3PNUA

2.4 angstrom crystal structure of dihydroorotase (pyrc) from campylobacter jejuni.
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
344
structure length
337
Chain Sequence
ENLYFQSNAMKLKNPLDMHLHLRDNQMLELIAPLSARDFCAAVIMPNLIPPLCNLEDLKAYKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGILYPAGITTNSNGGVSSFDIEYLKPTLEAMSDLNIPLLVHGETNDFVMDRESNFAKIYEKLAKHFPRLKIVMEHITTKTLCELLKDYENLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALCELAFSGYEKVMFGSDSAPHPKGCAAGVFSAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKFKEDKILTLEEKEWQVPNVYEDKYNQVVPYMAGEILKFQLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.4 Angstrom Crystal Structure of Dihydroorotase (pyrC) from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
molecule keywords Dihydroorotase
total genus 103
structure length 337
sequence length 344
chains with identical sequence B
ec nomenclature ec 3.5.2.3: Dihydroorotase.
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3pnuA00
2YB1A 4IG2A 3MTWA 3SFWA 1RK6A 2EG6A 1O5RA 1IE7C 3EGJA 4CQDA 4DI8A 2GSEA 2F6KA 4WGXA 4GBDA 1YMYA 1YBQB 2FTYA 4M51A 2Z29A 4KERA 4WVXA 3GIPA 4HJWA 4ICMA 3F2BA 3WZ0E 2UBPC 3V7PA 3DC8A 2OOFA 4XD4A 2GZXA 2BB0A 4KESA 3E2VA 3QY8A 4H9XA 3S4TA 4B92A 3URAA 1FWCC 2WJDA 3DCPA 3ICJA 4KEUA 4RDZA 3UPMA 3IV8A 4G2DA 3PAOA 1FWJC 2FTWA 4PCNA 2D2HA 4GXWA 1FWDC 3IRSA 4B3ZA 4V1YA 4H9YA 2Z2BA 3PANA 4G7EA 3E0FA 1K1DA 4RDWA 3K5XA 2EG8A 4PBFA 1ADDA 3UBPC 2Z27A 3S2LA 2AQVA 4XAYA 1EJRC 1PSCA 3IARA 3BE7A 4Z42C 3R0DA 4R7WA 4C60A 1NDZA 3LGDA 4KETA 4V1XA 4CQCA 3AUOA 2QPXA 4HK5A 2VUNA 3RCMA 4XAFA 4OFCA 2OQLA 1I0DA 1P6CA 3GU1A 4BJHA 1WXZA 3IGHX 2HNHA 2WJEA 4NP7A 3F4DA 1R9ZA 4CEUC 1UBPC 3F2CA 1GKQA 3PNUA 3TN5A 3IACA 4L9XA 4EPEC 3URNA 2R1PA 2GWGA 3WMLA 4XAGA 3AU2A 5E5CA 3ID7A 4C65A 3RYSA 4C6IA 4HA0A 4KIRA 1O12A 1DPMA 4IH3A 4GY0A 2D2GA 4YIWA 5FSEC 1EJWC 1E9ZB 1M68A 4GZ7A 3SO7A 3GU9A 3FDKA 2A3LA 3GG7A 4IFRA 3IPWA 3LA4A 2Z7GA 2PAJA 4R85A 1FWGC 4H01A 1RK5A 4KEZA 3T81A 4LFYA 3GTFA 4LCRA 4GC3A 1FWBC 2WM1A 4C5YA 1FWFC 2R1KA 4IGNA 2Z28A 1E9YB 4DLMA 1FWHC 2FVMA 3OVGA 4C6OA 1RJRA 2Z26A 4DI9A 4QTGA 1EJVC 1BF6A 1EJTC 3CS2A 4C6BA 3MVIA 4IQJA 4INFA 4H9TA 1FWIC 4LCSA 3NEHA 1GKRA 2FVKA 3URQA 4LEFA 4DO7A 3T1GA 2W9MA 5G4HC 1J5SA 1V77A 3HPAA 4C6QA 4ERGA 4ERIA 4GY1A 2Q09A 1ZZMA 4P5UA 1NDVA 2XIOA 1K6WA 4J5NA 4L6DA 4XD6A 3LU2A 3OQEA 4E3TA 4B90A 1UMLA 4LAOA 4QRNA 1K70A 4EPBC 4GX8A 1V79A 2DVUA 5HMDA 3KM8A 1YIXA 2Q01A 2ICSA 3GTXA 1KRAC 1RAKA 3CJPA 4RDVA 5HMEA 4LAKA 2O4MA 3DUGA 2G3FA 3O7UA 2FFIA 3TN3A 4HK6A 1A4MA 4GK8A 4DNMA 4DZIA 1EF2A 2YXOA 1I0BA 2KAUC 4EPKA 2Z4GA 2Z2AA 3B0YA 1FKXA 1XWYA 2I9UA 1J6PA 4H9MA 2VM8A 3GUWA 2HPMA 3CAKA 2VR2A 2VC7A 2OODA 2QS8A 4C6FA 3F4CA 3ITCA 1NFGA 2ANUA 1ITQA 2OGJA 2GOKA 2QVNA 4XAZA 4F0RA 3QGAC 4PE8A 3GIQA 3GTHA 3LSCA 1ITUA 1J6OA 1PTAA 4QSFA 3URBA 4C6DA 1GKPA 1RJPA 4PCPA 3AU6A 2CZVA 5CH9A 1YBQA 1HZYA 1NDYA 2DVXA 4I6KA 4BKNA 2WJFA 4J35A 4H9ZA 4H00A 4CNUA 4IFOA 3G77A 2RAGA 1P6BA 3GU2A 3TNBA 3GRIA 1M65A 1J79A 4DIAA 4EP8C 4B91A 3UR2A 1UIOA 1M7JA 4GY7A 4F0SA 1FWEC 2BGNE 4H9VA 1RA0A 4IF2A 3FEQA 1RA5A 2O4QA 4G7EB 4UBPC 2PGRA 5FSDC 4KQNA 1A5NC 3WYZA 1QW7A 1UIPA 2DVTA 2Y1HA 4C6EA 4CNTA 4ZSTA 3MDWA 5HMFA 4PBEA 1XGEA 3MDUA 3ORWA 2Z24A 3N2CA 1R9XA 1KRMA 1VFLA 4IG2B 2I5GA 1XRFA 4BY3A 3OODA 1A5KC 1KCXA 4C6LA 3A3WA 3QY7A 1R9YA 1V51A 2UZ9A 2YB4A 2E25A 2GWNA 3OOQA 4QS5A 3K2GA 4EPDC 3LS9A 3LGGA 1FKWA 3OJGA 4CNSA 4R88A 4C6KA 1FWAC 4D8LA 3HTWA 4NG3A 1EJUC 4C6CA 2PLMA 4RZBA 3LSBA 2HBXA 2AMXA 3LY0A 3UR5A 3D6NA 4MUPA 1YRRA 4C6JA 2HQAA 3QY6A 3MVTA 4DZHA 5LXXA 1POKA 1PB0A 4WHBA 3A3XA 1PO9A 4I6VA 2VC5A 4GX9A 4CEXC 1EYWA 2HPIA 1ONWA 3T8LA 2IMRA 1V4YA 2R1NA 1POJA 4XD5A 4KF1A 3ISIX 4UB9A 4RDYA 4AQLA 4LH8A 2E1WA 1QXLA 3NQBA 2QT3A 3QGKC 3C86A 3LNPA 2PGFA 1NDWA 3EWCA 3FDGA 4C5ZA 5A6TC 3OU8A 3RHGA 4C6MA 3S2JA 1V7AA 5AKQA 1ONXA 2Z25A 1S3TC 3GTIA 1EJSC 3NURA 4C6NA 2P53A 2R1MA 4LCQA 2D2JA 1EJXC 3MKVA 2P50A 4KEVA 1RJQA 2AQOA 1A5OC 3MSRA 4DYKA 3E38A 4J2MA 2VHLA 3EWDA 3O0FA 4IFKA 3B40A 4H9UA 1KRBC 3HM7A 4TQTA 2Z00A 3S2NA 3TN4A 2ADAA 4XD3A 3MJMA 3TN6A 1KRCC 4ERAA 1P1MA 4C6PA 4AC7C 4RE0A 4GYFA 4ZSUA 2PUZA 3E3HA 1W1IE 2HBVA 3MPGA 1A5LC 2YZ5A 1EZ2A 4LAMA 4IFKB 4LANA 4CQBA 3E0LA 1JGMA 3K4WA 4DLFA 3PNZA 1YNYA 1WXYA 2ZC1A 2EG7A 4JOMA 3S2MA 1A4LA 4QROA 3B0XA 4LALA 4QS6A 2OB3A 4GOAA 1A5MC 3IJ6A 3RN6A 3E74A 3F2DA 3JZEA 1XRTA 2R1LA 3PBMA 3A4JA 4NI8A 4HK7A 4F0LA 4IGMA 3UF9A
chains in the Genus database with same CATH superfamily
1B5TA 3P6LA 3WJYA 4DUOA 1NF7A 5I79A 1G4SA 1XYLA 4M81A 3QN3A 3GYCA 1O5RA 2OWXA 1BVWA 2GVJA 3W01A 3UG8A 3HPSA 1FP8A 2CBVA 3NGFA 1JI2A 5I3KA 1AJ0A 3LHUA 1JYVA 7ENLA 1AMKA 5G4EA 1SSDA 3UWZA 1GYMA 3WLSA 2FGLA 3UCCA 5BWFA 4LV9A 4X0VA 1R2SA 4RW3A 2Z2BA 5HNUA 3DECA 3PR2A 2D3LA 4QEHA 3WBAA 4JIIX 2GVGA 3UBPC 1VGAA 4URIA 1O1ZA 3C8FA 5G2WA 1PSCA 3IARA 1PJ9A 3TAKA 1V6XA 4FNUA 4L9YA 4IOTA 4NJGA 3DU0A 3WNNA 4A8NA 3N34A 4O53A 4OFCA 4KFOA 2E7FA 3TTYA 1CTNA 3GNRA 3S47A 3BJSA 4FF7A 4PTVA 2FH6A 4L5ZA 3UJEA 1M3UA 1MEHA 3TN5A 4DJFA 3TW9A 4ZBCA 2MUCA 5DF0A 2PP1A 1I1XA 1OT2A 3VKAA 3ID7A 3GIYA 2INFA 2XH4A 1T96A 4HA0A 3S1UA 4K1GA 1OBAA 4JD4A 1EHNA 3GVWA 5M03A 2JGQA 4MVAA 4YIWA 1VFSA 1HO4A 3UNTA 4ZQRA 1SR9A 4DVOA 3QF0A 1E9ZB 3NQMA 2ZA1A 3A9IA 3G8RA 5T8GA 4DX3A 1FWGC 2DZUA 4HU0A 4A8RA 3ONBA 1GYLA 3M41A 1EB3A 2DT0A 4QP0A 2R1KA 1F3TA 4WD0A 5I3HA 4IQDA 5FJJA 1OC5A 3G2GA 3UT0A 3A12A 4D2JA 3MHUA 4RCXA 3VIIA 3AIUA 2MNRA 3VKCA 1TPH1 4D6HA 1R46A 4Z1DA 2J13A 1LRNA 1TKKA 2NSXA 1O68A 1LLWA 1CDGA 3U5YA 4UMBA 3VE7A 1XI3A 3C2YA 2ZRWA 1DV7A 4PCSA 5D4YA 1LG2A 2E28A 3TOPA 2BHUA 1LWJA 3NVTA 3RO6A 5FJIA 4LAKA 3AISA 5C7VA 4KEMA 4HQVA 5DCDA 1W6TA 3ZQ9A 3B0UX 4HK6A 3IVSA 3D5HA 4L6OA 2XGBA 3W75A 3I7QA 4RW5A 3KHJA 3WFLA 4UCFA 2VM8A 3GUWA 4S39A 3CQIA 2Y62A 2I57A 3LEPA 5T26A 3IUDA 1O4UA 1YADA 4QJ4B 1Q7MA 1GJWA 3ABRA 1VFTA 5FF0A 1RLCL 1GK8A 1QO5A 1HGWA 1KFJA 1SZFA 3QGAC 5CSUA 2DPEA 4E5TA 1BYCA 3ITXA 1OX5A 2DZAA 4QSFA 1VFUA 2FJKA 3QR1A 2CZVA 5HAOA 3VO0A 3M0HA 4DRSA 3TLQA 1B0IA 1QASA 5LIUX 1XP3A 4GINA 3W7HA 2VELA 3GDKA 4DUXA 4L56A 1GVFA 3GU2A 4AMCA 4YU1A 4IGHA 4HSHA 4W5UA 2YKKA 3A4XA 4KKXA 2CCRA 3CH0A 2R82A 1TPEA 3WEMA 3ABXA 3VD7A 3UA4A 3LM3A 1S2UA 3AIWA 3KBNA 3MCOA 1B3YA 2EPKX 2ZUNA 3UJ2A 1J0HA 3EDJA 1XGEA 3R89A 2FPVA 4ECLA 4O57A 2YL8A 1YTKA 2ZICA 4GRSA 2PB1A 1XRFA 4GNKB 3FEMA 3WH5A 4KWOA 4QS5A 4AYGA 1V3HA 2VT0A 4CNSA 3T8QA 2GDVA 2PRLA 3MZNA 2YIHA 3E0IA 2VZTA 1AW5A 1IIHA 5E9XA 5H2ZA 5JIPA 1VFHA 1H4PA 5LNWA 1KR1A 3AWNA 3W1MA 3M47A 3P5ZA 1I60A 2HQAA 4G1NA 1OK6A 5EYWA 4L80A 3C8NA 3FIGA 3THQA 1NU5A 4CVUA 4HB7A 4U3CA 2E3ZA 1R47A 3ITOA 1YKWA 5AHEA 3L7RA 1M7XA 4HA1A 2QT3A 1BWVA 1S2AA 3D3FA 3KLLA 3RLGA 2F2HA 5CAHA 3EWCA 4M56A 4DJDD 2X30A 3TC3A 4JZ5A 1E56A 4AYSA 2Q6ZA 3WF1A 5E0KA 5I77A 1TSIA 3AHXA 3AYSA 4Y7EA 1KCLA 3E96A 2HS8A 4XZ9A 4MNMA 3ZJ6A 1JRBA 1PTDA 3TLLA 3JS3A 4UZSA 1NJJA 2VZUA 3HM7A 1OSEA 3BK0A 3TWBA 3GZAA 5HBFA 3QOMA 3RR4A 2PWUA 1VEMA 1WCGA 4HNNA 1UR9A 1YDVA 3ITYA 2RUSA 3NQAA 4QEEA 3K1DA 4H04A 3FXGA 4ZEPA 2ZZ5A 4Q8UA 4YVPA 3DKJA 4I5XA 3W07A 2FPYA 1EQPA 3LOTA 4JAWA 4K68A 1XICA 4K8EA 1Z32X 3BCJA 1KXHA 1EBHA 2CLFA 1HN1A 2CLPA 3OLIA 1NP0A 2C13A 3H2CA 3LUTA 4DELA 2OKOA 2FH8A 4DWSA 4ZB0A 2A7PA 4U31A 3WLNA 4UQCA 3GXPA 1S5MA 4R7JA 1PCKA 4XTDA 1RD6A 4H8VA 3TJIA 3OPSA 1D8WA 4QXIA 3HPFA 3SCSA 4H1ZA 7REQB 2GSEA 4AHQA 4NT0A 3A47A 4UTIA 5M3WA 3SSZA 4AIOA 3KOYA 4QHRA 3GHSA 1C8XA 4ZL1A 3CHVA 3MKKA 5CC5A 1FCUA 2G37A 1MWOA 3MSYA 3A64A 2FZ8A 2TODA 4POCA 3KVLA 3VMPA 2GSJA 4IQEA 3GWQA 2ZX6A 3LG3A 3RJYA 1J9YA 1NAL1 1QNPA 4NNAA 1U83A 2ZIDA 3UYCA 4K38A 3W53A 4PBFA 1ADDA 2G50A 4GXMA 1E6SM 4QISA 1EJRC 2NW0A 1KXVA 3UD6A 1R7OA 4MAZA 2ZX8A 3TXVA 1UR2A 2ACQA 4HK5A 3WQVA 4XAFA 3DEQA 1N8WA 3GO2A 3PVFA 1I9CB 1OABA 4MFEA 3O6AA 1BWLA 1FDJA 1K4HA 4UFKA 3MHGA 4FXSA 1VJIA 5DMYA 3D0CA 3STFA 2OSXA 1V6WA 2GWGA 3RM8A 1TWZA 5E5CA 1L0PA 1WXJA 3GZ3A 1FHLA 4OTKA 4C6IA 4A3HA 2E5DA 4IPPA 2D2GA 9RUBA 1SPQA 3BCDA 4NL1A 4W7UA 3S42A 3AMDA 4YN5A 4PC8A 4JHZA 2PAJA 4MY8A 1FQ0A 2NUYA 3T08A 3GR8A 1OY0A 4B2DD 1ZALA 1FWBC 1FWFC 2IKIA 2BGQA 1Q6LA 3QBUA 1QVBA 4DLMA 1B4KA 3DG7A 1LJYA 1CYGA 3OEXA 4XVEA 5CPQA 4D1IA 4MWAC 4J3WA 1KFWA 2P0IA 3DHDA 3CHFA 2E5BA 1O60A 4ZQPA 5AYYA 5ABHA 4DO7A 4DF2A 4UTWA 3HPAA 5CBIA 4ORMA 4YJ5A 3B8VA 4C7DA 4DZAA 1WNOA 2PDFA 3N9RA 2ZUUA 2W79A 3MT1A 1LBFA 4UXDA 2EPHA 1I2RA 4TMBA 1RBOB 2O4MA 2HDJA 2BXYA 2G3FA 1XC4A 2Y2WA 1OX6A 3QM3A 5DEZA 3UEQA 4MKSA 1XGZA 4J7RA 4NZ5A 1FCBA 5G1YA 3WY1A 3EWYA 3Q37A 4TV6A 3W1RA 1E5NA 5H1WA 4EX4A 4IMGA 3OYXA 1NEYA 1KGUA 2VC7A 4MB1A 5T9BG 3QXBA 4XISA 5KZEA 4ADUA 1FFQA 1X7IA 3AS2A 3LHWA 3HOJA 1QI4A 1BXNA 1JPIA 5K4XA 1TJ2A 1F73A 1PL9A 2OZ8A 2FIQA 3BZGA 3LERA 1XD0A 2WMFA 4JNYA 4UTKA 4UTFA 4YCOA 2XU2A 4S38A 3GNOA 3KBSA 3GDTA 1E70M 1JCXA 3RAOA 4IIGA 2DVXA 5C9WA 4D71A 3RG6A 3GVGA 2P88A 3POCA 1KFLA 2HROA 2JK2A 3FY1A 4HNUA 4MNJA 3BAYA 3H8AA 4NIRA 4J3VA 3Q65A 1ZU8A 2HWGA 2Y7GA 3VNIA 1XIBA 4ASTA 3ZLHA 4IF2A 3FEQA 2FMNA 3UYIA 1MEIA 4FS9A 4KQNA 3Q67A 1A5NC 3LGEA 1P43A 3WQOA 3NQEA 4PRRA 3LV5A 3QKEA 1TPC1 4NY2A 4PBEA 3SUWA 2ONEA 3EWUA 2QQ6A 2ZUVA 2F38A 1LOSA 4DJFC 4MWAD 3UZJA 1OD0A 4C6LA 1R9YA 4G1KA 1T5AA 3M0ZA 4NYYA 1EUNA 1AODA 2G0WA 4EPDC 2CHRA 1MVYA 1YQ2A 3WBYA 3A5FA 1DJWA 4RZ6A 1FWAC 2VEGA 4W7WA 3HTWA 4JQ3A 5BU6A 3AS0A 3O15A 1QMLA 4LUSB 4ML9A 2WKGA 1EGZA 4MMWA 2CLEA 1WKDA 3N6QA 2ZQ0A 4HKPA 3GXMA 4NRRA 2RH9A 5FL1A 2WC7A 2RJHA 2OGYA 3DOPA 2V5DA 4JTKA 4S3KA 4R7OA 2FMOA 4LH8A 5HWJA 3NL5A 3T4CA 1KR0A 4FF5A 2V6AA 4DUVA 3FDGA 2V2DA 2QJMA 3PPGA 3SY1A 5CPLA 1DKWA 4KCUA 4A2RA 1Q6QA 5E0FA 4IX2A 1CPUA 1EJSC 2QAPA 4XV0A 3SZ8A 1W5PA 2GGEA 4FNQA 2D0FA 5I07A 1MUCA 1VCVA 3VNZA 2AQOA 2VP8A 1ZGDA 2HSAA 2VGIA 4YHEA 1UC5A 1XC6A 2ZZ3A 4LXFA 2XZ7A 5CG7A 6TAAA 4AY8A 3T0TA 3BV4A 3TK7A 3PUGA 3MJMA 3IANA 3PJXA 3QZEA 4AF0B 4R53A 2HNEA 1DE6A 3AHYA 4V33A 4JEJA 2PUZA 3AYRA 4D6GA 4LANA 3BAKA 1M7OA 3UJFA 4HN8A 4ZFMA 3TC6A 1TV4A 1SJCA 4QROA 3TMQA 3UP8A 5EGRA 5AFDA 1DTNA 1G01A 5BXRA 3IIOA 2C18A 4DJEA 2R1LA 1SZRA 2E1DA 1Y0EA 2G41A 3UF9A 3NQ2A 3DFPA 1WAUA 2PWHA 2NV2A 1XYCA 1J0IA 3ITGA 3UWEA 2FYMA 4PUWA 3SFWA 4KW2A 5F1UA 4ZA0A 3B8DA 1QNQA 1LQ0A 2FTYA 1C9DA 2PDBA 3CMFA 3WQ6A 3GIPA 1R3RA 1ISXA 1TO3A 3W2KA 1ITCA 1W1ZA 3DH7A 4XD4A 2NVAA 2CHOA 2HXUA 2V2HA 3QY8A 4DBDA 3TFCA 2A0NA 1KW1A 1E55A 1KBLA 4H2CA 5JBFA 3GHTA 3KDNA 2XSAA 2FTWA 2QIIA 2QUTA 4GXWA 3G18A 5EBUA 1D3HA 2WCSA 1HF6A 1QI2A 3PANA 1KB3A 1U5HA 4G6CA 4WXYA 5F2LA 3B4YA 1VHNA 3PFRA 1QHPA 2DZTA 2VGBA 3GYEA 4NZJA 2JALA 4JR5A 4I8YA 5C54A 4I7WA 3HQPA 2FDSA 2IPJA 1VQTA 4M19A 3V35A 2XN2A 3H7UA 4CU7A 1BTCA 2VD8A 3KRBA 1I0DA 1VFMA 3NZ1A 3SBFA 3B4UA 1GCYA 2ISFA 1K9TA 2HVNA 4FOUA 4H83A 4AG0A 1YDOA 3IJQA 3GAKA 3UERA 1H2JA 1JR1A 3KOWA 2I5QA 1H60A 3PUDA 3QYSA 1L6SA 4B15A 4KRTA 5C55A 2J24A 3AU2A 1DJIA 1T0OA 1JXJA 2BX7A 2CKSA 3QPZA 4KIRA 3PG9A 3PC0A 3QYQA 1VJZA 4O14A 1QPRA 1JEZA 1VD6A 3QHNA 4WX2A 1BYBA 4JTLA 3B8TA 5CPNA 1XSKA 1N55A 3SO7A 1TREA 1VRDA 3RF9A 3OBEA 5AC4A 1QWKA 3U57A 3KRZA 2BOGX 1GVSA 2WNZA 1OF8A 2WM1A 3TKFA 4HCLA 3BV7A 3CEUA 2FVMA 4NZFA 4YWIA 5EFDA 1VEOA 2TAAA 3W7RA 3CM4A 1GVYA 2BXZA 4QITA 3WF3A 4HCDA 1QBBA 1XH0A 1A0CA 4LCSA 4CCZA 3THDA 3R7MA 3A9BA 3E49A 4IZGA 3W70A 4F0KA 2E0PA 4JFWA 4G56A 3W3OA 4IL2A 2WZIA 3P8IA 2CKRA 1KWKA 4GC4A 1TPUA 4HZ7A 1ZJAA 4ZTXA 4HMNA 1H5YA 4IPNB 1HIZA 3IIZA 3MSGA 3KM8A 4DQWA 4WSKA 4QLKA 5F4WA 3ONCA 4JIQA 2WANA 2QCDB 3KAOA 2XVLA 5JH2A 4WJXA 4ZOAA 1H7PA 3BJTA 4JICA 1MYRA 2ZZ4A 2DSVA 3TXZA 4BWLA 2DQWA 4C1NA 1PZ2A 1BHGA 5D32A 5E09A 2DT3A 4S3GA 3ZR4A 4ACYA 4O1CA 3GDLA 3UU0A 2HRWA 3TTSA 1U30A 1H1NA 2VGGA 1QHOA 3VC5A 3O3RA 4L65A 1HL2A 5U7SA 4C1KA 4DWSC 1S1PA 3LNMA 4M3PA 3PFMA 1TA3B 5HQMA 4MSSA 2ZUTA 4OUIA 3AIVA 3EZ4A 3NFUA 1H1ZA 4DXKA 1E0TA 3UG4A 2ZFAA 3W1PA 2VENA 4H00A 2JKAA 3W23A 1SMDA 3G77A 4LX4A 3QSTA 4QE1A 4M80A 2PBGA 3VIFA 5CXPA 2VEPA 1YPIA 1YE6A 4C1NB 3G1VA 4B91A 4HOWA 3S3GA 2PU1A 2XN0A 2ZZ7A 2BGNE 3M6YA 1KQZA 1V08A 4GYPC 5D8WA 4UTTC 5AB3A 3TYUA 2FB3A 3W7JA 1C3FA 2P10A 4QX4A 4DWSD 4R9XA 1X6NA 3W22A 3WLKX 4DBSA 3M4HA 1IR1A 1FXPA 2V0TA 3GLCA 3E02A 5DO8A 2OT0A 3VTRA 4U10A 2PDNA 3BUVA 1XLFA 1JZ8A 4ZOCA 1GVQA 3K2GA 4DBWA 1ZENA 4LBUA 3T55A 4Z2LA 5EMMA 3SSJA 3NDOA 4GNJA 1US0A 5LGXA 4RZ4A 4R88A 1WOAA 4D8LA 4NG3A 4UOZA 2FTPA 4GIAA 2PLMA 1AW2A 1PKYA 4TVCA 4C6JA 1KBIA 1Y65A 3PY2A 3R4IA 3C2OA 3LRLA 1UOZA 3WDIA 4DZHA 5LXXA 3ZMRA 1HKJA 1KFEA 4GX9A 2J7BA 2J77A 1W9XA 2QJJA 3BVJA 5BW6A 4J9JA 4I9TA 5HQLA 4MNLA 1QK2A 4MAVA 3IVTA 4GFSA 2WXDM 4HIBA 1UASA 5JBEA 4GI8A 3NCOA 3L68A 2OVLA 4HSNA 4O19A 4R5EA 2HV5A 4FIQA 1XPYA 5C6MA 1J0YA 3C6CA 3EWZA 8A3HA 3VGBA 4DBEA 2XYLA 3VIHA 3ZT5A 3N73A 1R3YA 3TP4A 3LCWA 4GVGA 2MANA 3GR7A 5A94A 2NQ5A 3UGVA 1GW9A 1VH7A 2QNEA 3G1DA 4LV4A 2OFJA 3WF0A 5LXEA 4R27A 4KCTA 2ADAA 1TJ0A 2CESA 3BW2A 4C6PA 7PTDA 1PKLA 3HURA 1JCLA 2A3CA 4E2VA 4FX8A 2FHCA 4JX5A 1D9EA 1FDYA 1PAMA 3VIJA 3QRHA 2E9BA 3I6EA 1WXYA 3TYBA 2C19A 4QS6A 1M04A 2OR2A 3WL0A 2A7NA 4K7YA 3HGOA 3OZMA 1OCNA 2WWDA 4P7OA 4NX0A 1VYPX 3P93A 3HFYA 1UD3A 4JCMA 5RUBA 2J4GA 3C2EA 2GK1A 1C91A 3SN0A 5FOOA 1OFOA 1Z69A 3NM1A 4AVOA 2J7EA 3VM5A 1DORA 5D03A 2DSKA 1G69A 2GJNA 3GG1A 2OLHA 3SY8A 2PLCA 4MYXA 3FS2A 1DHPA 1G6CA 4W5ZA 3LK6A 1XR2A 2Z1KA 1FOBA 2NWSA 2GZXA 1HL9A 3TC7A 4A8IA 3W4RA 1F07A 2PWGA 4Q8MA 3URAA 3ZSSA 4V1YA 3CB8A 4Z2GA 3E0FA 1GT8A 1JPMA 3BGJA 3WNMA 1EPXA 1HW6A 3VE9A 4I3GA 3W7IA 5HA7A 2AQVA 4NQ1A 5G1MA 3BLFA 3LYEA 1AMYA 3UWUA 3LGDA 4CQCA 3MY9A 3KX6A 1EX1A 1AH3A 2ZTJA 3W1AA 4I7UA 3A24A 3WLJA 2PA6A 1X97A 4PUDA 4QGCA 1W1TA 2DH3A 2Q8XA 2HNHA 4N42A 2H9AB 2J6VA 3C0LA 3NIYA 1R9ZA 3TJLA 1GKQA 4Y9NA 1DJHA 4A3RA 5XINA 3WK1A 4L9XA 2E77A 2BVYA 4Z08A 2QJGA 3PWAA 1U2YA 2YLAA 1TFVA 5CPTA 2YDSA 1REQA 3E2RA 4A22A 3TCSA 4LAUA 5D9PA 3WLOA 1ODUA 1C8VA 4EF9A 3WMBA 3SRDA 4F2UA 1JPDX 3GC2A 1TPDA 3WQWA 2CLKA 3L5MA 1M68A 1KM0A 2CBUA 1QOQA 1FWRA 2DUZA 2Z7GA 3NO1A 1V02E 3KZPA 2GQAA 1Q6RA 3SRHA 3XIMA 3GVQA 3GUGA 4ZODA 3GTFA 1BYAA 4LVAA 1WDRA 5DQPA 5BWAA 2EGZA 1PS9A 4JHOA 1EO7A 3NUKA 5AOUA 3WLRA 2ALRA 4DI9A 4U4MA 3GAYA 5CSSA 4LVBA 2WCAA 3LRKA 2VI0A 3URQA 3UCQA 1REQB 2RGMA 3ALGA 5CZSA 1E4NA 4CLMA 1VIZA 1HKMA 4DO5A 3EKGA 1RLDA 3A4AA 1F3WA 1DJQA 4BQ3A 2WZMA 5A8GA 1G67A 3OZYA 3HG3A 3W9ZA 2O56A 3NZGA 3G5EA 1SYTA 3UJRA 3LCXA 4W9TA 2QF7A 2PWFA 5DRCA 3GS6A 3RR1A 3RLVA 3WQEA 4CD6A 3WH6A 4QNEA 2YL9A 3W7OA 2OELA 3BMWA 4RV8A 1ME8A 4S2BA 4LY8A 4QM1A 3W71A 5EMJA 3NA8A 1UUMA 3IIVA 2QS8A 3ABSA 3H54A 4LF1A 5FI8A 3SIZA 3BJFA 4HHHA 4O12A 3AMGA 2ABBA 1GQLA 3M43A 1E3XA 3BDKA 3NPWA 1UPPA 3N04A 2Y63A 3NXLA 1RQBA 4GE8A 3U3HA 4WDXA 3AZSA 3EDEA 4XO6A 1OFQA 3ABOA 2VEMA 2D23A 2XM2A 4E2OA 1S5VA 1WOBA 2V82A 1E0XA 3ARZA 2AMGA 2QVHA 4XUYA 1J79A 1V02A 1OFRA 4KWWA 5F2IA 4U5IA 1PHQA 4ZVJA 4IUGA 1Q65A 4UQDA 1M7JA 3BTNA 4GUGA 4H6RA 5CC3A 3M0YA 4UBPC 2Q71A 1FUYA 4CQ9A 2ACSA 2GDQA 1QW7A 5I24A 1YX1A 1Q3NA 4M1BA 1XDMA 3V0UA 5FEXA 3L4ZA 1UA7A 3MS8A 4KWUA 2V69A 5KMYA 4E4FA 2UZ9A 2YB4A 5JMUA 3UA3A 2X2YA 3L21A 4NZ3A 2E8ZA 3LGGA 3OJGA 2BSLA 1JVNA 1W9VA 2QAFA 1C8QA 2PODA 4PMDA 2VUYA 4IMDA 4C6CA 1CLVA 3H4GA 4Z17A 3IJIA 3H2OA 1B54A 3M0JA 3G1XA 4JQ2A 1R87A 1ZHAA 5EBAA 1BRLB 4ZO8A 1XFBA 3B3DA 1T40A 3DESA 2VCCA 3NJ3A 2O7QA 2RKXA 1R38A 2VC5A 3PPCA 5F1VA 3WQ8A 1SZGA 3GDRA 1B3WA 1XFCA 3MUY1 2W67A 1V4YA 4P2VA 3VXGA 3QFEA 4B3KA 1HKKA 3O0KA 4NX5A 5AYZA 4RE3A 1GW1A 1QPOA 4MB5A 4NRSA 3IGSA 4LQ1A 2PFHA 3CTLA 3VMOA 1LT8A 2X0YA 1UD8A 1JQXA 4O16A 5A6TC 2QW5A 3S2JA 2E68A 1A5AA 3WMCA 1XCXA 4CD4A 1S3HA 3GTIA 3MUZ1 1EJXC 2P50A 4KEVA 1RJQA 4Q32A 3LLXA 4XBSA 4CCDA 4H8UA 3Q4DA 4N9CA 3O0FA 1QNRA 3EXTA 2H9AA 5F4SA 2E6YA 3LBOA 1TUXA 4LVDA 1QPQA 3ES8A 5FAJA 4XAPA 1R3TA 1GOQA 4KCVA 4DWDA 4PUEA 5D9MA 4JQ4A 2NVDA 2VXNA 2UWFA 4JN7A 4BWLC 5AHMA 4HSOA 3LN3A 2WMIA 4PMRA 1A5LC 3WJWA 3NSNA 1PIGA 4MJMA 1K7FA 1E4IA 3RCYA 4CQBA 3LMZA 2ZZ6A 4YVXA 5IFTA 4NU7A 3U2ZA 3S2MA 1Q2RA 5ABGA 1V3MA 2YCIX 4J3ZA 3SRKA 1QR7A 1S1RA 1PX8A 3NDYA 4JCLA 3PBMA 2AL2B 4UTWC 1K8XA 3NL2A 2J74A 4IGMA 3MSDA 3ES7A 2PF8A 1F05A 4WJEA 1UR3M 2YB1A 2QDHA 1EH9A 2X0HA 1W3JA 1W3TA 3AROA 3WUGA 2DJXA 3EWBX 1TCDA 5FL0A 4QQUA 2DW6A 1UZDA 1H7XA 1G4TA 4O10A 3VIGA 1WPCA 1BWKA 2QIWA 4UFJA 3VDGA 2NQ9A 3BLDA 3DFYA 4JTUA 3M9YA 3VOFA 3W7EA 1RP8A 1FDZA 4N7QA 1UROA 1XYAA 4ZB2A 1XBYA 4CD7A 4KMQA 4DXVA 4C7GA 4EK7A 2IPWA 1W3HA 4B92A 2HS6A 4RDZA 4CUCA 2Z1SA 3FJ6A 4R3UA 4MJ4A 3L4VA 3B97A 4ZENA 3EA2A 3EOLA 5FJRA 1E72M 2Z1VA 3VOJA 2PDHA 5FF2A 4MNKA 2QDEA 3TYCA 3ELFA 1DQWA 5T9CE 1WQ5A 1P48A 4Z42C 3AUOA 1KXQA 1IT7A 5EU9A 3NXFA 2CYGA 2DIEA 3GKAA 3MMUA 3N6HA 2AAMA 3PJTA 1VPQA 1A49A 5CPSA 3H21A 3L65A 1E1EA 4MADA 3IGHX 3VM7A 3K30A 2VQUA 4BFAA 3AUJA 4Q4KA 4NP7A 3P0XA 3V0TA 1I2OA 3VIPA 3R0UA 1LROA 3MI2A 3OZPA 2FDMA 2Z1WA 4BF9A 4Z2KA 3BG9A 3B8UA 2ISDA 1DPMA 3WLIA 5D02A 3O16A 5FSEC 1H61A 4JDBA 3VOHA 1RH9A 3DFHA 3LLFA 3FDKA 4RK8A 3MCNA 1KKRA 4AZ6A 4GD0A 3MUCA 4K37A 3WUBA 4GC3A 3B0PA 6ENLA 2NX1A 3V5OA 2DH2A 4U2YA 4E4PA 2H8XA 1RJRA 4FLQA 3WD2A 4QTGA 2OSWA 3K8MA 2XSBA 2C1GA 5A6JA 4MUZA 3EEGA 4Q4RA 3NEHA 2VX5A 3PM6A 3S5ZA 3AXMA 1IZCA 3HN3A 3RRAA 3T1GA 2J9XA 3STGA 4ERGA 2QCNA 1DWAM 4IIFA 1MMFA 3JU2A 3EKZA 3CZGA 1UMLA 1K70A 1S5NA 4EPBC 1KC7A 1BVNP 1EXPA 1LL4A 4HVXA 3GR4A 3QV6A 2O92A 3KBVA 4JQ1A 3TX9A 4RDVA 2OZ0A 1DWJM 4FA3A 3QMTA 3NL6A 3DUGA 1A4MA 1J0KA 4NJJA 3IEBA 1XBZA 2I7GA 1KNWA 4Z2JA 2G3JA 1FKXA 1CXEA 2AKMA 2XUCA 3W76A 1ZBWA 1R3QA 4GI4A 3M46A 2GK1B 1YDYA 3W29A 2Z1BA 5H8PA 3DHFA 4JTIA 1GVRA 4XAZA 1J5TA 1W5NA 1WX0A 5KZMA 3ZO9A 5F2GA 3GIQA 4F2BA 1UP2A 1ITUA 3URBA 4C6DA 5CC6A 3EX3A 4S23A 1HZYA 3CV2A 2CERA 2PTXA 2VZVA 1LBMA 3W72A 1OFPA 2VVSA 1QAPA 2CLHA 3BOXA 2GJPA 4QAWA 3GRIA 3CAQA 2Y6ZA 3G1YA 2WMIB 2DY3A 5GJPA 4TO8A 5DFAA 1IQ8A 3VOCA 3VGDA 4GY7A 1RA0A 3PSVA 4OHQA 3WMSA 2QGHA 2PGRA 2ZWYA 2PDYA 1TRDA 4KIEA 2DVTA 2Y1HA 4CNTA 4AXKA 3WUEA 1CT5A 3VKJA 4MLRA 4MZYA 2Z24A 3N2CA 4HHLA 1BTMA 4FX6M 4D9PA 4OJYA 3OODA 5BU9A 3IGXA 4PZVA 1L9WA 1Q63A 3USZA 2BOFX 5T91A 1ICSA 3M5VA 4N4PA 4WSJA 2PDWA 1FKWA 4LEQA 5DMLA 4AW7A 7A3HA 5AN7A 3L23A 2BTMA 4UFHA 3TAOA 3PSWA 3BGAA 3IUHA 1POKA 3UG5A 5FJUA 2DZWA 3VX0A 3W00A 2VURA 5CLTA 1D7FA 5TNVA 3NQBA 2A2IA 2ZUMA 4DAFA 3LNPA 5C2XA 2ZDRA 2J62A 5DT7A 3L4UA 1E6RA 4A2SA 3RHGA 4J27A 3PB2A 2GUUA 1A5SA 1UP0A 1S3TC 2R8WA 2D20A 4NXKA 2AOSA 1EP3A 2DZXA 3TZFA 2DV0A 1ICPA 4Q3MA 3DKLA 4D1JA 4IFKA 4UTJA 5AC7A 3B40A 1I45A 2IKJA 4ML4A 1UW9A 1KXTA 2ZRUA 1ZP4A 5BOFA 4NXSA 3U2CA 1JZ4A 3L2MA 2XPKA 1KRCC 4ERAA 1PYMA 2JFEX 1P1MA 1PX4A 4AC7C 4S2CA 4QAIA 4OUEA 1GQKA 1NQKA 3SJNA 3VNKA 4LT9A 1EA0A 4PRTA 3S5SA 1E4LA 4C90A 4RE2A 3UY7A 3WLTA 2QCFA 1TA3A 4GMEA 5E9AA 3N18A 5BNKA 4V27A 4L4LA 3MMWA 3CO8A 1P0BA 1WA3A 4ZOEA 4GI9A 2WYSA 4OVXA 4W8BA 3GB6A 4US6A 2DUXA 2HJPA 2X42A 2Y5JA 4FO4A 1VYRA 1XYZA 4GBDA 3OW1A 1YMYA 1F5ZA 2BNJA 2PWDA 5A6BA 5G2HA 6XIMA 3DBNA 3NOEA 3W25A 4B9ZA 4J40A 2GJXB 1ONRA 3DC8A 4QJ5B 3QC0A 1R6WA 3LBCA 3T44A 3SR7A 4GJIA 1NOFA 3S4TA 3V4BA 3UPMA 5C71A 4Z1CA 5CZKA 4QJ3B 3LENA 1OZMA 2XVGA 1GTEA 4PEKA 4Y9MA 2YYTA 3S2CA 3K5XA 3N19B 2BHZA 3K1GA 4XKYB 3MB9A 4RE4A 1W1A1 3B8IA 4ADSA 4UOJA 3U9IA 2QV5A 3CPGA 1GOMA 4GJ1A 2GGHA 4YYCA 1ZAHA 1MZRA 1OFDA 4GVFA 1XYFA 4J3SA 3FGCA 4PTWA 1J18A 3AMLA 1UUOA 2NXIA 5C70A 4JN8A 1EFZA 1EDQA 3UW6A 1O1HA 3KWXA 5A8NA 2W91A 1FWNA 4B4FA 1K6AA 1DWIM 1ZAIA 1IWBA 3WF2A 4PUJA 4JIEA 5LHFA 2PDJA 3PBWA 4IICA 4Q8WA 4XKYA 3QZ6A 4TX6A 5AVNA 1EJWC 1MXSA 4HT3A 1E9IA 1ADSA 2W5FA 3GFYA 3CTTA 3FJLA 3I3EA 4DBUA 3SUVA 4Q8PA 1A0DA 4LFYA 4LCRA 3PULA 4C5YA 1X8FA 4F66A 3SN4A 4GZIA 1XLKA 3KOXA 3VMNA 4WEVX 3PBUA 3UGRA 1L6YA 1EJVC 5J8LA 3T05A 5FEZA 5JQ9A 1EEXA 4HHMA 2P3EA 1EJTC 4LAZA 1R2TA 1VLIA 3BL3A 4J28A 1TV8A 5C2CA 3C3UA 3NEVA 2UY2A 1MI3A 1ZZMA 3N17A 5JBDA 4DJED 3PG8A 1K6WA 4YMZA 4B90A 1L6FA 1LQAA 3R12A 2G4JA 2D73A 2YBTA 2Q01A 4LVGA 5HMEA 3R2GA 1XUZA 2V3DA 2EPNA 4UR7A 2XFYA 2Z4GA 4PR4A 4H9MA 3O6DA 4OV4A 5HANA 1EHAA 3OZOA 1DVJA 4N9BA 3DFSA 2CZ5A 5I09A 2EPOA 1OYBA 4HMCA 3T0AA 1VBGA 1NFGA 2ANUA 5CPMA 4AZHA 2QUVA 4BEUA 3S5YA 1AQMA 4F2TA 3UETA 3PF3A 3LQLA 3W2UA 1DIDA 2YBUA 4NKCA 1HT6A 5HPOA 5CH9A 2JKPA 3RX2A 1CXIA 4QBXA 3SY5A 4AD2A 3N3TA 1OIMA 3IJ8A 3ZT7A 5BRQA 1K7XA 1KV5A 4O17A 2OYKA 1UD2A 3CL6A 4HNLA 1XRSA 4F0SA 3SCRA 4H9VA 1EC8A 2PLKA 2PDIA 3PZTA 3QV7A 3W2LA 3DYOA 1Q45A 3MDWA 2EO7A 3F03K 1CB2A 6TIMA 2FVLA 4ZXOA 4OU1A 1VKFA 4JTJA 3H12A 2E25A 4HA4A 4AVFA 4LC8A 3IAPA 4YLWA 2OXNA 3DYPA 4O28A 4H3DA 4OE7A 1JZ6A 2ZE0A 1NOWA 1RY0A 1M01A 5JVLA 3BGGA 5A6AA 3VGEA 3M0IA 2OPJA 3CC1A 8XIMA 5AZ0A 3EWWA 3S83A 4MUPA 1J2WA 5BRPA 5MHBA 4GBUA 1YW1A 4QE4A 1V7YA 1H11A 3RPDA 4AIUA 1H0GA 4N02A 5D04C 1UOKA 2HPIA 4Q4MA 4WOQA 4GCXA 2IQTA 2H6RA 3W2JA 1XIJA 2E1WA 3I6RA 3DHPA 3DFNA 1MW2A 3P80A 4UQAA 4X9SA 4LB4A 4RV3A 4S1FA 4K1WA 1JCTA 2EF9A 3HB9A 1BPLB 3OU8A 3M0MA 4ZO6A 1ONXA 3A4WA 4MYAA 1UD5A 2AGKA 4O18A 4FIRA 3N2OA 1UH2A 2BOEX 2HE8A 3PBVA 2P53A 4AD5A 4WJ8A 1XH1A 3U0HA 4UFLA 1ALDA 3QHMA 4LY4A 4D6EA 1W1YA 1JYWA 3MCMA 2GVLA 3IS4A 1K8CA 4KBXA 2Z0IA 2PS2A 3W6LA 1QUMA 1VZWA 2UY3A 2W3ZA 2D0GA 4H7CA 3VVGA 3MYOA 1LF1A 2QJNA 2GDUA 3A23A 3KDOA 3FSTA 3MKCA 1EZ2A 3G1FA 3MYPA 5BCAA 1JCYA 1NWRA 4H6KA 4S3CA 3GW0A 3NQVA 4V15A 4XZIA 1E5JA 1KTBA 2IW0A 2XIQA 4IIBA 3JVAA 3B0XA 3STPA 4UFIA 3QJAA 2H3DA 2F9RA 4OZOA 1MRAA 2IPFA 1ZFJA 2Y89A 1MQPA 3JUGA 4NI8A 3DGRA 3IUIA 1MFUA 3GVVA 4WY0B 4JQAA 1DL3A 4AD3A 1NH6A 4DHGA 1A80A 2POZA 4GZJA 3PZOA 3N9SA 4M24A 2P8BA 2Q3OA 2OQHA 2CXGA 3WL1A 4M51A 1EQCA 3MUAA 2JIEA 4Y90A 2V81A 1JYNA 3BAXA 3F2BA 2CNCA 3L4WA 1XYBA 1B3XA 3BLLA 1X1ZA 1OVDA 1TVNA 4JFTA 4EAYA 3VDHA 1WV2A 4JS3A 4LYRA 4YVVA 2J47A 2J79A 3H6OA 4YTUA 3HG5A 2WJDA 3ICJA 4KCWA 3CZEA 4US5D 4Y9PA 4EF8A 2DUAA 2YYUA 1TPFA 3APYA 5ABTA 4JTFA 1YTEA 4GQGA 3WD3A 4FK9A 3G22A 1HL8A 1QK0A 3H4XA 4PTNA 2TMDA 1R85A 2CFFA 2JQXA 4R7WA 3CK5A 5D33A 2QPXA 1VC4A 1EXBA 4O13A 2C71A 1V6VA 3VKKA 1W91A 2ZADA 2AGTA 1E0WA 1XSJA 3CUGA 4RL3A 1ECEA 4L7ZA 2V9DA 3SGUA 4GUJA 1H51A 1JYXA 4KWVA 4P8XA 4AEEA 4R34A 4RNJA 2ZVIA 1RBLA 2D2OA 4IP4A 2YOCA 3WLQA 1M6JA 2PWEA 4LU0A 3I4EA 1JZ5A 4LUTB 4PUMA 1TTPA 4U3AA 4GY0A 2PC8A 3H2EA 1Q7ZA 1DOSA 2Z6IA 4GA8A 1BKHA 3T09A 2F84A 3MP5A 1FX6A 1SUXA 2ZRZA 4HCHA 5LNUA 1J0JA 1U1JA 5KZ6A 3S1WA 3L2LA 4IGNA 3MV11 1KTCA 4BHYA 1FWHC 4WLCA 3SUSA 1QDSA 2VJXA 1G9HA 2J88A 1U5VA 1B57A 5J5RA 4GYKA 2VRKA 4H9TA 1FWIC 1GKRA 4BCEA 4JX6A 4RKAA 3O63A 5EL1A 1RCQA 3CMGA 3VFCA 4C6QA 1CBGA 2IQ0A 1XIDA 3H7RA 1VHCA 4YPJA 3FKRA 2DZPA 4QFUA 3OQEA 4GKLA 1RXOB 1UBSA 2AL2A 1RSCA 3TTQA 1YIXA 3T2QA 3MA8A 1BAGA 3A21A 3VOGA 5I3IA 3TQVA 2H90A 1GPFA 4DNMA 1KGWA 2PP0A 1EF2A 2YXOA 3G1RA 2PF0A 2PLJA 1B3ZA 1W0MA 3J7HA 1RCOB 4BI7A 4RXFA 4HPNA 3O2LA 3F1QA 1YXCA 2W63A 3CV1A 4FZIA 2JE8A 2QKFA 3LTPA 3MBDA 3GC4A 1ZY9A 1TPWA 2OGJA 3ANUA 4IX0A 2YXGA 3NM3A 3P2VA 5A6KA 3HGSA 4JXCA 3AYVA 1C90A 3RITA 4PMYA 4QLJA 1HP4A 3E0WA 1JIBA 1PTAA 2VX7A 1P6WA 1F3XA 3NYZA 5AC8A 4Q7IA 3W24A 3N1AA 4AZ5A 2D24A 4I9AA 2BODX 4BKNA 3NSMA 3TSMA 4CNUA 3F4VA 3NQFA 4PFMA 1HJSA 4B9YA 1XIIA 1XLDA 3IJ7A 3MO7A 2BBFA 2FHFA 2PDPA 4HZ6A 3LI1A 4HU3A 1XHGA 5D38A 3EX2A 4Q22A 5FJPA 4GYPA 3H26A 4XSLA 4LUYA 3BLPX 3TQPA 5FSDC 1B2YA 3TVAA 4OBRA 4TU1A 4C6EA 3N25A 2D69A 3CUJA 4KS0A 3WJZA 4PTXA 4IG2B 4BI6A 4TVUA 1HJWA 3QY7A 3A6OA 4HZ8A 3SQSA 3B0VC 1XYMA 1IR2A 3G0UA 4LVFA 3VDBA 1GUVA 3UPBA 4JYEA 2W66A 3M6DA 2OEKA 1VB9A 3R8RA 3WQ4A 3PZ9A 4P7RA 3UVIA 2OCZA 2B7PA 1TWIA 3AMKA 3C3NA 2R1NA 5K9XA 4AZGA 3MWAA 5CG0A 1X7FA 3KBMA 2Q8LA 3FJNA 2CLMA 3PB0A 2HISA 1NWTA 1MW1A 4B16A 3QH2A 5AKQA 1SO3A 3KZSA 1TR9A 2BY1A 1J01A 4X9YA 3U48A 3CB3A 3DERA 1WUFA 2BMBA 3TROA 4E8GA 3NR0A 1PWMA 2VD9A 4LWWA 2YLLA 1MFVA 1GQJA 2F2KA 3LX9A 4QDPA 4ZQCA 5IXEA 1HFBA 3NNTA 1XIEA 2ACRA 3B9DA 2Z1XA 1X96A 1TRIA 4L4PA 4LS0A 1AL8A 3O07A 3BOFA 1UP3A 3BMVA 4A3YA 3EMZA 1F6YA 1FWWA 3OA3A 2YA1A 3HG4A 3W0KA 3HV9A 1PIFA 2HXTA 4O0KA 1WDQA 1A4LA 4NASA 5HMSA 4MOZA 3V3WA 2YW3A 1JUKA 1EP2A 4AWUA 1CIUA 3JZEA 2FGBA 5CZJA 1DIOA 1HXJA 1UZ1A 3RPMA 1RQHA 4HK7A 3QTPA 1HG3A 3FYPA 3RU6A 5A2CA 3A22A 1OK4A 1VP5A 1Z8AA 4IJBA 4OBSA 2OX1A 1UMYA 3ZWSA 3CAWA 1ELSA 2EQDA 2O7SA 4I9MA 2IKGA 3AXHA 4UUIA 4X2RA 2Z6JA 1W32A 2E6DA 3NYDA 5LYRA 1W1VA 3CZKA 3E9AA 3DBPA 2NWRA 3F7JA 2QCDA 3FAWA 3VPLA 1HGYA 1QOPA 1QNSA 4KESA 4KPLA 4WIWA 2A79A 1FWCC 1SFTA 1R2RA 1JL8A 3FYYA 1FWJC 1TIMA 4B3ZA 4ZQOA 4H9YA 2QUUA 1K1DA 1V0MA 4MJ2A 1UD4A 4P8WA 5FKYA 2REQB 4ICCX 4WF7A 2WLZA 3G1AA 4M6VA 2WMKA 1LL6A 2CZEA 4QG6A 4MLJA 4ZB5A 1LCOA 1OM0A 3KTCA 5C2GA 3GG0A 4LNCA 2VZSA 1VCGA 5K7JA 1OCBA 2A21A 2C0HA 4MKVA 4X61A 1LP6A 1E6XM 2A7RA 2VEIA 5AZ1A 4XAGA 3KUMA 3GXIA 3T42A 2CPUA 1JULA 3VABA 1JD7A 1RV8A 2V5LA 1OD8A 3V36A 1S5TA 5J04A 2YFOA 3E5PA 2HVMA 4IM4A 4HA3A 2CWXA 3GSMA 1BLIA 2GVEA 2J9YA 4JBRA 1IZKA 1IZJA 2PDLA 1MQRA 4FNPA 4HOZA 3NL3A 2BV9A 2V3EA 1XIHA 4H01A 1OX4B 4WRHA 1OF6A 3T81A 1XCWA 4F48A 3WJXA 1OX4A 4ADTA 1EGVA 3NAVA 4MM1A 3EXSA 1OFBA 1W3KA 3LZ5A 3LCHA 3QMSA 1EO5A 1O7AA 3WJSA 4JTAA 3R43A 4CD5A 1E40A 2C8NA 4LSBA 4C6BA 3HQ1A 3KP0A 8CGTA 5LIWX 1KM4A 1A3XA 1PHWA 2W9MA 1HX0A 4JKLA 1J5SA 1OYCA 1AK5A 4ERIA 1EPVA 4AEFA 4ZGYA 4P5UA 1NDVA 4AZCB 4XD6A 3RLHA 1V93A 3S6OA 1FP9A 4WDWA 4D6CA 2IUZA 3WEOA 5AVHA 1V79A 3CBWA 1V3LA 5HR6A 1KRAC 3CJPA 3QFWA 4LYQA 1NTHA 1GEHA 1BKSA 4W85A 3TN3A 3ARUA 4BK9A 5IDIA 2KAUC 4MPQA 3LXBA 3TYZA 4TTUA 1QJWA 1XWYA 4CU6A 2I16A 3RMJA 3FHQA 5CPOA 2CW6A 2HPMA 1IXNA 2V68A 2AQWA 2NX3A 3SCQA 2FHBA 2NZLA 2G96A 2VL4A 5HPCA 5ECUA 4PRWA 3THCA 3A13A 5H91A 3VUSA 2GOKA 3IIXA 4Z0JA 3ZM8A 2BDQA 1IV8A 3T7VA 1JFXA 3FX4A 4H41A 1J6OA 3P81A 2J8FA 4DF0A 1RR2A 3MANA 1PYFA 2PRHA 3VD5A 3W7CA 4PMUA 5U4NA 4BI5A 1PV8A 1UA3A 2ZKMX 4H9ZA 4Y9OA 1C7SA 2DSZA 4XSMA 1A47A 2JKEA 5AYBA 3FW6A 3WF4A 9XIMA 3LXAA 1Q8AA 2CC0A 1IXQA 5I5RA 3RU8X 2GQ3A 3U6WA 5C9XA 1F2JA 4A05A 3KBJA 3PWIA 4LC6A 1B3OA 3R58A 3PN8A 4I5RA 3HGRA 4JIPA 3UZYA 2I5IA 3DG6A 2WSPA 2KX9A 4JTQA 4LF2A 1MXDA 3W74A 3LXCA 1GGOA 2G4FA 4MKNA 1X8CA 4AWSA 3MDUA 6REQB 2XIMA 4AD4A 4I5UA 5HATA 5BRBA 2HVOA 3QW3A 4QDWA 2FJUB 2D0HA 3ARYA 2NX9A 2DZVA 4KRUA 1ESWA 2QMJA 3QV8A 7TIMA 1JCNA 1M5WA 1V6TA 4CN4A 3BAJA 2F6UA 3EOUA 4N0RA 4RZBA 5C7HA 2AMXA 3UZWA 3UR5A 2QLYA 2A4AA 3VI2A 3PUEA 5DX7A 2WBGA 1U1UA 3DC0A 3MVTA 3HMJG 2R14A 2PRMA 4GIYA 3OA5A 4ILSA 3HG2A 4QLLA 2WOQA 5HNRA 3GNPA 4L64A 2J6XA 4ATDA 4FP1A 6REQA 3DAQA 3MO4A 3LCLA 5IM51 4LUJA 4C6MA 5C0QA 1W31A 3C0QA 2PPGA 3RLUA 3IRDA 2ZYFA 4ZQMA 3S1GA 4L4MA 5AC5A 1FHUA 4LRTA 1J96A 1K4GA 1T6MA 3L5LA 4GO8A 2WSYA 3P8JA 3UPWA 4IMCA 4IMFA 3ARVA 4JTGA 4A21A 3GHRA 4XD3A 2R94A 3CHEA 1FCVA 3LPPA 1K7EA 4JL1A 3DFOA 4UC5A 3V0SA 3VYLA 1PDZA 1LORA 1LG1A 3EX6A 4DXXA 3ARQA 3B06A 3KOZA 3K4WA 1BGAA 3OVRA 1W8GA 2EG7A 3UWVA 4HHPA 4HU4A 3EOEA 1AG1O 1TMLA 3AC0A 2FZBA 4FXJA 2OYMA 2G3IA 1WP6A 4C7FA 3UG3A 1VBRA 1MZHA 2W4XA 5HINA 1X98A 1UWAA 2RFGA 3QEZA 4LB3A 3WG6A 3U2OA 5K3VA 4D6JA 5HQEA 3K8KA 4IHCA 3NG3A 5JU6A 3BAIA 5HWMA 3ZFHA 4FAMA 1YPFA 4PH6A 2XGIA 3MWCA 2Z29A 3RUBL 1SZEA 3AALA 3QZAA 4HJWA 4ICMA 3H2FA 2NV1A 4BR1A 4HJFA 1C29A 2OOFA 3LBMA 1XKYA 1H09A 3TYEA 3ATYA 1LLZA 1UKQA 3E2VA 3QQ0A 3QW4B 4O8RA 2E5CA 3HQNA 4NAEB 3SDOA 2PBOA 4G2DA 3GW3A 3O8AA 3ZR5A 1XLCA 3S1XA 1FBAA 3WH7A 3ZJ8A 1P0EA 5GVJA 3HJEA 3OVPA 1FY6A 4RDWA 2YDRA 3PTMA 1JZ3A 2EG8A 3VOIA 3O6YX 5LIKX 3K4AA 2PDXA 4IXHA 2WVVB 3LHVA 3KCLA 3BARA 4K6AA 2X1UA 2P3ZA 1F4HA 4HD5A 2VUNA 4XZWA 2AAAA 4YTSA 1N8FA 1TTIA 2QCHA 2QR6A 2V5CA 1YPXA 5AYIA 2BFGA 1K3UA 1E6PA 4CNOA 1CGVA 1E43A 2UY5A 1JUBA 2VCBA 4X22A 4AVNA 4Q8OA 1UH3A 5M2FX 4M7TA 4EKJA 2VC9A 4W89A 5GPRA 4A8LA 3RJXA 3OB8A 4FB7A 4XBKA 4LOCA 5JUVA 2BASA 1H5VA 1O12A 1VJSA 4Y6GA 1Q4WA 1TMHA 1CWYA 4LYKA 5CZ0A 3UWYA 2ACUA 3GHUA 1P5BA 3PPFA 3GBDA 2PDQA 5A8OA 2XIIA 1AFSA 1OGGA 1G7UA 1UYQA 1PZ3A 2ZE3A 1CXKA 1E9YB 3EB3A 5IHRA 1GQIA 3LQGA 3SM0A 1R7AA 3OVGA 3O9NA 1KLZA 5HNNA 3M7SA 4IQLA 3WENA 1QT1A 4LPCA 1PE1A 5CC7A 2YW4A 2XVKA 1F7BA 1LUCB 3OLEA 4GIRA 1K77A 4QDMA 1NIUA 3NZQA 3KRUA 4F0MA 4UR8A 4GABA 3AICA 2EPMX 2V3GA 2QXWA 3LU2A 1IIGA 4LAOA 2VFGA 1RVKA 2W0UA 1R86A 4TX9A 1V03A 5HJXA 3GTXA 3W7KA 2J25A 3VGHA 4CN1A 4L1GA 3IVUA 2WPBA 4GK8A 2NVCA 4DZIA 5KITA 2ISSA 2WBKA 4G9PA 4Q6JA 3B0YA 3OLDA 1HJQA 2XZ9A 4FLOA 1ME7A 1SM9A 3CAKA 1VLWA 3W28A 2OLAA 2E40A 1TV2A 1L6WA 3BQ6A 4HNOA 3ZOAA 4OGZA 3SECA 3W1UA 4B3LA 2YDAA 4PEEA 1B30A 2J9ZA 2V67A 1FRBA 1KWGA 4QSHA 1CEOA 3BH4A 4YTQA 1SFSA 3GDMA 2PSNA 1TELA 1QO2A 4QR6A 1JJKA 2VEFA 4J35A 3AJ7A 3W83A 1UUQA 4EP8C 4DIAA 4BQ2A 1QBAA 3LHTA 4N6FA 1LT7A 5M1TA 2XWEA 2RDTA 1UIOA 2ZZ2A 3ZS4A 6PTDA 3FAXA 1CXLA 3FSUA 2NQJA 1EX5A 4AIEA 3C0SA 2CEQA 2VQTA 4HOXA 1EL3A 3WBEA 5LNVA 4PN2A 1KRMA 2Q8ZA 3N12A 2VYOA 3UNDA 1N82A 3ZIZA 5G5IA 3TR9A 3UR7A 1JQVA 4X2PA 5G4WA 1V6YA 3CGTA 4UQBA 4H4IA 1BFNA 3NQGA 5KETA 5KSWA 3IJDA 3DDMA 4MGGA 3W02A 1YRRA 2BVTA 4ZO7A 4MFDA 1H0IA 3FYOA 3VGFA 1PO9A 4LS2A 3WO8A 2RGLA 3WELA 1M53A 4CEXC 1FA2A 3PZMA 4NYUA 4J4KA 2QUNA 2HK0A 3K8LA 5AECA 3KFTA 1VCFA 2GOUA 3QGKC 1CGTA 3C86A 2GQ9A 2PGFA 4JEQA 1NARA 3C2VA 4FLRA 1GNXA 1LBLA 3VU2A 2O55A 1UZ4A 1TTJA 3GC5A 4C6NA 2R1MA 2X41A 4J3XA 3IJ9A 3MSRA 3TSBA 1Q6CA 4XZLX 3M5XA 5DCEA 3BC9A 3G6LA 4PL1A 4L4OA 2I14A 1C92A 1W2VA 4Y9AA 5SWUA 1PKMA 1UC4A 3BWWA 3E3HA 3MPGA 4M8UA 4AWTA 2X09A 3CUIA 3PNZA 4JOMA 2OB3A 1F4AA 3VNLA 4MJZA 1VS1A 4Q33A 4W4QA 3DHUA 3A4JA 4DPQA 4F0LA 4UR9A 4IJCA 4K36A 3NZRA 2QDGA 3SQMA 4IG2A 1L2QA 4IGSA 3QQ1A 1W1B1 2WPGA 2Y0FA 1MRQA 1RK6A 2QCEA 4DI8A 4W87A 3O6CA 4AZCA 2VFDA 1HJVA 3MP3A 1F3EA 1FFRA 1JUEA 4DJFD 4UCGA 1D8CA 2H8ZA 1WKEA 1QATA 1UQZA 3FCPA 2QJHA 1NELA 3G24A 1FTXA 1KCZA 2X1TA 1ZQ5A 2OEJA 3R10A 1ZJIA 5FF3A 3GE7A 5TQLA 2CIPA 3VINA 3TTOA 5A6LA 1ZLPA 1V8EA 4AZBA 3AXIA 4LRSA 3T78A 1MUWA 3SW6A 3O1NA 3IV8A 5A6SA 1RPKA 3PJWA 1FWDC 3MV01 3PZGA 4D6IA 2F61A 2P76A 4KH2A 4BQ5A 3SGZA 3HIJA 3B05A 3JW7A 5B7ZA 1EIBA 2O0TA 4FXFA 5GNYA 3ANVA 4P7NA 4DO4A 3R25A 2EEXA 2ISVA 1H7WA 1CECA 3TV8A 5EFFA 2FQIA 2GL5A 2PTDA 4W88A 3TZNA 3BURA 1TX0A 2W6RA 1TV3A 2Y70A 1P6CA 4Y96A 4BJHA 3TQ0A 3TSDA 3TU9A 2BLEA 3LPFA 1RCXB 1UKTA 1SFLA 1E51A 1WZKA 2XGZA 3URNA 3BSHA 1EF3A 1TQXA 2XWDA 4C65A 2VTFA 4O1FA 1I4NA 4C91A 2DIKA 1MSSA 2PTZA 3KL5A 1KM6A 3TA6A 1LZOA 1AZ2A 4GZ7A 3GG7A 4E2DA 4IFRA 4O4WA 2WHJA 1ISYA 2V8ZA 5I78A 3SRFA 3DFTA 3AMCA 4TV5A 1DJZA 1Q6DA 2WMHA 2QPUA 3UVAA 4Z2IA 3FKKA 3PBYA 3R8GA 3W6MA 4XZHA 3T0BA 3LMYA 4INFA 4XBJA 4XUGA 1GG0A 5A2AA 5A8PA 1ENUA 2YL5A 5XIMA 1BG4A 1Q6OA 2VDHA 4UTLA 4LUTA 3SUUA 3ALFA 4GY1A 3I65A 3LB0A 3OYZA 1JD9A 3B04A 4TX8A 3W84A 5FEWA 3FV9A 3NO3A 3N6JA 3T4WA 2HMCA 2J7CA 3VZXA 1WDWA 1B3VA 3N3MA 5HMDA 4RR4A 1BXCA 5CGMA 4AHOA 2C7FA 1RAKA 4YTTA 5CLWA 2BVDA 3CL7A 4DUWA 4Y8FA 1ICQA 1L8PA 1EP1A 3NQ8A 1WO2A 3OG2A 3P0WA 3SUTA 1KM5A 1XLBA 3I6TA 3RMEA 2J75A 1F6PA 2Z2AA 1EBGA 1KV8A 3CWNA 1DWHM 2RHGA 4KFNA 3VILA 4I90A 6ALDA 2PD9A 3N4AA 4Q4SA 2BS9A 4C6FA 4FI4A 4DJDC 3S1VA 4XIMA 3PZVA 3FLUA 3AIQA 2VVNA 3VD9A 1CNVA 4UWMA 4GUHA 1XINA 3K46A 2ZUSA 3CH9A 2OO6A 3OBAA 2VX6A 3U8GA 1N2VA 5D30A 3SIMA 4PCPA 4AD0A 2DZBA 1UH4A 3KE0A 2XVNA 1UHVA 1D3CA 1GHSA 4R9OA 1XBXA 3TNBA 4BS0A 3OTRA 1RP9A 1FWTA 3C56A 3CUHA 1SO4A 3VIOA 3VK5A 1OQFA 1A5CA 1X1OA 4LS1A 1SSGA 4DN1A 4B5UA 1MQQA 3L67A 1E1CA 1LWIA 3THUA 3K4DA 1FWEC 2GGIA 2Q02A 3ECQA 2DT1A 1GPWA 5EB8A 1T7LA 1RVGA 1EWDA 1IHIA 4WKFA 1QNOA 2ZWZA 3VAVA 4CNPA 2YCLA 1J4EA 2NUWA 5C9UA 1XIFA 4CKQA 1KGXA 1R9XA 3H2NA 2I5GA 3T6CA 2ESCA 1A0EA 3KW3A 1XGDA 2W62A 3N2MA 4JTEA 5HJLA 1BVZA 2BY3A 4U5KA 3TQKA 4UNKA 3EX4A 5GQBA 4XVDA 5DN1A 4JIHA 2Y5SA 1OC6A 4Q7BA 3BICA 3B8SA 5B7YA 2NXGA 1RBAA 2WQDA 2ISWA 3OBKA 1PB0A 3ARXA 1DXEA 1MW3A 3F5JA 3L9CA 2B0MA 5LIXX 1TZ7A 4XD5A 4KF1A 3G0XA 5LIYX 4UB9A 4GZEA 2GYIA 2CBIA 4AQLA 4CCCA 3NQDA 3AS3A 5TAOA 1MNSA 1A50A 2A85A 2YZRA 4D8AA 5ECVA 4XIAA 5E0CA 1XPGA 2NLYA 5DXYA 4JTDA 3FK4A 4G8TA 1LRQA 3HFTA 4K8HA 2VKZG 4AH7A 4MDOA 3T0DA 3DI0A 4O1BA 3EWXA 1LUCA 3MKVA 2QPSA 3VKBA 4GH3A 5FCZA 3BZJA 4H9UA 4LBRA 2J8TA 3NPXA 2EPLX 3S2NA 1PEZA 2PD5A 4MWAA 4A29A 5MKGA 1W1PA 3NOYA 1HTIA 3L0GA 1CGUA 5GNZA 2POTA 2X05A 2OLSA 1JF5A 3HV8A 6CGTA 1PX3A 3HBLA 3MMTA 1SO5A 1MNZA 4ZO9A 3PJUA 4WKAA 1PCWA 3QPYA 4NJIA 1G0CA 2GUBA 1OZQA 2VX4A 2WC3A 3MJYA 3W1NA 3P82A 3WKZA 1K03A 1V0KA 4E0CA 1HJUA 3MQTA 1OC7A 4GOAA 4H8HA 4YWSA 5DELA 3AIEA 1W9DM 3KL0A 1ZAJA 2X7VA 4PCFA 1KTNA 3BCFA 4B5TA 1AH4A 1YE4A 1Y8BA 5CBJA 4H6EA 5D9NA 2X1RA 3TMLA 3LM7A 1QRQA 3N15A 1IF2A 3WDHA 3EOOA 3OLGA 1BGGA 3N9KA 3NTYA 2P5NA 3DIPA 1E4MM 4KERA 4WK9A 4UTHA 3V7PA 1X6LA 2WNNA 1T8XA 1TPB1 1TWSA 1KM3A 4JL2A 4AMAA 1EJ7L 3KL3A 2ZX9A 2CITA 4KEUA 1SW7A 4GPNA 3BLIA 4UNIA 1SJBA 1JZ2A 5DLCA 5FAGA 4PYSA 1UR1A 3IRSA 3A5VA 4CD8A 4FNTA 2REQA 5I00A 2Y7EA 4B2DA 1LYXA 2DFAA 4XAYA 3H23A 3CV7A 4M6QA 4EXQA 1H63A 1NFPA 4OBTA 1HP5A 3R0DA 3PAJA 3N13A 4UTUA 1LDCA 1QHZA 2GJLA 1Y5XA 1Q5MA 3COTA 1WXZA 4KRZA 1XUUA 2WJEA 1FWSA 4L61A 4FR1A 2D3NA 2WJZA 1LTDA 4GACA 1OGBA 3U2EA 1Z41A 2Y5EA 2YGYA 1HVXA 1H50A 2ZRXA 3HO8A 4MB3A 3STCA 3HMCA 4GQBA 3TEVA 3GBEA 3NPUA 4I7VA 2X16A 2JGYA 5HNTA 2YSWA 2WNWA 5D2XA 4ES4A 4P8UA 4BA0A 4CN6A 2G97A 3FFSA 3CQJA 3UZ5A 1J93A 5EMUA 3WDPP 2YL6A 2WZTA 3KP1A 3MW7A 1JF6A 1TWWA 2DJLA 1TX2A 1EKOA 4EOUA 2YFNA 2Z26A 5FACA 2OWWA 1BF6A 3BAWA 2ASHA 3CIWA 3HA1A 3RDKA 5G1TA 5DRIA 3P60A 1XG4A 3ENLA 2Q09A 3LTYA 1JXKA 5DY2A 4E3TA 3AYTA 3ABQA 4PUNA 1PWLA 4NAEA 3MU7A 4JDYA 5GJNA 4B5WA 2DVUA 3C5QA 1X6UA 2PDGA 1DTUA 1O5QA 1U22A 4Q4QA 2PDKA 2XSXA 4O0QA 3WH8A 1GOWA 2I9UA 3NVDA 1W9BM 4W84A 3RFAA 4YNGA 2VR4A 1CENA 1X39A 3DGBA 4GXPA 1DJNA 4AUBA 1YEYA 3USBA 3M0LA 2XG9A 2GJXA 5M5DA 4F8XA 1KD0A 3EB2A 4FNRA 2WHKA 4AZIA 4IPLA 2V5JA 3GG8A 2DORA 2QVNA 3F5KA 1PBGA 4RPQA 3E1F1 3TDFA 5CSRA 4WR3A 1R3SA 1KBJA 3FA5A 4S3JA 4DEFA 4PMXA 2WKJA 1RJPA 1EUAA 4JKKA 1ZBKA 2YJQA 3CPUA 1J2BA 3S6TA 1Y5WA 4DYJA 3P61A 1F6KA 1Z9AA 2P8CA 1I2PA 1UQYA 1M9HA 4DJEC 3UY8A 1C7TA 1Q6FA 2G3MA 1WZLA 3ZJKA 4JIRA 1BD0A 2BG5A 3UXIA 2WQPA 3UR2A 1W8SA 3RM4A 1Z42A 2SFPA 3QHOA 3WD0A 5HULA 3VGGA 2INEA 4O50A 1XLEA 1SMAA 3WNOA 5A6MA 1JZ7A 2WVSA 2GSHA 4G7EB 5CKSA 2OYLA 5FA5A 3E5BA 4OIFA 3WYZA 3LZ3A 1YXYA 1DXIA 4RLIA 2PDCA 3NDZA 1N8IA 2DDXA 4Q8NA 4IUOA 2HTMA 3EDKA 1K8ZA 4EACA 5D8ZA 1XBVA 2WZHA 4REQA 1E71M 3VNYA 4PMJA 1FHVA 1HO1A 3A3WA 4Z2HA 1UR0A 1PVNA 3W1LA 4RUBA 4K2SA 1ZUAX 3B9OA 2IXUA 4Z1AA 2VWTA 3I7RA 5FD0A 3C4UA 3LSBA 1EIXA 2RDWA 2VWSA 3VCNA 2WM0A 5LZLA 3YPIA 4D8ZA 2WHMA 4RNIA 3TIMA 4AC1X 1QOXA 3WIJA 4WHBA 1TJPA 1XF0A 1ONEA 4NF7A 3RNDA 1JFHA 1DJXA 1G7VA 4BF7A 3VCCA 1QPKA 3ZSTA 4ICNA 3ZJ7A 3EX1A 3L0KA 2KZHA 2R6OA 1IT0A 3C0JA 1SVDA 5DCBA 3UZXA 3V1HA 2WC4A 5AHLA 5I3JA 2OZTA 2QGYA 1F74A 1KFBA 5D37A 3EXRA 3H2MA 1DBTA 2D2JA 5EPDA 3AIBA 2VFIA 4JTTA 3L12A 4DYKA 4QCEA 4XK2A 1UR4A 2VHLA 3EWDA 3T07A 1TYGA 5REQA 3ZVHB 2H3BA 3GFXA 2OOGA 1OHLA 2UV8G 3TN4A 4MY9A 3QOKA 1S38A 4ROQA 1K9EA 1OYAA 1RHCA 2YDQA 4GCAA 2B4GA 5I6SA 2FFCA 3L66A 3CPRA 2PGWA 1WBJA 5BMXA 3CLWA 4GYFA 4CU8A 3WDQA 4FSAA 5BXPA 5A1AA 4H6QA 1JRCA 2PI6A 1KQYA 3WX7A 2ZC1A 3AAMA 1QWGA 2LLEA 1AZ1A 5F4XA 1A5MC 3Q94A 3WBWA 3SGGA 2WSRA 2GJRA 1DJGA 3GH7A 2XINA 5I23A 1UWSA 3E0VA 1BG9A 4AY7A 5KEZA 3FVMA 1XH2A 3P62A 1S39A 3I3BA 2DU2A 2PTWA 4Q6XA 2NSOA 2EG6A 3UR8A 3EGJA 3KRSA 3EDFA 2ZOXA 3NQ6A 4E2BA 4ATWA 1W2PA 4S3AA 3B9EA 3WQCA 2C3ZA 3VX1A 2UBPC 1H7NA 2EXOA 7CGTA 2Y24A 2BB0A 3PUOA 2OZ3A 1NFBA 5FF4A 4H9XA 3UXDA 4KGLA 5CJMA 1UR8A 4B5SA 3M5YA 2XFWA 4EXAA 4E38A 2D2HA 4LGXA 4UMAA 3CASA 4W7VA 5H6HA 4J2PA 1EC9A 2NUXA 2GUYA 1UZHA 1SU5A 3MI6A 1RUSA 2ZCGA 4C60A 3S46A 3CQKA 1NDZA 2R24A 4KETA 5FIPA 4GQ0A 2YA0A 4NNCA 4M5PA 1XJBA 4XZMX 1S46A 3R11A 2XIBA 3WNKA 1B31A 4S3EA 1ISWA 4XZNX 4AZ7A 5E70A 3VZZA 5K4ZA 3M07A 4GVHA 2C0AA 2J7GA 1UCWA 1M7PA 4PULA 3UQNA 1QW9A 1UBPC 4KWSA 4EANA 3BLKA 3CO4A 3ARRA 3IACA 4DM2A 2R1PA 3EPNA 5I03A 3CWHA 3AO0A 1M03A 1OCQA 4F0HA 2FKPA 4OECA 1OT1A 1JDFA 3H2AA 1CXFA 2WSQA 3MMDA 5BOOA 2B7QA 4MY1A 1OIFA 3OGSA 3G8EA 1OEPA 2ZA3A 1ADOA 2A3LA 2E8YA 1LOQA 1FH8A 4LYPA 2CBJA 3GY1A 2WK2A 3LA4A 3RIKA 3QPEA 2IQDA 1TB3A 5BXTA 1DJYA 4LBSA 1XIGA 4ACZA 5JIWA 3VNDA 3RO8A 2B7NA 1BSIA 1UWUA 1H62A 4N6EA 4PMVA 1TWDA 3CS2A 1P0NA 4NI3A 4O15A 1VEPA 2PTYA 2FVKA 1VYSX 2WNQA 3IV3A 4HU8A 4O4VA 3KS5A 2VEKA 3ZVIA 3VCRA 1WZMA 5TIMA 4X60A 2DW7A 3B8WA 3S9YA 5D2WA 2DQXA 3H55A 3ZLFA 4J5NA 4N4QA 4JFVA 1R5YA 4L9ZA 2ICSA 1OWQA 4FEZA 3TCEA 3N11A 3T9PA 1TZZA 1MUMA 1I6NA 4AD1A 3EDDA 4UNLA 1XKJA 2TRSA 2VO5A 1Z44A 3CQHA 3MUXA 2NLIA 1OG0A 3WNLA 4S3DA 2ABAA 3UZZA 4M29A 1MEWA 5CGTA 1D7KA 3ITLA 4DF1A 3ITCA 4B5NA 5LA0A 2WW5A 1ITQA 4TOQA 5K9CA 3W27A 1JAEA 3CIXA 3GTHA 3W38A 4JFUA 1SQ7A 1ZL1A 2BP1A 1QI3A 3QR0A 1TV5A 2YR1A 3CMJA 1NDYA 3EPMA 3THAA 1JDDA 2QUMA 1EOMA 1O6IA 4WCJA 4IFOA 1DQUA 1P7TA 1P6BA 2PE4A 4QIUA 3PZUA 1H7OA 4ZCWA 3E2SA 1J11A 1XLAA 2V63A 1F61A 3GNXA 4MPKA 5CEWA 1SW3A 4D6FA 4IIDA 2YA2A 1EDTA 8XIAA 1QW8A 1W54A 3CUXA 2DIJA 4FOJA 4H7ZA 1K9DA 2P0OA 4JYFA 5CCZA 4J3UA 2DZSA 1E6NA 5IHSA 1HKIA 1ME9A 2WO5A 1GVOA 3QKZA 1HNYA 1V3KA 1FHDA 1KM2A 1YDNA 1ML1A 3DENA 1ZBVA 4FMVA 1RPXA 3KVMA 4W8AA 5DBTA 2VCAA 3G1HA 2CHNA 9XIAA 2EJ1A 2R91A 4W86A 3WEZA 1CI1A 1P0DA 5AYXA 2G5WA 3BMXA 1EC7A 4MG4A 4CCEA 3BLEA 4JN6A 1HKWA 1ZB5A 3PHAA 1Q8JA 2XDFA 2VC6A 3A3XA 4I6VA 2WVUA 4IPJA 2FB2A 1EGMA 3AIRA 5IRPA 1DQXA 1D2KA 3VDCA 4RDYA 3EOSA 2QJIA 4JTSA 1R3VA 4P7QA 1I1WA 4RX0A 4C5ZA 4DO6A 2FGZA 2IS7A 3UJSA 4V28A 4XX6A 3M0XA 1CLXA 5HUPA 4JTHA 3EYPA 2V5KA 2NV9A 5IBXA 3BSMA 2E6FA 3C52A 2XH0A 2OMAA 3QV9A 3UXLA 1LL7A 3FN9A 3PPHA 3N4EA 2GFTA 4GNVA 1H1YA 8RUCA 2XTKA 2WWCA 3TJXA 3DX5A 3W1TA 5HJYA 1TJRA 3SB0A 1H41A 1DHKA 4ZSUA 4C1LA 1GZJA 2X1SA 1VFFA 3AXXA 2PC4A 3QVQA 1J8VA 5KINA 3E0LA 1Q4NX 2X1IA 1JGMA 2QCLA 4GGHA 3KCOA 2V2CA 3JRKA 4LALA 2FZNA 3D47A 2OSYA 1E15A 1H3GA 2V3FA 4OWGA 1EYEA 1G4EA 3DN5A 1PTGA 1Z48A 3KS6A 3SJ3A 1XQLA 2WB5A 3V75A 3VC6A 4AX6A 3QSRA 2I1OA 3JZUA 3I7SA 3ZT6A 2FZDA 3VDAA 2VOTA 1IE7C 3IWPA 4HYWA 1R30A 4WGXA 3KTXA 3W2NA 2DSUA 3CT2A 1QFEA 4U33A 1GHRA 4WVXA 3W7MA 4CVWA 1DWFM 2CXEA 3GXNA 3WZ0E 2WMGA 2YPIA 1FH9A 5AHIA 3AHZA 3AI0A 2VDGA 1OGSA 2VOMA 2G8ZA 3AJXA 4B5XA 3HGJA 4PMOA 1K02A 4MZ1A 1GYNA 4PL2A 4G7EA 3WN6A 3LCIA 4JX4A 4PMZA 3CNYA 4EWJA 4BF5A 1E0UA 3KBWA 1CCWB 2ZXAA 2Z2UA 3LPOA 1HQTA 2TPSA 3BLOA 2I17A 3I3DA 5F2MA 1LLOA 1G94A 4F9JA 1W56A 5EMYA 3PTQA 5IOBA 5A95A 1A3HA 3N29A 4IPIA 1E1FA 1S2WA 1S5WA 3CEPA 3DYMA 1V3IA 1J12A 1J0ZA 1AVAA 3VA8A 1I75A 4AB4A 1JNEA 1X38A 3R0KA 2A1YA 2ZBTA 3WMLA 1XLGA 4NJHA 3RX3A 1I2NA 3RYSA 2QEZA 4QCFA 2C1IA 3AHVA 1YTDA 1TG7A 4MTVA 3R13A 3W7QA 2F8QA 3TNOA 3F5LA 1Q6EA 2ZRVA 2ZX7A 1GZGA 1O5XA 5I06A 4IP7A 3NWRA 5MKGB 3GNNA 3WD1A 4EWND 1UWQA 4PMNA 3RM9A 1B1YA 1RQEA 5ENLA 2GGGA 1T99A 4Z0SA 3L4YA 4QQ3A 1TE1A 1L2UA 3PZIA 3LI0A 4Q4OA 2JF7A 1C9WA 1QI5A 2E09A 4K8GA 3HJZA 5HR7A 2XIOA 4DYEA 1OINA 1F76A 5I3DA 4LJ3A 5D05A 2W27A 3OIXA 4GX8A 3U7BA 3P3BA 3OHMB 1PUDA 4GHRA 2WVTA 3STEA 3UXKA 1GVIA 1FCQA 2ON3A 4TR9A 1I0BA 3ZYZA 2PZ0A 2I56A 1WKYA 3XISA 2B31A 2VR2A 3RILA 3BW3A 3VNJA 1HJXA 2VGFA 4NSBA 1CGXA 2DT2A 1YXDA 1E73M 4X63A 2Y61A 3LCFA 3HZ3A 4V2XA 1ZS2A 4F0RA 1Q2SA 2J7FA 1BQGA 3M5ZA 5L6UA 2ODOA 2NQLA 4PE8A 4JTRA 3V5FA 2AL1A 3NGJA 3OQ8A 1RY8A 1YBQA 2C6QA 4M6UA 1P1XA 4CQ8A 1W37A 2XM1A 3IIPA 2JF6A 3ERPA 4EAMA 2OG9A 1M65A 3DFQA 2GLKA 1E1CB 1IXOA 3OHIA 4OOZA 1NM9A 2E67A 5EA9A 5H8MA 1AQ0A 1BQCA 1CZ1A 1JNDA 3ARPA 3CZJA 1US2A 1TIWA 3RGTA 4QJ1A 1PXGA 2J7DA 1MDLA 2PEVA 3W88A 3ORWA 1ZCCA 1BSLA 1QNVA 4PUUA 4US5A 2OEMA 4Q8QA 4CQAA 3W82A 3KWSA 4YS1A 3OGVA 3EKLA 1V51A 4AIBA 2A3HA 1XLJA 2GWNA 1XSIA 1NSJA 3A3HA 1YNPA 3KXQA 4UZUA 1XCFA 3DZ1A 3M44A 1Y5VA 4PMQA 3P14A 5A6BD 1XS2A 1HVQA 2Y88A 2VFFA 1FVPA 4HGXA 1CX9A 4C6KA 3H53A 3S9ZA 3D3AA 5ABFB 2DGAA 3G1SA 3GH4A 3W7LA 1WDPA 4D6DA 1VF8A 3QLLA 2W61A 1PKNA 3QY6A 3M7WA 1WB0A 1UKSA 4ATLA 1KFCA 2Y4SA 2RDUA 5I02A 3EA1A 4HN4A 3T8LA 3AOFA 4YTRA 4NJKA 2X7WA 3MP4A 3U4AA 1IEWA 1IXPA 1R0MA 1DEDA 1BRLA 4NZCA 3CLMA 4NHVA 3PTDA 1V7AA 3R6IA 4H19A 1OB0A 3M0VA 5I0DA 3NURA 4XB3A 3H7VA 3WBXA 1QCWA 1DYSA 2C16A 3E38A 4A4AA 1LM1A 4P7LA 4J2MA 1WE5A 1O95A 5A69A 3HQOA 1PDYA 3R1ZA 1XG3A 4H8NA 3PWGA 1W5MA 3WD4A 3TN6A 4UQEA 5I7GA 4NUWA 4RE0A 2OU4A 3ZWTA 4WY0A 2HBVA 2OJPA 2YZ5A 3WLMA 4A3UA 6A3HA 5F7UA 3CT7A 1YNYA 2V38A 2PU0A 7TAAA 3T0CA 3IJ6A 1GOIA 4E4UA 3E74A 3CZ8A 2ZXDA 3EPOA 4GJJA 2VRQA 1F8IA 3HF3A 3ME3A 3G3DA 4PGLA 1XISA 1ZBCA 3W81A 2A3BA 3BW4A 3MTWA 2JBMA 4CQDA 1W9PA 3VD4A 1VENA 1IEVA 3E2QA 2A5HA 4W8LA 1OFAA 2CLLA 3B03A 4JY8A 4DWSB 1RALA 2L5HA 2ZXBA 1J10A 4RJEA 1VFOA 4IXXA 1GWJA 2DP3A 1TVLA 4WUIA 3PZQA 1TZ9A 1AQHA 4D72A 3DCPA 3GXTA 3DXIA 3DI1A 4FALA 3PAOA 4PCNA 1BYDA 4DAIA 4REQB 1Z3NA 1IT8A 1S2VA 2NQZA 2J66A 2WSKA 4CNNA 3PTKA 2ZA2A 3FXYA 1P0KA 1DP0A 2FZMA 4PSPA 3LD5A 1JG9A 5C9RA 4J3TA 4BEQA 2CLOA 3FHAA 4F4RA 4XZBA 4WDUA 3BXWA 3II1A 5JXQA 3RCMA 4MB4A 4RZ5A 4U2ZA 2WV8A 4XTIA 2OQLA 3S8HA 1K8YA 4JGDA 3C2RA 4L1XA 1XM3A 4X3ZA 3SN1A 2E9LA 4FLSA 3F4DA 4TVDA 4WXZA 2VNCA 4M82A 2OKTA 4K7VA 5G2IA 3IK4A 3APTA 1Q7QA 3SCTA 4EPEC 4PB3A 2HK1A 2BWGA 3TR2A 5GJMA 3C61A 2YX0A 2QULA 4Z1YA 1W3IA 1CW2A 2D22A 2EJAA 2WAGA 4LUSA 3SURA 1VPXA 4MHBA 3QTGA 3O05A 4HTYA 3WCZA 4AY1A 5BYWA 3GU9A 5EMKA 3IPWA 4WDTA 5AHNA 3U5UA 1XL9A 4KEZA 2J78A 3SCVA 2ZDSA 4ZR8A 1BEUA 3S9IA 4IMEA 4L6HA 1VAHA 2ZZ1A 1WBHA 5C9ZA 2VFHA 2FZ9A 5LSMA 5ABEA 4IQJA 4NAFB 2I9EA 8TIMA 3E12A 1PIIA 1LRTA 4NAFA 3IGUA 5G4HC 4PTDA 3R5EA 1B9BA 1KBBA 2FPTA 1WAWA 1UWTA 4L6DA 2PDUA 1U33A 4QRNA 3UFYA 4TTGA 1W5QA 2PWVA 3SQLA 3N2TA 3WNPA 1AJ2A 3EMQA 3FVDA 1SFJA 4WY0F 2JEPA 4HPJA 5K9DA 4RNFA 3O7UA 4ONVA 1Q13A 3WQDA 5BMWA 5E93A 2XH7A 2GPTA 1KFKA 5KTLA 3ATZA 1J6PA 2QCMA 4DB7A 3V1PA 3W1XA 5DBUA 3CZLA 1B90A