3PNLB

Crystal structure of e.coli dha kinase dhak-dhal complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
GSSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insight into covalent substrate binding by Escherichia coli dihydroxyacetone kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-bind
total genus 84
structure length 211
sequence length 211
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pnlB00
3CR3A 1UN9A 4LRZA 3PNLB 2BTDA 1UN8A
chains in the Genus database with same CATH superfamily
5LCWJ 3OAWA 3C98A 3HRAA 4U8YD 2OCCE 3ZXPA 4P29A 1HE8A 3AS5A 5D0QD 3CVVA 2I2OA 1DVPA 2X6FA 3FUDA 4LUNU 3TWSA 3GW4A 2VGYA 2OVBA 2GRQB 1N0RA 1IKND 2QYJA 1K1AA 3GYZA 3QWVA 3FULA 1EPUA 3FP3A 2A5UA 1N4SA 4FC8A 1DCQA 4N5CA 1IHBA 1WAO1 3QB2A 1UW4B 5EILA 3RIBA 2LUHA 3CVYA 1IXVA 4XKBA 5KNHD 4G8LA 4M3OA 4GA1A 4WNEA 1VDYA 2OOEA 1NA0A 1X81A 2UWJG 2R17C 3QWWA 3BUAA 4RLYA 4U8VD 1HG2A 2L0IA 3QKYA 5ANLA 3R7QA 1MX6A 4GZDA 2CG3A 4ZHBA 2XHEA 4GCNA 4HB5A 3ASNE 4DI3A 3UT4A 2R03A 3OXGA 5CEAA 4O1PA 2GROB 2X3MA 1YA0A 2ZISA 3UT7A 4APOA 4GZ5A 4AM9A 2R59A 4HBDA 2E2EA 5EIDA 3DSXA 3D9NA 2LSUA 3U4TA 3FTYA 1N52A 3OTNA 4Q94A 4C48B 3DEOA 4GTPA 4WAFA 1N4RA 1H6PA 1BU9A 3QJZA 3I4GA 1S64A 2Q7FA 1BI7B 4UQYA 2A4ZA 5J90A 4ACKA 3FU3A 3V79K 3PZ1A 3U9WA 3CHQA 4A55A 4TXRA 3G2WA 4EQFA 1Z5SC 3FTWA 3EHRA 2YHEA 2KZTA 3ASOE 2XPYA 4JL0A 1Q2ZA 5BV1A 3IV0A 3J5PA 2HYZA 3D9KA 4ILGA 3ESLA 3UXGA 4UI9J 3E30A 3TWWA 1HX8A 2XRZA 3FUJA 3MCXA 2LXLA 3U3WA 1MX2A 3J5QB 3SY2A 3FH7A 1TJCA 4KBQA 3E4BA 4O6FA 3PZ3A 3CSFA 4ANWA 4BTBA 2P9UG 5AENA 2V4HC 1BPOA 4YDWA 4EECA 4DX5D 1IQRA 1TNOA 2B0OE 2WXFA 5FZSA 3V30A 2LSVA 3CGHA 4DLQA 3Q49B 4BT9A 4JB8P 2VYIA 3ZFWA 4PS3A 5G55A 1LF8A 1TN7A 4OAVB 5G05C 5EYPF 4BESA 2KCLA 3NZSA 3FU6A 2DIWA 4AJWA 3DRAA 1P5QA 1KZOA 3UQ3A 3PRZA 1UN9A 5KJNA 1QZ2A 4BETA 3ONLA 1RZ4A 4GMJA 4IULA 3TWUA 3Q4AB 3G2SA 1MZCA 5CBNA 4AOFA 5T3RA 2H6HA 1BD8A 2KM4A 4JXTA 2ZGGA 4AY6A 3UX4A 3FUHA 1HO8A 1JWGA 3LY9A 5CBOA 4DX7D 4G11A 2WXQA 4GU5A 3FUKA 4LNGA 3CVXA 4DX1A 2OEWA 2WXOA 1OCOE 3SNXA 1N4QA 1MHQA 4KZ0A 1E90A 3ZYLA 3ABLE 3FTVA 2YHCA 3DSWA 3K9IA 2BEDA 3CK7A 4HFGA 3CVWA 4A1SA 1HG5A 3ML8A 1JCSA 1DC2A 3NQPA 1PC2A 3Q7FA 1WY6A 2FEZA 3EIJA 4G8KA 3SFYA 4X8QA 3HDXA 2LAHA 3AG1E 3HVEA 2X6HA 2VTBB 3T5VA 1ELRA 3ASGA 1LTXA 3ZIMA 4PS8A 1LD8A 2EIKE 2J4BA 5EKQD 3UM1A 1BI8B 3IHVA 1MX4A 4HOTA 1A17A 4CGWA 1DNPA 3TAXA 1KT1A 3CHOA 5JJ6A 4GTTA 2R5SA 2DVWA 5EX0A 3DEPA 5HRYA 2CHZA 4WWOA 3Q79A 5C1DA 1N4PA 4TUUA 3L82A 4WUYA 3I3NA 3CVLA 3PUKA 4TRQA 2KCVA 4YDOA 3RRMB 3ESKA 1XNFA 2XPIA 2L9BA 4GMLA 1KPSB 3S7FA 4GZCA 4I9CA 5BUZA 5JJTA 2X6IA 5BXUA 1UG3A 4ANUA 1QYMA 2XZDG 4R7LA 4HORA 4DX2A 1TNBA 1TYQG 3VLEA 4AIFA 3RKVA 2IONA 2QC9A 4UWGA 2NC9A 1NP7A 5CHEE 2XEVA 1X5BA 4IRUA 3CSTA 3CQGB 1K8KG 3HXDA 3DXKG 5DIZA 4ANVA 4I17A 2PM6A 3MZLB 4RG6A 2AJAA 3FFLA 3TJPA 5LP0A 2AXVA 4BSZB 4JHRA 1Z3XA 3N71A 2P2CP 4M7CA 2ETAA 3NB2A 4GPMA 2AXUA 5AARA 3TXMA 2XZTG 3U64A 3MKQB 1WDYA 3GZ1A 3L54A 4L1BA 2HO1A 5HQ8A 1N11A 3HYMB 1LD7A 4L2LA 1INZA 3PS6A 4HQDA 4TXPA 3LJNA 2J49A 2MYOA 4FJZA 3FWVA 3ZU7B 1NZNA 3MGBA 3PEVB 2J9QA 1SQMA 5JMND 2H6GA 2WXIA 3B7TA 4J8SA 1MQSA 4GTVA 4JHKA 1OXJA 2V0PA 3Q9UC 5E76A 3JUEA 2L6JA 3CEQA 2MRIA 2KXPC 4HRMB 5FJYA 4GMRA 2WPVA 5C2YA 2RFMA 4UI9C 3V2XA 3V31A 4HOQA 2EIME 3APFA 3OXLA 2VTBA 3GZ2A 2L6BA 2VGEA 3MV3B 4N5QA 4U96D 3S7JA 1KZPA 1GW6A 2WXKA 3ZYMA 3MEKA 4DLOA 1OT8A 4GZ6A 4BEPA 5ARGA 3PUJA 4F1SA 5B3SE 3MV2B 1KLXA 3TG5A 3R9MA 4F3VA 4GYYA 2V4LA 3UKRG 1MJ0A 2GRMA 3QOUA 4C9BB 1JPLA 2MHKA 3ULQA 4XEIG 4HI9A 2VSOE 5FQ6A 3S7DA 2MOWA 3ABKE 5DBKA 1IHGA 3ZXSA 3DWLG 4YNDA 3ZHEA 3R7RA 4GTRA 4QQIA 3Q78A 3D9PA 3DSSA 1WM5A 4LSZE 4N3AA 3C3QA 2IEJA 5G2NA 4MS6A 3ML9A 2JABA 3S7BA 2VSXE 2IU1A 4CT0A 4U0UA 3D9JA 5BV0A 3KEZA 3EU5A 4BSXA 4NACA 5D2MC 3DSUA 2VSYA 4J6IA 2FBNA 3E37A 5CRUA 4J8FA 5AQ9A 5JJ7A 3FH5A 2XGMA 3CKCA 4HXIA 4IYPA 1N9AA 1OWPA 3SO8A 4LNBA 2PL2A 3KSLA 4KYOB 5ENPD 4DPRA 2PZIA 2GRRB 4UWFA 1FCHA 1NL4A 4CCAA 3EHNA 4KZCA 2OVFA 3B95A 3DSTA 1ZU2A 2XPZA 1PY1A 2PM7A 4TXQA 4Q69A 3F6QA 2XCCA 4BX8A 2NXPA 4KT6B 3T5XA 2UY1B 3HXFA 5ENTD 4PS7A 3ZGQA 2I1KA 1S63A 4HRNA 1OWMA 4FHKA 2R05A 5J08A 5AN8A 4GA0A 3L22A 2M63A 3JUIA 2IOLA 1HXIA 4PH4B 4ABNA 2DCPA 5E75A 1E7UA 3FUMA 2CFZA 5BT1A 1TN8A 3L9TA 1N94A 4NURA 4NRHB 4D10C 4N2SA 5BPPA 4B94A 3PE3A 4WNGA 2X6JA 3QNKA 5CMWA 3HIZA 5T4YA 3RSEG 1HH8A 2LAIA 5LFAA 2RKKA 4CDRA 3SGHA 4AP2A 3FU5A 5ENRD 3TWXA 2RD0A 3CK8A 5EN5D 3KD7A 5B1AE 1N95A 1IYGA 3Q47B 2NYJA 5CEDB 3ASHA 1H2UA 4O1OA 5KNGA 1L5JA 4ILHB 3CVNA 3FY4A 3BQOA 4B0ZA 5CCLA 2AXZA 4U07A 4GYOA 1O1RA 3HG0D 4CDMA 4EZJA 3PZ2A 3VTYA 1O1SA 3QARA 4JA7A 2WXJA 4YVOA 1G3NB 4U04A 4JW1A 2EQXA 5BNWA 2LO6A 5G04C 3RJVA 1H2VC 2VGXA 2R02A 3G2VA 3PZDA 3D3MA 2IQCA 5A23A 1TJFA 2XS8A 3AU4A 2WMOA 4L23A 1SA4A 4EZLA 3AS4A 4U0ZA 3EDTB 4YDEA 2B6CA 3IXEA 3B7UX 4A3TA 4G23A 4XZ4A 2CHXA 4I6GA 3BG0B 5AYWD 1E8YA 4GB9A 3VTXA 2H6FA 3ZYKA 3JYSA 1ELWA 1QQEA 4FU3A 4KVMA 4G2VA 1FT2A 4ANXA 3CHMA 4BT8A 4B89A 2LNIA 3JXIA 2XENA 3RRNB 5KJMA 3QDNA 3C5RA 1H0AA 4EBAG 5FQ7A 2IOSA 4OAUC 4A1GA 2BF0X 2HR2A 4J8YA 3MKRA 3TWVA 1W3BA 2F0YA 4JEHA 2WQ7A 2PQRA 4HLLA 2QZAA 2F8YA 5T8IA 4DK5A 2EILE 4I2WA 2CFUA 1K1BA 4GCOA 3ABME 5FTPA 3IHYA 5AIJA 4Y6WA 4JA9A 3Q15A 3MX3A 3UT8A 4NIKA 3CIAA 1YMPA 1OCCE 3NF1A 2DYSE 1AP7A 4Z68A 4DRXE 2ZU6B 4GAAA 1E8XA 2J08A 4YDYA 4RVBA 4CYMD 1ZB1A 3TG4A 3D9OA 3DPDA 1SVXA 2HE0A 1MYOA 3PEUB 1OUVA 4N39A 4EHMA 4I2ZA 3ZEFA 4XX5A 4A3VA 5BXOA 1Y6IA 3DSVA 2AVPA 4I1MA 3SBSA 5LX8A 3NOCD 3TWRA 4ILIA 4CGVA 5AQ7A 2YNQA 5A7DB 3QAQA 1YCSB 2C2LA 3B7BA 3G2UA 1Z3YA 1TEZA 3RK6A 2YINA 3FTUA 3LS8A 5KWDA 3I5PA 2IO2C 4DX6D 5FQ4A 3L16A 4JZYA 4FULA 2XEHA 3ZRHA 3P2BA 4E85A 2Y4TA 4UWHA 3SBTB 2J09A 3PNTB 2ONDA 4ATGA 4L9PA 4CRWA 1H2TC 2I9CA 4CT4A 4XI9A 3JQ1A 3L17A 3MA5A 1UN8A 4F6RD 2ETCA 4HOUA 4Q96A 5EX3A 4NQ0A 3HHMA 2VGXB 2KZTB 1SA5A 2BUGA 3FDHA 3KAEA 2KBXA 3X2QE 5HKPA 2WVIA 2F8XK 3SQVA 2VSNA 5CRVA 4I9EA 4F7AA 4V3IA 4FP7A 3EJNA 3DPYA 4L2YA 4UI9K 3HXBA 5FQ8A 3PREA 3UM3A 4EZKA 5G05J 5JA4D 2I1JA 3QC1A 3LYAA 3AU5A 3LKUA 2OEVA 5ITZF 5JHAA 4FHJA 3V2OA 5HI7A 1HZ4A 3E34A 3RAUA 4DJAA 3AS8A 2RFAA 4G25A 4BFRA 2Y3AA 3T9KA 4Y6CA 2WXMA 1DCEA 2GRNB 2V5FA 2Y0BG 4C0EA 3FEYA 4KVOA 2KATA 4ZFHA 3AAAC 4QFVA 3FU0A 2J4DA 1BLXB 5FWQA 4K03A 3FEXA 4N3CA 1S70B 4LNUD 4GTQA 3ZYQA 3FH8A 3EUVA 2GRPB 2DWZA 2XS1A 3BU8A 3E32A 3L08A 1EDUA 5M72A 5FINA 1TNZA 3I4RB 2XEEA 5IY5E 1H6OA 3KS2A 3EU9A 1U3DA 1HU3A 4BWRA 3L6AA 4G1TA 1HFAA 2WMNA 4J7WA 4URKA 4WNDA 3ZKJA 1NA3A 3WG7E 5EIBE 2P9PG 4GA2A 3ULYA 4APFA 1N54A 4PDXA 3UM2A 2WXPA 3CLJA 3C72A 2AWIA 2WM9A 4U0SA 4O60A 2Y69E 3RU0A 2IO3C 4U95D 2ILRA 3VLDA 5D66A 4F53A 4AEZC 5G04J 2XQ0A 4U8HA 3APDA 3Q7AA 4BTAA 3TWTA 1XGWA 3LPZA 5FZRA 5CERB 3T8MA 3APCA 3O48A 3CVUA 4G24A 2P9IG 2WXRA 5AJDA 2FF4A 4MBGA 3DXMG 4ME2A 3L13A 4JHJA 4FA6A 4HOSA 4A63B 3UUXA 4AV7A 4GPKA 4CDNA 4UWLA 3ZVVA 1JCQA 2WXLA 1TN6A 3Q9NC 2CG2A 1SZAA 4JC8A 5ARFA 3ZW3A 2CHWA 3CHPA 2JEKA 2IJGX 5HS0A 3CVPA 3Q73A 4C0MA 3ULEG 3CHRA 3SD5A 5CECB 2P9NG 3TGOA 4BX9A 5D0OD 4LCTA 4OVUA 4AY5A 5AAOA 1OCRE 3IKOB 4J8DA 3FUNA 1RW2A 1FPPA 3PH0C 4W9RA 4EPZA 1AWCB 4B8CB 3CVQA 2NSZA 4UQZA 1OY3D 3MJWA 2XGSA 1D8EA 4LRZA 1JUQA 2ZXWE 4GTMA 3T8KA 3ZN3A 2P9SG 2V8SE 3CV0A 4H7XA 3LCAA 3NZUA 1UJJA 3MKQA 3QK0A 3G2TA 3QWPA 4FLHA 2LXMA 1E8ZA 4U7EB 5EYLA 3VLFA 3UPVA 5LOZA 3SF4A 3UKUG 1UJKA 3IBEA 3UINC 2BKGA 5A6CA 2E0IA 3HVEB 1OCZE 4JD2G 1JCRA 3FUEA 5ENOD 3MYVA 1NFIE 1HS6A 3KEAA 2GGFA 1A5EA 2IF4A 2C0MA 4G26A 3ENEA 2A5EA 3R9AB 3FTZA 4RG9A 3PZ4A 4YVQC 5ENQD 4EBAA 1TR4A 2P9LG 3PVLA 4K5AB 1K3ZD 5FZQA 5CCMA 2EINE 3PNLB 4OYSA 3EHQA 2AW6A 4IN3B 5BW8C 1E7VA 3TWQA 1HF8A 4B8AA 2BTDA 3FTSA 2UY1A 3Q75A 5AJLA 3ZPJA 3TXNA 4UQXA 4RSYA 1SZ9A 2DYRE 4K0RA 2F37A 5KJKA 4L7TA 1OWLA 1O1TA 4I43A 4J0UA 1E8WA 3GZSA 3ZHEB 1TNUA 1UOHA 4JEUA 2BKKB 3SFZA 2EIJE 2QFCA 1QNFA 4AVXA 3CK9A 3UI2A 2WXGA 4K5BA 3FUFA 4HVBA 3JQ0A 4RQIA 4LEUA 5KBAA 2VJ8A 3AG4E 1ELKA 4GTSA 5ENSD 2VQ2A 4FLBA 3CR3A 4I6JA 4HNAD 4FJYA 4WWNA 4CEMA 2J07A 5KJLA 1Y8MA 5FIOA 5KCMA 1YYHA 3NBNB 3LXUX 4WWPA 2DZNA 3CQCB 1OWNA 5AQAA 3WXXA 1V54E 3SI5A 2I6HA 4FADA 3D9HA 5ANRA 3SZ7A 1EF1C 2P58C 1NI1A 4XI0A 4JPSA 3LVRE 5CMYA 5B1BE 3SHFA 4K5CA 4N3BA 3HXCA 4ATZD 2FI7A 4GYWA 2FULA 4TUMA 3FUIA 2WXHA 2WB2A 2ZGDA 3C3RA 3EIQC 3JCKC 3ZUVB 2KCKA 3IEGA 3UIPC 3B7RL 3LJ3A 3D9LA 3AJIA 3B13A 1Z6TA 3TL5A 3FHEA 3ZNGA 3UMVA 1IQUA 3AG3E 4JVSA 2IFUA 3LDZA 5LCWC 3O4ZA 4ACLA 3B7SA 4BERA 3KSQA 3UM0A 4HLEA 2J8SD 3W9FA 3Q5MA 2ETBA 2X6KA 4I1AA 3LEWA 5FT9A 2PNNA 2X38A 4PUCA 3DBSA 4DUIA 4H7YA 1V55E 4BY6A 3NOGD 4UWKA 1SW6A 1WG0A 2RG8A 1JWFA 2WQHA 4I6EA 2XRYA 4UUCA 3URZA 3D9IA 2P9KG 3ASFA 2KC7A 1U2VG 3UIOC 2XCBA 3ASDA 3UTMA 3CKBA 1TNYA 3RRUA 1D9SA 4OVVA 1N0QA 3RO2A 3CHSA 3HXEA 1H6KA 3EHMA 4AXHA 2XGOA 2FO1E 3BEEA 1O5MA 2GW1A 2OV8A 2YQ8A 4J8EA 3AG2E 4MRUA 4GZ3A 2L0TB 1FT1A 2QY7A 3FTXA 4CZ2D 2WXNA 3RO3A 1ZBPA 3E33A 3U66A 1OWOA 1EYHA 3LY7A 2GRLA 2FO7A 1PAQA 3LVQE 5JHBA 3ISMC 4XE0A 4B93B 4HRLA 4MLPA 4MKTA 3LY8A 4DI4A 1FVFA 2H6IA 4U63A 2ZIRA 3PE4A 2WQ6A 1FVHA 1D8DA 5EDSA 1KT0A 4XIFA 2PQNA 2DBAA 3P1UA 1U3CA 1S0PA 1H19A 3BG1B 4N2QA 4WNFA 2IY0C 3W9GA 4KMOA 2Y1LE 3NAWA 1E96B 3JXJA 1B89A 4TV3A 3SFXA 2R2LA 2QYUA 2Y4UA 4KXKB 5ENNA 4I1OB 3D9MA 5H7PA 4XKCA 5AQBA 4LG6A 1QBQA 3ONKA 3S2AA 3OXFA 3C3OA 4GTOA 3PDNA 4LERA 2HM8A 4HS2A 4E6HA 2JLBA 4HI8A 4F1PA 2DZOA 2C0LA 2V5QC
chains in the Genus database with same CATH topology
4KVMA 2AXVA 5LP0A 3MJWA 4JHRA 1Z3XA 2XGSA 4G2VA 5LCWJ 3N71A 4LRZA 3OAWA 4ANXA 3CHMA 1JUQA 2AXUA 4BT8A 3C98A 3TXMA 4B89A 2LNIA 3U64A 3MKQB 3ZN3A 2V8SE 3CV0A 3GZ1A 3L54A 4H7XA 4L1BA 3LCAA 3NZUA 1UJJA 3RRNB 3MKQA 3QDNA 3QK0A 5KJMA 3G2TA 2HO1A 1HE8A 4P29A 3AS5A 1H0AA 3QWPA 5D0QD 4FLHA 3CVVA 5HQ8A 2I2OA 4EBAG 1DVPA 3HYMB 5FQ7A 2X6FA 1E8ZA 2IOSA 3PS6A 4L2LA 1INZA 3FUDA 4LUNU 3VLFA 3GW4A 2VGYA 2OVBA 3UPVA 2J49A 5LOZA 4A1GA 2BF0X 2HR2A 4FJZA 3FWVA 3SF4A 3MKRA 1W3BA 4JEHA 1UJKA 2WQ7A 2PQRA 1NZNA 3MGBA 3PEVB 3IBEA 3GYZA 3QWVA 3FULA 5T8IA 4DK5A 1EPUA 4I2WA 2J9QA 2CFUA 1SQMA 4GCOA 2E0IA 5A6CA 3FP3A 3HVEB 2A5UA 5FTPA 3IHYA 5AIJA 2WXIA 4Y6WA 4JA9A 3B7TA 4FC8A 4J8SA 3Q15A 3MX3A 3FUEA 4N5CA 1MQSA 1WAO1 3UT8A 3QB2A 1UW4B 3CIAA 3MYVA 4JHKA 3RIBA 2V0PA 3CVYA 4XKBA 1HS6A 2GGFA 5E76A 4M3OA 4GA1A 4WNEA 1VDYA 2L6JA 3CEQA 2MRIA 2IF4A 3NF1A 2OOEA 1NA0A 2C0MA 2ZU6B 4G26A 2UWJG 2R17C 3QWWA 1E8XA 2J08A 4GAAA 3ENEA 5FJYA 1HG2A 3R9AB 4RVBA 3FTZA 3TG4A 2L0IA 3D9OA 3QKYA 2WPVA 3DPDA 4RG9A 3PEUB 5C2YA 5ANLA 3R7QA 1OUVA 4YVQC 4N39A 4GZDA 4UI9C 4I2ZA 4HOQA 4EBAA 2CG3A 3APFA 3ZEFA 3OXLA 4XX5A 4A3VA 3PVLA 2VTBA 2XHEA 1Y6IA 4GCNA 2AVPA 4I1MA 3SBSA 5LX8A 3GZ2A 5FZQA 4DI3A 3UT4A 5CCMA 4ILIA 4CGVA 2YNQA 3OXGA 5A7DB 3QAQA 3MV3B 2X3MA 1YA0A 3PNLB 4OYSA 2C2LA 3UT7A 2AW6A 3G2UA 1Z3YA 4IN3B 3S7JA 4APOA 4GZ5A 4AM9A 1TEZA 5BW8C 1E7VA 2YINA 3FTUA 3RK6A 3LS8A 1GW6A 2R59A 2WXKA 3ZYMA 3I5PA 1HF8A 3MEKA 4DLOA 4B8AA 2BTDA 3FTSA 5FQ4A 2E2EA 2UY1A 3L16A 4GZ6A 4JZYA 3D9NA 2LSUA 3U4TA 5ARGA 3PUJA 3FTYA 5AJLA 4FULA 1N52A 4F1SA 3ZPJA 3OTNA 3TXNA 3ZRHA 3P2BA 4E85A 2Y4TA 3MV2B 4Q94A 4UWHA 1KLXA 3SBTB 3TG5A 4UQXA 4RSYA 2J09A 1SZ9A 4F3VA 4GYYA 4WAFA 2V4LA 4K0RA 3PNTB 3QJZA 2GRMA 3QOUA 4L7TA 4C9BB 3I4GA 5KJKA 1JPLA 2ONDA 4ATGA 2MHKA 3ULQA 2Q7FA 5FQ6A 2VSOE 4UQYA 3S7DA 2A4ZA 2MOWA 1OWLA 5J90A 4ACKA 4CRWA 3FU3A 4I43A 1H2TC 2I9CA 4J0UA 1E8WA 4CT4A 3GZSA 4XI9A 3ZHEB 5DBKA 1IHGA 3U9WA 3ZXSA 3JQ1A 3L17A 3MA5A 4YNDA 3ZHEA 3R7RA 4JEUA 3CHQA 4A55A 1UN8A 3G2WA 3SFZA 4HOUA 3D9PA 4EQFA 2QFCA 1QNFA 4AVXA 3FTWA 1WM5A 4Q96A 5EX3A 2YHEA 2KZTA 4NQ0A 3CK9A 3HHMA 2VGXB 2WXGA 2XPYA 4N3AA 3FUFA 4JL0A 4HVBA 2KZTB 2BUGA 3IV0A 3JQ0A 5BV1A 3FDHA 4LEUA 3KAEA 5G2NA 2VJ8A 4MS6A 2HYZA 1ELKA 3D9KA 4ILGA 3ESLA 3ML9A 4UI9J 2VQ2A 3S7BA 4FLBA 3CR3A 1HX8A 3FUJA 3MCXA 4I6JA 3U3WA 2WVIA 2XRZA 4FJYA 2VSXE 4WWNA 2IU1A 4CEMA 2J07A 4CT0A 4U0UA 5KJLA 3FH7A 1TJCA 1Y8MA 3E4BA 4KBQA 5KCMA 3D9JA 4O6FA 3LXUX 3CSFA 4WWPA 4ANWA 5BV0A 3KEZA 4BTBA 3CQCB 1OWNA 2VSNA 3WXXA 5AENA 4BSXA 3SI5A 1BPOA 4NACA 4EECA 2I6HA 1IQRA 4I9EA 2WXFA 4FADA 5ANRA 5FZSA 3SZ7A 2LSVA 1EF1C 2VSYA 4J6IA 4F7AA 2P58C 4V3IA 2FBNA 4FP7A 3CGHA 3EJNA 4DLQA 3Q49B 4BT9A 4XI0A 4JPSA 4L2YA 4UI9K 2VYIA 3ZFWA 5FQ8A 3LVRE 3PREA 4J8FA 4EZKA 5CMYA 5G05J 3SHFA 2I1JA 5JJ7A 3FH5A 3QC1A 4N3BA 2XGMA 4PS3A 5G55A 3LYAA 3CKCA 3AU5A 3LKUA 4HXIA 4IYPA 2FI7A 1LF8A 1OWPA 4GYWA 5G05C 2FULA 2PL2A 2KCLA 3NZSA 4KYOB 5JHAA 3FU6A 2DIWA 3FUIA 2WXHA 4FHJA 4AJWA 2WB2A 1P5QA 3UQ3A 4DPRA 3EIQC 3PRZA 3JCKC 1UN9A 5HI7A 2PZIA 5KJNA 1HZ4A 2KCKA 1QZ2A 3IEGA 3ONLA 4DJAA 4GMJA 3AS8A 3B7RL 3LJ3A 3D9LA 5BPPA 4IULA 4G25A 3B13A 4UWFA 3Q4AB 1FCHA 4CCAA 3G2SA 4BFRA 2Y3AA 4Y6CA 3EHNA 1Z6TA 3TL5A 4KZCA 2OVFA 2WXMA 3FHEA 4AOFA 5T3RA 1ZU2A 3UMVA 2V5FA 1IQUA 4C0EA 4JVSA 2IFUA 3LDZA 3FEYA 2XPZA 2KATA 2KM4A 4KVOA 5LCWC 3O4ZA 1PY1A 4JXTA 4ACLA 2PM7A 4AY6A 3B7SA 3UX4A 4Q69A 3FUHA 4QFVA 1HO8A 3FU0A 2XCCA 2J4DA 4HLEA 4BX8A 1JWGA 3LY9A 5FWQA 2NXPA 4K03A 4KT6B 4G11A 2WXQA 4GU5A 3FEXA 3FUKA 3Q5MA 4N3CA 2X6KA 4I1AA 3LEWA 5FT9A 3CVXA 2WXOA 3ZYQA 3FH8A 2X38A 3SNXA 3T5XA 1MHQA 4PUCA 2UY1B 4KZ0A 1E90A 4PS7A 3ZYLA 3DBSA 4H7YA 3ZGQA 2I1KA 3L08A 1OWMA 4FHKA 4BY6A 5J08A 3FTVA 1EDUA 5M72A 4GA0A 2YHCA 3K9IA 4UWKA 3CK7A 3L22A 4HFGA 3I4RB 2RG8A 3CVWA 2M63A 3JUIA 1JWFA 4A1SA 1HG5A 3ML8A 2IOLA 2WQHA 1HXIA 3KS2A 4I6EA 4PH4B 2XRYA 1U3DA 1HU3A 4ABNA 4BWRA 3URZA 3NQPA 1PC2A 2DCPA 3D9IA 1E7UA 3L6AA 4G1TA 5E75A 1HFAA 2WMNA 1WY6A 3ASFA 3FUMA 2CFZA 5BT1A 4URKA 2FEZA 4WNDA 2KC7A 3EIJA 1NA3A 4NURA 4NRHB 4D10C 2XCBA 4GA2A 4APFA 3ASDA 4N2SA 3HDXA 4B94A 1N54A 2LAHA 3PE3A 2X6JA 4WNGA 3CKBA 3QNKA 3RRUA 3HVEA 5CMWA 3HIZA 2X6HA 5T4YA 2VTBB 4OVVA 1HH8A 2LAIA 3T5VA 1ELRA 3ASGA 3RO2A 3CHSA 5LFAA 3ZIMA 4PDXA 4PS8A 2WXPA 1H6KA 2J4BA 3CLJA 3EHMA 4AXHA 5EKQD 2XGOA 3BEEA 2AWIA 2WM9A 4CDRA 3SGHA 4AP2A 4U0SA 2GW1A 2OV8A 3FU5A 2RD0A 2YQ8A 4J8EA 4MRUA 3CK8A 3KD7A 3IHVA 3RU0A 4HOTA 4GZ3A 1A17A 1IYGA 2L0TB 2ILRA 3Q47B 3VLDA 2QY7A 3ASHA 3FTXA 4F53A 4AEZC 1H2UA 1DNPA 1KT1A 5G04J 2WXNA 1L5JA 4ILHB 3RO3A 3CHOA 5JJ6A 3TAXA 2XQ0A 3CVNA 4U8HA 2R5SA 3APDA 1ZBPA 3FY4A 3U66A 1OWOA 5EX0A 1EYHA 4B0ZA 5CCLA 2CHZA 4BTAA 2AXZA 4U07A 3LY7A 2GRLA 4WWOA 2FO7A 4GYOA 1PAQA 5C1DA 3LVQE 5JHBA 4TUUA 4XE0A 1XGWA 3LPZA 5FZRA 4MLPA 4MKTA 4CDMA 3LY8A 4EZJA 4DI4A 4WUYA 3I3NA 3T8MA 3APCA 3CVLA 1FVFA 3O48A 3CVUA 4G24A 5AJDA 2WXRA 4U63A 3PE4A 3PUKA 4TRQA 2KCVA 3VTYA 3QARA 2WQ6A 1FVHA 4JA7A 2FF4A 2WXJA 4ME2A 3L13A 4JHJA 4FA6A 4HOSA 5EDSA 3RRMB 3ESKA 4YVOA 1KT0A 4XIFA 3UUXA 2PQNA 4AV7A 4GPKA 4CDNA 2DBAA 1XNFA 2XPIA 3P1UA 1U3CA 2L9BA 4UWLA 4U04A 3ZVVA 4JW1A 1S0PA 1H19A 2WXLA 3BG1B 2EQXA 4GMLA 4N2QA 3S7FA 5BNWA 2LO6A 4GZCA 4I9CA 4WNFA 2CG2A 1SZAA 5G04C 5BUZA 4JC8A 5ARFA 5JJTA 3ZW3A 2CHWA 2X6IA 3CHPA 4KMOA 3RJVA 1H2VC 2VGXA 1E96B 1UG3A 3G2VA 4ANUA 3PZDA 4R7LA 2JEKA 2IJGX 4HORA 3D3MA 2IQCA 3CVPA 3VLEA 5A23A 1B89A 4AIFA 4C0MA 1TJFA 4TV3A 3RKVA 2IONA 3AU4A 3CHRA 2WMOA 3SD5A 4UWGA 4L23A 1NP7A 2NC9A 4EZLA 3AS4A 4U0ZA 3TGOA 3EDTB 5CHEE 4BX9A 2XEVA 2Y4UA 5D0OD 1X5BA 4KXKB 4IRUA 5ENNA 3B7UX 3D9MA 3CSTA 4I1OB 4LCTA 4OVUA 3CQGB 4AY5A 4A3TA 4CGWA 4XKCA 3ONKA 3IKOB 4J8DA 3S2AA 4G23A 4XZ4A 3OXFA 3FUNA 2CHXA 4I6GA 5DIZA 4ANVA 4I17A 3BG0B 3PDNA 4LERA 4W9RA 3PH0C 2HM8A 4HS2A 4E6HA 2PM6A 3MZLB 4EPZA 5AYWD 2JLBA 4RG6A 1E8YA 4GB9A 4B8CB 3FFLA 3CVQA 3VTXA 2NSZA 3ZYKA 4UQZA 2C0LA 3JYSA 1ELWA 1QQEA 4FU3A 3TJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR3 A;  1UN9 A;  4LRZ A;  3PNL B;  2BTD A;  1UN8 A; 
#chains in the Genus database with same CATH topology
 5LCW J;  3OAW A;  3C98 A;  3HRA A;  4U8Y D;  2OCC E;  3ZXP A;  4P29 A;  1HE8 A;  3AS5 A;  5D0Q D;  3CVV A;  2I2O A;  1DVP A;  2X6F A;  3FUD A;  4LUN U;  3TWS A;  3GW4 A;  2VGY A;  2OVB A;  2GRQ B;  1N0R A;  1IKN D;  2QYJ A;  1K1A A;  3GYZ A;  3QWV A;  3FUL A;  1EPU A;  3FP3 A;  2A5U A;  1N4S A;  4FC8 A;  1DCQ A;  4N5C A;  1IHB A;  1WAO 1;  3QB2 A;  1UW4 B;  5EIL A;  3RIB A;  2LUH A;  3CVY A;  1IXV A;  4XKB A;  5KNH D;  4G8L A;  4M3O A;  4GA1 A;  4WNE A;  1VDY A;  2OOE A;  1NA0 A;  1X81 A;  2UWJ G;  2R17 C;  3QWW A;  3BUA A;  4RLY A;  4U8V D;  1HG2 A;  2L0I A;  3QKY A;  5ANL A;  3R7Q A;  1MX6 A;  4GZD A;  2CG3 A;  4ZHB A;  2XHE A;  4GCN A;  4HB5 A;  3ASN E;  4DI3 A;  3UT4 A;  2R03 A;  3OXG A;  5CEA A;  4O1P A;  2GRO B;  2X3M A;  1YA0 A;  2ZIS A;  3UT7 A;  4APO A;  4GZ5 A;  4AM9 A;  2R59 A;  4HBD A;  2E2E A;  5EID A;  3DSX A;  3D9N A;  2LSU A;  3U4T A;  3FTY A;  1N52 A;  3OTN A;  4Q94 A;  4C48 B;  3DEO A;  4GTP A;  4WAF A;  1N4R A;  1H6P A;  1BU9 A;  3QJZ A;  3I4G A;  1S64 A;  2Q7F A;  1BI7 B;  4UQY A;  2A4Z A;  5J90 A;  4ACK A;  3FU3 A;  3V79 K;  3PZ1 A;  3U9W A;  3CHQ A;  4A55 A;  4TXR A;  3G2W A;  4EQF A;  1Z5S C;  3FTW A;  3EHR A;  2YHE A;  2KZT A;  3ASO E;  2XPY A;  4JL0 A;  1Q2Z A;  5BV1 A;  3IV0 A;  3J5P A;  2HYZ A;  3D9K A;  4ILG A;  3ESL A;  3UXG A;  4UI9 J;  3E30 A;  3TWW A;  1HX8 A;  2XRZ A;  3FUJ A;  3MCX A;  2LXL A;  3U3W A;  1MX2 A;  3J5Q B;  3SY2 A;  3FH7 A;  1TJC A;  4KBQ A;  3E4B A;  4O6F A;  3PZ3 A;  3CSF A;  4ANW A;  4BTB A;  2P9U G;  5AEN A;  2V4H C;  1BPO A;  4YDW A;  4EEC A;  4DX5 D;  1IQR A;  1TNO A;  2B0O E;  2WXF A;  5FZS A;  3V30 A;  2LSV A;  3CGH A;  4DLQ A;  3Q49 B;  4BT9 A;  4JB8 P;  2VYI A;  3ZFW A;  4PS3 A;  5G55 A;  1LF8 A;  1TN7 A;  4OAV B;  5G05 C;  5EYP F;  4BES A;  2KCL A;  3NZS A;  3FU6 A;  2DIW A;  4AJW A;  3DRA A;  1P5Q A;  1KZO A;  3UQ3 A;  3PRZ A;  1UN9 A;  5KJN A;  1QZ2 A;  4BET A;  3ONL A;  1RZ4 A;  4GMJ A;  4IUL A;  3TWU A;  3Q4A B;  3G2S A;  1MZC A;  5CBN A;  4AOF A;  5T3R A;  2H6H A;  1BD8 A;  2KM4 A;  4JXT A;  2ZGG A;  4AY6 A;  3UX4 A;  3FUH A;  1HO8 A;  1JWG A;  3LY9 A;  5CBO A;  4DX7 D;  4G11 A;  2WXQ A;  4GU5 A;  3FUK A;  4LNG A;  3CVX A;  4DX1 A;  2OEW A;  2WXO A;  1OCO E;  3SNX A;  1N4Q A;  1MHQ A;  4KZ0 A;  1E90 A;  3ZYL A;  3ABL E;  3FTV A;  2YHC A;  3DSW A;  3K9I A;  2BED A;  3CK7 A;  4HFG A;  3CVW A;  4A1S A;  1HG5 A;  3ML8 A;  1JCS A;  1DC2 A;  3NQP A;  1PC2 A;  3Q7F A;  1WY6 A;  2FEZ A;  3EIJ A;  4G8K A;  3SFY A;  4X8Q A;  3HDX A;  2LAH A;  3AG1 E;  3HVE A;  2X6H A;  2VTB B;  3T5V A;  1ELR A;  3ASG A;  1LTX A;  3ZIM A;  4PS8 A;  1LD8 A;  2EIK E;  2J4B A;  5EKQ D;  3UM1 A;  1BI8 B;  3IHV A;  1MX4 A;  4HOT A;  1A17 A;  4CGW A;  1DNP A;  3TAX A;  1KT1 A;  3CHO A;  5JJ6 A;  4GTT A;  2R5S A;  2DVW A;  5EX0 A;  3DEP A;  5HRY A;  2CHZ A;  4WWO A;  3Q79 A;  5C1D A;  1N4P A;  4TUU A;  3L82 A;  4WUY A;  3I3N A;  3CVL A;  3PUK A;  4TRQ A;  2KCV A;  4YDO A;  3RRM B;  3ESK A;  1XNF A;  2XPI A;  2L9B A;  4GML A;  1KPS B;  3S7F A;  4GZC A;  4I9C A;  5BUZ A;  5JJT A;  2X6I A;  5BXU A;  1UG3 A;  4ANU A;  1QYM A;  2XZD G;  4R7L A;  4HOR A;  4DX2 A;  1TNB A;  1TYQ G;  3VLE A;  4AIF A;  3RKV A;  2ION A;  2QC9 A;  4UWG A;  2NC9 A;  1NP7 A;  5CHE E;  2XEV A;  1X5B A;  4IRU A;  3CST A;  3CQG B;  1K8K G;  3HXD A;  3DXK G;  5DIZ A;  4ANV A;  4I17 A;  2PM6 A;  3MZL B;  4RG6 A;  2AJA A;  3FFL A;  3TJP A;  5LP0 A;  2AXV A;  4BSZ B;  4JHR A;  1Z3X A;  3N71 A;  2P2C P;  4M7C A;  2ETA A;  3NB2 A;  4GPM A;  2AXU A;  5AAR A;  3TXM A;  2XZT G;  3U64 A;  3MKQ B;  1WDY A;  3GZ1 A;  3L54 A;  4L1B A;  2HO1 A;  5HQ8 A;  1N11 A;  3HYM B;  1LD7 A;  4L2L A;  1INZ A;  3PS6 A;  4HQD A;  4TXP A;  3LJN A;  2J49 A;  2MYO A;  4FJZ A;  3FWV A;  3ZU7 B;  1NZN A;  3MGB A;  3PEV B;  2J9Q A;  1SQM A;  5JMN D;  2H6G A;  2WXI A;  3B7T A;  4J8S A;  1MQS A;  4GTV A;  4JHK A;  1OXJ A;  2V0P A;  3Q9U C;  5E76 A;  3JUE A;  2L6J A;  3CEQ A;  2MRI A;  2KXP C;  4HRM B;  5FJY A;  4GMR A;  2WPV A;  5C2Y A;  2RFM A;  4UI9 C;  3V2X A;  3V31 A;  4HOQ A;  2EIM E;  3APF A;  3OXL A;  2VTB A;  3GZ2 A;  2L6B A;  2VGE A;  3MV3 B;  4N5Q A;  4U96 D;  3S7J A;  1KZP A;  1GW6 A;  2WXK A;  3ZYM A;  3MEK A;  4DLO A;  1OT8 A;  4GZ6 A;  4BEP A;  5ARG A;  3PUJ A;  4F1S A;  5B3S E;  3MV2 B;  1KLX A;  3TG5 A;  3R9M A;  4F3V A;  4GYY A;  2V4L A;  3UKR G;  1MJ0 A;  2GRM A;  3QOU A;  4C9B B;  1JPL A;  2MHK A;  3ULQ A;  4XEI G;  4HI9 A;  2VSO E;  5FQ6 A;  3S7D A;  2MOW A;  3ABK E;  5DBK A;  1IHG A;  3ZXS A;  3DWL G;  4YND A;  3ZHE A;  3R7R A;  4GTR A;  4QQI A;  3Q78 A;  3D9P A;  3DSS A;  1WM5 A;  4LSZ E;  4N3A A;  3C3Q A;  2IEJ A;  5G2N A;  4MS6 A;  3ML9 A;  2JAB A;  3S7B A;  2VSX E;  2IU1 A;  4CT0 A;  4U0U A;  3D9J A;  5BV0 A;  3KEZ A;  3EU5 A;  4BSX A;  4NAC A;  5D2M C;  3DSU A;  2VSY A;  4J6I A;  2FBN A;  3E37 A;  5CRU A;  4J8F A;  5AQ9 A;  5JJ7 A;  3FH5 A;  2XGM A;  3CKC A;  4HXI A;  4IYP A;  1N9A A;  1OWP A;  3SO8 A;  4LNB A;  2PL2 A;  3KSL A;  4KYO B;  5ENP D;  4DPR A;  2PZI A;  2GRR B;  4UWF A;  1FCH A;  1NL4 A;  4CCA A;  3EHN A;  4KZC A;  2OVF A;  3B95 A;  3DST A;  1ZU2 A;  2XPZ A;  1PY1 A;  2PM7 A;  4TXQ A;  4Q69 A;  3F6Q A;  2XCC A;  4BX8 A;  2NXP A;  4KT6 B;  3T5X A;  2UY1 B;  3HXF A;  5ENT D;  4PS7 A;  3ZGQ A;  2I1K A;  1S63 A;  4HRN A;  1OWM A;  4FHK A;  2R05 A;  5J08 A;  5AN8 A;  4GA0 A;  3L22 A;  2M63 A;  3JUI A;  2IOL A;  1HXI A;  4PH4 B;  4ABN A;  2DCP A;  5E75 A;  1E7U A;  3FUM A;  2CFZ A;  5BT1 A;  1TN8 A;  3L9T A;  1N94 A;  4NUR A;  4NRH B;  4D10 C;  4N2S A;  5BPP A;  4B94 A;  3PE3 A;  4WNG A;  2X6J A;  3QNK A;  5CMW A;  3HIZ A;  5T4Y A;  3RSE G;  1HH8 A;  2LAI A;  5LFA A;  2RKK A;  4CDR A;  3SGH A;  4AP2 A;  3FU5 A;  5ENR D;  3TWX A;  2RD0 A;  3CK8 A;  5EN5 D;  3KD7 A;  5B1A E;  1N95 A;  1IYG A;  3Q47 B;  2NYJ A;  5CED B;  3ASH A;  1H2U A;  4O1O A;  5KNG A;  1L5J A;  4ILH B;  3CVN A;  3FY4 A;  3BQO A;  4B0Z A;  5CCL A;  2AXZ A;  4U07 A;  4GYO A;  1O1R A;  3HG0 D;  4CDM A;  4EZJ A;  3PZ2 A;  3VTY A;  1O1S A;  3QAR A;  4JA7 A;  2WXJ A;  4YVO A;  1G3N B;  4U04 A;  4JW1 A;  2EQX A;  5BNW A;  2LO6 A;  5G04 C;  3RJV A;  1H2V C;  2VGX A;  2R02 A;  3G2V A;  3PZD A;  3D3M A;  2IQC A;  5A23 A;  1TJF A;  2XS8 A;  3AU4 A;  2WMO A;  4L23 A;  1SA4 A;  4EZL A;  3AS4 A;  4U0Z A;  3EDT B;  4YDE A;  2B6C A;  3IXE A;  3B7U X;  4A3T A;  4G23 A;  4XZ4 A;  2CHX A;  4I6G A;  3BG0 B;  5AYW D;  1E8Y A;  4GB9 A;  3VTX A;  2H6F A;  3ZYK A;  3JYS A;  1ELW A;  1QQE A;  4FU3 A;  4KVM A;  4G2V A;  1FT2 A;  4ANX A;  3CHM A;  4BT8 A;  4B89 A;  2LNI A;  3JXI A;  2XEN A;  3RRN B;  5KJM A;  3QDN A;  3C5R A;  1H0A A;  4EBA G;  5FQ7 A;  2IOS A;  4OAU C;  4A1G A;  2BF0 X;  2HR2 A;  4J8Y A;  3MKR A;  3TWV A;  1W3B A;  2F0Y A;  4JEH A;  2WQ7 A;  2PQR A;  4HLL A;  2QZA A;  2F8Y A;  5T8I A;  4DK5 A;  2EIL E;  4I2W A;  2CFU A;  1K1B A;  4GCO A;  3ABM E;  5FTP A;  3IHY A;  5AIJ A;  4Y6W A;  4JA9 A;  3Q15 A;  3MX3 A;  3UT8 A;  4NIK A;  3CIA A;  1YMP A;  1OCC E;  3NF1 A;  2DYS E;  1AP7 A;  4Z68 A;  4DRX E;  2ZU6 B;  4GAA A;  1E8X A;  2J08 A;  4YDY A;  4RVB A;  4CYM D;  1ZB1 A;  3TG4 A;  3D9O A;  3DPD A;  1SVX A;  2HE0 A;  1MYO A;  3PEU B;  1OUV A;  4N39 A;  4EHM A;  4I2Z A;  3ZEF A;  4XX5 A;  4A3V A;  5BXO A;  1Y6I A;  3DSV A;  2AVP A;  4I1M A;  3SBS A;  5LX8 A;  3NOC D;  3TWR A;  4ILI A;  4CGV A;  5AQ7 A;  2YNQ A;  5A7D B;  3QAQ A;  1YCS B;  2C2L A;  3B7B A;  3G2U A;  1Z3Y A;  1TEZ A;  3RK6 A;  2YIN A;  3FTU A;  3LS8 A;  5KWD A;  3I5P A;  2IO2 C;  4DX6 D;  5FQ4 A;  3L16 A;  4JZY A;  4FUL A;  2XEH A;  3ZRH A;  3P2B A;  4E85 A;  2Y4T A;  4UWH A;  3SBT B;  2J09 A;  3PNT B;  2OND A;  4ATG A;  4L9P A;  4CRW A;  1H2T C;  2I9C A;  4CT4 A;  4XI9 A;  3JQ1 A;  3L17 A;  3MA5 A;  1UN8 A;  4F6R D;  2ETC A;  4HOU A;  4Q96 A;  5EX3 A;  4NQ0 A;  3HHM A;  2VGX B;  2KZT B;  1SA5 A;  2BUG A;  3FDH A;  3KAE A;  2KBX A;  3X2Q E;  5HKP A;  2WVI A;  2F8X K;  3SQV A;  2VSN A;  5CRV A;  4I9E A;  4F7A A;  4V3I A;  4FP7 A;  3EJN A;  3DPY A;  4L2Y A;  4UI9 K;  3HXB A;  5FQ8 A;  3PRE A;  3UM3 A;  4EZK A;  5G05 J;  5JA4 D;  2I1J A;  3QC1 A;  3LYA A;  3AU5 A;  3LKU A;  2OEV A;  5ITZ F;  5JHA A;  4FHJ A;  3V2O A;  5HI7 A;  1HZ4 A;  3E34 A;  3RAU A;  4DJA A;  3AS8 A;  2RFA A;  4G25 A;  4BFR A;  2Y3A A;  3T9K A;  4Y6C A;  2WXM A;  1DCE A;  2GRN B;  2V5F A;  2Y0B G;  4C0E A;  3FEY A;  4KVO A;  2KAT A;  4ZFH A;  3AAA C;  4QFV A;  3FU0 A;  2J4D A;  1BLX B;  5FWQ A;  4K03 A;  3FEX A;  4N3C A;  1S70 B;  4LNU D;  4GTQ A;  3ZYQ A;  3FH8 A;  3EUV A;  2GRP B;  2DWZ A;  2XS1 A;  3BU8 A;  3E32 A;  3L08 A;  1EDU A;  5M72 A;  5FIN A;  1TNZ A;  3I4R B;  2XEE A;  5IY5 E;  1H6O A;  3KS2 A;  3EU9 A;  1U3D A;  1HU3 A;  4BWR A;  3L6A A;  4G1T A;  1HFA A;  2WMN A;  4J7W A;  4URK A;  4WND A;  3ZKJ A;  1NA3 A;  3WG7 E;  5EIB E;  2P9P G;  4GA2 A;  3ULY A;  4APF A;  1N54 A;  4PDX A;  3UM2 A;  2WXP A;  3CLJ A;  3C72 A;  2AWI A;  2WM9 A;  4U0S A;  4O60 A;  2Y69 E;  3RU0 A;  2IO3 C;  4U95 D;  2ILR A;  3VLD A;  5D66 A;  4F53 A;  4AEZ C;  5G04 J;  2XQ0 A;  4U8H A;  3APD A;  3Q7A A;  4BTA A;  3TWT A;  1XGW A;  3LPZ A;  5FZR A;  5CER B;  3T8M A;  3APC A;  3O48 A;  3CVU A;  4G24 A;  2P9I G;  2WXR A;  5AJD A;  2FF4 A;  4MBG A;  3DXM G;  4ME2 A;  3L13 A;  4JHJ A;  4FA6 A;  4HOS A;  4A63 B;  3UUX A;  4AV7 A;  4GPK A;  4CDN A;  4UWL A;  3ZVV A;  1JCQ A;  2WXL A;  1TN6 A;  3Q9N C;  2CG2 A;  1SZA A;  4JC8 A;  5ARF A;  3ZW3 A;  2CHW A;  3CHP A;  2JEK A;  2IJG X;  5HS0 A;  3CVP A;  3Q73 A;  4C0M A;  3ULE G;  3CHR A;  3SD5 A;  5CEC B;  2P9N G;  3TGO A;  4BX9 A;  5D0O D;  4LCT A;  4OVU A;  4AY5 A;  5AAO A;  1OCR E;  3IKO B;  4J8D A;  3FUN A;  1RW2 A;  1FPP A;  3PH0 C;  4W9R A;  4EPZ A;  1AWC B;  4B8C B;  3CVQ A;  2NSZ A;  4UQZ A;  1OY3 D;  3MJW A;  2XGS A;  1D8E A;  4LRZ A;  1JUQ A;  2ZXW E;  4GTM A;  3T8K A;  3ZN3 A;  2P9S G;  2V8S E;  3CV0 A;  4H7X A;  3LCA A;  3NZU A;  1UJJ A;  3MKQ A;  3QK0 A;  3G2T A;  3QWP A;  4FLH A;  2LXM A;  1E8Z A;  4U7E B;  5EYL A;  3VLF A;  3UPV A;  5LOZ A;  3SF4 A;  3UKU G;  1UJK A;  3IBE A;  3UIN C;  2BKG A;  5A6C A;  2E0I A;  3HVE B;  1OCZ E;  4JD2 G;  1JCR A;  3FUE A;  5ENO D;  3MYV A;  1NFI E;  1HS6 A;  3KEA A;  2GGF A;  1A5E A;  2IF4 A;  2C0M A;  4G26 A;  3ENE A;  2A5E A;  3R9A B;  3FTZ A;  4RG9 A;  3PZ4 A;  4YVQ C;  5ENQ D;  4EBA A;  1TR4 A;  2P9L G;  3PVL A;  4K5A B;  1K3Z D;  5FZQ A;  5CCM A;  2EIN E;  3PNL B;  4OYS A;  3EHQ A;  2AW6 A;  4IN3 B;  5BW8 C;  1E7V A;  3TWQ A;  1HF8 A;  4B8A A;  2BTD A;  3FTS A;  2UY1 A;  3Q75 A;  5AJL A;  3ZPJ A;  3TXN A;  4UQX A;  4RSY A;  1SZ9 A;  2DYR E;  4K0R A;  2F37 A;  5KJK A;  4L7T A;  1OWL A;  1O1T A;  4I43 A;  4J0U A;  1E8W A;  3GZS A;  3ZHE B;  1TNU A;  1UOH A;  4JEU A;  2BKK B;  3SFZ A;  2EIJ E;  2QFC A;  1QNF A;  4AVX A;  3CK9 A;  3UI2 A;  2WXG A;  4K5B A;  3FUF A;  4HVB A;  3JQ0 A;  4RQI A;  4LEU A;  5KBA A;  2VJ8 A;  3AG4 E;  1ELK A;  4GTS A;  5ENS D;  2VQ2 A;  4FLB A;  3CR3 A;  4I6J A;  4HNA D;  4FJY A;  4WWN A;  4CEM A;  2J07 A;  5KJL A;  1Y8M A;  5FIO A;  5KCM A;  1YYH A;  3NBN B;  3LXU X;  4WWP A;  2DZN A;  3CQC B;  1OWN A;  5AQA A;  3WXX A;  1V54 E;  3SI5 A;  2I6H A;  4FAD A;  3D9H A;  5ANR A;  3SZ7 A;  1EF1 C;  2P58 C;  1NI1 A;  4XI0 A;  4JPS A;  3LVR E;  5CMY A;  5B1B E;  3SHF A;  4K5C A;  4N3B A;  3HXC A;  4ATZ D;  2FI7 A;  4GYW A;  2FUL A;  4TUM A;  3FUI A;  2WXH A;  2WB2 A;  2ZGD A;  3C3R A;  3EIQ C;  3JCK C;  3ZUV B;  2KCK A;  3IEG A;  3UIP C;  3B7R L;  3LJ3 A;  3D9L A;  3AJI A;  3B13 A;  1Z6T A;  3TL5 A;  3FHE A;  3ZNG A;  3UMV A;  1IQU A;  3AG3 E;  4JVS A;  2IFU A;  3LDZ A;  5LCW C;  3O4Z A;  4ACL A;  3B7S A;  4BER A;  3KSQ A;  3UM0 A;  4HLE A;  2J8S D;  3W9F A;  3Q5M A;  2ETB A;  2X6K A;  4I1A A;  3LEW A;  5FT9 A;  2PNN A;  2X38 A;  4PUC A;  3DBS A;  4DUI A;  4H7Y A;  1V55 E;  4BY6 A;  3NOG D;  4UWK A;  1SW6 A;  1WG0 A;  2RG8 A;  1JWF A;  2WQH A;  4I6E A;  2XRY A;  4UUC A;  3URZ A;  3D9I A;  2P9K G;  3ASF A;  2KC7 A;  1U2V G;  3UIO C;  2XCB A;  3ASD A;  3UTM A;  3CKB A;  1TNY A;  3RRU A;  1D9S A;  4OVV A;  1N0Q A;  3RO2 A;  3CHS A;  3HXE A;  1H6K A;  3EHM A;  4AXH A;  2XGO A;  2FO1 E;  3BEE A;  1O5M A;  2GW1 A;  2OV8 A;  2YQ8 A;  4J8E A;  3AG2 E;  4MRU A;  4GZ3 A;  2L0T B;  1FT1 A;  2QY7 A;  3FTX A;  4CZ2 D;  2WXN A;  3RO3 A;  1ZBP A;  3E33 A;  3U66 A;  1OWO A;  1EYH A;  3LY7 A;  2GRL A;  2FO7 A;  1PAQ A;  3LVQ E;  5JHB A;  3ISM C;  4XE0 A;  4B93 B;  4HRL A;  4MLP A;  4MKT A;  3LY8 A;  4DI4 A;  1FVF A;  2H6I A;  4U63 A;  2ZIR A;  3PE4 A;  2WQ6 A;  1FVH A;  1D8D A;  5EDS A;  1KT0 A;  4XIF A;  2PQN A;  2DBA A;  3P1U A;  1U3C A;  1S0P A;  1H19 A;  3BG1 B;  4N2Q A;  4WNF A;  2IY0 C;  3W9G A;  4KMO A;  2Y1L E;  3NAW A;  1E96 B;  3JXJ A;  1B89 A;  4TV3 A;  3SFX A;  2R2L A;  2QYU A;  2Y4U A;  4KXK B;  5ENN A;  4I1O B;  3D9M A;  5H7P A;  4XKC A;  5AQB A;  4LG6 A;  1QBQ A;  3ONK A;  3S2A A;  3OXF A;  3C3O A;  4GTO A;  3PDN A;  4LER A;  2HM8 A;  4HS2 A;  4E6H A;  2JLB A;  4HI8 A;  4F1P A;  2DZO A;  2C0L A;  2V5Q C; 
#chains in the Genus database with same CATH homology
 4KVM A;  2AXV A;  5LP0 A;  3MJW A;  4JHR A;  1Z3X A;  2XGS A;  4G2V A;  5LCW J;  3N71 A;  4LRZ A;  3OAW A;  4ANX A;  3CHM A;  1JUQ A;  2AXU A;  4BT8 A;  3C98 A;  3TXM A;  4B89 A;  2LNI A;  3U64 A;  3MKQ B;  3ZN3 A;  2V8S E;  3CV0 A;  3GZ1 A;  3L54 A;  4H7X A;  4L1B A;  3LCA A;  3NZU A;  1UJJ A;  3RRN B;  3MKQ A;  3QDN A;  3QK0 A;  5KJM A;  3G2T A;  2HO1 A;  1HE8 A;  4P29 A;  3AS5 A;  1H0A A;  3QWP A;  5D0Q D;  4FLH A;  3CVV A;  5HQ8 A;  2I2O A;  4EBA G;  1DVP A;  3HYM B;  5FQ7 A;  2X6F A;  1E8Z A;  2IOS A;  3PS6 A;  4L2L A;  1INZ A;  3FUD A;  4LUN U;  3VLF A;  3GW4 A;  2VGY A;  2OVB A;  3UPV A;  2J49 A;  5LOZ A;  4A1G A;  2BF0 X;  2HR2 A;  4FJZ A;  3FWV A;  3SF4 A;  3MKR A;  1W3B A;  4JEH A;  1UJK A;  2WQ7 A;  2PQR A;  1NZN A;  3MGB A;  3PEV B;  3IBE A;  3GYZ A;  3QWV A;  3FUL A;  5T8I A;  4DK5 A;  1EPU A;  4I2W A;  2J9Q A;  2CFU A;  1SQM A;  4GCO A;  2E0I A;  5A6C A;  3FP3 A;  3HVE B;  2A5U A;  5FTP A;  3IHY A;  5AIJ A;  2WXI A;  4Y6W A;  4JA9 A;  3B7T A;  4FC8 A;  4J8S A;  3Q15 A;  3MX3 A;  3FUE A;  4N5C A;  1MQS A;  1WAO 1;  3UT8 A;  3QB2 A;  1UW4 B;  3CIA A;  3MYV A;  4JHK A;  3RIB A;  2V0P A;  3CVY A;  4XKB A;  1HS6 A;  2GGF A;  5E76 A;  4M3O A;  4GA1 A;  4WNE A;  1VDY A;  2L6J A;  3CEQ A;  2MRI A;  2IF4 A;  3NF1 A;  2OOE A;  1NA0 A;  2C0M A;  2ZU6 B;  4G26 A;  2UWJ G;  2R17 C;  3QWW A;  1E8X A;  2J08 A;  4GAA A;  3ENE A;  5FJY A;  1HG2 A;  3R9A B;  4RVB A;  3FTZ A;  3TG4 A;  2L0I A;  3D9O A;  3QKY A;  2WPV A;  3DPD A;  4RG9 A;  3PEU B;  5C2Y A;  5ANL A;  3R7Q A;  1OUV A;  4YVQ C;  4N39 A;  4GZD A;  4UI9 C;  4I2Z A;  4HOQ A;  4EBA A;  2CG3 A;  3APF A;  3ZEF A;  3OXL A;  4XX5 A;  4A3V A;  3PVL A;  2VTB A;  2XHE A;  1Y6I A;  4GCN A;  2AVP A;  4I1M A;  3SBS A;  5LX8 A;  3GZ2 A;  5FZQ A;  4DI3 A;  3UT4 A;  5CCM A;  4ILI A;  4CGV A;  2YNQ A;  3OXG A;  5A7D B;  3QAQ A;  3MV3 B;  2X3M A;  1YA0 A;  3PNL B;  4OYS A;  2C2L A;  3UT7 A;  2AW6 A;  3G2U A;  1Z3Y A;  4IN3 B;  3S7J A;  4APO A;  4GZ5 A;  4AM9 A;  1TEZ A;  5BW8 C;  1E7V A;  2YIN A;  3FTU A;  3RK6 A;  3LS8 A;  1GW6 A;  2R59 A;  2WXK A;  3ZYM A;  3I5P A;  1HF8 A;  3MEK A;  4DLO A;  4B8A A;  2BTD A;  3FTS A;  5FQ4 A;  2E2E A;  2UY1 A;  3L16 A;  4GZ6 A;  4JZY A;  3D9N A;  2LSU A;  3U4T A;  5ARG A;  3PUJ A;  3FTY A;  5AJL A;  4FUL A;  1N52 A;  4F1S A;  3ZPJ A;  3OTN A;  3TXN A;  3ZRH A;  3P2B A;  4E85 A;  2Y4T A;  3MV2 B;  4Q94 A;  4UWH A;  1KLX A;  3SBT B;  3TG5 A;  4UQX A;  4RSY A;  2J09 A;  1SZ9 A;  4F3V A;  4GYY A;  4WAF A;  2V4L A;  4K0R A;  3PNT B;  3QJZ A;  2GRM A;  3QOU A;  4L7T A;  4C9B B;  3I4G A;  5KJK A;  1JPL A;  2OND A;  4ATG A;  2MHK A;  3ULQ A;  2Q7F A;  5FQ6 A;  2VSO E;  4UQY A;  3S7D A;  2A4Z A;  2MOW A;  1OWL A;  5J90 A;  4ACK A;  4CRW A;  3FU3 A;  4I43 A;  1H2T C;  2I9C A;  4J0U A;  1E8W A;  4CT4 A;  3GZS A;  4XI9 A;  3ZHE B;  5DBK A;  1IHG A;  3U9W A;  3ZXS A;  3JQ1 A;  3L17 A;  3MA5 A;  4YND A;  3ZHE A;  3R7R A;  4JEU A;  3CHQ A;  4A55 A;  1UN8 A;  3G2W A;  3SFZ A;  4HOU A;  3D9P A;  4EQF A;  2QFC A;  1QNF A;  4AVX A;  3FTW A;  1WM5 A;  4Q96 A;  5EX3 A;  2YHE A;  2KZT A;  4NQ0 A;  3CK9 A;  3HHM A;  2VGX B;  2WXG A;  2XPY A;  4N3A A;  3FUF A;  4JL0 A;  4HVB A;  2KZT B;  2BUG A;  3IV0 A;  3JQ0 A;  5BV1 A;  3FDH A;  4LEU A;  3KAE A;  5G2N A;  2VJ8 A;  4MS6 A;  2HYZ A;  1ELK A;  3D9K A;  4ILG A;  3ESL A;  3ML9 A;  4UI9 J;  2VQ2 A;  3S7B A;  4FLB A;  3CR3 A;  1HX8 A;  3FUJ A;  3MCX A;  4I6J A;  3U3W A;  2WVI A;  2XRZ A;  4FJY A;  2VSX E;  4WWN A;  2IU1 A;  4CEM A;  2J07 A;  4CT0 A;  4U0U A;  5KJL A;  3FH7 A;  1TJC A;  1Y8M A;  3E4B A;  4KBQ A;  5KCM A;  3D9J A;  4O6F A;  3LXU X;  3CSF A;  4WWP A;  4ANW A;  5BV0 A;  3KEZ A;  4BTB A;  3CQC B;  1OWN A;  2VSN A;  3WXX A;  5AEN A;  4BSX A;  3SI5 A;  1BPO A;  4NAC A;  4EEC A;  2I6H A;  1IQR A;  4I9E A;  2WXF A;  4FAD A;  5ANR A;  5FZS A;  3SZ7 A;  2LSV A;  1EF1 C;  2VSY A;  4J6I A;  4F7A A;  2P58 C;  4V3I A;  2FBN A;  4FP7 A;  3CGH A;  3EJN A;  4DLQ A;  3Q49 B;  4BT9 A;  4XI0 A;  4JPS A;  4L2Y A;  4UI9 K;  2VYI A;  3ZFW A;  5FQ8 A;  3LVR E;  3PRE A;  4J8F A;  4EZK A;  5CMY A;  5G05 J;  3SHF A;  2I1J A;  5JJ7 A;  3FH5 A;  3QC1 A;  4N3B A;  2XGM A;  4PS3 A;  5G55 A;  3LYA A;  3CKC A;  3AU5 A;  3LKU A;  4HXI A;  4IYP A;  2FI7 A;  1LF8 A;  1OWP A;  4GYW A;  5G05 C;  2FUL A;  2PL2 A;  2KCL A;  3NZS A;  4KYO B;  5JHA A;  3FU6 A;  2DIW A;  3FUI A;  2WXH A;  4FHJ A;  4AJW A;  2WB2 A;  1P5Q A;  3UQ3 A;  4DPR A;  3EIQ C;  3PRZ A;  3JCK C;  1UN9 A;  5HI7 A;  2PZI A;  5KJN A;  1HZ4 A;  2KCK A;  1QZ2 A;  3IEG A;  3ONL A;  4DJA A;  4GMJ A;  3AS8 A;  3B7R L;  3LJ3 A;  3D9L A;  5BPP A;  4IUL A;  4G25 A;  3B13 A;  4UWF A;  3Q4A B;  1FCH A;  4CCA A;  3G2S A;  4BFR A;  2Y3A A;  4Y6C A;  3EHN A;  1Z6T A;  3TL5 A;  4KZC A;  2OVF A;  2WXM A;  3FHE A;  4AOF A;  5T3R A;  1ZU2 A;  3UMV A;  2V5F A;  1IQU A;  4C0E A;  4JVS A;  2IFU A;  3LDZ A;  3FEY A;  2XPZ A;  2KAT A;  2KM4 A;  4KVO A;  5LCW C;  3O4Z A;  1PY1 A;  4JXT A;  4ACL A;  2PM7 A;  4AY6 A;  3B7S A;  3UX4 A;  4Q69 A;  3FUH A;  4QFV A;  1HO8 A;  3FU0 A;  2XCC A;  2J4D A;  4HLE A;  4BX8 A;  1JWG A;  3LY9 A;  5FWQ A;  2NXP A;  4K03 A;  4KT6 B;  4G11 A;  2WXQ A;  4GU5 A;  3FEX A;  3FUK A;  3Q5M A;  4N3C A;  2X6K A;  4I1A A;  3LEW A;  5FT9 A;  3CVX A;  2WXO A;  3ZYQ A;  3FH8 A;  2X38 A;  3SNX A;  3T5X A;  1MHQ A;  4PUC A;  2UY1 B;  4KZ0 A;  1E90 A;  4PS7 A;  3ZYL A;  3DBS A;  4H7Y A;  3ZGQ A;  2I1K A;  3L08 A;  1OWM A;  4FHK A;  4BY6 A;  5J08 A;  3FTV A;  1EDU A;  5M72 A;  4GA0 A;  2YHC A;  3K9I A;  4UWK A;  3CK7 A;  3L22 A;  4HFG A;  3I4R B;  2RG8 A;  3CVW A;  2M63 A;  3JUI A;  1JWF A;  4A1S A;  1HG5 A;  3ML8 A;  2IOL A;  2WQH A;  1HXI A;  3KS2 A;  4I6E A;  4PH4 B;  2XRY A;  1U3D A;  1HU3 A;  4ABN A;  4BWR A;  3URZ A;  3NQP A;  1PC2 A;  2DCP A;  3D9I A;  1E7U A;  3L6A A;  4G1T A;  5E75 A;  1HFA A;  2WMN A;  1WY6 A;  3ASF A;  3FUM A;  2CFZ A;  5BT1 A;  4URK A;  2FEZ A;  4WND A;  2KC7 A;  3EIJ A;  1NA3 A;  4NUR A;  4NRH B;  4D10 C;  2XCB A;  4GA2 A;  4APF A;  3ASD A;  4N2S A;  3HDX A;  4B94 A;  1N54 A;  2LAH A;  3PE3 A;  2X6J A;  4WNG A;  3CKB A;  3QNK A;  3RRU A;  3HVE A;  5CMW A;  3HIZ A;  2X6H A;  5T4Y A;  2VTB B;  4OVV A;  1HH8 A;  2LAI A;  3T5V A;  1ELR A;  3ASG A;  3RO2 A;  3CHS A;  5LFA A;  3ZIM A;  4PDX A;  4PS8 A;  2WXP A;  1H6K A;  2J4B A;  3CLJ A;  3EHM A;  4AXH A;  5EKQ D;  2XGO A;  3BEE A;  2AWI A;  2WM9 A;  4CDR A;  3SGH A;  4AP2 A;  4U0S A;  2GW1 A;  2OV8 A;  3FU5 A;  2RD0 A;  2YQ8 A;  4J8E A;  4MRU A;  3CK8 A;  3KD7 A;  3IHV A;  3RU0 A;  4HOT A;  4GZ3 A;  1A17 A;  1IYG A;  2L0T B;  2ILR A;  3Q47 B;  3VLD A;  2QY7 A;  3ASH A;  3FTX A;  4F53 A;  4AEZ C;  1H2U A;  1DNP A;  1KT1 A;  5G04 J;  2WXN A;  1L5J A;  4ILH B;  3RO3 A;  3CHO A;  5JJ6 A;  3TAX A;  2XQ0 A;  3CVN A;  4U8H A;  2R5S A;  3APD A;  1ZBP A;  3FY4 A;  3U66 A;  1OWO A;  5EX0 A;  1EYH A;  4B0Z A;  5CCL A;  2CHZ A;  4BTA A;  2AXZ A;  4U07 A;  3LY7 A;  2GRL A;  4WWO A;  2FO7 A;  4GYO A;  1PAQ A;  5C1D A;  3LVQ E;  5JHB A;  4TUU A;  4XE0 A;  1XGW A;  3LPZ A;  5FZR A;  4MLP A;  4MKT A;  4CDM A;  3LY8 A;  4EZJ A;  4DI4 A;  4WUY A;  3I3N A;  3T8M A;  3APC A;  3CVL A;  1FVF A;  3O48 A;  3CVU A;  4G24 A;  5AJD A;  2WXR A;  4U63 A;  3PE4 A;  3PUK A;  4TRQ A;  2KCV A;  3VTY A;  3QAR A;  2WQ6 A;  1FVH A;  4JA7 A;  2FF4 A;  2WXJ A;  4ME2 A;  3L13 A;  4JHJ A;  4FA6 A;  4HOS A;  5EDS A;  3RRM B;  3ESK A;  4YVO A;  1KT0 A;  4XIF A;  3UUX A;  2PQN A;  4AV7 A;  4GPK A;  4CDN A;  2DBA A;  1XNF A;  2XPI A;  3P1U A;  1U3C A;  2L9B A;  4UWL A;  4U04 A;  3ZVV A;  4JW1 A;  1S0P A;  1H19 A;  2WXL A;  3BG1 B;  2EQX A;  4GML A;  4N2Q A;  3S7F A;  5BNW A;  2LO6 A;  4GZC A;  4I9C A;  4WNF A;  2CG2 A;  1SZA A;  5G04 C;  5BUZ A;  4JC8 A;  5ARF A;  5JJT A;  3ZW3 A;  2CHW A;  2X6I A;  3CHP A;  4KMO A;  3RJV A;  1H2V C;  2VGX A;  1E96 B;  1UG3 A;  3G2V A;  4ANU A;  3PZD A;  4R7L A;  2JEK A;  2IJG X;  4HOR A;  3D3M A;  2IQC A;  3CVP A;  3VLE A;  5A23 A;  1B89 A;  4AIF A;  4C0M A;  1TJF A;  4TV3 A;  3RKV A;  2ION A;  3AU4 A;  3CHR A;  2WMO A;  3SD5 A;  4UWG A;  4L23 A;  1NP7 A;  2NC9 A;  4EZL A;  3AS4 A;  4U0Z A;  3TGO A;  3EDT B;  5CHE E;  4BX9 A;  2XEV A;  2Y4U A;  5D0O D;  1X5B A;  4KXK B;  4IRU A;  5ENN A;  3B7U X;  3D9M A;  3CST A;  4I1O B;  4LCT A;  4OVU A;  3CQG B;  4AY5 A;  4A3T A;  4CGW A;  4XKC A;  3ONK A;  3IKO B;  4J8D A;  3S2A A;  4G23 A;  4XZ4 A;  3OXF A;  3FUN A;  2CHX A;  4I6G A;  5DIZ A;  4ANV A;  4I17 A;  3BG0 B;  3PDN A;  4LER A;  4W9R A;  3PH0 C;  2HM8 A;  4HS2 A;  4E6H A;  2PM6 A;  3MZL B;  4EPZ A;  5AYW D;  2JLB A;  4RG6 A;  1E8Y A;  4GB9 A;  4B8C B;  3FFL A;  3CVQ A;  3VTX A;  2NSZ A;  3ZYK A;  4UQZ A;  2C0L A;  3JYS A;  1ELW A;  1QQE A;  4FU3 A;  3TJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...