3PNLB

Crystal structure of e.coli dha kinase dhak-dhal complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
GSSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-bind
publication title Structural and mechanistic insight into covalent substrate binding by Escherichia coli dihydroxyacetone kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 84
structure length 211
sequence length 211
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pnlB00
2BTDA 1UN8A 3CR3A 3PNLB 4LRZA 1UN9A
chains in the Genus database with same CATH superfamily
1N94A 5KNHD 3FUMA 4YNDA 1WDYA 4XKBA 3B7RL 3JQ1A 2V5QC 3C98A 4HOUA 1PY1A 4U0SA 5ENSD 1ELWA 4GZ6A 2FO1E 3ISMC 3BG0B 1U3DA 1EYHA 3U4TA 1INZA 4OAVB 4HS2A 2FI7A 5KWDA 2AWIA 5ENQD 1BI8B 4J8SA 1JCRA 3ABME 3P1UA 3UKRG 1ZBPA 4CCAA 5LCWC 2WXMA 3PEVB 4AJWA 4I9EA 3MA5A 4G26A 3LJNA 4ABNA 5A6CA 2C0MA 1OCOE 2I1KA 4YVQC 4GZ3A 2Y0BG 4L7TA 3ASNE 1WAO1 1V55E 4JHKA 2WPVA 2XGSA 3Q79A 2XHEA 4E85A 4B8AA 5C1DA 3PZ4A 3EIQC 5E76A 2L0TB 2VGYA 4ANVA 4K03A 4CZ2D 3LCAA 5EDSA 3J5QB 1ELRA 3DEOA 4LSZE 2L6BA 1OWOA 3ZU7B 4BT8A 1BI7B 1SW6A 2PQNA 3SHFA 3CKCA 3RAUA 4GA2A 4WNDA 4APOA 1HG2A 2WXPA 2ONDA 5DIZA 1O1TA 3DXMG 2OOEA 2V8SE 1JWGA 2QZAA 2Y3AA 1PC2A 3LY7A 2V5FA 3PRZA 4GTMA 4GAAA 5KJKA 1UJJA 3Q7AA 5KJLA 4E6HA 1PAQA 4WNGA 5ENPD 5M72A 3W9FA 4I6JA 3ULEG 2V4HC 4HLLA 2LAIA 4DLOA 3CVPA 1LD7A 5JJ6A 2GRNB 3RKVA 3ONLA 4I2ZA 5T8IA 4JB8P 3CVNA 1QNFA 4ME2A 3UQ3A 2WXQA 3D9HA 4CYMD 5ITZF 3Q47B 2KBXA 3ZXSA 4EHMA 4HNAD 3PZ3A 4GYOA 3D9KA 2XZDG 1TJCA 3PE3A 3FDHA 3NQPA 1H0AA 1MJ0A 4OAUC 1QQEA 3C5RA 2R03A 4LNUD 3O4ZA 1QYMA 5FQ8A 3BUAA 4BWRA 2X6FA 1H2VC 1N52A 3ZVVA 2XPYA 1E96B 5ENRD 5ENTD 3B7SA 3DBSA 2EIJE 3GYZA 4JA9A 1YYHA 5AQ7A 4C48B 3I3NA 4ZHBA 2PNNA 3AG3E 4APFA 1HFAA 1TNOA 1UN8A 2J49A 3B7TA 5EIDA 3JXIA 3DSWA 2PZIA 1KPSB 3CK8A 2V4LA 3DPYA 4UQZA 3V31A 3T9KA 2LAHA 4B8CB 1N11A 3JQ0A 5LP0A 4XKCA 3E32A 4FA6A 4I9CA 5ENNA 5AARA 2OVFA 3UT8A 3CHSA 1Z3YA 1E7UA 3CVXA 3EHQA 2XRYA 1Z5SC 3I4RB 3TWRA 3R9MA 5FZRA 3B13A 4HB5A 3LY9A 2UY1B 2JLBA 3TG4A 1Z6TA 2C0LA 4JW1A 1ELKA 1W3BA 3RSEG 5CEAA 3ENEA 3KSQA 3G2SA 4LNGA 3LVRE 1OCZE 4GTTA 2MYOA 4HBDA 1U3CA 3D9OA 4BFRA 2PL2A 3KEAA 1N95A 3QB2A 4I17A 4DX5D 1AP7A 1K1BA 4HOTA 4HOSA 4W9RA 2CHZA 4XI9A 5BNWA 4I2WA 4WWOA 3J5PA 2GGFA 4LEUA 4F53A 4U07A 2WVIA 1KT0A 2X38A 3HVEA 1K1AA 4JHRA 3NF1A 3FUEA 5AENA 2I9CA 1FT2A 3ZHEB 4GTOA 5BV1A 5BV0A 2M63A 3ZYMA 3D9NA 3BG1B 3ZN3A 2VGEA 3AG1E 1MZCA 3FTWA 3PNTB 4FHJA 4N39A 3CK7A 2QFCA 4EZLA 1EDUA 3Q9UC 4HRLA 4U63A 3I5PA 1N9AA 3LY8A 4U96D 2I6HA 2AXVA 2VSYA 3G2UA 2HM8A 2VYIA 1NL4A 3ULQA 2MOWA 3ABKE 4OVUA 4JD2G 2P9NG 3ZYLA 4HI8A 4JVSA 3FUFA 3K9IA 2EINE 3Q4AB 1VDYA 3AS8A 1TNUA 4DX6D 3LVQE 3Q49B 3OXFA 4HRMB 3AG2E 4GB9A 2F8YA 2P58C 3UT7A 3QJZA 2P9PG 1JCSA 2R05A 2ETAA 4WWNA 1IHBA 1OWMA 2E2EA 4R7LA 5HQ8A 4DRXE 2VTBB 4G8KA 3S7FA 2JEKA 4GYYA 2J4DA 4UWLA 3ZYKA 3ZPJA 3EHMA 4I1OB 4U7EB 1NA0A 1XNFA 3FU6A 2YQ8A 1DCEA 1HE8A 5ANRA 3QWWA 4FULA 4C0MA 3MZLB 4A1SA 2WB2A 4K0RA 4HQDA 3UM3A 3R9AB 4PUCA 2KATA 3FULA 3I4GA 3PUKA 5G05C 1X81A 4A63B 3ONKA 3APCA 4U95D 4GTSA 3CK9A 5FWQA 4RSYA 2XCBA 1KT1A 2WMOA 3SO8A 4KT6B 1NZNA 2P9KG 3CGHA 3WXXA 4UWGA 1LTXA 3CQGB 3CHQA 4F6RD 1E8XA 4O1OA 3C3RA 3JUIA 5KCMA 4FP7A 2NSZA 4BESA 3APFA 4L1BA 1OWPA 2IOLA 1OWNA 4KYOB 3KAEA 4XEIG 4FC8A 4NIKA 1A17A 3PVLA 3ZUVB 3JCKC 2R2LA 3ML9A 2R02A 3Q7FA 2J08A 4PDXA 1TN6A 2X3MA 4GZCA 2VGXA 3GW4A 4N3BA 5B1BE 4UQXA 3PEUB 4KVOA 2XZTG 3TWQA 4IN3B 1TNZA 4BT9A 4U8HA 4UI9C 3ZNGA 3ZKJA 4F1SA 3HYMB 2GRQB 3UX4A 3T5XA 3PUJA 1TJFA 4EPZA 3RK6A 3EHRA 5CBOA 2YHCA 1E7VA 1IXVA 3SQVA 3CHMA 4IULA 1UJKA 3LXUX 5CBNA 3UI2A 4LERA 5BW8C 1DC2A 4IRUA 1BPOA 4J8DA 4NQ0A 3SI5A 3CVUA 3HDXA 4LG6A 5B3SE 3NZUA 3FFLA 3V30A 4N5QA 4JHJA 4JC8A 1S70B 4AOFA 3HHMA 4AVXA 3RRMB 4JEHA 1WY6A 2LNIA 3FY4A 2XPIA 2JABA 2EIME 1EPUA 2RKKA 4U0ZA 2Y69E 1KZPA 3L9TA 3FWVA 1JUQA 5T4YA 2XPZA 4I6EA 4L23A 2IQCA 4CT0A 3MCXA 4D10C 2DZOA 4N2QA 4BSXA 4UI9K 3IXEA 4GTQA 1DVPA 1IKND 4HORA 1D8EA 1E8ZA 2WXLA 1O1SA 2WQ6A 2OCCE 3ZHEA 3ZRHA 1HF8A 3Q5MA 3FH5A 3IHVA 2WM9A 1XGWA 1K3ZD 5JHBA 5IY5E 3TXNA 3KD7A 3TWTA 1IHGA 4MKTA 4RG9A 3HIZA 2PM6A 4HRNA 5ANLA 1TN8A 4N3AA 4TXPA 4GMLA 3UKUG 4YVOA 4KBQA 5EYLA 3MEKA 3S2AA 3D9IA 4HOQA 4OYSA 2OEWA 1FT1A 4AXHA 4ACKA 2IF4A 2Q7FA 4U04A 4RVBA 1O5MA 2WQHA 4C0EA 4KZCA 3UIOC 2WQ7A 3VTXA 2Y4TA 3TJPA 4MRUA 2B0OE 2HE0A 1NFIE 4ILHB 3C3QA 5DBKA 3CEQA 3FUDA 1MQSA 4JPSA 4ANUA 2VTBA 2WXJA 1HX8A 4G24A 5AQBA 3FUKA 4WNEA 4UWFA 3ULYA 4TXRA 3FU5A 2KCLA 3E33A 4YDEA 2BEDA 1DNPA 1OWLA 3L17A 3AS5A 1IYGA 4J8FA 3QNKA 4GPMA 4XI0A 5KNGA 5G04C 3VLFA 4XZ4A 3E34A 3TWUA 2IOSA 1E90A 4HLEA 1A5EA 2P2CP 4J6IA 4B93B 1SA4A 1GW6A 4CGWA 5JJTA 1OXJA 2R17C 3EJNA 1H6KA 3NOCD 3LDZA 3ZW3A 3PE4A 2LUHA 2RG8A 4BEPA 2ZISA 2IO3C 4DUIA 5FQ7A 3FU3A 2IU1A 3DPDA 4EBAG 1QBQA 4O1PA 1E8WA 3SBSA 2AW6A 5AQ9A 4O6FA 4N5CA 4OVVA 4IYPA 3U9WA 4GMRA 2EILE 2ZU6B 4GZDA 4G8LA 2UWJG 2XEVA 1OT8A 4B94A 3TWVA 5G05J 1TNYA 3RO2A 4G1TA 2YINA 1KZOA 3BU8A 2NXPA 2HR2A 4DPRA 3PREA 4ATGA 1H6OA 1BLXB 2MRIA 2X6IA 1TEZA 1UG3A 1TR4A 2L0IA 5B1AE 3E37A 2KCKA 3V2OA 3GZ2A 1LD8A 1HG5A 4C9BB 1YCSB 3JXJA 3OXGA 4RG6A 2J07A 3JYSA 4GU5A 1Y8MA 4UWKA 1RW2A 2WMNA 5EN5D 2NC9A 2WXHA 3MGBA 4EBAA 3PH0C 3MKRA 1N0QA 4FADA 2WXIA 3LPZA 4B89A 2OEVA 4UQYA 2XGOA 1OY3D 1B89A 3QKYA 5FQ6A 2A4ZA 4BSZB 4FJZA 1SQMA 2WXGA 2CHXA 2AXZA 2KZTB 3QWPA 5A7DB 3CKBA 3FU0A 3MV3B 2VSNA 4G23A 4O60A 1HS6A 4G2VA 4YDWA 2QYJA 2ZIRA 4UI9J 3S7BA 3TWWA 4AP2A 3HXFA 4WUYA 2BF0X 2J9QA 5LX8A 4UWHA 2XS8A 3ASHA 3QWVA 3CVYA 2F8XK 3HXCA 2ZGGA 4FLBA 2HO1A 2OVBA 3UUXA 3MV2B 2DIWA 1K8KG 4PS8A 1JPLA 3ML8A 4WWPA 3CQCB 3FEYA 4ILIA 2DYRE 4I43A 3D9JA 3BEEA 2F37A 5FJYA 5LCWJ 1HH8A 2H6HA 1N54A 4NURA 3C3OA 3FTVA 3LS8A 4A3VA 3IBEA 4Y6CA 4BY6A 5T3RA 4L9PA 3AJIA 5G2NA 5EX0A 5J08A 3S7DA 1Q2ZA 2IY0C 3DSVA 3DXKG 2R5SA 3DSSA 3HG0D 3ESKA 1IQUA 5EKQD 4BX9A 2WXOA 4DX7D 2OV8A 5D2MC 3NB2A 2KC7A 5FZSA 4XIFA 3EU5A 2XQ0A 3ZXPA 1N4QA 2EQXA 4CDRA 3UM0A 4F7AA 3UTMA 3QK0A 2KCVA 2IONA 5CEDB 3QC1A 2Y1LE 2LO6A 3QOUA 3TG5A 3EHNA 2L9BA 3AG4E 3CLJA 4DJAA 3S7JA 4AY6A 3EDTB 5EX3A 4AV7A 1H19A 2XRZA 1JCQA 3D9PA 2IO2C 3OAWA 4Q94A 3TL5A 3MJWA 3EU9A 2MHKA 2PM7A 3ZIMA 3RRUA 1G3NB 4HI9A 3B7UX 4EZKA 3DSTA 5LOZA 4Q69A 3C72A 3NAWA 2FEZA 2CFZA 3EUVA 2H6GA 2XEEA 5CCLA 1SVXA 3FTUA 4G25A 4HFGA 3E30A 2FF4A 4DK5A 3U3WA 3CVQA 4HXIA 1E8YA 3T8MA 2A5EA 3AU4A 1SZAA 1UOHA 3MKQB 4FLHA 3GZSA 5E75A 3KS2A 2YHEA 5AJDA 2BUGA 3KSLA 4URKA 3IV0A 4TUUA 3G2VA 2ILRA 5D0OD 5ENOD 5CERB 2P9LG 1QZ2A 1LF8A 1S64A 4M3OA 3SF4A 2A5UA 5CECB 2LXMA 3WG7E 5BT1A 4QQIA 4GYWA 4DI3A 5FQ4A 4KZ0A 4I6GA 3L82A 4N2SA 2GRPB 2CFUA 3CHOA 3V79K 2XEHA 2UY1A 1JWFA 5AYWD 3FTSA 5EIBE 4HVBA 3P2BA 3QARA 5G04J 4GTVA 4GCNA 5AQAA 2F0YA 3HVEB 2GW1A 2J4BA 1UN9A 5KBAA 3O48A 3MYVA 4EECA 4MS6A 3FTZA 3PNLB 1N4PA 3NZSA 1WG0A 4JEUA 2RD0A 5JJ7A 3PZDA 3D9LA 4XX5A 3URZA 3DRAA 3FEXA 3Q78A 1NA3A 3AAAC 4B0ZA 4LRZA 3N71A 2B6CA 4CGVA 2ZXWE 4ZFHA 3L54A 3TGOA 4H7YA 1YMPA 1HO8A 2GRMA 5EYPF 2WXRA 3JUEA 2IFUA 4EQFA 4A55A 2PQRA 3AU5A 1N0RA 2BTDA 2DWZA 4BTBA 3HXEA 5CRUA 1MHQA 3W9GA 2IEJA 4FJYA 2KZTA 5CMYA 5CHEE 3FH7A 1OCRE 3LYAA 3VTYA 3FUHA 2FO7A 3RIBA 3HXDA 4N3CA 2RFAA 2WXFA 2X6JA 3VLDA 3FUJA 3UT4A 4A3TA 2QY7A 5HI7A 5FINA 2C2LA 3FP3A 2GROB 5AIJA 4ANXA 3D9MA 3SY2A 5BXUA 4QFVA 2EIKE 5BUZA 2LSUA 3D3MA 1HZ4A 4RLYA 5HKPA 1NI1A 4MLPA 2QYUA 3UM1A 2CG2A 4TRQA 2KM4A 2XS1A 1SA5A 3ASOE 1OCCE 2GRRB 3FTXA 3UPVA 5D66A 3UINC 3TAXA 1HXIA 1IQRA 2ZGDA 1ZB1A 1EF1C 3UMVA 4AEZC 3X2QE 1NP7A 1O1RA 5AAOA 3SFXA 3NBNB 5JHAA 4JZYA 3QDNA 1D8DA 4Y6WA 3HXBA 4J0UA 4BERA 3QAQA 2XGMA 1FVHA 3NOGD 1FVFA 4RQIA 1OUVA 3CV0A 3CIAA 2VGXB 1TN7A 3E4BA 5AJLA 4K5CA 3ZEFA 2BKKB 4EZJA 3T8KA 2R59A 4CDNA 4DLQA 1KLXA 2I1JA 1P5QA 2QC9A 4NACA 4UUCA 4J7WA 4L2LA 4GZ5A 5FTPA 4JXTA 4ATZD 2LSVA 1FCHA 3FUNA 5A23A 4GTPA 2ETCA 3TWSA 2VSXE 4J8EA 1V54E 1S0PA 3ABLE 3UM2A 2AJAA 2V0PA 3HRAA 2ETBA 3CVLA 5EILA 3L13A 3RU0A 1L5JA 3MKQA 1BU9A 2NYJA 3G2TA 4L2YA 4ACLA 1X5BA 2WXKA 4AM9A 5CCMA 1H6PA 3ESLA 2HYZA 2XENA 2X6KA 5BXOA 4TUMA 4BTAA 4ILGA 3BQOA 5FZQA 4DI4A 3ASDA 4BETA 2DBAA 2AXUA 4U8YD 4WNFA 5JA4D 3FH8A 3UXGA 3Q75A 3L08A 4YDYA 4KXKB 1ZU2A 1RZ4A 5G55A 4K5AB 4U8VD 4Z68A 1Y6IA 2CG3A 4AY5A 3Q9NC 1Z3XA 3CVVA 2VQ2A 3VLEA 3SNXA 5KJMA 2IJGX 5CMWA 2BKGA 1WM5A 2DYSE 2E0IA 2FBNA 3DWLG 3U64A 3Q73A 5BPPA 4PS7A 3L16A 4LCTA 3SFYA 4GPKA 3LKUA 5KJNA 1H2UA 5ARGA 3CSFA 4KMOA 1MX6A 3CVWA 1SZ9A 1YA0A 4P29A 4H7XA 4V3IA 2H6FA 3DSXA 3GZ1A 4X8QA 5CRVA 4M7CA 3PZ2A 1TYQG 3Q15A 3ASGA 4KVMA 2I2OA 3L22A 2L6JA 2P9UG 3G2WA 3ZFWA 3UIPC 2KXPC 1HU3A 5J90A 2YNQA 1DCQA 4A1GA 4XE0A 3ZYQA 3IEGA 5LFAA 4I1MA 4LNBA 4TXQA 4CEMA 3F6QA 2J8SD 4GA1A 2AVPA 2P9IG 2P9SG 2XCCA 4K5BA 3LEWA 1N4RA 4FHKA 3CR3A 4Q96A 3V2XA 2DCPA 3DSUA 4GMJA 3FUIA 2X6HA 4MBGA 3AS4A 4CRWA 2J09A 3TXMA 4I1AA 4U0UA 5JMND 2H6IA 4GTRA 4ANWA 4YDOA 3IKOB 4FU3A 4JA7A 3SD5A 4G11A 3ASFA 1N4SA 4TV3A 3FTYA 3MX3A 3R7RA 3B95A 4F1PA 5H7PA 5HS0A 2FULA 4CT4A 3CHRA 3KEZA 2VJ8A 4GCOA 4DX2A 3DEPA 1MX2A 3U66A 3L6AA 1MX4A 1TNBA 3SFZA 2VSOE 3SZ7A 2LXLA 3OXLA 1UW4B 3CHPA 5C2YA 3RO3A 1MYOA 5FIOA 3PDNA 5AN8A 3CSTA 5FT9A 2Y4UA 4LUNU 5D0QD 5ARFA 4BX8A 4CDMA 4NRHB 3PS6A 4PS3A 3ZGQA 2DZNA 1FPPA 3B7BA 3R7QA 4PH4B 3IHYA 2RFMA 3APDA 4DX1A 2DVWA 3SGHA 3TWXA 3OTNA 4JL0A 1H2TC 3EIJA 2WXNA 4F3VA 2CHWA 4GA0A 1U2VG 1BD8A 5HRYA 3RRNB 4WAFA 1D9SA 3FHEA 2GRLA 3SBTB 3PZ1A 3RJVA 1S63A 4AIFA 3LJ3A 4J8YA 3T5VA 1AWCB
chains in the Genus database with same CATH topology
2NXPA 2HR2A 3FUMA 4QFVA 4YNDA 5BUZA 4XKBA 4I1OB 4DPRA 1NA0A 1XNFA 2LSUA 3FU6A 2YQ8A 3PREA 1HE8A 3B7RL 3JQ1A 5ANRA 4ATGA 3QWWA 3D3MA 3C98A 1HZ4A 4FULA 4HOUA 4C0MA 1PY1A 3MZLB 4U0SA 4A1SA 2WB2A 1ELWA 2MRIA 4GZ6A 4K0RA 2X6IA 3BG0B 1U3DA 1UG3A 1EYHA 4MLPA 3U4TA 1TEZA 2CG2A 2L0IA 1INZA 4HS2A 4TRQA 2KM4A 2FI7A 2KCKA 2AWIA 3GZ2A 3R9AB 4J8SA 3FTXA 1HG5A 3P1UA 4C9BB 3OXGA 4PUCA 3UPVA 4RG6A 1ZBPA 2J07A 2KATA 3FULA 3JYSA 4CCAA 5LCWC 3I4GA 2WXMA 3PUKA 5G05C 4GU5A 3PEVB 4AJWA 4I9EA 1Y8MA 4UWKA 3MA5A 3ONKA 2WMNA 3APCA 4G26A 5FWQA 3CK9A 2NC9A 2WXHA 2XCBA 4RSYA 1KT1A 3TAXA 3MGBA 4ABNA 1HXIA 5A6CA 2WMOA 4EBAA 2C0MA 4KT6B 3PH0C 1IQRA 1NZNA 3MKRA 3CGHA 3WXXA 4UWGA 2I1KA 4YVQC 4FADA 4GZ3A 1EF1C 3UMVA 2WXIA 4L7TA 4AEZC 3LPZA 3CQGB 4B89A 3CHQA 1WAO1 4UQYA 4JHKA 2WPVA 2XGSA 1NP7A 2XGOA 1B89A 2XHEA 3QKYA 1E8XA 3JUIA 5FQ6A 5KCMA 4E85A 4B8AA 5C1DA 4FP7A 2NSZA 3EIQC 5JHAA 3APFA 4L1BA 4JZYA 2A4ZA 3QDNA 5E76A 2L0TB 1OWPA 2IOLA 4FJZA 2VGYA 4Y6WA 1OWNA 4ANVA 1SQMA 4J0UA 4K03A 2WXGA 4KYOB 2CHXA 2AXZA 2KZTB 3QWPA 5A7DB 3QAQA 3KAEA 3LCAA 5EDSA 3CKBA 2XGMA 3FU0A 1ELRA 1FVHA 3MV3B 4FC8A 2VSNA 1FVFA 4G23A 1OUVA 1HS6A 1OWOA 3CV0A 4BT8A 2PQNA 1A17A 3PVLA 4G2VA 3CIAA 3JCKC 3ML9A 2VGXB 4UI9J 3S7BA 3E4BA 5AJLA 4AP2A 3ZEFA 2J08A 4WUYA 3SHFA 4PDXA 2R59A 2BF0X 2J9QA 3CKCA 4CDNA 4EZJA 5LX8A 4UWHA 4GA2A 4DLQA 1KLXA 2I1JA 1P5QA 4WNDA 3ASHA 3QWVA 3CVYA 4NACA 2X3MA 4L2LA 4GZ5A 4FLBA 4APOA 5FTPA 4JXTA 2HO1A 4GZCA 2OVBA 2VGXA 2LSVA 1FCHA 3UUXA 3FUNA 3MV2B 5A23A 3GW4A 4N3BA 1HG2A 2WXPA 2DIWA 2ONDA 4PS8A 1JPLA 3ML8A 5DIZA 4WWPA 3CQCB 4UQXA 2OOEA 3PEUB 2VSXE 3FEYA 4J8EA 4KVOA 2V8SE 4IN3B 4ILIA 1JWGA 1S0PA 4BT9A 4I43A 2Y3AA 4U8HA 1PC2A 3LY7A 2V5FA 3PRZA 4UI9C 4GAAA 4F1SA 3D9JA 2V0PA 3HYMB 3UX4A 3CVLA 3BEEA 3T5XA 5KJKA 5FJYA 3L13A 3RU0A 1L5JA 3PUJA 3MKQA 1TJFA 5LCWJ 4EPZA 1UJJA 5KJLA 1HH8A 3RK6A 1PAQA 3G2TA 4E6HA 4WNGA 1N54A 4NURA 4L2YA 5M72A 2YHCA 3FTVA 1E7VA 3LS8A 4A3VA 1X5BA 4ACLA 3IBEA 4I6JA 4Y6CA 4BY6A 3CHMA 2WXKA 5T3RA 4IULA 4AM9A 2LAIA 4DLOA 5CCMA 3CVPA 1UJKA 5G2NA 3LXUX 5EX0A 5JJ6A 3ESLA 5J08A 3S7DA 2HYZA 3ZRHA 4LERA 5BW8C 4IRUA 2X6KA 3RKVA 2R5SA 3ONLA 4I2ZA 3ESKA 1BPOA 1IQUA 4J8DA 4NQ0A 5EKQD 5T8IA 4BX9A 2WXOA 3CVNA 1QNFA 3SI5A 4BTAA 4ILGA 4ME2A 3CVUA 3HDXA 2OV8A 5FZQA 2WXQA 3UQ3A 4DI4A 3ASDA 3NZUA 3Q47B 2DBAA 2KC7A 3FFLA 3ZXSA 2AXUA 5FZSA 4XIFA 2XQ0A 4JHJA 4JC8A 4WNFA 3FH8A 4AOFA 2EQXA 3HHMA 3L08A 4CDRA 4AVXA 4KXKB 4GYOA 3D9KA 4F7AA 1TJCA 1ZU2A 3PE3A 5G55A 3FDHA 3QK0A 3RRMB 2KCVA 4JEHA 3NQPA 1WY6A 2IONA 2LNIA 3QC1A 3FY4A 2LO6A 1H0AA 2XPIA 3QOUA 1Y6IA 3TG5A 1QQEA 3EHNA 2L9BA 2CG3A 3CLJA 4DJAA 3S7JA 4AY5A 1EPUA 4AY6A 4U0ZA 3EDTB 5EX3A 4AV7A 1Z3XA 3FWVA 1H19A 1JUQA 2XRZA 3CVVA 3D9PA 5T4YA 2XPZA 2VQ2A 3O4ZA 4I6EA 5FQ8A 3OAWA 3VLEA 4Q94A 4L23A 3SNXA 2IQCA 4CT0A 3MCXA 5KJMA 4D10C 3TL5A 3MJWA 2IJGX 4N2QA 2MHKA 5CMWA 4BWRA 2PM7A 4BSXA 1WM5A 3ZIMA 3RRUA 4UI9K 2E0IA 2X6FA 3B7UX 1H2VC 1N52A 2FBNA 3U64A 3ZVVA 2XPYA 1DVPA 1E96B 4EZKA 5BPPA 3B7SA 3DBSA 5LOZA 4Q69A 4HORA 1E8ZA 3GYZA 2FEZA 4PS7A 2WXLA 4JA9A 2CFZA 3L16A 4LCTA 2WQ6A 4GPKA 3LKUA 3I3NA 5CCLA 4APFA 3FTUA 3ZHEA 5KJNA 1HFAA 1HF8A 1H2UA 1UN8A 3Q5MA 3FH5A 3CSFA 3IHVA 4G25A 2WM9A 4KMOA 5ARGA 4HFGA 2FF4A 1XGWA 2J49A 3B7TA 4DK5A 5JHBA 3U3WA 3CVQA 3CVWA 1SZ9A 3TXNA 4HXIA 1E8YA 3T8MA 1YA0A 4P29A 4H7XA 3KD7A 1IHGA 4V3IA 3AU4A 1SZAA 4MKTA 3MKQB 2PZIA 3HIZA 2PM6A 4FLHA 4RG9A 3GZ1A 5ANLA 3CK8A 2V4LA 3GZSA 4UQZA 3Q15A 5E75A 3ASGA 4KVMA 3KS2A 2I2OA 3L22A 2YHEA 2LAHA 2L6JA 3G2WA 3JQ0A 4N3AA 5AJDA 4XKCA 4B8CB 2BUGA 4FA6A 5LP0A 4I9CA 5ENNA 4URKA 3ZFWA 2OVFA 3IV0A 4GMLA 4TUUA 3UT8A 3G2VA 2ILRA 5D0OD 3CHSA 1Z3YA 4YVOA 1HU3A 1E7UA 5J90A 3CVXA 4KBQA 2XRYA 2YNQA 3I4RB 3MEKA 5FZRA 4A1GA 3S2AA 3D9IA 4XE0A 3B13A 1QZ2A 3ZYQA 1LF8A 4HOQA 4OYSA 3IEGA 5LFAA 4I1MA 3LY9A 4M3OA 3SF4A 4CEMA 2A5UA 2UY1B 2JLBA 3TG4A 3ZPJA 4GA1A 4AXHA 1Z6TA 5BT1A 4ACKA 2IF4A 2C0LA 2AVPA 2Q7FA 4JW1A 4U04A 4RVBA 1ELKA 1W3BA 2XCCA 4GYWA 4DI3A 2WQHA 4C0EA 4KZCA 3LEWA 5FQ4A 2WQ7A 4FHKA 3CR3A 4Q96A 4KZ0A 2Y4TA 3TJPA 4I6GA 2DCPA 4MRUA 3VTXA 3ENEA 4N2SA 4GMJA 2CFUA 3CHOA 3FUIA 2X6HA 3G2SA 2UY1A 4ILHB 1JWFA 3AS4A 5AYWD 3FTSA 4CRWA 2J09A 3LVRE 5DBKA 3CEQA 3FUDA 1MQSA 4HVBA 3TXMA 4JPSA 4I1AA 4U0UA 3P2BA 4ANUA 1U3CA 3QARA 3D9OA 4ANWA 5G04J 4BFRA 2PL2A 2VTBA 3IKOB 2WXJA 3QB2A 4FU3A 4GCNA 4I17A 4JA7A 3SD5A 1HX8A 4G24A 3FUKA 3HVEB 4G11A 3ASFA 4WNEA 4HOTA 4UWFA 4HOSA 4TV3A 4W9RA 2GW1A 3FTYA 2CHZA 2KCLA 2J4BA 3FU5A 3MX3A 4I2WA 4XI9A 3R7RA 5BNWA 4WWOA 1UN9A 3O48A 3MYVA 4EECA 2FULA 4CT4A 3CHRA 4MS6A 2GGFA 3FTZA 3KEZA 2VJ8A 4LEUA 4F53A 3PNLB 4GCOA 4U07A 2WVIA 1DNPA 1OWLA 3NZSA 3L17A 3U66A 1KT0A 3AS5A 1IYGA 2X38A 3HVEA 4JEUA 2RD0A 3L6AA 5JJ7A 4JHRA 3NF1A 2VSOE 3PZDA 3QNKA 4J8FA 3SFZA 3SZ7A 3FUEA 5AENA 2I9CA 3D9LA 4XI0A 3ZHEB 3OXLA 1UW4B 5BV1A 3CHPA 4XX5A 5G04C 3URZA 3FEXA 5C2YA 3RO3A 5BV0A 2M63A 3ZYMA 3VLFA 1NA3A 4B0ZA 4LRZA 3N71A 3D9NA 4XZ4A 3PDNA 3BG1B 3CSTA 4CGVA 2IOSA 1E90A 4HLEA 5FT9A 4J6IA 3ZN3A 3L54A 2Y4UA 4LUNU 1GW6A 4CGWA 3FTWA 3PNTB 4FHJA 4N39A 5JJTA 3TGOA 3CK7A 5D0QD 2QFCA 4H7YA 2GRMA 1HO8A 4EZLA 1EDUA 2WXRA 5ARFA 4BX8A 2IFUA 4U63A 4CDMA 4EQFA 3I5PA 3LY8A 4NRHB 2R17C 3EJNA 4A55A 1H6KA 3PS6A 2I6HA 2PQRA 3LDZA 4PS3A 3ZGQA 3AU5A 3ZW3A 3PE4A 2BTDA 2RG8A 2AXVA 4BTBA 2VSYA 1MHQA 3G2UA 2HM8A 2VYIA 5FQ7A 3ULQA 3FU3A 2IU1A 3DPDA 3R7QA 2MOWA 4OVUA 4EBAG 3ZYLA 4FJYA 4PH4B 2KZTA 3IHYA 4JVSA 5CMYA 3APDA 1E8WA 5CHEE 3FUFA 3K9IA 3SBSA 2AW6A 3FH7A 3Q4AB 1VDYA 3SGHA 3AS8A 3LYAA 3OTNA 3LVQE 4O6FA 3FUHA 2FO7A 3Q49B 4N5CA 3VTYA 3OXFA 3RIBA 4N3CA 4JL0A 1H2TC 2WXFA 4GB9A 4OVVA 3EIJA 2WXNA 4F3VA 2P58C 2CHWA 2X6JA 3QJZA 4GA0A 4IYPA 3U9WA 3UT7A 2ZU6B 3VLDA 4GZDA 3FUJA 3RRNB 3UT4A 4WAFA 3FHEA 4A3TA 2GRLA 2QY7A 2UWJG 2XEVA 4WWNA 5HI7A 3SBTB 1OWMA 2E2EA 4R7LA 5HQ8A 2C2LA 2VTBB 3RJVA 3FP3A 3S7FA 2JEKA 4B94A 5AIJA 4GYYA 4AIFA 4ANXA 5G05J 2J4DA 3RO2A 3LJ3A 2YINA 4G1TA 4UWLA 3ZYKA 3EHMA 3D9MA 3T5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTD A;  1UN8 A;  3CR3 A;  3PNL B;  4LRZ A;  1UN9 A; 
#chains in the Genus database with same CATH topology
 1N94 A;  5KNH D;  3FUM A;  4YND A;  1WDY A;  4XKB A;  3B7R L;  3JQ1 A;  2V5Q C;  3C98 A;  4HOU A;  1PY1 A;  4U0S A;  5ENS D;  1ELW A;  4GZ6 A;  2FO1 E;  3ISM C;  3BG0 B;  1U3D A;  1EYH A;  3U4T A;  1INZ A;  4OAV B;  4HS2 A;  2FI7 A;  5KWD A;  2AWI A;  5ENQ D;  1BI8 B;  4J8S A;  1JCR A;  3ABM E;  3P1U A;  3UKR G;  1ZBP A;  4CCA A;  5LCW C;  2WXM A;  3PEV B;  4AJW A;  4I9E A;  3MA5 A;  4G26 A;  3LJN A;  4ABN A;  5A6C A;  2C0M A;  1OCO E;  2I1K A;  4YVQ C;  4GZ3 A;  2Y0B G;  4L7T A;  3ASN E;  1WAO 1;  1V55 E;  4JHK A;  2WPV A;  2XGS A;  3Q79 A;  2XHE A;  4E85 A;  4B8A A;  5C1D A;  3PZ4 A;  3EIQ C;  5E76 A;  2L0T B;  2VGY A;  4ANV A;  4K03 A;  4CZ2 D;  3LCA A;  5EDS A;  3J5Q B;  1ELR A;  3DEO A;  4LSZ E;  2L6B A;  1OWO A;  3ZU7 B;  4BT8 A;  1BI7 B;  1SW6 A;  2PQN A;  3SHF A;  3CKC A;  3RAU A;  4GA2 A;  4WND A;  4APO A;  1HG2 A;  2WXP A;  2OND A;  5DIZ A;  1O1T A;  3DXM G;  2OOE A;  2V8S E;  1JWG A;  2QZA A;  2Y3A A;  1PC2 A;  3LY7 A;  2V5F A;  3PRZ A;  4GTM A;  4GAA A;  5KJK A;  1UJJ A;  3Q7A A;  5KJL A;  4E6H A;  1PAQ A;  4WNG A;  5ENP D;  5M72 A;  3W9F A;  4I6J A;  3ULE G;  2V4H C;  4HLL A;  2LAI A;  4DLO A;  3CVP A;  1LD7 A;  5JJ6 A;  2GRN B;  3RKV A;  3ONL A;  4I2Z A;  5T8I A;  4JB8 P;  3CVN A;  1QNF A;  4ME2 A;  3UQ3 A;  2WXQ A;  3D9H A;  4CYM D;  5ITZ F;  3Q47 B;  2KBX A;  3ZXS A;  4EHM A;  4HNA D;  3PZ3 A;  4GYO A;  3D9K A;  2XZD G;  1TJC A;  3PE3 A;  3FDH A;  3NQP A;  1H0A A;  1MJ0 A;  4OAU C;  1QQE A;  3C5R A;  2R03 A;  4LNU D;  3O4Z A;  1QYM A;  5FQ8 A;  3BUA A;  4BWR A;  2X6F A;  1H2V C;  1N52 A;  3ZVV A;  2XPY A;  1E96 B;  5ENR D;  5ENT D;  3B7S A;  3DBS A;  2EIJ E;  3GYZ A;  4JA9 A;  1YYH A;  5AQ7 A;  4C48 B;  3I3N A;  4ZHB A;  2PNN A;  3AG3 E;  4APF A;  1HFA A;  1TNO A;  1UN8 A;  2J49 A;  3B7T A;  5EID A;  3JXI A;  3DSW A;  2PZI A;  1KPS B;  3CK8 A;  2V4L A;  3DPY A;  4UQZ A;  3V31 A;  3T9K A;  2LAH A;  4B8C B;  1N11 A;  3JQ0 A;  5LP0 A;  4XKC A;  3E32 A;  4FA6 A;  4I9C A;  5ENN A;  5AAR A;  2OVF A;  3UT8 A;  3CHS A;  1Z3Y A;  1E7U A;  3CVX A;  3EHQ A;  2XRY A;  1Z5S C;  3I4R B;  3TWR A;  3R9M A;  5FZR A;  3B13 A;  4HB5 A;  3LY9 A;  2UY1 B;  2JLB A;  3TG4 A;  1Z6T A;  2C0L A;  4JW1 A;  1ELK A;  1W3B A;  3RSE G;  5CEA A;  3ENE A;  3KSQ A;  3G2S A;  4LNG A;  3LVR E;  1OCZ E;  4GTT A;  2MYO A;  4HBD A;  1U3C A;  3D9O A;  4BFR A;  2PL2 A;  3KEA A;  1N95 A;  3QB2 A;  4I17 A;  4DX5 D;  1AP7 A;  1K1B A;  4HOT A;  4HOS A;  4W9R A;  2CHZ A;  4XI9 A;  5BNW A;  4I2W A;  4WWO A;  3J5P A;  2GGF A;  4LEU A;  4F53 A;  4U07 A;  2WVI A;  1KT0 A;  2X38 A;  3HVE A;  1K1A A;  4JHR A;  3NF1 A;  3FUE A;  5AEN A;  2I9C A;  1FT2 A;  3ZHE B;  4GTO A;  5BV1 A;  5BV0 A;  2M63 A;  3ZYM A;  3D9N A;  3BG1 B;  3ZN3 A;  2VGE A;  3AG1 E;  1MZC A;  3FTW A;  3PNT B;  4FHJ A;  4N39 A;  3CK7 A;  2QFC A;  4EZL A;  1EDU A;  3Q9U C;  4HRL A;  4U63 A;  3I5P A;  1N9A A;  3LY8 A;  4U96 D;  2I6H A;  2AXV A;  2VSY A;  3G2U A;  2HM8 A;  2VYI A;  1NL4 A;  3ULQ A;  2MOW A;  3ABK E;  4OVU A;  4JD2 G;  2P9N G;  3ZYL A;  4HI8 A;  4JVS A;  3FUF A;  3K9I A;  2EIN E;  3Q4A B;  1VDY A;  3AS8 A;  1TNU A;  4DX6 D;  3LVQ E;  3Q49 B;  3OXF A;  4HRM B;  3AG2 E;  4GB9 A;  2F8Y A;  2P58 C;  3UT7 A;  3QJZ A;  2P9P G;  1JCS A;  2R05 A;  2ETA A;  4WWN A;  1IHB A;  1OWM A;  2E2E A;  4R7L A;  5HQ8 A;  4DRX E;  2VTB B;  4G8K A;  3S7F A;  2JEK A;  4GYY A;  2J4D A;  4UWL A;  3ZYK A;  3ZPJ A;  3EHM A;  4I1O B;  4U7E B;  1NA0 A;  1XNF A;  3FU6 A;  2YQ8 A;  1DCE A;  1HE8 A;  5ANR A;  3QWW A;  4FUL A;  4C0M A;  3MZL B;  4A1S A;  2WB2 A;  4K0R A;  4HQD A;  3UM3 A;  3R9A B;  4PUC A;  2KAT A;  3FUL A;  3I4G A;  3PUK A;  5G05 C;  1X81 A;  4A63 B;  3ONK A;  3APC A;  4U95 D;  4GTS A;  3CK9 A;  5FWQ A;  4RSY A;  2XCB A;  1KT1 A;  2WMO A;  3SO8 A;  4KT6 B;  1NZN A;  2P9K G;  3CGH A;  3WXX A;  4UWG A;  1LTX A;  3CQG B;  3CHQ A;  4F6R D;  1E8X A;  4O1O A;  3C3R A;  3JUI A;  5KCM A;  4FP7 A;  2NSZ A;  4BES A;  3APF A;  4L1B A;  1OWP A;  2IOL A;  1OWN A;  4KYO B;  3KAE A;  4XEI G;  4FC8 A;  4NIK A;  1A17 A;  3PVL A;  3ZUV B;  3JCK C;  2R2L A;  3ML9 A;  2R02 A;  3Q7F A;  2J08 A;  4PDX A;  1TN6 A;  2X3M A;  4GZC A;  2VGX A;  3GW4 A;  4N3B A;  5B1B E;  4UQX A;  3PEU B;  4KVO A;  2XZT G;  3TWQ A;  4IN3 B;  1TNZ A;  4BT9 A;  4U8H A;  4UI9 C;  3ZNG A;  3ZKJ A;  4F1S A;  3HYM B;  2GRQ B;  3UX4 A;  3T5X A;  3PUJ A;  1TJF A;  4EPZ A;  3RK6 A;  3EHR A;  5CBO A;  2YHC A;  1E7V A;  1IXV A;  3SQV A;  3CHM A;  4IUL A;  1UJK A;  3LXU X;  5CBN A;  3UI2 A;  4LER A;  5BW8 C;  1DC2 A;  4IRU A;  1BPO A;  4J8D A;  4NQ0 A;  3SI5 A;  3CVU A;  3HDX A;  4LG6 A;  5B3S E;  3NZU A;  3FFL A;  3V30 A;  4N5Q A;  4JHJ A;  4JC8 A;  1S70 B;  4AOF A;  3HHM A;  4AVX A;  3RRM B;  4JEH A;  1WY6 A;  2LNI A;  3FY4 A;  2XPI A;  2JAB A;  2EIM E;  1EPU A;  2RKK A;  4U0Z A;  2Y69 E;  1KZP A;  3L9T A;  3FWV A;  1JUQ A;  5T4Y A;  2XPZ A;  4I6E A;  4L23 A;  2IQC A;  4CT0 A;  3MCX A;  4D10 C;  2DZO A;  4N2Q A;  4BSX A;  4UI9 K;  3IXE A;  4GTQ A;  1DVP A;  1IKN D;  4HOR A;  1D8E A;  1E8Z A;  2WXL A;  1O1S A;  2WQ6 A;  2OCC E;  3ZHE A;  3ZRH A;  1HF8 A;  3Q5M A;  3FH5 A;  3IHV A;  2WM9 A;  1XGW A;  1K3Z D;  5JHB A;  5IY5 E;  3TXN A;  3KD7 A;  3TWT A;  1IHG A;  4MKT A;  4RG9 A;  3HIZ A;  2PM6 A;  4HRN A;  5ANL A;  1TN8 A;  4N3A A;  4TXP A;  4GML A;  3UKU G;  4YVO A;  4KBQ A;  5EYL A;  3MEK A;  3S2A A;  3D9I A;  4HOQ A;  4OYS A;  2OEW A;  1FT1 A;  4AXH A;  4ACK A;  2IF4 A;  2Q7F A;  4U04 A;  4RVB A;  1O5M A;  2WQH A;  4C0E A;  4KZC A;  3UIO C;  2WQ7 A;  3VTX A;  2Y4T A;  3TJP A;  4MRU A;  2B0O E;  2HE0 A;  1NFI E;  4ILH B;  3C3Q A;  5DBK A;  3CEQ A;  3FUD A;  1MQS A;  4JPS A;  4ANU A;  2VTB A;  2WXJ A;  1HX8 A;  4G24 A;  5AQB A;  3FUK A;  4WNE A;  4UWF A;  3ULY A;  4TXR A;  3FU5 A;  2KCL A;  3E33 A;  4YDE A;  2BED A;  1DNP A;  1OWL A;  3L17 A;  3AS5 A;  1IYG A;  4J8F A;  3QNK A;  4GPM A;  4XI0 A;  5KNG A;  5G04 C;  3VLF A;  4XZ4 A;  3E34 A;  3TWU A;  2IOS A;  1E90 A;  4HLE A;  1A5E A;  2P2C P;  4J6I A;  4B93 B;  1SA4 A;  1GW6 A;  4CGW A;  5JJT A;  1OXJ A;  2R17 C;  3EJN A;  1H6K A;  3NOC D;  3LDZ A;  3ZW3 A;  3PE4 A;  2LUH A;  2RG8 A;  4BEP A;  2ZIS A;  2IO3 C;  4DUI A;  5FQ7 A;  3FU3 A;  2IU1 A;  3DPD A;  4EBA G;  1QBQ A;  4O1P A;  1E8W A;  3SBS A;  2AW6 A;  5AQ9 A;  4O6F A;  4N5C A;  4OVV A;  4IYP A;  3U9W A;  4GMR A;  2EIL E;  2ZU6 B;  4GZD A;  4G8L A;  2UWJ G;  2XEV A;  1OT8 A;  4B94 A;  3TWV A;  5G05 J;  1TNY A;  3RO2 A;  4G1T A;  2YIN A;  1KZO A;  3BU8 A;  2NXP A;  2HR2 A;  4DPR A;  3PRE A;  4ATG A;  1H6O A;  1BLX B;  2MRI A;  2X6I A;  1TEZ A;  1UG3 A;  1TR4 A;  2L0I A;  5B1A E;  3E37 A;  2KCK A;  3V2O A;  3GZ2 A;  1LD8 A;  1HG5 A;  4C9B B;  1YCS B;  3JXJ A;  3OXG A;  4RG6 A;  2J07 A;  3JYS A;  4GU5 A;  1Y8M A;  4UWK A;  1RW2 A;  2WMN A;  5EN5 D;  2NC9 A;  2WXH A;  3MGB A;  4EBA A;  3PH0 C;  3MKR A;  1N0Q A;  4FAD A;  2WXI A;  3LPZ A;  4B89 A;  2OEV A;  4UQY A;  2XGO A;  1OY3 D;  1B89 A;  3QKY A;  5FQ6 A;  2A4Z A;  4BSZ B;  4FJZ A;  1SQM A;  2WXG A;  2CHX A;  2AXZ A;  2KZT B;  3QWP A;  5A7D B;  3CKB A;  3FU0 A;  3MV3 B;  2VSN A;  4G23 A;  4O60 A;  1HS6 A;  4G2V A;  4YDW A;  2QYJ A;  2ZIR A;  4UI9 J;  3S7B A;  3TWW A;  4AP2 A;  3HXF A;  4WUY A;  2BF0 X;  2J9Q A;  5LX8 A;  4UWH A;  2XS8 A;  3ASH A;  3QWV A;  3CVY A;  2F8X K;  3HXC A;  2ZGG A;  4FLB A;  2HO1 A;  2OVB A;  3UUX A;  3MV2 B;  2DIW A;  1K8K G;  4PS8 A;  1JPL A;  3ML8 A;  4WWP A;  3CQC B;  3FEY A;  4ILI A;  2DYR E;  4I43 A;  3D9J A;  3BEE A;  2F37 A;  5FJY A;  5LCW J;  1HH8 A;  2H6H A;  1N54 A;  4NUR A;  3C3O A;  3FTV A;  3LS8 A;  4A3V A;  3IBE A;  4Y6C A;  4BY6 A;  5T3R A;  4L9P A;  3AJI A;  5G2N A;  5EX0 A;  5J08 A;  3S7D A;  1Q2Z A;  2IY0 C;  3DSV A;  3DXK G;  2R5S A;  3DSS A;  3HG0 D;  3ESK A;  1IQU A;  5EKQ D;  4BX9 A;  2WXO A;  4DX7 D;  2OV8 A;  5D2M C;  3NB2 A;  2KC7 A;  5FZS A;  4XIF A;  3EU5 A;  2XQ0 A;  3ZXP A;  1N4Q A;  2EQX A;  4CDR A;  3UM0 A;  4F7A A;  3UTM A;  3QK0 A;  2KCV A;  2ION A;  5CED B;  3QC1 A;  2Y1L E;  2LO6 A;  3QOU A;  3TG5 A;  3EHN A;  2L9B A;  3AG4 E;  3CLJ A;  4DJA A;  3S7J A;  4AY6 A;  3EDT B;  5EX3 A;  4AV7 A;  1H19 A;  2XRZ A;  1JCQ A;  3D9P A;  2IO2 C;  3OAW A;  4Q94 A;  3TL5 A;  3MJW A;  3EU9 A;  2MHK A;  2PM7 A;  3ZIM A;  3RRU A;  1G3N B;  4HI9 A;  3B7U X;  4EZK A;  3DST A;  5LOZ A;  4Q69 A;  3C72 A;  3NAW A;  2FEZ A;  2CFZ A;  3EUV A;  2H6G A;  2XEE A;  5CCL A;  1SVX A;  3FTU A;  4G25 A;  4HFG A;  3E30 A;  2FF4 A;  4DK5 A;  3U3W A;  3CVQ A;  4HXI A;  1E8Y A;  3T8M A;  2A5E A;  3AU4 A;  1SZA A;  1UOH A;  3MKQ B;  4FLH A;  3GZS A;  5E75 A;  3KS2 A;  2YHE A;  5AJD A;  2BUG A;  3KSL A;  4URK A;  3IV0 A;  4TUU A;  3G2V A;  2ILR A;  5D0O D;  5ENO D;  5CER B;  2P9L G;  1QZ2 A;  1LF8 A;  1S64 A;  4M3O A;  3SF4 A;  2A5U A;  5CEC B;  2LXM A;  3WG7 E;  5BT1 A;  4QQI A;  4GYW A;  4DI3 A;  5FQ4 A;  4KZ0 A;  4I6G A;  3L82 A;  4N2S A;  2GRP B;  2CFU A;  3CHO A;  3V79 K;  2XEH A;  2UY1 A;  1JWF A;  5AYW D;  3FTS A;  5EIB E;  4HVB A;  3P2B A;  3QAR A;  5G04 J;  4GTV A;  4GCN A;  5AQA A;  2F0Y A;  3HVE B;  2GW1 A;  2J4B A;  1UN9 A;  5KBA A;  3O48 A;  3MYV A;  4EEC A;  4MS6 A;  3FTZ A;  3PNL B;  1N4P A;  3NZS A;  1WG0 A;  4JEU A;  2RD0 A;  5JJ7 A;  3PZD A;  3D9L A;  4XX5 A;  3URZ A;  3DRA A;  3FEX A;  3Q78 A;  1NA3 A;  3AAA C;  4B0Z A;  4LRZ A;  3N71 A;  2B6C A;  4CGV A;  2ZXW E;  4ZFH A;  3L54 A;  3TGO A;  4H7Y A;  1YMP A;  1HO8 A;  2GRM A;  5EYP F;  2WXR A;  3JUE A;  2IFU A;  4EQF A;  4A55 A;  2PQR A;  3AU5 A;  1N0R A;  2BTD A;  2DWZ A;  4BTB A;  3HXE A;  5CRU A;  1MHQ A;  3W9G A;  2IEJ A;  4FJY A;  2KZT A;  5CMY A;  5CHE E;  3FH7 A;  1OCR E;  3LYA A;  3VTY A;  3FUH A;  2FO7 A;  3RIB A;  3HXD A;  4N3C A;  2RFA A;  2WXF A;  2X6J A;  3VLD A;  3FUJ A;  3UT4 A;  4A3T A;  2QY7 A;  5HI7 A;  5FIN A;  2C2L A;  3FP3 A;  2GRO B;  5AIJ A;  4ANX A;  3D9M A;  3SY2 A;  5BXU A;  4QFV A;  2EIK E;  5BUZ A;  2LSU A;  3D3M A;  1HZ4 A;  4RLY A;  5HKP A;  1NI1 A;  4MLP A;  2QYU A;  3UM1 A;  2CG2 A;  4TRQ A;  2KM4 A;  2XS1 A;  1SA5 A;  3ASO E;  1OCC E;  2GRR B;  3FTX A;  3UPV A;  5D66 A;  3UIN C;  3TAX A;  1HXI A;  1IQR A;  2ZGD A;  1ZB1 A;  1EF1 C;  3UMV A;  4AEZ C;  3X2Q E;  1NP7 A;  1O1R A;  5AAO A;  3SFX A;  3NBN B;  5JHA A;  4JZY A;  3QDN A;  1D8D A;  4Y6W A;  3HXB A;  4J0U A;  4BER A;  3QAQ A;  2XGM A;  1FVH A;  3NOG D;  1FVF A;  4RQI A;  1OUV A;  3CV0 A;  3CIA A;  2VGX B;  1TN7 A;  3E4B A;  5AJL A;  4K5C A;  3ZEF A;  2BKK B;  4EZJ A;  3T8K A;  2R59 A;  4CDN A;  4DLQ A;  1KLX A;  2I1J A;  1P5Q A;  2QC9 A;  4NAC A;  4UUC A;  4J7W A;  4L2L A;  4GZ5 A;  5FTP A;  4JXT A;  4ATZ D;  2LSV A;  1FCH A;  3FUN A;  5A23 A;  4GTP A;  2ETC A;  3TWS A;  2VSX E;  4J8E A;  1V54 E;  1S0P A;  3ABL E;  3UM2 A;  2AJA A;  2V0P A;  3HRA A;  2ETB A;  3CVL A;  5EIL A;  3L13 A;  3RU0 A;  1L5J A;  3MKQ A;  1BU9 A;  2NYJ A;  3G2T A;  4L2Y A;  4ACL A;  1X5B A;  2WXK A;  4AM9 A;  5CCM A;  1H6P A;  3ESL A;  2HYZ A;  2XEN A;  2X6K A;  5BXO A;  4TUM A;  4BTA A;  4ILG A;  3BQO A;  5FZQ A;  4DI4 A;  3ASD A;  4BET A;  2DBA A;  2AXU A;  4U8Y D;  4WNF A;  5JA4 D;  3FH8 A;  3UXG A;  3Q75 A;  3L08 A;  4YDY A;  4KXK B;  1ZU2 A;  1RZ4 A;  5G55 A;  4K5A B;  4U8V D;  4Z68 A;  1Y6I A;  2CG3 A;  4AY5 A;  3Q9N C;  1Z3X A;  3CVV A;  2VQ2 A;  3VLE A;  3SNX A;  5KJM A;  2IJG X;  5CMW A;  2BKG A;  1WM5 A;  2DYS E;  2E0I A;  2FBN A;  3DWL G;  3U64 A;  3Q73 A;  5BPP A;  4PS7 A;  3L16 A;  4LCT A;  3SFY A;  4GPK A;  3LKU A;  5KJN A;  1H2U A;  5ARG A;  3CSF A;  4KMO A;  1MX6 A;  3CVW A;  1SZ9 A;  1YA0 A;  4P29 A;  4H7X A;  4V3I A;  2H6F A;  3DSX A;  3GZ1 A;  4X8Q A;  5CRV A;  4M7C A;  3PZ2 A;  1TYQ G;  3Q15 A;  3ASG A;  4KVM A;  2I2O A;  3L22 A;  2L6J A;  2P9U G;  3G2W A;  3ZFW A;  3UIP C;  2KXP C;  1HU3 A;  5J90 A;  2YNQ A;  1DCQ A;  4A1G A;  4XE0 A;  3ZYQ A;  3IEG A;  5LFA A;  4I1M A;  4LNB A;  4TXQ A;  4CEM A;  3F6Q A;  2J8S D;  4GA1 A;  2AVP A;  2P9I G;  2P9S G;  2XCC A;  4K5B A;  3LEW A;  1N4R A;  4FHK A;  3CR3 A;  4Q96 A;  3V2X A;  2DCP A;  3DSU A;  4GMJ A;  3FUI A;  2X6H A;  4MBG A;  3AS4 A;  4CRW A;  2J09 A;  3TXM A;  4I1A A;  4U0U A;  5JMN D;  2H6I A;  4GTR A;  4ANW A;  4YDO A;  3IKO B;  4FU3 A;  4JA7 A;  3SD5 A;  4G11 A;  3ASF A;  1N4S A;  4TV3 A;  3FTY A;  3MX3 A;  3R7R A;  3B95 A;  4F1P A;  5H7P A;  5HS0 A;  2FUL A;  4CT4 A;  3CHR A;  3KEZ A;  2VJ8 A;  4GCO A;  4DX2 A;  3DEP A;  1MX2 A;  3U66 A;  3L6A A;  1MX4 A;  1TNB A;  3SFZ A;  2VSO E;  3SZ7 A;  2LXL A;  3OXL A;  1UW4 B;  3CHP A;  5C2Y A;  3RO3 A;  1MYO A;  5FIO A;  3PDN A;  5AN8 A;  3CST A;  5FT9 A;  2Y4U A;  4LUN U;  5D0Q D;  5ARF A;  4BX8 A;  4CDM A;  4NRH B;  3PS6 A;  4PS3 A;  3ZGQ A;  2DZN A;  1FPP A;  3B7B A;  3R7Q A;  4PH4 B;  3IHY A;  2RFM A;  3APD A;  4DX1 A;  2DVW A;  3SGH A;  3TWX A;  3OTN A;  4JL0 A;  1H2T C;  3EIJ A;  2WXN A;  4F3V A;  2CHW A;  4GA0 A;  1U2V G;  1BD8 A;  5HRY A;  3RRN B;  4WAF A;  1D9S A;  3FHE A;  2GRL A;  3SBT B;  3PZ1 A;  3RJV A;  1S63 A;  4AIF A;  3LJ3 A;  4J8Y A;  3T5V A;  1AWC B; 
#chains in the Genus database with same CATH homology
 2NXP A;  2HR2 A;  3FUM A;  4QFV A;  4YND A;  5BUZ A;  4XKB A;  4I1O B;  4DPR A;  1NA0 A;  1XNF A;  2LSU A;  3FU6 A;  2YQ8 A;  3PRE A;  1HE8 A;  3B7R L;  3JQ1 A;  5ANR A;  4ATG A;  3QWW A;  3D3M A;  3C98 A;  1HZ4 A;  4FUL A;  4HOU A;  4C0M A;  1PY1 A;  3MZL B;  4U0S A;  4A1S A;  2WB2 A;  1ELW A;  2MRI A;  4GZ6 A;  4K0R A;  2X6I A;  3BG0 B;  1U3D A;  1UG3 A;  1EYH A;  4MLP A;  3U4T A;  1TEZ A;  2CG2 A;  2L0I A;  1INZ A;  4HS2 A;  4TRQ A;  2KM4 A;  2FI7 A;  2KCK A;  2AWI A;  3GZ2 A;  3R9A B;  4J8S A;  3FTX A;  1HG5 A;  3P1U A;  4C9B B;  3OXG A;  4PUC A;  3UPV A;  4RG6 A;  1ZBP A;  2J07 A;  2KAT A;  3FUL A;  3JYS A;  4CCA A;  5LCW C;  3I4G A;  2WXM A;  3PUK A;  5G05 C;  4GU5 A;  3PEV B;  4AJW A;  4I9E A;  1Y8M A;  4UWK A;  3MA5 A;  3ONK A;  2WMN A;  3APC A;  4G26 A;  5FWQ A;  3CK9 A;  2NC9 A;  2WXH A;  2XCB A;  4RSY A;  1KT1 A;  3TAX A;  3MGB A;  4ABN A;  1HXI A;  5A6C A;  2WMO A;  4EBA A;  2C0M A;  4KT6 B;  3PH0 C;  1IQR A;  1NZN A;  3MKR A;  3CGH A;  3WXX A;  4UWG A;  2I1K A;  4YVQ C;  4FAD A;  4GZ3 A;  1EF1 C;  3UMV A;  2WXI A;  4L7T A;  4AEZ C;  3LPZ A;  3CQG B;  4B89 A;  3CHQ A;  1WAO 1;  4UQY A;  4JHK A;  2WPV A;  2XGS A;  1NP7 A;  2XGO A;  1B89 A;  2XHE A;  3QKY A;  1E8X A;  3JUI A;  5FQ6 A;  5KCM A;  4E85 A;  4B8A A;  5C1D A;  4FP7 A;  2NSZ A;  3EIQ C;  5JHA A;  3APF A;  4L1B A;  4JZY A;  2A4Z A;  3QDN A;  5E76 A;  2L0T B;  1OWP A;  2IOL A;  4FJZ A;  2VGY A;  4Y6W A;  1OWN A;  4ANV A;  1SQM A;  4J0U A;  4K03 A;  2WXG A;  4KYO B;  2CHX A;  2AXZ A;  2KZT B;  3QWP A;  5A7D B;  3QAQ A;  3KAE A;  3LCA A;  5EDS A;  3CKB A;  2XGM A;  3FU0 A;  1ELR A;  1FVH A;  3MV3 B;  4FC8 A;  2VSN A;  1FVF A;  4G23 A;  1OUV A;  1HS6 A;  1OWO A;  3CV0 A;  4BT8 A;  2PQN A;  1A17 A;  3PVL A;  4G2V A;  3CIA A;  3JCK C;  3ML9 A;  2VGX B;  4UI9 J;  3S7B A;  3E4B A;  5AJL A;  4AP2 A;  3ZEF A;  2J08 A;  4WUY A;  3SHF A;  4PDX A;  2R59 A;  2BF0 X;  2J9Q A;  3CKC A;  4CDN A;  4EZJ A;  5LX8 A;  4UWH A;  4GA2 A;  4DLQ A;  1KLX A;  2I1J A;  1P5Q A;  4WND A;  3ASH A;  3QWV A;  3CVY A;  4NAC A;  2X3M A;  4L2L A;  4GZ5 A;  4FLB A;  4APO A;  5FTP A;  4JXT A;  2HO1 A;  4GZC A;  2OVB A;  2VGX A;  2LSV A;  1FCH A;  3UUX A;  3FUN A;  3MV2 B;  5A23 A;  3GW4 A;  4N3B A;  1HG2 A;  2WXP A;  2DIW A;  2OND A;  4PS8 A;  1JPL A;  3ML8 A;  5DIZ A;  4WWP A;  3CQC B;  4UQX A;  2OOE A;  3PEU B;  2VSX E;  3FEY A;  4J8E A;  4KVO A;  2V8S E;  4IN3 B;  4ILI A;  1JWG A;  1S0P A;  4BT9 A;  4I43 A;  2Y3A A;  4U8H A;  1PC2 A;  3LY7 A;  2V5F A;  3PRZ A;  4UI9 C;  4GAA A;  4F1S A;  3D9J A;  2V0P A;  3HYM B;  3UX4 A;  3CVL A;  3BEE A;  3T5X A;  5KJK A;  5FJY A;  3L13 A;  3RU0 A;  1L5J A;  3PUJ A;  3MKQ A;  1TJF A;  5LCW J;  4EPZ A;  1UJJ A;  5KJL A;  1HH8 A;  3RK6 A;  1PAQ A;  3G2T A;  4E6H A;  4WNG A;  1N54 A;  4NUR A;  4L2Y A;  5M72 A;  2YHC A;  3FTV A;  1E7V A;  3LS8 A;  4A3V A;  1X5B A;  4ACL A;  3IBE A;  4I6J A;  4Y6C A;  4BY6 A;  3CHM A;  2WXK A;  5T3R A;  4IUL A;  4AM9 A;  2LAI A;  4DLO A;  5CCM A;  3CVP A;  1UJK A;  5G2N A;  3LXU X;  5EX0 A;  5JJ6 A;  3ESL A;  5J08 A;  3S7D A;  2HYZ A;  3ZRH A;  4LER A;  5BW8 C;  4IRU A;  2X6K A;  3RKV A;  2R5S A;  3ONL A;  4I2Z A;  3ESK A;  1BPO A;  1IQU A;  4J8D A;  4NQ0 A;  5EKQ D;  5T8I A;  4BX9 A;  2WXO A;  3CVN A;  1QNF A;  3SI5 A;  4BTA A;  4ILG A;  4ME2 A;  3CVU A;  3HDX A;  2OV8 A;  5FZQ A;  2WXQ A;  3UQ3 A;  4DI4 A;  3ASD A;  3NZU A;  3Q47 B;  2DBA A;  2KC7 A;  3FFL A;  3ZXS A;  2AXU A;  5FZS A;  4XIF A;  2XQ0 A;  4JHJ A;  4JC8 A;  4WNF A;  3FH8 A;  4AOF A;  2EQX A;  3HHM A;  3L08 A;  4CDR A;  4AVX A;  4KXK B;  4GYO A;  3D9K A;  4F7A A;  1TJC A;  1ZU2 A;  3PE3 A;  5G55 A;  3FDH A;  3QK0 A;  3RRM B;  2KCV A;  4JEH A;  3NQP A;  1WY6 A;  2ION A;  2LNI A;  3QC1 A;  3FY4 A;  2LO6 A;  1H0A A;  2XPI A;  3QOU A;  1Y6I A;  3TG5 A;  1QQE A;  3EHN A;  2L9B A;  2CG3 A;  3CLJ A;  4DJA A;  3S7J A;  4AY5 A;  1EPU A;  4AY6 A;  4U0Z A;  3EDT B;  5EX3 A;  4AV7 A;  1Z3X A;  3FWV A;  1H19 A;  1JUQ A;  2XRZ A;  3CVV A;  3D9P A;  5T4Y A;  2XPZ A;  2VQ2 A;  3O4Z A;  4I6E A;  5FQ8 A;  3OAW A;  3VLE A;  4Q94 A;  4L23 A;  3SNX A;  2IQC A;  4CT0 A;  3MCX A;  5KJM A;  4D10 C;  3TL5 A;  3MJW A;  2IJG X;  4N2Q A;  2MHK A;  5CMW A;  4BWR A;  2PM7 A;  4BSX A;  1WM5 A;  3ZIM A;  3RRU A;  4UI9 K;  2E0I A;  2X6F A;  3B7U X;  1H2V C;  1N52 A;  2FBN A;  3U64 A;  3ZVV A;  2XPY A;  1DVP A;  1E96 B;  4EZK A;  5BPP A;  3B7S A;  3DBS A;  5LOZ A;  4Q69 A;  4HOR A;  1E8Z A;  3GYZ A;  2FEZ A;  4PS7 A;  2WXL A;  4JA9 A;  2CFZ A;  3L16 A;  4LCT A;  2WQ6 A;  4GPK A;  3LKU A;  3I3N A;  5CCL A;  4APF A;  3FTU A;  3ZHE A;  5KJN A;  1HFA A;  1HF8 A;  1H2U A;  1UN8 A;  3Q5M A;  3FH5 A;  3CSF A;  3IHV A;  4G25 A;  2WM9 A;  4KMO A;  5ARG A;  4HFG A;  2FF4 A;  1XGW A;  2J49 A;  3B7T A;  4DK5 A;  5JHB A;  3U3W A;  3CVQ A;  3CVW A;  1SZ9 A;  3TXN A;  4HXI A;  1E8Y A;  3T8M A;  1YA0 A;  4P29 A;  4H7X A;  3KD7 A;  1IHG A;  4V3I A;  3AU4 A;  1SZA A;  4MKT A;  3MKQ B;  2PZI A;  3HIZ A;  2PM6 A;  4FLH A;  4RG9 A;  3GZ1 A;  5ANL A;  3CK8 A;  2V4L A;  3GZS A;  4UQZ A;  3Q15 A;  5E75 A;  3ASG A;  4KVM A;  3KS2 A;  2I2O A;  3L22 A;  2YHE A;  2LAH A;  2L6J A;  3G2W A;  3JQ0 A;  4N3A A;  5AJD A;  4XKC A;  4B8C B;  2BUG A;  4FA6 A;  5LP0 A;  4I9C A;  5ENN A;  4URK A;  3ZFW A;  2OVF A;  3IV0 A;  4GML A;  4TUU A;  3UT8 A;  3G2V A;  2ILR A;  5D0O D;  3CHS A;  1Z3Y A;  4YVO A;  1HU3 A;  1E7U A;  5J90 A;  3CVX A;  4KBQ A;  2XRY A;  2YNQ A;  3I4R B;  3MEK A;  5FZR A;  4A1G A;  3S2A A;  3D9I A;  4XE0 A;  3B13 A;  1QZ2 A;  3ZYQ A;  1LF8 A;  4HOQ A;  4OYS A;  3IEG A;  5LFA A;  4I1M A;  3LY9 A;  4M3O A;  3SF4 A;  4CEM A;  2A5U A;  2UY1 B;  2JLB A;  3TG4 A;  3ZPJ A;  4GA1 A;  4AXH A;  1Z6T A;  5BT1 A;  4ACK A;  2IF4 A;  2C0L A;  2AVP A;  2Q7F A;  4JW1 A;  4U04 A;  4RVB A;  1ELK A;  1W3B A;  2XCC A;  4GYW A;  4DI3 A;  2WQH A;  4C0E A;  4KZC A;  3LEW A;  5FQ4 A;  2WQ7 A;  4FHK A;  3CR3 A;  4Q96 A;  4KZ0 A;  2Y4T A;  3TJP A;  4I6G A;  2DCP A;  4MRU A;  3VTX A;  3ENE A;  4N2S A;  4GMJ A;  2CFU A;  3CHO A;  3FUI A;  2X6H A;  3G2S A;  2UY1 A;  4ILH B;  1JWF A;  3AS4 A;  5AYW D;  3FTS A;  4CRW A;  2J09 A;  3LVR E;  5DBK A;  3CEQ A;  3FUD A;  1MQS A;  4HVB A;  3TXM A;  4JPS A;  4I1A A;  4U0U A;  3P2B A;  4ANU A;  1U3C A;  3QAR A;  3D9O A;  4ANW A;  5G04 J;  4BFR A;  2PL2 A;  2VTB A;  3IKO B;  2WXJ A;  3QB2 A;  4FU3 A;  4GCN A;  4I17 A;  4JA7 A;  3SD5 A;  1HX8 A;  4G24 A;  3FUK A;  3HVE B;  4G11 A;  3ASF A;  4WNE A;  4HOT A;  4UWF A;  4HOS A;  4TV3 A;  4W9R A;  2GW1 A;  3FTY A;  2CHZ A;  2KCL A;  2J4B A;  3FU5 A;  3MX3 A;  4I2W A;  4XI9 A;  3R7R A;  5BNW A;  4WWO A;  1UN9 A;  3O48 A;  3MYV A;  4EEC A;  2FUL A;  4CT4 A;  3CHR A;  4MS6 A;  2GGF A;  3FTZ A;  3KEZ A;  2VJ8 A;  4LEU A;  4F53 A;  3PNL B;  4GCO A;  4U07 A;  2WVI A;  1DNP A;  1OWL A;  3NZS A;  3L17 A;  3U66 A;  1KT0 A;  3AS5 A;  1IYG A;  2X38 A;  3HVE A;  4JEU A;  2RD0 A;  3L6A A;  5JJ7 A;  4JHR A;  3NF1 A;  2VSO E;  3PZD A;  3QNK A;  4J8F A;  3SFZ A;  3SZ7 A;  3FUE A;  5AEN A;  2I9C A;  3D9L A;  4XI0 A;  3ZHE B;  3OXL A;  1UW4 B;  5BV1 A;  3CHP A;  4XX5 A;  5G04 C;  3URZ A;  3FEX A;  5C2Y A;  3RO3 A;  5BV0 A;  2M63 A;  3ZYM A;  3VLF A;  1NA3 A;  4B0Z A;  4LRZ A;  3N71 A;  3D9N A;  4XZ4 A;  3PDN A;  3BG1 B;  3CST A;  4CGV A;  2IOS A;  1E90 A;  4HLE A;  5FT9 A;  4J6I A;  3ZN3 A;  3L54 A;  2Y4U A;  4LUN U;  1GW6 A;  4CGW A;  3FTW A;  3PNT B;  4FHJ A;  4N39 A;  5JJT A;  3TGO A;  3CK7 A;  5D0Q D;  2QFC A;  4H7Y A;  2GRM A;  1HO8 A;  4EZL A;  1EDU A;  2WXR A;  5ARF A;  4BX8 A;  2IFU A;  4U63 A;  4CDM A;  4EQF A;  3I5P A;  3LY8 A;  4NRH B;  2R17 C;  3EJN A;  4A55 A;  1H6K A;  3PS6 A;  2I6H A;  2PQR A;  3LDZ A;  4PS3 A;  3ZGQ A;  3AU5 A;  3ZW3 A;  3PE4 A;  2BTD A;  2RG8 A;  2AXV A;  4BTB A;  2VSY A;  1MHQ A;  3G2U A;  2HM8 A;  2VYI A;  5FQ7 A;  3ULQ A;  3FU3 A;  2IU1 A;  3DPD A;  3R7Q A;  2MOW A;  4OVU A;  4EBA G;  3ZYL A;  4FJY A;  4PH4 B;  2KZT A;  3IHY A;  4JVS A;  5CMY A;  3APD A;  1E8W A;  5CHE E;  3FUF A;  3K9I A;  3SBS A;  2AW6 A;  3FH7 A;  3Q4A B;  1VDY A;  3SGH A;  3AS8 A;  3LYA A;  3OTN A;  3LVQ E;  4O6F A;  3FUH A;  2FO7 A;  3Q49 B;  4N5C A;  3VTY A;  3OXF A;  3RIB A;  4N3C A;  4JL0 A;  1H2T C;  2WXF A;  4GB9 A;  4OVV A;  3EIJ A;  2WXN A;  4F3V A;  2P58 C;  2CHW A;  2X6J A;  3QJZ A;  4GA0 A;  4IYP A;  3U9W A;  3UT7 A;  2ZU6 B;  3VLD A;  4GZD A;  3FUJ A;  3RRN B;  3UT4 A;  4WAF A;  3FHE A;  4A3T A;  2GRL A;  2QY7 A;  2UWJ G;  2XEV A;  4WWN A;  5HI7 A;  3SBT B;  1OWM A;  2E2E A;  4R7L A;  5HQ8 A;  2C2L A;  2VTB B;  3RJV A;  3FP3 A;  3S7F A;  2JEK A;  4B94 A;  5AIJ A;  4GYY A;  4AIF A;  4ANX A;  5G05 J;  2J4D A;  3RO2 A;  3LJ3 A;  2YIN A;  4G1T A;  4UWL A;  3ZYK A;  3EHM A;  3D9M A;  3T5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...