;  3SGI A;  4MVZ A;  3UZB A;  1Q8I A;  3X2Q B;  3OE7 G;  3AK3 A;  3RVZ A;  4IRC A;  1TWG A;  1I7N A;  2E76 B;  2W6M A;  2C2D A;  4PD4 F;  2UUA B;  3ZRW A;  3TJT A;  3TCU A;  2WPD G;  1S0M A;  3K06 A;  1MNG A;  3FB5 C;  2C2A A;  5EIB D;  1MOF A;  5FPO A;  1IXB A;  1QLN A;  4MVQ A;  4UCO A;  4FZ0 A;  2YWV A;  4A93 G;  1JQ0 A;  2OTL V;  5J2T A;  3L73 H;  2XIG A;  4FK5 C;  5JJJ B;  4X1K A;  2A0L A;  1Y76 A;  3OGC C;  4J9O A;  4GKK B;  3TK1 A;  3PZP A;  5DLG A;  4QNH B;  3UT5 A;  5KFU A;  2Q69 A;  3JAS A;  2PY5 A;  4F6E A;  2VPS A;  3C3T A;  4IIJ B;  1DGS A;  4X65 B;  3J7A K;  5KFZ A;  2HVK C;  2EZP A;  2AXT Z;  2I87 A;  1HNX O;  4IWY A;  2HVS A;  1G8M A;  2R8G A;  2ADQ B;  2YXY A;  2BTO A;  4P9O A;  3VNN A;  1WB7 A;  2X6A A;  1M0T A;  2VQE H;  3Q8Q B;  3IJ4 A;  4J11 A;  5FL7 G;  4BIU A;  1AJN A;  2LFR A;  3AG4 B;  4BIO A;  2HHF A;  3NUA A;  3MHS C;  4K35 A;  2IJH A;  2OWO A;  4DR7 B;  1SA0 B;  4XYL B;  4JI2 H;  1VQ9 V;  1YTF B;  4FLW A;  1I1M A;  2VOB A;  3NC0 B;  2YI8 A;  2B5U A;  2YS7 A;  2HGW A;  4O3S A;  5CE8 A;  3R66 A;  3IFX A;  5EYP B;  1EFR G;  2CNU A;  1I2L A;  4CH5 A;  4B3R B;  2NVX A;  4G2K A;  3D8C A;  1GN4 A;  4LF5 H;  1NTM H;  4XYM B;  4K3A A;  4DR2 O;  3R5H A;  2W7O A;  1KB9 F;  3N2G A;  1EYZ A;  1JDE A;  2FK1 A;  2CUG A;  4MW8 A;  4FU0 A;  3JAT A;  4DIM A;  2X7R B;  5JJN B;  3U9T A;  3HKC B;  1OCO B;  3CRC A;  2DAB A;  5IP9 G;  3U0Z A;  1OCZ C;  5B1B C;  1VP7 A;  2GTA A;  1N0J A;  5KHH A;  3T9E A;  5I5U A;  3GTP A;  4O81 A;  4DV2 O;  5KG1 A;  1O9G A;  1JLL B;  3BQ2 A;  4LFB O;  2FMA A;  3CCJ V;  2WDT A;  5H2F Z;  2L6L A;  2WAQ E;  4B08 A;  4Z1V A;  1CQI B;  2ZDQ A;  4RO2 A;  3LWB A;  4X88 A;  5KAI Z;  4QW8 A;  1SER A;  3GIL A;  3O65 A;  3FKS G;  4BWS C;  1M7J A;  4LFB H;  2C2E A;  1K8A W;  3OR7 C;  1NBM G;  3LDD A;  4A3M G;  1H2N A;  1JJ2 U;  2YC0 A;  2HIV A;  4PI0 A;  3RYC A;  4I0X A;  1A0G A;  2Y48 A;  4ZI7 A;  1GN3 A;  1KJQ A;  1FYJ A;  4GKK H;  3GIQ A;  1EUC B;  4O4I B;  1CP9 A;  1UFI A;  2UXD B;  3F7Y C;  3HKZ E;  1YI2 V;  4UCR A;  4JAS A;  4CKE A;  3HKE A;  1KBH A;  5LGT A;  4QE7 A;  3R23 A;  5LP6 F;  3CWB H;  4O3Q A;  2QTS A;  2J6T A;  4B3T B;  4PBC A;  2ITD C;  5JJE B;  1FS0 G;  3ABM C;  3CB2 A;  4L8J A;  4PA3 A;  2PI5 A;  4BW5 A;  1KUT A;  3U55 A;  3T5H A;  4PWQ A;  4GLX A;  1Y66 A;  3SE7 A;  2XGP A;  5BYA A;  3W7T A;  5IYD O;  1BT8 A;  4PZ8 A;  2W6O A;  2JA5 A;  2OIE A;  3H4D A;  3ETE A;  2BTQ A;  1G1X B;  2E75 B;  5LHH A;  3W7W A;  1WP8 A;  3KG2 A;  2ABJ A;  1TWC A;  4O7V A;  1GLV A;  4I7H A;  4JI8 B;  3AG1 C;  5IY5 B;  2N05 A;  4LF9 O;  1ZHQ A;  2ZNI A;  3D3Q A;  2PYL A;  2PGG A;  3JAM W;  2X0L A;  4H33 A;  1HNZ O;  2FLP A;  3EPI A;  1S0N A;  5KT2 A;  5CB4 B;  5A2Q N;  5GON A;  4I50 F;  4Q44 A;  3WG7 C;  4LMY A;  2P90 A;  5IYC O;  1QLE C;  4LR3 A;  2DIK A;  3FX7 A;  2JS5 A;  5CN0 A;  3QO7 A;  1I5Y A;  1FKA O;  1S5H C;  3SPJ A;  2ZJT A;  4B3S H;  1GTO A;  1WB8 A;  5BY1 A;  4KFM A;  1QVF U;  1PK8 A;  2Q0O C;  4FFK A;  4DL2 A;  4ED7 A;  2ZDG A;  4TV8 A;  2UU9 O;  3J80 W;  3JCZ A;  2F23 A;  2IBZ H;  3BAA A;  4KHP O;  4O7S A;  1S97 A;  2ZIN A;  5L1L A;  1XDC A;  2Z02 A;  5B1N A;  4DL4 A;  3ETG A;  2VS0 A;  2DYS C;  4ECQ A;  3KRE A;  5HNE A;  4G27 B;  5JVD A;  4AQY H;  2LP7 A;  2ZQM A;  5CBH A;  2XGQ A;  2W8L A;  5FD6 A;  2CTQ A;  1N34 O;  3MR6 A;  3B40 A;  2IJJ A;  4O3N A;  3S3W A;  2IJI A;  4I4T B;  1SCU B;  2RDC A;  3BPZ A;  3U54 A;  3RW0 A;  4NYK A;  1Y1V A;  3HKB A;  4MA5 A;  5KA6 A;  2GSM B;  2HHF B;  2RDJ A;  3W7S A;  5BR8 H;  3T9D A;  4WFA V;  4JV5 O;  1P7B A;  3RFR A;  3ZCC A;  4KHP B;  3I5D A;  3A2F A;  1S0O A;  2UU9 H;  4LFC B;  2HP8 A;  1F23 A;  3ETD A;  1IBM B;  3O9O A;  4YBZ B;  3QZ7 A;  5J2T B;  3LNN A;  1XNQ B;  4NZM A;  4I5S A;  4MTF A;  5K1X A;  2RGR A;  2JK5 C;  4AI8 A;  1Z2O X;  3I12 A;  5KFV A;  3W7U A;  1KEE A;  4TV8 B;  4U6P A;  4X9Q A;  1IZ3 A;  2ZXW C;  3GLK A;  3B2E E;  3ASN B;  3RVY A;  4PDB A;  5BXZ A;  1KYO F;  3RBZ A;  4QJF B;  4PZ6 A;  3SYQ A;  4DV1 O;  3LUT B;  4JI4 B;  2P22 C;  1E4E A;  5BWX A;  4RQF A;  4NZO A;  4LF4 B;  4RZR A;  3K08 A;  3BEH A;  5CA1 F;  3HXL A;  1Y67 A;  3HKZ A;  4RNN A;  1MSD A;  2FYU H;  1L0N H;  5KMG B;  4WFG A;  4CKB A;  4A5U B;  2FML A;  3HKB B;  2WA3 A;  3LSS A;  4BR6 A;  3OAA G;  1WPX A;  2RJZ A;  2XND G;  1GAX A;  3OUU A;  1VQL V;  3ZIA G;  4KXR A;  3P3N A;  1S76 D;  3CHX A;  2YYA A;  1YIT V;  3ZHV A;  1J5E O;  3NBZ B;  2B63 A;  4O83 A;  1P8L A;  4XDL A;  3H40 A;  3K3W A;  4J9Q A;  4LSX A;  1K5Q A;  1Y76 B;  1S3J A;  4J9Z B;  1DTO A;  4X62 O;  4R7R A;  3JYC A;  1AIL A;  2LW7 A;  4B3S B;  5C8Y F;  5J2U F;  2XAH A;  5BYB A;  3K0D A;  4JI6 O;  1K1S A;  4IIJ A;  2H8P C;  3ABT A;  5KT6 A;  3RB6 A;  3RB3 A;  4F4Z A;  1AP5 A;  2FLN A;  4F4W A;  3K58 A;  4O4J F;  2VQF O;  3APQ A;  4DR1 B;  4C5C A;  3TGU H;  1NQT A;  1PNL A;  2AQ4 A;  2ARH A;  2HEP A;  2B1I A;  4ZHQ B;  2BQU A;  2W57 A;  4LBE C;  4O4H A;  4MTG A;  4O3O A;  1XDN A;  3T5L A;  1AI4 A;  1V55 B;  2B9Z A;  3PR5 B;  5IT9 N;  3G71 V;  2DWC A;  3J81 W;  3PO3 G;  3SJB C;  3BRC A;  1FKA H;  2QB5 A;  1VMG A;  1W59 A;  3CEB A;  1U97 A;  3OHB A;  2F95 B;  3KXY T;  4YR3 A;  2Z3Y A;  3A0R A;  2WLL A;  4PDR A;  5CA0 A;  5B5E Z;  1JIH A;  5KHG A;  3MAQ A;  2RNB A;  1V54 B;  3C0F B;  3HKE B;  3VPB A;  5DIS C;  1VBG A;  4TV8 F;  3CXC U;  3BCC H;  4O7N A;  5GTI Z;  2Q7G A;  1JFF B;  2DN9 A;  1VQ6 V;  3VOT A;  4E4T A;  4HQ6 A;  3TY5 A;  4ECT A;  3STL C;  3CRQ A;  4F4X A;  5I5X A;  1ZX3 A;  3F7V C;  5JH7 F;  1R9T A;  1AR5 A;  4CKC A;  3K3P A;  4A2A A;  4R7C A;  4GYC B;  4OX9 B;  1E79 G;  1N34 H;  2CZG A;  1MZE A;  4FJC C;  1GKF A;  5HFL A;  5LGN A;  4IIJ F;  5T14 A;  4TVI A;  5C4X G;  3KAJ A;  4DR5 O;  5FD5 A;  1GSA A;  2YI9 A;  5IWA O;  3K5L A;  4A3E G;  5IDJ A;  4HZ3 A;  4JZG A;  1IBM H;  3P30 A;  2EJ2 A;  2PZS A;  1N36 B;  3K5O A;  4FS1 A;  4PEL A;  3N2K B;  3M9M B;  3G4S V;  4BBR G;  3G80 A;  1KP3 A;  5CBF A;  4YJ2 F;  1IBL H;  4LSA A;  2VQE O;  4JV2 A;  1VQM V;  2CTP A;  2VRZ A;  2OTJ V;  1S5J A;  1GSH A;  4J0M A;  3FB7 C;  4Q8E A;  3HOX G;  2WA4 A;  1KU9 A;  3AG2 C;  3HR0 A;  1FVI A;  1I5X A;  2CGN A;  3NBY B;  1HNW O;  3D36 A;  3R65 A;  4DUZ B;  4X65 O;  5KX5 B;  2W6N A;  2XAF A;  3E8G A;  5LOV F;  4JI1 O;  3N40 P;  4UB6 Z;  2FP4 B;  3Q8P B;  4B7E A;  1DLB A;  1GYF A;  3J7A U;  4ZBM A;  1HNZ B;  1SKV A;  2UXX A;  3GDE A;  3I55 V;  3R5F A;  2FB5 A;  4BW9 A;  1WAZ A;  5KHJ A;  1A9X A;  5L3F A;  4R6Z A;  2GLT A;  2XAG A;  2JGD A;  3C90 A;  2HKO A;  3RYF A;  4DV4 O;  1NJI W;  1OCR C;  3K5M A;  4DV1 H;  2DJV A;  2E5L B;  3KHH A;  1M90 W;  4MV8 A;  2FKL A;  1IBM O;  3LSQ A;  2PMZ A;  3H3V H;  5KA5 A;  4F4Y A;  3B09 A;  4U3J A;  5LMN O;  3SYC A;  3ORQ A;  3UZO A;  3BA8 A;  1SS3 A;  4F4L A;  2WTF A;  1VQO V;  4DR6 B;  3SPI A;  5I5T A;  3PW0 A;  2HG8 A;  1OBG A;  5IYB O;  1N8R W;  3AK1 A;  3T9B A;  2DPJ A;  4K8X A;  2QDO A;  1V51 A;  1I3Q A;  5IYB G;  1KJI A;  3MR3 A;  3AK2 A;  3DXR A;  4X62 H;  4DV7 O;  2DYR B;  4X1K B;  4RZQ A;  5F9N A;  4QWA A;  1YEW A;  5JH7 A;  4RUE A;  1PPJ H;  4DW0 A;  3ASO B;  4JI2 B;  4TQS A;  5EZY B;  4LF5 O;  1WJZ A;  5H5N A;  5EK0 A;  3BAB A;  3QF7 A;  2CFM A;  2R85 A;  1OCC C;  3HB3 B;  1S9F A;  4BY1 G;  1JMK C;  5KUM A;  3UT5 B;  5KG7 A;  2XCL A;  5BMV F;  4UB8 Z;  4A2B A;  5KG4 A;  2JEJ A;  3SDL A;  2XTA A;  4TV9 F;  3WWH A;  3WFV A;  3GV8 B;  1NVP D;  4JPR A;  5LMU O;  1N33 B;  1BHA A;  5FLX N;  4Q45 A;  2KG7 A;  3RR5 A;  4ED3 A;  2UVU A;  5L3C A;  1WA8 B;  3STZ C;  5CR5 A;  4X66 O;  4ECY A;  3CCQ V;  3Q4H A;  3ZRW B;  4TM5 A;  1AUV A;  1B04 A;  2R92 G;  2HVQ A;  1HP8 A;  5KFG A;  1XNQ H;  4U3J B;  4JI8 O;  1K33 A;  1YVW A;  1GSO A;  3CSX A;  5GON B;  1ENV A;  1NZ6 A;  1SA0 A;  2XAS A;  3KCX A;  4MVS A;  5E79 Z;  1NTK H;  2ZIO A;  1UPG A;  4X1Y B;  4MA0 A;  4JI0 O;  3W1G A;  1C3O A;  4X1Y A;  2BOB C;  4J7Z A;  3ZHS A;  4PI2 A;  4R8U B;  3GIK A;  5EC1 C;  5JVD F;  1XNQ O;  4B3R O;  1I0H A;  3LNM B;  5EOY A;  2IH1 C;  3H4B A;  4YY3 B;  2JIZ G;  1BJT A;  5DMX A;  4IR1 A;  3QQM A;  4JAA A;  2WB1 E;  3H0G G;  4AYB A;  5E1A C;  1GM9 A;  4Q20 A;  5DAA A;  3HT5 A;  4WHX A;  4DR1 O;  2YIB D;  1R3J C;  5HBR B;  4GX2 A;  2XAQ A;  2Q6A A;  2QM8 A;  1RYR A;  4DV5 B;  4RUA A;  3OMN B;  5I60 A;  2W9B B;  5BPH A;  5KG3 A;  1FFT B;  5LBQ A;  1K34 A;  1B6S A;  1ZLZ A;  1VIB A;  3RFC A;  3CCR V;  2XAJ A;  5EWG A;  4MS2 A;  4MTX A;  1GO3 F;  3B8N A;  4FLT A;  4ME6 A;  1HW7 A;  4MV1 A;  2X6C A;  1AR4 A;  5D1O A;  4O2A F;  4YJ2 B;  4X1I B;  3QG5 A;  3OSP A;  2R9A A;  4X1I A;  1E1Q G;  2FK3 A;  3AG3 B;  2EIL C;  1Y74 A;  1FJG H;  4GUN A;  3Q8S B;  2YRW A;  3WU2 Z;  1EZV H;  4X64 B;  2VA3 A;  4IHJ B;  1IXM A;  2F4V O;  3WB2 A;  3G6B A;  2WLH A;  3CCS V;  5E25 A;  5IJ0 B;  1RK5 A;  4J9N A;  2R7Z G;  4H13 B;  3P3P A;  1Z5W A;  2VWK A;  1PL4 A;  3IGA C;  5LXT A;  2UXN A;  5EZY F;  1ZTE A;  4DLK A;  2EIJ C;  5BWV A;  4X65 H;  3ZHQ A;  1H2S B;  3LQS A;  4FE2 A;  2GPS A;  1IDS A;  2A06 H;  2M6Y A;  1K83 A;  5LMN H;  4DR6 H;  3SJA C;  5KG6 A;  1GM7 A;  2R8J A;  1OCR B;  2CE4 A;  5DGB A;  4B3M B;  1V54 C;  2PN1 A;  3KCY A;  2AZ2 A;  3RAQ A;  3J81 N;  3WB0 A;  1QVG U;  2AGP A;  5LP6 A;  3JCU Z;  4NLG A;  2VWJ A;  4O7L A;  5IYZ F;  1SQQ H;  4DV4 H;  4FFP A;  4DV4 B;  1WRV A;  3UQ8 A;  1WSC A;  4DAA A;  5KFO A;  1WLE A;  4DR7 H;  4LWS A;  3QNE A;  2WLN A;  5KFC A;  1YSC A;  2QK4 A;  4MTD A;  1X59 A;  1XL6 A;  2YID A;  2GHY A;  5HFM A;  5LGU A;  4CMF A;  2Y0S E;  2JEF A;  4DQN A;  5IWA H;  2XCA A;  4NYE A;  4FFB A;  4N23 A;  5JQG B;  4UCS A;  4PDM A;  4KL1 A;  4TUY B;  5BWR A;  3UYY A;  1HNW H;  1OHH G;  2C22 A;  4LF8 O;  2MCT A;  1IUR A;  2WE6 A;  4QE9 A;  2R8H A;  3JAM N;  1XRE A;  4NKG B;  3MD0 A;  4YHH H;  4UXN A;  3OGI B;  5TIS Z;  5KT5 A;  3ASO C;  3KHL A;  3EFF K;  1BL8 A;  2HJW A;  4TT3 G;  3AG7 A;  2Q67 A;  2GUZ B;  4RU9 A;  3N41 B;  4DV5 H;  4DL7 A;  2QKC A;  3ABL C;  2O57 A;  2HR3 A;  2YSU B;  1NVP B;  2QKA A;  1XOU A;  5CA1 B;  3QWU A;  2M7W A;  2J9G A;  5KX5 F;  1CXZ B;  4YY3 H;  5FNV A;  5FLX W;  4JI6 B;  2P7T C;  2ZIM A;  2IU0 A;  2NU6 B;  4I55 A;  2ETN A;  2EZO A;  4LWS B;  2J6S A;  1Q6I A;  2Q4P A;  2W9C A;  4YIO A;  4HN2 A;  4X8A A;  2R9I A;  5L1J A;  4PA6 A;  3G6V A;  2VQF H;  3W7X A;  5K2M A;  3E8B A;  3ZJZ A;  2UXC H;  3F5W C;  5FJ8 G;  2R8I A;  1A32 A;  1H8E G;  1OV9 A;  5ITZ A;  2OT5 A;  2EX3 A;  3K3V A;  3GWK C;  5EWF A;  3CCM V;  1EM1 A;  2NR5 A;  1FXH A;  2ZDI C;  3L71 H;  1WA8 A;  4FLY A;  1CKN B;  1I94 O;  2R86 A;  4O2B F;  2ODM A;  3VQY A;  2P4K A;  4LF6 B;  3CEI A;  3OTO H;  4I9W A;  1VQK V;  4JI4 O;  1IYD A;  2V7Q G;  1Q6H A;  4DV6 B;  4O4I A;  2XCP A;  3ZN0 A;  3E22 A;  1F4M A;  2H3O A;  3RYH A;  4AIL C;  3GWO A;  4YR2 A;  5JQW A;  2EBO A;  4DL6 A;  4LH6 A;  1E1R G;  5IJ9 A;  3SYP A;  2FJZ A;  4NXM O;  3T9C A;  1I7F A;  3F5T A;  5LYJ F;  1GH6 A;  1N48 A;  2UUB B;  2MK3 A;  3OEE G;  3CC2 V;  3CQZ A;  1DAA A;  2ODT X;  1EUD B;  4HBN A;  3ABK B;  1AR1 B;  2BE3 A;  3JRX A;  4RB2 C;  2YIB A;  1NR1 A;  2BSK A;  5LOV A;  3VMM A;  4QJF A;  2C2R A;  1M0W A;  2UUA H;  5LP6 B;  3OUZ A;  2V4D A;  2OH2 A;  1FPO A;  1M6V A;  2LGW A;  1X4T A;  1A0I A;  4WF9 V;  1JXL A;  2CTR A;  3ASN C;  4NXN H;  3U0G A;  3N6X A;  5BWW A;  1BMF G;  2OYQ A;  2HDK A;  3PW5 A;  5DGI A;  2ASJ A;  5KG5 A;  5CB4 A;  4YJ2 A;  3E8F A;  2JJ2 G;  5BZB A;  1VQ7 V;  5IWA B;  2UUC B;  4Q4D A;  1GO3 E;  2ASD A;  1SQB H;  2UUC O;  3ZMS A;  4EQ5 A;  4JI5 H;  3QO8 A;  3E8H A;  2ZDH A;  1GN2 A;  4JTD B;  1ZSP A;  2P6J A;  4CS2 A;  1EN6 A;  4NTW A;  1W0J G;  2GUZ A;  4IYH A;  2DPI A;  1XNR H;  1IBK H;  1ET0 A;  3GID A;  1K4C C;  2PMZ E;  3W5O A;  3M9O B;  5CMU A;  1GM8 A;  1Q3E A;  1TUB A;  2HG5 C;  2HVR A;  2X6B A;  1G2W A;  3QFF A;  5C8Y B;  4P30 A;  2VQF B;  4JYB A;  1R6N A;  4C7U A;  5C8Y A;  1Z2N X;  5HV6 A;  2NLJ C;  1NT2 B;  1KQS U;  4PA9 A;  1WP7 A;  4FM0 A;  1Z2P X;  4PZ7 A;  1BXR A;  4MT8 A;  2DE0 X;  3H1H H;  2AW9 A;  3LDC A;  3H20 A;  2A9H A;  1VF6 A;  4LC1 A;  4L87 A;  1CKN A;  4FZ1 A;  3JAL B;  4CC6 A;  3CX5 F;  3DSQ A;  1M57 C;  4LF8 H;  4ECR A;  5JVL A;  1OWT A;  1NR7 A;  3CMA V;  1RPO A;  2JA7 G;  3GB7 C;  4W4L A;  5K3W A;  2LJ2 A;  3G6Y A;  4RAZ A;  3N44 B;  2FKX A;  2R7M A;  5KFQ A;  5EBW C;  4TOI A;  3VQV A;  4QPJ A;  5IP7 G;  2R6F A;  4ECW A;  4JYA H;  5BR8 B;  2K9P A;  4DUY H;  4O82 A;  3OTO B;  2QTO A;  4R8C A;  3MWD A;  4LFA H;  1MA1 A;  4OPH A;  2QWN B;  3HKD A;  2GBO A;  5LMU H;  2W7P A;  5KT7 A;  2JVD A;  4KP4 A;  4DV0 H;  2JEG A;  1GN6 A;  3H9V A;  1RSO A;  3DTF A;  4YB8 B;  4BY7 G;  2UXD O;  3RTX A;  4O4H B;  2RF4 A;  3BFR A;  5LP6 C;  1XBL A;  5CA3 A;  3GB8 B;  3L9D A;  2R72 A;  1GRJ A;  3K5N A;  2KG7 B;  4HYK A;  1KC8 W;  3WB1 A;  1BZK A;  1VAJ A;  2IMW P;  1S68 A;  4QPK A;  2BQR A;  3ZBH A;  1MZF A;  4CH4 A;  4UVC A;  2YEV B;  4WBN F;  1EKP A;  1L0L H;  4P9P A;  4J9K A;  4C5A A;  4XX0 B;  3MR2 A;  2Q7E A;  4O3R A;  1H2M A;  1VQ5 V;  4RUF A;  2YRX A;  2QF7 A;  2R82 A;  1B3Q A;  3SR2 C;  3CCE V;  2UXC O;  3HKD B;  3QVN A;  2PI4 A;  4MTO A;  2WAM A;  4FLU A;  4EKW A;  1QHT A;  2QKS A;  4NZN A;  5KKN B;  1RYS A;  1AJP A;  1Q86 W;  1BS3 A;  4LF9 B;  4DR4 H;  3JZ6 A;  5KFE A;  4PDV A;  4NXN B;  1M93 A;  3S24 A;  5C3E G;  4JGS A;  4O3P A;  1BGW A;  5KFY A;  2LO1 A;  5EBL C;  1S0V A;  3CXH F;  4I55 B;  5KFA A;  4DV2 H;  4PV1 B;  5EWE A;  4X64 H;  1K5S A;  4JTA B;  5LXT F;  5I47 A;  1JKJ B;  1YHQ V;  1RJQ A;  4K6N A;  3Q4H B;  3MR5 A;  1M9N A;  4MVR A;  3SPH A;  1PP9 H;  3SNO A;  4B3R H;  4ZHQ A;  3K5I A;  2ITC C;  3N43 B;  4DV3 O;  2BSK B;  4K0K O;  3K0G A;  5L3D A;  2Y69 B;  1TUE B;  2BOC C;  1CKO A;  1IBK B;  2EIK B;  1KKD A;  3H01 A;  3K9S A;  3L4K A;  4JV5 H;  2Z5U A;  4HR7 A;  4ECU A;  1KJJ A;  1LUV A;  3ZRS A;  4OGQ B;  2HHH B;  3HB9 A;  4QWC A;  1ZET A;  1HNX H;  1BQ0 A;  2CQY A;  3C3S A;  3U11 A;  1N32 B;  2P67 A;  2CH7 B;  3T54 A;  1JX9 A;  2O03 A;  3H0G A;  1A48 A;  2P5O A;  4O4L B;  3LDE A;  4X62 B;  4M9U A;  4OX9 H;  4X89 A;  3ZMZ A;  3I4M G;  1BE3 H;  3H1I H;  5B1A B;  2CDY A;  4G28 B;  3X2Q C;  4UV9 A;  1EZ1 A;  3JAK A;  3BHP A;  4O4H F;  4H44 B;  3T2M A;  2YUA A;  1UC8 A;  2Y0S A;  4GT1 A;  2AGO A;  1TA8 A;  1YIJ V;  3JAR A;  4LF6 O;  2NU7 B;  4EGQ A;  4J10 A;  2R92 A;  1JDB B;  3T4Z A;  3FDS A;  4ECZ A;  2ZE8 A;  1YF2 A;  4DR5 B;  5KFD A;  2QYZ A; 
#chains in the Genus database with same CATH homology
 4LF4 H;  2BTQ B;  2BTO A;  3JAT B;  1O75 A;  3RR5 A;  3ZED A;  5KMG A;  4O2A A;  3GJX B;  3VNN A;  4DV0 B;  1T5E A;  1AN7 A;  1M0T A;  2VQE H;  2F93 B;  4DV3 H;  4K0K H;  3N42 B;  4LFA B;  1B04 A;  1WNS A;  3N2K A;  2HVQ A;  2YCH A;  3RJ0 A;  4HNA A;  2OWO A;  4DR7 B;  1SA0 B;  1XNQ H;  4U3J B;  4JI2 H;  3CSX A;  5GON B;  1SA0 A;  4FLW A;  2VOB A;  3ETQ A;  3NC0 B;  1ZHS A;  2ZIO A;  4X1Y B;  2YI8 A;  1JFF A;  3W1G A;  3T1Y H;  1SQG A;  3THO A;  4LF9 H;  4X1Y A;  4PI2 A;  3K57 A;  5EYP B;  1M5I A;  4LH7 A;  5EOY A;  5D5P A;  4JI7 B;  4CH5 A;  4YY3 B;  4B3R B;  5D1P A;  1BJT A;  4LF5 H;  2CAZ C;  4MTE A;  4ZIB A;  4BWA A;  4I50 B;  4ZOL A;  2YIB D;  3N2G A;  5LOV B;  4DV5 B;  3JAT A;  1X9N A;  1TUB B;  5JJN B;  3HKC B;  1Q5O A;  3U0Z A;  4DR1 H;  4YHH B;  5KHH A;  2QJ1 A;  5A2Q W;  3T1H B;  5LMN B;  4FLT A;  1O9G A;  5J2U B;  4EB6 A;  2WDT A;  3IAY A;  4B08 A;  4FM9 A;  1HW7 A;  5D1O A;  3CVZ A;  4YJ2 B;  4X1I B;  4EFE A;  3QG5 A;  4BWS C;  1XMQ H;  4LFB H;  2R9A A;  4X1I A;  1SQF A;  1FJG H;  2HIV A;  4PI0 A;  3RYC A;  4ETS A;  4ZI7 A;  3RF2 A;  4TV9 B;  4CS4 A;  1XMO B;  4DV2 B;  1XNR B;  4GKK H;  4X64 B;  4IHJ B;  4O4I B;  3WB2 A;  1M4U A;  4LNU A;  5IJ0 B;  3RYI B;  2Q2T A;  2UXD B;  1WPB A;  1QQC A;  4UCR A;  3RYI A;  4TQD A;  1Z5W A;  4JYA B;  3HKE A;  2VWK A;  5LXT A;  2CW8 A;  5LA6 B;  4ZOL B;  4X65 H;  4B3T B;  4D7T A;  1N32 H;  1H2S B;  1XHX A;  5LA6 A;  4JI1 H;  5JJE B;  5BMV A;  4L8J A;  3CB2 A;  4DR5 H;  4CS3 A;  5LMN H;  1I94 B;  4DR6 H;  3SJA C;  2F4V B;  3JSL A;  5LYJ B;  3FFQ A;  4DRF A;  4B3M B;  4GLX A;  4EB6 B;  5J2U A;  3WB0 A;  3JAW A;  5LP6 A;  4PZ8 A;  3RWR D;  1Q43 A;  2VWJ A;  4O2A B;  4DV4 H;  4YJ3 A;  4DV4 B;  3UQ8 A;  4JI3 B;  2BTQ A;  4DR7 H;  4CC5 A;  3M4I A;  2JGU A;  3JAL A;  4MTD A;  1N36 H;  2R70 A;  4I7H A;  4JI8 B;  1N33 H;  5IWA H;  2FE3 A;  1IBL B;  4FFB A;  3T1Y B;  5JQG B;  4UCS A;  2ZM6 B;  1ZHQ A;  4FFB B;  4KL1 A;  4TUY B;  4LNU B;  1TAE A;  4CH3 A;  2PYJ A;  2PYL A;  2ZNI A;  2PGG A;  2UXB B;  1SEI A;  3JAM W;  1HNW H;  3TY8 A;  2MCT A;  4IAJ A;  4JI7 H;  1HNW B;  2ZCE A;  2WE6 A;  4E6N A;  5CB4 B;  5LXT B;  4YHH H;  5GON A;  1Z5V A;  4GKJ H;  4ZI7 B;  4TV9 A;  4LMY A;  1I6U A;  1WH2 A;  3N41 B;  1TVK B;  4LR3 A;  4DUZ H;  2JS5 A;  4K8Z A;  4DV5 H;  5KHK A;  3MWM A;  5LYJ A;  5K1P A;  4EEQ A;  4FM1 A;  2ZJT A;  4DV3 B;  4K0K B;  4B3S H;  5CA1 B;  3QWU A;  4JI0 B;  4YY3 H;  4I50 A;  5FNV A;  1VF7 A;  4JI6 B;  5FLX W;  5D5Q A;  1ZAU A;  2ZIM A;  5FNV B;  4TV8 A;  4I55 A;  3PN1 A;  3J80 W;  3BAA A;  2ZIN A;  4LF7 H;  3RYF B;  3L2P A;  2KKW A;  2VQF H;  4RAY A;  2E5L H;  4DRX A;  5JVD A;  4AQY H;  2UXC H;  5IT9 W;  5FD6 A;  4APM A;  5ITZ A;  3K3V A;  2EX3 A;  5LMU B;  5ITZ B;  4JI4 H;  3KYH C;  4I4T B;  3BPZ A;  4FLY A;  1CKN B;  3HKB A;  5EYP A;  3VQY A;  2VQE B;  2XHB A;  4LF6 B;  5BR8 H;  3OTO H;  4EFB A;  3SJC C;  4DV6 B;  3RFR A;  4KHP B;  2UU9 H;  3A2F A;  4O4I A;  3RYH B;  4LFC B;  1XI1 A;  1HR0 H;  1FJG B;  4MV9 A;  1IBM B;  3E22 A;  4WBN A;  3RYH A;  4AIL C;  4NXM H;  5J2T B;  3LNN A;  5JH7 B;  1XNQ B;  2PUS A;  4LH6 A;  1JJO A;  5FPR A;  5K1X A;  2RGR A;  1Z2O X;  5IJ9 A;  4LF7 B;  3HKC A;  4TV8 B;  1TVK A;  2ZM6 H;  4JI5 B;  1P16 A;  1I7F A;  3B2E E;  2UUB B;  4PDB A;  1L2Z A;  1SYX B;  4RB3 C;  4UFZ A;  4HBN A;  3VQX A;  4DV7 B;  3K59 A;  4PZ6 A;  4RB2 C;  2YIB A;  2RQ6 A;  4JI4 B;  2P22 C;  5LOV A;  2F4V H;  2YXL A;  3QTC A;  4LF4 B;  1M0W A;  2UUA H;  5LP6 B;  1HNX B;  2V4D A;  3HXL A;  2HHH H;  2Q7H A;  1A0I A;  1X4T A;  4I4T A;  5KMG B;  3F8N A;  4PHZ A;  4B3T H;  1D5A A;  3HKB B;  3JSN A;  4NXN H;  2RJZ A;  3N6X A;  4D7S A;  4IHJ A;  2OYQ A;  3CHX A;  1I94 H;  3NBZ B;  5CB4 A;  1P8L A;  4O4J B;  4YJ2 A;  4LSX A;  2UUC B;  5IWA B;  4RB1 A;  4EQ5 A;  4R7R A;  4JI5 H;  4B3S B;  3JAK B;  1J5E H;  1XMQ B;  3L4J A;  5IJ9 B;  1J5E B;  4FVM A;  4CS2 A;  4JI3 H;  4M7E A;  4UCT A;  4F6R B;  5IYZ A;  2F1M A;  4IIJ A;  4O4L A;  1XNR H;  1IBK H;  3ZS8 C;  4JV5 B;  3W5O A;  3TY9 A;  1Q3E A;  2Q0A A;  1TUB A;  2HVR A;  2PTM A;  5C8Y B;  2UXB H;  3RGZ A;  2VQF B;  3KAK A;  3K58 A;  3VQW A;  5C8Y A;  4DR1 B;  1L8D A;  1Z2N X;  1NT2 B;  3FMA A;  2HEP A;  4JI0 H;  4FM0 A;  4DRX B;  1N34 B;  1TGO A;  4ZHQ B;  1Z2P X;  4PZ7 A;  2W57 A;  4O4H A;  3JAW B;  1XDN A;  2WYO A;  4YJ3 B;  3H20 A;  1CKM A;  4DR4 B;  1WN7 A;  5D1O B;  1CKN A;  3J81 W;  3JAL B;  3SJB C;  2F66 C;  3BRC A;  4CC6 A;  3DSQ A;  1FKA H;  1HNZ H;  4LF8 H;  2F95 B;  3KXY T;  1XMO H;  5KHI A;  5IJ0 A;  3RYC B;  5KX5 A;  4TQF A;  5CA0 A;  5IYZ B;  5KHG A;  3MAQ A;  4X20 A;  3RGB A;  5LL6 b;  3C0F B;  4RAZ A;  3HKE B;  3N44 B;  5DIS C;  5EIB C;  4X20 B;  4DV1 B;  3VQV A;  4TOI A;  2Q7G A;  1JFF B;  4X66 H;  4JYA H;  3TY5 A;  5BR8 B;  4DUY H;  4LF6 H;  4WBN B;  3OTO B;  2CW7 A;  1N33 B;  4A2A A;  4DV7 H;  4LFA H;  1KMI Z;  3HKD A;  1V9P A;  4GYC B;  4OX9 B;  3EYY A;  4DR2 H;  1N34 H;  5LMU H;  4I9Q A;  5BMV B;  4DR2 B;  3JAS B;  4FM2 A;  4NVP A;  2JVD A;  4DV0 H;  2UUC H;  1RSO A;  4O2B B;  3KAJ A;  4B3M H;  3RTX A;  4O4H B;  3GB8 B;  5LP6 C;  3N2G B;  2R72 A;  3K5N A;  4O2B A;  5FD5 A;  2YI9 A;  3WB1 A;  3K5L A;  1XQ8 A;  1FFX B;  1HR0 B;  2Q2U A;  1MZB A;  1IBM H;  4LF5 B;  1S68 A;  2QM4 A;  3ICX A;  2PZS A;  4NXM B;  4CH6 A;  1N36 B;  3K5O A;  4CH4 A;  2RGV A;  2IM9 A;  4JI8 H;  4UCV A;  3IG0 A;  4RB0 A;  1P49 A;  3N2K B;  3BA9 A;  1E4G T;  1IBL H;  2E3C A;  4LSA A;  2HIX A;  5JCO C;  5JVD B;  2KSW A;  5JQG A;  1S5J A;  4J0M A;  4HNA B;  3U10 A;  2Q7E A;  3E22 B;  1KU9 A;  2ZNJ A;  1FVI A;  3NBY B;  3OTF A;  4F6R A;  1G6U A;  3SR2 C;  4DUZ B;  3HKD B;  5KX5 B;  4FLU A;  1QHT A;  3N40 P;  5CA1 A;  4LF9 B;  4DR4 H;  2YIA A;  4MV7 A;  1GYF A;  4NXN B;  2VUG A;  3DF7 A;  1M93 A;  1O9H A;  2UU9 B;  3S24 A;  1HNZ B;  1SKV A;  4LF8 B;  4KHP H;  1BGW A;  3GDE A;  4JI6 H;  4LFC H;  3T1H H;  4I55 B;  4DV2 H;  4BW9 A;  4Q6G A;  4X64 H;  4AHC A;  5KHJ A;  4FLX A;  4DK1 A;  4FLZ A;  3RYF A;  4Q0Y A;  2UXD H;  1E4F T;  3K5M A;  4DV1 H;  1VS0 A;  4FLV A;  1XK5 A;  2E5L B;  3W1B A;  3KAL A;  4DUY B;  4AQY B;  2UXC B;  2UUB H;  4B3R H;  4ZHQ A;  4TUY A;  3N43 B;  4U3J A;  1S03 G;  3M7M X;  3RGX A;  4GKJ B;  3BA8 A;  3RIZ A;  3SGI A;  1CKO A;  1IBK B;  1Q8I A;  4DR6 B;  4DR3 B;  3L4K A;  4JV5 H;  4DR3 H;  2UUA B;  2HHH B;  1HNX H;  1XHZ A;  5CA0 B;  3U11 A;  4K8X A;  5EIB D;  1N32 B;  5FPO A;  4DV6 H;  2O03 A;  4UCO A;  4X62 H;  4X1K B;  2P5O A;  4RZQ A;  4O4L B;  4O4J A;  5J2T A;  4X62 B;  5JH7 A;  1YEW A;  4UCU A;  2XIG A;  4OX9 H;  5JJJ B;  4X1K A;  4JI2 B;  4GKK B;  2HGS A;  4DK0 A;  5EZY B;  3LML A;  3JAK A;  2CFM A;  3BHP A;  3BAB A;  3QF7 A;  3UT5 A;  3JAR B;  5EZY A;  1JMK C;  3JAS A;  2PY5 A;  2GV9 A;  1TA8 A;  3JAR A;  3UT5 B;  4LFB B;  5JCO A;  4X66 B;  2VPS A;  4IIJ B;  1DGS A;  4X65 B;  3J7A K;  4A2B A;  4JI1 B;  2HVS A;  4DR5 B;  1FFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...