3PO2J

Arrested rna polymerase ii elongation complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3po2J00
2E2HJ 2DMUA 5FKNA 5GPAA 1QVTA 2DJNA 9ANTA 1H8AC 3BG5A 5C4XJ 1B72B 4XRSA 1G2HA 2CU7A 3IH2A 2Y9YA 1APLC 2R92J 3FKIJ 2OF7A 3JRHA 1VFCA 4D7MA 2K9SA 2ZB9A 3O8GA 1MH3A 4W1UA 2WV1A 4V2FA 4JX6A 1BW6A 3HBLA 3JRIA 2XSDC 4C3IJ 1IDYA 4S0HB 4FE7A 3JRBA 2DTZA 3TW6A 1IG7A 4JX4A 1UG2A 1QRYA 4XRMA 1FEXA 1WH5A 2DA4A 1VF9A 5EEAA 3L1PA 2X48A 3Q0VA 2CJJA 4A3MJ 2FD5A 3H0GJ 2X9DA 1JKQC 1UHSA 3QPSA 4MO7A 4A3JJ 2O9LA 1HF0A 1MBFA 2M0CA 4GFBA 2L7FP 4IHXA 1T56A 3FK7A 5EG0B 2HXOA 3RZDJ 3PM1A 5C3EJ 4FE4A 5BNGA 4M3FA 4IHVA 2FQ4A 4C3HJ 1BL0A 2R5ZB 2DN0A 4C2MJ 2K40A 2LFBA 1IC8A 3HEFA 4X1EA 5IP6A 1PUFA 2QF7A 3M3YJ 4BKXA 3LNQA 1ZTRA 4FTHA 3HDDA 4A3FJ 3HOZJ 1A6IA 2M8GX 2AO9A 2WAQN 3DCFA 3HKZN 3SFIA 5J1YA 1JJ8C 5E3OA 5EF6A 3A03A 1IGNA 4B1RA 5M3MJ 2L7ZA 1MSFC 3JRGA 2JWTA 4JYKA 2MGQA 2VPRA 1GUUA 2JN6A 5J1RA 3FK6A 3LOCA 5F04A 2X6OA 3S16J 2YU9J 2JMWA 2CQXA 2VI6A 2XPWA 3K7AJ 5GPCA 1JUSA 1X2MA 3ZQGA 1TC3C 5FKOA 2JA8J 3GTJJ 1ZQ3P 4A3IJ 1I50J 1XC5A 3HB9A 4IHYA 3WHBA 2AHQA 4D7NA 3BR2A 2DA1A 2EH3A 4BBRJ 4UUSA 2XRLA 2HDDA 2ID3A 2DA7A 1AKHA 2JJ7A 2EZKA 4AC0A 3B6CA 3SJMA 2E1OA 4DZPA 4RBOA 4A3BJ 4B3AA 1RKTA 4ABZA 3OSGA 1SANA 3HOVJ 3CDLA 3PO3J 5M5XJ 2DMNA 2K9NA 3PO2J 3ZOBA 1LE8A 1TWAJ 4DYRA 5C44J 1OJLA 3NARA 2DMTA 1MNMC 4BY7J 5EZHA 5F0CA 1ZR4A 1SFOJ 3ZQHA 3BTLA 2EZHA 3TP0A 3JRFA 2JA6J 5F27A 2IAIA 1GV2A 3H3VK 3GBGA 3M4OJ 3BR5A 3G1LA 3HOYJ 2HQ5A 1P7JA 5C4JJ 1GVDA 3BR3A 3CCYA 1YRNA 3GTLJ 2O8KA 2EQRA 3A01A 2GLOA 1EF4A 1X58A 2W48A 2E2IJ 5IPAA 4XRSG 1HCRA 4DW6A 3S2HJ 5IOYA 5FKKA 2DMQA 2ID6A 4UUSB 1ITYA 1ETVA 1VNDA 2NOGA 2CRGA 1ZGWA 1AKHB 5GP9A 1Y1WJ 1RETA 4DYCA 1JT6A 3ZQIA 4DZJA 1F43A 4V2GA 2N8GA 2COBA 2R0QC 2LVSA 5EDNA 1FIPA 4LOCA 4X6AJ 1IV6A 2DA5A 2TCTA 3F0CA 3S17J 1LE8B 3K2AA 1JUPA 1ETKA 4AYBN 3OIOA 2B63J 3OOUA 3Q3SA 5K7ZA 2LTPA 4I6ZA 2PMZN 3ZQLA 5M5WJ 1CQTA 1BJZA 3BT9A 2CUEA 5IYBJ 1MBGA 3GTMJ 4W97A 4C3JJ 4Y52J 1R9TJ 5IP9J 4IHWA 3LSRA 2VKVA 1FTTA 2Y2ZA 2GBYA 1K61A 3GTOJ 2ECCA 2XB0X 1YRNB 1OCTC 1MSEC 2NVTJ 1WGXA 4XICA 1HOMA 4CYCA 2E19A 3HM5A 2L0KA 2RAEA 5EGOA 3TP3A 3JRDA 4JX5A 1ZK8A 3MN2A 3GTQJ 2NVYJ 3QQAA 2LK2A 3DEWA 3BQYA 3S1MJ 4A93J 1NTCA 1ETOA 2Y31A 2GM4A 2YUSA 3S1NJ 1MBEA 3I4MJ 1DU0A 1MH4A 1WH7A 3ZQCA 3JREA 2HOAA 2YS9A 3IH4A 4A3LJ 2DA6A 1Q1VA 2H1KA 1WPKA 2VUMJ 1T33A 5M5YJ 5EYRA 5E3LA 4D5CA 3G1OA 3UKGA 1DU6A 1H89C 5FKLA 2ME0A 2DA3A 1K83J 5J1UA 2LY9A 3MKLA 2HI3A 4Y7NJ 4A3CJ 1BW5A 1TWCJ 2LLKA 1GT0C 3S2DJ 2G0EA 5IOZA 1JT0A 3TW7A 1ZKGA 2CQQA 4XIDA 2ME6A 3HGGA 3D1NI 3LSPA 2LD5A 2OPTA 2P81A 1PUFB 4J19A 5HODA 1LFBA 1ETXA 1JKRC 3BTIA 3C2BA 5DS9A 4M6VA 2Y0SN 1ETYA 3VPRA 3I4NJ 1XS9A 3LSGA 4L5EA 1HDDC 1NK3P 2LKXA 5IYDJ 1FJLA 2DMPA 2IEKA 1B8IA 3IH3A 4AUXA 5JLWA 1F36A 1WCMJ 2NVQJ 4B4CA 2HYJA 3BQZA 3HOUJ 1LFUP 5EG0A 4QIWN 4M3DA 2R5YA 1AU7A 1OFCX 4A69C 4M3EA 4DYQA 1ETWA 3O8HA 2JK3A 4MFDA 5F08A 1IDZA 3JR9A 3Q0UA 1H88C 2IBDA 1QPIA 3IV5A 1D5YA 5F0FA 2NVXJ 3BR1A 3GTGJ 2O7OA 5DTDA 2JA5J 2HOTA 3QPLA 3BG3A 2MSYA 4NDLA 3Q0WA 2XGEA 4QSHA 2XPUA 2Y30A 3NAUA 1QVUA 2ECBA 2EZIA 3W6VA 3HGYA 5JLXA 2ELKA 3RKQA 4IEJA 3JRAA 2FX0A 4M3GA 2MW8A 2FJ1A 2XGDA 3ZQFA 2VKEA 3BTCA 3WHCA 3E7LA 5E3MA 5FKMA 1I3QJ 1BA5A 4BXXJ 2WB1N 4HNVA 5K7HA 2D5VA 1JTYA 2DA2A 3RQIA 1MBJA 1P7IA 5FLMJ 3G1MA 3HOXJ 4XK4A 1ZR2A 2L9RA 1B8IB 3JRCA 2H8RA 3LSJA 2R5YB 3A01B 2JA7J 1Y1VJ 2NS7A 2QCOA 1HLVA 3B6AA 4A3KJ 2XB5A 5K7FA 1JKOC 1I6HJ 1AHDP 1U9OA 1W0TA 1RR7A 3S1QJ 1JUMA 1RESA 2KT0A 1U78A 4D5FA 3A02A 1RKWA 4MIMA 3BR6A 5FLVA 2XPVA 1A5JA 1MBHA 3FIWA 4QTRA 3TEDA 2R7ZJ 1U9NA 4MFEA 5F0HA 2EZLA 1VI0A 1OCPA 4JP0A 1Z77A 5F1JA 5M3FJ 5FJ8J 1X2NA 1IJWC 4BBSJ 1RPWA 2MG4A 1GDTA 1TWHJ 3BR0A 2L7MP 1NK2P 1GV5A 2KDZA 4M3BA 1ORKA 1JKPC 2HXIA 5EZGA 2HOSA 1B72A 1UMQA 5IP7J 1ENHA 2E2JJ 1ETQA 2LP0A 4EEFG 4A3GJ 4G12A 3GTKJ 3MVPA 3BTJA 3S1RJ 4FISA 4FCYA 2XGCA 1FIAA 1XG1A 3S15J 3BG9A 1W0UA 1E3OC 3OSFA 3S14J 4BY1J 4A3EJ 4A3DJ 2CUFA 3CMYA 2R93J 1Z0XA 1HDPA 1JTXA 4CYCB 2M34A 2EBIA 5EGOB 3RZOJ 5IYCJ 3SDGA 2K9QA 3HOWJ 1JGGA 5J3LA 1TWGJ 3CQZJ 1IRZA 2TRTA 3FISA 4UUTA 2LR8A 1WI3A 1U8BA 4RDUA 2NS8A 1JJ6C 2M9HA 1S7EA 4I76A 2M2EA 5E3NA 3GTPJ 1O4XA 2Y9ZA 1IUFA 4MLOA 1MBKA 1POGA 1TWFJ 2I10A 2R5ZA 1FTZA
chains in the Genus database with same CATH superfamily
4A2UA 2DMUA 5FKNA 3ABTA 2DJNA 9ANTA 3GLLA 1D0YA 1H8AC 3BG5A 1B72B 3C7JA 4RB1A 3JRHA 2UWMA 2VONA 1K78A 2K9SA 1MH3A 3E5UA 4W1UA 4BDYA 3ECHA 2D1HA 2Z9OA 4JX6A 3VWBA 2OQGA 1SD5A 1O3SA 2V6CA 2ZMEC 1EA3A 5LD2C 2DTZA 4JX4A 1V5GA 1XPXA 2GQQA 3MKZA 3HIFA 3V8JA 2CV1A 3L2RA 3L2WA 4FX4A 2JQ7A 2DA4A 1QGPA 4KDPA 2X48A 1RIOH 4A3MJ 5E1XA 3RKXA 2VT2A 1ACIA 2E36A 2X9DA 5D5UB 4A3JJ 2HKOA 4I7HA 4BL0B 1MBFA 1SVOA 1JGSA 4BE2A 1EH8A 3GWZA 1FOKA 1FSHA 5BMZA 1G3SA 1YO5C 2R7DA 5EG0B 4OMZA 2EV5A 1MDMB 1PUEE 3PM1A 1SVMA 4B3XA 4PSWA 4IHVA 4XKBA 1BL0A 2R5ZB 1FX7A 1YI2I 4C2MJ 3HZJA 3HTSB 1X1PA 1U5TB 2L2OA 4HLYA 4LLNA 4X1EA 2EFQA 2QF7A 3M3YJ 4DIQA 4PZJA 1ZTRA 4FTHA 4G7HF 2JUGA 2LREA 2F5CA 2NXNB 3JSOA 2ADUA 4A3FJ 4UB6C 5HNFA 2VPLA 2AO9A 5LHIA 3IRQA 4JQFA 1BJAA 1O7LA 1UAAA 1IN4A 1S29A 4RAZA 1G8XA 3PL8A 2KRFA 2DYSH 5E3OA 5BPDA 4F55A 1R36A 3NRVA 4B1RA 2W1OA 2L7ZA 2VBWA 5M3MJ 3MZ8A 4JYKA 1I1SA 3P5JA 4UNOA 1OMIA 2G9WA 4XOTA 1R58A 4ZYEA 4Q5SF 4B48A 2WB1A 3JCUC 3NEUA 3HHGA 1QPMA 1X2MA 5LGTA 2GXAA 4A3IJ 4EV0A 3AKZA 4IHYA 5BS6A 1IRFA 5J4YA 1QU3A 1U6GA 2EH3A 3IWZA 4UUSA 1YTYA 2ID3A 2D1VA 4UB8C 5GAHJ 1AKHA 2JJ7A 1CF7B 1ON1A 4AC0A 2E1OA 4ASNA 2HVSA 2IT0A 3PNVA 5HS7A 1W36D 4B3AA 1VQ7I 2KQRA 1RKTA 3NQOA 4ABZA 3OSGA 2X51A 4IPAA 1IN8A 4BGDA 2WC2A 2L9NA 5FGMA 5M5XJ 1EH6A 1O57A 1W4MA 2CS3A 1ZN2A 2DMNA 4XM3A 5FFXA 3PO2J 3RI4A 1R1UA 4CUGA 4A12A 1TWAJ 2MFZA 1MMSA 2W7NA 1TLHB 5C44J 3F8CA 2A69F 3UR3C 4Y13A 5EZHA 3WE2A 1WZ2A 1ZARA 3FXJA 3ONQA 3F23A 3GXOA 2BW3A 2VXDA 2XDVA 1BIBA 4PFPA 5JR3A 4MHGA 3W2VA 1XMXA 4UVBA 3H3VK 3FXMA 3MZYA 2ZJQF 3WE3A 1OKRA 3HOYJ 3W2WA 1S6LA 2F48A 1P7JA 2L9VA 2LF7A 1GVDA 1TQPA 5D5XB 1YRNA 2O61A 2MC4A 3LQRA 5LGUA 3A01A 1EF4A 4ZDOA 2V79A 4IF4A 1XGOA 1TZLA 5IPAA 3TDZC 2XAJA 5CVVA 5GTIC 3N05A 5IOYA 2JRMA 3MZHA 5IT9Z 2VBZA 3BG6A 4ANJA 3LFKA 4IRHA 1BC7C 4JOMA 2NOGA 3VB2A 1ZGWA 2MD5A 4OIRF 1RNLA 3OOPA 4DZJA 3CC2I 1M1EB 2F5VA 4V2GA 1F43A 1B9MA 2R0QC 3B73A 4X6AJ 4BJ6C 2MC3A 4MQ9F 3L00A 3OWTA 3V4GA 1F1ZA 2TCTA 3I4PA 2FMYA 3ESWB 3OYHA 4MQVA 1WJFA 4AYBN 1TQMA 3RYPA 3OOUA 5K7ZA 1BJZA 2HYFA 2XF5A 1Z6TA 2MH9A 1WJCA 4KMUX 2PX9A 1R9TJ 3DU5A 1ZREA 1W1WE 1WI9A 4IHWA 4CH7A 3LSRA 1HC8A 2CSOA 1BIAA 1VQKI 3KP2A 5H20A 2EWNA 3BDDA 4KISA 3GTOJ 2XB0X 2EIMH 1OCTC 1U2WA 4EJVA 3E6DA 1P2FA 4CYCA 3H35A 2VL8A 2LG4A 4JK1X 1BM9A 2RAEA 5EGOA 5LBQA 4I02A 3J80K 4JX5A 3DEWA 3ZMTA 2F4OB 2M30A 2UUZA 1STZA 2GM4A 2X1DA 1MBEA 4M71A 1HXDA 1QA6A 3BOQA 4ENKA 2HYGD 4Q47A 2YS9A 3IH4A 1A31A 1B59A 1IF1A 1Q1VA 4L0ZB 1WPKA 2QWWA 3RKYA 2I8DA 2VUMJ 4HAMA 3AL0B 4KICA 2GOXB 3G1OA 4MEXF 1A04A 3QP6A 4Q48A 1DP7P 5J1UA 1K83J 1NHAA 2LY9A 3MKLA 3CUOA 5CYVA 2EINH 2DO7A 4UHTA 4A3CJ 3O3KA 3I55I 4CCMA 1FYMA 4XQFA 1U0JA 2A5WA 1D1AA 3QYFA 4HSRA 3LSPA 2BV6A 3U1KA 2P81A 2OV7A 2CGPA 4J19A 1LFBA 3F6OA 4HBLA 3HC7A 1XN7A 2EK5A 2IJLA 4M6VA 4IHSA 1XS9A 3S8PA 3V7SA 3HKZA 1HDDC 3OYIA 3GMEA 1I1GA 5K5RA 2LKXA 1LEAA 4DBQA 1VQ9I 3CLQA 1YJNI 3ZGKA 5IT9K 2IEKA 3K70C 2Z33A 4RA2A 3IH3A 4AUXA 1IXSB 5JLWA 2XV4S 2HGCA 3ML6A 4IZZA 4AIKA 3HOUJ 5L3CA 4G6TB 1TL8A 1K6OA 1SFXA 4M3DA 4XKCA 2NNYA 3BROA 4DYQA 3O8HA 2JK3A 4YG2F 4L0YB 2NVUB 2IBDA 5DD4A 2ZMEB 3IV5A 5ILVA 3OL4A 2W57A 3H36A 5CQEA 2O7OA 2XKPA 1VQ5I 1YS6A 3KETA 3BG3A 1XB4A 2RVCA 4U7BA 4DJAA 1V5FA 4PK4A 4HA8A 4HZFA 5J47A 2BBYA 3FMQA 1GLNA 4HEA2 1USSA 4A6DA 3JRAA 1Z3XA 4M3GA 1KQ0A 3WG7H 3ZQFA 3BTCA 3BZCA 1I6XA 5L3EA 3F8FA 3G71I 1B6AA 3GLXA 3K4KA 4EGYA 4ZJZA 1BA5A 1MMAA 3CMAI 1AA7A 3PQKA 1LUJB 1MBJA 2Q0OA 5BPIA 1P7IA 1R00A 2QVOA 5D4RA 3HOXJ 3LMMA 3ZP5A 2QBYB 3WU1B 3MWMA 3WTUC 4WF2A 4I2OA 4BXUA 1B9NA 1MMDA 3A01B 1Y1VJ 4AIJA 2OQRA 1IW7F 3B6AA 4HLXA 5L3FA 1DGRM 3GYHX 5K7FA 3J7AO 3H5AA 1W0TA 2H6BA 1JUMA 1RESA 3S1QJ 1VTNC 3OYLA 2FNPA 4EJOA 4OMYA 4YRVA 5TGTA 4IJAA 1E3PA 1VQNI 2CUJA 3PSIA 2WV0A 4Y3OA 3KP7A 3TEDA 2JTVA 3ABMH 1LEBA 1J0RA 1U9NA 3HRTA 5D4SA 4U0VA 5F0HA 3CCUI 2EZLA 4KUMA 3ZN1A 2CYYA 1DUXC 3ZQQA 2DT7B 1ZLJA 1USTA 3BC8A 1J2XA 4BBSJ 2MG4A 1KYWA 2W25A 3K1NA 1NK2P 3ZRGA 5D5WB 1OR7C 3A4CA 4BU2A 1GV5A 5DV5A 5GAEJ 1FP1D 1JKPC 5EZGA 3ISPA 1ZAOA 2K5CA 3H5NA 1B72A 1ETQA 3P9IA 1W7PB 2PN6A 4G12A 1MJAA 2XAHA 3BTJA 3MVPA 3R0JA 4RGXA 4FISA 4A0YA 2XGCA 3AG4H 3RPUA 4PJLA 3S15J 3GFJA 2P8TA 1W0UA 2BXZA 4U88A 3JTGA 1E3OC 4RM3A 2GIVA 2DFHA 2DJIA 2FMLA 5FD6A 4A3EJ 2OCEA 1L3LA 5GADJ 1HA8A 4NUBA 3CMYA 3CF2A 3VODA 2A05A 1WWXA 1Z0XA 3S32A 4IRGA 4BS9A 1HDPA 4RM2A 1YIOA 4CYCB 1KU2A 1S3JA 2DW4A 3DKYA 2AS5F 5EGOB 3CTAA 2AQEA 2F5FA 4KT6A 5IYCJ 3EDPA 2L02A 2K9QA 1D1BA 3HOWJ 5H6QA 1J09A 3B02A 2IP2A 2RC4A 2M4KA 2TRTA 4ITVA 3FISA 2XAGA 4FETA 1KGSA 3DU6A 2GZWA 2NS0A 2LR8A 3PNTA 2WY8Q 1LDJA 4ENNA 4ESBA 3FMSA 3FXUA 1JJ6C 3FM3A 1MDMA 5E3NA 2M2EA 3Q9VA 1O4XA 3BPXA 4MLOA 1MBKA 3I59A 3RKWA 2I10A 2R5ZA 1WJBA 2OAZA 3TOBA 1HKSA 2E2HJ 3WGHA 3OYEA 4PCQA 5FROA 4LB6B 1QVTA 5KAIC 1Y0UA 5ICGA 3OYKA 1U5TA 1T38A 2PEXA 2RQPA 3E0JB 3IH2A 2Y9YA 4HG2A 1APLC 4HYEA 1I5ZA 2BY2A 3FKIJ 4A6EA 4XONA 2YU3A 4UXNA 4D7MA 2ZB9A 3O8GA 3OIQA 2LYCA 2ICWG 2JRTA 3DLLF 4V2FA 1BW6A 4P9UA 3JRIA 2XSDC 2C6YA 4D0PA 2FOKA 1QHHD 2QQ8A 3GX4X 3M1CA 2BVMA 1R49A 3OYNA 3TQNA 1FEXA 5LHGA 4HNTA 1VF9A 2X1EA 3L1PA 1D5VA 2ZNZA 4GXOA 2CJJA 2DODA 4LG0A 2VODA 3H0GJ 2K27A 1HW1A 1UHSA 3QPSA 2P5LC 3ASOH 2D2WA 3SEQA 2GA1A 2DCEA 1P4WA 4E6KG 3H9GA 4XORA 4GFBA 1T56A 5J8CA 2HXOA 2MH2A 3RZDJ 1R23A 1T8IA 3CUQC 3HXLA 3ZN0A 3M7GA 4M3FA 2L5QA 1IAWA 2DQRA 3ZXSA 1CF7A 2R7FA 1MIJA 3LQQA 5LEKA 4EMSA 2QENA 2R7SA 2KMUA 4L18B 5IT3A 2FQ3A 5DD8A 2W84A 2Z2SB 3VEPA 1IC8A 4E7JA 5IP6A 3ABKH 4I09A 1VQMI 2DDAA 3JAMZ 2V26A 2VJJA 4IO9F 5E20A 3HOZJ 2M8GX 3DCFA 3ZMZA 4HOBA 2A61A 2G7HA 1WHUA 2F2EA 4PJMA 2ZXHA 2K85A 1XSXA 3LAPA 4OWRB 1IGNA 3JRGA 1TW2A 2V7FA 2W4SA 2LOOA 3K10A 2JN6A 4WXDA 1FMVA 3SEZA 3MKWB 4CZCA 5F04A 2FBKA 2CQXA 3QAHA 2M87A 3K7AJ 3GVAA 3I9V2 2E7WA 3V7CA 5FKOA 1TC3C 2LF8A 1ZQ3P 1XC5A 3HB9A 4YFNF 4KIFA 3QU3A 4D7NA 4HX7A 2NYXA 2HDDA 1T39A 2YX7A 1UELB 1X1DA 2CV2A 4LG3A 2DA7A 5CVJA 2HQNA 3SYTA 1Y56A 3PFIA 2OZUA 2PMHA 4A3BJ 3EUHC 4PFOA 1Z7LA 3H3ZA 5E8GA 2VQGA 3G73A 2K9NA 2KJCA 3TO7A 2J5PA 2J5OA 3S3MA 4NC8A 5J40A 2NNNA 3F9KA 2DMTA 2KDOA 2R3SA 3ECOA 2K4BA 4E7SA 3DLAA 3EQLF 1ZR4A 1SFOJ 3ZQHA 5BOXA 2KISA 2A6TA 2EZHA 2JA6J 1GV2A 1I39A 2M7AA 3GBGA 5EEGA 2XGXA 4KT5C 2PG4A 1V3FA 2IPQX 3CCYA 4A5NA 2GLOA 2CQNA 5HLGA 1X58A 5DUKA 2W48A 2ZC2A 1VQPI 4CGZA 3M8EA 1MNDA 3E6MA 3FX3A 3RSNA 4XRSG 2R4GA 1OLTA 3HL2A 4DW6A 4ZTFA 1WJEA 3HRUA 3D0SA 5HNHA 2LC2A 3WTWC 3CCQI 1ITYA 1ULYA 2EJRA 1FP2A 1RI7A 1K4TA 1VNDA 3OYMA 1DDNA 4I0BA 4IVNA 2Z3YA 1Y1WJ 1BC8C 4I98B 4LMYA 3WTVC 1MD0A 3ZQIA 2Y0SA 2N8GA 2COBA 4RLQA 5EDNA 1UJ8A 1R5GA 2DA5A 3S2WA 4XLPF 2BVLA 2ESHA 1LE8B 3R61A 3GFIA 4HQMA 2IGOA 2B7EA 4ZC3A 2BGCA 3Q3SA 2O5RA 3FZVA 2EIKH 3I58A 2LTPA 3SZTA 2M45A 5FLXZ 3KP6A 3JSPA 1BI1A 2CUEA 3I59B 4U0YA 4HQEA 1MBGA 2XRNA 3FMRA 2B9SA 1IN7A 2H27A 3V8LA 2EILH 2M7BA 1Y8RB 1RR8C 3BJOA 2A6EF 3EUHA 3K4MA 1J7KA 3RQ4A 4OIQF 2KFDA 4M9ZA 2ECCA 4Y15A 1MSEC 1WGXA 2L7KA 4GYIA 3QP5A 1N78A 2E19A 1QBJA 3OYCA 4GGGA 3QYEA 2XVCA 1Z05A 2HTJA 1ZK8A 2QUFA 3MN2A 3GTQJ 3BZ6A 2NVYJ 2FNAA 2G7UA 2LK2A 1YJ9I 2HPIA 4OAZA 3DTIA 3EETA 1S5LC 4Y17A 3I64A 5L3DA 3T8TA 2TDXA 3CO6C 3S1NJ 2XSJC 3BG7A 3I56I 4LG0B 1WH7A 1H9GA 3JREA 1A36A 2XROA 1I3AA 2HOAA 5KVRA 1QQIA 2K9MA 3W3CA 3OYBA 3KYLA 5M5YJ 5EYRA 4XSXF 2IRFG 2IGMA 3FWEA 2ZMEA 3UKGA 3Q5FA 1XX5A 1R7JA 2CW8A 2ME0A 2MYSA 2Q1ZB 1XSDA 1RRJA 5JVTA 3CF5F 2GIZA 4Y7NJ 1QHGA 4LK1F 1BW5A 3IUOA 5KHDA 3KYCB 2MLGA 2G0EA 2PI0A 1JT0A 3OYGA 2AQFA 2JSPA 5HLIA 2OUMA 4XIDA 3D1NI 5A2QK 3E6BA 2VJIA 4ZZDA 4BDZA 4HRIA 1E0EA 2LD5A 3SXYA 2CFOA 2IA2A 5HODA 1UZCA 3QPTA 1ETXA 1D0XA 1JKRC 1XGNA 5HDGA 1FYKA 3RDIA 5DUIA 4XNFA 1X3ZB 4N9HA 5JHFA 1Q1HA 2HQRA 2M8EA 2M4GA 1FY7A 2I5UA 5F6FA 2VBXA 1R6RA 4F3QA 1EH7A 2P7CB 5FRNA 4LIVA 1NK3P 4L9NA 1BI3A 2IVMA 3J7AY 4E7LA 4C2UA 1DQUA 2WY7Q 2QBYA 1F36A 1WCMJ 1WRJA 3QOEA 4LK0F 4B4CA 2NVQJ 3BQZA 2E5NA 3EUKL 1SEUA 2Y48A 2GXBA 3LA7A 4XLNF 4U87A 4E4HA 4KFCA 4A69C 3VYRB 4NNJA 1ETWA 3N4MA 1IXRC 2KL4A 1QPIA 1D5YA 1FT9A 2F5EA 2WA0A 4LLLA 5L3BA 2V1DA 2F4IA 1SD6A 4AIHA 1S7AA 2MSYA 1NG7A 3Q0WA 5KCMA 4DBRA 4KIBA 4QSHA 3RCOA 3NAUA 2ZKZA 3W6KB 3W6VA 2ELKA 2OTLI 2ZCWA 4IEJA 4ETSA 2YR2A 4II2A 2XGDA 2ACJA 2VKEA 5LFAA 5CVUA 3DXJF 3O2PE 5K5QA 4YELA 1KYZA 3CUQB 1FBSA 2A5YB 4HPQA 5JVGF 5D6FA 4BXXJ 4CO8A 4HNVA 5K7HA 1W7PA 2IXSA 3GO5A 1T0FC 2FOWA 1JTYA 1FYLA 2KZGA 3NWTA 3RQIA 1V5EA 2E7XA 6PAXA 2RNGA 1MZBA 2L9RA 1DP3A 2O3FA 3JRCA 4FX0A 3VFZA 2EFWA 4G7ZF 4YIIA 2R5YB 2KPMA 2V9PA 3S3NA 2XIGA 2XUBA 4BAYA 1FBQA 2QCOA 1UCRA 2XB5A 2OU2A 1JKOC 2H94A 1U9OA 3ZMVA 2STTA 1MMGA 1P9QC 4KA4A 1ZHFA 3A02A 3CP8A 4D5FA 1U78A 1DPUA 4LFUA 5FLVA 5H2FC 1SAUA 2BZTA 1A5JA 1MBHA 2R7ZJ 4LLGF 3KFWX 2DT5A 1Z1DA 3F6VA 2IA0A 2RDPA 4HX8A 3HRSA 3OIPA 3C1DA 4XMYA 4JP0A 3TO6A 3CD6I 2LSOA 3PUBA 5FJ8J 1ONVA 1GDTA 3DKXA 1TWHJ 1T6SA 2R7RA 3GZNB 4M3BA 4BH9A 2HOSA 2CMPA 3KP4A 1BBYA 2LP0A 3I54A 3HJEA 3RJPA 4AYBA 5HDNA 2XASA 2LY2A 1LVKA 1ZGAA 2P6TA 1W5CC 3KP3A 1FIAA 3KE2A 4BXFA 3FHNA 2O03A 1ON2A 2IA1A 1YX3A 3I0TA 4KYWA 3S14J 2PQ8A 3K4NA 5GAGJ 5EJCA 4BY1J 4A3DJ 4N4OB 4GRIA 3HSFA 1C0WA 2X4HA 4MEYF 1JTXA 3G2BA 2QKLB 4MNUA 1HKTA 5LHHA 3RZOJ 3D5RC 5ILSA 4BNCA 2ESNA 1G6NA 1XTAA 3GFLA 1CGPA 3FDYA 1JXSA 4ZYAA 2KIUA 1MMNA 2HOEA 2FSWA 4YEJA 5J3LA 1VQLI 4ZYDA 4RGSA 1IRZA 2R7UA 4UUTA 4PDKA 1R4NB 2E71A 1XDUA 5ICCA 1KQ8A 1N75A 4M72A 4CCOA 3CJRB 1YS7A 2M9HA 2ISZA 3GTPJ 3WTYC 1R1TA 3CCRI 4XN3A 4GYGA 1IUFA 1IRXA 4OIPF 1OYIA 3CCVI 4G94A 5GPAA 1KU9A 1IRGA 4XLCA 2R7VA 4R1HA 4IOAF 1WQ2A 3W2AA 4XRSA 1G2HA 2CU7A 1IUYA 3IWFA 4FHTA 2R92J 2OF7A 2STWA 1LDDA 2VBYA 5DM7F 4P1WA 2QM3A 3ZQ7A 1LJ9A 1RUNA 2KRHA 2FBHA 3LL7A 2JPCA 1FLIA 1ZG5A 4S0HB 3A0BC 3JRBA 1IG7A 4CCKA 1JHFA 4N4NB 2LDUA 1UG2A 1QRYA 3VDXA 1WJ5A 1BN5A 3IAS2 2EA2A 5CJ9A 3LSKA 5EEAA 2DFFA 2CQKA 3DFGA 2LMDA 4NC7A 3R4KA 3SFZA 2FD5A 2GOMA 1T08B 2O9LA 1IO2A 1PJRA 2DOAA 1FSEA 3CC4I 2L7FP 4IHXA 3FK7A 2UXXA 4S05A 1HKQA 5C3EJ 5BNGA 5L3GA 2H1LA 3OYFA 2FQ4A 4C3HJ 2DN0A 3OY9A 2CH0A 3FM5A 2K02A 4M6YA 3RYRA 3L2QA 2M5WA 1VQ6I 2VXZA 2CFXA 3HOSA 5DYMA 2HQAA 1FOYA 2WAEA 2NAZA 3H9QA 4BHCA 1IN5A 5HOOA 1ZGJA 1LFPA 4IKFA 4AD9A 1BOBA 1TBXA 2FE3A 2WAQN 2OA4A 4IRIA 1H9TA 5J1YA 5B3SH 1BR2A 3TKYA 1JJ8C 3DWLE 4YFKF 1JHHA 3WU0A 2LNBA 5EF6A 3H1CA 3HRMA 4C9YA 1O3RA 3A03A 4HF0A 2P7VB 1XCBA 2JWTA 3M9AA 2Z5UA 2MGQA 1S72I 2V1UA 5ED4A 5HVQC 5J1RA 3CJTB 1OISA 4HSTA 4M73A 3SZPA 1SD7A 2X6OA 3S16J 1X3WB 2YU9J 2X6YA 4OOIA 4GDFA 4F92B 4L5IA 5GPCA 1JUSA 2FU4A 5TISC 1S8NA 2K3FA 2ZXIA 3GTJJ 1I50J 3WHBA 2AHQA 3BWGA 3BR2A 3PIPF 2DA1A 4IL6C 1Y6IA 2XRLA 1BOAA 2VKDA 5TJJA 4LJZF 3HPHA 3B6CA 4HDUA 4DZPA 1QZYA 2P0WA 3M07A 2HFHA 1R1VA 4Z6YA 4RAYA 3HOVJ 3CDLA 3FXKA 1OYWA 3J81Z 2K4JA 4IQJA 2Z1DA 1KU3A 2HTSA 1LE8A 3QRFF 2R7TA 2YPRA 2XC7A 4DYRA 1FPQA 2OTJI 4ZH4F 1YW8A 1OJLA 3NARA 1YQAA 2A6HF 1YIJI 2DYRH 4BY7J 3KEOA 3U9GA 2LKPA 4CZZA 3BTLA 1OYYA 2Y75A 3V8KA 4B47A 4S04A 3JRFA 5JHUA 5F64A 4EJTA 3M4OJ 3WTSC 4E7IA 3BR5A 1UG0A 2KJBA 2Z16A 3G1LA 2HQ5A 2CO5A 3LSIA 4ZYGA 2K86A 3GTLJ 3DPTA 2O8KA 3I5UA 2EQRA 2Q2EB 1ZLKA 3GZ5A 3ZCOA 2KP6A 1OR7A 2DMQA 4TV7A 1WVRA 4R79A 4EJWA 2JUCA 3GW2A 3S3OA 1REPC 2CRGA 2KIFA 3U21A 2WBMA 3ZR8X 2CW0F 3CMMA 4DYCA 1JT6A 3KLOA 2H8WA 3T8RA 3FHZA 2JT1A 3RPUD 1X3UA 1FIPA 2M0MA 2LRDA 1IV6A 1TP4A 3ZMSA 2HZTA 2JA2A 5FFZA 3F0CA 2VE9A 1HQCA 1K4SA 3S17J 3K2AA 3OIOA 4IOCF 3IKVA 3K1MA 2IS6A 2PMZN 3ZQLA 5M5WJ 1CQTA 4KN7X 5IYBJ 4WX9A 3GTMJ 3WTXC 1O3TA 4W97A 3PJRA 3A0HC 1K79A 3DBHB 1YOVB 3OYAA 5D6EA 2KZVA 5IP9J 1N25A 2VOPA 2VKVA 1E3HA 3BZKA 4M9XA 3SDBA 5DEQA 5J8FA 1JE8A 1FTTA 4EVIA 2Y2ZA 2M1BA 2GBYA 4HDVA 1FMWA 1WFXA 4XICA 5DCFA 2R7QA 2BHYA 4XKVA 4FT8A 4XR6A 3K4CA 2L0KA 1FOXA 2DOFA 3JRDA 1SVLA 1Z3YA 3ELKA 3N97A 5ICFA 3DV8A 2PJRB 3FXLA 1IZ1A 3DQVC 3S1MJ 4EM1A 1NTCA 4A93J 3TDUC 1ETOA 2Y31A 2YUSA 2GXGA 2DPUA 1UB9A 3BJAA 5LGNA 2OD5A 4X0GA 1MH4A 2M3AA 3GCMA 3VSLA 1BR4A 2WADA 4CDGA 4A3LJ 1DPRA 2DA6A 2DLLA 2BY0A 1JI8A 1T33A 3CCSI 4PUSA 5E3LA 4D5CA 3QOPA 1PYVA 1TQIA 2QQBA 2RKHA 2VJ5A 3P7NA 3CCMI 1H89C 5FKLA 1LPQA 2DA3A 2DFEA 2QQ9A 2HI3A 3KPHA 5LRSA 2DDBA 2E60A 3EYIA 3RTRA 1TWCJ 4OIOF 1FOWA 1PVEA 3D5SC 5IOZA 3TW7A 1ZKGA 4YFXF 3OS0A 1LB2A 2IGKA 4BJTA 3HGGA 4C30A 3ERMA 1S9HA 4Z2YA 1ZELA 2WAFA 2OPTA 1J9IA 3AFHA 2VASA 2BYVE 1G59A 1TNSA 2FBIA 3L2UA 3BTIA 2VE8A 4G6DA 3C2BA 5DS9A 1Y0NA 3UNGC 4HF1A 5HDKA 4IQ4A 4ON0A 1OPCA 2RN7A 4N9IA 2Y0SN 3CUQA 1ETYA 2AXLA 1Y8QB 3IC7A 4XN0A 3VYTB 3BPVA 2BY1A 2HVQA 2DAOA 3QODA 4BHPA 2X85A 4PJ0C 5ICEA 2EV0A 2ISYA 2FEZA 5KAFC 1LFUP 3KLNA 4QIWN 5E1WA 4KNYA 4J01A 2R5YA 2K9LA 4AIDA 3PSFA 1AU7A 1B4AA 1OFCX 4OU0A 2OC6A 4ENJA 4UUVA 1IDZA 3H92A 2E1MC 5HS8A 3JR9A 4B09A 5FRMA 2NRAC 1YJWI 3F21A 1B1BA 2NVXJ 3BR1A 4BQQA 1BI0A 5DTDA 2YX4A 4CA0A 2DK5A 3K0LA 2JA5J 4HF2A 1EV7A 3G3ZA 4G9YA 2MD0A 3HTUA 3F22A 2BHZA 2XF6A 5JFRA 4NDLA 2R7XA 3GFMA 1FC3A 1ZG3A 1TNTA 2GAUA 2XHKA 1QVUA 3BJ6A 2ECBA 2A68F 4AM3A 2D45A 1R22A 4PGGA 3HGYA 5JLXA 3RKQA 1W5TA 2UZKA 1HW2A 2W00A 3P9CA 4BQOA 3QPHA 1YW7A 4NB5A 1O3QA 2DFIA 3E7LA 1N77A 5E3MA 1GXQA 5FKMA 5DDGA 3DTKA 1I3QJ 1XMKA 3JAMK 1LQ1A 5D8KB 2WB1N 1GVJA 3LA3A 1XGMA 2D5VA 2R7OA 2DA2A 3W6JB 5FLMJ 1TTYA 3G1MA 4OINF 4XK4A 1ZR2A 1B8IB 1QNTA 5B66C 2V6EA 3ZMDA 3R0AA 3TL4X 3QU6A 1E17A 2DOEA 3KZYA 2VB6A 3HSEA 2NS7A 1HLVA 2X6XA 4A3KJ 1I6HJ 4ENMA 1AHDP 1RR7A 5FD5A 4RGUA 1J5YA 2DT6A 4H0EA 1RKWA 4MIMA 2XKOA 3PFYA 2LKSA 1T2KA 4QTRA 3VOEA 3DBLB 4NQWB 1QO0D 3MQ0A 5BQTA 3IRRA 2PJPA 1VI0A 5IY5H 3HPGA 1XGSA 1XDSA 4F93B 5F1JA 4QWQA 5F1RA 1X2NA 1IJWC 4RAFA 1RPWA 3MFKA 3ZPLA 3BR0A 5FO5A 3AG3H 4UY8I 2KDZA 2QLZA 4P96A 3GUDA 2L9SA 4EM2A 3TGNA 2VN2A 1UMQA 5IP7J 2ZFUA 2E2JJ 1OCZH 3LFUA 1XG1A 1FNNA 3J80Z 2P5KA 4R8HA 3L2VA 4V19K 3I53A 2CV0A 4AVZA 3DPUA 4GCVA 2CUFA 3MCZA 1X4OA 1D3YA 5CLSA 4CSWA 4UV8A 3GF2A 5KNLA 4CICA 2EBIA 3H5RA 3M1EA 4O5VA 3C2HA 3CP2A 1TW3A 1SMTA 1JGGA 5LLQA 2O8XA 3C18A 4LB5A 3QWLA 4M9SA 1MJ9A 3OYJA 3CMEI 5AONA 1IXCA 4L5JA 1LKXA 3T0YA 4RDUA 2BE5F 2ZSIB 4QLCU 1S7EA 4I76A 2IGNA 1F5TA 1LDKB 1RC9A 2BOLA 2VIXA 4DNCA 5E79C 5ILUA 1FTZA 3M8JA 2OCCH 4YIFA 1YE9A 2JPBA 5C4XJ 2HZDA 4WWCA 1Z9CA 1T95A 3VSKA 4BEHB 2V4JC 2RV8A 3Q9SA 1KZHA 4E70A 5FLXK 1VFCA 4QPQA 4DQ2A 1OCOH 5LEJA 4U7DA 2ZFWA 2ZSHB 3V7RA 3R60A 4UVAA 3PQJA 1MKMA 1WSUA 3BCAA 1X1AA 2WV1A 4EATA 5B5EC 1R5ID 1X1BA 3HBLA 3F8BA 3JTHA 1IDYA 2DU9A 4C3IJ 4EM0B 1K6YA 1HSTA 5DCMB 3F8MA 4FE7A 3TW6A 1ODDA 2HKXA 2BY3A 1HBXG 5E8IA 4XRMA 1D1CA 4BE0A 2HVRA 3GEZA 3BLYA 2VQCA 4WXHA 4JBAA 1WH5A 3KX2A 4BQAA 3Q0VA 2IS4A 3EPZA 2HEOA 1JKQC 4MO7A 4G7OF 3S93A 3FBNB 1HF0A 1YW9A 2V1NA 4BUPA 4CCNA 2MABA 4WK8F 3LAJA 4PSXA 3F72A 5EEHA 2M0CA 5B1BH 2XAQA 4F7ZA 2W24A 4QPOA 2RQQA 2HNHA 3HUGB 1Z21A 4II3A 3PUFA 3HSRA 3K2ZA 2LBFA 1D0ZA 2QKMB 4FE4A 3OL3A 2L4MA 1YYVA 5AIPA 1ZH5A 4KJZA 3FBIB 2FUG2 4XLAA 2ZJRF 2K40A 3HYIA 1UHWA 4MTEA 1XSVA 2LFBA 4KIGA 4YIRX 2FA5A 3HEFA 1PUFA 2JVHA 1WJDA 3OR2C 1FZPB 4BKXA 3LNQA 3KYDB 3HDDA 5ERIA 1K78B 2KKOA 4XRFA 1ZRCA 3J7YJ 1A6IA 3HKZN 1R5HA 2Q8KA 3SFIA 2VC1A 4O6JA 4XL9A 4XLEA 1W5SA 1UHMA 1ZRFA 2F6CA 1P4XA 4C2TA 1LNWA 1ZYRF 3E5QA 1SFEA 4ZDPA 4I0AA 5HS9A 1KU7A 1MSFC 3I71A 3L7WA 3IKTA 2VPRA 3KP5A 4A0ZA 2EFNA 1GUUA 1VQ4I 4MGRA 4P5OA 3REOA 2CWEA 3DPLC 3F8NA 3FK6A 2E35A 3LOCA 3FF5A 1XMAA 2JMWA 2EIJH 2Q2EA 2X0LA 2UV1A 2VI6A 4IX7A 2XPWA 1YITI 1J75A 4RAGA 2RNJA 3SZGA 3ZQGA 1O7FA 3OV8A 2JA8J 3P9KA 3T1BA 2NOJB 3KEQA 1K7AA 4BBRJ 4BYYA 2H09A 1YLFA 3RPQA 3ZMUA 3MAJA 3WGIA 3DKWA 1NG6A 2EZKA 3J7ZI 3SJMA 1ZG1A 2DQLA 4ZDLA 1W7PD 4RBOA 1T0FA 2YSRA 2XAFA 4HW0A 2ZNYA 4M6XA 1OCCH 3MKYB 3MEXA 1SANA 3PO3J 3IAM2 2Y69H 2XAUA 3ZOBA 5TRDA 3T5XA 3FXOA 1R4MB 2LH9A 4N0BA 4D9JA 2HWVA 3OS1A 4WCGA 1MNMC 4L9VA 1MGTA 3U1DA 5E17F 4XLHA 1PP8F 2GWRA 2E1MB 5F0CA 1YFHA 2EFOA 3KIOA 2EA4A 4XBFA 3TP0A 3IL2A 1FBUA 1RZ4A 3DF8A 2IAIA 5F27A 3LA2A 1G3WA 3HG9A 1TT5B 2VKHA 4M74A 4O3MA 1YX5A 3BY6A 3KZZA 5C4JJ 3BR3A 1RUOA 2P4WA 3K4JA 3KZIC 1LVAA 2L3DA 4NC6A 3EYYA 2E2IJ 3BCBA 4RB2C 1NH3A 4Y4RA 1HCRA 3MMYB 3A2KA 4XKWA 2W85A 4ZZLA 4L9JA 4AU7A 3HOTA 2VC0A 2X6WA 3F3XA 3K9TA 1U8RA 3S2HJ 5FKKA 4BJ5C 4PJNA 2ID6A 4HNUA 2PJRA 4UUSB 1Z67A 1Z7UA 1ETVA 2A3SA 3COAC 4PJJA 1AKHB 2HS5A 4LIUA 5GP9A 1UFMA 2KIQA 2VT3A 4FQGA 1RETA 1H0MA 2EPFA 2E1CA 3H3UA 5DM6F 2LVSA 3L09A 2VOOA 4LOCA 1GHCA 2DTRA 4EGZA 1IV8A 5CKTA 5CQGA 3OYDA 1F9NA 3K69A 2DPDA 3CLOA 1JUPA 1ETKA 4CHUA 2B63J 4Y33A 1Z91A 2ZXJA 2V1XA 4I6ZA 4ESJA 4B44A 5D5VB 3BT9A 4PGHA 2HU9A 2DBBA 2JSCA 2BW3B 4C3JJ 3R6SA 4Y52J 3FKJA 3SHFA 2EB7A 3WGGA 3C3WA 2DK8A 4WXCA 1VQ8I 1U3EM 1G3TA 1K61A 2CG4A 4IXAA 3H9JA 2B0LA 3L2CA 1YRNB 2NVTJ 2GA2A 4P55A 1A35A 1HOMA 2F5DA 3HM5A 3I3LA 1SAXA 1TT0A 3DEEA 3TP3A 5KK1A 4ZTJA 3CJQB 1X1CA 1D8KA 3QQAA 3QYBA 2CQ7A 4I01A 3TBIA 3CO7C 5K5OA 4H4KC 1U5TC 3K1PA 3KEYA 4K2EA 3BQYA 1S7OA 4CYDA 2IS2A 4E7ZA 2PBIA 2MA3A 3I4MJ 1DU0A 5D8LB 2E5ZA 2OZ6A 3ZQCA 2ZBKA 1SMYF 1P92A 2FXAA 3LSMA 3IHUA 5CVRA 2H1KA 2OBPA 4DGWB 2F4MB 3E97A 1MJBA 4RLFA 2UXNA 2QEXI 3L9FA 3WU2C 2KRCA 2DXIA 1DU6A 2LBFB 2QSFX 3K4BA 1QZZA 1F4KA 1KA8A 1BI2A 2Y0MA 2LLKA 4F52A 1GT0C 3S2DJ 4D1QA 3PIOF 2L01A 2CQQA 2QZ8A 3LSTA 2ME6A 1BR1A 2BEOA 3MD2A 3FXQA 3VYSB 2EFPA 1PUFB 4P9FA 2V9VA 3OMYA 3GZ6A 2XF7A 2VQLA 3WTTC 5FB2A 2ZO4A 4NBQA 4A0XA 1AOYA 2CW7A 3HHHA 3VPRA 3I4NJ 2H6CA 3E3VA 4G8XA 4XLFA 3TOAA 1AWCA 1A6QA 3SQNA 5B1AH 3LSGA 4L5EA 5HLHA 2WAQA 3DP7A 1SD4A 5H6RA 5IYDJ 3CCJI 1FJLA 4RB3C 2DMPA 2WTEA 1X4PA 1B8IA 3WTZA 2E34A 3NWSA 2L4AA 4UVCA 3PNYA 5GTHC 1E2XA 1QZEA 2HYJA 3H0DA 3K70D 5EG0A 2HDWA 2O0YA 2BXYA 4FASD 2ZJPF 5J4VA 4F91B 3D5LA 3M8FA 4M3EA 4ESFA 4MFDA 5F08A 2Z99A 3Q0UA 2QYOA 3ULQB 2V9KA 1SFUA 1H88C 1FWZA 4XOPA 1GXPA 5F0FA 3O6BB 3FXRA 4BHBA 2HR3A 3WG9A 2HPMA 3GTGJ 3CZ6A 2JZYA 2HOTA 3QPLA 3AG1H 3X2QH 2KLOA 3DEUA 1G3YA 4E7HA 2VQHA 1Z6RA 2XGEA 4NQWA 4U0WA 2ETHA 2RGVA 2XPUA 5CVIA 2PLYA 1YHQI 2Y30A 3ABLH 2EZIA 1P4AA 1V4RA 1YG2A 4E7KA 4B43A 1VQOI 2QGUA 2FX0A 3DTEA 4A5MA 4BE1A 2MW8A 4RMNA 2FJ1A 3CDHA 4Q4ZF 3WHCA 3CCLI 3CESA 1HSJA 3KCCA 4KITB 3RIRA 1R71A 1DGWY 3K6GA 4OAYA 4RGRA 1WJAA 4UV9A 2DI3A 3V42A 4KMFA 2PMUA 4HX4A 3WODF 2HDCA 2MLKA 2X1CA 2VJ4A 3IP4B 2L54A 1SFKA 2CUZA 2H8RA 1T98A 3LSJA 1XD7A 3OS2A 3E6CC 2JA7J 5JI6A 3K4LA 1ZRDA 1V55H 2PFBA 4MTDA 3CJNA 4LGWA 3TO9A 3ABUA 2KT0A 4AVPA 1OQYA 4L9TA 4GO1A 3ERED 2K7LA 1WKMA 3ASNH 2QSGX 3BR6A 2XPVA 4BQNA 4XSZF 1V54H 3FIWA 4NHJA 5AIQA 3VYUB 3DBRB 1PDNC 3C2GA 4MFEA 1VZ0A 3CDIA 2KIMA 2AXTC 4B8XA 3BP8A 5CPRB 3E1SA 1OCPA 2ELJA 1Z77A 5E18F 2FF4A 1KQ9A 5M3FJ 4CCLA 2K3PA 2L7MP 2WWYA 4DOZA 1ORKA 2MBFA 2HXIA 3JW4A 4CCJA 3J81K 3G6EI 4ZYHA 4RB0A 1Y39A 5E1ZB 2ZXWH 3LWFA 2R7WA 1ENHA 4KN4X 5LRRA 2E1NA 4EEFG 4A3GJ 3GTKJ 1EJ9A 1X19A 2P5VA 4BEHA 3S1RJ 4FCYA 2JVGA 2PMZA 3CCEI 2COMA 3ROUA 2P6SA 3U2RA 2LY1A 3BG9A 1PP7U 2ZJ2A 2IS1A 1I27A 2IW5A 2QQAA 3E5XA 3AL0C 4CXFA 1D8JA 3OSFA 1P6RA 1OCRH 5K1YA 4EJUA 4LITA 2R93J 1G4DA 4HV6A 5DCMA 4HV5A 3G4SI 2W82A 1IN6A 5J6XA 1EKEA 2M34A 4EQQA 4LD5A 1J59A 5HLTA 4BACA 2KHMA 1SC7A 3SDGA 2QA4I 1W36C 2OJED 2EV6A 4J00A 2ELHA 2A07F 1MW7A 1TWGJ 2O6GE 3CQZJ 1MNEA 4I99C 1XCVA 4G6QA 3CC7I 1KONA 1L0OC 1WI3A 2FRHA 3HUGA 4AWXB 4RS8A 3TMOA 1U8BA 3AAFA 2NS8A 3EUAA 3LSHA 1ERDA 3OR1C 2RREA 2QSHX 4IHTA 3A1YA 2VLAA 2Y9ZA 5A2QZ 1POGA 1TWFJ 1HW5A 3AG2H
chains in the Genus database with same CATH topology
2E2HJ 2DMUA 5FKNA 5GPAA 1QVTA 2DJNA 9ANTA 1H8AC 3BG5A 5C4XJ 1B72B 4XRSA 1G2HA 2CU7A 3IH2A 2Y9YA 1APLC 2R92J 3FKIJ 2OF7A 3JRHA 1VFCA 4D7MA 2K9SA 2ZB9A 3O8GA 1MH3A 4W1UA 2WV1A 4V2FA 4JX6A 1BW6A 3HBLA 3JRIA 2XSDC 4C3IJ 1IDYA 4S0HB 4FE7A 3JRBA 2DTZA 3TW6A 1IG7A 4JX4A 1UG2A 1QRYA 4XRMA 1FEXA 1WH5A 2DA4A 1VF9A 5EEAA 3L1PA 2X48A 3Q0VA 2CJJA 4A3MJ 2FD5A 3H0GJ 2X9DA 1JKQC 1UHSA 3QPSA 4MO7A 4A3JJ 2O9LA 1HF0A 1MBFA 2M0CA 4GFBA 2L7FP 4IHXA 1T56A 3FK7A 5EG0B 2HXOA 3RZDJ 3PM1A 5C3EJ 4FE4A 5BNGA 4M3FA 4IHVA 2FQ4A 4C3HJ 1BL0A 2R5ZB 2DN0A 4C2MJ 2K40A 2LFBA 1IC8A 3HEFA 4X1EA 5IP6A 1PUFA 2QF7A 3M3YJ 4BKXA 3LNQA 1ZTRA 4FTHA 3HDDA 4A3FJ 3HOZJ 1A6IA 2M8GX 2AO9A 2WAQN 3DCFA 3HKZN 3SFIA 5J1YA 1JJ8C 5E3OA 5EF6A 3A03A 1IGNA 4B1RA 5M3MJ 2L7ZA 1MSFC 3JRGA 2JWTA 4JYKA 2MGQA 2VPRA 1GUUA 2JN6A 5J1RA 3FK6A 3LOCA 5F04A 2X6OA 3S16J 2YU9J 2JMWA 2CQXA 2VI6A 2XPWA 3K7AJ 5GPCA 1JUSA 1X2MA 3ZQGA 1TC3C 5FKOA 2JA8J 3GTJJ 1ZQ3P 4A3IJ 1I50J 1XC5A 3HB9A 4IHYA 3WHBA 2AHQA 4D7NA 3BR2A 2DA1A 2EH3A 4BBRJ 4UUSA 2XRLA 2HDDA 2ID3A 2DA7A 1AKHA 2JJ7A 2EZKA 4AC0A 3B6CA 3SJMA 2E1OA 4DZPA 4RBOA 4A3BJ 4B3AA 1RKTA 4ABZA 3OSGA 1SANA 3HOVJ 3CDLA 3PO3J 5M5XJ 2DMNA 2K9NA 3PO2J 3ZOBA 1LE8A 1TWAJ 4DYRA 5C44J 1OJLA 3NARA 2DMTA 1MNMC 4BY7J 5EZHA 5F0CA 1ZR4A 1SFOJ 3ZQHA 3BTLA 2EZHA 3TP0A 3JRFA 2JA6J 5F27A 2IAIA 1GV2A 3H3VK 3GBGA 3M4OJ 3BR5A 3G1LA 3HOYJ 2HQ5A 1P7JA 5C4JJ 1GVDA 3BR3A 3CCYA 1YRNA 3GTLJ 2O8KA 2EQRA 3A01A 2GLOA 1EF4A 1X58A 2W48A 2E2IJ 5IPAA 4XRSG 1HCRA 4DW6A 3S2HJ 5IOYA 5FKKA 2DMQA 2ID6A 4UUSB 1ITYA 1ETVA 1VNDA 2NOGA 2CRGA 1ZGWA 1AKHB 5GP9A 1Y1WJ 1RETA 4DYCA 1JT6A 3ZQIA 4DZJA 1F43A 4V2GA 2N8GA 2COBA 2R0QC 2LVSA 5EDNA 1FIPA 4LOCA 4X6AJ 1IV6A 2DA5A 2TCTA 3F0CA 3S17J 1LE8B 3K2AA 1JUPA 1ETKA 4AYBN 3OIOA 2B63J 3OOUA 3Q3SA 5K7ZA 2LTPA 4I6ZA 2PMZN 3ZQLA 5M5WJ 1CQTA 1BJZA 3BT9A 2CUEA 5IYBJ 1MBGA 3GTMJ 4W97A 4C3JJ 4Y52J 1R9TJ 5IP9J 4IHWA 3LSRA 2VKVA 1FTTA 2Y2ZA 2GBYA 1K61A 3GTOJ 2ECCA 2XB0X 1YRNB 1OCTC 1MSEC 2NVTJ 1WGXA 4XICA 1HOMA 4CYCA 2E19A 3HM5A 2L0KA 2RAEA 5EGOA 3TP3A 3JRDA 4JX5A 1ZK8A 3MN2A 3GTQJ 2NVYJ 3QQAA 2LK2A 3DEWA 3BQYA 3S1MJ 4A93J 1NTCA 1ETOA 2Y31A 2GM4A 2YUSA 3S1NJ 1MBEA 3I4MJ 1DU0A 1MH4A 1WH7A 3ZQCA 3JREA 2HOAA 2YS9A 3IH4A 4A3LJ 2DA6A 1Q1VA 2H1KA 1WPKA 2VUMJ 1T33A 5M5YJ 5EYRA 5E3LA 4D5CA 3G1OA 3UKGA 1DU6A 1H89C 5FKLA 2ME0A 2DA3A 1K83J 5J1UA 2LY9A 3MKLA 2HI3A 4Y7NJ 4A3CJ 1BW5A 1TWCJ 2LLKA 1GT0C 3S2DJ 2G0EA 5IOZA 1JT0A 3TW7A 1ZKGA 2CQQA 4XIDA 2ME6A 3HGGA 3D1NI 3LSPA 2LD5A 2OPTA 2P81A 1PUFB 4J19A 5HODA 1LFBA 1ETXA 1JKRC 3BTIA 3C2BA 5DS9A 4M6VA 2Y0SN 1ETYA 3VPRA 3I4NJ 1XS9A 3LSGA 4L5EA 1HDDC 1NK3P 2LKXA 5IYDJ 1FJLA 2DMPA 2IEKA 1B8IA 3IH3A 4AUXA 5JLWA 1F36A 1WCMJ 2NVQJ 4B4CA 2HYJA 3BQZA 3HOUJ 1LFUP 5EG0A 4QIWN 4M3DA 2R5YA 1AU7A 1OFCX 4A69C 4M3EA 4DYQA 1ETWA 3O8HA 2JK3A 4MFDA 5F08A 1IDZA 3JR9A 3Q0UA 1H88C 2IBDA 1QPIA 3IV5A 1D5YA 5F0FA 2NVXJ 3BR1A 3GTGJ 2O7OA 5DTDA 2JA5J 2HOTA 3QPLA 3BG3A 2MSYA 4NDLA 3Q0WA 2XGEA 4QSHA 2XPUA 2Y30A 3NAUA 1QVUA 2ECBA 2EZIA 3W6VA 3HGYA 5JLXA 2ELKA 3RKQA 4IEJA 3JRAA 2FX0A 4M3GA 2MW8A 2FJ1A 2XGDA 3ZQFA 2VKEA 3BTCA 3WHCA 3E7LA 5E3MA 5FKMA 1I3QJ 1BA5A 4BXXJ 2WB1N 4HNVA 5K7HA 2D5VA 1JTYA 2DA2A 3RQIA 1MBJA 1P7IA 5FLMJ 3G1MA 3HOXJ 4XK4A 1ZR2A 2L9RA 1B8IB 3JRCA 2H8RA 3LSJA 2R5YB 3A01B 2JA7J 1Y1VJ 2NS7A 2QCOA 1HLVA 3B6AA 4A3KJ 2XB5A 5K7FA 1JKOC 1I6HJ 1AHDP 1U9OA 1W0TA 1RR7A 3S1QJ 1JUMA 1RESA 2KT0A 1U78A 4D5FA 3A02A 1RKWA 4MIMA 3BR6A 5FLVA 2XPVA 1A5JA 1MBHA 3FIWA 4QTRA 3TEDA 2R7ZJ 1U9NA 4MFEA 5F0HA 2EZLA 1VI0A 1OCPA 4JP0A 1Z77A 5F1JA 5M3FJ 5FJ8J 1X2NA 1IJWC 4BBSJ 1RPWA 2MG4A 1GDTA 1TWHJ 3BR0A 2L7MP 1NK2P 1GV5A 2KDZA 4M3BA 1ORKA 1JKPC 2HXIA 5EZGA 2HOSA 1B72A 1UMQA 5IP7J 1ENHA 2E2JJ 1ETQA 2LP0A 4EEFG 4A3GJ 4G12A 3GTKJ 3MVPA 3BTJA 3S1RJ 4FISA 4FCYA 2XGCA 1FIAA 1XG1A 3S15J 3BG9A 1W0UA 1E3OC 3OSFA 3S14J 4BY1J 4A3EJ 4A3DJ 2CUFA 3CMYA 2R93J 1Z0XA 1HDPA 1JTXA 4CYCB 2M34A 2EBIA 5EGOB 3RZOJ 5IYCJ 3SDGA 2K9QA 3HOWJ 1JGGA 5J3LA 1TWGJ 3CQZJ 1IRZA 2TRTA 3FISA 4UUTA 2LR8A 1WI3A 1U8BA 4RDUA 2NS8A 1JJ6C 2M9HA 1S7EA 4I76A 2M2EA 5E3NA 3GTPJ 1O4XA 2Y9ZA 1IUFA 4MLOA 1MBKA 1POGA 1TWFJ 2I10A 2R5ZA 1FTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H J;  2DMU A;  5FKN A;  5GPA A;  1QVT A;  2DJN A;  9ANT A;  1H8A C;  3BG5 A;  5C4X J;  1B72 B;  4XRS A;  1G2H A;  2CU7 A;  3IH2 A;  2Y9Y A;  1APL C;  2R92 J;  3FKI J;  2OF7 A;  3JRH A;  1VFC A;  4D7M A;  2K9S A;  2ZB9 A;  3O8G A;  1MH3 A;  4W1U A;  2WV1 A;  4V2F A;  4JX6 A;  1BW6 A;  3HBL A;  3JRI A;  2XSD C;  4C3I J;  1IDY A;  4S0H B;  4FE7 A;  3JRB A;  2DTZ A;  3TW6 A;  1IG7 A;  4JX4 A;  1UG2 A;  1QRY A;  4XRM A;  1FEX A;  1WH5 A;  2DA4 A;  1VF9 A;  5EEA A;  3L1P A;  2X48 A;  3Q0V A;  2CJJ A;  4A3M J;  2FD5 A;  3H0G J;  2X9D A;  1JKQ C;  1UHS A;  3QPS A;  4MO7 A;  4A3J J;  2O9L A;  1HF0 A;  1MBF A;  2M0C A;  4GFB A;  2L7F P;  4IHX A;  1T56 A;  3FK7 A;  5EG0 B;  2HXO A;  3RZD J;  3PM1 A;  5C3E J;  4FE4 A;  5BNG A;  4M3F A;  4IHV A;  2FQ4 A;  4C3H J;  1BL0 A;  2R5Z B;  2DN0 A;  4C2M J;  2K40 A;  2LFB A;  1IC8 A;  3HEF A;  4X1E A;  5IP6 A;  1PUF A;  2QF7 A;  3M3Y J;  4BKX A;  3LNQ A;  1ZTR A;  4FTH A;  3HDD A;  4A3F J;  3HOZ J;  1A6I A;  2M8G X;  2AO9 A;  2WAQ N;  3DCF A;  3HKZ N;  3SFI A;  5J1Y A;  1JJ8 C;  5E3O A;  5EF6 A;  3A03 A;  1IGN A;  4B1R A;  5M3M J;  2L7Z A;  1MSF C;  3JRG A;  2JWT A;  4JYK A;  2MGQ A;  2VPR A;  1GUU A;  2JN6 A;  5J1R A;  3FK6 A;  3LOC A;  5F04 A;  2X6O A;  3S16 J;  2YU9 J;  2JMW A;  2CQX A;  2VI6 A;  2XPW A;  3K7A J;  5GPC A;  1JUS A;  1X2M A;  3ZQG A;  1TC3 C;  5FKO A;  2JA8 J;  3GTJ J;  1ZQ3 P;  4A3I J;  1I50 J;  1XC5 A;  3HB9 A;  4IHY A;  3WHB A;  2AHQ A;  4D7N A;  3BR2 A;  2DA1 A;  2EH3 A;  4BBR J;  4UUS A;  2XRL A;  2HDD A;  2ID3 A;  2DA7 A;  1AKH A;  2JJ7 A;  2EZK A;  4AC0 A;  3B6C A;  3SJM A;  2E1O A;  4DZP A;  4RBO A;  4A3B J;  4B3A A;  1RKT A;  4ABZ A;  3OSG A;  1SAN A;  3HOV J;  3CDL A;  3PO3 J;  5M5X J;  2DMN A;  2K9N A;  3PO2 J;  3ZOB A;  1LE8 A;  1TWA J;  4DYR A;  5C44 J;  1OJL A;  3NAR A;  2DMT A;  1MNM C;  4BY7 J;  5EZH A;  5F0C A;  1ZR4 A;  1SFO J;  3ZQH A;  3BTL A;  2EZH A;  3TP0 A;  3JRF A;  2JA6 J;  5F27 A;  2IAI A;  1GV2 A;  3H3V K;  3GBG A;  3M4O J;  3BR5 A;  3G1L A;  3HOY J;  2HQ5 A;  1P7J A;  5C4J J;  1GVD A;  3BR3 A;  3CCY A;  1YRN A;  3GTL J;  2O8K A;  2EQR A;  3A01 A;  2GLO A;  1EF4 A;  1X58 A;  2W48 A;  2E2I J;  5IPA A;  4XRS G;  1HCR A;  4DW6 A;  3S2H J;  5IOY A;  5FKK A;  2DMQ A;  2ID6 A;  4UUS B;  1ITY A;  1ETV A;  1VND A;  2NOG A;  2CRG A;  1ZGW A;  1AKH B;  5GP9 A;  1Y1W J;  1RET A;  4DYC A;  1JT6 A;  3ZQI A;  4DZJ A;  1F43 A;  4V2G A;  2N8G A;  2COB A;  2R0Q C;  2LVS A;  5EDN A;  1FIP A;  4LOC A;  4X6A J;  1IV6 A;  2DA5 A;  2TCT A;  3F0C A;  3S17 J;  1LE8 B;  3K2A A;  1JUP A;  1ETK A;  4AYB N;  3OIO A;  2B63 J;  3OOU A;  3Q3S A;  5K7Z A;  2LTP A;  4I6Z A;  2PMZ N;  3ZQL A;  5M5W J;  1CQT A;  1BJZ A;  3BT9 A;  2CUE A;  5IYB J;  1MBG A;  3GTM J;  4W97 A;  4C3J J;  4Y52 J;  1R9T J;  5IP9 J;  4IHW A;  3LSR A;  2VKV A;  1FTT A;  2Y2Z A;  2GBY A;  1K61 A;  3GTO J;  2ECC A;  2XB0 X;  1YRN B;  1OCT C;  1MSE C;  2NVT J;  1WGX A;  4XIC A;  1HOM A;  4CYC A;  2E19 A;  3HM5 A;  2L0K A;  2RAE A;  5EGO A;  3TP3 A;  3JRD A;  4JX5 A;  1ZK8 A;  3MN2 A;  3GTQ J;  2NVY J;  3QQA A;  2LK2 A;  3DEW A;  3BQY A;  3S1M J;  4A93 J;  1NTC A;  1ETO A;  2Y31 A;  2GM4 A;  2YUS A;  3S1N J;  1MBE A;  3I4M J;  1DU0 A;  1MH4 A;  1WH7 A;  3ZQC A;  3JRE A;  2HOA A;  2YS9 A;  3IH4 A;  4A3L J;  2DA6 A;  1Q1V A;  2H1K A;  1WPK A;  2VUM J;  1T33 A;  5M5Y J;  5EYR A;  5E3L A;  4D5C A;  3G1O A;  3UKG A;  1DU6 A;  1H89 C;  5FKL A;  2ME0 A;  2DA3 A;  1K83 J;  5J1U A;  2LY9 A;  3MKL A;  2HI3 A;  4Y7N J;  4A3C J;  1BW5 A;  1TWC J;  2LLK A;  1GT0 C;  3S2D J;  2G0E A;  5IOZ A;  1JT0 A;  3TW7 A;  1ZKG A;  2CQQ A;  4XID A;  2ME6 A;  3HGG A;  3D1N I;  3LSP A;  2LD5 A;  2OPT A;  2P81 A;  1PUF B;  4J19 A;  5HOD A;  1LFB A;  1ETX A;  1JKR C;  3BTI A;  3C2B A;  5DS9 A;  4M6V A;  2Y0S N;  1ETY A;  3VPR A;  3I4N J;  1XS9 A;  3LSG A;  4L5E A;  1HDD C;  1NK3 P;  2LKX A;  5IYD J;  1FJL A;  2DMP A;  2IEK A;  1B8I A;  3IH3 A;  4AUX A;  5JLW A;  1F36 A;  1WCM J;  2NVQ J;  4B4C A;  2HYJ A;  3BQZ A;  3HOU J;  1LFU P;  5EG0 A;  4QIW N;  4M3D A;  2R5Y A;  1AU7 A;  1OFC X;  4A69 C;  4M3E A;  4DYQ A;  1ETW A;  3O8H A;  2JK3 A;  4MFD A;  5F08 A;  1IDZ A;  3JR9 A;  3Q0U A;  1H88 C;  2IBD A;  1QPI A;  3IV5 A;  1D5Y A;  5F0F A;  2NVX J;  3BR1 A;  3GTG J;  2O7O A;  5DTD A;  2JA5 J;  2HOT A;  3QPL A;  3BG3 A;  2MSY A;  4NDL A;  3Q0W A;  2XGE A;  4QSH A;  2XPU A;  2Y30 A;  3NAU A;  1QVU A;  2ECB A;  2EZI A;  3W6V A;  3HGY A;  5JLX A;  2ELK A;  3RKQ A;  4IEJ A;  3JRA A;  2FX0 A;  4M3G A;  2MW8 A;  2FJ1 A;  2XGD A;  3ZQF A;  2VKE A;  3BTC A;  3WHC A;  3E7L A;  5E3M A;  5FKM A;  1I3Q J;  1BA5 A;  4BXX J;  2WB1 N;  4HNV A;  5K7H A;  2D5V A;  1JTY A;  2DA2 A;  3RQI A;  1MBJ A;  1P7I A;  5FLM J;  3G1M A;  3HOX J;  4XK4 A;  1ZR2 A;  2L9R A;  1B8I B;  3JRC A;  2H8R A;  3LSJ A;  2R5Y B;  3A01 B;  2JA7 J;  1Y1V J;  2NS7 A;  2QCO A;  1HLV A;  3B6A A;  4A3K J;  2XB5 A;  5K7F A;  1JKO C;  1I6H J;  1AHD P;  1U9O A;  1W0T A;  1RR7 A;  3S1Q J;  1JUM A;  1RES A;  2KT0 A;  1U78 A;  4D5F A;  3A02 A;  1RKW A;  4MIM A;  3BR6 A;  5FLV A;  2XPV A;  1A5J A;  1MBH A;  3FIW A;  4QTR A;  3TED A;  2R7Z J;  1U9N A;  4MFE A;  5F0H A;  2EZL A;  1VI0 A;  1OCP A;  4JP0 A;  1Z77 A;  5F1J A;  5M3F J;  5FJ8 J;  1X2N A;  1IJW C;  4BBS J;  1RPW A;  2MG4 A;  1GDT A;  1TWH J;  3BR0 A;  2L7M P;  1NK2 P;  1GV5 A;  2KDZ A;  4M3B A;  1ORK A;  1JKP C;  2HXI A;  5EZG A;  2HOS A;  1B72 A;  1UMQ A;  5IP7 J;  1ENH A;  2E2J J;  1ETQ A;  2LP0 A;  4EEF G;  4A3G J;  4G12 A;  3GTK J;  3MVP A;  3BTJ A;  3S1R J;  4FIS A;  4FCY A;  2XGC A;  1FIA A;  1XG1 A;  3S15 J;  3BG9 A;  1W0U A;  1E3O C;  3OSF A;  3S14 J;  4BY1 J;  4A3E J;  4A3D J;  2CUF A;  3CMY A;  2R93 J;  1Z0X A;  1HDP A;  1JTX A;  4CYC B;  2M34 A;  2EBI A;  5EGO B;  3RZO J;  5IYC J;  3SDG A;  2K9Q A;  3HOW J;  1JGG A;  5J3L A;  1TWG J;  3CQZ J;  1IRZ A;  2TRT A;  3FIS A;  4UUT A;  2LR8 A;  1WI3 A;  1U8B A;  4RDU A;  2NS8 A;  1JJ6 C;  2M9H A;  1S7E A;  4I76 A;  2M2E A;  5E3N A;  3GTP J;  1O4X A;  2Y9Z A;  1IUF A;  4MLO A;  1MBK A;  1POG A;  1TWF J;  2I10 A;  2R5Z A;  1FTZ A; 
#chains in the Genus database with same CATH topology
 4A2U A;  2DMU A;  5FKN A;  3ABT A;  2DJN A;  9ANT A;  3GLL A;  1D0Y A;  1H8A C;  3BG5 A;  1B72 B;  3C7J A;  4RB1 A;  3JRH A;  2UWM A;  2VON A;  1K78 A;  2K9S A;  1MH3 A;  3E5U A;  4W1U A;  4BDY A;  3ECH A;  2D1H A;  2Z9O A;  4JX6 A;  3VWB A;  2OQG A;  1SD5 A;  1O3S A;  2V6C A;  2ZME C;  1EA3 A;  5LD2 C;  2DTZ A;  4JX4 A;  1V5G A;  1XPX A;  2GQQ A;  3MKZ A;  3HIF A;  3V8J A;  2CV1 A;  3L2R A;  3L2W A;  4FX4 A;  2JQ7 A;  2DA4 A;  1QGP A;  4KDP A;  2X48 A;  1RIO H;  4A3M J;  5E1X A;  3RKX A;  2VT2 A;  1ACI A;  2E36 A;  2X9D A;  5D5U B;  4A3J J;  2HKO A;  4I7H A;  4BL0 B;  1MBF A;  1SVO A;  1JGS A;  4BE2 A;  1EH8 A;  3GWZ A;  1FOK A;  1FSH A;  5BMZ A;  1G3S A;  1YO5 C;  2R7D A;  5EG0 B;  4OMZ A;  2EV5 A;  1MDM B;  1PUE E;  3PM1 A;  1SVM A;  4B3X A;  4PSW A;  4IHV A;  4XKB A;  1BL0 A;  2R5Z B;  1FX7 A;  1YI2 I;  4C2M J;  3HZJ A;  3HTS B;  1X1P A;  1U5T B;  2L2O A;  4HLY A;  4LLN A;  4X1E A;  2EFQ A;  2QF7 A;  3M3Y J;  4DIQ A;  4PZJ A;  1ZTR A;  4FTH A;  4G7H F;  2JUG A;  2LRE A;  2F5C A;  2NXN B;  3JSO A;  2ADU A;  4A3F J;  4UB6 C;  5HNF A;  2VPL A;  2AO9 A;  5LHI A;  3IRQ A;  4JQF A;  1BJA A;  1O7L A;  1UAA A;  1IN4 A;  1S29 A;  4RAZ A;  1G8X A;  3PL8 A;  2KRF A;  2DYS H;  5E3O A;  5BPD A;  4F55 A;  1R36 A;  3NRV A;  4B1R A;  2W1O A;  2L7Z A;  2VBW A;  5M3M J;  3MZ8 A;  4JYK A;  1I1S A;  3P5J A;  4UNO A;  1OMI A;  2G9W A;  4XOT A;  1R58 A;  4ZYE A;  4Q5S F;  4B48 A;  2WB1 A;  3JCU C;  3NEU A;  3HHG A;  1QPM A;  1X2M A;  5LGT A;  2GXA A;  4A3I J;  4EV0 A;  3AKZ A;  4IHY A;  5BS6 A;  1IRF A;  5J4Y A;  1QU3 A;  1U6G A;  2EH3 A;  3IWZ A;  4UUS A;  1YTY A;  2ID3 A;  2D1V A;  4UB8 C;  5GAH J;  1AKH A;  2JJ7 A;  1CF7 B;  1ON1 A;  4AC0 A;  2E1O A;  4ASN A;  2HVS A;  2IT0 A;  3PNV A;  5HS7 A;  1W36 D;  4B3A A;  1VQ7 I;  2KQR A;  1RKT A;  3NQO A;  4ABZ A;  3OSG A;  2X51 A;  4IPA A;  1IN8 A;  4BGD A;  2WC2 A;  2L9N A;  5FGM A;  5M5X J;  1EH6 A;  1O57 A;  1W4M A;  2CS3 A;  1ZN2 A;  2DMN A;  4XM3 A;  5FFX A;  3PO2 J;  3RI4 A;  1R1U A;  4CUG A;  4A12 A;  1TWA J;  2MFZ A;  1MMS A;  2W7N A;  1TLH B;  5C44 J;  3F8C A;  2A69 F;  3UR3 C;  4Y13 A;  5EZH A;  3WE2 A;  1WZ2 A;  1ZAR A;  3FXJ A;  3ONQ A;  3F23 A;  3GXO A;  2BW3 A;  2VXD A;  2XDV A;  1BIB A;  4PFP A;  5JR3 A;  4MHG A;  3W2V A;  1XMX A;  4UVB A;  3H3V K;  3FXM A;  3MZY A;  2ZJQ F;  3WE3 A;  1OKR A;  3HOY J;  3W2W A;  1S6L A;  2F48 A;  1P7J A;  2L9V A;  2LF7 A;  1GVD A;  1TQP A;  5D5X B;  1YRN A;  2O61 A;  2MC4 A;  3LQR A;  5LGU A;  3A01 A;  1EF4 A;  4ZDO A;  2V79 A;  4IF4 A;  1XGO A;  1TZL A;  5IPA A;  3TDZ C;  2XAJ A;  5CVV A;  5GTI C;  3N05 A;  5IOY A;  2JRM A;  3MZH A;  5IT9 Z;  2VBZ A;  3BG6 A;  4ANJ A;  3LFK A;  4IRH A;  1BC7 C;  4JOM A;  2NOG A;  3VB2 A;  1ZGW A;  2MD5 A;  4OIR F;  1RNL A;  3OOP A;  4DZJ A;  3CC2 I;  1M1E B;  2F5V A;  4V2G A;  1F43 A;  1B9M A;  2R0Q C;  3B73 A;  4X6A J;  4BJ6 C;  2MC3 A;  4MQ9 F;  3L00 A;  3OWT A;  3V4G A;  1F1Z A;  2TCT A;  3I4P A;  2FMY A;  3ESW B;  3OYH A;  4MQV A;  1WJF A;  4AYB N;  1TQM A;  3RYP A;  3OOU A;  5K7Z A;  1BJZ A;  2HYF A;  2XF5 A;  1Z6T A;  2MH9 A;  1WJC A;  4KMU X;  2PX9 A;  1R9T J;  3DU5 A;  1ZRE A;  1W1W E;  1WI9 A;  4IHW A;  4CH7 A;  3LSR A;  1HC8 A;  2CSO A;  1BIA A;  1VQK I;  3KP2 A;  5H20 A;  2EWN A;  3BDD A;  4KIS A;  3GTO J;  2XB0 X;  2EIM H;  1OCT C;  1U2W A;  4EJV A;  3E6D A;  1P2F A;  4CYC A;  3H35 A;  2VL8 A;  2LG4 A;  4JK1 X;  1BM9 A;  2RAE A;  5EGO A;  5LBQ A;  4I02 A;  3J80 K;  4JX5 A;  3DEW A;  3ZMT A;  2F4O B;  2M30 A;  2UUZ A;  1STZ A;  2GM4 A;  2X1D A;  1MBE A;  4M71 A;  1HXD A;  1QA6 A;  3BOQ A;  4ENK A;  2HYG D;  4Q47 A;  2YS9 A;  3IH4 A;  1A31 A;  1B59 A;  1IF1 A;  1Q1V A;  4L0Z B;  1WPK A;  2QWW A;  3RKY A;  2I8D A;  2VUM J;  4HAM A;  3AL0 B;  4KIC A;  2GOX B;  3G1O A;  4MEX F;  1A04 A;  3QP6 A;  4Q48 A;  1DP7 P;  5J1U A;  1K83 J;  1NHA A;  2LY9 A;  3MKL A;  3CUO A;  5CYV A;  2EIN H;  2DO7 A;  4UHT A;  4A3C J;  3O3K A;  3I55 I;  4CCM A;  1FYM A;  4XQF A;  1U0J A;  2A5W A;  1D1A A;  3QYF A;  4HSR A;  3LSP A;  2BV6 A;  3U1K A;  2P81 A;  2OV7 A;  2CGP A;  4J19 A;  1LFB A;  3F6O A;  4HBL A;  3HC7 A;  1XN7 A;  2EK5 A;  2IJL A;  4M6V A;  4IHS A;  1XS9 A;  3S8P A;  3V7S A;  3HKZ A;  1HDD C;  3OYI A;  3GME A;  1I1G A;  5K5R A;  2LKX A;  1LEA A;  4DBQ A;  1VQ9 I;  3CLQ A;  1YJN I;  3ZGK A;  5IT9 K;  2IEK A;  3K70 C;  2Z33 A;  4RA2 A;  3IH3 A;  4AUX A;  1IXS B;  5JLW A;  2XV4 S;  2HGC A;  3ML6 A;  4IZZ A;  4AIK A;  3HOU J;  5L3C A;  4G6T B;  1TL8 A;  1K6O A;  1SFX A;  4M3D A;  4XKC A;  2NNY A;  3BRO A;  4DYQ A;  3O8H A;  2JK3 A;  4YG2 F;  4L0Y B;  2NVU B;  2IBD A;  5DD4 A;  2ZME B;  3IV5 A;  5ILV A;  3OL4 A;  2W57 A;  3H36 A;  5CQE A;  2O7O A;  2XKP A;  1VQ5 I;  1YS6 A;  3KET A;  3BG3 A;  1XB4 A;  2RVC A;  4U7B A;  4DJA A;  1V5F A;  4PK4 A;  4HA8 A;  4HZF A;  5J47 A;  2BBY A;  3FMQ A;  1GLN A;  4HEA 2;  1USS A;  4A6D A;  3JRA A;  1Z3X A;  4M3G A;  1KQ0 A;  3WG7 H;  3ZQF A;  3BTC A;  3BZC A;  1I6X A;  5L3E A;  3F8F A;  3G71 I;  1B6A A;  3GLX A;  3K4K A;  4EGY A;  4ZJZ A;  1BA5 A;  1MMA A;  3CMA I;  1AA7 A;  3PQK A;  1LUJ B;  1MBJ A;  2Q0O A;  5BPI A;  1P7I A;  1R00 A;  2QVO A;  5D4R A;  3HOX J;  3LMM A;  3ZP5 A;  2QBY B;  3WU1 B;  3MWM A;  3WTU C;  4WF2 A;  4I2O A;  4BXU A;  1B9N A;  1MMD A;  3A01 B;  1Y1V J;  4AIJ A;  2OQR A;  1IW7 F;  3B6A A;  4HLX A;  5L3F A;  1DGR M;  3GYH X;  5K7F A;  3J7A O;  3H5A A;  1W0T A;  2H6B A;  1JUM A;  1RES A;  3S1Q J;  1VTN C;  3OYL A;  2FNP A;  4EJO A;  4OMY A;  4YRV A;  5TGT A;  4IJA A;  1E3P A;  1VQN I;  2CUJ A;  3PSI A;  2WV0 A;  4Y3O A;  3KP7 A;  3TED A;  2JTV A;  3ABM H;  1LEB A;  1J0R A;  1U9N A;  3HRT A;  5D4S A;  4U0V A;  5F0H A;  3CCU I;  2EZL A;  4KUM A;  3ZN1 A;  2CYY A;  1DUX C;  3ZQQ A;  2DT7 B;  1ZLJ A;  1UST A;  3BC8 A;  1J2X A;  4BBS J;  2MG4 A;  1KYW A;  2W25 A;  3K1N A;  1NK2 P;  3ZRG A;  5D5W B;  1OR7 C;  3A4C A;  4BU2 A;  1GV5 A;  5DV5 A;  5GAE J;  1FP1 D;  1JKP C;  5EZG A;  3ISP A;  1ZAO A;  2K5C A;  3H5N A;  1B72 A;  1ETQ A;  3P9I A;  1W7P B;  2PN6 A;  4G12 A;  1MJA A;  2XAH A;  3BTJ A;  3MVP A;  3R0J A;  4RGX A;  4FIS A;  4A0Y A;  2XGC A;  3AG4 H;  3RPU A;  4PJL A;  3S15 J;  3GFJ A;  2P8T A;  1W0U A;  2BXZ A;  4U88 A;  3JTG A;  1E3O C;  4RM3 A;  2GIV A;  2DFH A;  2DJI A;  2FML A;  5FD6 A;  4A3E J;  2OCE A;  1L3L A;  5GAD J;  1HA8 A;  4NUB A;  3CMY A;  3CF2 A;  3VOD A;  2A05 A;  1WWX A;  1Z0X A;  3S32 A;  4IRG A;  4BS9 A;  1HDP A;  4RM2 A;  1YIO A;  4CYC B;  1KU2 A;  1S3J A;  2DW4 A;  3DKY A;  2AS5 F;  5EGO B;  3CTA A;  2AQE A;  2F5F A;  4KT6 A;  5IYC J;  3EDP A;  2L02 A;  2K9Q A;  1D1B A;  3HOW J;  5H6Q A;  1J09 A;  3B02 A;  2IP2 A;  2RC4 A;  2M4K A;  2TRT A;  4ITV A;  3FIS A;  2XAG A;  4FET A;  1KGS A;  3DU6 A;  2GZW A;  2NS0 A;  2LR8 A;  3PNT A;  2WY8 Q;  1LDJ A;  4ENN A;  4ESB A;  3FMS A;  3FXU A;  1JJ6 C;  3FM3 A;  1MDM A;  5E3N A;  2M2E A;  3Q9V A;  1O4X A;  3BPX A;  4MLO A;  1MBK A;  3I59 A;  3RKW A;  2I10 A;  2R5Z A;  1WJB A;  2OAZ A;  3TOB A;  1HKS A;  2E2H J;  3WGH A;  3OYE A;  4PCQ A;  5FRO A;  4LB6 B;  1QVT A;  5KAI C;  1Y0U A;  5ICG A;  3OYK A;  1U5T A;  1T38 A;  2PEX A;  2RQP A;  3E0J B;  3IH2 A;  2Y9Y A;  4HG2 A;  1APL C;  4HYE A;  1I5Z A;  2BY2 A;  3FKI J;  4A6E A;  4XON A;  2YU3 A;  4UXN A;  4D7M A;  2ZB9 A;  3O8G A;  3OIQ A;  2LYC A;  2ICW G;  2JRT A;  3DLL F;  4V2F A;  1BW6 A;  4P9U A;  3JRI A;  2XSD C;  2C6Y A;  4D0P A;  2FOK A;  1QHH D;  2QQ8 A;  3GX4 X;  3M1C A;  2BVM A;  1R49 A;  3OYN A;  3TQN A;  1FEX A;  5LHG A;  4HNT A;  1VF9 A;  2X1E A;  3L1P A;  1D5V A;  2ZNZ A;  4GXO A;  2CJJ A;  2DOD A;  4LG0 A;  2VOD A;  3H0G J;  2K27 A;  1HW1 A;  1UHS A;  3QPS A;  2P5L C;  3ASO H;  2D2W A;  3SEQ A;  2GA1 A;  2DCE A;  1P4W A;  4E6K G;  3H9G A;  4XOR A;  4GFB A;  1T56 A;  5J8C A;  2HXO A;  2MH2 A;  3RZD J;  1R23 A;  1T8I A;  3CUQ C;  3HXL A;  3ZN0 A;  3M7G A;  4M3F A;  2L5Q A;  1IAW A;  2DQR A;  3ZXS A;  1CF7 A;  2R7F A;  1MIJ A;  3LQQ A;  5LEK A;  4EMS A;  2QEN A;  2R7S A;  2KMU A;  4L18 B;  5IT3 A;  2FQ3 A;  5DD8 A;  2W84 A;  2Z2S B;  3VEP A;  1IC8 A;  4E7J A;  5IP6 A;  3ABK H;  4I09 A;  1VQM I;  2DDA A;  3JAM Z;  2V26 A;  2VJJ A;  4IO9 F;  5E20 A;  3HOZ J;  2M8G X;  3DCF A;  3ZMZ A;  4HOB A;  2A61 A;  2G7H A;  1WHU A;  2F2E A;  4PJM A;  2ZXH A;  2K85 A;  1XSX A;  3LAP A;  4OWR B;  1IGN A;  3JRG A;  1TW2 A;  2V7F A;  2W4S A;  2LOO A;  3K10 A;  2JN6 A;  4WXD A;  1FMV A;  3SEZ A;  3MKW B;  4CZC A;  5F04 A;  2FBK A;  2CQX A;  3QAH A;  2M87 A;  3K7A J;  3GVA A;  3I9V 2;  2E7W A;  3V7C A;  5FKO A;  1TC3 C;  2LF8 A;  1ZQ3 P;  1XC5 A;  3HB9 A;  4YFN F;  4KIF A;  3QU3 A;  4D7N A;  4HX7 A;  2NYX A;  2HDD A;  1T39 A;  2YX7 A;  1UEL B;  1X1D A;  2CV2 A;  4LG3 A;  2DA7 A;  5CVJ A;  2HQN A;  3SYT A;  1Y56 A;  3PFI A;  2OZU A;  2PMH A;  4A3B J;  3EUH C;  4PFO A;  1Z7L A;  3H3Z A;  5E8G A;  2VQG A;  3G73 A;  2K9N A;  2KJC A;  3TO7 A;  2J5P A;  2J5O A;  3S3M A;  4NC8 A;  5J40 A;  2NNN A;  3F9K A;  2DMT A;  2KDO A;  2R3S A;  3ECO A;  2K4B A;  4E7S A;  3DLA A;  3EQL F;  1ZR4 A;  1SFO J;  3ZQH A;  5BOX A;  2KIS A;  2A6T A;  2EZH A;  2JA6 J;  1GV2 A;  1I39 A;  2M7A A;  3GBG A;  5EEG A;  2XGX A;  4KT5 C;  2PG4 A;  1V3F A;  2IPQ X;  3CCY A;  4A5N A;  2GLO A;  2CQN A;  5HLG A;  1X58 A;  5DUK A;  2W48 A;  2ZC2 A;  1VQP I;  4CGZ A;  3M8E A;  1MND A;  3E6M A;  3FX3 A;  3RSN A;  4XRS G;  2R4G A;  1OLT A;  3HL2 A;  4DW6 A;  4ZTF A;  1WJE A;  3HRU A;  3D0S A;  5HNH A;  2LC2 A;  3WTW C;  3CCQ I;  1ITY A;  1ULY A;  2EJR A;  1FP2 A;  1RI7 A;  1K4T A;  1VND A;  3OYM A;  1DDN A;  4I0B A;  4IVN A;  2Z3Y A;  1Y1W J;  1BC8 C;  4I98 B;  4LMY A;  3WTV C;  1MD0 A;  3ZQI A;  2Y0S A;  2N8G A;  2COB A;  4RLQ A;  5EDN A;  1UJ8 A;  1R5G A;  2DA5 A;  3S2W A;  4XLP F;  2BVL A;  2ESH A;  1LE8 B;  3R61 A;  3GFI A;  4HQM A;  2IGO A;  2B7E A;  4ZC3 A;  2BGC A;  3Q3S A;  2O5R A;  3FZV A;  2EIK H;  3I58 A;  2LTP A;  3SZT A;  2M45 A;  5FLX Z;  3KP6 A;  3JSP A;  1BI1 A;  2CUE A;  3I59 B;  4U0Y A;  4HQE A;  1MBG A;  2XRN A;  3FMR A;  2B9S A;  1IN7 A;  2H27 A;  3V8L A;  2EIL H;  2M7B A;  1Y8R B;  1RR8 C;  3BJO A;  2A6E F;  3EUH A;  3K4M A;  1J7K A;  3RQ4 A;  4OIQ F;  2KFD A;  4M9Z A;  2ECC A;  4Y15 A;  1MSE C;  1WGX A;  2L7K A;  4GYI A;  3QP5 A;  1N78 A;  2E19 A;  1QBJ A;  3OYC A;  4GGG A;  3QYE A;  2XVC A;  1Z05 A;  2HTJ A;  1ZK8 A;  2QUF A;  3MN2 A;  3GTQ J;  3BZ6 A;  2NVY J;  2FNA A;  2G7U A;  2LK2 A;  1YJ9 I;  2HPI A;  4OAZ A;  3DTI A;  3EET A;  1S5L C;  4Y17 A;  3I64 A;  5L3D A;  3T8T A;  2TDX A;  3CO6 C;  3S1N J;  2XSJ C;  3BG7 A;  3I56 I;  4LG0 B;  1WH7 A;  1H9G A;  3JRE A;  1A36 A;  2XRO A;  1I3A A;  2HOA A;  5KVR A;  1QQI A;  2K9M A;  3W3C A;  3OYB A;  3KYL A;  5M5Y J;  5EYR A;  4XSX F;  2IRF G;  2IGM A;  3FWE A;  2ZME A;  3UKG A;  3Q5F A;  1XX5 A;  1R7J A;  2CW8 A;  2ME0 A;  2MYS A;  2Q1Z B;  1XSD A;  1RRJ A;  5JVT A;  3CF5 F;  2GIZ A;  4Y7N J;  1QHG A;  4LK1 F;  1BW5 A;  3IUO A;  5KHD A;  3KYC B;  2MLG A;  2G0E A;  2PI0 A;  1JT0 A;  3OYG A;  2AQF A;  2JSP A;  5HLI A;  2OUM A;  4XID A;  3D1N I;  5A2Q K;  3E6B A;  2VJI A;  4ZZD A;  4BDZ A;  4HRI A;  1E0E A;  2LD5 A;  3SXY A;  2CFO A;  2IA2 A;  5HOD A;  1UZC A;  3QPT A;  1ETX A;  1D0X A;  1JKR C;  1XGN A;  5HDG A;  1FYK A;  3RDI A;  5DUI A;  4XNF A;  1X3Z B;  4N9H A;  5JHF A;  1Q1H A;  2HQR A;  2M8E A;  2M4G A;  1FY7 A;  2I5U A;  5F6F A;  2VBX A;  1R6R A;  4F3Q A;  1EH7 A;  2P7C B;  5FRN A;  4LIV A;  1NK3 P;  4L9N A;  1BI3 A;  2IVM A;  3J7A Y;  4E7L A;  4C2U A;  1DQU A;  2WY7 Q;  2QBY A;  1F36 A;  1WCM J;  1WRJ A;  3QOE A;  4LK0 F;  4B4C A;  2NVQ J;  3BQZ A;  2E5N A;  3EUK L;  1SEU A;  2Y48 A;  2GXB A;  3LA7 A;  4XLN F;  4U87 A;  4E4H A;  4KFC A;  4A69 C;  3VYR B;  4NNJ A;  1ETW A;  3N4M A;  1IXR C;  2KL4 A;  1QPI A;  1D5Y A;  1FT9 A;  2F5E A;  2WA0 A;  4LLL A;  5L3B A;  2V1D A;  2F4I A;  1SD6 A;  4AIH A;  1S7A A;  2MSY A;  1NG7 A;  3Q0W A;  5KCM A;  4DBR A;  4KIB A;  4QSH A;  3RCO A;  3NAU A;  2ZKZ A;  3W6K B;  3W6V A;  2ELK A;  2OTL I;  2ZCW A;  4IEJ A;  4ETS A;  2YR2 A;  4II2 A;  2XGD A;  2ACJ A;  2VKE A;  5LFA A;  5CVU A;  3DXJ F;  3O2P E;  5K5Q A;  4YEL A;  1KYZ A;  3CUQ B;  1FBS A;  2A5Y B;  4HPQ A;  5JVG F;  5D6F A;  4BXX J;  4CO8 A;  4HNV A;  5K7H A;  1W7P A;  2IXS A;  3GO5 A;  1T0F C;  2FOW A;  1JTY A;  1FYL A;  2KZG A;  3NWT A;  3RQI A;  1V5E A;  2E7X A;  6PAX A;  2RNG A;  1MZB A;  2L9R A;  1DP3 A;  2O3F A;  3JRC A;  4FX0 A;  3VFZ A;  2EFW A;  4G7Z F;  4YII A;  2R5Y B;  2KPM A;  2V9P A;  3S3N A;  2XIG A;  2XUB A;  4BAY A;  1FBQ A;  2QCO A;  1UCR A;  2XB5 A;  2OU2 A;  1JKO C;  2H94 A;  1U9O A;  3ZMV A;  2STT A;  1MMG A;  1P9Q C;  4KA4 A;  1ZHF A;  3A02 A;  3CP8 A;  4D5F A;  1U78 A;  1DPU A;  4LFU A;  5FLV A;  5H2F C;  1SAU A;  2BZT A;  1A5J A;  1MBH A;  2R7Z J;  4LLG F;  3KFW X;  2DT5 A;  1Z1D A;  3F6V A;  2IA0 A;  2RDP A;  4HX8 A;  3HRS A;  3OIP A;  3C1D A;  4XMY A;  4JP0 A;  3TO6 A;  3CD6 I;  2LSO A;  3PUB A;  5FJ8 J;  1ONV A;  1GDT A;  3DKX A;  1TWH J;  1T6S A;  2R7R A;  3GZN B;  4M3B A;  4BH9 A;  2HOS A;  2CMP A;  3KP4 A;  1BBY A;  2LP0 A;  3I54 A;  3HJE A;  3RJP A;  4AYB A;  5HDN A;  2XAS A;  2LY2 A;  1LVK A;  1ZGA A;  2P6T A;  1W5C C;  3KP3 A;  1FIA A;  3KE2 A;  4BXF A;  3FHN A;  2O03 A;  1ON2 A;  2IA1 A;  1YX3 A;  3I0T A;  4KYW A;  3S14 J;  2PQ8 A;  3K4N A;  5GAG J;  5EJC A;  4BY1 J;  4A3D J;  4N4O B;  4GRI A;  3HSF A;  1C0W A;  2X4H A;  4MEY F;  1JTX A;  3G2B A;  2QKL B;  4MNU A;  1HKT A;  5LHH A;  3RZO J;  3D5R C;  5ILS A;  4BNC A;  2ESN A;  1G6N A;  1XTA A;  3GFL A;  1CGP A;  3FDY A;  1JXS A;  4ZYA A;  2KIU A;  1MMN A;  2HOE A;  2FSW A;  4YEJ A;  5J3L A;  1VQL I;  4ZYD A;  4RGS A;  1IRZ A;  2R7U A;  4UUT A;  4PDK A;  1R4N B;  2E71 A;  1XDU A;  5ICC A;  1KQ8 A;  1N75 A;  4M72 A;  4CCO A;  3CJR B;  1YS7 A;  2M9H A;  2ISZ A;  3GTP J;  3WTY C;  1R1T A;  3CCR I;  4XN3 A;  4GYG A;  1IUF A;  1IRX A;  4OIP F;  1OYI A;  3CCV I;  4G94 A;  5GPA A;  1KU9 A;  1IRG A;  4XLC A;  2R7V A;  4R1H A;  4IOA F;  1WQ2 A;  3W2A A;  4XRS A;  1G2H A;  2CU7 A;  1IUY A;  3IWF A;  4FHT A;  2R92 J;  2OF7 A;  2STW A;  1LDD A;  2VBY A;  5DM7 F;  4P1W A;  2QM3 A;  3ZQ7 A;  1LJ9 A;  1RUN A;  2KRH A;  2FBH A;  3LL7 A;  2JPC A;  1FLI A;  1ZG5 A;  4S0H B;  3A0B C;  3JRB A;  1IG7 A;  4CCK A;  1JHF A;  4N4N B;  2LDU A;  1UG2 A;  1QRY A;  3VDX A;  1WJ5 A;  1BN5 A;  3IAS 2;  2EA2 A;  5CJ9 A;  3LSK A;  5EEA A;  2DFF A;  2CQK A;  3DFG A;  2LMD A;  4NC7 A;  3R4K A;  3SFZ A;  2FD5 A;  2GOM A;  1T08 B;  2O9L A;  1IO2 A;  1PJR A;  2DOA A;  1FSE A;  3CC4 I;  2L7F P;  4IHX A;  3FK7 A;  2UXX A;  4S05 A;  1HKQ A;  5C3E J;  5BNG A;  5L3G A;  2H1L A;  3OYF A;  2FQ4 A;  4C3H J;  2DN0 A;  3OY9 A;  2CH0 A;  3FM5 A;  2K02 A;  4M6Y A;  3RYR A;  3L2Q A;  2M5W A;  1VQ6 I;  2VXZ A;  2CFX A;  3HOS A;  5DYM A;  2HQA A;  1FOY A;  2WAE A;  2NAZ A;  3H9Q A;  4BHC A;  1IN5 A;  5HOO A;  1ZGJ A;  1LFP A;  4IKF A;  4AD9 A;  1BOB A;  1TBX A;  2FE3 A;  2WAQ N;  2OA4 A;  4IRI A;  1H9T A;  5J1Y A;  5B3S H;  1BR2 A;  3TKY A;  1JJ8 C;  3DWL E;  4YFK F;  1JHH A;  3WU0 A;  2LNB A;  5EF6 A;  3H1C A;  3HRM A;  4C9Y A;  1O3R A;  3A03 A;  4HF0 A;  2P7V B;  1XCB A;  2JWT A;  3M9A A;  2Z5U A;  2MGQ A;  1S72 I;  2V1U A;  5ED4 A;  5HVQ C;  5J1R A;  3CJT B;  1OIS A;  4HST A;  4M73 A;  3SZP A;  1SD7 A;  2X6O A;  3S16 J;  1X3W B;  2YU9 J;  2X6Y A;  4OOI A;  4GDF A;  4F92 B;  4L5I A;  5GPC A;  1JUS A;  2FU4 A;  5TIS C;  1S8N A;  2K3F A;  2ZXI A;  3GTJ J;  1I50 J;  3WHB A;  2AHQ A;  3BWG A;  3BR2 A;  3PIP F;  2DA1 A;  4IL6 C;  1Y6I A;  2XRL A;  1BOA A;  2VKD A;  5TJJ A;  4LJZ F;  3HPH A;  3B6C A;  4HDU A;  4DZP A;  1QZY A;  2P0W A;  3M07 A;  2HFH A;  1R1V A;  4Z6Y A;  4RAY A;  3HOV J;  3CDL A;  3FXK A;  1OYW A;  3J81 Z;  2K4J A;  4IQJ A;  2Z1D A;  1KU3 A;  2HTS A;  1LE8 A;  3QRF F;  2R7T A;  2YPR A;  2XC7 A;  4DYR A;  1FPQ A;  2OTJ I;  4ZH4 F;  1YW8 A;  1OJL A;  3NAR A;  1YQA A;  2A6H F;  1YIJ I;  2DYR H;  4BY7 J;  3KEO A;  3U9G A;  2LKP A;  4CZZ A;  3BTL A;  1OYY A;  2Y75 A;  3V8K A;  4B47 A;  4S04 A;  3JRF A;  5JHU A;  5F64 A;  4EJT A;  3M4O J;  3WTS C;  4E7I A;  3BR5 A;  1UG0 A;  2KJB A;  2Z16 A;  3G1L A;  2HQ5 A;  2CO5 A;  3LSI A;  4ZYG A;  2K86 A;  3GTL J;  3DPT A;  2O8K A;  3I5U A;  2EQR A;  2Q2E B;  1ZLK A;  3GZ5 A;  3ZCO A;  2KP6 A;  1OR7 A;  2DMQ A;  4TV7 A;  1WVR A;  4R79 A;  4EJW A;  2JUC A;  3GW2 A;  3S3O A;  1REP C;  2CRG A;  2KIF A;  3U21 A;  2WBM A;  3ZR8 X;  2CW0 F;  3CMM A;  4DYC A;  1JT6 A;  3KLO A;  2H8W A;  3T8R A;  3FHZ A;  2JT1 A;  3RPU D;  1X3U A;  1FIP A;  2M0M A;  2LRD A;  1IV6 A;  1TP4 A;  3ZMS A;  2HZT A;  2JA2 A;  5FFZ A;  3F0C A;  2VE9 A;  1HQC A;  1K4S A;  3S17 J;  3K2A A;  3OIO A;  4IOC F;  3IKV A;  3K1M A;  2IS6 A;  2PMZ N;  3ZQL A;  5M5W J;  1CQT A;  4KN7 X;  5IYB J;  4WX9 A;  3GTM J;  3WTX C;  1O3T A;  4W97 A;  3PJR A;  3A0H C;  1K79 A;  3DBH B;  1YOV B;  3OYA A;  5D6E A;  2KZV A;  5IP9 J;  1N25 A;  2VOP A;  2VKV A;  1E3H A;  3BZK A;  4M9X A;  3SDB A;  5DEQ A;  5J8F A;  1JE8 A;  1FTT A;  4EVI A;  2Y2Z A;  2M1B A;  2GBY A;  4HDV A;  1FMW A;  1WFX A;  4XIC A;  5DCF A;  2R7Q A;  2BHY A;  4XKV A;  4FT8 A;  4XR6 A;  3K4C A;  2L0K A;  1FOX A;  2DOF A;  3JRD A;  1SVL A;  1Z3Y A;  3ELK A;  3N97 A;  5ICF A;  3DV8 A;  2PJR B;  3FXL A;  1IZ1 A;  3DQV C;  3S1M J;  4EM1 A;  1NTC A;  4A93 J;  3TDU C;  1ETO A;  2Y31 A;  2YUS A;  2GXG A;  2DPU A;  1UB9 A;  3BJA A;  5LGN A;  2OD5 A;  4X0G A;  1MH4 A;  2M3A A;  3GCM A;  3VSL A;  1BR4 A;  2WAD A;  4CDG A;  4A3L J;  1DPR A;  2DA6 A;  2DLL A;  2BY0 A;  1JI8 A;  1T33 A;  3CCS I;  4PUS A;  5E3L A;  4D5C A;  3QOP A;  1PYV A;  1TQI A;  2QQB A;  2RKH A;  2VJ5 A;  3P7N A;  3CCM I;  1H89 C;  5FKL A;  1LPQ A;  2DA3 A;  2DFE A;  2QQ9 A;  2HI3 A;  3KPH A;  5LRS A;  2DDB A;  2E60 A;  3EYI A;  3RTR A;  1TWC J;  4OIO F;  1FOW A;  1PVE A;  3D5S C;  5IOZ A;  3TW7 A;  1ZKG A;  4YFX F;  3OS0 A;  1LB2 A;  2IGK A;  4BJT A;  3HGG A;  4C30 A;  3ERM A;  1S9H A;  4Z2Y A;  1ZEL A;  2WAF A;  2OPT A;  1J9I A;  3AFH A;  2VAS A;  2BYV E;  1G59 A;  1TNS A;  2FBI A;  3L2U A;  3BTI A;  2VE8 A;  4G6D A;  3C2B A;  5DS9 A;  1Y0N A;  3UNG C;  4HF1 A;  5HDK A;  4IQ4 A;  4ON0 A;  1OPC A;  2RN7 A;  4N9I A;  2Y0S N;  3CUQ A;  1ETY A;  2AXL A;  1Y8Q B;  3IC7 A;  4XN0 A;  3VYT B;  3BPV A;  2BY1 A;  2HVQ A;  2DAO A;  3QOD A;  4BHP A;  2X85 A;  4PJ0 C;  5ICE A;  2EV0 A;  2ISY A;  2FEZ A;  5KAF C;  1LFU P;  3KLN A;  4QIW N;  5E1W A;  4KNY A;  4J01 A;  2R5Y A;  2K9L A;  4AID A;  3PSF A;  1AU7 A;  1B4A A;  1OFC X;  4OU0 A;  2OC6 A;  4ENJ A;  4UUV A;  1IDZ A;  3H92 A;  2E1M C;  5HS8 A;  3JR9 A;  4B09 A;  5FRM A;  2NRA C;  1YJW I;  3F21 A;  1B1B A;  2NVX J;  3BR1 A;  4BQQ A;  1BI0 A;  5DTD A;  2YX4 A;  4CA0 A;  2DK5 A;  3K0L A;  2JA5 J;  4HF2 A;  1EV7 A;  3G3Z A;  4G9Y A;  2MD0 A;  3HTU A;  3F22 A;  2BHZ A;  2XF6 A;  5JFR A;  4NDL A;  2R7X A;  3GFM A;  1FC3 A;  1ZG3 A;  1TNT A;  2GAU A;  2XHK A;  1QVU A;  3BJ6 A;  2ECB A;  2A68 F;  4AM3 A;  2D45 A;  1R22 A;  4PGG A;  3HGY A;  5JLX A;  3RKQ A;  1W5T A;  2UZK A;  1HW2 A;  2W00 A;  3P9C A;  4BQO A;  3QPH A;  1YW7 A;  4NB5 A;  1O3Q A;  2DFI A;  3E7L A;  1N77 A;  5E3M A;  1GXQ A;  5FKM A;  5DDG A;  3DTK A;  1I3Q J;  1XMK A;  3JAM K;  1LQ1 A;  5D8K B;  2WB1 N;  1GVJ A;  3LA3 A;  1XGM A;  2D5V A;  2R7O A;  2DA2 A;  3W6J B;  5FLM J;  1TTY A;  3G1M A;  4OIN F;  4XK4 A;  1ZR2 A;  1B8I B;  1QNT A;  5B66 C;  2V6E A;  3ZMD A;  3R0A A;  3TL4 X;  3QU6 A;  1E17 A;  2DOE A;  3KZY A;  2VB6 A;  3HSE A;  2NS7 A;  1HLV A;  2X6X A;  4A3K J;  1I6H J;  4ENM A;  1AHD P;  1RR7 A;  5FD5 A;  4RGU A;  1J5Y A;  2DT6 A;  4H0E A;  1RKW A;  4MIM A;  2XKO A;  3PFY A;  2LKS A;  1T2K A;  4QTR A;  3VOE A;  3DBL B;  4NQW B;  1QO0 D;  3MQ0 A;  5BQT A;  3IRR A;  2PJP A;  1VI0 A;  5IY5 H;  3HPG A;  1XGS A;  1XDS A;  4F93 B;  5F1J A;  4QWQ A;  5F1R A;  1X2N A;  1IJW C;  4RAF A;  1RPW A;  3MFK A;  3ZPL A;  3BR0 A;  5FO5 A;  3AG3 H;  4UY8 I;  2KDZ A;  2QLZ A;  4P96 A;  3GUD A;  2L9S A;  4EM2 A;  3TGN A;  2VN2 A;  1UMQ A;  5IP7 J;  2ZFU A;  2E2J J;  1OCZ H;  3LFU A;  1XG1 A;  1FNN A;  3J80 Z;  2P5K A;  4R8H A;  3L2V A;  4V19 K;  3I53 A;  2CV0 A;  4AVZ A;  3DPU A;  4GCV A;  2CUF A;  3MCZ A;  1X4O A;  1D3Y A;  5CLS A;  4CSW A;  4UV8 A;  3GF2 A;  5KNL A;  4CIC A;  2EBI A;  3H5R A;  3M1E A;  4O5V A;  3C2H A;  3CP2 A;  1TW3 A;  1SMT A;  1JGG A;  5LLQ A;  2O8X A;  3C18 A;  4LB5 A;  3QWL A;  4M9S A;  1MJ9 A;  3OYJ A;  3CME I;  5AON A;  1IXC A;  4L5J A;  1LKX A;  3T0Y A;  4RDU A;  2BE5 F;  2ZSI B;  4QLC U;  1S7E A;  4I76 A;  2IGN A;  1F5T A;  1LDK B;  1RC9 A;  2BOL A;  2VIX A;  4DNC A;  5E79 C;  5ILU A;  1FTZ A;  3M8J A;  2OCC H;  4YIF A;  1YE9 A;  2JPB A;  5C4X J;  2HZD A;  4WWC A;  1Z9C A;  1T95 A;  3VSK A;  4BEH B;  2V4J C;  2RV8 A;  3Q9S A;  1KZH A;  4E70 A;  5FLX K;  1VFC A;  4QPQ A;  4DQ2 A;  1OCO H;  5LEJ A;  4U7D A;  2ZFW A;  2ZSH B;  3V7R A;  3R60 A;  4UVA A;  3PQJ A;  1MKM A;  1WSU A;  3BCA A;  1X1A A;  2WV1 A;  4EAT A;  5B5E C;  1R5I D;  1X1B A;  3HBL A;  3F8B A;  3JTH A;  1IDY A;  2DU9 A;  4C3I J;  4EM0 B;  1K6Y A;  1HST A;  5DCM B;  3F8M A;  4FE7 A;  3TW6 A;  1ODD A;  2HKX A;  2BY3 A;  1HBX G;  5E8I A;  4XRM A;  1D1C A;  4BE0 A;  2HVR A;  3GEZ A;  3BLY A;  2VQC A;  4WXH A;  4JBA A;  1WH5 A;  3KX2 A;  4BQA A;  3Q0V A;  2IS4 A;  3EPZ A;  2HEO A;  1JKQ C;  4MO7 A;  4G7O F;  3S93 A;  3FBN B;  1HF0 A;  1YW9 A;  2V1N A;  4BUP A;  4CCN A;  2MAB A;  4WK8 F;  3LAJ A;  4PSX A;  3F72 A;  5EEH A;  2M0C A;  5B1B H;  2XAQ A;  4F7Z A;  2W24 A;  4QPO A;  2RQQ A;  2HNH A;  3HUG B;  1Z21 A;  4II3 A;  3PUF A;  3HSR A;  3K2Z A;  2LBF A;  1D0Z A;  2QKM B;  4FE4 A;  3OL3 A;  2L4M A;  1YYV A;  5AIP A;  1ZH5 A;  4KJZ A;  3FBI B;  2FUG 2;  4XLA A;  2ZJR F;  2K40 A;  3HYI A;  1UHW A;  4MTE A;  1XSV A;  2LFB A;  4KIG A;  4YIR X;  2FA5 A;  3HEF A;  1PUF A;  2JVH A;  1WJD A;  3OR2 C;  1FZP B;  4BKX A;  3LNQ A;  3KYD B;  3HDD A;  5ERI A;  1K78 B;  2KKO A;  4XRF A;  1ZRC A;  3J7Y J;  1A6I A;  3HKZ N;  1R5H A;  2Q8K A;  3SFI A;  2VC1 A;  4O6J A;  4XL9 A;  4XLE A;  1W5S A;  1UHM A;  1ZRF A;  2F6C A;  1P4X A;  4C2T A;  1LNW A;  1ZYR F;  3E5Q A;  1SFE A;  4ZDP A;  4I0A A;  5HS9 A;  1KU7 A;  1MSF C;  3I71 A;  3L7W A;  3IKT A;  2VPR A;  3KP5 A;  4A0Z A;  2EFN A;  1GUU A;  1VQ4 I;  4MGR A;  4P5O A;  3REO A;  2CWE A;  3DPL C;  3F8N A;  3FK6 A;  2E35 A;  3LOC A;  3FF5 A;  1XMA A;  2JMW A;  2EIJ H;  2Q2E A;  2X0L A;  2UV1 A;  2VI6 A;  4IX7 A;  2XPW A;  1YIT I;  1J75 A;  4RAG A;  2RNJ A;  3SZG A;  3ZQG A;  1O7F A;  3OV8 A;  2JA8 J;  3P9K A;  3T1B A;  2NOJ B;  3KEQ A;  1K7A A;  4BBR J;  4BYY A;  2H09 A;  1YLF A;  3RPQ A;  3ZMU A;  3MAJ A;  3WGI A;  3DKW A;  1NG6 A;  2EZK A;  3J7Z I;  3SJM A;  1ZG1 A;  2DQL A;  4ZDL A;  1W7P D;  4RBO A;  1T0F A;  2YSR A;  2XAF A;  4HW0 A;  2ZNY A;  4M6X A;  1OCC H;  3MKY B;  3MEX A;  1SAN A;  3PO3 J;  3IAM 2;  2Y69 H;  2XAU A;  3ZOB A;  5TRD A;  3T5X A;  3FXO A;  1R4M B;  2LH9 A;  4N0B A;  4D9J A;  2HWV A;  3OS1 A;  4WCG A;  1MNM C;  4L9V A;  1MGT A;  3U1D A;  5E17 F;  4XLH A;  1PP8 F;  2GWR A;  2E1M B;  5F0C A;  1YFH A;  2EFO A;  3KIO A;  2EA4 A;  4XBF A;  3TP0 A;  3IL2 A;  1FBU A;  1RZ4 A;  3DF8 A;  2IAI A;  5F27 A;  3LA2 A;  1G3W A;  3HG9 A;  1TT5 B;  2VKH A;  4M74 A;  4O3M A;  1YX5 A;  3BY6 A;  3KZZ A;  5C4J J;  3BR3 A;  1RUO A;  2P4W A;  3K4J A;  3KZI C;  1LVA A;  2L3D A;  4NC6 A;  3EYY A;  2E2I J;  3BCB A;  4RB2 C;  1NH3 A;  4Y4R A;  1HCR A;  3MMY B;  3A2K A;  4XKW A;  2W85 A;  4ZZL A;  4L9J A;  4AU7 A;  3HOT A;  2VC0 A;  2X6W A;  3F3X A;  3K9T A;  1U8R A;  3S2H J;  5FKK A;  4BJ5 C;  4PJN A;  2ID6 A;  4HNU A;  2PJR A;  4UUS B;  1Z67 A;  1Z7U A;  1ETV A;  2A3S A;  3COA C;  4PJJ A;  1AKH B;  2HS5 A;  4LIU A;  5GP9 A;  1UFM A;  2KIQ A;  2VT3 A;  4FQG A;  1RET A;  1H0M A;  2EPF A;  2E1C A;  3H3U A;  5DM6 F;  2LVS A;  3L09 A;  2VOO A;  4LOC A;  1GHC A;  2DTR A;  4EGZ A;  1IV8 A;  5CKT A;  5CQG A;  3OYD A;  1F9N A;  3K69 A;  2DPD A;  3CLO A;  1JUP A;  1ETK A;  4CHU A;  2B63 J;  4Y33 A;  1Z91 A;  2ZXJ A;  2V1X A;  4I6Z A;  4ESJ A;  4B44 A;  5D5V B;  3BT9 A;  4PGH A;  2HU9 A;  2DBB A;  2JSC A;  2BW3 B;  4C3J J;  3R6S A;  4Y52 J;  3FKJ A;  3SHF A;  2EB7 A;  3WGG A;  3C3W A;  2DK8 A;  4WXC A;  1VQ8 I;  1U3E M;  1G3T A;  1K61 A;  2CG4 A;  4IXA A;  3H9J A;  2B0L A;  3L2C A;  1YRN B;  2NVT J;  2GA2 A;  4P55 A;  1A35 A;  1HOM A;  2F5D A;  3HM5 A;  3I3L A;  1SAX A;  1TT0 A;  3DEE A;  3TP3 A;  5KK1 A;  4ZTJ A;  3CJQ B;  1X1C A;  1D8K A;  3QQA A;  3QYB A;  2CQ7 A;  4I01 A;  3TBI A;  3CO7 C;  5K5O A;  4H4K C;  1U5T C;  3K1P A;  3KEY A;  4K2E A;  3BQY A;  1S7O A;  4CYD A;  2IS2 A;  4E7Z A;  2PBI A;  2MA3 A;  3I4M J;  1DU0 A;  5D8L B;  2E5Z A;  2OZ6 A;  3ZQC A;  2ZBK A;  1SMY F;  1P92 A;  2FXA A;  3LSM A;  3IHU A;  5CVR A;  2H1K A;  2OBP A;  4DGW B;  2F4M B;  3E97 A;  1MJB A;  4RLF A;  2UXN A;  2QEX I;  3L9F A;  3WU2 C;  2KRC A;  2DXI A;  1DU6 A;  2LBF B;  2QSF X;  3K4B A;  1QZZ A;  1F4K A;  1KA8 A;  1BI2 A;  2Y0M A;  2LLK A;  4F52 A;  1GT0 C;  3S2D J;  4D1Q A;  3PIO F;  2L01 A;  2CQQ A;  2QZ8 A;  3LST A;  2ME6 A;  1BR1 A;  2BEO A;  3MD2 A;  3FXQ A;  3VYS B;  2EFP A;  1PUF B;  4P9F A;  2V9V A;  3OMY A;  3GZ6 A;  2XF7 A;  2VQL A;  3WTT C;  5FB2 A;  2ZO4 A;  4NBQ A;  4A0X A;  1AOY A;  2CW7 A;  3HHH A;  3VPR A;  3I4N J;  2H6C A;  3E3V A;  4G8X A;  4XLF A;  3TOA A;  1AWC A;  1A6Q A;  3SQN A;  5B1A H;  3LSG A;  4L5E A;  5HLH A;  2WAQ A;  3DP7 A;  1SD4 A;  5H6R A;  5IYD J;  3CCJ I;  1FJL A;  4RB3 C;  2DMP A;  2WTE A;  1X4P A;  1B8I A;  3WTZ A;  2E34 A;  3NWS A;  2L4A A;  4UVC A;  3PNY A;  5GTH C;  1E2X A;  1QZE A;  2HYJ A;  3H0D A;  3K70 D;  5EG0 A;  2HDW A;  2O0Y A;  2BXY A;  4FAS D;  2ZJP F;  5J4V A;  4F91 B;  3D5L A;  3M8F A;  4M3E A;  4ESF A;  4MFD A;  5F08 A;  2Z99 A;  3Q0U A;  2QYO A;  3ULQ B;  2V9K A;  1SFU A;  1H88 C;  1FWZ A;  4XOP A;  1GXP A;  5F0F A;  3O6B B;  3FXR A;  4BHB A;  2HR3 A;  3WG9 A;  2HPM A;  3GTG J;  3CZ6 A;  2JZY A;  2HOT A;  3QPL A;  3AG1 H;  3X2Q H;  2KLO A;  3DEU A;  1G3Y A;  4E7H A;  2VQH A;  1Z6R A;  2XGE A;  4NQW A;  4U0W A;  2ETH A;  2RGV A;  2XPU A;  5CVI A;  2PLY A;  1YHQ I;  2Y30 A;  3ABL H;  2EZI A;  1P4A A;  1V4R A;  1YG2 A;  4E7K A;  4B43 A;  1VQO I;  2QGU A;  2FX0 A;  3DTE A;  4A5M A;  4BE1 A;  2MW8 A;  4RMN A;  2FJ1 A;  3CDH A;  4Q4Z F;  3WHC A;  3CCL I;  3CES A;  1HSJ A;  3KCC A;  4KIT B;  3RIR A;  1R71 A;  1DGW Y;  3K6G A;  4OAY A;  4RGR A;  1WJA A;  4UV9 A;  2DI3 A;  3V42 A;  4KMF A;  2PMU A;  4HX4 A;  3WOD F;  2HDC A;  2MLK A;  2X1C A;  2VJ4 A;  3IP4 B;  2L54 A;  1SFK A;  2CUZ A;  2H8R A;  1T98 A;  3LSJ A;  1XD7 A;  3OS2 A;  3E6C C;  2JA7 J;  5JI6 A;  3K4L A;  1ZRD A;  1V55 H;  2PFB A;  4MTD A;  3CJN A;  4LGW A;  3TO9 A;  3ABU A;  2KT0 A;  4AVP A;  1OQY A;  4L9T A;  4GO1 A;  3ERE D;  2K7L A;  1WKM A;  3ASN H;  2QSG X;  3BR6 A;  2XPV A;  4BQN A;  4XSZ F;  1V54 H;  3FIW A;  4NHJ A;  5AIQ A;  3VYU B;  3DBR B;  1PDN C;  3C2G A;  4MFE A;  1VZ0 A;  3CDI A;  2KIM A;  2AXT C;  4B8X A;  3BP8 A;  5CPR B;  3E1S A;  1OCP A;  2ELJ A;  1Z77 A;  5E18 F;  2FF4 A;  1KQ9 A;  5M3F J;  4CCL A;  2K3P A;  2L7M P;  2WWY A;  4DOZ A;  1ORK A;  2MBF A;  2HXI A;  3JW4 A;  4CCJ A;  3J81 K;  3G6E I;  4ZYH A;  4RB0 A;  1Y39 A;  5E1Z B;  2ZXW H;  3LWF A;  2R7W A;  1ENH A;  4KN4 X;  5LRR A;  2E1N A;  4EEF G;  4A3G J;  3GTK J;  1EJ9 A;  1X19 A;  2P5V A;  4BEH A;  3S1R J;  4FCY A;  2JVG A;  2PMZ A;  3CCE I;  2COM A;  3ROU A;  2P6S A;  3U2R A;  2LY1 A;  3BG9 A;  1PP7 U;  2ZJ2 A;  2IS1 A;  1I27 A;  2IW5 A;  2QQA A;  3E5X A;  3AL0 C;  4CXF A;  1D8J A;  3OSF A;  1P6R A;  1OCR H;  5K1Y A;  4EJU A;  4LIT A;  2R93 J;  1G4D A;  4HV6 A;  5DCM A;  4HV5 A;  3G4S I;  2W82 A;  1IN6 A;  5J6X A;  1EKE A;  2M34 A;  4EQQ A;  4LD5 A;  1J59 A;  5HLT A;  4BAC A;  2KHM A;  1SC7 A;  3SDG A;  2QA4 I;  1W36 C;  2OJE D;  2EV6 A;  4J00 A;  2ELH A;  2A07 F;  1MW7 A;  1TWG J;  2O6G E;  3CQZ J;  1MNE A;  4I99 C;  1XCV A;  4G6Q A;  3CC7 I;  1KON A;  1L0O C;  1WI3 A;  2FRH A;  3HUG A;  4AWX B;  4RS8 A;  3TMO A;  1U8B A;  3AAF A;  2NS8 A;  3EUA A;  3LSH A;  1ERD A;  3OR1 C;  2RRE A;  2QSH X;  4IHT A;  3A1Y A;  2VLA A;  2Y9Z A;  5A2Q Z;  1POG A;  1TWF J;  1HW5 A;  3AG2 H; 
#chains in the Genus database with same CATH homology
 2E2H J;  2DMU A;  5FKN A;  5GPA A;  1QVT A;  2DJN A;  9ANT A;  1H8A C;  3BG5 A;  5C4X J;  1B72 B;  4XRS A;  1G2H A;  2CU7 A;  3IH2 A;  2Y9Y A;  1APL C;  2R92 J;  3FKI J;  2OF7 A;  3JRH A;  1VFC A;  4D7M A;  2K9S A;  2ZB9 A;  3O8G A;  1MH3 A;  4W1U A;  2WV1 A;  4V2F A;  4JX6 A;  1BW6 A;  3HBL A;  3JRI A;  2XSD C;  4C3I J;  1IDY A;  4S0H B;  4FE7 A;  3JRB A;  2DTZ A;  3TW6 A;  1IG7 A;  4JX4 A;  1UG2 A;  1QRY A;  4XRM A;  1FEX A;  1WH5 A;  2DA4 A;  1VF9 A;  5EEA A;  3L1P A;  2X48 A;  3Q0V A;  2CJJ A;  4A3M J;  2FD5 A;  3H0G J;  2X9D A;  1JKQ C;  1UHS A;  3QPS A;  4MO7 A;  4A3J J;  2O9L A;  1HF0 A;  1MBF A;  2M0C A;  4GFB A;  2L7F P;  4IHX A;  1T56 A;  3FK7 A;  5EG0 B;  2HXO A;  3RZD J;  3PM1 A;  5C3E J;  4FE4 A;  5BNG A;  4M3F A;  4IHV A;  2FQ4 A;  4C3H J;  1BL0 A;  2R5Z B;  2DN0 A;  4C2M J;  2K40 A;  2LFB A;  1IC8 A;  3HEF A;  4X1E A;  5IP6 A;  1PUF A;  2QF7 A;  3M3Y J;  4BKX A;  3LNQ A;  1ZTR A;  4FTH A;  3HDD A;  4A3F J;  3HOZ J;  1A6I A;  2M8G X;  2AO9 A;  2WAQ N;  3DCF A;  3HKZ N;  3SFI A;  5J1Y A;  1JJ8 C;  5E3O A;  5EF6 A;  3A03 A;  1IGN A;  4B1R A;  5M3M J;  2L7Z A;  1MSF C;  3JRG A;  2JWT A;  4JYK A;  2MGQ A;  2VPR A;  1GUU A;  2JN6 A;  5J1R A;  3FK6 A;  3LOC A;  5F04 A;  2X6O A;  3S16 J;  2YU9 J;  2JMW A;  2CQX A;  2VI6 A;  2XPW A;  3K7A J;  5GPC A;  1JUS A;  1X2M A;  3ZQG A;  1TC3 C;  5FKO A;  2JA8 J;  3GTJ J;  1ZQ3 P;  4A3I J;  1I50 J;  1XC5 A;  3HB9 A;  4IHY A;  3WHB A;  2AHQ A;  4D7N A;  3BR2 A;  2DA1 A;  2EH3 A;  4BBR J;  4UUS A;  2XRL A;  2HDD A;  2ID3 A;  2DA7 A;  1AKH A;  2JJ7 A;  2EZK A;  4AC0 A;  3B6C A;  3SJM A;  2E1O A;  4DZP A;  4RBO A;  4A3B J;  4B3A A;  1RKT A;  4ABZ A;  3OSG A;  1SAN A;  3HOV J;  3CDL A;  3PO3 J;  5M5X J;  2DMN A;  2K9N A;  3PO2 J;  3ZOB A;  1LE8 A;  1TWA J;  4DYR A;  5C44 J;  1OJL A;  3NAR A;  2DMT A;  1MNM C;  4BY7 J;  5EZH A;  5F0C A;  1ZR4 A;  1SFO J;  3ZQH A;  3BTL A;  2EZH A;  3TP0 A;  3JRF A;  2JA6 J;  5F27 A;  2IAI A;  1GV2 A;  3H3V K;  3GBG A;  3M4O J;  3BR5 A;  3G1L A;  3HOY J;  2HQ5 A;  1P7J A;  5C4J J;  1GVD A;  3BR3 A;  3CCY A;  1YRN A;  3GTL J;  2O8K A;  2EQR A;  3A01 A;  2GLO A;  1EF4 A;  1X58 A;  2W48 A;  2E2I J;  5IPA A;  4XRS G;  1HCR A;  4DW6 A;  3S2H J;  5IOY A;  5FKK A;  2DMQ A;  2ID6 A;  4UUS B;  1ITY A;  1ETV A;  1VND A;  2NOG A;  2CRG A;  1ZGW A;  1AKH B;  5GP9 A;  1Y1W J;  1RET A;  4DYC A;  1JT6 A;  3ZQI A;  4DZJ A;  1F43 A;  4V2G A;  2N8G A;  2COB A;  2R0Q C;  2LVS A;  5EDN A;  1FIP A;  4LOC A;  4X6A J;  1IV6 A;  2DA5 A;  2TCT A;  3F0C A;  3S17 J;  1LE8 B;  3K2A A;  1JUP A;  1ETK A;  4AYB N;  3OIO A;  2B63 J;  3OOU A;  3Q3S A;  5K7Z A;  2LTP A;  4I6Z A;  2PMZ N;  3ZQL A;  5M5W J;  1CQT A;  1BJZ A;  3BT9 A;  2CUE A;  5IYB J;  1MBG A;  3GTM J;  4W97 A;  4C3J J;  4Y52 J;  1R9T J;  5IP9 J;  4IHW A;  3LSR A;  2VKV A;  1FTT A;  2Y2Z A;  2GBY A;  1K61 A;  3GTO J;  2ECC A;  2XB0 X;  1YRN B;  1OCT C;  1MSE C;  2NVT J;  1WGX A;  4XIC A;  1HOM A;  4CYC A;  2E19 A;  3HM5 A;  2L0K A;  2RAE A;  5EGO A;  3TP3 A;  3JRD A;  4JX5 A;  1ZK8 A;  3MN2 A;  3GTQ J;  2NVY J;  3QQA A;  2LK2 A;  3DEW A;  3BQY A;  3S1M J;  4A93 J;  1NTC A;  1ETO A;  2Y31 A;  2GM4 A;  2YUS A;  3S1N J;  1MBE A;  3I4M J;  1DU0 A;  1MH4 A;  1WH7 A;  3ZQC A;  3JRE A;  2HOA A;  2YS9 A;  3IH4 A;  4A3L J;  2DA6 A;  1Q1V A;  2H1K A;  1WPK A;  2VUM J;  1T33 A;  5M5Y J;  5EYR A;  5E3L A;  4D5C A;  3G1O A;  3UKG A;  1DU6 A;  1H89 C;  5FKL A;  2ME0 A;  2DA3 A;  1K83 J;  5J1U A;  2LY9 A;  3MKL A;  2HI3 A;  4Y7N J;  4A3C J;  1BW5 A;  1TWC J;  2LLK A;  1GT0 C;  3S2D J;  2G0E A;  5IOZ A;  1JT0 A;  3TW7 A;  1ZKG A;  2CQQ A;  4XID A;  2ME6 A;  3HGG A;  3D1N I;  3LSP A;  2LD5 A;  2OPT A;  2P81 A;  1PUF B;  4J19 A;  5HOD A;  1LFB A;  1ETX A;  1JKR C;  3BTI A;  3C2B A;  5DS9 A;  4M6V A;  2Y0S N;  1ETY A;  3VPR A;  3I4N J;  1XS9 A;  3LSG A;  4L5E A;  1HDD C;  1NK3 P;  2LKX A;  5IYD J;  1FJL A;  2DMP A;  2IEK A;  1B8I A;  3IH3 A;  4AUX A;  5JLW A;  1F36 A;  1WCM J;  2NVQ J;  4B4C A;  2HYJ A;  3BQZ A;  3HOU J;  1LFU P;  5EG0 A;  4QIW N;  4M3D A;  2R5Y A;  1AU7 A;  1OFC X;  4A69 C;  4M3E A;  4DYQ A;  1ETW A;  3O8H A;  2JK3 A;  4MFD A;  5F08 A;  1IDZ A;  3JR9 A;  3Q0U A;  1H88 C;  2IBD A;  1QPI A;  3IV5 A;  1D5Y A;  5F0F A;  2NVX J;  3BR1 A;  3GTG J;  2O7O A;  5DTD A;  2JA5 J;  2HOT A;  3QPL A;  3BG3 A;  2MSY A;  4NDL A;  3Q0W A;  2XGE A;  4QSH A;  2XPU A;  2Y30 A;  3NAU A;  1QVU A;  2ECB A;  2EZI A;  3W6V A;  3HGY A;  5JLX A;  2ELK A;  3RKQ A;  4IEJ A;  3JRA A;  2FX0 A;  4M3G A;  2MW8 A;  2FJ1 A;  2XGD A;  3ZQF A;  2VKE A;  3BTC A;  3WHC A;  3E7L A;  5E3M A;  5FKM A;  1I3Q J;  1BA5 A;  4BXX J;  2WB1 N;  4HNV A;  5K7H A;  2D5V A;  1JTY A;  2DA2 A;  3RQI A;  1MBJ A;  1P7I A;  5FLM J;  3G1M A;  3HOX J;  4XK4 A;  1ZR2 A;  2L9R A;  1B8I B;  3JRC A;  2H8R A;  3LSJ A;  2R5Y B;  3A01 B;  2JA7 J;  1Y1V J;  2NS7 A;  2QCO A;  1HLV A;  3B6A A;  4A3K J;  2XB5 A;  5K7F A;  1JKO C;  1I6H J;  1AHD P;  1U9O A;  1W0T A;  1RR7 A;  3S1Q J;  1JUM A;  1RES A;  2KT0 A;  1U78 A;  4D5F A;  3A02 A;  1RKW A;  4MIM A;  3BR6 A;  5FLV A;  2XPV A;  1A5J A;  1MBH A;  3FIW A;  4QTR A;  3TED A;  2R7Z J;  1U9N A;  4MFE A;  5F0H A;  2EZL A;  1VI0 A;  1OCP A;  4JP0 A;  1Z77 A;  5F1J A;  5M3F J;  5FJ8 J;  1X2N A;  1IJW C;  4BBS J;  1RPW A;  2MG4 A;  1GDT A;  1TWH J;  3BR0 A;  2L7M P;  1NK2 P;  1GV5 A;  2KDZ A;  4M3B A;  1ORK A;  1JKP C;  2HXI A;  5EZG A;  2HOS A;  1B72 A;  1UMQ A;  5IP7 J;  1ENH A;  2E2J J;  1ETQ A;  2LP0 A;  4EEF G;  4A3G J;  4G12 A;  3GTK J;  3MVP A;  3BTJ A;  3S1R J;  4FIS A;  4FCY A;  2XGC A;  1FIA A;  1XG1 A;  3S15 J;  3BG9 A;  1W0U A;  1E3O C;  3OSF A;  3S14 J;  4BY1 J;  4A3E J;  4A3D J;  2CUF A;  3CMY A;  2R93 J;  1Z0X A;  1HDP A;  1JTX A;  4CYC B;  2M34 A;  2EBI A;  5EGO B;  3RZO J;  5IYC J;  3SDG A;  2K9Q A;  3HOW J;  1JGG A;  5J3L A;  1TWG J;  3CQZ J;  1IRZ A;  2TRT A;  3FIS A;  4UUT A;  2LR8 A;  1WI3 A;  1U8B A;  4RDU A;  2NS8 A;  1JJ6 C;  2M9H A;  1S7E A;  4I76 A;  2M2E A;  5E3N A;  3GTP J;  1O4X A;  2Y9Z A;  1IUF A;  4MLO A;  1MBK A;  1POG A;  1TWF J;  2I10 A;  2R5Z A;  1FTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...