3PNLB

Crystal structure of e.coli dha kinase dhak-dhal complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
211
structure length
211
Chain Sequence
GSSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insight into covalent substrate binding by Escherichia coli dihydroxyacetone kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-bind
total genus 84
structure length 211
sequence length 211
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pnlB00
1UN8A 1UN9A 2BTDA 3PNLB 3CR3A 4LRZA
chains in the Genus database with same CATH superfamily
4U95D 3ZYLA 1TNOA 2AXZA 5DBKA 3DEOA 3C3OA 3MV3B 2I6HA 2V5FA 2WM9A 3LY8A 3Q4AB 4WNEA 2J49A 3RRNB 4GB9A 5CBOA 3BG0B 3R7QA 3JUEA 1WY6A 1K1AA 3S7BA 3CVWA 4OYSA 1DNPA 5LFAA 1N95A 2UWJG 1Q2ZA 3AS8A 4J8FA 3BU8A 1S0PA 5LP0A 3CHPA 4ANUA 5M72A 4LRZA 1N4PA 1HX8A 2WXKA 4OVVA 2X6HA 2EQXA 4GTOA 4A63B 4O6FA 4JB8P 4B0ZA 3ASNE 5HRYA 5FT9A 3FTYA 4F1SA 4IULA 3ZNGA 5EN5D 2VGXB 4C0EA 1S70B 2WMOA 2MRIA 3RU0A 1NL4A 4BY6A 3LVQE 1ELWA 1O1RA 4IRUA 3G2TA 5EDSA 3DSSA 4HI9A 2V4LA 2EILE 1UJKA 2PM6A 3QK0A 1HO8A 2ZU6B 1FCHA 3EHQA 5KJMA 1H0AA 1W3BA 3CVNA 2XS8A 3N71A 1K1BA 3CVYA 4J7WA 3MZLB 4CT0A 3V31A 5AARA 3EU5A 4NRHB 3S7DA 3VTXA 3UM3A 1KT1A 3L16A 5LCWJ 1H2UA 2R59A 4RVBA 2DYRE 1Z6TA 2ETCA 2WXGA 4JXTA 4I17A 2UY1A 2FO1E 1TN8A 4BTAA 4LNBA 2IO3C 3QAQA 1KT0A 2VSXE 2FO7A 4JA7A 4FA6A 4MLPA 2X6KA 4A55A 4G11A 1MX2A 4JEUA 4J8DA 2P9KG 4HFGA 2EIKE 3D9IA 4FP7A 3S7JA 2WXQA 4GPKA 5KCMA 4GU5A 4LEUA 3BUAA 1FPPA 4KVMA 3LDZA 5J08A 3O48A 3LY9A 4LSZE 4AOFA 3UKRG 4EZKA 1TN7A 3RO3A 3X2QE 3SO8A 3L08A 5JHAA 2DBAA 5HI7A 2LUHA 3B7RL 4GYWA 2WXFA 2KZTB 3MCXA 4DI3A 3SFYA 3FEYA 3JQ0A 3HRAA 4YDOA 2A5EA 2EINE 4I9CA 4H7YA 5KBAA 4LUNU 3SFZA 3QDNA 1DC2A 1E8WA 4FJZA 2J9QA 4G8LA 1IQUA 4GMRA 3C5RA 3FUKA 4BX9A 3ZGQA 3PUJA 5CERB 4N3CA 4PH4B 3TAXA 3TWUA 4JVSA 4EQFA 4EZLA 3CLJA 1YCSB 3VTYA 3QB2A 3PDNA 2FF4A 1MQSA 4NIKA 3T8KA 4DLQA 5G2NA 4I1AA 3ZHEA 3AG4E 2UY1B 4NQ0A 4H7XA 5CRUA 2B6CA 2VSNA 3Q5MA 3U64A 3TJPA 1TR4A 3KSQA 1ZB1A 3OAWA 3VLDA 5IY5E 3FH5A 2C0LA 1X5BA 3D9HA 2DZNA 2XEHA 5CBNA 3V79K 5AJLA 2IJGX 4GAAA 1ELKA 4FHKA 4K03A 4BERA 1OWOA 1OXJA 5EYPF 1E90A 3CVUA 4EHMA 3HVEA 3ISMC 1EYHA 4GTSA 1TJFA 2P9SG 3CK7A 2ETBA 3BEEA 1HG2A 2BUGA 2L0IA 1KZOA 3AJIA 3W9GA 3L82A 2J09A 5CEAA 4U0ZA 5B1BE 1QBQA 1HZ4A 2I9CA 4Y6CA 4GTPA 3ESKA 3G2WA 4XEIG 3EJNA 4LNUD 1SVXA 4TV3A 4DX1A 3MEKA 3UXGA 2Q7FA 4O1PA 3GW4A 3D3MA 1AWCB 3ML8A 1LF8A 4GTMA 4E6HA 4ANVA 3NF1A 2GRQB 5ENSD 1HF8A 3ZXSA 1DCEA 3AAAC 3HXCA 3HVEB 3GZSA 2CFZA 4UI9K 3FP3A 3RO2A 5JJ7A 4L2LA 4KT6B 2WXMA 2CFUA 3ONLA 1HE8A 1UW4B 5CMWA 2H6GA 4HS2A 2R05A 2GRRB 4EPZA 1OUVA 3ONKA 2ZISA 4N3BA 2ETAA 1RZ4A 3V2OA 3PNLB 5CCLA 1HH8A 2XPIA 4I43A 2R17C 2A4ZA 2MHKA 1A5EA 4UUCA 3U66A 5E76A 3TWWA 5AYWD 4EECA 2CHWA 5AQBA 4Z68A 5D2MC 3KSLA 3O4ZA 1NFIE 3ZUVB 3GZ2A 4F7AA 4YVOA 5CECB 1H6PA 1P5QA 1N4RA 3ULYA 3FY4A 2CG2A 1ELRA 3EU9A 4U7EB 4KVOA 3UKUG 1EPUA 5AIJA 3ML9A 4HRMB 3LKUA 3Q49B 3JYSA 3ABME 3SFXA 3QKYA 3F6QA 3FU6A 2BKGA 3Q78A 3DXKG 4C48B 2AXVA 2PQRA 4ACKA 3D9OA 3V30A 4B8AA 3DRAA 4HB5A 3NBNB 3OTNA 1XGWA 3CSTA 3T5VA 1HS6A 3L54A 5BXUA 2WXPA 4G25A 3CGHA 3FFLA 3L22A 5G04J 1WAO1 3KS2A 4U07A 2YINA 2LAHA 3UMVA 4IN3B 3FTWA 5FQ8A 4HXIA 4ANWA 5T4YA 4APFA 5HS0A 1TEZA 5AQ9A 3S2AA 4MKTA 3RRUA 2J08A 2BTDA 1E7VA 2Y0BG 5BPPA 1TYQG 4GZ3A 4JC8A 4N2SA 3VLFA 1H6OA 2L9BA 1ZBPA 5BW8C 1N52A 1IHGA 1DCQA 3MX3A 1SW6A 3EDTB 3MA5A 2GRPB 4I6GA 3ZVVA 4GA2A 2VTBA 3ZKJA 3RJVA 3URZA 4YDYA 3QWVA 4LCTA 2I2OA 2VGYA 3TL5A 4UWFA 1BI7B 4JHJA 3U3WA 3MKQA 4BT8A 2J8SD 5BXOA 1MHQA 3CEQA 2CHZA 1FVHA 2JEKA 4ILHB 2RFAA 2J4BA 4Q69A 1JCQA 2OCCE 3Q79A 4F3VA 4AVXA 4JHKA 3PNTB 1PY1A 5CMYA 4DRXE 3TWVA 4PDXA 3E30A 2DZOA 5EIDA 1V55E 4AY6A 5FJYA 5CHEE 2XCCA 4HVBA 3NQPA 1YYHA 4L23A 3HXDA 2XHEA 3FH8A 4D10C 3APCA 4ILIA 4AP2A 2I1JA 2LSUA 3K9IA 4HLEA 1B89A 3Q9NC 5EX0A 1H2VC 1HXIA 3ASFA 1E8YA 3AG2E 3R7RA 3PREA 4WNDA 2ZXWE 3FHEA 3DSWA 2MYOA 4ZHBA 1TNUA 5FZRA 3Q75A 1U3DA 3QC1A 3QJZA 4HOTA 4O1OA 4CT4A 4UWGA 3G2VA 4IYPA 2L6BA 4FLHA 5J90A 3HXBA 1SA5A 4JA9A 3W9FA 4UWKA 4GA0A 5ANLA 3DXMG 3TG5A 3B7BA 1UN9A 3PUKA 3ASOE 4JW1A 2IF4A 2LNIA 4HOUA 2R03A 5T8IA 1TJCA 1QQEA 4GZCA 3FU0A 4URKA 1NP7A 1KLXA 1V54E 2PQNA 4BESA 4E85A 3ASHA 3FUMA 5FQ4A 4KYOB 4L1BA 3BQOA 2Y4UA 4FLBA 2Y69E 4LNGA 2HE0A 1N0QA 1JPLA 4FULA 4Q94A 5FQ6A 5EIBE 3IBEA 3FTSA 3I3NA 3FUNA 3L9TA 1YA0A 2E0IA 5D66A 3U9WA 2F8YA 2C2LA 5AN8A 3UI2A 4C9BB 3TG4A 4AV7A 4WNGA 3PZ1A 1DVPA 1OWLA 4I9EA 4I1MA 5H7PA 3CVXA 4DX6D 2P9LG 2WXLA 3PZ2A 4WWPA 2IEJA 2WMNA 2GROB 4GA1A 1IHBA 1NA0A 3FUIA 2WQ6A 1Z5SC 4DX5D 5LCWC 1H19A 2V4HC 4WNFA 2AW6A 5KNGA 5KNHD 3FEXA 3P1UA 3MJWA 1IKND 2LO6A 2HO1A 4FC8A 4DJAA 1K8KG 5BV0A 3ASDA 2VYIA 4GZ6A 4BSXA 1K3ZD 2X6FA 1Z3YA 3CVLA 2WQHA 3WXXA 1UOHA 3DSUA 3CSFA 3HXFA 2P2CP 2L6JA 3QWPA 1WG0A 3DSVA 4J6IA 4ANXA 4JPSA 2RD0A 5EILA 4NURA 3ZXPA 3CVPA 3PRZA 4KXKB 3JQ1A 3CHMA 5JA4D 4GTRA 3NOGD 4A3VA 4FADA 5E75A 3B95A 3SI5A 2VSOE 1X81A 4G8KA 2XCBA 3ZYMA 3Q73A 4UWHA 4F1PA 2MOWA 3D9KA 3L6AA 4Q96A 3FUDA 2PL2A 2VGEA 2VJ8A 1OY3D 4XX5A 4WUYA 5FQ7A 3FH7A 1PC2A 1N4QA 3FTXA 5C2YA 4BTBA 4MRUA 3E33A 2P9UG 4G23A 1HG5A 2PM7A 2OV8A 3SBTB 1H6KA 2DVWA 2WXIA 4LERA 2XRZA 4DX7D 3SF4A 5EKQD 3FUEA 5KJLA 3TWQA 3CHRA 5FIOA 4Y6WA 5FWQA 4GCNA 5D0OD 2ONDA 2WXNA 3G2SA 4U8VD 1S64A 4P29A 2P9IG 1IQRA 3L13A 3NZSA 5AENA 4RG6A 3FU3A 4I6JA 2P9PG 3DBSA 5A23A 5LOZA 1D9SA 3AG3E 2C0MA 3D9NA 3P2BA 1HFAA 4GTTA 2GRMA 3PE4A 3ZPJA 3SNXA 3LEWA 4K5BA 1N54A 2XGSA 2LXLA 3IXEA 5AJDA 1VDYA 1TNYA 1SQMA 4CZ2D 3AU5A 3D9PA 3V2XA 1EDUA 2EIME 3HHMA 3QARA 3EUVA 2BKKB 2XS1A 1TNBA 3NAWA 3PE3A 1IYGA 2KM4A 3AS4A 2LAIA 4TUUA 3TXNA 2R2LA 4JEHA 1O5MA 5G05C 3QOUA 4XKBA 3LCAA 4TXQA 2AWIA 5KWDA 3LVRE 3LJ3A 3J5PA 3NB2A 4WWNA 2NYJA 1BLXB 3UTMA 2QC9A 4AEZC 1EF1C 2IO2C 3UPVA 3LJNA 4U96D 4XI9A 4K5CA 1Y8MA 4JL0A 3Q47B 3MKRA 2I1KA 2JLBA 4ZFHA 2DIWA 2IY0C 3S7FA 2EIJE 3UT8A 4J8YA 4PS3A 2WQ7A 2NC9A 2M63A 3DPDA 3SGHA 1NI1A 4BEPA 4QQIA 1KPSB 1QYMA 4GYOA 4TUMA 4C0MA 4HBDA 3FTVA 3JXJA 3UIPC 2ZGDA 3IEGA 5ENOD 4ATGA 4YNDA 4EBAA 2R02A 4F53A 2J4DA 2RKKA 4FJYA 2J07A 1TNZA 1H2TC 2OVFA 3OXFA 4ABNA 3DEPA 2XGMA 3PZ3A 4KBQA 4A1GA 2OEWA 4GTQA 3T5XA 3SY2A 4FHJA 3C3QA 3AG1E 3U4TA 3ESLA 5T3RA 3C3RA 4BWRA 3PEUB 3RRMB 2KATA 3E37A 4U0SA 4U63A 2KCKA 4B93B 2BEDA 4UI9J 4AXHA 2XPZA 3UM0A 4GZDA 5ARGA 4JZYA 4GCOA 4RQIA 2AJAA 3MGBA 4DK5A 4GMJA 5KJNA 4I1OB 1NA3A 3E32A 2IONA 1KZPA 2KCVA 2DYSE 3UT7A 2GRNB 4XIFA 3ZYKA 4AIFA 2YHCA 2OVBA 5DIZA 4YDEA 1LD8A 4M7CA 1UN8A 2QYUA 3LY7A 3GYZA 5KJKA 4TXRA 5EYLA 2WXOA 3PZ4A 1JWFA 4OVUA 4HRNA 3WG7E 4B89A 3DSXA 4RLYA 3UINC 4YVQC 2OEVA 2XQ0A 5ENRD 1WDYA 5ARFA 3I4RB 1HU3A 1S63A 4MS6A 2R5SA 2FULA 4WWOA 4HQDA 1YMPA 3QNKA 5ANRA 3Q15A 2ZIRA 3ABKE 3AS5A 2PZIA 4BETA 3FTUA 2GGFA 3OXLA 1MYOA 4AY5A 4EBAG 1OCRE 1E8ZA 4N39A 2XRYA 3B7UX 3B13A 3EHNA 3EHMA 4R7LA 3ZYQA 1RW2A 2DWZA 3D9LA 3SQVA 2VGXA 1D8EA 4UI9C 4A1SA 3CV0A 5JHBA 5AQ7A 1N11A 4DI4A 5HQ8A 3JXIA 2YQ8A 3FUHA 3QWWA 3IHYA 2XZDG 4GPMA 2F8XK 1UJJA 4YDWA 3EHRA 5FTPA 3TWTA 3TXMA 2HM8A 3CKCA 3ZRHA 4CRWA 3VLEA 4M3OA 2AVPA 3CHQA 2IOLA 5AAOA 2ZGGA 3UUXA 1N94A 2CG3A 4AM9A 3FUJA 1QNFA 3DWLG 3FDHA 3D9MA 1BI8B 3PH0C 1E96B 3MKQB 4FU3A 5CRVA 1UG3A 2RFMA 4UWLA 2IOSA 4N2QA 2JABA 3SZ7A 3HIZA 3LS8A 2VTBB 4PUCA 3FULA 5ENPD 4RSYA 3CK9A 5CCMA 2XPYA 1OCZE 3T9KA 4GZ5A 5JJTA 4N5QA 3PZDA 2X38A 2WXJA 1JUQA 3E4BA 4GYYA 2KZTA 1D8DA 3ZU7B 1BD8A 1INZA 2KBXA 2PNNA 5B1AE 5BT1A 3Q7AA 3SBSA 4I6EA 2WVIA 3ZIMA 4HOQA 4HI8A 3UIOC 5ENQD 2WXRA 2RG8A 3B7SA 3ZW3A 1JCRA 4I2ZA 2E2EA 4W9RA 1GW6A 4HOSA 1N4SA 3CHSA 1U3CA 2GRLA 3I5PA 4DLOA 1U2VG 2DCPA 1WM5A 4ACLA 4A3TA 3SD5A 1OCOE 3KEAA 3ZHEB 4L7TA 1SZAA 4JD2G 3CK8A 1E7UA 3FTZA 4DPRA 4G1TA 1L5JA 4EZJA 2FEZA 3L17A 4L9PA 1TN6A 2XEVA 5ENTD 4PS8A 2XEEA 5LX8A 3I4GA 2X3MA 1JCSA 3RK6A 2NXPA 1Y6IA 1BU9A 4TRQA 4CDMA 1QZ2A 2CHXA 3C72A 2IU1A 3MYVA 4BT9A 3RSEG 2F37A 3IKOB 4MBGA 4ATZD 3T8MA 3G2UA 4XKCA 2Y3AA 4OAUC 3NZUA 3CQGB 2L0TB 3EIQC 4J8EA 3HDXA 2HYZA 4CEMA 4GMLA 4UQYA 3KEZA 3UQ3A 3CR3A 3FUFA 3Q7FA 3TWSA 5BNWA 4QFVA 1N0RA 3ZFWA 4BX8A 4HORA 5C1DA 1MJ0A 2H6IA 3ASGA 1N9AA 2H6FA 3GZ1A 3CHOA 3RKVA 1OWMA 3EIJA 1OWNA 4RG9A 4CGVA 2IFUA 4B8CB 4ME2A 2WB2A 2QY7A 5ITZF 3DSTA 1E8XA 3HYMB 2WPVA 3HXEA 4CGWA 2V0PA 3JUIA 3Q9UC 4U8YD 3ULQA 2V8SE 5A7DB 4AJWA 3FWVA 2WXHA 1FT1A 2KC7A 2XENA 3UX4A 4G24A 2LSVA 2H6HA 4U8HA 1OWPA 2YHEA 4KZ0A 1SZ9A 3MV2B 3KD7A 4XE0A 3RAUA 3UM1A 3BG1B 5FINA 2HR2A 2Y1LE 4K5AB 4K0RA 1JWGA 1LTXA 1MX6A 4O60A 1OT8A 3TWXA 4BSZB 2P9NG 2XZTG 1A17A 2QZAA 4G2VA 3LXUX 4UQZA 4DUIA 4LG6A 4KZCA 3NOCD 5JJ6A 3DPYA 3UT4A 3C98A 5FZSA 4CDRA 4G26A 2FI7A 2F0YA 3FU5A 3R9AB 5CEDB 3LPZA 2YNQA 3TGOA 3CQCB 3APDA 1AP7A 1O1TA 2B0OE 5BV1A 2OOEA 4WAFA 1MZCA 5D0QD 2ILRA 3CKBA 3IHVA 2KCLA 3E34A 2QYJA 5A6CA 1G3NB 1ZU2A 3IV0A 3CVVA 3D9JA 3APFA 4X8QA 1OCCE 3SHFA 2BF0X 3B7TA 3RIBA 5B3SE 2GW1A 4HLLA 1O1SA 4GTVA 1IXVA 4U0UA 3CVQA 2A5UA 4NACA 2XGOA 5AQAA 4L2YA 1NZNA 4U04A 4APOA 3UM2A 3PVLA 5G05J 4HNAD 4J8SA 4J0UA 3TWRA 3ZN3A 2X6IA 5G04C 5EX3A 1LD7A 5G55A 3ZEFA 4B94A 3OXGA 4ILGA 4N5CA 3KAEA 2LXMA 3PEVB 2VQ2A 2Y4TA 3ULEG 3ENEA 4CDNA 4PS7A 2AXUA 5FZQA 2FBNA 2V5QC 1SA4A 4OAVB 4UQXA 4HRLA 1PAQA 4F6RD 4XI0A 1Z3XA 2KXPC 1FT2A 4CYMD 2QFCA 3HG0D 3R9MA 4CCAA 3AU4A 3J5QB 2NSZA 4TXPA 3ABLE 5HKPA 1MX4A 1BPOA 4DX2A 4N3AA 2P58C 4JHRA 4I2WA 4BFRA 5JMND 4KMOA 1XNFA 1FVFA 3LYAA 3PS6A 3CIAA 5BUZA 3JCKC 4V3IA 2VSYA 5ENNA 2X6JA 4XZ4A 2IQCA
chains in the Genus database with same CATH topology
3CHMA 3ZYLA 1UG3A 2AXZA 4UWLA 5DBKA 3O4ZA 2IOSA 3MV3B 2I6HA 4A3VA 4FADA 3SZ7A 5E75A 3GZ2A 4N2QA 3HIZA 3LS8A 3SI5A 2V5FA 2VTBB 2WM9A 2VSOE 4PUCA 3FULA 3LY8A 4YVOA 4F7AA 3Q4AB 2XCBA 3CK9A 4RSYA 4WNEA 2J49A 3RRNB 1P5QA 4UWHA 3ZYMA 4GB9A 5CCMA 3FY4A 2XPYA 2CG2A 3BG0B 3R7QA 4GZ5A 2MOWA 1WY6A 3D9KA 5JJTA 1ELRA 3L6AA 3PZDA 2X38A 3S7BA 2WXJA 3CVWA 4OYSA 1JUQA 1DNPA 3E4BA 4Q96A 3FUDA 2PL2A 4GYYA 1EPUA 4KVOA 5AIJA 2VJ8A 2KZTA 5LFAA 2UWJG 4XX5A 3ML9A 4WUYA 1INZA 5FQ7A 3LKUA 3Q49B 3FH7A 5BT1A 1PC2A 3AS8A 3JYSA 4J8FA 1S0PA 5LP0A 3CHPA 3FTXA 5C2YA 4BTBA 3QKYA 4MRUA 4ANUA 5M72A 4LRZA 3FU6A 1HX8A 2WXKA 4G23A 4OVVA 2X6HA 1HG5A 2EQXA 3SBSA 4I6EA 2WVIA 4O6FA 2AXVA 4B0ZA 2PM7A 2OV8A 2PQRA 5FT9A 4ACKA 3ZIMA 4HOQA 3D9OA 3SBTB 1H6KA 3FTYA 2WXIA 4LERA 2XRZA 4F1SA 4B8AA 3OTNA 2WXRA 2RG8A 3B7SA 3ZW3A 4I2ZA 3SF4A 1XGWA 5EKQD 3CSTA 3FUEA 3T5VA 4IULA 2E2EA 5KJLA 1HS6A 4W9RA 3L54A 1GW6A 3CHRA 4HOSA 2WXPA 2VGXB 4C0EA 3CHSA 2WMOA 4G25A 2MRIA 1U3CA 3CGHA 3RU0A 4Y6WA 3FFLA 3L22A 2GRLA 4BY6A 3I5PA 5G04J 5FWQA 1WAO1 3KS2A 3LVQE 4GCNA 4DLOA 2DCPA 1WM5A 5D0OD 2ONDA 2WXNA 1ELWA 4U07A 4A3TA 4ACLA 3SD5A 3G2SA 3ZHEB 2YINA 4L7TA 4P29A 1SZAA 1IQRA 3L13A 4IRUA 3CK8A 1E7UA 3NZSA 3FTZA 3G2TA 4DPRA 4G1TA 5AENA 2LAHA 4RG6A 5EDSA 3UMVA 4IN3B 2V4LA 3FU3A 4I6JA 1UJKA 1L5JA 2PM6A 4EZJA 2FEZA 3FTWA 5FQ8A 3QK0A 1HO8A 4HXIA 4ANWA 3L17A 5T4YA 2ZU6B 4APFA 1FCHA 3DBSA 5KJMA 5A23A 1H0AA 1TEZA 5LOZA 1W3BA 2XEVA 2C0MA 3D9NA 3P2BA 1HFAA 3S2AA 4PS8A 4MKTA 3CVNA 3I4GA 3RRUA 5LX8A 2GRMA 2X3MA 2J08A 2BTDA 3RK6A 2NXPA 1Y6IA 1E7VA 3PE4A 3ZPJA 3N71A 5BPPA 4GZ3A 3SNXA 3LEWA 4JC8A 4TRQA 4N2SA 3CVYA 4CDMA 3MZLB 4CT0A 1QZ2A 2CHXA 2IU1A 3MYVA 2L9BA 1ZBPA 5BW8C 3VLFA 4BT9A 4NRHB 1N52A 1N54A 3S7DA 2XGSA 1IHGA 5AJDA 3IKOB 3MX3A 3VTXA 3T8MA 1VDYA 3G2UA 3EDTB 3MA5A 4I6GA 1KT1A 3ZVVA 4GA2A 2VTBA 4XKCA 2Y3AA 1SQMA 3CQGB 3NZUA 3L16A 2L0TB 3EIQC 4J8EA 3RJVA 5LCWJ 1H2UA 3HDXA 2HYZA 4CEMA 4GMLA 3AU5A 3D9PA 4UQYA 3KEZA 1EDUA 3URZA 3UQ3A 3QWVA 4LCTA 2R59A 2I2OA 2VGYA 3CR3A 3TL5A 3HHMA 4RVBA 3QARA 4UWFA 3FUFA 4JHJA 5BNWA 4QFVA 1Z6TA 3ZFWA 4BX8A 3U3WA 2WXGA 4JXTA 4HORA 3MKQA 4BT8A 3PE3A 4I17A 1IYGA 2UY1A 2KM4A 3AS4A 5C1DA 1MHQA 3ASGA 2LAIA 4TUUA 3TXNA 4BTAA 3CEQA 4JEHA 2CHZA 5G05C 3QAQA 1FVHA 1KT0A 2JEKA 2VSXE 3QOUA 4ILHB 4XKBA 2FO7A 3GZ1A 3CHOA 3LCAA 4JA7A 3RKVA 2J4BA 4FA6A 4MLPA 2X6KA 2AWIA 4A55A 3LVRE 1OWMA 4G11A 4Q69A 3EIJA 4JEUA 4J8DA 1OWNA 3LJ3A 4HFGA 4F3VA 4AVXA 4JHKA 3PNTB 4RG9A 4WWNA 1PY1A 4CGVA 5CMYA 4AEZC 3D9IA 4FP7A 2IFUA 1EF1C 3S7JA 2WXQA 4B8CB 4ME2A 4PDXA 2WB2A 3UPVA 2QY7A 4GPKA 5KCMA 1E8XA 3HYMB 2WPVA 4XI9A 4AY6A 4GU5A 5FJYA 4LEUA 5CHEE 1Y8MA 2XCCA 3Q47B 4JL0A 3MKRA 4HVBA 4CGWA 4KVMA 2I1KA 2JLBA 3NQPA 4L23A 3LDZA 2DIWA 2V0PA 3JUIA 2XHEA 3FH8A 3S7FA 4D10C 3APCA 5J08A 3O48A 3UT8A 3LY9A 4ILIA 4PS3A 4AP2A 4AOFA 2I1JA 4EZKA 2LSUA 3ULQA 2V8SE 3RO3A 2WQ7A 5A7DB 3K9IA 3FWVA 2NC9A 4AJWA 1B89A 4HLEA 2IQCA 2M63A 3L08A 5JHAA 2DBAA 3DPDA 5EX0A 5HI7A 3SGHA 3B7RL 2WXHA 2WXFA 4GYWA 2KC7A 3UX4A 4GYOA 2KZTB 4G24A 1H2VC 1HXIA 3ASFA 1E8YA 3MCXA 4DI3A 3FEYA 2LSVA 4C0MA 3JQ0A 4U8HA 3R7RA 3FTVA 3PREA 4WNDA 1OWPA 4I9CA 3IEGA 3FHEA 2YHEA 4ATGA 4H7YA 4YNDA 4KZ0A 1SZ9A 4EBAA 4LUNU 3SFZA 3MV2B 3KD7A 3QDNA 5FZRA 4F53A 2J4DA 1E8WA 4FJZA 4XE0A 1U3DA 2J9QA 4FJYA 1IQUA 2J07A 3QC1A 3QJZA 4HOTA 1H2TC 3FUKA 2OVFA 4CT4A 3BG1B 3OXFA 4UWGA 3G2VA 4IYPA 4ABNA 4FLHA 2XGMA 2HR2A 4KBQA 4K0RA 5J90A 4A1GA 1JWGA 4BX9A 3T5XA 4JA9A 3ZGQA 3PUJA 4UWKA 4N3CA 4PH4B 4GA0A 5ANLA 3TAXA 3TG5A 4EZLA 4JVSA 4EQFA 4FHJA 3CLJA 3VTYA 3QB2A 3U4TA 3ESLA 1UN9A 3PDNA 5T3RA 2FF4A 3PUKA 4BWRA 1A17A 3PEUB 1MQSA 4G2VA 3LXUX 3RRMB 4UQZA 4JW1A 2KATA 4DLQA 4U0SA 4U63A 5G2NA 4I1AA 4KZCA 2IF4A 3ZHEA 2LNIA 5JJ6A 2KCKA 4HOUA 3UT4A 3C98A 4UI9J 5FZSA 5T8IA 4CDRA 4AXHA 4G26A 2XPZA 1TJCA 2UY1B 1QQEA 4GZDA 4NQ0A 4H7XA 4GZCA 2FI7A 3FU0A 3FU5A 3R9AB 5ARGA 4URKA 2VSNA 4JZYA 1NP7A 1KLXA 2PQNA 3Q5MA 4GCOA 3LPZA 2YNQA 3U64A 3TJPA 3TGOA 3CQCB 3MGBA 4DK5A 3APDA 4GMJA 4E85A 5KJNA 3OAWA 3ASHA 3VLDA 4I1OB 3FUMA 5FQ4A 3FH5A 1NA3A 5BV1A 2C0LA 4KYOB 2IONA 4L1BA 2OOEA 4WAFA 1X5BA 5D0QD 2KCVA 2Y4UA 2ILRA 4FLBA 3UT7A 4XIFA 3ZYKA 4AIFA 2YHCA 2OVBA 3CKBA 3IHVA 5DIZA 5AJLA 2IJGX 2KCLA 4GAAA 1ELKA 1JPLA 4FULA 4Q94A 1UN8A 4FHKA 5FQ6A 4K03A 3LY7A 5A6CA 1OWOA 3IV0A 1ZU2A 3GYZA 1E90A 5KJKA 3CVUA 2WXOA 3HVEA 1JWFA 3IBEA 1EYHA 3CVVA 3D9JA 3FTSA 3I3NA 3APFA 3FUNA 1TJFA 1YA0A 4OVUA 2E0IA 4B89A 3CK7A 3U9WA 3SHFA 2BF0X 3B7TA 3BEEA 3RIBA 4YVQC 2C2LA 1HG2A 2GW1A 2XQ0A 2BUGA 5ARFA 2L0IA 4C9BB 3I4RB 1HU3A 3TG4A 4MS6A 4U0UA 4AV7A 3CVQA 2R5SA 4WNGA 2FULA 2J09A 2A5UA 4U0ZA 4WWOA 4NACA 1DVPA 1OWLA 1HZ4A 2I9CA 4I9EA 2XGOA 4I1MA 3CVXA 4Y6CA 3QNKA 3ESKA 3G2WA 4L2YA 3EJNA 4TV3A 5ANRA 1NZNA 2WXLA 4U04A 3MEKA 4APOA 3Q15A 4WWPA 3PVLA 5G05J 3AS5A 4J8SA 4J0UA 2PZIA 2Q7FA 3GW4A 2WMNA 3D3MA 3ZN3A 2X6IA 3ML8A 4GA1A 1LF8A 5G04C 3FTUA 2GGFA 4E6HA 4ANVA 3OXLA 5EX3A 3NF1A 5G55A 4AY5A 3ZEFA 1HF8A 3ZXSA 4B94A 3OXGA 4ILGA 4EBAG 1NA0A 4N5CA 3FUIA 1E8ZA 3HVEB 3KAEA 3GZSA 4N39A 2XRYA 2WQ6A 3EHNA 3B13A 2CFZA 3B7UX 3PEVB 2VQ2A 3EHMA 4R7LA 2Y4TA 4UI9K 3ZYQA 3FP3A 3ENEA 3RO2A 5JJ7A 4CDNA 4PS7A 2AXUA 3D9LA 4L2LA 4KT6B 5LCWC 1H19A 5FZQA 2WXMA 2VGXA 4UI9C 2CFUA 3ONLA 4WNFA 4A1SA 2FBNA 3CV0A 1HE8A 2AW6A 5JHBA 1UW4B 3FEXA 5CMWA 4UQXA 4DI4A 1PAQA 3P1UA 5HQ8A 4XI0A 1Z3XA 2YQ8A 3MJWA 3FUHA 3QWWA 3IHYA 2LO6A 2QFCA 2HO1A 4CCAA 4HS2A 3AU4A 4FC8A 2NSZA 4DJAA 5BV0A 3ASDA 4EPZA 1OUVA 2VYIA 1UJJA 4GZ6A 4BSXA 2X6FA 5FTPA 3ONKA 1Z3YA 1BPOA 3CVLA 3TXMA 2WQHA 3WXXA 4N3BA 2HM8A 4N3AA 2P58C 3CSFA 3PNLB 4JHRA 5CCLA 3CKCA 4I2WA 3ZRHA 3VLEA 4M3OA 2AVPA 4BFRA 1HH8A 4CRWA 2XPIA 2L6JA 3QWPA 3CHQA 4I43A 2IOLA 4KMOA 4J6IA 2R17C 1XNFA 1FVFA 3UUXA 3LYAA 4ANXA 3PS6A 2A4ZA 2CG3A 2MHKA 4JPSA 4AM9A 3CIAA 2RD0A 3FUJA 5BUZA 3JCKC 1QNFA 4NURA 3U66A 3FDHA 3CVPA 5E76A 3PRZA 3D9MA 4V3IA 3PH0C 2VSYA 1E96B 5ENNA 3MKQB 5AYWD 2X6JA 4KXKB 4XZ4A 4EECA 2CHWA 4FU3A 3JQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN8 A;  1UN9 A;  2BTD A;  3PNL B;  3CR3 A;  4LRZ A; 
#chains in the Genus database with same CATH topology
 4U95 D;  3ZYL A;  1TNO A;  2AXZ A;  5DBK A;  3DEO A;  3C3O A;  3MV3 B;  2I6H A;  2V5F A;  2WM9 A;  3LY8 A;  3Q4A B;  4WNE A;  2J49 A;  3RRN B;  4GB9 A;  5CBO A;  3BG0 B;  3R7Q A;  3JUE A;  1WY6 A;  1K1A A;  3S7B A;  3CVW A;  4OYS A;  1DNP A;  5LFA A;  1N95 A;  2UWJ G;  1Q2Z A;  3AS8 A;  4J8F A;  3BU8 A;  1S0P A;  5LP0 A;  3CHP A;  4ANU A;  5M72 A;  4LRZ A;  1N4P A;  1HX8 A;  2WXK A;  4OVV A;  2X6H A;  2EQX A;  4GTO A;  4A63 B;  4O6F A;  4JB8 P;  4B0Z A;  3ASN E;  5HRY A;  5FT9 A;  3FTY A;  4F1S A;  4IUL A;  3ZNG A;  5EN5 D;  2VGX B;  4C0E A;  1S70 B;  2WMO A;  2MRI A;  3RU0 A;  1NL4 A;  4BY6 A;  3LVQ E;  1ELW A;  1O1R A;  4IRU A;  3G2T A;  5EDS A;  3DSS A;  4HI9 A;  2V4L A;  2EIL E;  1UJK A;  2PM6 A;  3QK0 A;  1HO8 A;  2ZU6 B;  1FCH A;  3EHQ A;  5KJM A;  1H0A A;  1W3B A;  3CVN A;  2XS8 A;  3N71 A;  1K1B A;  3CVY A;  4J7W A;  3MZL B;  4CT0 A;  3V31 A;  5AAR A;  3EU5 A;  4NRH B;  3S7D A;  3VTX A;  3UM3 A;  1KT1 A;  3L16 A;  5LCW J;  1H2U A;  2R59 A;  4RVB A;  2DYR E;  1Z6T A;  2ETC A;  2WXG A;  4JXT A;  4I17 A;  2UY1 A;  2FO1 E;  1TN8 A;  4BTA A;  4LNB A;  2IO3 C;  3QAQ A;  1KT0 A;  2VSX E;  2FO7 A;  4JA7 A;  4FA6 A;  4MLP A;  2X6K A;  4A55 A;  4G11 A;  1MX2 A;  4JEU A;  4J8D A;  2P9K G;  4HFG A;  2EIK E;  3D9I A;  4FP7 A;  3S7J A;  2WXQ A;  4GPK A;  5KCM A;  4GU5 A;  4LEU A;  3BUA A;  1FPP A;  4KVM A;  3LDZ A;  5J08 A;  3O48 A;  3LY9 A;  4LSZ E;  4AOF A;  3UKR G;  4EZK A;  1TN7 A;  3RO3 A;  3X2Q E;  3SO8 A;  3L08 A;  5JHA A;  2DBA A;  5HI7 A;  2LUH A;  3B7R L;  4GYW A;  2WXF A;  2KZT B;  3MCX A;  4DI3 A;  3SFY A;  3FEY A;  3JQ0 A;  3HRA A;  4YDO A;  2A5E A;  2EIN E;  4I9C A;  4H7Y A;  5KBA A;  4LUN U;  3SFZ A;  3QDN A;  1DC2 A;  1E8W A;  4FJZ A;  2J9Q A;  4G8L A;  1IQU A;  4GMR A;  3C5R A;  3FUK A;  4BX9 A;  3ZGQ A;  3PUJ A;  5CER B;  4N3C A;  4PH4 B;  3TAX A;  3TWU A;  4JVS A;  4EQF A;  4EZL A;  3CLJ A;  1YCS B;  3VTY A;  3QB2 A;  3PDN A;  2FF4 A;  1MQS A;  4NIK A;  3T8K A;  4DLQ A;  5G2N A;  4I1A A;  3ZHE A;  3AG4 E;  2UY1 B;  4NQ0 A;  4H7X A;  5CRU A;  2B6C A;  2VSN A;  3Q5M A;  3U64 A;  3TJP A;  1TR4 A;  3KSQ A;  1ZB1 A;  3OAW A;  3VLD A;  5IY5 E;  3FH5 A;  2C0L A;  1X5B A;  3D9H A;  2DZN A;  2XEH A;  5CBN A;  3V79 K;  5AJL A;  2IJG X;  4GAA A;  1ELK A;  4FHK A;  4K03 A;  4BER A;  1OWO A;  1OXJ A;  5EYP F;  1E90 A;  3CVU A;  4EHM A;  3HVE A;  3ISM C;  1EYH A;  4GTS A;  1TJF A;  2P9S G;  3CK7 A;  2ETB A;  3BEE A;  1HG2 A;  2BUG A;  2L0I A;  1KZO A;  3AJI A;  3W9G A;  3L82 A;  2J09 A;  5CEA A;  4U0Z A;  5B1B E;  1QBQ A;  1HZ4 A;  2I9C A;  4Y6C A;  4GTP A;  3ESK A;  3G2W A;  4XEI G;  3EJN A;  4LNU D;  1SVX A;  4TV3 A;  4DX1 A;  3MEK A;  3UXG A;  2Q7F A;  4O1P A;  3GW4 A;  3D3M A;  1AWC B;  3ML8 A;  1LF8 A;  4GTM A;  4E6H A;  4ANV A;  3NF1 A;  2GRQ B;  5ENS D;  1HF8 A;  3ZXS A;  1DCE A;  3AAA C;  3HXC A;  3HVE B;  3GZS A;  2CFZ A;  4UI9 K;  3FP3 A;  3RO2 A;  5JJ7 A;  4L2L A;  4KT6 B;  2WXM A;  2CFU A;  3ONL A;  1HE8 A;  1UW4 B;  5CMW A;  2H6G A;  4HS2 A;  2R05 A;  2GRR B;  4EPZ A;  1OUV A;  3ONK A;  2ZIS A;  4N3B A;  2ETA A;  1RZ4 A;  3V2O A;  3PNL B;  5CCL A;  1HH8 A;  2XPI A;  4I43 A;  2R17 C;  2A4Z A;  2MHK A;  1A5E A;  4UUC A;  3U66 A;  5E76 A;  3TWW A;  5AYW D;  4EEC A;  2CHW A;  5AQB A;  4Z68 A;  5D2M C;  3KSL A;  3O4Z A;  1NFI E;  3ZUV B;  3GZ2 A;  4F7A A;  4YVO A;  5CEC B;  1H6P A;  1P5Q A;  1N4R A;  3ULY A;  3FY4 A;  2CG2 A;  1ELR A;  3EU9 A;  4U7E B;  4KVO A;  3UKU G;  1EPU A;  5AIJ A;  3ML9 A;  4HRM B;  3LKU A;  3Q49 B;  3JYS A;  3ABM E;  3SFX A;  3QKY A;  3F6Q A;  3FU6 A;  2BKG A;  3Q78 A;  3DXK G;  4C48 B;  2AXV A;  2PQR A;  4ACK A;  3D9O A;  3V30 A;  4B8A A;  3DRA A;  4HB5 A;  3NBN B;  3OTN A;  1XGW A;  3CST A;  3T5V A;  1HS6 A;  3L54 A;  5BXU A;  2WXP A;  4G25 A;  3CGH A;  3FFL A;  3L22 A;  5G04 J;  1WAO 1;  3KS2 A;  4U07 A;  2YIN A;  2LAH A;  3UMV A;  4IN3 B;  3FTW A;  5FQ8 A;  4HXI A;  4ANW A;  5T4Y A;  4APF A;  5HS0 A;  1TEZ A;  5AQ9 A;  3S2A A;  4MKT A;  3RRU A;  2J08 A;  2BTD A;  1E7V A;  2Y0B G;  5BPP A;  1TYQ G;  4GZ3 A;  4JC8 A;  4N2S A;  3VLF A;  1H6O A;  2L9B A;  1ZBP A;  5BW8 C;  1N52 A;  1IHG A;  1DCQ A;  3MX3 A;  1SW6 A;  3EDT B;  3MA5 A;  2GRP B;  4I6G A;  3ZVV A;  4GA2 A;  2VTB A;  3ZKJ A;  3RJV A;  3URZ A;  4YDY A;  3QWV A;  4LCT A;  2I2O A;  2VGY A;  3TL5 A;  4UWF A;  1BI7 B;  4JHJ A;  3U3W A;  3MKQ A;  4BT8 A;  2J8S D;  5BXO A;  1MHQ A;  3CEQ A;  2CHZ A;  1FVH A;  2JEK A;  4ILH B;  2RFA A;  2J4B A;  4Q69 A;  1JCQ A;  2OCC E;  3Q79 A;  4F3V A;  4AVX A;  4JHK A;  3PNT B;  1PY1 A;  5CMY A;  4DRX E;  3TWV A;  4PDX A;  3E30 A;  2DZO A;  5EID A;  1V55 E;  4AY6 A;  5FJY A;  5CHE E;  2XCC A;  4HVB A;  3NQP A;  1YYH A;  4L23 A;  3HXD A;  2XHE A;  3FH8 A;  4D10 C;  3APC A;  4ILI A;  4AP2 A;  2I1J A;  2LSU A;  3K9I A;  4HLE A;  1B89 A;  3Q9N C;  5EX0 A;  1H2V C;  1HXI A;  3ASF A;  1E8Y A;  3AG2 E;  3R7R A;  3PRE A;  4WND A;  2ZXW E;  3FHE A;  3DSW A;  2MYO A;  4ZHB A;  1TNU A;  5FZR A;  3Q75 A;  1U3D A;  3QC1 A;  3QJZ A;  4HOT A;  4O1O A;  4CT4 A;  4UWG A;  3G2V A;  4IYP A;  2L6B A;  4FLH A;  5J90 A;  3HXB A;  1SA5 A;  4JA9 A;  3W9F A;  4UWK A;  4GA0 A;  5ANL A;  3DXM G;  3TG5 A;  3B7B A;  1UN9 A;  3PUK A;  3ASO E;  4JW1 A;  2IF4 A;  2LNI A;  4HOU A;  2R03 A;  5T8I A;  1TJC A;  1QQE A;  4GZC A;  3FU0 A;  4URK A;  1NP7 A;  1KLX A;  1V54 E;  2PQN A;  4BES A;  4E85 A;  3ASH A;  3FUM A;  5FQ4 A;  4KYO B;  4L1B A;  3BQO A;  2Y4U A;  4FLB A;  2Y69 E;  4LNG A;  2HE0 A;  1N0Q A;  1JPL A;  4FUL A;  4Q94 A;  5FQ6 A;  5EIB E;  3IBE A;  3FTS A;  3I3N A;  3FUN A;  3L9T A;  1YA0 A;  2E0I A;  5D66 A;  3U9W A;  2F8Y A;  2C2L A;  5AN8 A;  3UI2 A;  4C9B B;  3TG4 A;  4AV7 A;  4WNG A;  3PZ1 A;  1DVP A;  1OWL A;  4I9E A;  4I1M A;  5H7P A;  3CVX A;  4DX6 D;  2P9L G;  2WXL A;  3PZ2 A;  4WWP A;  2IEJ A;  2WMN A;  2GRO B;  4GA1 A;  1IHB A;  1NA0 A;  3FUI A;  2WQ6 A;  1Z5S C;  4DX5 D;  5LCW C;  1H19 A;  2V4H C;  4WNF A;  2AW6 A;  5KNG A;  5KNH D;  3FEX A;  3P1U A;  3MJW A;  1IKN D;  2LO6 A;  2HO1 A;  4FC8 A;  4DJA A;  1K8K G;  5BV0 A;  3ASD A;  2VYI A;  4GZ6 A;  4BSX A;  1K3Z D;  2X6F A;  1Z3Y A;  3CVL A;  2WQH A;  3WXX A;  1UOH A;  3DSU A;  3CSF A;  3HXF A;  2P2C P;  2L6J A;  3QWP A;  1WG0 A;  3DSV A;  4J6I A;  4ANX A;  4JPS A;  2RD0 A;  5EIL A;  4NUR A;  3ZXP A;  3CVP A;  3PRZ A;  4KXK B;  3JQ1 A;  3CHM A;  5JA4 D;  4GTR A;  3NOG D;  4A3V A;  4FAD A;  5E75 A;  3B95 A;  3SI5 A;  2VSO E;  1X81 A;  4G8K A;  2XCB A;  3ZYM A;  3Q73 A;  4UWH A;  4F1P A;  2MOW A;  3D9K A;  3L6A A;  4Q96 A;  3FUD A;  2PL2 A;  2VGE A;  2VJ8 A;  1OY3 D;  4XX5 A;  4WUY A;  5FQ7 A;  3FH7 A;  1PC2 A;  1N4Q A;  3FTX A;  5C2Y A;  4BTB A;  4MRU A;  3E33 A;  2P9U G;  4G23 A;  1HG5 A;  2PM7 A;  2OV8 A;  3SBT B;  1H6K A;  2DVW A;  2WXI A;  4LER A;  2XRZ A;  4DX7 D;  3SF4 A;  5EKQ D;  3FUE A;  5KJL A;  3TWQ A;  3CHR A;  5FIO A;  4Y6W A;  5FWQ A;  4GCN A;  5D0O D;  2OND A;  2WXN A;  3G2S A;  4U8V D;  1S64 A;  4P29 A;  2P9I G;  1IQR A;  3L13 A;  3NZS A;  5AEN A;  4RG6 A;  3FU3 A;  4I6J A;  2P9P G;  3DBS A;  5A23 A;  5LOZ A;  1D9S A;  3AG3 E;  2C0M A;  3D9N A;  3P2B A;  1HFA A;  4GTT A;  2GRM A;  3PE4 A;  3ZPJ A;  3SNX A;  3LEW A;  4K5B A;  1N54 A;  2XGS A;  2LXL A;  3IXE A;  5AJD A;  1VDY A;  1TNY A;  1SQM A;  4CZ2 D;  3AU5 A;  3D9P A;  3V2X A;  1EDU A;  2EIM E;  3HHM A;  3QAR A;  3EUV A;  2BKK B;  2XS1 A;  1TNB A;  3NAW A;  3PE3 A;  1IYG A;  2KM4 A;  3AS4 A;  2LAI A;  4TUU A;  3TXN A;  2R2L A;  4JEH A;  1O5M A;  5G05 C;  3QOU A;  4XKB A;  3LCA A;  4TXQ A;  2AWI A;  5KWD A;  3LVR E;  3LJ3 A;  3J5P A;  3NB2 A;  4WWN A;  2NYJ A;  1BLX B;  3UTM A;  2QC9 A;  4AEZ C;  1EF1 C;  2IO2 C;  3UPV A;  3LJN A;  4U96 D;  4XI9 A;  4K5C A;  1Y8M A;  4JL0 A;  3Q47 B;  3MKR A;  2I1K A;  2JLB A;  4ZFH A;  2DIW A;  2IY0 C;  3S7F A;  2EIJ E;  3UT8 A;  4J8Y A;  4PS3 A;  2WQ7 A;  2NC9 A;  2M63 A;  3DPD A;  3SGH A;  1NI1 A;  4BEP A;  4QQI A;  1KPS B;  1QYM A;  4GYO A;  4TUM A;  4C0M A;  4HBD A;  3FTV A;  3JXJ A;  3UIP C;  2ZGD A;  3IEG A;  5ENO D;  4ATG A;  4YND A;  4EBA A;  2R02 A;  4F53 A;  2J4D A;  2RKK A;  4FJY A;  2J07 A;  1TNZ A;  1H2T C;  2OVF A;  3OXF A;  4ABN A;  3DEP A;  2XGM A;  3PZ3 A;  4KBQ A;  4A1G A;  2OEW A;  4GTQ A;  3T5X A;  3SY2 A;  4FHJ A;  3C3Q A;  3AG1 E;  3U4T A;  3ESL A;  5T3R A;  3C3R A;  4BWR A;  3PEU B;  3RRM B;  2KAT A;  3E37 A;  4U0S A;  4U63 A;  2KCK A;  4B93 B;  2BED A;  4UI9 J;  4AXH A;  2XPZ A;  3UM0 A;  4GZD A;  5ARG A;  4JZY A;  4GCO A;  4RQI A;  2AJA A;  3MGB A;  4DK5 A;  4GMJ A;  5KJN A;  4I1O B;  1NA3 A;  3E32 A;  2ION A;  1KZP A;  2KCV A;  2DYS E;  3UT7 A;  2GRN B;  4XIF A;  3ZYK A;  4AIF A;  2YHC A;  2OVB A;  5DIZ A;  4YDE A;  1LD8 A;  4M7C A;  1UN8 A;  2QYU A;  3LY7 A;  3GYZ A;  5KJK A;  4TXR A;  5EYL A;  2WXO A;  3PZ4 A;  1JWF A;  4OVU A;  4HRN A;  3WG7 E;  4B89 A;  3DSX A;  4RLY A;  3UIN C;  4YVQ C;  2OEV A;  2XQ0 A;  5ENR D;  1WDY A;  5ARF A;  3I4R B;  1HU3 A;  1S63 A;  4MS6 A;  2R5S A;  2FUL A;  4WWO A;  4HQD A;  1YMP A;  3QNK A;  5ANR A;  3Q15 A;  2ZIR A;  3ABK E;  3AS5 A;  2PZI A;  4BET A;  3FTU A;  2GGF A;  3OXL A;  1MYO A;  4AY5 A;  4EBA G;  1OCR E;  1E8Z A;  4N39 A;  2XRY A;  3B7U X;  3B13 A;  3EHN A;  3EHM A;  4R7L A;  3ZYQ A;  1RW2 A;  2DWZ A;  3D9L A;  3SQV A;  2VGX A;  1D8E A;  4UI9 C;  4A1S A;  3CV0 A;  5JHB A;  5AQ7 A;  1N11 A;  4DI4 A;  5HQ8 A;  3JXI A;  2YQ8 A;  3FUH A;  3QWW A;  3IHY A;  2XZD G;  4GPM A;  2F8X K;  1UJJ A;  4YDW A;  3EHR A;  5FTP A;  3TWT A;  3TXM A;  2HM8 A;  3CKC A;  3ZRH A;  4CRW A;  3VLE A;  4M3O A;  2AVP A;  3CHQ A;  2IOL A;  5AAO A;  2ZGG A;  3UUX A;  1N94 A;  2CG3 A;  4AM9 A;  3FUJ A;  1QNF A;  3DWL G;  3FDH A;  3D9M A;  1BI8 B;  3PH0 C;  1E96 B;  3MKQ B;  4FU3 A;  5CRV A;  1UG3 A;  2RFM A;  4UWL A;  2IOS A;  4N2Q A;  2JAB A;  3SZ7 A;  3HIZ A;  3LS8 A;  2VTB B;  4PUC A;  3FUL A;  5ENP D;  4RSY A;  3CK9 A;  5CCM A;  2XPY A;  1OCZ E;  3T9K A;  4GZ5 A;  5JJT A;  4N5Q A;  3PZD A;  2X38 A;  2WXJ A;  1JUQ A;  3E4B A;  4GYY A;  2KZT A;  1D8D A;  3ZU7 B;  1BD8 A;  1INZ A;  2KBX A;  2PNN A;  5B1A E;  5BT1 A;  3Q7A A;  3SBS A;  4I6E A;  2WVI A;  3ZIM A;  4HOQ A;  4HI8 A;  3UIO C;  5ENQ D;  2WXR A;  2RG8 A;  3B7S A;  3ZW3 A;  1JCR A;  4I2Z A;  2E2E A;  4W9R A;  1GW6 A;  4HOS A;  1N4S A;  3CHS A;  1U3C A;  2GRL A;  3I5P A;  4DLO A;  1U2V G;  2DCP A;  1WM5 A;  4ACL A;  4A3T A;  3SD5 A;  1OCO E;  3KEA A;  3ZHE B;  4L7T A;  1SZA A;  4JD2 G;  3CK8 A;  1E7U A;  3FTZ A;  4DPR A;  4G1T A;  1L5J A;  4EZJ A;  2FEZ A;  3L17 A;  4L9P A;  1TN6 A;  2XEV A;  5ENT D;  4PS8 A;  2XEE A;  5LX8 A;  3I4G A;  2X3M A;  1JCS A;  3RK6 A;  2NXP A;  1Y6I A;  1BU9 A;  4TRQ A;  4CDM A;  1QZ2 A;  2CHX A;  3C72 A;  2IU1 A;  3MYV A;  4BT9 A;  3RSE G;  2F37 A;  3IKO B;  4MBG A;  4ATZ D;  3T8M A;  3G2U A;  4XKC A;  2Y3A A;  4OAU C;  3NZU A;  3CQG B;  2L0T B;  3EIQ C;  4J8E A;  3HDX A;  2HYZ A;  4CEM A;  4GML A;  4UQY A;  3KEZ A;  3UQ3 A;  3CR3 A;  3FUF A;  3Q7F A;  3TWS A;  5BNW A;  4QFV A;  1N0R A;  3ZFW A;  4BX8 A;  4HOR A;  5C1D A;  1MJ0 A;  2H6I A;  3ASG A;  1N9A A;  2H6F A;  3GZ1 A;  3CHO A;  3RKV A;  1OWM A;  3EIJ A;  1OWN A;  4RG9 A;  4CGV A;  2IFU A;  4B8C B;  4ME2 A;  2WB2 A;  2QY7 A;  5ITZ F;  3DST A;  1E8X A;  3HYM B;  2WPV A;  3HXE A;  4CGW A;  2V0P A;  3JUI A;  3Q9U C;  4U8Y D;  3ULQ A;  2V8S E;  5A7D B;  4AJW A;  3FWV A;  2WXH A;  1FT1 A;  2KC7 A;  2XEN A;  3UX4 A;  4G24 A;  2LSV A;  2H6H A;  4U8H A;  1OWP A;  2YHE A;  4KZ0 A;  1SZ9 A;  3MV2 B;  3KD7 A;  4XE0 A;  3RAU A;  3UM1 A;  3BG1 B;  5FIN A;  2HR2 A;  2Y1L E;  4K5A B;  4K0R A;  1JWG A;  1LTX A;  1MX6 A;  4O60 A;  1OT8 A;  3TWX A;  4BSZ B;  2P9N G;  2XZT G;  1A17 A;  2QZA A;  4G2V A;  3LXU X;  4UQZ A;  4DUI A;  4LG6 A;  4KZC A;  3NOC D;  5JJ6 A;  3DPY A;  3UT4 A;  3C98 A;  5FZS A;  4CDR A;  4G26 A;  2FI7 A;  2F0Y A;  3FU5 A;  3R9A B;  5CED B;  3LPZ A;  2YNQ A;  3TGO A;  3CQC B;  3APD A;  1AP7 A;  1O1T A;  2B0O E;  5BV1 A;  2OOE A;  4WAF A;  1MZC A;  5D0Q D;  2ILR A;  3CKB A;  3IHV A;  2KCL A;  3E34 A;  2QYJ A;  5A6C A;  1G3N B;  1ZU2 A;  3IV0 A;  3CVV A;  3D9J A;  3APF A;  4X8Q A;  1OCC E;  3SHF A;  2BF0 X;  3B7T A;  3RIB A;  5B3S E;  2GW1 A;  4HLL A;  1O1S A;  4GTV A;  1IXV A;  4U0U A;  3CVQ A;  2A5U A;  4NAC A;  2XGO A;  5AQA A;  4L2Y A;  1NZN A;  4U04 A;  4APO A;  3UM2 A;  3PVL A;  5G05 J;  4HNA D;  4J8S A;  4J0U A;  3TWR A;  3ZN3 A;  2X6I A;  5G04 C;  5EX3 A;  1LD7 A;  5G55 A;  3ZEF A;  4B94 A;  3OXG A;  4ILG A;  4N5C A;  3KAE A;  2LXM A;  3PEV B;  2VQ2 A;  2Y4T A;  3ULE G;  3ENE A;  4CDN A;  4PS7 A;  2AXU A;  5FZQ A;  2FBN A;  2V5Q C;  1SA4 A;  4OAV B;  4UQX A;  4HRL A;  1PAQ A;  4F6R D;  4XI0 A;  1Z3X A;  2KXP C;  1FT2 A;  4CYM D;  2QFC A;  3HG0 D;  3R9M A;  4CCA A;  3AU4 A;  3J5Q B;  2NSZ A;  4TXP A;  3ABL E;  5HKP A;  1MX4 A;  1BPO A;  4DX2 A;  4N3A A;  2P58 C;  4JHR A;  4I2W A;  4BFR A;  5JMN D;  4KMO A;  1XNF A;  1FVF A;  3LYA A;  3PS6 A;  3CIA A;  5BUZ A;  3JCK C;  4V3I A;  2VSY A;  5ENN A;  2X6J A;  4XZ4 A;  2IQC A; 
#chains in the Genus database with same CATH homology
 3CHM A;  3ZYL A;  1UG3 A;  2AXZ A;  4UWL A;  5DBK A;  3O4Z A;  2IOS A;  3MV3 B;  2I6H A;  4A3V A;  4FAD A;  3SZ7 A;  5E75 A;  3GZ2 A;  4N2Q A;  3HIZ A;  3LS8 A;  3SI5 A;  2V5F A;  2VTB B;  2WM9 A;  2VSO E;  4PUC A;  3FUL A;  3LY8 A;  4YVO A;  4F7A A;  3Q4A B;  2XCB A;  3CK9 A;  4RSY A;  4WNE A;  2J49 A;  3RRN B;  1P5Q A;  4UWH A;  3ZYM A;  4GB9 A;  5CCM A;  3FY4 A;  2XPY A;  2CG2 A;  3BG0 B;  3R7Q A;  4GZ5 A;  2MOW A;  1WY6 A;  3D9K A;  5JJT A;  1ELR A;  3L6A A;  3PZD A;  2X38 A;  3S7B A;  2WXJ A;  3CVW A;  4OYS A;  1JUQ A;  1DNP A;  3E4B A;  4Q96 A;  3FUD A;  2PL2 A;  4GYY A;  1EPU A;  4KVO A;  5AIJ A;  2VJ8 A;  2KZT A;  5LFA A;  2UWJ G;  4XX5 A;  3ML9 A;  4WUY A;  1INZ A;  5FQ7 A;  3LKU A;  3Q49 B;  3FH7 A;  5BT1 A;  1PC2 A;  3AS8 A;  3JYS A;  4J8F A;  1S0P A;  5LP0 A;  3CHP A;  3FTX A;  5C2Y A;  4BTB A;  3QKY A;  4MRU A;  4ANU A;  5M72 A;  4LRZ A;  3FU6 A;  1HX8 A;  2WXK A;  4G23 A;  4OVV A;  2X6H A;  1HG5 A;  2EQX A;  3SBS A;  4I6E A;  2WVI A;  4O6F A;  2AXV A;  4B0Z A;  2PM7 A;  2OV8 A;  2PQR A;  5FT9 A;  4ACK A;  3ZIM A;  4HOQ A;  3D9O A;  3SBT B;  1H6K A;  3FTY A;  2WXI A;  4LER A;  2XRZ A;  4F1S A;  4B8A A;  3OTN A;  2WXR A;  2RG8 A;  3B7S A;  3ZW3 A;  4I2Z A;  3SF4 A;  1XGW A;  5EKQ D;  3CST A;  3FUE A;  3T5V A;  4IUL A;  2E2E A;  5KJL A;  1HS6 A;  4W9R A;  3L54 A;  1GW6 A;  3CHR A;  4HOS A;  2WXP A;  2VGX B;  4C0E A;  3CHS A;  2WMO A;  4G25 A;  2MRI A;  1U3C A;  3CGH A;  3RU0 A;  4Y6W A;  3FFL A;  3L22 A;  2GRL A;  4BY6 A;  3I5P A;  5G04 J;  5FWQ A;  1WAO 1;  3KS2 A;  3LVQ E;  4GCN A;  4DLO A;  2DCP A;  1WM5 A;  5D0O D;  2OND A;  2WXN A;  1ELW A;  4U07 A;  4A3T A;  4ACL A;  3SD5 A;  3G2S A;  3ZHE B;  2YIN A;  4L7T A;  4P29 A;  1SZA A;  1IQR A;  3L13 A;  4IRU A;  3CK8 A;  1E7U A;  3NZS A;  3FTZ A;  3G2T A;  4DPR A;  4G1T A;  5AEN A;  2LAH A;  4RG6 A;  5EDS A;  3UMV A;  4IN3 B;  2V4L A;  3FU3 A;  4I6J A;  1UJK A;  1L5J A;  2PM6 A;  4EZJ A;  2FEZ A;  3FTW A;  5FQ8 A;  3QK0 A;  1HO8 A;  4HXI A;  4ANW A;  3L17 A;  5T4Y A;  2ZU6 B;  4APF A;  1FCH A;  3DBS A;  5KJM A;  5A23 A;  1H0A A;  1TEZ A;  5LOZ A;  1W3B A;  2XEV A;  2C0M A;  3D9N A;  3P2B A;  1HFA A;  3S2A A;  4PS8 A;  4MKT A;  3CVN A;  3I4G A;  3RRU A;  5LX8 A;  2GRM A;  2X3M A;  2J08 A;  2BTD A;  3RK6 A;  2NXP A;  1Y6I A;  1E7V A;  3PE4 A;  3ZPJ A;  3N71 A;  5BPP A;  4GZ3 A;  3SNX A;  3LEW A;  4JC8 A;  4TRQ A;  4N2S A;  3CVY A;  4CDM A;  3MZL B;  4CT0 A;  1QZ2 A;  2CHX A;  2IU1 A;  3MYV A;  2L9B A;  1ZBP A;  5BW8 C;  3VLF A;  4BT9 A;  4NRH B;  1N52 A;  1N54 A;  3S7D A;  2XGS A;  1IHG A;  5AJD A;  3IKO B;  3MX3 A;  3VTX A;  3T8M A;  1VDY A;  3G2U A;  3EDT B;  3MA5 A;  4I6G A;  1KT1 A;  3ZVV A;  4GA2 A;  2VTB A;  4XKC A;  2Y3A A;  1SQM A;  3CQG B;  3NZU A;  3L16 A;  2L0T B;  3EIQ C;  4J8E A;  3RJV A;  5LCW J;  1H2U A;  3HDX A;  2HYZ A;  4CEM A;  4GML A;  3AU5 A;  3D9P A;  4UQY A;  3KEZ A;  1EDU A;  3URZ A;  3UQ3 A;  3QWV A;  4LCT A;  2R59 A;  2I2O A;  2VGY A;  3CR3 A;  3TL5 A;  3HHM A;  4RVB A;  3QAR A;  4UWF A;  3FUF A;  4JHJ A;  5BNW A;  4QFV A;  1Z6T A;  3ZFW A;  4BX8 A;  3U3W A;  2WXG A;  4JXT A;  4HOR A;  3MKQ A;  4BT8 A;  3PE3 A;  4I17 A;  1IYG A;  2UY1 A;  2KM4 A;  3AS4 A;  5C1D A;  1MHQ A;  3ASG A;  2LAI A;  4TUU A;  3TXN A;  4BTA A;  3CEQ A;  4JEH A;  2CHZ A;  5G05 C;  3QAQ A;  1FVH A;  1KT0 A;  2JEK A;  2VSX E;  3QOU A;  4ILH B;  4XKB A;  2FO7 A;  3GZ1 A;  3CHO A;  3LCA A;  4JA7 A;  3RKV A;  2J4B A;  4FA6 A;  4MLP A;  2X6K A;  2AWI A;  4A55 A;  3LVR E;  1OWM A;  4G11 A;  4Q69 A;  3EIJ A;  4JEU A;  4J8D A;  1OWN A;  3LJ3 A;  4HFG A;  4F3V A;  4AVX A;  4JHK A;  3PNT B;  4RG9 A;  4WWN A;  1PY1 A;  4CGV A;  5CMY A;  4AEZ C;  3D9I A;  4FP7 A;  2IFU A;  1EF1 C;  3S7J A;  2WXQ A;  4B8C B;  4ME2 A;  4PDX A;  2WB2 A;  3UPV A;  2QY7 A;  4GPK A;  5KCM A;  1E8X A;  3HYM B;  2WPV A;  4XI9 A;  4AY6 A;  4GU5 A;  5FJY A;  4LEU A;  5CHE E;  1Y8M A;  2XCC A;  3Q47 B;  4JL0 A;  3MKR A;  4HVB A;  4CGW A;  4KVM A;  2I1K A;  2JLB A;  3NQP A;  4L23 A;  3LDZ A;  2DIW A;  2V0P A;  3JUI A;  2XHE A;  3FH8 A;  3S7F A;  4D10 C;  3APC A;  5J08 A;  3O48 A;  3UT8 A;  3LY9 A;  4ILI A;  4PS3 A;  4AP2 A;  4AOF A;  2I1J A;  4EZK A;  2LSU A;  3ULQ A;  2V8S E;  3RO3 A;  2WQ7 A;  5A7D B;  3K9I A;  3FWV A;  2NC9 A;  4AJW A;  1B89 A;  4HLE A;  2IQC A;  2M63 A;  3L08 A;  5JHA A;  2DBA A;  3DPD A;  5EX0 A;  5HI7 A;  3SGH A;  3B7R L;  2WXH A;  2WXF A;  4GYW A;  2KC7 A;  3UX4 A;  4GYO A;  2KZT B;  4G24 A;  1H2V C;  1HXI A;  3ASF A;  1E8Y A;  3MCX A;  4DI3 A;  3FEY A;  2LSV A;  4C0M A;  3JQ0 A;  4U8H A;  3R7R A;  3FTV A;  3PRE A;  4WND A;  1OWP A;  4I9C A;  3IEG A;  3FHE A;  2YHE A;  4ATG A;  4H7Y A;  4YND A;  4KZ0 A;  1SZ9 A;  4EBA A;  4LUN U;  3SFZ A;  3MV2 B;  3KD7 A;  3QDN A;  5FZR A;  4F53 A;  2J4D A;  1E8W A;  4FJZ A;  4XE0 A;  1U3D A;  2J9Q A;  4FJY A;  1IQU A;  2J07 A;  3QC1 A;  3QJZ A;  4HOT A;  1H2T C;  3FUK A;  2OVF A;  4CT4 A;  3BG1 B;  3OXF A;  4UWG A;  3G2V A;  4IYP A;  4ABN A;  4FLH A;  2XGM A;  2HR2 A;  4KBQ A;  4K0R A;  5J90 A;  4A1G A;  1JWG A;  4BX9 A;  3T5X A;  4JA9 A;  3ZGQ A;  3PUJ A;  4UWK A;  4N3C A;  4PH4 B;  4GA0 A;  5ANL A;  3TAX A;  3TG5 A;  4EZL A;  4JVS A;  4EQF A;  4FHJ A;  3CLJ A;  3VTY A;  3QB2 A;  3U4T A;  3ESL A;  1UN9 A;  3PDN A;  5T3R A;  2FF4 A;  3PUK A;  4BWR A;  1A17 A;  3PEU B;  1MQS A;  4G2V A;  3LXU X;  3RRM B;  4UQZ A;  4JW1 A;  2KAT A;  4DLQ A;  4U0S A;  4U63 A;  5G2N A;  4I1A A;  4KZC A;  2IF4 A;  3ZHE A;  2LNI A;  5JJ6 A;  2KCK A;  4HOU A;  3UT4 A;  3C98 A;  4UI9 J;  5FZS A;  5T8I A;  4CDR A;  4AXH A;  4G26 A;  2XPZ A;  1TJC A;  2UY1 B;  1QQE A;  4GZD A;  4NQ0 A;  4H7X A;  4GZC A;  2FI7 A;  3FU0 A;  3FU5 A;  3R9A B;  5ARG A;  4URK A;  2VSN A;  4JZY A;  1NP7 A;  1KLX A;  2PQN A;  3Q5M A;  4GCO A;  3LPZ A;  2YNQ A;  3U64 A;  3TJP A;  3TGO A;  3CQC B;  3MGB A;  4DK5 A;  3APD A;  4GMJ A;  4E85 A;  5KJN A;  3OAW A;  3ASH A;  3VLD A;  4I1O B;  3FUM A;  5FQ4 A;  3FH5 A;  1NA3 A;  5BV1 A;  2C0L A;  4KYO B;  2ION A;  4L1B A;  2OOE A;  4WAF A;  1X5B A;  5D0Q D;  2KCV A;  2Y4U A;  2ILR A;  4FLB A;  3UT7 A;  4XIF A;  3ZYK A;  4AIF A;  2YHC A;  2OVB A;  3CKB A;  3IHV A;  5DIZ A;  5AJL A;  2IJG X;  2KCL A;  4GAA A;  1ELK A;  1JPL A;  4FUL A;  4Q94 A;  1UN8 A;  4FHK A;  5FQ6 A;  4K03 A;  3LY7 A;  5A6C A;  1OWO A;  3IV0 A;  1ZU2 A;  3GYZ A;  1E90 A;  5KJK A;  3CVU A;  2WXO A;  3HVE A;  1JWF A;  3IBE A;  1EYH A;  3CVV A;  3D9J A;  3FTS A;  3I3N A;  3APF A;  3FUN A;  1TJF A;  1YA0 A;  4OVU A;  2E0I A;  4B89 A;  3CK7 A;  3U9W A;  3SHF A;  2BF0 X;  3B7T A;  3BEE A;  3RIB A;  4YVQ C;  2C2L A;  1HG2 A;  2GW1 A;  2XQ0 A;  2BUG A;  5ARF A;  2L0I A;  4C9B B;  3I4R B;  1HU3 A;  3TG4 A;  4MS6 A;  4U0U A;  4AV7 A;  3CVQ A;  2R5S A;  4WNG A;  2FUL A;  2J09 A;  2A5U A;  4U0Z A;  4WWO A;  4NAC A;  1DVP A;  1OWL A;  1HZ4 A;  2I9C A;  4I9E A;  2XGO A;  4I1M A;  3CVX A;  4Y6C A;  3QNK A;  3ESK A;  3G2W A;  4L2Y A;  3EJN A;  4TV3 A;  5ANR A;  1NZN A;  2WXL A;  4U04 A;  3MEK A;  4APO A;  3Q15 A;  4WWP A;  3PVL A;  5G05 J;  3AS5 A;  4J8S A;  4J0U A;  2PZI A;  2Q7F A;  3GW4 A;  2WMN A;  3D3M A;  3ZN3 A;  2X6I A;  3ML8 A;  4GA1 A;  1LF8 A;  5G04 C;  3FTU A;  2GGF A;  4E6H A;  4ANV A;  3OXL A;  5EX3 A;  3NF1 A;  5G55 A;  4AY5 A;  3ZEF A;  1HF8 A;  3ZXS A;  4B94 A;  3OXG A;  4ILG A;  4EBA G;  1NA0 A;  4N5C A;  3FUI A;  1E8Z A;  3HVE B;  3KAE A;  3GZS A;  4N39 A;  2XRY A;  2WQ6 A;  3EHN A;  3B13 A;  2CFZ A;  3B7U X;  3PEV B;  2VQ2 A;  3EHM A;  4R7L A;  2Y4T A;  4UI9 K;  3ZYQ A;  3FP3 A;  3ENE A;  3RO2 A;  5JJ7 A;  4CDN A;  4PS7 A;  2AXU A;  3D9L A;  4L2L A;  4KT6 B;  5LCW C;  1H19 A;  5FZQ A;  2WXM A;  2VGX A;  4UI9 C;  2CFU A;  3ONL A;  4WNF A;  4A1S A;  2FBN A;  3CV0 A;  1HE8 A;  2AW6 A;  5JHB A;  1UW4 B;  3FEX A;  5CMW A;  4UQX A;  4DI4 A;  1PAQ A;  3P1U A;  5HQ8 A;  4XI0 A;  1Z3X A;  2YQ8 A;  3MJW A;  3FUH A;  3QWW A;  3IHY A;  2LO6 A;  2QFC A;  2HO1 A;  4CCA A;  4HS2 A;  3AU4 A;  4FC8 A;  2NSZ A;  4DJA A;  5BV0 A;  3ASD A;  4EPZ A;  1OUV A;  2VYI A;  1UJJ A;  4GZ6 A;  4BSX A;  2X6F A;  5FTP A;  3ONK A;  1Z3Y A;  1BPO A;  3CVL A;  3TXM A;  2WQH A;  3WXX A;  4N3B A;  2HM8 A;  4N3A A;  2P58 C;  3CSF A;  3PNL B;  4JHR A;  5CCL A;  3CKC A;  4I2W A;  3ZRH A;  3VLE A;  4M3O A;  2AVP A;  4BFR A;  1HH8 A;  4CRW A;  2XPI A;  2L6J A;  3QWP A;  3CHQ A;  4I43 A;  2IOL A;  4KMO A;  4J6I A;  2R17 C;  1XNF A;  1FVF A;  3UUX A;  3LYA A;  4ANX A;  3PS6 A;  2A4Z A;  2CG3 A;  2MHK A;  4JPS A;  4AM9 A;  3CIA A;  2RD0 A;  3FUJ A;  5BUZ A;  3JCK C;  1QNF A;  4NUR A;  3U66 A;  3FDH A;  3CVP A;  5E76 A;  3PRZ A;  3D9M A;  4V3I A;  3PH0 C;  2VSY A;  1E96 B;  5ENN A;  3MKQ B;  5AYW D;  2X6J A;  4KXK B;  4XZ4 A;  4EEC A;  2CHW A;  4FU3 A;  3JQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...