3PNNA

The crystal structure of a glycosyltransferase from porphyromonas gingivalis w83
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
301
structure length
301
Chain Sequence
AMKPTLFVLAAGMGSRYGSLKQLDGIGPGGDTIMDYSVYDAIRAGFGRLVFVIRHSFEKEFREKILTKYEGRIPVELVFQELDRLPEGFSCPEGREKPWGTNHAVLMGRDAIREPFAVINADDFYGRNGFEVLARKLMTLEGKQGEYCMVGYRVGNTLSESGGVSRGVCQVDEKHLLTGVVERTGIERTDGTISFRDETGKICTLAEDAPVSMNMWGFTPDYFDYSEELFINFLNAHGQEPKSEFFIPFVVNDLIRSGRASVEVLDTTARWFGVTYSDDRPGVVAKLRELTEAGEYPTKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title The crystal structure of a glycosyltransferase from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
total genus 88
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3pnnA00
1W57A 1ZJ3A 1JYLA 3DUVA 5CMHA 1VICA 4FRBA 2V0HA 2WGZA 3R2WA 5CQNX 2AM3A 5I1FA 2VS5A 4ECMA 5C38A 1VGTA 2RJ9A 4HO9A 1R80A 1WVCA 2AH9A 5FTVA 2I5EA 1V83A 2RIYA 2Y4JA 4Y7UA 3TZTA 3JUKA 4B3UA 1GQCA 1IIMA 2V0KA 1ZJ0A 1G0RA 4Y7TA 4HO5A 3F1CA 1G95A 3HL3A 3SX8A 1ZJOA 2PA4A 3USRA 3V8ZA 2PX7A 4KNRA 5DDVA 2AM5A 4FRLA 2YQJA 3OH0A 4Y64A 2BO8A 3FOQA 3OH1A 3I0CA 1FR8A 2FYBA 1ZI4A 1FGGA 5IDSA 1ON6A 3ZF8A 1VPAA 1W77A 2FFVA 1VZXA 3BRKX 4EE3A 4KXOA 1S4OA 5C47A 1K4VA 1LZJA 1VM8A 3V90A 1VZTA 5FV9A 4R7PA 2X5ZA 3RSBA 2JCKA 1LZ0A 1ZCYA 3U0XA 4AC3A 2JCJA 3RMWA 4EEGA 4DDZA 4FREA 1KWSA 3OC9A 1TZFA 4KQLA 1LL3A 1G3LA 4FRDA 4FQWA 1QWJA 3U2TA 2YESA 1ZJ1A 3K8EA 2I5KA 4Y9XA 4CJ8A 1MC3A 1INIA 1ON8A 1JVDA 2P6WA 2AESA 3USQA 1GWWA 3NGWA 1TW1A 1PZYB 1G9RA 4J18A 1E5KA 1FRWA 3SX3A 3V0MA 3I0LA 3PNNA 4D0TA 4NAKA 3O3PA 4M28A 4HO2A 3K8DA 3V91A 2RJ5A 2Y7AA 1H7QA 3KIAA 1LL0A 3D8VA 2VS3A 5C36A 2WVMA 3SXGA 1HV9A 5C8RA 3T7OA 3T7NA 4G3QA 3CKQA 4D11C 1G8OA 1G2VA 1ZCTA 2XWNA 3ZLKA 5CMGX 1O7OA 2OI7A 5L6VA 2DPWA 1FO9A 5BXCA 5CMJA 1H5TB 1OMXA 2XMEA 3IOIA 2BO7A 3N9WA 2YCMA 4CJCA 1GWVA 2D7RA 4KPZA 5C1HA 1HM9A 4MYBA 1GX0A 1NMMB 1YP4A 3D5NA 3E25A 1LZIA 5IFYA 2RJ6A 1XHBA 1QGSA 2YQHA 4G3PA 4G87A 1INJA 1V84A 3I0HA 5C1GA 4KC1A 1YROB 1TVYA 5FTSA 1FR9A 4D48A 5C4FA 3V0PA 1QG8A 1S4NA 4Y7GA 3EE5A 2VXLA 1ZIZA 1O7QA 4AYJA 4EE5A 4XWIA 3SXEA 4B4MA 5C4EA 4ZDQA 3POLA 2XWLA 4IRPA 4B5BA 3V0OA 5C1LA 1ZI3A 5J49A 2O1GA 2WAWA 4NAIA 4HO3A 1H5TA 1ZCVA 1ZHJA 5CQLX 2QH5A 2VSHA 2VXMA 4C2SA 1ZJ2A 2RIXA 2ICXA 1WT0A 1WSZA 2Z86A 3R3IA 1OMZA 1H4DA 4AAWA 1G97A 2XWMA 3DK5A 4P02A 1R7UA 4ARWA 4BMAA 4LW6A 5DDTA 1O0RA 1HM0A 3SX7A 1HM8A 5JQQA 5CMIA 3CU0A 3ZGFA 1JVGA 4AYLA 2GGQA 2QGIA 1R7VA 2D7IA 4MNDA 2XMHA 2X65A 4KPXA 3OGZA 5EIYA 1JV3A 1VGUA 1VGZA 2VD4A 1LZ7A 4FRHA 5C4DA 3OH3A 1W55A 2JCOA 1FOAA 3CKVA 4FRMA 2YC5A 3ZLLA 1FO8A 1LVWA 2OI5A 2FFUA 5FUHA 1H7HA 4Y6UA 1TW5A 2E8BA 1EZIA 1H5SB 2RJ4A 1FXJA 3SXAA 1G93A 3I0GA 5C48A 3JTJA 3I0EA 1GQ9A 1H7FA 1SS9A 5AJPA 5EJ1A 4M2BA 1XZ6A 2AM4A 2I7BA 2VS4A 1NF5B 1R7YA 3I0KA 5FU8A 2OEFA 4CVHA 2A8WA 3QVBA 2V0LA 4EVWA 2RITA 2FYAA 1NHEB 3LW6A 2YQCA 4KT7A 1I52A 1EYRA 2Y4LA 1FG5N 1JYKA 1H5SA 4Y7FA 2YQSA 3OAMA 1O23B 3I0JA 4FRAA 2Y6PA 4BQHA 3T7MA 1ZDGA 1H5RA 2E3DA 2P72A 3SXDA 3JUJA 4DE7A 2PGVA 4KNXA 5C49A 2X60A 3PKQA 4CJBA 4Y63A 3V0NA 4E1KA 3CKJA 3IOJA 3SXBA 5HS2A 1VGWA 1ZCUA 2RJ0A 2A8UA 5EJZA 1R7XA 3V0QA 1H7GA 1QGQA 2VSIA 4FRPA 5FYEA 1YP3A 2RJ7A 4ASJA 4B4BA 3V8YA 4M2AA 2WEEA 4P00A 1H7EA 4NANA 4Y62A 2QKXA 5L6SA 1WT2A 1NWGB 5C4BA 2APCA 1ZI5A 3I0DA 2MZBA 5AJNA 1FWYA 5C3BA 3I0FA 4IRQA 1MP5A 1ZJPA 2X5SA 2UX8A 3ZGGA 1Z90A 2RJ1A 2RIZA 1FZWA 5IDTA 4M4KA 4HO6A 1OQMB 3Q80A 2FYCB 2V0JA 5CQMX 2Q4JA 2D0JA 2Y4KA 5C4CA 4EEMA 5CMFX 5CQPA 1S4PA 4HCQA 2WVKA 1IINA 4UEGA 3SXCA 3E26A 1WT3A 1V82A 4HOCA 4L41C 5C3AA 4KC4A 5FU0A 4FCEA 3OH4A 4Y6NA 2VFZA 4NALA 4B2XA 5AJOA 3Q4SA 4HO0A 3PKPA 1R7TA 2AGDA 2CU2A 3U2WA 3I0IX 1HJJA 5CQOA 1R82A 3U2UA 2OI6A 1R81A 4B2WA 1HJLA 1ZDFA 2GGOA 4HG6A 3Q7UA 3OKRA 2WE9A 2AECA 4EEAA 3TQDA 1H5RB 4DECA 4D0ZA 1YP2A 4YS8A 2ZU8A 3CKOA 2ICYA 1VH3A 3ST8A 3CKNA 2BO6A 1ZI1A 2AE7A 2O1HA 3D98A 4FROA 1FGXA 1WT1A 1H7TA 3DJ4A 2PGYA 2O1FA 3RMVA 2ZU7A 2P73A 2OEGA 4HO4A 4D11A 3SPTA 3IOHA 3U0YA 4FRQA 4B4GA 1G23A 3FWWA 2YC3A 3F1YA 4EEOA 2BO4A 1FXOA 4ASYA 4GBPA 2ZU9A 1MP4A 4KRVA 3OH2A 3V0LA 4JD0A 1LL2A 1H4EA 2RJ8A 2W0WA 1JV1A 1H7LA 1H5SD 1H4CA 1PZTA 2JCLA 1MP3A 2Y4MA 4Y7VA 4B42A 1GA8A 3BCVA 3SX5A 5C3DA 4K6RA 1GX4A 4G3SA 3CGXA 1NKHB 4KC2A 2WVLA 4LW3A 1NQIB 2NXVA 1H5SC 3GUEA 4JISA 1VH1A 2W0VA 2Z87A 3U2XA 4HO8A 3U2VA 2V0IA 2FYDB 2FY7A 4FCUA 1G1LA 4EE4A 1H3MA 1VZUA
chains in the Genus database with same CATH superfamily
1W57A 1ZJ3A 1JYLA 3DUVA 5CMHA 1VICA 4FRBA 2V0HA 2WGZA 3R2WA 5CQNX 2AM3A 5I1FA 2VS5A 4ECMA 5C38A 1VGTA 2RJ9A 4HO9A 1R80A 1WVCA 2AH9A 5FTVA 2I5EA 1V83A 2RIYA 2Y4JA 4Y7UA 3TZTA 3JUKA 4B3UA 1GQCA 1IIMA 2V0KA 1ZJ0A 1G0RA 4Y7TA 4HO5A 3F1CA 1G95A 3HL3A 3SX8A 1ZJOA 2PA4A 3USRA 3V8ZA 2PX7A 4KNRA 5DDVA 2AM5A 4FRLA 2YQJA 3OH0A 4Y64A 2BO8A 3FOQA 3OH1A 3I0CA 1FR8A 2J0BA 2FYBA 4FIXA 1ZI4A 1FGGA 5IDSA 1ON6A 3ZF8A 1VPAA 1W77A 2FFVA 1VZXA 3BRKX 4EE3A 4KXOA 1S4OA 5C47A 1K4VA 1LZJA 1VM8A 3V90A 1VZTA 5FV9A 4R7PA 2X5ZA 3RSBA 2JCKA 1LZ0A 1ZCYA 3U0XA 4AC3A 2JCJA 3RMWA 4EEGA 4DDZA 4FREA 1KWSA 3OC9A 1TZFA 4KQLA 1LL3A 1G3LA 4FRDA 4FQWA 1QWJA 3U2TA 2YESA 1ZJ1A 3K8EA 2I5KA 4Y9XA 4CJ8A 1MC3A 1INIA 1ON8A 1JVDA 2P6WA 2AESA 5D91A 3USQA 1GWWA 3NGWA 1TW1A 1PZYB 4O6NA 1G9RA 4J18A 1E5KA 1FRWA 3SX3A 3V0MA 3I0LA 3PNNA 4D0TA 4NAKA 3O3PA 4M28A 4HO2A 3K8DA 3V91A 2RJ5A 2Y7AA 1H7QA 3KIAA 1LL0A 3D8VA 2VS3A 5C36A 2WVMA 3SXGA 1HV9A 5C8RA 3T7OA 3T7NA 4G3QA 3CKQA 4D11C 1G8OA 1G2VA 1ZCTA 2XWNA 3ZLKA 5CMGX 1O7OA 2OI7A 5L6VA 2DPWA 1FO9A 5BXCA 5CMJA 1H5TB 1OMXA 2XMEA 3IOIA 2BO7A 3N9WA 2YCMA 4CJCA 1GWVA 2D7RA 4KPZA 5C1HA 1HM9A 4MYBA 1GX0A 1NMMB 1YP4A 3D5NA 3E25A 1LZIA 5IFYA 2RJ6A 1XHBA 1QGSA 2YQHA 4G3PA 4G87A 1INJA 1V84A 3I0HA 5C1GA 4KC1A 1YROB 1TVYA 5FTSA 1FR9A 4D48A 5C4FA 3V0PA 1QG8A 1S4NA 4Y7GA 3EE5A 2VXLA 1ZIZA 1O7QA 4AYJA 4EE5A 4XWIA 3SXEA 4B4MA 5C4EA 4ZDQA 3POLA 2XWLA 4IRPA 4B5BA 3V0OA 5C1LA 1ZI3A 5J49A 2O1GA 2WAWA 4NAIA 4HO3A 1H5TA 1ZCVA 1ZHJA 5CQLX 2QH5A 2VSHA 2VXMA 4C2SA 1ZJ2A 2RIXA 2ICXA 1WT0A 1WSZA 2Z86A 3R3IA 1OMZA 1H4DA 4AAWA 1G97A 2XWMA 3DK5A 4P02A 1R7UA 4ARWA 4BMAA 4LW6A 5DDTA 1O0RA 1HM0A 3SX7A 1HM8A 5JQQA 5CMIA 3CU0A 3ZGFA 1JVGA 4AYLA 2GGQA 2QGIA 1R7VA 2D7IA 4MNDA 2XMHA 2X65A 4KPXA 3OGZA 5EIYA 1JV3A 1VGUA 1VGZA 2VD4A 1LZ7A 4FRHA 5C4DA 3OH3A 1W55A 2JCOA 1FOAA 3CKVA 4FRMA 2YC5A 3ZLLA 1FO8A 1LVWA 2OI5A 2FFUA 5FUHA 1H7HA 4Y6UA 1TW5A 2E8BA 1EZIA 1H5SB 2RJ4A 1FXJA 3SXAA 5D92A 1G93A 3I0GA 5C48A 3JTJA 3I0EA 1GQ9A 1H7FA 1SS9A 5AJPA 5EJ1A 4M2BA 1XZ6A 2AM4A 2I7BA 2VS4A 1NF5B 1R7YA 3I0KA 5FU8A 2OEFA 4CVHA 2A8WA 3QVBA 2V0LA 4EVWA 2RITA 2FYAA 1NHEB 3LW6A 2YQCA 4KT7A 1I52A 1EYRA 2Y4LA 4FIYA 1FG5N 1JYKA 1H5SA 4Y7FA 2YQSA 3OAMA 1O23B 3I0JA 4FRAA 2Y6PA 4BQHA 3T7MA 1ZDGA 4Q7CA 1H5RA 2E3DA 2P72A 3SXDA 3JUJA 4DE7A 2PGVA 4KNXA 5C49A 2X60A 3PKQA 4CJBA 4Y63A 3V0NA 4E1KA 3CKJA 3IOJA 3SXBA 4O6MA 5HS2A 1VGWA 1ZCUA 2RJ0A 2A8UA 5EJZA 1R7XA 3V0QA 1H7GA 1QGQA 2VSIA 4FRPA 5FYEA 1YP3A 2RJ7A 4ASJA 4B4BA 3V8YA 4M2AA 2WEEA 4P00A 1H7EA 4NANA 4Y62A 2QKXA 5L6SA 1WT2A 1NWGB 5C4BA 2APCA 1ZI5A 3I0DA 2MZBA 5AJNA 1FWYA 5C3BA 3I0FA 4IRQA 1MP5A 1ZJPA 2X5SA 2UX8A 3ZGGA 1Z90A 2RJ1A 2RIZA 1FZWA 5IDTA 4M4KA 4HO6A 4MIXA 1OQMB 3Q80A 2FYCB 2V0JA 5CQMX 2Q4JA 2D0JA 2VK9A 2Y4KA 5C4CA 4EEMA 5CMFX 5CQPA 1S4PA 4HCQA 2WVKA 1IINA 4UEGA 3SXCA 3E26A 1WT3A 1V82A 4HOCA 4L41C 2C0NA 4KC4A 5C3AA 5FU0A 4FCEA 3OH4A 4Y6NA 2VFZA 4NALA 4B2XA 5AJOA 3Q4SA 4HO0A 3PKPA 1R7TA 2AGDA 2CU2A 3U2WA 3I0IX 1HJJA 5CQOA 1R82A 3U2UA 2OI6A 1R81A 4B2WA 1HJLA 1ZDFA 2GGOA 4HG6A 3Q7UA 3OKRA 2WE9A 2AECA 4EEAA 3TQDA 1H5RB 4DECA 4D0ZA 1YP2A 4YS8A 2ZU8A 3CKOA 2ICYA 1VH3A 3ST8A 3CKNA 2BO6A 1ZI1A 2AE7A 2O1HA 3D98A 4FROA 1FGXA 1WT1A 1H7TA 3DJ4A 2PGYA 2O1FA 3RMVA 2ZU7A 2P73A 2OEGA 4HO4A 4D11A 3SPTA 3IOHA 3U0YA 4FRQA 4B4GA 1G23A 3FWWA 2YC3A 3F1YA 4EEOA 2BO4A 1FXOA 4ASYA 4GBPA 2ZU9A 1MP4A 4KRVA 3OH2A 3V0LA 4JD0A 1LL2A 1H4EA 2RJ8A 2W0WA 1JV1A 1H7LA 1H5SD 1H4CA 1PZTA 2JCLA 1MP3A 2Y4MA 4Y7VA 4B42A 1GA8A 3BCVA 3SX5A 5C3DA 4K6RA 1GX4A 4G3SA 3CGXA 1NKHB 4KC2A 2J0AA 2WVLA 4LW3A 1NQIB 2NXVA 1H5SC 3GUEA 4JISA 1VH1A 2W0VA 2Z87A 3U2XA 4HO8A 3U2VA 2V0IA 2FYDB 2FY7A 4FCUA 1G1LA 4EE4A 1H3MA 1VZUA
chains in the Genus database with same CATH topology
1W57A 1ZJ3A 1JYLA 3DUVA 5CMHA 1VICA 4FRBA 2V0HA 2WGZA 3R2WA 5CQNX 2AM3A 5I1FA 2VS5A 4ECMA 5C38A 1VGTA 2RJ9A 4HO9A 1R80A 1WVCA 2AH9A 5FTVA 2I5EA 1V83A 2RIYA 2Y4JA 4Y7UA 3TZTA 3JUKA 4B3UA 1GQCA 1IIMA 2V0KA 1ZJ0A 1G0RA 4Y7TA 4HO5A 3F1CA 1G95A 3HL3A 3SX8A 1ZJOA 2PA4A 3USRA 3V8ZA 2PX7A 4KNRA 5DDVA 2AM5A 4FRLA 2YQJA 3OH0A 4Y64A 2BO8A 3FOQA 3OH1A 3I0CA 1FR8A 2J0BA 2FYBA 4FIXA 1ZI4A 1FGGA 5IDSA 1ON6A 3ZF8A 1VPAA 1W77A 2FFVA 1VZXA 3BRKX 4EE3A 4KXOA 1S4OA 5C47A 1K4VA 1LZJA 1VM8A 3V90A 1VZTA 5FV9A 4R7PA 2X5ZA 3RSBA 2JCKA 1LZ0A 1ZCYA 3U0XA 4AC3A 2JCJA 3RMWA 4EEGA 4DDZA 4FREA 1KWSA 3OC9A 1TZFA 4KQLA 1LL3A 1G3LA 4FRDA 4FQWA 1QWJA 3U2TA 2YESA 1ZJ1A 3K8EA 2I5KA 4Y9XA 4CJ8A 1MC3A 1INIA 1ON8A 1JVDA 2P6WA 2AESA 5D91A 3USQA 1GWWA 3NGWA 1TW1A 1PZYB 4O6NA 1G9RA 4J18A 1E5KA 1FRWA 3SX3A 3V0MA 3I0LA 3PNNA 4D0TA 4NAKA 3O3PA 4M28A 4HO2A 3K8DA 3V91A 2RJ5A 2Y7AA 1H7QA 3KIAA 1LL0A 3D8VA 2VS3A 5C36A 2WVMA 3SXGA 1HV9A 5C8RA 3T7OA 3T7NA 4G3QA 3CKQA 4D11C 1G8OA 1G2VA 1ZCTA 2XWNA 3ZLKA 5CMGX 1O7OA 2OI7A 5L6VA 2DPWA 1FO9A 5BXCA 5CMJA 1H5TB 1OMXA 2XMEA 3IOIA 2BO7A 3N9WA 2YCMA 4CJCA 1GWVA 2D7RA 4KPZA 5C1HA 1HM9A 4MYBA 1GX0A 1NMMB 1YP4A 3D5NA 3E25A 1LZIA 5IFYA 2RJ6A 1XHBA 1QGSA 2YQHA 4G3PA 4G87A 1INJA 1V84A 3I0HA 5C1GA 4KC1A 1YROB 1TVYA 5FTSA 1FR9A 4D48A 5C4FA 3V0PA 1QG8A 1S4NA 4Y7GA 3EE5A 2VXLA 1ZIZA 1O7QA 4AYJA 4EE5A 4XWIA 3SXEA 4B4MA 5C4EA 4ZDQA 3POLA 2XWLA 4IRPA 4B5BA 3V0OA 5C1LA 1ZI3A 5J49A 2O1GA 2WAWA 4NAIA 4HO3A 1H5TA 1ZCVA 1ZHJA 5CQLX 2QH5A 2VSHA 2VXMA 4C2SA 1ZJ2A 2RIXA 2ICXA 1WT0A 1WSZA 2Z86A 3R3IA 1OMZA 1H4DA 4AAWA 1G97A 2XWMA 3DK5A 4P02A 1R7UA 4ARWA 4BMAA 4LW6A 5DDTA 1O0RA 1HM0A 3SX7A 1HM8A 5JQQA 5CMIA 3CU0A 3ZGFA 1JVGA 4AYLA 2GGQA 2QGIA 1R7VA 2D7IA 4MNDA 2XMHA 2X65A 4KPXA 3OGZA 5EIYA 1JV3A 1VGUA 1VGZA 2VD4A 1LZ7A 4FRHA 5C4DA 3OH3A 1W55A 2JCOA 1FOAA 3CKVA 4FRMA 2YC5A 3ZLLA 1FO8A 1LVWA 2OI5A 2FFUA 5FUHA 1H7HA 4Y6UA 1TW5A 2E8BA 1EZIA 1H5SB 2RJ4A 1FXJA 3SXAA 5D92A 1G93A 3I0GA 5C48A 3JTJA 3I0EA 1GQ9A 1H7FA 1SS9A 5AJPA 5EJ1A 4M2BA 1XZ6A 2AM4A 2I7BA 2VS4A 1NF5B 1R7YA 3I0KA 5FU8A 2OEFA 4CVHA 2A8WA 3QVBA 2V0LA 4EVWA 2RITA 2FYAA 1NHEB 3LW6A 2YQCA 4KT7A 1I52A 1EYRA 2Y4LA 4FIYA 1FG5N 1JYKA 1H5SA 4Y7FA 2YQSA 3OAMA 1O23B 3I0JA 4FRAA 2Y6PA 4BQHA 3T7MA 1ZDGA 4Q7CA 1H5RA 2E3DA 2P72A 3SXDA 3JUJA 4DE7A 2PGVA 4KNXA 5C49A 2X60A 3PKQA 4CJBA 4Y63A 3V0NA 4E1KA 3CKJA 3IOJA 3SXBA 4O6MA 5HS2A 1VGWA 1ZCUA 2RJ0A 2A8UA 5EJZA 1R7XA 3V0QA 1H7GA 1QGQA 2VSIA 4FRPA 5FYEA 1YP3A 2RJ7A 4ASJA 4B4BA 3V8YA 4M2AA 2WEEA 4P00A 1H7EA 4NANA 4Y62A 2QKXA 5L6SA 1WT2A 1NWGB 5C4BA 2APCA 1ZI5A 3I0DA 2MZBA 5AJNA 1FWYA 5C3BA 3I0FA 4IRQA 1MP5A 1ZJPA 2X5SA 2UX8A 3ZGGA 1Z90A 2RJ1A 2RIZA 1FZWA 5IDTA 4M4KA 4HO6A 4MIXA 1OQMB 3Q80A 2FYCB 2V0JA 5CQMX 2Q4JA 2D0JA 2VK9A 2Y4KA 5C4CA 4EEMA 5CMFX 5CQPA 1S4PA 4HCQA 2WVKA 1IINA 4UEGA 3SXCA 3E26A 1WT3A 1V82A 4HOCA 4L41C 2C0NA 4KC4A 5C3AA 5FU0A 4FCEA 3OH4A 4Y6NA 2VFZA 4NALA 4B2XA 5AJOA 3Q4SA 4HO0A 3PKPA 1R7TA 2AGDA 2CU2A 3U2WA 3I0IX 1HJJA 5CQOA 1R82A 3U2UA 2OI6A 1R81A 4B2WA 1HJLA 1ZDFA 2GGOA 4HG6A 3Q7UA 3OKRA 2WE9A 2AECA 4EEAA 3TQDA 1H5RB 4DECA 4D0ZA 1YP2A 4YS8A 2ZU8A 3CKOA 2ICYA 1VH3A 3ST8A 3CKNA 2BO6A 1ZI1A 2AE7A 2O1HA 3D98A 4FROA 1FGXA 1WT1A 1H7TA 3DJ4A 2PGYA 2O1FA 3RMVA 2ZU7A 2P73A 2OEGA 4HO4A 4D11A 3SPTA 3IOHA 3U0YA 4FRQA 4B4GA 1G23A 3FWWA 2YC3A 3F1YA 4EEOA 2BO4A 1FXOA 4ASYA 4GBPA 2ZU9A 1MP4A 4KRVA 3OH2A 3V0LA 4JD0A 1LL2A 1H4EA 2RJ8A 2W0WA 1JV1A 1H7LA 1H5SD 1H4CA 1PZTA 2JCLA 1MP3A 2Y4MA 4Y7VA 4B42A 1GA8A 3BCVA 3SX5A 5C3DA 4K6RA 1GX4A 4G3SA 3CGXA 1NKHB 4KC2A 2J0AA 2WVLA 4LW3A 1NQIB 2NXVA 1H5SC 3GUEA 4JISA 1VH1A 2W0VA 2Z87A 3U2XA 4HO8A 3U2VA 2V0IA 2FYDB 2FY7A 4FCUA 1G1LA 4EE4A 1H3MA 1VZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W57 A;  1ZJ3 A;  1JYL A;  3DUV A;  5CMH A;  1VIC A;  4FRB A;  2V0H A;  2WGZ A;  3R2W A;  5CQN X;  2AM3 A;  5I1F A;  2VS5 A;  4ECM A;  5C38 A;  1VGT A;  2RJ9 A;  4HO9 A;  1R80 A;  1WVC A;  2AH9 A;  5FTV A;  2I5E A;  1V83 A;  2RIY A;  2Y4J A;  4Y7U A;  3TZT A;  3JUK A;  4B3U A;  1GQC A;  1IIM A;  2V0K A;  1ZJ0 A;  1G0R A;  4Y7T A;  4HO5 A;  3F1C A;  1G95 A;  3HL3 A;  3SX8 A;  1ZJO A;  2PA4 A;  3USR A;  3V8Z A;  2PX7 A;  4KNR A;  5DDV A;  2AM5 A;  4FRL A;  2YQJ A;  3OH0 A;  4Y64 A;  2BO8 A;  3FOQ A;  3OH1 A;  3I0C A;  1FR8 A;  2FYB A;  1ZI4 A;  1FGG A;  5IDS A;  1ON6 A;  3ZF8 A;  1VPA A;  1W77 A;  2FFV A;  1VZX A;  3BRK X;  4EE3 A;  4KXO A;  1S4O A;  5C47 A;  1K4V A;  1LZJ A;  1VM8 A;  3V90 A;  1VZT A;  5FV9 A;  4R7P A;  2X5Z A;  3RSB A;  2JCK A;  1LZ0 A;  1ZCY A;  3U0X A;  4AC3 A;  2JCJ A;  3RMW A;  4EEG A;  4DDZ A;  4FRE A;  1KWS A;  3OC9 A;  1TZF A;  4KQL A;  1LL3 A;  1G3L A;  4FRD A;  4FQW A;  1QWJ A;  3U2T A;  2YES A;  1ZJ1 A;  3K8E A;  2I5K A;  4Y9X A;  4CJ8 A;  1MC3 A;  1INI A;  1ON8 A;  1JVD A;  2P6W A;  2AES A;  3USQ A;  1GWW A;  3NGW A;  1TW1 A;  1PZY B;  1G9R A;  4J18 A;  1E5K A;  1FRW A;  3SX3 A;  3V0M A;  3I0L A;  3PNN A;  4D0T A;  4NAK A;  3O3P A;  4M28 A;  4HO2 A;  3K8D A;  3V91 A;  2RJ5 A;  2Y7A A;  1H7Q A;  3KIA A;  1LL0 A;  3D8V A;  2VS3 A;  5C36 A;  2WVM A;  3SXG A;  1HV9 A;  5C8R A;  3T7O A;  3T7N A;  4G3Q A;  3CKQ A;  4D11 C;  1G8O A;  1G2V A;  1ZCT A;  2XWN A;  3ZLK A;  5CMG X;  1O7O A;  2OI7 A;  5L6V A;  2DPW A;  1FO9 A;  5BXC A;  5CMJ A;  1H5T B;  1OMX A;  2XME A;  3IOI A;  2BO7 A;  3N9W A;  2YCM A;  4CJC A;  1GWV A;  2D7R A;  4KPZ A;  5C1H A;  1HM9 A;  4MYB A;  1GX0 A;  1NMM B;  1YP4 A;  3D5N A;  3E25 A;  1LZI A;  5IFY A;  2RJ6 A;  1XHB A;  1QGS A;  2YQH A;  4G3P A;  4G87 A;  1INJ A;  1V84 A;  3I0H A;  5C1G A;  4KC1 A;  1YRO B;  1TVY A;  5FTS A;  1FR9 A;  4D48 A;  5C4F A;  3V0P A;  1QG8 A;  1S4N A;  4Y7G A;  3EE5 A;  2VXL A;  1ZIZ A;  1O7Q A;  4AYJ A;  4EE5 A;  4XWI A;  3SXE A;  4B4M A;  5C4E A;  4ZDQ A;  3POL A;  2XWL A;  4IRP A;  4B5B A;  3V0O A;  5C1L A;  1ZI3 A;  5J49 A;  2O1G A;  2WAW A;  4NAI A;  4HO3 A;  1H5T A;  1ZCV A;  1ZHJ A;  5CQL X;  2QH5 A;  2VSH A;  2VXM A;  4C2S A;  1ZJ2 A;  2RIX A;  2ICX A;  1WT0 A;  1WSZ A;  2Z86 A;  3R3I A;  1OMZ A;  1H4D A;  4AAW A;  1G97 A;  2XWM A;  3DK5 A;  4P02 A;  1R7U A;  4ARW A;  4BMA A;  4LW6 A;  5DDT A;  1O0R A;  1HM0 A;  3SX7 A;  1HM8 A;  5JQQ A;  5CMI A;  3CU0 A;  3ZGF A;  1JVG A;  4AYL A;  2GGQ A;  2QGI A;  1R7V A;  2D7I A;  4MND A;  2XMH A;  2X65 A;  4KPX A;  3OGZ A;  5EIY A;  1JV3 A;  1VGU A;  1VGZ A;  2VD4 A;  1LZ7 A;  4FRH A;  5C4D A;  3OH3 A;  1W55 A;  2JCO A;  1FOA A;  3CKV A;  4FRM A;  2YC5 A;  3ZLL A;  1FO8 A;  1LVW A;  2OI5 A;  2FFU A;  5FUH A;  1H7H A;  4Y6U A;  1TW5 A;  2E8B A;  1EZI A;  1H5S B;  2RJ4 A;  1FXJ A;  3SXA A;  1G93 A;  3I0G A;  5C48 A;  3JTJ A;  3I0E A;  1GQ9 A;  1H7F A;  1SS9 A;  5AJP A;  5EJ1 A;  4M2B A;  1XZ6 A;  2AM4 A;  2I7B A;  2VS4 A;  1NF5 B;  1R7Y A;  3I0K A;  5FU8 A;  2OEF A;  4CVH A;  2A8W A;  3QVB A;  2V0L A;  4EVW A;  2RIT A;  2FYA A;  1NHE B;  3LW6 A;  2YQC A;  4KT7 A;  1I52 A;  1EYR A;  2Y4L A;  1FG5 N;  1JYK A;  1H5S A;  4Y7F A;  2YQS A;  3OAM A;  1O23 B;  3I0J A;  4FRA A;  2Y6P A;  4BQH A;  3T7M A;  1ZDG A;  1H5R A;  2E3D A;  2P72 A;  3SXD A;  3JUJ A;  4DE7 A;  2PGV A;  4KNX A;  5C49 A;  2X60 A;  3PKQ A;  4CJB A;  4Y63 A;  3V0N A;  4E1K A;  3CKJ A;  3IOJ A;  3SXB A;  5HS2 A;  1VGW A;  1ZCU A;  2RJ0 A;  2A8U A;  5EJZ A;  1R7X A;  3V0Q A;  1H7G A;  1QGQ A;  2VSI A;  4FRP A;  5FYE A;  1YP3 A;  2RJ7 A;  4ASJ A;  4B4B A;  3V8Y A;  4M2A A;  2WEE A;  4P00 A;  1H7E A;  4NAN A;  4Y62 A;  2QKX A;  5L6S A;  1WT2 A;  1NWG B;  5C4B A;  2APC A;  1ZI5 A;  3I0D A;  2MZB A;  5AJN A;  1FWY A;  5C3B A;  3I0F A;  4IRQ A;  1MP5 A;  1ZJP A;  2X5S A;  2UX8 A;  3ZGG A;  1Z90 A;  2RJ1 A;  2RIZ A;  1FZW A;  5IDT A;  4M4K A;  4HO6 A;  1OQM B;  3Q80 A;  2FYC B;  2V0J A;  5CQM X;  2Q4J A;  2D0J A;  2Y4K A;  5C4C A;  4EEM A;  5CMF X;  5CQP A;  1S4P A;  4HCQ A;  2WVK A;  1IIN A;  4UEG A;  3SXC A;  3E26 A;  1WT3 A;  1V82 A;  4HOC A;  4L41 C;  5C3A A;  4KC4 A;  5FU0 A;  4FCE A;  3OH4 A;  4Y6N A;  2VFZ A;  4NAL A;  4B2X A;  5AJO A;  3Q4S A;  4HO0 A;  3PKP A;  1R7T A;  2AGD A;  2CU2 A;  3U2W A;  3I0I X;  1HJJ A;  5CQO A;  1R82 A;  3U2U A;  2OI6 A;  1R81 A;  4B2W A;  1HJL A;  1ZDF A;  2GGO A;  4HG6 A;  3Q7U A;  3OKR A;  2WE9 A;  2AEC A;  4EEA A;  3TQD A;  1H5R B;  4DEC A;  4D0Z A;  1YP2 A;  4YS8 A;  2ZU8 A;  3CKO A;  2ICY A;  1VH3 A;  3ST8 A;  3CKN A;  2BO6 A;  1ZI1 A;  2AE7 A;  2O1H A;  3D98 A;  4FRO A;  1FGX A;  1WT1 A;  1H7T A;  3DJ4 A;  2PGY A;  2O1F A;  3RMV A;  2ZU7 A;  2P73 A;  2OEG A;  4HO4 A;  4D11 A;  3SPT A;  3IOH A;  3U0Y A;  4FRQ A;  4B4G A;  1G23 A;  3FWW A;  2YC3 A;  3F1Y A;  4EEO A;  2BO4 A;  1FXO A;  4ASY A;  4GBP A;  2ZU9 A;  1MP4 A;  4KRV A;  3OH2 A;  3V0L A;  4JD0 A;  1LL2 A;  1H4E A;  2RJ8 A;  2W0W A;  1JV1 A;  1H7L A;  1H5S D;  1H4C A;  1PZT A;  2JCL A;  1MP3 A;  2Y4M A;  4Y7V A;  4B42 A;  1GA8 A;  3BCV A;  3SX5 A;  5C3D A;  4K6R A;  1GX4 A;  4G3S A;  3CGX A;  1NKH B;  4KC2 A;  2WVL A;  4LW3 A;  1NQI B;  2NXV A;  1H5S C;  3GUE A;  4JIS A;  1VH1 A;  2W0V A;  2Z87 A;  3U2X A;  4HO8 A;  3U2V A;  2V0I A;  2FYD B;  2FY7 A;  4FCU A;  1G1L A;  4EE4 A;  1H3M A;  1VZU A; 
#chains in the Genus database with same CATH topology
 1W57 A;  1ZJ3 A;  1JYL A;  3DUV A;  5CMH A;  1VIC A;  4FRB A;  2V0H A;  2WGZ A;  3R2W A;  5CQN X;  2AM3 A;  5I1F A;  2VS5 A;  4ECM A;  5C38 A;  1VGT A;  2RJ9 A;  4HO9 A;  1R80 A;  1WVC A;  2AH9 A;  5FTV A;  2I5E A;  1V83 A;  2RIY A;  2Y4J A;  4Y7U A;  3TZT A;  3JUK A;  4B3U A;  1GQC A;  1IIM A;  2V0K A;  1ZJ0 A;  1G0R A;  4Y7T A;  4HO5 A;  3F1C A;  1G95 A;  3HL3 A;  3SX8 A;  1ZJO A;  2PA4 A;  3USR A;  3V8Z A;  2PX7 A;  4KNR A;  5DDV A;  2AM5 A;  4FRL A;  2YQJ A;  3OH0 A;  4Y64 A;  2BO8 A;  3FOQ A;  3OH1 A;  3I0C A;  1FR8 A;  2J0B A;  2FYB A;  4FIX A;  1ZI4 A;  1FGG A;  5IDS A;  1ON6 A;  3ZF8 A;  1VPA A;  1W77 A;  2FFV A;  1VZX A;  3BRK X;  4EE3 A;  4KXO A;  1S4O A;  5C47 A;  1K4V A;  1LZJ A;  1VM8 A;  3V90 A;  1VZT A;  5FV9 A;  4R7P A;  2X5Z A;  3RSB A;  2JCK A;  1LZ0 A;  1ZCY A;  3U0X A;  4AC3 A;  2JCJ A;  3RMW A;  4EEG A;  4DDZ A;  4FRE A;  1KWS A;  3OC9 A;  1TZF A;  4KQL A;  1LL3 A;  1G3L A;  4FRD A;  4FQW A;  1QWJ A;  3U2T A;  2YES A;  1ZJ1 A;  3K8E A;  2I5K A;  4Y9X A;  4CJ8 A;  1MC3 A;  1INI A;  1ON8 A;  1JVD A;  2P6W A;  2AES A;  5D91 A;  3USQ A;  1GWW A;  3NGW A;  1TW1 A;  1PZY B;  4O6N A;  1G9R A;  4J18 A;  1E5K A;  1FRW A;  3SX3 A;  3V0M A;  3I0L A;  3PNN A;  4D0T A;  4NAK A;  3O3P A;  4M28 A;  4HO2 A;  3K8D A;  3V91 A;  2RJ5 A;  2Y7A A;  1H7Q A;  3KIA A;  1LL0 A;  3D8V A;  2VS3 A;  5C36 A;  2WVM A;  3SXG A;  1HV9 A;  5C8R A;  3T7O A;  3T7N A;  4G3Q A;  3CKQ A;  4D11 C;  1G8O A;  1G2V A;  1ZCT A;  2XWN A;  3ZLK A;  5CMG X;  1O7O A;  2OI7 A;  5L6V A;  2DPW A;  1FO9 A;  5BXC A;  5CMJ A;  1H5T B;  1OMX A;  2XME A;  3IOI A;  2BO7 A;  3N9W A;  2YCM A;  4CJC A;  1GWV A;  2D7R A;  4KPZ A;  5C1H A;  1HM9 A;  4MYB A;  1GX0 A;  1NMM B;  1YP4 A;  3D5N A;  3E25 A;  1LZI A;  5IFY A;  2RJ6 A;  1XHB A;  1QGS A;  2YQH A;  4G3P A;  4G87 A;  1INJ A;  1V84 A;  3I0H A;  5C1G A;  4KC1 A;  1YRO B;  1TVY A;  5FTS A;  1FR9 A;  4D48 A;  5C4F A;  3V0P A;  1QG8 A;  1S4N A;  4Y7G A;  3EE5 A;  2VXL A;  1ZIZ A;  1O7Q A;  4AYJ A;  4EE5 A;  4XWI A;  3SXE A;  4B4M A;  5C4E A;  4ZDQ A;  3POL A;  2XWL A;  4IRP A;  4B5B A;  3V0O A;  5C1L A;  1ZI3 A;  5J49 A;  2O1G A;  2WAW A;  4NAI A;  4HO3 A;  1H5T A;  1ZCV A;  1ZHJ A;  5CQL X;  2QH5 A;  2VSH A;  2VXM A;  4C2S A;  1ZJ2 A;  2RIX A;  2ICX A;  1WT0 A;  1WSZ A;  2Z86 A;  3R3I A;  1OMZ A;  1H4D A;  4AAW A;  1G97 A;  2XWM A;  3DK5 A;  4P02 A;  1R7U A;  4ARW A;  4BMA A;  4LW6 A;  5DDT A;  1O0R A;  1HM0 A;  3SX7 A;  1HM8 A;  5JQQ A;  5CMI A;  3CU0 A;  3ZGF A;  1JVG A;  4AYL A;  2GGQ A;  2QGI A;  1R7V A;  2D7I A;  4MND A;  2XMH A;  2X65 A;  4KPX A;  3OGZ A;  5EIY A;  1JV3 A;  1VGU A;  1VGZ A;  2VD4 A;  1LZ7 A;  4FRH A;  5C4D A;  3OH3 A;  1W55 A;  2JCO A;  1FOA A;  3CKV A;  4FRM A;  2YC5 A;  3ZLL A;  1FO8 A;  1LVW A;  2OI5 A;  2FFU A;  5FUH A;  1H7H A;  4Y6U A;  1TW5 A;  2E8B A;  1EZI A;  1H5S B;  2RJ4 A;  1FXJ A;  3SXA A;  5D92 A;  1G93 A;  3I0G A;  5C48 A;  3JTJ A;  3I0E A;  1GQ9 A;  1H7F A;  1SS9 A;  5AJP A;  5EJ1 A;  4M2B A;  1XZ6 A;  2AM4 A;  2I7B A;  2VS4 A;  1NF5 B;  1R7Y A;  3I0K A;  5FU8 A;  2OEF A;  4CVH A;  2A8W A;  3QVB A;  2V0L A;  4EVW A;  2RIT A;  2FYA A;  1NHE B;  3LW6 A;  2YQC A;  4KT7 A;  1I52 A;  1EYR A;  2Y4L A;  4FIY A;  1FG5 N;  1JYK A;  1H5S A;  4Y7F A;  2YQS A;  3OAM A;  1O23 B;  3I0J A;  4FRA A;  2Y6P A;  4BQH A;  3T7M A;  1ZDG A;  4Q7C A;  1H5R A;  2E3D A;  2P72 A;  3SXD A;  3JUJ A;  4DE7 A;  2PGV A;  4KNX A;  5C49 A;  2X60 A;  3PKQ A;  4CJB A;  4Y63 A;  3V0N A;  4E1K A;  3CKJ A;  3IOJ A;  3SXB A;  4O6M A;  5HS2 A;  1VGW A;  1ZCU A;  2RJ0 A;  2A8U A;  5EJZ A;  1R7X A;  3V0Q A;  1H7G A;  1QGQ A;  2VSI A;  4FRP A;  5FYE A;  1YP3 A;  2RJ7 A;  4ASJ A;  4B4B A;  3V8Y A;  4M2A A;  2WEE A;  4P00 A;  1H7E A;  4NAN A;  4Y62 A;  2QKX A;  5L6S A;  1WT2 A;  1NWG B;  5C4B A;  2APC A;  1ZI5 A;  3I0D A;  2MZB A;  5AJN A;  1FWY A;  5C3B A;  3I0F A;  4IRQ A;  1MP5 A;  1ZJP A;  2X5S A;  2UX8 A;  3ZGG A;  1Z90 A;  2RJ1 A;  2RIZ A;  1FZW A;  5IDT A;  4M4K A;  4HO6 A;  4MIX A;  1OQM B;  3Q80 A;  2FYC B;  2V0J A;  5CQM X;  2Q4J A;  2D0J A;  2VK9 A;  2Y4K A;  5C4C A;  4EEM A;  5CMF X;  5CQP A;  1S4P A;  4HCQ A;  2WVK A;  1IIN A;  4UEG A;  3SXC A;  3E26 A;  1WT3 A;  1V82 A;  4HOC A;  4L41 C;  2C0N A;  4KC4 A;  5C3A A;  5FU0 A;  4FCE A;  3OH4 A;  4Y6N A;  2VFZ A;  4NAL A;  4B2X A;  5AJO A;  3Q4S A;  4HO0 A;  3PKP A;  1R7T A;  2AGD A;  2CU2 A;  3U2W A;  3I0I X;  1HJJ A;  5CQO A;  1R82 A;  3U2U A;  2OI6 A;  1R81 A;  4B2W A;  1HJL A;  1ZDF A;  2GGO A;  4HG6 A;  3Q7U A;  3OKR A;  2WE9 A;  2AEC A;  4EEA A;  3TQD A;  1H5R B;  4DEC A;  4D0Z A;  1YP2 A;  4YS8 A;  2ZU8 A;  3CKO A;  2ICY A;  1VH3 A;  3ST8 A;  3CKN A;  2BO6 A;  1ZI1 A;  2AE7 A;  2O1H A;  3D98 A;  4FRO A;  1FGX A;  1WT1 A;  1H7T A;  3DJ4 A;  2PGY A;  2O1F A;  3RMV A;  2ZU7 A;  2P73 A;  2OEG A;  4HO4 A;  4D11 A;  3SPT A;  3IOH A;  3U0Y A;  4FRQ A;  4B4G A;  1G23 A;  3FWW A;  2YC3 A;  3F1Y A;  4EEO A;  2BO4 A;  1FXO A;  4ASY A;  4GBP A;  2ZU9 A;  1MP4 A;  4KRV A;  3OH2 A;  3V0L A;  4JD0 A;  1LL2 A;  1H4E A;  2RJ8 A;  2W0W A;  1JV1 A;  1H7L A;  1H5S D;  1H4C A;  1PZT A;  2JCL A;  1MP3 A;  2Y4M A;  4Y7V A;  4B42 A;  1GA8 A;  3BCV A;  3SX5 A;  5C3D A;  4K6R A;  1GX4 A;  4G3S A;  3CGX A;  1NKH B;  4KC2 A;  2J0A A;  2WVL A;  4LW3 A;  1NQI B;  2NXV A;  1H5S C;  3GUE A;  4JIS A;  1VH1 A;  2W0V A;  2Z87 A;  3U2X A;  4HO8 A;  3U2V A;  2V0I A;  2FYD B;  2FY7 A;  4FCU A;  1G1L A;  4EE4 A;  1H3M A;  1VZU A; 
#chains in the Genus database with same CATH homology
 1W57 A;  1ZJ3 A;  1JYL A;  3DUV A;  5CMH A;  1VIC A;  4FRB A;  2V0H A;  2WGZ A;  3R2W A;  5CQN X;  2AM3 A;  5I1F A;  2VS5 A;  4ECM A;  5C38 A;  1VGT A;  2RJ9 A;  4HO9 A;  1R80 A;  1WVC A;  2AH9 A;  5FTV A;  2I5E A;  1V83 A;  2RIY A;  2Y4J A;  4Y7U A;  3TZT A;  3JUK A;  4B3U A;  1GQC A;  1IIM A;  2V0K A;  1ZJ0 A;  1G0R A;  4Y7T A;  4HO5 A;  3F1C A;  1G95 A;  3HL3 A;  3SX8 A;  1ZJO A;  2PA4 A;  3USR A;  3V8Z A;  2PX7 A;  4KNR A;  5DDV A;  2AM5 A;  4FRL A;  2YQJ A;  3OH0 A;  4Y64 A;  2BO8 A;  3FOQ A;  3OH1 A;  3I0C A;  1FR8 A;  2J0B A;  2FYB A;  4FIX A;  1ZI4 A;  1FGG A;  5IDS A;  1ON6 A;  3ZF8 A;  1VPA A;  1W77 A;  2FFV A;  1VZX A;  3BRK X;  4EE3 A;  4KXO A;  1S4O A;  5C47 A;  1K4V A;  1LZJ A;  1VM8 A;  3V90 A;  1VZT A;  5FV9 A;  4R7P A;  2X5Z A;  3RSB A;  2JCK A;  1LZ0 A;  1ZCY A;  3U0X A;  4AC3 A;  2JCJ A;  3RMW A;  4EEG A;  4DDZ A;  4FRE A;  1KWS A;  3OC9 A;  1TZF A;  4KQL A;  1LL3 A;  1G3L A;  4FRD A;  4FQW A;  1QWJ A;  3U2T A;  2YES A;  1ZJ1 A;  3K8E A;  2I5K A;  4Y9X A;  4CJ8 A;  1MC3 A;  1INI A;  1ON8 A;  1JVD A;  2P6W A;  2AES A;  5D91 A;  3USQ A;  1GWW A;  3NGW A;  1TW1 A;  1PZY B;  4O6N A;  1G9R A;  4J18 A;  1E5K A;  1FRW A;  3SX3 A;  3V0M A;  3I0L A;  3PNN A;  4D0T A;  4NAK A;  3O3P A;  4M28 A;  4HO2 A;  3K8D A;  3V91 A;  2RJ5 A;  2Y7A A;  1H7Q A;  3KIA A;  1LL0 A;  3D8V A;  2VS3 A;  5C36 A;  2WVM A;  3SXG A;  1HV9 A;  5C8R A;  3T7O A;  3T7N A;  4G3Q A;  3CKQ A;  4D11 C;  1G8O A;  1G2V A;  1ZCT A;  2XWN A;  3ZLK A;  5CMG X;  1O7O A;  2OI7 A;  5L6V A;  2DPW A;  1FO9 A;  5BXC A;  5CMJ A;  1H5T B;  1OMX A;  2XME A;  3IOI A;  2BO7 A;  3N9W A;  2YCM A;  4CJC A;  1GWV A;  2D7R A;  4KPZ A;  5C1H A;  1HM9 A;  4MYB A;  1GX0 A;  1NMM B;  1YP4 A;  3D5N A;  3E25 A;  1LZI A;  5IFY A;  2RJ6 A;  1XHB A;  1QGS A;  2YQH A;  4G3P A;  4G87 A;  1INJ A;  1V84 A;  3I0H A;  5C1G A;  4KC1 A;  1YRO B;  1TVY A;  5FTS A;  1FR9 A;  4D48 A;  5C4F A;  3V0P A;  1QG8 A;  1S4N A;  4Y7G A;  3EE5 A;  2VXL A;  1ZIZ A;  1O7Q A;  4AYJ A;  4EE5 A;  4XWI A;  3SXE A;  4B4M A;  5C4E A;  4ZDQ A;  3POL A;  2XWL A;  4IRP A;  4B5B A;  3V0O A;  5C1L A;  1ZI3 A;  5J49 A;  2O1G A;  2WAW A;  4NAI A;  4HO3 A;  1H5T A;  1ZCV A;  1ZHJ A;  5CQL X;  2QH5 A;  2VSH A;  2VXM A;  4C2S A;  1ZJ2 A;  2RIX A;  2ICX A;  1WT0 A;  1WSZ A;  2Z86 A;  3R3I A;  1OMZ A;  1H4D A;  4AAW A;  1G97 A;  2XWM A;  3DK5 A;  4P02 A;  1R7U A;  4ARW A;  4BMA A;  4LW6 A;  5DDT A;  1O0R A;  1HM0 A;  3SX7 A;  1HM8 A;  5JQQ A;  5CMI A;  3CU0 A;  3ZGF A;  1JVG A;  4AYL A;  2GGQ A;  2QGI A;  1R7V A;  2D7I A;  4MND A;  2XMH A;  2X65 A;  4KPX A;  3OGZ A;  5EIY A;  1JV3 A;  1VGU A;  1VGZ A;  2VD4 A;  1LZ7 A;  4FRH A;  5C4D A;  3OH3 A;  1W55 A;  2JCO A;  1FOA A;  3CKV A;  4FRM A;  2YC5 A;  3ZLL A;  1FO8 A;  1LVW A;  2OI5 A;  2FFU A;  5FUH A;  1H7H A;  4Y6U A;  1TW5 A;  2E8B A;  1EZI A;  1H5S B;  2RJ4 A;  1FXJ A;  3SXA A;  5D92 A;  1G93 A;  3I0G A;  5C48 A;  3JTJ A;  3I0E A;  1GQ9 A;  1H7F A;  1SS9 A;  5AJP A;  5EJ1 A;  4M2B A;  1XZ6 A;  2AM4 A;  2I7B A;  2VS4 A;  1NF5 B;  1R7Y A;  3I0K A;  5FU8 A;  2OEF A;  4CVH A;  2A8W A;  3QVB A;  2V0L A;  4EVW A;  2RIT A;  2FYA A;  1NHE B;  3LW6 A;  2YQC A;  4KT7 A;  1I52 A;  1EYR A;  2Y4L A;  4FIY A;  1FG5 N;  1JYK A;  1H5S A;  4Y7F A;  2YQS A;  3OAM A;  1O23 B;  3I0J A;  4FRA A;  2Y6P A;  4BQH A;  3T7M A;  1ZDG A;  4Q7C A;  1H5R A;  2E3D A;  2P72 A;  3SXD A;  3JUJ A;  4DE7 A;  2PGV A;  4KNX A;  5C49 A;  2X60 A;  3PKQ A;  4CJB A;  4Y63 A;  3V0N A;  4E1K A;  3CKJ A;  3IOJ A;  3SXB A;  4O6M A;  5HS2 A;  1VGW A;  1ZCU A;  2RJ0 A;  2A8U A;  5EJZ A;  1R7X A;  3V0Q A;  1H7G A;  1QGQ A;  2VSI A;  4FRP A;  5FYE A;  1YP3 A;  2RJ7 A;  4ASJ A;  4B4B A;  3V8Y A;  4M2A A;  2WEE A;  4P00 A;  1H7E A;  4NAN A;  4Y62 A;  2QKX A;  5L6S A;  1WT2 A;  1NWG B;  5C4B A;  2APC A;  1ZI5 A;  3I0D A;  2MZB A;  5AJN A;  1FWY A;  5C3B A;  3I0F A;  4IRQ A;  1MP5 A;  1ZJP A;  2X5S A;  2UX8 A;  3ZGG A;  1Z90 A;  2RJ1 A;  2RIZ A;  1FZW A;  5IDT A;  4M4K A;  4HO6 A;  4MIX A;  1OQM B;  3Q80 A;  2FYC B;  2V0J A;  5CQM X;  2Q4J A;  2D0J A;  2VK9 A;  2Y4K A;  5C4C A;  4EEM A;  5CMF X;  5CQP A;  1S4P A;  4HCQ A;  2WVK A;  1IIN A;  4UEG A;  3SXC A;  3E26 A;  1WT3 A;  1V82 A;  4HOC A;  4L41 C;  2C0N A;  4KC4 A;  5C3A A;  5FU0 A;  4FCE A;  3OH4 A;  4Y6N A;  2VFZ A;  4NAL A;  4B2X A;  5AJO A;  3Q4S A;  4HO0 A;  3PKP A;  1R7T A;  2AGD A;  2CU2 A;  3U2W A;  3I0I X;  1HJJ A;  5CQO A;  1R82 A;  3U2U A;  2OI6 A;  1R81 A;  4B2W A;  1HJL A;  1ZDF A;  2GGO A;  4HG6 A;  3Q7U A;  3OKR A;  2WE9 A;  2AEC A;  4EEA A;  3TQD A;  1H5R B;  4DEC A;  4D0Z A;  1YP2 A;  4YS8 A;  2ZU8 A;  3CKO A;  2ICY A;  1VH3 A;  3ST8 A;  3CKN A;  2BO6 A;  1ZI1 A;  2AE7 A;  2O1H A;  3D98 A;  4FRO A;  1FGX A;  1WT1 A;  1H7T A;  3DJ4 A;  2PGY A;  2O1F A;  3RMV A;  2ZU7 A;  2P73 A;  2OEG A;  4HO4 A;  4D11 A;  3SPT A;  3IOH A;  3U0Y A;  4FRQ A;  4B4G A;  1G23 A;  3FWW A;  2YC3 A;  3F1Y A;  4EEO A;  2BO4 A;  1FXO A;  4ASY A;  4GBP A;  2ZU9 A;  1MP4 A;  4KRV A;  3OH2 A;  3V0L A;  4JD0 A;  1LL2 A;  1H4E A;  2RJ8 A;  2W0W A;  1JV1 A;  1H7L A;  1H5S D;  1H4C A;  1PZT A;  2JCL A;  1MP3 A;  2Y4M A;  4Y7V A;  4B42 A;  1GA8 A;  3BCV A;  3SX5 A;  5C3D A;  4K6R A;  1GX4 A;  4G3S A;  3CGX A;  1NKH B;  4KC2 A;  2J0A A;  2WVL A;  4LW3 A;  1NQI B;  2NXV A;  1H5S C;  3GUE A;  4JIS A;  1VH1 A;  2W0V A;  2Z87 A;  3U2X A;  4HO8 A;  3U2V A;  2V0I A;  2FYD B;  2FY7 A;  4FCU A;  1G1L A;  4EE4 A;  1H3M A;  1VZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...