3PO2J

Arrested rna polymerase ii elongation complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3po2J00
1VFCA 5DS9A 1JT6A 2DMQA 1P7JA 2ECCA 4Y52J 2LLKA 4DYQA 1JUPA 1P7IA 3RQIA 4XRSA 1ETQA 2MGQA 1HDPA 2IBDA 4A3CJ 2WB1N 2LFBA 1ZR2A 3A03A 5IYDJ 2CRGA 5K7ZA 4A3IJ 2Y31A 3JRIA 5C4XJ 5M3MJ 5IPAA 2L7MP 5F0CA 5F1JA 3JREA 1HLVA 1U9OA 1SFOJ 1RKWA 3MN2A 2DA7A 2YUSA 1HCRA 2HQ5A 5M5WJ 2JN6A 4XRMA 1RETA 4UUTA 1H8AC 1FJLA 3TEDA 1W0UA 1T56A 4IEJA 3L1PA 1Q1VA 3IH2A 5F27A 5IOYA 4CYCA 5JLXA 4D7NA 1WGXA 1JTYA 4RBOA 1IC8A 1MSEC 1GV5A 2PMZN 1HF0A 2ELKA 1NTCA 4M3EA 3S2HJ 2NVYJ 3DEWA 3Q0VA 1QPIA 1QRYA 4I6ZA 3BG9A 1MBKA 3ZQIA 3SDGA 1K61A 1BA5A 2HXOA 2VKEA 1ETVA 4BXXJ 2LVSA 5EZHA 3G1MA 5IOZA 1LFUP 2XB0X 1MBHA 1BW6A 4M6VA 4DZPA 2D5VA 5J1RA 2CU7A 4NDLA 2H1KA 2B63J 2K9NA 4FE7A 5M5YJ 3OSFA 1UMQA 3GBGA 3BTJA 3QPSA 3VPRA 1AHDP 4W97A 1B8IB 3HOXJ 3GTJJ 4MFDA 4A3EJ 1G2HA 1VNDA 5J1YA 1VI0A 4BBRJ 4JX6A 4M3FA 4QIWN 2MG4A 1ORKA 2NOGA 2DA2A 3JRBA 2ECBA 1WPKA 2DJNA 3BQZA 4I76A 1Y1VJ 3GTMJ 4MIMA 3A01A 3HOZJ 2HOTA 4BBSJ 2XPWA 4XK4A 1JJ6C 3B6CA 1Z0XA 5F0HA 5E3OA 3QPLA 1X2MA 4IHXA 3JRCA 3GTQJ 1CQTA 1OCPA 1YRNA 2QCOA 2IEKA 2JA6J 5K7HA 1HDDC 4S0HB 3ZQGA 1UG2A 2H8RA 1W0TA 2W48A 2HDDA 3FIWA 1RESA 1ETWA 1ETKA 4FCYA 2XGEA 1A6IA 1JUMA 3BTIA 1H89C 1VF9A 2L9RA 2DTZA 3HEFA 4D5CA 1JJ8C 2Y2ZA 3HM5A 2XGDA 4ABZA 1RPWA 1ZK8A 4X6AJ 3GTGJ 3NAUA 3IH4A 4D7MA 4XIDA 1Y1WJ 3S1MJ 5FKLA 3CQZJ 3PM1A 5E3MA 4B3AA 1R9TJ 2P81A 3BTLA 4A93J 1TWCJ 1I6HJ 5EGOB 5IP6A 3Q0WA 3LSJA 3S1QJ 4UUSA 2AHQA 2DA6A 1ENHA 5FKNA 4A3JJ 2COBA 2M34A 4B1RA 1MBEA 2G0EA 3Q3SA 3O8HA 2DA4A 4M3DA 4M3BA 3HOWJ 1IRZA 3B6AA 5K7FA 1OFCX 1POGA 3HGGA 3HGYA 1X58A 5J3LA 2JJ7A 2M0CA 2L0KA 1BJZA 3BG5A 2O7OA 1LFBA 2CQQA 2DMTA 3LNQA 2JA5J 2EBIA 3JRHA 2M9HA 4V2FA 2ME0A 2Y0SN 2LK2A 3HDDA 1TWAJ 3JRDA 2ID6A 1GT0C 1JKRC 1TWGJ 3Q0UA 5HODA 2X9DA 5C4JJ 3WHBA 2XSDC 1GVDA 3BR3A 2FQ4A 4FE4A 5M5XJ 2L7FP 2VI6A 1XC5A 5FKMA 5GPCA 2EZHA 3PO3J 2HOSA 3QQAA 4A69C 2E1OA 2EZLA 4G12A 3UKGA 2DMPA 1WI3A 1ITYA 3E7LA 3K2AA 4FISA 2FJ1A 2R93J 3CDLA 3A02A 1RKTA 1O4XA 3S15J 5IP9J 2LKXA 1B8IA 2MW8A 2RAEA 1MBFA 3CCYA 4BY7J 4EEFG 3HOYJ 4W1UA 2XRLA 2MSYA 2ID3A 1BL0A 2QF7A 1JUSA 5M3FJ 2VPRA 1JKPC 1BW5A 3S1RJ 1MNMC 2LP0A 1NK3P 2CUEA 3TP0A 3H3VK 1D5YA 1MH4A 2EZIA 1JTXA 4C2MJ 4QTRA 3BR5A 2M8GX 3FK6A 5GP9A 3W6VA 2R5ZB 1K83J 1WH5A 2DA3A 4B4CA 4A3KJ 2CUFA 4IHYA 1XG1A 3HBLA 3MVPA 1GDTA 2TCTA 3S17J 2R5ZA 3LOCA 4AC0A 2EZKA 5EEAA 3DCFA 3BR1A 2DA5A 2R0QC 3ZQCA 2XGCA 3RZDJ 4L5EA 1LE8B 4A3LJ 1X2NA 4JX5A 1TWFJ 4RDUA 2JK3A 3S2DJ 2EH3A 3LSGA 1U8BA 5FLVA 3TW6A 1UHSA 3FKIJ 1IGNA 1U78A 3F0CA 3GTOJ 2GBYA 1RR7A 3MKLA 1ETYA 3CMYA 1H88C 2K9QA 5EGOA 5C3EJ 3BTCA 5EZGA 2LY9A 3HKZN 5FJ8J 1F36A 2XPUA 2HI3A 3RZOJ 1GV2A 3BQYA 1IV6A 5DTDA 3IH3A 3S14J 1Z77A 4AUXA 2XPVA 3ZOBA 4A3MJ 3JRFA 1FTZA 1I3QJ 2L7ZA 5FLMJ 3ZQHA 2LD5A 2DMNA 2JA7J 4JX4A 3GTPJ 1TC3C 2NS7A 3FK7A 4MFEA 5C44J 1JGGA 2FX0A 5IYBJ 2EQRA 5EF6A 4J19A 3HOVJ 2VUMJ 3PO2J 3FISA 4QSHA 1MH3A 3ZQLA 1DU0A 3WHCA 1QVUA 1JKQC 5EG0B 3IV5A 2R7ZJ 4DW6A 1FTTA 5E3LA 1MBJA 2IAIA 3HOUJ 3LSPA 1NK2P 2KDZA 2LR8A 4A3BJ 5EG0A 1S7EA 1F43A 2E2IJ 3SFIA 3OSGA 4FTHA 2E19A 1T33A 2OPTA 1ETOA 1JKOC 3SJMA 1MBGA 5BNGA 2JWTA 1U9NA 3GTKJ 3BG3A 2CQXA 4Y7NJ 1AKHB 2Y30A 3ZQFA 3BR2A 1B72B 4CYCB 1ETXA 5FKKA 2JA8J 4XRSG 1AKHA 5EYRA 4LOCA 5EDNA 3D1NI 1HOMA 1B72A 1E3OC 2E2JJ 5J1UA 1FEXA 2HYJA 2ME6A 4XICA 1IDYA 3K7AJ 2I10A 2R92J 2DN0A 1I50J 2K40A 4V2GA 1SANA 1WH7A 1ZTRA 3M3YJ 2VKVA 2Y9ZA 1ZGWA 2NVXJ 4X1EA 5F0FA 1IUFA 4A3GJ 4D5FA 2TRTA 4MO7A 3S16J 2N8GA 2X48A 3H0GJ 3BR0A 3GTLJ 3G1LA 3NARA 1QVTA 1OCTC 2LTPA 2ZB9A 3M4OJ 2X6OA 4HNVA 2O8KA 2WAQN 1FIPA 2DMUA 1IDZA 3JRAA 2E2HJ 3BR6A 1WCMJ 2WV1A 5F04A 1APLC 4IHVA 3S1NJ 3LSRA 2NVTJ 5IP7J 5FKOA 3C2BA 4MLOA 1TWHJ 1ZR4A 3TP3A 4JYKA 3BT9A 4C3HJ 4BKXA 3A01B 1DU6A 2Y9YA 3TW7A 2M2EA 3I4NJ 4DZJA 1EF4A 4JP0A 1XS9A 5F08A 1YRNB 3JR9A 4DYCA 1PUFB 1MSFC 1ZQ3P 4A3FJ 4DYRA 1LE8A 2GM4A 2O9LA 1IG7A 4A3DJ 1GUUA 3RKQA 2CJJA 5IYCJ 2R5YB 1IJWC 4BY1J 1PUFA 1FIAA 1ZKGA 2AO9A 2R5YA 1JT0A 1A5JA 1OJLA 2GLOA 3OOUA 2HXIA 5GPAA 1AU7A 4C3JJ 3HB9A 2NS8A 2NVQJ 2FD5A 4GFBA 2K9SA 2JMWA 2HOAA 2YS9A 2KT0A 2YU9J 4AYBN 2XB5A 3I4MJ 5JLWA 4M3GA 2OF7A 3JRGA 2DA1A 5E3NA 4IHWA 4UUSB 3OIOA 3O8GA 3G1OA 9ANTA 4C3IJ
chains in the Genus database with same CATH superfamily
1VFCA 1LDDA 4HAMA 4I01A 3P9KA 1JT6A 1LUJB 5H20A 2E5ZA 3RQ4A 1K78A 3PSIA 4QWQA 2EWNA 2M7AA 1HKQA 1R36A 4AYBA 1P7IA 1XMXA 3LA2A 2C6YA 1WHUA 3RQIA 4XRSA 1ETQA 2IBDA 2WB1N 1BIBA 3DFGA 2KKOA 2MC4A 4A3IJ 2Y31A 1NH3A 4RM2A 2IP2A 1WRJA 3OR1C 4I09A 2GA2A 5F0CA 4EATA 3JREA 3CCJI 1RKWA 1GLNA 4PUSA 2HQ5A 2XAQA 1SAUA 3QODA 2JN6A 1PP7U 1R6RA 5L3FA 4WCGA 1B9NA 2VODA 5CLSA 1DPUA 1FJLA 4ESJA 5AONA 1N78A 4R79A 3OYKA 1O3QA 1Q1VA 4IZZA 1ERDA 4EGYA 2XRNA 4NUBA 2IGKA 2EPFA 5F27A 4CYCA 1WGXA 1JTYA 1IC8A 4CCOA 2O61A 1IUYA 2PMZN 1HF0A 3CLOA 5H2FC 2QQ8A 2A6HF 1TT0A 2HGCA 3K4KA 4UHTA 5J8CA 3QWLA 4M3EA 1ZRCA 3S2HJ 4L18B 3QP6A 1OQYA 3Q0VA 3QU3A 4OIPF 4I6ZA 3CJNA 3BG9A 1K61A 3DTKA 4IQ4A 2VXDA 4KT6A 1Z3YA 3RPUA 3G1MA 2VXZA 5IOZA 2HWVA 5J1RA 2CU7A 2HTSA 3FMSA 4CCLA 3WU2C 4AIKA 1B9MA 4XSXF 2K3FA 2BHZA 4S05A 3F8MA 1X3ZB 1N75A 1Y0NA 3FXRA 3DQVC 3T8RA 1R00A 4L9JA 3GFMA 5TGTA 2W00A 4MFDA 4G9YA 4BBRJ 2IRFG 4NQWA 3NWTA 2XGXA 3PQKA 1OR7C 5J40A 3ZN0A 2MD0A 1T38A 1ZG5A 6PAXA 5FFXA 3JRBA 1WPKA 2DJNA 4LB6B 3A01A 2HOTA 3OYLA 2VBXA 3G4SI 3FHNA 3B6CA 1PJRA 5F0HA 3QPLA 1X2MA 4IHXA 4ZYAA 3RDIA 1OCPA 1HW1A 2MABA 4F91B 2M4GA 2IEKA 2V6CA 1MD0A 4RAZA 4YIIA 5K7HA 3V7CA 4D1QA 5HDNA 4XLNF 2QBYB 1UG2A 2L9SA 4M9XA 5HDGA 4AD9A 3ABUA 3ZMUA 3J80Z 1VQ5I 2E7XA 2XUBA 4KYWA 5L3CA 3P5JA 3BTIA 2VQGA 2R7QA 1V5GA 3MWMA 3BLYA 3H9GA 4UB8C 4P9UA 4XR6A 3F8CA 3WGHA 1JJ8C 2JPBA 2HPMA 4ITVA 1ZK8A 4X6AJ 4D7MA 3IH4A 1Y1WJ 3FXJA 1IXCA 5FKLA 5L3BA 3GX4X 5E3MA 1XDSA 3BZ6A 2JT1A 2F4IA 3FXUA 4L9NA 2DYRH 2P81A 4G8XA 2GZWA 3PIPF 1TWCJ 5EGOB 2VKDA 2E34A 3LSJA 1E2XA 2RQPA 3OYGA 4UNOA 1BM9A 4B44A 1I3AA 1G3TA 2LSOA 1K79A 2OC6A 4CUGA 2DW4A 3KE2A 3TO9A 3KZIC 4KUMA 1MMNA 4M3BA 1T0FA 3ZCOA 1RZ4A 2QQAA 2XASA 2QSHX 1Z1DA 2L9NA 2A5WA 1BJZA 3BG5A 3KZYA 2ZSIB 4HF0A 4ENJA 3H35A 4V2FA 3K1MA 4F93B 3K4BA 2GXBA 2QKLB 3HC7A 1TWAJ 3K4NA 3L7WA 4XLEA 3WTZA 2RQQA 1UB9A 2PMUA 4HLYA 1R4MB 1YYVA 2IT0A 3OMYA 5HODA 3OL3A 4E7JA 1VQ8I 4IQJA 3HXLA 3AG3H 2XSDC 1GVDA 3ABMH 4AM3A 2A3SA 2WY8Q 5D4SA 2MBFA 3BR3A 2V7FA 5M5XJ 1OYIA 4LFUA 1A35A 3K1PA 4MNUA 2VI6A 2OD5A 1KU2A 3TGNA 5KAFC 3I3LA 3Q9SA 1P9QC 4KNYA 4KITB 2I5UA 4GYGA 2FF4A 2KISA 5BS6A 3FXQA 4ZYDA 3QQAA 3O2PE 2I8DA 3OYAA 2E1OA 2EZLA 4G12A 1T98A 2YX7A 2OBPA 2KHMA 3ZMZA 2OTJI 2M0MA 3T0YA 1X3UA 1K6YA 4ZYHA 3LQRA 2R93J 1KGSA 2L7KA 1VQLI 2PN6A 1MJBA 3A02A 5IP9J 4DNCA 2LKXA 2XKPA 1B8IA 1SC7A 2JUCA 5J8FA 3HOYJ 5K1YA 2HVRA 5E8IA 3J7ZI 1HKSA 3DPLC 1D8JA 1OLTA 1W36D 4JQFA 3OR2C 1JUSA 2STTA 2KZGA 2JUGA 3PFIA 1NG7A 2L54A 3S1RJ 1NK3P 3EETA 4LLGF 1JHHA 2WADA 2GWRA 2M87A 4HZFA 2G7HA 4IHTA 5KVRA 4A2UA 4QTRA 1XSVA 2M8GX 4WXHA 4CCKA 4PFPA 2QSFX 1K83J 1WH5A 2FOWA 5HLHA 3DXJF 2TCTA 2XF7A 2M45A 1J5YA 3E6BA 3LOCA 2FQ3A 4AC0A 2EZKA 1FOXA 3WTYC 3L2CA 3BROA 3CF5F 3ZQCA 1LB2A 4OOIA 4MTEA 2FEZA 4L5EA 4L0ZB 4BEHB 1X2NA 2FU4A 4JX5A 4A3LJ 1ZYRF 2QZ8A 1SD5A 2Y48A 3D5SC 2HU9A 1U2WA 2JK3A 3S2DJ 2MLGA 3HRTA 3HTSB 1PYVA 2HKXA 3VYTB 4D9JA 5FLVA 2ZXHA 1QA6A 2AXLA 3CCUI 1TNSA 3L2RA 3HG9A 1YFHA 2GBYA 3Q9VA 1A31A 3M8JA 1J7KA 1H88C 4HRIA 3GZ5A 3WGGA 1LEAA 3ROUA 3LFUA 2IS6A 2R7SA 1IN6A 4BDYA 3CJRB 5EEGA 2VOPA 2CUZA 1IV6A 3IH3A 4PJNA 4AUXA 1AA7A 2XPVA 2QSGX 3C2HA 3ZOBA 2QA4I 1FYMA 3PJRA 3CLQA 4KIBA 3UR3C 1SFXA 3JRFA 3LAJA 1FTZA 2BZTA 3CF2A 2CV2A 1OCCH 2PLYA 2D45A 2NS0A 3ZQHA 1P6RA 5LHGA 4RGUA 4XQFA 4NHJA 1DGWY 3H9QA 1K78B 2EQRA 4E7IA 1HW5A 4M73A 3FISA 3K4CA 3G2BA 4QSHA 3MD2A 3ZQLA 4PGHA 1VQ7I 2FBIA 3IV5A 5KAIC 3U1DA 1FPQA 1OPCA 3ZMDA 4DW6A 1FTTA 1MBJA 3VSKA 1S5LC 3O3KA 1NK2P 1F43A 2L9VA 3E97A 5EG0A 2JZYA 4KMFA 1FWZA 3LMMA 3SFIA 1FZPB 2Y0MA 2OPTA 1O7FA 2MD5A 3J81Z 1ETOA 3JTGA 3NEUA 1XX5A 1MBGA 2VE9A 3BG3A 2D1VA 2KZVA 2EIJH 4U7BA 2P5KA 5DM6F 4IVNA 2Y0SA 3OYJA 2GOXB 4CYCB 1KA8A 2DOEA 2BHYA 4XRSG 3ZRGA 5JR3A 2E1MC 4E4HA 4GXOA 1B72A 3EYYA 2IGNA 4ENMA 1IDYA 2R92J 2I10A 2CG4A 3DLAA 1XGSA 4M9SA 2XAGA 4CSWA 2VKVA 2A07F 1TQPA 4X1EA 3P9CA 1MMSA 2TRTA 3WG9A 3H0GJ 3BR0A 3GTLJ 1D0YA 1G3SA 3D5LA 1SMYF 2EFPA 4EGZA 1UZCA 4NNJA 1OCTC 4HV6A 1REPC 2WAQN 3KPHA 3S8PA 3W6JB 1P4XA 2KDOA 3FHZA 3JSPA 5K5OA 2XAHA 1WCMJ 1KQ0A 2IA2A 2P6TA 3MKYB 3CMEI 1APLC 1E3PA 3FX3A 1TL8A 3OS0A 3K0LA 4BQNA 2JSCA 2KIMA 4NQWB 3CO6C 5FKOA 1IRFA 3PNYA 1ZR4A 1Y39A 4Q48A 1SAXA 3BT9A 2X85A 3WTUC 2K7LA 4E70A 3A01B 1DU6A 2Y9YA 3TW7A 1XB4A 2M4KA 4ASNA 1XCVA 2RV8A 3HIFA 2LY2A 3JCUC 2EINH 1SVMA 4EJTA 2V6EA 2RDPA 4IX7A 2WBMA 3DU6A 1PUFB 4DYRA 1IG7A 4BQQA 1SEUA 3DKXA 1Z6RA 5AIPA 1IJWC 1ZN2A 4BY1J 2BW3A 3IWZA 4CDGA 2VC0A 1FIAA 1Z7LA 1A5JA 1JT0A 4LGWA 4O3MA 1OJLA 2GLOA 3WU0A 5GPAA 4OIQF 1OCRH 2UXNA 2X6XA 3CO7C 2HOAA 2YS9A 2KT0A 2X1DA 3I4MJ 2OU2A 2MH9A 1X4OA 3HPGA 2HZTA 3BDDA 5DEQA 4N9HA 2DA1A 4PZJA 3HRUA 1ZG3A 4IHWA 2K4BA 3RKXA 2R7RA 4E7SA 1OKRA 3CJQB 3OIOA 4F92B 4HPQA 2D2WA 2Y69H 4NC8A 4C3IJ 1U0JA 1W7PA 4QLCU 2DMQA 1RC9A 2M3AA 3DWLE 5A2QK 3WTSC 3VEPA 2G7UA 3W3CA 5J4VA 4BE0A 3EUHA 1JUPA 3K2ZA 2V9VA 2IA0A 1EH6A 3L00A 2MGQA 3ZGKA 3HHGA 1ZR2A 3A03A 3FXKA 3VFZA 5IYDJ 1MIJA 1QZYA 4A5MA 3CCRI 4B47A 1SD7A 3AKZA 1BI2A 1UCRA 5F1JA 2EV6A 3BWGA 1U9OA 5BPDA 4BUPA 3QOEA 2H94A 3M8EA 3PSFA 1TQIA 2IVMA 1DGRM 3I9V2 5ICEA 1W0UA 2PEXA 2Z3YA 2K3PA 4HNTA 5HS8A 5FRMA 4QPOA 3T8TA 5JLXA 3A0BC 2DYSH 3ZR8X 3DKWA 1FYKA 2FA5A 1NG6A 3ML6A 2ZKZA 2E36A 4KMUX 3SQNA 4U0WA 1YI2I 2ZJRF 3R6SA 1MBKA 3ZQIA 2Z5UA 2QKMB 4I0AA 2VT2A 3SEQA 2LVSA 1YG2A 5EZHA 3OIPA 1FBSA 1HKTA 4E7LA 4OAYA 1LFUP 5DD8A 2XB0X 3CZ6A 2D5VA 4ZDPA 2VQCA 2H1KA 1SFEA 3FXMA 2K9NA 3LL7A 4Y15A 2VT3A 3H36A 3VYSB 1TZLA 3OV8A 3OSFA 3H5NA 3C3WA 2ZJ2A 3FKJA 3MQ0A 3VPRA 4CYDA 2R7DA 4ZZDA 3OS2A 1AHDP 4BQAA 4W97A 1B8IB 1WSUA 3HUGA 3K70D 1ZH5A 2LOOA 2NXNB 1VNDA 1O3RA 4M3FA 4Y33A 3TDUC 2MG4A 5GADJ 5LHIA 5E18F 2BBYA 1BOBA 4FHTA 4MHGA 4RB1A 3BQZA 4RGRA 2NYXA 3E5QA 1HW2A 1Y1VJ 1O3SA 4BS9A 4XL9A 4HA8A 5L3DA 4A0YA 2XC7A 5ICFA 3VYUB 5HS7A 3JW4A 4CZZA 3DU5A 3GTQJ 1S3JA 4G6DA 5JVGF 2RNGA 4XKCA 1FOWA 3V8JA 2W48A 1KONA 2JA2A 1BI1A 2L02A 3FF5A 4N4OB 5TISC 2XGEA 1T6SA 1A6IA 3K10A 2FNPA 1R1UA 4ETSA 1H89C 5D5WB 2L9RA 1HQCA 1ZGAA 4HG2A 4IRIA 2CQKA 3HEFA 2Y2ZA 3HM5A 2P8TA 3NAUA 3S1MJ 2RGVA 3CQZJ 4LG0A 2WAFA 4I02A 4R1HA 1DQUA 5BQTA 1R9TJ 2OCEA 2Z16A 1VZ0A 4XLFA 3X2QH 1O57A 1HSJA 2L01A 5D4RA 3EYIA 5IP6A 2HQNA 4RGXA 4UUSA 2DCEA 4F52A 4A0XA 5TJJA 2OZUA 4B1RA 1VTNC 2Y75A 4BDZA 1OCOH 4ANJA 1U5TA 1R5HA 1D3YA 3B6AA 3NRVA 2YU3A 4KIFA 3I4PA 1X58A 4XMYA 2KIFA 3D0SA 1SFUA 5CPRB 2ACJA 2O7OA 1LFBA 2CQQA 4L9VA 3LFKA 4BXFA 3LNQA 2CV0A 2JA5J 2GA1A 3JRHA 1YIJI 2Y0SN 1MDMB 3JRDA 2ID6A 1F5TA 3HTUA 1YOVB 2ZMEA 1FC3A 2KJCA 2DODA 3PNTA 5GTIC 5GAGJ 2PQ8A 1A04A 1WKMA 4XNFA 2IGMA 1TLHB 5B66C 2HR3A 1LKXA 3DPUA 4BH9A 1USTA 3MKWB 1PDNC 3SDBA 4FE4A 1XMAA 3A0HC 4PFOA 1DP7P 1XC5A 3JAMZ 4L5JA 4HLXA 1S9HA 3HPHA 1Z05A 3MZYA 5J6XA 2NNNA 2UUZA 2CH0A 3AL0C 5ILVA 3CCVI 2HOSA 4A69C 4IPAA 4OAZA 3G71I 1MZBA 2ZJPF 2OTLI 5LLQA 3H0DA 1JHFA 3UKGA 4MEXF 5JI6A 1WI3A 1VQMI 3K2AA 3ULQB 3CDLA 4A6DA 1D5VA 3KEYA 3L2WA 3S15J 1WJCA 3V4GA 2XAJA 4ZTFA 1RIOH 2AQEA 2RAEA 4HQMA 5F1RA 1ONVA 4M72A 3BG6A 3BZKA 2XRLA 1IF1A 3FM3A 2ID3A 2F5DA 2ZC2A 3TOAA 3SFZA 5LGNA 3DBLB 3FMQA 3HHHA 4P96A 4B43A 1JKPC 1TP4A 1MNMC 4ENKA 3GZNB 2LY1A 3HYIA 4B48A 4UB6C 1D5YA 1JTXA 3BR5A 2WWYA 2HEOA 3W6VA 1BN5A 2HQRA 3C1DA 3CDHA 2DA3A 3E0JB 2R5ZB 1WJDA 3GLLA 3MVPA 3F23A 1YW7A 2AXTC 3BG7A 3ZQQA 1XGNA 4UVAA 3VSLA 1XSDA 3ZMSA 2HDWA 5EEAA 3BR1A 2FUG2 5E17F 2R0QC 1TTYA 4UVCA 2DPDA 1UFMA 4QPQA 5D6FA 3FZVA 1K4TA 3CUQC 2WV0A 4V19K 2ZBKA 3EQLF 1IAWA 3WE3A 1FLIA 1I39A 2LC2A 2DFEA 3M7GA 4H4KC 3R0JA 1J0RA 5D8LB 5TRDA 2DDAA 3QP5A 3F0CA 4BU2A 1EH8A 2CW7A 1R1TA 2HQAA 1RR7A 1QNTA 3I0TA 3H92A 3ABLH 5C3EJ 2M7BA 5EZGA 4IRGA 2PJRA 5FRNA 1YO5C 3G3ZA 2HI3A 3LWFA 3IRQA 3ZQ7A 2UZKA 4XONA 2V9PA 4JBAA 1VQPI 2RVCA 2DOAA 1L3LA 1GV2A 3BQYA 5ERIA 5DTDA 5JHUA 4HDVA 1LPQA 3KYLA 2P4WA 2VBWA 4KN4X 4CH7A 3BP8A 4XLPF 2CV1A 4NC7A 4LITA 5K5QA 2LD5A 3I71A 1MJAA 2DMNA 2PJPA 2JA7J 3CJTB 1TC3C 1STZA 5C44J 1JGGA 4RLFA 2VQLA 5EF6A 2BOLA 3ONQA 5BMZA 4CGZA 1BR2A 2VUMJ 1YQAA 2K4JA 5ICGA 1BC8C 1CF7A 4PDKA 3FM5A 3SEZA 1QO0D 3CC7I 1JKQC 2CSOA 5E3LA 3HOUJ 4HX4A 1B4AA 4K2EA 3R60A 1ZRFA 3OSGA 4BAYA 1HA8A 3M1EA 1JKOC 4N0BA 4PSXA 1JXSA 2XSJC 3KP5A 4HEA2 4EJUA 1U9NA 3F9KA 1OYWA 3GFLA 3J80K 1D0XA 4LG3A 3RTRA 2DQRA 3OYDA 3F72A 4YIFA 3TO6A 3MAJA 5FKKA 1QZEA 1AKHA 5EDNA 3KP2A 1HOMA 1FP2A 1W1WE 4I0BA 5HVQC 1K4SA 4EQQA 2R7TA 5J1UA 1FEXA 2HYJA 5LD2C 1OR7A 2P5VA 3K7AJ 3C18A 2YPRA 2DN0A 1CGPA 1RR8C 1X1DA 1ZTRA 2FE3A 4GRIA 5FD5A 4Y17A 2RKHA 4YFXF 2A61A 2Y9ZA 1X3WB 4KA4A 1LDKB 3GFIA 4EMSA 2LKSA 3S16J 2N8GA 4P1WA 4CCMA 2VONA 4ENNA 3G1LA 3PUFA 2Z9OA 2CYYA 4R8HA 3M4OJ 2Q2EA 3K69A 3UNGC 3TO7A 4CCNA 4DQ2A 2HDCA 5BOXA 3HUGB 2E2HJ 2F5CA 2QVOA 5DUKA 3QYEA 3HJEA 3BJOA 2W25A 5B1AH 4OINF 4MEYF 1WJBA 2DQLA 1KU9A 3F22A 2DDBA 3LA7A 2BYVE 4C3HJ 2GXGA 2HOEA 2QUFA 2JRMA 1S29A 5HLGA 1YJWI 3H3ZA 2ICWG 4PGGA 5FGMA 4A12A 3ESWB 3KP6A 1EF4A 3KP7A 3I53A 1ON1A 1WJFA 1ZARA 4HW0A 4PK4A 4XKVA 3BPXA 2E5NA 3U9GA 4BNCA 3KCCA 1MSFC 1Q1HA 4A3FJ 2XHKA 4A3DJ 1GUUA 1W7PD 2FSWA 4G6TB 2R5YB 3RKQA 1MW7A 1ZELA 3PL8A 3KYCB 3GW2A 2EV0A 3CDIA 3WG7H 4EM2A 3EPZA 3ZMTA 3WGIA 1KYZA 4EJOA 3T1BA 4LMYA 3OOUA 1TW3A 2HXIA 3SYTA 3TL4X 4LK0F 3TOBA 5ICCA 5E79C 2MC3A 2KMUA 3QPTA 4PCQA 2P7CB 2NVQJ 1BOAA 2K9SA 4A6EA 4LG0B 2GOMA 3W2AA 1GXPA 2IS4A 2A5YB 4AYBN 2COMA 2K9LA 3QPHA 1G4DA 3MFKA 1S72I 4WXCA 1TW2A 3JRGA 4C2TA 2LNBA 2R7WA 5E1WA 2KIQA 2VBZA 2JRTA 4UUSB 3CP2A 2V79A 3F6OA 5HOOA 2ZJQF 9ANTA 2VPLA 3HRSA 3IKVA 2IS1A 4O6JA 3SZGA 5D5UB 1P7JA 1W36C 4IKFA 3BOQA 4Y52J 3G6EI 1U8RA 1U5TB 4HNUA 3H1CA 2LH9A 2FMLA 2EFOA 5ILUA 5F6FA 2VBYA 5ED4A 4RLQA 3L2QA 4A3CJ 5J4YA 2LFBA 2CRGA 2O8XA 2MFZA 5K7ZA 4CO8A 4RS8A 3DTIA 4WK8F 2ETHA 4JOMA 3KYDB 1HCRA 2ELJA 4HF1A 1SFOJ 1VQNI 2DA7A 5M5WJ 1MNDA 1FP1D 5E1XA 2ZCWA 3LA3A 3HOSA 4E7HA 2A6TA 2K27A 2DAOA 4GCVA 2D1HA 3L1PA 1ULYA 2CWEA 4E6KG 4KISA 3H5RA 4LIUA 4RBOA 4P55A 1MSEC 2O3FA 4M6YA 3CCEI 3EUKL 4OIRF 4ZH4F 3CCQI 2H6CA 1GXQA 2NVYJ 4WWCA 3BZCA 2HKOA 4MQVA 3DEWA 2DK8A 4BJ6C 1QPIA 3ERMA 3FWEA 2OA4A 1YE9A 1BA5A 1P2FA 3BY6A 1T2KA 2VKEA 3N05A 4FETA 1MGTA 1FMVA 4BE2A 2V1UA 1FSHA 2ESNA 4XOPA 3RCOA 1IV8A 1BW6A 1MBHA 2RN7A 4M6VA 3MKZA 2B63J 4RGSA 3I59A 4FE7A 2LG4A 3CTAA 5M5YJ 3ELKA 3BTJA 2H09A 2UWMA 4CCJA 2WY7Q 3HOXJ 4EJVA 3GTJJ 3F8BA 1WI9A 3GO5A 2KRHA 4UV8A 2AS5F 4A3EJ 1I6XA 5J1YA 2BEOA 3BC8A 4QIWN 1V5EA 1ORKA 1T08B 4IO9F 3W6KB 2DA2A 1RI7A 2W82A 2K5CA 3ZMVA 2V1NA 4I76A 1WQ2A 3IP4B 4RAYA 4MIMA 1RUNA 4J01A 2DPUA 4BBSJ 3HOZJ 2XPWA 2Q0OA 2VL8A 4LJZF 1Z0XA 2J5OA 2XIGA 5E3OA 3PNVA 4DIQA 5CVUA 1CQTA 1B59A 1RRJA 3OWTA 1YRNA 1X1CA 2QCOA 3CP8A 4XLCA 5IT9K 3PFYA 3J7AO 4S0HB 3ZQGA 4BL0B 2HDDA 1F1ZA 3OL4A 3WODF 1RESA 1S6LA 1ETWA 3QU6A 1ETKA 2Z33A 1O3TA 4XRFA 2MLKA 3IRRA 4HDUA 2R7XA 1VF9A 4P9FA 1E0EA 2EIKH 2KP6A 1LJ9A 3QRFF 2HTJA 1FNNA 4FX0A 2DTZA 4D5CA 2W7NA 1OCZH 4ABZA 1RPWA 4A5NA 4Z6YA 4XIDA 4ZTJA 3PM1A 4KN7X 4LK1F 4D0PA 4B3AA 1YW9A 3F21A 3RI4A 1L0OC 3BTLA 2A05A 1I6HJ 4LLLA 4KJZA 2AHQA 2H6BA 2DA6A 1YS6A 2VN2A 3OOPA 5DCFA 4AVZA 1ENHA 2CS3A 1D1BA 4RB2C 2COBA 1MBEA 1QHHD 2G0EA 2BVMA 3LSKA 4PJJA 3L09A 3Q3SA 4XN0A 3G73A 2NOJB 3KEQA 1J9IA 1I5ZA 2F4OB 2DA4A 3I5UA 3IAM2 3KLNA 4FX4A 3WE2A 4GDFA 3HOWJ 1UHMA 5K7FA 1POGA 3HGGA 2O0YA 3CMAI 3HGYA 3KZZA 4KFCA 2F5VA 1I1SA 3RJPA 2L0KA 2R3SA 5LEKA 1KQ8A 2CQNA 4LIVA 1HC8A 1XTAA 1CF7B 2IJLA 5FB2A 2EBIA 2KRFA 2M9HA 4S04A 2LK2A 3HDDA 2E7WA 3CC2I 4OIOF 1S7OA 3M8FA 2H8WA 2XF6A 1LDJA 1TWGJ 1Z67A 2BV6A 3F8NA 3A1YA 2EFWA 4UUVA 2X4HA 2OAZA 2X9DA 1YW8A 5C4JJ 2XKOA 2BVLA 2DFFA 4GGGA 2VIXA 2OQRA 3S3NA 1V5FA 1R1VA 3HL2A 1KYWA 1BI3A 5GPCA 3W2VA 2DU9A 1W5CC 3H3UA 2EZHA 4PJMA 3AAFA 2BXZA 2CQ7A 1OYYA 5ILSA 4DOZA 2EA2A 3C2GA 2DMPA 2HPIA 1ITYA 4NC6A 1QPMA 2FJ1A 4HYEA 4M9ZA 2VOOA 3MEXA 1RKTA 1D0ZA 1O4XA 1QGPA 2OUMA 1I1GA 3LAPA 3CCYA 4BY7J 1B1BA 4OWRB 2F48A 3GYHX 4II3A 4W1UA 3LSMA 2MSYA 3ZN1A 1BL0A 5D6EA 3OYHA 4IHSA 4IOCF 1EA3A 1ODDA 4RAFA 1FBUA 4MGRA 5M3FJ 1BW5A 2GQQA 4A0ZA 5CQEA 2LP0A 2PMHA 3MMYB 4HX8A 3FBNB 1IW7F 2TDXA 1SFKA 1MH4A 3TP0A 3V8LA 3GZ6A 2PI0A 4BHCA 3I55I 4MTDA 2KLOA 3FK6A 5GP9A 2CW0F 4G7ZF 4IHYA 1Y0UA 1X4PA 4BE1A 1TQMA 2LF7A 2Z2SB 5LFAA 3S17J 2GIZA 3PIOF 4YRVA 3FMRA 4U88A 2DT6A 3S3MA 4AIJA 2KIUA 4HX7A 4AIHA 4WX9A 3IC7A 2DA5A 1EV7A 2WAEA 4ESBA 2XGCA 3SXYA 3M9AA 1SMTA 4BXUA 2BE5F 4L5IA 2Q8KA 2QENA 1TWFJ 1YTYA 4F7ZA 3CCMI 3E5XA 4BEHA 2J5PA 4BJ5C 3GEZA 1U8BA 1BJAA 2ZXWH 1YIOA 3V7RA 3TW6A 1UHSA 3FKIJ 1HBXG 1IGNA 3GFJA 3GTOJ 1W5TA 1Z6TA 5JVTA 4I98B 5CKTA 1YJNI 2K9QA 2BY2A 1EH7A 1XN7A 4RB3C 1ZLKA 2M5WA 2BY1A 3RZOJ 4O5VA 4UY8I 1Z3XA 2F6CA 2G9WA 4U0VA 1PP8F 1P4AA 1Y56A 3U21A 2O03A 2HVQA 3MZ8A 3GWZA 1I3QJ 1LEBA 2F5EA 3V7SA 4ZYGA 1VQ4I 3KX2A 3BJ6A 3EDPA 4JX4A 3AG4H 4G7HF 3FK7A 1IN5A 4MFEA 2IXSA 4YFKF 4J19A 3PO2J 1WJ5A 1D8KA 2HFHA 4OMYA 1MH3A 4Q47A 1D1CA 2RNJA 2VB6A 2ZFWA 4TV7A 1Z21A 5EG0B 3ISPA 2XV4S 5FLXK 1M1EB 2QEXI 1H9TA 2LR8A 1S7EA 1A6QA 2EFQA 3AFHA 3KLOA 3RKWA 5KK1A 4C2UA 4KT5C 1R49A 2HVSA 4PJ0C 3BCBA 3IUOA 2H1LA 2WA0A 1EKEA 1BIAA 1FT9A 3DLLF 3SJMA 2M1BA 2RREA 1IN4A 2JWTA 3KIOA 1H9GA 1DUXC 1T0FC 1QQIA 3V8KA 5HNFA 3MCZA 4Y7NJ 2Z1DA 3OY9A 3BR2A 1B72B 2KFDA 1WJAA 1ETXA 3W2WA 3HSFA 5EYRA 2L4MA 4LOCA 1TT5B 3KFWX 2E2JJ 1VQOI 3VODA 2ME6A 2STWA 1B6AA 4LD5A 4V2GA 2X1EA 1WH7A 2HS5A 4IRHA 4CHUA 1Z91A 5EJCA 2LF8A 3BPVA 1ZGWA 1R4NB 2ESHA 5F0FA 1IUFA 3DBHB 3WTWC 4A3GJ 3FDYA 4I7HA 3NWSA 2W85A 4IL6C 3SZPA 3M1CA 1SD4A 3OYBA 4UVBA 1XPXA 3I59B 3I54A 3NARA 1QVTA 2JVGA 5HLIA 3OYIA 2YX4A 2ZB9A 5KNLA 2XROA 1FIPA 2V1XA 2DMUA 4B8XA 4XSZF 2CFXA 3IL2A 1J09A 4RAGA 2OQGA 3BR6A 2WV1A 5F04A 1R22A 2XVCA 3S1NJ 2R7VA 4HSRA 4HSTA 3ERED 3OYMA 3LSRA 2NVTJ 3TMOA 3VOEA 5IP7J 2OCCH 3C2BA 3I64A 2E60A 4Q5SF 1TWHJ 1T39A 4P5OA 2O5RA 3H5AA 3TP3A 3RIRA 2CW8A 3SZTA 1YLFA 4H0EA 2YSRA 3ASNH 5DCMA 1U3EM 3HSEA 1XGOA 2JSPA 5LRSA 1ZGJA 1WFXA 4F3QA 2WAQA 3HRMA 3HZJA 1BR1A 2X51A 1X1BA 2KJBA 3OYEA 1MKMA 1J2XA 1OMIA 1FOYA 5F08A 1YRNB 3S2WA 4DYCA 2BW3B 3LSTA 1LE8A 1ZQ3P 2GM4A 5CQGA 2CJJA 2NNYA 2QYOA 2ELHA 4U7DA 1PUFA 1HSTA 4XLAA 4B3XA 2AO9A 2IPQX 2VE8A 4OU0A 3U1KA 5L3GA 2LRDA 2LBFA 3T5XA 2R4GA 1UJ8A 1AU7A 1AOYA 4BHPA 1PUEE 2CGPA 4II2A 5FFZA 3JAMK 1LNWA 2KRCA 4BHBA 1IN7A 4BACA 5JLWA 2QQ9A 4FT8A 2OF7A 3C7JA 4E7ZA 3QAHA 2GIVA 4RMNA 3U2RA 4EM1A 1N25A 2QM3A 2A68F 2IGOA 3G1OA 1W7PB 3JTHA 3DV8A 2ZSHB 2LDUA 5DM7F 2P0WA 3LQQA 3I56I 1YJ9I 5DS9A 4G7OF 1YS7A 3HKZA 2ECCA 2LLKA 4DYQA 4X0GA 1E17A 2B0LA 5CVRA 4HV5A 3REOA 2GAUA 2EILH 5CJ9A 4GO1A 1HDPA 1XDUA 2B9SA 3VYRB 3A2KA 2E1MB 1XMKA 3TKYA 2ISZA 3GVAA 2CO5A 3JRIA 5C4XJ 5JHFA 3F3XA 3BJAA 5M3MJ 2CMPA 4IF4A 5IPAA 2L7MP 2ZXJA 1J59A 3ASOH 2EV5A 1HLVA 3MN2A 1X1PA 2YUSA 4AU7A 1KQ9A 3AG2H 4XRMA 1RETA 3B73A 4UUTA 1H8AC 5J47A 3QOPA 3TEDA 1UG0A 1YX3A 3F8FA 1T56A 4IEJA 1SD6A 2DFHA 3IH2A 4WF2A 5IOYA 4D7NA 3K4JA 1IRXA 1GV5A 2DLLA 2ELKA 3CUOA 1NTCA 3HOTA 4PSWA 1X1AA 3GCMA 1K6OA 1U6GA 1QRYA 4RB0A 2QLZA 3DTEA 4ZYEA 3SDGA 2HXOA 2BY3A 1ETVA 4BXXJ 1UELB 2HYGD 1MMDA 3S3OA 2RC4A 5AIQA 3KP3A 4DZPA 2KPMA 4NDLA 5LGUA 1BBYA 3DBRB 3WTTC 3TDZC 2CUJA 1GHCA 2ZNYA 4EM0B 1UMQA 3GBGA 3QPSA 3DEUA 2MA3A 4NB5A 2AQFA 2DFIA 2PBIA 4YG2F 2DT5A 1KU3A 3AG1H 3NQOA 2DJIA 2IW5A 1QBJA 2FNAA 3BCAA 5D8KB 1G2HA 2R7FA 3KETA 1QHGA 1VI0A 4JX6A 5FD6A 3CUQA 3GUDA 2NOGA 3QYBA 1ZG1A 1EJ9A 2V26A 3R61A 5DUIA 2ECBA 3RSNA 2FBKA 2P6SA 4E7KA 4Y4RA 3CD6I 5CVIA 3GTMJ 1MMGA 2DK5A 4XK4A 5KHDA 1JJ6C 2EFNA 4EVIA 2NRAC 2X0LA 3JRCA 2X6WA 4AWXB 2MYSA 3LSHA 3ABTA 2JA6J 4Q4ZF 3ZXSA 1USSA 3V42A 1S8NA 5F64A 1KZHA 1HDDC 1E3HA 3DF8A 1G3YA 2FMYA 1R58A 1V3FA 4AVPA 2BXYA 1W0TA 2H8RA 4G6QA 1BC7C 2KL4A 3FIWA 3A4CA 3LSIA 3RYPA 3ZPLA 2HZDA 4ZDLA 4C30A 4FCYA 4FASD 2MH2A 1JUMA 1ZLJA 3O6BB 2OZ6A 2IS2A 5DV5A 2ZNZA 3R0AA 5B1BH 1AWCA 2IA1A 1IRZA 2XGDA 3K4LA 1FYLA 1XD7A 3GTGJ 3IAS2 2VQHA 5JFRA 3WTXC 1G3WA 1FSEA 3FBIB 4Z2YA 3CMMA 1BR4A 2Z99A 2E1CA 1I27A 3TBIA 4IJAA 4Y3OA 5H6RA 1D1AA 4XKWA 3VB2A 4A93J 1UHWA 1ZRDA 1V55H 1OISA 3Q0WA 3S1QJ 2EA4A 5FKNA 3CCSI 4A3JJ 2M34A 2XF5A 4I99C 2QQBA 2VJ5A 2EJRA 3P9IA 1V4RA 4DBQA 2E1NA 3O8HA 5CVVA 1ZAOA 4M3DA 4U87A 2M8EA 1SVLA 1OFCX 4CZCA 1R5GA 1R23A 4BGDA 1TBXA 2LREA 1VQ6I 2W24A 1IO2A 5J3LA 3RKYA 2JJ7A 1FX7A 2M0CA 4XOTA 1P92A 2DT7B 4UV9A 2EIMH 2DMTA 4HOBA 3OIQA 2ME0A 1T8IA 4CA0A 4ZZLA 4U0YA 3L2UA 3K9TA 2ZMEB 4XM3A 3GMEA 2LKPA 2PX9A 1GT0C 1MDMA 3EUAA 4YFNF 3GXOA 1JKRC 2DXIA 3WU1B 3Q0UA 5IT9Z 2ISYA 4G94A 3ECOA 1LFPA 2WB1A 3D5RC 3ECHA 5HS9A 3WHBA 1SVOA 3RPQA 2FQ4A 1NHAA 3EUHC 3KEOA 3MZHA 2E71A 2L7FP 3K4MA 4XORA 4J00A 2VJJA 1FY7A 5IT3A 5L3EA 5FKMA 4MQ9F 1O7LA 2W4SA 3N97A 3FXOA 4IXAA 1HXDA 3PO3J 2E35A 4XKBA 4HF2A 1JI8A 3F6VA 4FQGA 3VDXA 3SHFA 2A69F 1W4MA 1IXRC 2PMZA 2ZXIA 4HQEA 3E7LA 5LEJA 1Y6IA 1T95A 4FISA 2L5QA 3DEEA 1XSXA 4C9YA 4RA2A 3TQNA 1WJEA 5E8GA 4IOAF 4L0YB 4ON0A 5LRRA 2MW8A 1MBFA 4EEFG 5A2QZ 4ZC3A 2JTVA 1RUOA 3R4KA 4JK1X 2UV1A 2QF7A 5GTHC 4CICA 5FROA 2VPRA 3GLXA 4N9IA 5D5XB 3L9FA 2OJED 2CUEA 3L2VA 2VJ4A 3H3VK 4L9TA 5LBQA 2LMDA 2EZIA 4C2MJ 2PG4A 1IXSB 4EJWA 2NVUB 5DCMB 3I58A 4A3KJ 4B4CA 1MJ9A 2CUFA 1QZZA 1XG1A 3HBLA 5LHHA 1GDTA 4XLHA 2R5ZA 1R5ID 2W1OA 3J81K 4YEJA 2QBYA 3FXLA 1KU7A 3DCFA 3JSOA 3RZDJ 3J7YJ 5DDGA 1W5SA 4DJAA 2R7OA 1LE8B 1C0WA 4F55A 1IRGA 2O6GE 4RDUA 2F2EA 2EH3A 3WTVC 1WZ2A 3LSGA 5D5VB 5EEHA 2F5FA 4I2OA 1XGMA 2LBFB 4UXNA 1U78A 2K9MA 5HLTA 4HBLA 3MKLA 2V4JC 3CMYA 1ETYA 1A36A 2L2OA 2PJRB 2K86A 2FOKA 2DTRA 3H9JA 5DD4A 5EGOA 1DDNA 3BTCA 3DPTA 1IZ1A 2LY9A 2XAUA 3HKZN 5FJ8J 2X1CA 1F36A 2XPUA 2P5LC 2NAZA 3S14J 4KICA 1IN8A 1Z77A 4DGWB 2PFBA 3ZP5A 3B02A 1ZREA 1R7JA 3ABKH 2DOFA 4GYIA 2YR2A 4M71A 4A3MJ 2R7UA 2VKHA 1X19A 2A6EF 4CXFA 5HNHA 2DI3A 2L7ZA 5FLMJ 4XN3A 2EK5A 2H27A 4YELA 3GTPJ 2NS7A 2WTEA 4Y13A 2FRHA 2FX0A 2DO7A 5IYBJ 3HOVJ 2HYFA 2VASA 2VLAA 1JGSA 1LVKA 4YIRX 3IKTA 2M30A 1DU0A 5KCMA 3WHCA 1QVUA 2ADUA 1F9NA 2R7ZJ 2JVHA 5HDKA 4LB5A 2IAIA 3VWBA 1WWXA 3RPUD 3LSPA 3AL0B 2KDZA 3HSRA 4A3BJ 1QU3A 1JE8A 2E2IJ 2L4AA 4FTHA 2E19A 1T33A 4AIDA 1Z9CA 1F4KA 3OS1A 1WVRA 5BNGA 3CCLI 4OMZA 4ZJZA 1VQKI 2XDVA 3J7AY 4XBFA 4NBQA 3GTKJ 5CYVA 2CQXA 1GVJA 1U5TC 3K6GA 1AKHB 3Q5FA 2HNHA 2Y30A 3ZQFA 3N4MA 2FXAA 2WC2A 3PQJA 2UXXA 1DP3A 2JA8J 5H6QA 5IY5H 3D1NI 2K85A 2FBHA 1E3OC 3IHUA 2CFOA 2ZFUA 4XICA 3OYFA 4BQOA 2K40A 1I50J 1SANA 2LYCA 5B3SH 4M6XA 1Z7UA 2QGUA 4M74A 5DYMA 3M3YJ 5FO5A 2ZMEC 1ON2A 4EV0A 2NVXJ 1ACIA 5E1ZB 4D5FA 1K7AA 5BPIA 3DKYA 4MO7A 1MMAA 2X48A 4PJLA 2Q2EB 1TNTA 2F4MB 2LTPA 3DP7A 2X6OA 4HNVA 2X6YA 2O8KA 3E1SA 5E20A 1H0MA 3E3VA 1XCBA 1IDZA 1PVEA 2GXAA 3PUBA 3JRAA 1DPRA 5LGTA 4LLNA 2XAFA 4IHVA 3IWFA 4N4NB 3OYNA 2W57A 2Q1ZB 2OV7A 3CESA 3CUQB 4MLOA 4JYKA 1S7AA 4BJTA 3CC4I 5GAHJ 4KIGA 1VQ9I 2QWWA 3RYRA 4BKXA 4DBRA 2K02A 2ZO4A 3M07A 5FLXZ 1R71A 2M2EA 3E6DA 3I4NJ 3QYFA 2V9KA 3S32A 3K1NA 4DZJA 2BGCA 4JP0A 1LVAA 1XS9A 1G59A 3JR9A 1ZHFA 4BYYA 1J75A 2BY0A 2O9LA 1G8XA 1N77A 1RNLA 5IYCJ 2DBBA 1FMWA 1Y8RB 3KP4A 4ZDOA 1P4WA 3COAC 1FBQA 2P7VB 1ZKGA 4B09A 2R5YA 2KQRA 1UAAA 2W84A 2EB7A 5K5RA 2JQ7A 3S93A 3E5UA 2VJIA 4C3JJ 3HB9A 3E6CC 1MNEA 2NS8A 3OYCA 1YHQI 4WXDA 2FD5A 4GFBA 2JMWA 5CVJA 1BI0A 4KDPA 2YU9J 2XB5A 1YITI 3P7NA 3GF2A 4RM3A 1LQ1A 1G6NA 4M3GA 5B5EC 2B7EA 5GAEJ 2JPCA 3E6MA 5E3NA 3K70C 1YX5A 1FOKA 2VC1A 1Y8QB 3O8GA 4ESFA 1V54H 2L3DA 2V1DA
chains in the Genus database with same CATH topology
1VFCA 5DS9A 1JT6A 2DMQA 1P7JA 2ECCA 4Y52J 2LLKA 4DYQA 1JUPA 1P7IA 3RQIA 4XRSA 1ETQA 2MGQA 1HDPA 2IBDA 4A3CJ 2WB1N 2LFBA 1ZR2A 3A03A 5IYDJ 2CRGA 5K7ZA 4A3IJ 2Y31A 3JRIA 5C4XJ 5M3MJ 5IPAA 2L7MP 5F0CA 5F1JA 3JREA 1HLVA 1U9OA 1SFOJ 1RKWA 3MN2A 2DA7A 2YUSA 1HCRA 2HQ5A 5M5WJ 2JN6A 4XRMA 1RETA 4UUTA 1H8AC 1FJLA 3TEDA 1W0UA 1T56A 4IEJA 3L1PA 1Q1VA 3IH2A 5F27A 5IOYA 4CYCA 5JLXA 4D7NA 1WGXA 1JTYA 4RBOA 1IC8A 1MSEC 1GV5A 2PMZN 1HF0A 2ELKA 1NTCA 4M3EA 3S2HJ 2NVYJ 3DEWA 3Q0VA 1QPIA 1QRYA 4I6ZA 3BG9A 1MBKA 3ZQIA 3SDGA 1K61A 1BA5A 2HXOA 2VKEA 1ETVA 4BXXJ 2LVSA 5EZHA 3G1MA 5IOZA 1LFUP 2XB0X 1MBHA 1BW6A 4M6VA 4DZPA 2D5VA 5J1RA 2CU7A 4NDLA 2H1KA 2B63J 2K9NA 4FE7A 5M5YJ 3OSFA 1UMQA 3GBGA 3BTJA 3QPSA 3VPRA 1AHDP 4W97A 1B8IB 3HOXJ 3GTJJ 4MFDA 4A3EJ 1G2HA 1VNDA 5J1YA 1VI0A 4BBRJ 4JX6A 4M3FA 4QIWN 2MG4A 1ORKA 2NOGA 2DA2A 3JRBA 2ECBA 1WPKA 2DJNA 3BQZA 4I76A 1Y1VJ 3GTMJ 4MIMA 3A01A 3HOZJ 2HOTA 4BBSJ 2XPWA 4XK4A 1JJ6C 3B6CA 1Z0XA 5F0HA 5E3OA 3QPLA 1X2MA 4IHXA 3JRCA 3GTQJ 1CQTA 1OCPA 1YRNA 2QCOA 2IEKA 2JA6J 5K7HA 1HDDC 4S0HB 3ZQGA 1UG2A 2H8RA 1W0TA 2W48A 2HDDA 3FIWA 1RESA 1ETWA 1ETKA 4FCYA 2XGEA 1A6IA 1JUMA 3BTIA 1H89C 1VF9A 2L9RA 2DTZA 3HEFA 4D5CA 1JJ8C 2Y2ZA 3HM5A 2XGDA 4ABZA 1RPWA 1ZK8A 4X6AJ 3GTGJ 3NAUA 3IH4A 4D7MA 4XIDA 1Y1WJ 3S1MJ 5FKLA 3CQZJ 3PM1A 5E3MA 4B3AA 1R9TJ 2P81A 3BTLA 4A93J 1TWCJ 1I6HJ 5EGOB 5IP6A 3Q0WA 3LSJA 3S1QJ 4UUSA 2AHQA 2DA6A 1ENHA 5FKNA 4A3JJ 2COBA 2M34A 4B1RA 1MBEA 2G0EA 3Q3SA 3O8HA 2DA4A 4M3DA 4M3BA 3HOWJ 1IRZA 3B6AA 5K7FA 1OFCX 1POGA 3HGGA 3HGYA 1X58A 5J3LA 2JJ7A 2M0CA 2L0KA 1BJZA 3BG5A 2O7OA 1LFBA 2CQQA 2DMTA 3LNQA 2JA5J 2EBIA 3JRHA 2M9HA 4V2FA 2ME0A 2Y0SN 2LK2A 3HDDA 1TWAJ 3JRDA 2ID6A 1GT0C 1JKRC 1TWGJ 3Q0UA 5HODA 2X9DA 5C4JJ 3WHBA 2XSDC 1GVDA 3BR3A 2FQ4A 4FE4A 5M5XJ 2L7FP 2VI6A 1XC5A 5FKMA 5GPCA 2EZHA 3PO3J 2HOSA 3QQAA 4A69C 2E1OA 2EZLA 4G12A 3UKGA 2DMPA 1WI3A 1ITYA 3E7LA 3K2AA 4FISA 2FJ1A 2R93J 3CDLA 3A02A 1RKTA 1O4XA 3S15J 5IP9J 2LKXA 1B8IA 2MW8A 2RAEA 1MBFA 3CCYA 4BY7J 4EEFG 3HOYJ 4W1UA 2XRLA 2MSYA 2ID3A 1BL0A 2QF7A 1JUSA 5M3FJ 2VPRA 1JKPC 1BW5A 3S1RJ 1MNMC 2LP0A 1NK3P 2CUEA 3TP0A 3H3VK 1D5YA 1MH4A 2EZIA 1JTXA 4C2MJ 4QTRA 3BR5A 2M8GX 3FK6A 5GP9A 3W6VA 2R5ZB 1K83J 1WH5A 2DA3A 4B4CA 4A3KJ 2CUFA 4IHYA 1XG1A 3HBLA 3MVPA 1GDTA 2TCTA 3S17J 2R5ZA 3LOCA 4AC0A 2EZKA 5EEAA 3DCFA 3BR1A 2DA5A 2R0QC 3ZQCA 2XGCA 3RZDJ 4L5EA 1LE8B 4A3LJ 1X2NA 4JX5A 1TWFJ 4RDUA 2JK3A 3S2DJ 2EH3A 3LSGA 1U8BA 5FLVA 3TW6A 1UHSA 3FKIJ 1IGNA 1U78A 3F0CA 3GTOJ 2GBYA 1RR7A 3MKLA 1ETYA 3CMYA 1H88C 2K9QA 5EGOA 5C3EJ 3BTCA 5EZGA 2LY9A 3HKZN 5FJ8J 1F36A 2XPUA 2HI3A 3RZOJ 1GV2A 3BQYA 1IV6A 5DTDA 3IH3A 3S14J 1Z77A 4AUXA 2XPVA 3ZOBA 4A3MJ 3JRFA 1FTZA 1I3QJ 2L7ZA 5FLMJ 3ZQHA 2LD5A 2DMNA 2JA7J 4JX4A 3GTPJ 1TC3C 2NS7A 3FK7A 4MFEA 5C44J 1JGGA 2FX0A 5IYBJ 2EQRA 5EF6A 4J19A 3HOVJ 2VUMJ 3PO2J 3FISA 4QSHA 1MH3A 3ZQLA 1DU0A 3WHCA 1QVUA 1JKQC 5EG0B 3IV5A 2R7ZJ 4DW6A 1FTTA 5E3LA 1MBJA 2IAIA 3HOUJ 3LSPA 1NK2P 2KDZA 2LR8A 4A3BJ 5EG0A 1S7EA 1F43A 2E2IJ 3SFIA 3OSGA 4FTHA 2E19A 1T33A 2OPTA 1ETOA 1JKOC 3SJMA 1MBGA 5BNGA 2JWTA 1U9NA 3GTKJ 3BG3A 2CQXA 4Y7NJ 1AKHB 2Y30A 3ZQFA 3BR2A 1B72B 4CYCB 1ETXA 5FKKA 2JA8J 4XRSG 1AKHA 5EYRA 4LOCA 5EDNA 3D1NI 1HOMA 1B72A 1E3OC 2E2JJ 5J1UA 1FEXA 2HYJA 2ME6A 4XICA 1IDYA 3K7AJ 2I10A 2R92J 2DN0A 1I50J 2K40A 4V2GA 1SANA 1WH7A 1ZTRA 3M3YJ 2VKVA 2Y9ZA 1ZGWA 2NVXJ 4X1EA 5F0FA 1IUFA 4A3GJ 4D5FA 2TRTA 4MO7A 3S16J 2N8GA 2X48A 3H0GJ 3BR0A 3GTLJ 3G1LA 3NARA 1QVTA 1OCTC 2LTPA 2ZB9A 3M4OJ 2X6OA 4HNVA 2O8KA 2WAQN 1FIPA 2DMUA 1IDZA 3JRAA 2E2HJ 3BR6A 1WCMJ 2WV1A 5F04A 1APLC 4IHVA 3S1NJ 3LSRA 2NVTJ 5IP7J 5FKOA 3C2BA 4MLOA 1TWHJ 1ZR4A 3TP3A 4JYKA 3BT9A 4C3HJ 4BKXA 3A01B 1DU6A 2Y9YA 3TW7A 2M2EA 3I4NJ 4DZJA 1EF4A 4JP0A 1XS9A 5F08A 1YRNB 3JR9A 4DYCA 1PUFB 1MSFC 1ZQ3P 4A3FJ 4DYRA 1LE8A 2GM4A 2O9LA 1IG7A 4A3DJ 1GUUA 3RKQA 2CJJA 5IYCJ 2R5YB 1IJWC 4BY1J 1PUFA 1FIAA 1ZKGA 2AO9A 2R5YA 1JT0A 1A5JA 1OJLA 2GLOA 3OOUA 2HXIA 5GPAA 1AU7A 4C3JJ 3HB9A 2NS8A 2NVQJ 2FD5A 4GFBA 2K9SA 2JMWA 2HOAA 2YS9A 2KT0A 2YU9J 4AYBN 2XB5A 3I4MJ 5JLWA 4M3GA 2OF7A 3JRGA 2DA1A 5E3NA 4IHWA 4UUSB 3OIOA 3O8GA 3G1OA 9ANTA 4C3IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFC A;  5DS9 A;  1JT6 A;  2DMQ A;  1P7J A;  2ECC A;  4Y52 J;  2LLK A;  4DYQ A;  1JUP A;  1P7I A;  3RQI A;  4XRS A;  1ETQ A;  2MGQ A;  1HDP A;  2IBD A;  4A3C J;  2WB1 N;  2LFB A;  1ZR2 A;  3A03 A;  5IYD J;  2CRG A;  5K7Z A;  4A3I J;  2Y31 A;  3JRI A;  5C4X J;  5M3M J;  5IPA A;  2L7M P;  5F0C A;  5F1J A;  3JRE A;  1HLV A;  1U9O A;  1SFO J;  1RKW A;  3MN2 A;  2DA7 A;  2YUS A;  1HCR A;  2HQ5 A;  5M5W J;  2JN6 A;  4XRM A;  1RET A;  4UUT A;  1H8A C;  1FJL A;  3TED A;  1W0U A;  1T56 A;  4IEJ A;  3L1P A;  1Q1V A;  3IH2 A;  5F27 A;  5IOY A;  4CYC A;  5JLX A;  4D7N A;  1WGX A;  1JTY A;  4RBO A;  1IC8 A;  1MSE C;  1GV5 A;  2PMZ N;  1HF0 A;  2ELK A;  1NTC A;  4M3E A;  3S2H J;  2NVY J;  3DEW A;  3Q0V A;  1QPI A;  1QRY A;  4I6Z A;  3BG9 A;  1MBK A;  3ZQI A;  3SDG A;  1K61 A;  1BA5 A;  2HXO A;  2VKE A;  1ETV A;  4BXX J;  2LVS A;  5EZH A;  3G1M A;  5IOZ A;  1LFU P;  2XB0 X;  1MBH A;  1BW6 A;  4M6V A;  4DZP A;  2D5V A;  5J1R A;  2CU7 A;  4NDL A;  2H1K A;  2B63 J;  2K9N A;  4FE7 A;  5M5Y J;  3OSF A;  1UMQ A;  3GBG A;  3BTJ A;  3QPS A;  3VPR A;  1AHD P;  4W97 A;  1B8I B;  3HOX J;  3GTJ J;  4MFD A;  4A3E J;  1G2H A;  1VND A;  5J1Y A;  1VI0 A;  4BBR J;  4JX6 A;  4M3F A;  4QIW N;  2MG4 A;  1ORK A;  2NOG A;  2DA2 A;  3JRB A;  2ECB A;  1WPK A;  2DJN A;  3BQZ A;  4I76 A;  1Y1V J;  3GTM J;  4MIM A;  3A01 A;  3HOZ J;  2HOT A;  4BBS J;  2XPW A;  4XK4 A;  1JJ6 C;  3B6C A;  1Z0X A;  5F0H A;  5E3O A;  3QPL A;  1X2M A;  4IHX A;  3JRC A;  3GTQ J;  1CQT A;  1OCP A;  1YRN A;  2QCO A;  2IEK A;  2JA6 J;  5K7H A;  1HDD C;  4S0H B;  3ZQG A;  1UG2 A;  2H8R A;  1W0T A;  2W48 A;  2HDD A;  3FIW A;  1RES A;  1ETW A;  1ETK A;  4FCY A;  2XGE A;  1A6I A;  1JUM A;  3BTI A;  1H89 C;  1VF9 A;  2L9R A;  2DTZ A;  3HEF A;  4D5C A;  1JJ8 C;  2Y2Z A;  3HM5 A;  2XGD A;  4ABZ A;  1RPW A;  1ZK8 A;  4X6A J;  3GTG J;  3NAU A;  3IH4 A;  4D7M A;  4XID A;  1Y1W J;  3S1M J;  5FKL A;  3CQZ J;  3PM1 A;  5E3M A;  4B3A A;  1R9T J;  2P81 A;  3BTL A;  4A93 J;  1TWC J;  1I6H J;  5EGO B;  5IP6 A;  3Q0W A;  3LSJ A;  3S1Q J;  4UUS A;  2AHQ A;  2DA6 A;  1ENH A;  5FKN A;  4A3J J;  2COB A;  2M34 A;  4B1R A;  1MBE A;  2G0E A;  3Q3S A;  3O8H A;  2DA4 A;  4M3D A;  4M3B A;  3HOW J;  1IRZ A;  3B6A A;  5K7F A;  1OFC X;  1POG A;  3HGG A;  3HGY A;  1X58 A;  5J3L A;  2JJ7 A;  2M0C A;  2L0K A;  1BJZ A;  3BG5 A;  2O7O A;  1LFB A;  2CQQ A;  2DMT A;  3LNQ A;  2JA5 J;  2EBI A;  3JRH A;  2M9H A;  4V2F A;  2ME0 A;  2Y0S N;  2LK2 A;  3HDD A;  1TWA J;  3JRD A;  2ID6 A;  1GT0 C;  1JKR C;  1TWG J;  3Q0U A;  5HOD A;  2X9D A;  5C4J J;  3WHB A;  2XSD C;  1GVD A;  3BR3 A;  2FQ4 A;  4FE4 A;  5M5X J;  2L7F P;  2VI6 A;  1XC5 A;  5FKM A;  5GPC A;  2EZH A;  3PO3 J;  2HOS A;  3QQA A;  4A69 C;  2E1O A;  2EZL A;  4G12 A;  3UKG A;  2DMP A;  1WI3 A;  1ITY A;  3E7L A;  3K2A A;  4FIS A;  2FJ1 A;  2R93 J;  3CDL A;  3A02 A;  1RKT A;  1O4X A;  3S15 J;  5IP9 J;  2LKX A;  1B8I A;  2MW8 A;  2RAE A;  1MBF A;  3CCY A;  4BY7 J;  4EEF G;  3HOY J;  4W1U A;  2XRL A;  2MSY A;  2ID3 A;  1BL0 A;  2QF7 A;  1JUS A;  5M3F J;  2VPR A;  1JKP C;  1BW5 A;  3S1R J;  1MNM C;  2LP0 A;  1NK3 P;  2CUE A;  3TP0 A;  3H3V K;  1D5Y A;  1MH4 A;  2EZI A;  1JTX A;  4C2M J;  4QTR A;  3BR5 A;  2M8G X;  3FK6 A;  5GP9 A;  3W6V A;  2R5Z B;  1K83 J;  1WH5 A;  2DA3 A;  4B4C A;  4A3K J;  2CUF A;  4IHY A;  1XG1 A;  3HBL A;  3MVP A;  1GDT A;  2TCT A;  3S17 J;  2R5Z A;  3LOC A;  4AC0 A;  2EZK A;  5EEA A;  3DCF A;  3BR1 A;  2DA5 A;  2R0Q C;  3ZQC A;  2XGC A;  3RZD J;  4L5E A;  1LE8 B;  4A3L J;  1X2N A;  4JX5 A;  1TWF J;  4RDU A;  2JK3 A;  3S2D J;  2EH3 A;  3LSG A;  1U8B A;  5FLV A;  3TW6 A;  1UHS A;  3FKI J;  1IGN A;  1U78 A;  3F0C A;  3GTO J;  2GBY A;  1RR7 A;  3MKL A;  1ETY A;  3CMY A;  1H88 C;  2K9Q A;  5EGO A;  5C3E J;  3BTC A;  5EZG A;  2LY9 A;  3HKZ N;  5FJ8 J;  1F36 A;  2XPU A;  2HI3 A;  3RZO J;  1GV2 A;  3BQY A;  1IV6 A;  5DTD A;  3IH3 A;  3S14 J;  1Z77 A;  4AUX A;  2XPV A;  3ZOB A;  4A3M J;  3JRF A;  1FTZ A;  1I3Q J;  2L7Z A;  5FLM J;  3ZQH A;  2LD5 A;  2DMN A;  2JA7 J;  4JX4 A;  3GTP J;  1TC3 C;  2NS7 A;  3FK7 A;  4MFE A;  5C44 J;  1JGG A;  2FX0 A;  5IYB J;  2EQR A;  5EF6 A;  4J19 A;  3HOV J;  2VUM J;  3PO2 J;  3FIS A;  4QSH A;  1MH3 A;  3ZQL A;  1DU0 A;  3WHC A;  1QVU A;  1JKQ C;  5EG0 B;  3IV5 A;  2R7Z J;  4DW6 A;  1FTT A;  5E3L A;  1MBJ A;  2IAI A;  3HOU J;  3LSP A;  1NK2 P;  2KDZ A;  2LR8 A;  4A3B J;  5EG0 A;  1S7E A;  1F43 A;  2E2I J;  3SFI A;  3OSG A;  4FTH A;  2E19 A;  1T33 A;  2OPT A;  1ETO A;  1JKO C;  3SJM A;  1MBG A;  5BNG A;  2JWT A;  1U9N A;  3GTK J;  3BG3 A;  2CQX A;  4Y7N J;  1AKH B;  2Y30 A;  3ZQF A;  3BR2 A;  1B72 B;  4CYC B;  1ETX A;  5FKK A;  2JA8 J;  4XRS G;  1AKH A;  5EYR A;  4LOC A;  5EDN A;  3D1N I;  1HOM A;  1B72 A;  1E3O C;  2E2J J;  5J1U A;  1FEX A;  2HYJ A;  2ME6 A;  4XIC A;  1IDY A;  3K7A J;  2I10 A;  2R92 J;  2DN0 A;  1I50 J;  2K40 A;  4V2G A;  1SAN A;  1WH7 A;  1ZTR A;  3M3Y J;  2VKV A;  2Y9Z A;  1ZGW A;  2NVX J;  4X1E A;  5F0F A;  1IUF A;  4A3G J;  4D5F A;  2TRT A;  4MO7 A;  3S16 J;  2N8G A;  2X48 A;  3H0G J;  3BR0 A;  3GTL J;  3G1L A;  3NAR A;  1QVT A;  1OCT C;  2LTP A;  2ZB9 A;  3M4O J;  2X6O A;  4HNV A;  2O8K A;  2WAQ N;  1FIP A;  2DMU A;  1IDZ A;  3JRA A;  2E2H J;  3BR6 A;  1WCM J;  2WV1 A;  5F04 A;  1APL C;  4IHV A;  3S1N J;  3LSR A;  2NVT J;  5IP7 J;  5FKO A;  3C2B A;  4MLO A;  1TWH J;  1ZR4 A;  3TP3 A;  4JYK A;  3BT9 A;  4C3H J;  4BKX A;  3A01 B;  1DU6 A;  2Y9Y A;  3TW7 A;  2M2E A;  3I4N J;  4DZJ A;  1EF4 A;  4JP0 A;  1XS9 A;  5F08 A;  1YRN B;  3JR9 A;  4DYC A;  1PUF B;  1MSF C;  1ZQ3 P;  4A3F J;  4DYR A;  1LE8 A;  2GM4 A;  2O9L A;  1IG7 A;  4A3D J;  1GUU A;  3RKQ A;  2CJJ A;  5IYC J;  2R5Y B;  1IJW C;  4BY1 J;  1PUF A;  1FIA A;  1ZKG A;  2AO9 A;  2R5Y A;  1JT0 A;  1A5J A;  1OJL A;  2GLO A;  3OOU A;  2HXI A;  5GPA A;  1AU7 A;  4C3J J;  3HB9 A;  2NS8 A;  2NVQ J;  2FD5 A;  4GFB A;  2K9S A;  2JMW A;  2HOA A;  2YS9 A;  2KT0 A;  2YU9 J;  4AYB N;  2XB5 A;  3I4M J;  5JLW A;  4M3G A;  2OF7 A;  3JRG A;  2DA1 A;  5E3N A;  4IHW A;  4UUS B;  3OIO A;  3O8G A;  3G1O A;  9ANT A;  4C3I J; 
#chains in the Genus database with same CATH topology
 1VFC A;  1LDD A;  4HAM A;  4I01 A;  3P9K A;  1JT6 A;  1LUJ B;  5H20 A;  2E5Z A;  3RQ4 A;  1K78 A;  3PSI A;  4QWQ A;  2EWN A;  2M7A A;  1HKQ A;  1R36 A;  4AYB A;  1P7I A;  1XMX A;  3LA2 A;  2C6Y A;  1WHU A;  3RQI A;  4XRS A;  1ETQ A;  2IBD A;  2WB1 N;  1BIB A;  3DFG A;  2KKO A;  2MC4 A;  4A3I J;  2Y31 A;  1NH3 A;  4RM2 A;  2IP2 A;  1WRJ A;  3OR1 C;  4I09 A;  2GA2 A;  5F0C A;  4EAT A;  3JRE A;  3CCJ I;  1RKW A;  1GLN A;  4PUS A;  2HQ5 A;  2XAQ A;  1SAU A;  3QOD A;  2JN6 A;  1PP7 U;  1R6R A;  5L3F A;  4WCG A;  1B9N A;  2VOD A;  5CLS A;  1DPU A;  1FJL A;  4ESJ A;  5AON A;  1N78 A;  4R79 A;  3OYK A;  1O3Q A;  1Q1V A;  4IZZ A;  1ERD A;  4EGY A;  2XRN A;  4NUB A;  2IGK A;  2EPF A;  5F27 A;  4CYC A;  1WGX A;  1JTY A;  1IC8 A;  4CCO A;  2O61 A;  1IUY A;  2PMZ N;  1HF0 A;  3CLO A;  5H2F C;  2QQ8 A;  2A6H F;  1TT0 A;  2HGC A;  3K4K A;  4UHT A;  5J8C A;  3QWL A;  4M3E A;  1ZRC A;  3S2H J;  4L18 B;  3QP6 A;  1OQY A;  3Q0V A;  3QU3 A;  4OIP F;  4I6Z A;  3CJN A;  3BG9 A;  1K61 A;  3DTK A;  4IQ4 A;  2VXD A;  4KT6 A;  1Z3Y A;  3RPU A;  3G1M A;  2VXZ A;  5IOZ A;  2HWV A;  5J1R A;  2CU7 A;  2HTS A;  3FMS A;  4CCL A;  3WU2 C;  4AIK A;  1B9M A;  4XSX F;  2K3F A;  2BHZ A;  4S05 A;  3F8M A;  1X3Z B;  1N75 A;  1Y0N A;  3FXR A;  3DQV C;  3T8R A;  1R00 A;  4L9J A;  3GFM A;  5TGT A;  2W00 A;  4MFD A;  4G9Y A;  4BBR J;  2IRF G;  4NQW A;  3NWT A;  2XGX A;  3PQK A;  1OR7 C;  5J40 A;  3ZN0 A;  2MD0 A;  1T38 A;  1ZG5 A;  6PAX A;  5FFX A;  3JRB A;  1WPK A;  2DJN A;  4LB6 B;  3A01 A;  2HOT A;  3OYL A;  2VBX A;  3G4S I;  3FHN A;  3B6C A;  1PJR A;  5F0H A;  3QPL A;  1X2M A;  4IHX A;  4ZYA A;  3RDI A;  1OCP A;  1HW1 A;  2MAB A;  4F91 B;  2M4G A;  2IEK A;  2V6C A;  1MD0 A;  4RAZ A;  4YII A;  5K7H A;  3V7C A;  4D1Q A;  5HDN A;  4XLN F;  2QBY B;  1UG2 A;  2L9S A;  4M9X A;  5HDG A;  4AD9 A;  3ABU A;  3ZMU A;  3J80 Z;  1VQ5 I;  2E7X A;  2XUB A;  4KYW A;  5L3C A;  3P5J A;  3BTI A;  2VQG A;  2R7Q A;  1V5G A;  3MWM A;  3BLY A;  3H9G A;  4UB8 C;  4P9U A;  4XR6 A;  3F8C A;  3WGH A;  1JJ8 C;  2JPB A;  2HPM A;  4ITV A;  1ZK8 A;  4X6A J;  4D7M A;  3IH4 A;  1Y1W J;  3FXJ A;  1IXC A;  5FKL A;  5L3B A;  3GX4 X;  5E3M A;  1XDS A;  3BZ6 A;  2JT1 A;  2F4I A;  3FXU A;  4L9N A;  2DYR H;  2P81 A;  4G8X A;  2GZW A;  3PIP F;  1TWC J;  5EGO B;  2VKD A;  2E34 A;  3LSJ A;  1E2X A;  2RQP A;  3OYG A;  4UNO A;  1BM9 A;  4B44 A;  1I3A A;  1G3T A;  2LSO A;  1K79 A;  2OC6 A;  4CUG A;  2DW4 A;  3KE2 A;  3TO9 A;  3KZI C;  4KUM A;  1MMN A;  4M3B A;  1T0F A;  3ZCO A;  1RZ4 A;  2QQA A;  2XAS A;  2QSH X;  1Z1D A;  2L9N A;  2A5W A;  1BJZ A;  3BG5 A;  3KZY A;  2ZSI B;  4HF0 A;  4ENJ A;  3H35 A;  4V2F A;  3K1M A;  4F93 B;  3K4B A;  2GXB A;  2QKL B;  3HC7 A;  1TWA J;  3K4N A;  3L7W A;  4XLE A;  3WTZ A;  2RQQ A;  1UB9 A;  2PMU A;  4HLY A;  1R4M B;  1YYV A;  2IT0 A;  3OMY A;  5HOD A;  3OL3 A;  4E7J A;  1VQ8 I;  4IQJ A;  3HXL A;  3AG3 H;  2XSD C;  1GVD A;  3ABM H;  4AM3 A;  2A3S A;  2WY8 Q;  5D4S A;  2MBF A;  3BR3 A;  2V7F A;  5M5X J;  1OYI A;  4LFU A;  1A35 A;  3K1P A;  4MNU A;  2VI6 A;  2OD5 A;  1KU2 A;  3TGN A;  5KAF C;  3I3L A;  3Q9S A;  1P9Q C;  4KNY A;  4KIT B;  2I5U A;  4GYG A;  2FF4 A;  2KIS A;  5BS6 A;  3FXQ A;  4ZYD A;  3QQA A;  3O2P E;  2I8D A;  3OYA A;  2E1O A;  2EZL A;  4G12 A;  1T98 A;  2YX7 A;  2OBP A;  2KHM A;  3ZMZ A;  2OTJ I;  2M0M A;  3T0Y A;  1X3U A;  1K6Y A;  4ZYH A;  3LQR A;  2R93 J;  1KGS A;  2L7K A;  1VQL I;  2PN6 A;  1MJB A;  3A02 A;  5IP9 J;  4DNC A;  2LKX A;  2XKP A;  1B8I A;  1SC7 A;  2JUC A;  5J8F A;  3HOY J;  5K1Y A;  2HVR A;  5E8I A;  3J7Z I;  1HKS A;  3DPL C;  1D8J A;  1OLT A;  1W36 D;  4JQF A;  3OR2 C;  1JUS A;  2STT A;  2KZG A;  2JUG A;  3PFI A;  1NG7 A;  2L54 A;  3S1R J;  1NK3 P;  3EET A;  4LLG F;  1JHH A;  2WAD A;  2GWR A;  2M87 A;  4HZF A;  2G7H A;  4IHT A;  5KVR A;  4A2U A;  4QTR A;  1XSV A;  2M8G X;  4WXH A;  4CCK A;  4PFP A;  2QSF X;  1K83 J;  1WH5 A;  2FOW A;  5HLH A;  3DXJ F;  2TCT A;  2XF7 A;  2M45 A;  1J5Y A;  3E6B A;  3LOC A;  2FQ3 A;  4AC0 A;  2EZK A;  1FOX A;  3WTY C;  3L2C A;  3BRO A;  3CF5 F;  3ZQC A;  1LB2 A;  4OOI A;  4MTE A;  2FEZ A;  4L5E A;  4L0Z B;  4BEH B;  1X2N A;  2FU4 A;  4JX5 A;  4A3L J;  1ZYR F;  2QZ8 A;  1SD5 A;  2Y48 A;  3D5S C;  2HU9 A;  1U2W A;  2JK3 A;  3S2D J;  2MLG A;  3HRT A;  3HTS B;  1PYV A;  2HKX A;  3VYT B;  4D9J A;  5FLV A;  2ZXH A;  1QA6 A;  2AXL A;  3CCU I;  1TNS A;  3L2R A;  3HG9 A;  1YFH A;  2GBY A;  3Q9V A;  1A31 A;  3M8J A;  1J7K A;  1H88 C;  4HRI A;  3GZ5 A;  3WGG A;  1LEA A;  3ROU A;  3LFU A;  2IS6 A;  2R7S A;  1IN6 A;  4BDY A;  3CJR B;  5EEG A;  2VOP A;  2CUZ A;  1IV6 A;  3IH3 A;  4PJN A;  4AUX A;  1AA7 A;  2XPV A;  2QSG X;  3C2H A;  3ZOB A;  2QA4 I;  1FYM A;  3PJR A;  3CLQ A;  4KIB A;  3UR3 C;  1SFX A;  3JRF A;  3LAJ A;  1FTZ A;  2BZT A;  3CF2 A;  2CV2 A;  1OCC H;  2PLY A;  2D45 A;  2NS0 A;  3ZQH A;  1P6R A;  5LHG A;  4RGU A;  4XQF A;  4NHJ A;  1DGW Y;  3H9Q A;  1K78 B;  2EQR A;  4E7I A;  1HW5 A;  4M73 A;  3FIS A;  3K4C A;  3G2B A;  4QSH A;  3MD2 A;  3ZQL A;  4PGH A;  1VQ7 I;  2FBI A;  3IV5 A;  5KAI C;  3U1D A;  1FPQ A;  1OPC A;  3ZMD A;  4DW6 A;  1FTT A;  1MBJ A;  3VSK A;  1S5L C;  3O3K A;  1NK2 P;  1F43 A;  2L9V A;  3E97 A;  5EG0 A;  2JZY A;  4KMF A;  1FWZ A;  3LMM A;  3SFI A;  1FZP B;  2Y0M A;  2OPT A;  1O7F A;  2MD5 A;  3J81 Z;  1ETO A;  3JTG A;  3NEU A;  1XX5 A;  1MBG A;  2VE9 A;  3BG3 A;  2D1V A;  2KZV A;  2EIJ H;  4U7B A;  2P5K A;  5DM6 F;  4IVN A;  2Y0S A;  3OYJ A;  2GOX B;  4CYC B;  1KA8 A;  2DOE A;  2BHY A;  4XRS G;  3ZRG A;  5JR3 A;  2E1M C;  4E4H A;  4GXO A;  1B72 A;  3EYY A;  2IGN A;  4ENM A;  1IDY A;  2R92 J;  2I10 A;  2CG4 A;  3DLA A;  1XGS A;  4M9S A;  2XAG A;  4CSW A;  2VKV A;  2A07 F;  1TQP A;  4X1E A;  3P9C A;  1MMS A;  2TRT A;  3WG9 A;  3H0G J;  3BR0 A;  3GTL J;  1D0Y A;  1G3S A;  3D5L A;  1SMY F;  2EFP A;  4EGZ A;  1UZC A;  4NNJ A;  1OCT C;  4HV6 A;  1REP C;  2WAQ N;  3KPH A;  3S8P A;  3W6J B;  1P4X A;  2KDO A;  3FHZ A;  3JSP A;  5K5O A;  2XAH A;  1WCM J;  1KQ0 A;  2IA2 A;  2P6T A;  3MKY B;  3CME I;  1APL C;  1E3P A;  3FX3 A;  1TL8 A;  3OS0 A;  3K0L A;  4BQN A;  2JSC A;  2KIM A;  4NQW B;  3CO6 C;  5FKO A;  1IRF A;  3PNY A;  1ZR4 A;  1Y39 A;  4Q48 A;  1SAX A;  3BT9 A;  2X85 A;  3WTU C;  2K7L A;  4E70 A;  3A01 B;  1DU6 A;  2Y9Y A;  3TW7 A;  1XB4 A;  2M4K A;  4ASN A;  1XCV A;  2RV8 A;  3HIF A;  2LY2 A;  3JCU C;  2EIN H;  1SVM A;  4EJT A;  2V6E A;  2RDP A;  4IX7 A;  2WBM A;  3DU6 A;  1PUF B;  4DYR A;  1IG7 A;  4BQQ A;  1SEU A;  3DKX A;  1Z6R A;  5AIP A;  1IJW C;  1ZN2 A;  4BY1 J;  2BW3 A;  3IWZ A;  4CDG A;  2VC0 A;  1FIA A;  1Z7L A;  1A5J A;  1JT0 A;  4LGW A;  4O3M A;  1OJL A;  2GLO A;  3WU0 A;  5GPA A;  4OIQ F;  1OCR H;  2UXN A;  2X6X A;  3CO7 C;  2HOA A;  2YS9 A;  2KT0 A;  2X1D A;  3I4M J;  2OU2 A;  2MH9 A;  1X4O A;  3HPG A;  2HZT A;  3BDD A;  5DEQ A;  4N9H A;  2DA1 A;  4PZJ A;  3HRU A;  1ZG3 A;  4IHW A;  2K4B A;  3RKX A;  2R7R A;  4E7S A;  1OKR A;  3CJQ B;  3OIO A;  4F92 B;  4HPQ A;  2D2W A;  2Y69 H;  4NC8 A;  4C3I J;  1U0J A;  1W7P A;  4QLC U;  2DMQ A;  1RC9 A;  2M3A A;  3DWL E;  5A2Q K;  3WTS C;  3VEP A;  2G7U A;  3W3C A;  5J4V A;  4BE0 A;  3EUH A;  1JUP A;  3K2Z A;  2V9V A;  2IA0 A;  1EH6 A;  3L00 A;  2MGQ A;  3ZGK A;  3HHG A;  1ZR2 A;  3A03 A;  3FXK A;  3VFZ A;  5IYD J;  1MIJ A;  1QZY A;  4A5M A;  3CCR I;  4B47 A;  1SD7 A;  3AKZ A;  1BI2 A;  1UCR A;  5F1J A;  2EV6 A;  3BWG A;  1U9O A;  5BPD A;  4BUP A;  3QOE A;  2H94 A;  3M8E A;  3PSF A;  1TQI A;  2IVM A;  1DGR M;  3I9V 2;  5ICE A;  1W0U A;  2PEX A;  2Z3Y A;  2K3P A;  4HNT A;  5HS8 A;  5FRM A;  4QPO A;  3T8T A;  5JLX A;  3A0B C;  2DYS H;  3ZR8 X;  3DKW A;  1FYK A;  2FA5 A;  1NG6 A;  3ML6 A;  2ZKZ A;  2E36 A;  4KMU X;  3SQN A;  4U0W A;  1YI2 I;  2ZJR F;  3R6S A;  1MBK A;  3ZQI A;  2Z5U A;  2QKM B;  4I0A A;  2VT2 A;  3SEQ A;  2LVS A;  1YG2 A;  5EZH A;  3OIP A;  1FBS A;  1HKT A;  4E7L A;  4OAY A;  1LFU P;  5DD8 A;  2XB0 X;  3CZ6 A;  2D5V A;  4ZDP A;  2VQC A;  2H1K A;  1SFE A;  3FXM A;  2K9N A;  3LL7 A;  4Y15 A;  2VT3 A;  3H36 A;  3VYS B;  1TZL A;  3OV8 A;  3OSF A;  3H5N A;  3C3W A;  2ZJ2 A;  3FKJ A;  3MQ0 A;  3VPR A;  4CYD A;  2R7D A;  4ZZD A;  3OS2 A;  1AHD P;  4BQA A;  4W97 A;  1B8I B;  1WSU A;  3HUG A;  3K70 D;  1ZH5 A;  2LOO A;  2NXN B;  1VND A;  1O3R A;  4M3F A;  4Y33 A;  3TDU C;  2MG4 A;  5GAD J;  5LHI A;  5E18 F;  2BBY A;  1BOB A;  4FHT A;  4MHG A;  4RB1 A;  3BQZ A;  4RGR A;  2NYX A;  3E5Q A;  1HW2 A;  1Y1V J;  1O3S A;  4BS9 A;  4XL9 A;  4HA8 A;  5L3D A;  4A0Y A;  2XC7 A;  5ICF A;  3VYU B;  5HS7 A;  3JW4 A;  4CZZ A;  3DU5 A;  3GTQ J;  1S3J A;  4G6D A;  5JVG F;  2RNG A;  4XKC A;  1FOW A;  3V8J A;  2W48 A;  1KON A;  2JA2 A;  1BI1 A;  2L02 A;  3FF5 A;  4N4O B;  5TIS C;  2XGE A;  1T6S A;  1A6I A;  3K10 A;  2FNP A;  1R1U A;  4ETS A;  1H89 C;  5D5W B;  2L9R A;  1HQC A;  1ZGA A;  4HG2 A;  4IRI A;  2CQK A;  3HEF A;  2Y2Z A;  3HM5 A;  2P8T A;  3NAU A;  3S1M J;  2RGV A;  3CQZ J;  4LG0 A;  2WAF A;  4I02 A;  4R1H A;  1DQU A;  5BQT A;  1R9T J;  2OCE A;  2Z16 A;  1VZ0 A;  4XLF A;  3X2Q H;  1O57 A;  1HSJ A;  2L01 A;  5D4R A;  3EYI A;  5IP6 A;  2HQN A;  4RGX A;  4UUS A;  2DCE A;  4F52 A;  4A0X A;  5TJJ A;  2OZU A;  4B1R A;  1VTN C;  2Y75 A;  4BDZ A;  1OCO H;  4ANJ A;  1U5T A;  1R5H A;  1D3Y A;  3B6A A;  3NRV A;  2YU3 A;  4KIF A;  3I4P A;  1X58 A;  4XMY A;  2KIF A;  3D0S A;  1SFU A;  5CPR B;  2ACJ A;  2O7O A;  1LFB A;  2CQQ A;  4L9V A;  3LFK A;  4BXF A;  3LNQ A;  2CV0 A;  2JA5 J;  2GA1 A;  3JRH A;  1YIJ I;  2Y0S N;  1MDM B;  3JRD A;  2ID6 A;  1F5T A;  3HTU A;  1YOV B;  2ZME A;  1FC3 A;  2KJC A;  2DOD A;  3PNT A;  5GTI C;  5GAG J;  2PQ8 A;  1A04 A;  1WKM A;  4XNF A;  2IGM A;  1TLH B;  5B66 C;  2HR3 A;  1LKX A;  3DPU A;  4BH9 A;  1UST A;  3MKW B;  1PDN C;  3SDB A;  4FE4 A;  1XMA A;  3A0H C;  4PFO A;  1DP7 P;  1XC5 A;  3JAM Z;  4L5J A;  4HLX A;  1S9H A;  3HPH A;  1Z05 A;  3MZY A;  5J6X A;  2NNN A;  2UUZ A;  2CH0 A;  3AL0 C;  5ILV A;  3CCV I;  2HOS A;  4A69 C;  4IPA A;  4OAZ A;  3G71 I;  1MZB A;  2ZJP F;  2OTL I;  5LLQ A;  3H0D A;  1JHF A;  3UKG A;  4MEX F;  5JI6 A;  1WI3 A;  1VQM I;  3K2A A;  3ULQ B;  3CDL A;  4A6D A;  1D5V A;  3KEY A;  3L2W A;  3S15 J;  1WJC A;  3V4G A;  2XAJ A;  4ZTF A;  1RIO H;  2AQE A;  2RAE A;  4HQM A;  5F1R A;  1ONV A;  4M72 A;  3BG6 A;  3BZK A;  2XRL A;  1IF1 A;  3FM3 A;  2ID3 A;  2F5D A;  2ZC2 A;  3TOA A;  3SFZ A;  5LGN A;  3DBL B;  3FMQ A;  3HHH A;  4P96 A;  4B43 A;  1JKP C;  1TP4 A;  1MNM C;  4ENK A;  3GZN B;  2LY1 A;  3HYI A;  4B48 A;  4UB6 C;  1D5Y A;  1JTX A;  3BR5 A;  2WWY A;  2HEO A;  3W6V A;  1BN5 A;  2HQR A;  3C1D A;  3CDH A;  2DA3 A;  3E0J B;  2R5Z B;  1WJD A;  3GLL A;  3MVP A;  3F23 A;  1YW7 A;  2AXT C;  3BG7 A;  3ZQQ A;  1XGN A;  4UVA A;  3VSL A;  1XSD A;  3ZMS A;  2HDW A;  5EEA A;  3BR1 A;  2FUG 2;  5E17 F;  2R0Q C;  1TTY A;  4UVC A;  2DPD A;  1UFM A;  4QPQ A;  5D6F A;  3FZV A;  1K4T A;  3CUQ C;  2WV0 A;  4V19 K;  2ZBK A;  3EQL F;  1IAW A;  3WE3 A;  1FLI A;  1I39 A;  2LC2 A;  2DFE A;  3M7G A;  4H4K C;  3R0J A;  1J0R A;  5D8L B;  5TRD A;  2DDA A;  3QP5 A;  3F0C A;  4BU2 A;  1EH8 A;  2CW7 A;  1R1T A;  2HQA A;  1RR7 A;  1QNT A;  3I0T A;  3H92 A;  3ABL H;  5C3E J;  2M7B A;  5EZG A;  4IRG A;  2PJR A;  5FRN A;  1YO5 C;  3G3Z A;  2HI3 A;  3LWF A;  3IRQ A;  3ZQ7 A;  2UZK A;  4XON A;  2V9P A;  4JBA A;  1VQP I;  2RVC A;  2DOA A;  1L3L A;  1GV2 A;  3BQY A;  5ERI A;  5DTD A;  5JHU A;  4HDV A;  1LPQ A;  3KYL A;  2P4W A;  2VBW A;  4KN4 X;  4CH7 A;  3BP8 A;  4XLP F;  2CV1 A;  4NC7 A;  4LIT A;  5K5Q A;  2LD5 A;  3I71 A;  1MJA A;  2DMN A;  2PJP A;  2JA7 J;  3CJT B;  1TC3 C;  1STZ A;  5C44 J;  1JGG A;  4RLF A;  2VQL A;  5EF6 A;  2BOL A;  3ONQ A;  5BMZ A;  4CGZ A;  1BR2 A;  2VUM J;  1YQA A;  2K4J A;  5ICG A;  1BC8 C;  1CF7 A;  4PDK A;  3FM5 A;  3SEZ A;  1QO0 D;  3CC7 I;  1JKQ C;  2CSO A;  5E3L A;  3HOU J;  4HX4 A;  1B4A A;  4K2E A;  3R60 A;  1ZRF A;  3OSG A;  4BAY A;  1HA8 A;  3M1E A;  1JKO C;  4N0B A;  4PSX A;  1JXS A;  2XSJ C;  3KP5 A;  4HEA 2;  4EJU A;  1U9N A;  3F9K A;  1OYW A;  3GFL A;  3J80 K;  1D0X A;  4LG3 A;  3RTR A;  2DQR A;  3OYD A;  3F72 A;  4YIF A;  3TO6 A;  3MAJ A;  5FKK A;  1QZE A;  1AKH A;  5EDN A;  3KP2 A;  1HOM A;  1FP2 A;  1W1W E;  4I0B A;  5HVQ C;  1K4S A;  4EQQ A;  2R7T A;  5J1U A;  1FEX A;  2HYJ A;  5LD2 C;  1OR7 A;  2P5V A;  3K7A J;  3C18 A;  2YPR A;  2DN0 A;  1CGP A;  1RR8 C;  1X1D A;  1ZTR A;  2FE3 A;  4GRI A;  5FD5 A;  4Y17 A;  2RKH A;  4YFX F;  2A61 A;  2Y9Z A;  1X3W B;  4KA4 A;  1LDK B;  3GFI A;  4EMS A;  2LKS A;  3S16 J;  2N8G A;  4P1W A;  4CCM A;  2VON A;  4ENN A;  3G1L A;  3PUF A;  2Z9O A;  2CYY A;  4R8H A;  3M4O J;  2Q2E A;  3K69 A;  3UNG C;  3TO7 A;  4CCN A;  4DQ2 A;  2HDC A;  5BOX A;  3HUG B;  2E2H J;  2F5C A;  2QVO A;  5DUK A;  3QYE A;  3HJE A;  3BJO A;  2W25 A;  5B1A H;  4OIN F;  4MEY F;  1WJB A;  2DQL A;  1KU9 A;  3F22 A;  2DDB A;  3LA7 A;  2BYV E;  4C3H J;  2GXG A;  2HOE A;  2QUF A;  2JRM A;  1S29 A;  5HLG A;  1YJW I;  3H3Z A;  2ICW G;  4PGG A;  5FGM A;  4A12 A;  3ESW B;  3KP6 A;  1EF4 A;  3KP7 A;  3I53 A;  1ON1 A;  1WJF A;  1ZAR A;  4HW0 A;  4PK4 A;  4XKV A;  3BPX A;  2E5N A;  3U9G A;  4BNC A;  3KCC A;  1MSF C;  1Q1H A;  4A3F J;  2XHK A;  4A3D J;  1GUU A;  1W7P D;  2FSW A;  4G6T B;  2R5Y B;  3RKQ A;  1MW7 A;  1ZEL A;  3PL8 A;  3KYC B;  3GW2 A;  2EV0 A;  3CDI A;  3WG7 H;  4EM2 A;  3EPZ A;  3ZMT A;  3WGI A;  1KYZ A;  4EJO A;  3T1B A;  4LMY A;  3OOU A;  1TW3 A;  2HXI A;  3SYT A;  3TL4 X;  4LK0 F;  3TOB A;  5ICC A;  5E79 C;  2MC3 A;  2KMU A;  3QPT A;  4PCQ A;  2P7C B;  2NVQ J;  1BOA A;  2K9S A;  4A6E A;  4LG0 B;  2GOM A;  3W2A A;  1GXP A;  2IS4 A;  2A5Y B;  4AYB N;  2COM A;  2K9L A;  3QPH A;  1G4D A;  3MFK A;  1S72 I;  4WXC A;  1TW2 A;  3JRG A;  4C2T A;  2LNB A;  2R7W A;  5E1W A;  2KIQ A;  2VBZ A;  2JRT A;  4UUS B;  3CP2 A;  2V79 A;  3F6O A;  5HOO A;  2ZJQ F;  9ANT A;  2VPL A;  3HRS A;  3IKV A;  2IS1 A;  4O6J A;  3SZG A;  5D5U B;  1P7J A;  1W36 C;  4IKF A;  3BOQ A;  4Y52 J;  3G6E I;  1U8R A;  1U5T B;  4HNU A;  3H1C A;  2LH9 A;  2FML A;  2EFO A;  5ILU A;  5F6F A;  2VBY A;  5ED4 A;  4RLQ A;  3L2Q A;  4A3C J;  5J4Y A;  2LFB A;  2CRG A;  2O8X A;  2MFZ A;  5K7Z A;  4CO8 A;  4RS8 A;  3DTI A;  4WK8 F;  2ETH A;  4JOM A;  3KYD B;  1HCR A;  2ELJ A;  4HF1 A;  1SFO J;  1VQN I;  2DA7 A;  5M5W J;  1MND A;  1FP1 D;  5E1X A;  2ZCW A;  3LA3 A;  3HOS A;  4E7H A;  2A6T A;  2K27 A;  2DAO A;  4GCV A;  2D1H A;  3L1P A;  1ULY A;  2CWE A;  4E6K G;  4KIS A;  3H5R A;  4LIU A;  4RBO A;  4P55 A;  1MSE C;  2O3F A;  4M6Y A;  3CCE I;  3EUK L;  4OIR F;  4ZH4 F;  3CCQ I;  2H6C A;  1GXQ A;  2NVY J;  4WWC A;  3BZC A;  2HKO A;  4MQV A;  3DEW A;  2DK8 A;  4BJ6 C;  1QPI A;  3ERM A;  3FWE A;  2OA4 A;  1YE9 A;  1BA5 A;  1P2F A;  3BY6 A;  1T2K A;  2VKE A;  3N05 A;  4FET A;  1MGT A;  1FMV A;  4BE2 A;  2V1U A;  1FSH A;  2ESN A;  4XOP A;  3RCO A;  1IV8 A;  1BW6 A;  1MBH A;  2RN7 A;  4M6V A;  3MKZ A;  2B63 J;  4RGS A;  3I59 A;  4FE7 A;  2LG4 A;  3CTA A;  5M5Y J;  3ELK A;  3BTJ A;  2H09 A;  2UWM A;  4CCJ A;  2WY7 Q;  3HOX J;  4EJV A;  3GTJ J;  3F8B A;  1WI9 A;  3GO5 A;  2KRH A;  4UV8 A;  2AS5 F;  4A3E J;  1I6X A;  5J1Y A;  2BEO A;  3BC8 A;  4QIW N;  1V5E A;  1ORK A;  1T08 B;  4IO9 F;  3W6K B;  2DA2 A;  1RI7 A;  2W82 A;  2K5C A;  3ZMV A;  2V1N A;  4I76 A;  1WQ2 A;  3IP4 B;  4RAY A;  4MIM A;  1RUN A;  4J01 A;  2DPU A;  4BBS J;  3HOZ J;  2XPW A;  2Q0O A;  2VL8 A;  4LJZ F;  1Z0X A;  2J5O A;  2XIG A;  5E3O A;  3PNV A;  4DIQ A;  5CVU A;  1CQT A;  1B59 A;  1RRJ A;  3OWT A;  1YRN A;  1X1C A;  2QCO A;  3CP8 A;  4XLC A;  5IT9 K;  3PFY A;  3J7A O;  4S0H B;  3ZQG A;  4BL0 B;  2HDD A;  1F1Z A;  3OL4 A;  3WOD F;  1RES A;  1S6L A;  1ETW A;  3QU6 A;  1ETK A;  2Z33 A;  1O3T A;  4XRF A;  2MLK A;  3IRR A;  4HDU A;  2R7X A;  1VF9 A;  4P9F A;  1E0E A;  2EIK H;  2KP6 A;  1LJ9 A;  3QRF F;  2HTJ A;  1FNN A;  4FX0 A;  2DTZ A;  4D5C A;  2W7N A;  1OCZ H;  4ABZ A;  1RPW A;  4A5N A;  4Z6Y A;  4XID A;  4ZTJ A;  3PM1 A;  4KN7 X;  4LK1 F;  4D0P A;  4B3A A;  1YW9 A;  3F21 A;  3RI4 A;  1L0O C;  3BTL A;  2A05 A;  1I6H J;  4LLL A;  4KJZ A;  2AHQ A;  2H6B A;  2DA6 A;  1YS6 A;  2VN2 A;  3OOP A;  5DCF A;  4AVZ A;  1ENH A;  2CS3 A;  1D1B A;  4RB2 C;  2COB A;  1MBE A;  1QHH D;  2G0E A;  2BVM A;  3LSK A;  4PJJ A;  3L09 A;  3Q3S A;  4XN0 A;  3G73 A;  2NOJ B;  3KEQ A;  1J9I A;  1I5Z A;  2F4O B;  2DA4 A;  3I5U A;  3IAM 2;  3KLN A;  4FX4 A;  3WE2 A;  4GDF A;  3HOW J;  1UHM A;  5K7F A;  1POG A;  3HGG A;  2O0Y A;  3CMA I;  3HGY A;  3KZZ A;  4KFC A;  2F5V A;  1I1S A;  3RJP A;  2L0K A;  2R3S A;  5LEK A;  1KQ8 A;  2CQN A;  4LIV A;  1HC8 A;  1XTA A;  1CF7 B;  2IJL A;  5FB2 A;  2EBI A;  2KRF A;  2M9H A;  4S04 A;  2LK2 A;  3HDD A;  2E7W A;  3CC2 I;  4OIO F;  1S7O A;  3M8F A;  2H8W A;  2XF6 A;  1LDJ A;  1TWG J;  1Z67 A;  2BV6 A;  3F8N A;  3A1Y A;  2EFW A;  4UUV A;  2X4H A;  2OAZ A;  2X9D A;  1YW8 A;  5C4J J;  2XKO A;  2BVL A;  2DFF A;  4GGG A;  2VIX A;  2OQR A;  3S3N A;  1V5F A;  1R1V A;  3HL2 A;  1KYW A;  1BI3 A;  5GPC A;  3W2V A;  2DU9 A;  1W5C C;  3H3U A;  2EZH A;  4PJM A;  3AAF A;  2BXZ A;  2CQ7 A;  1OYY A;  5ILS A;  4DOZ A;  2EA2 A;  3C2G A;  2DMP A;  2HPI A;  1ITY A;  4NC6 A;  1QPM A;  2FJ1 A;  4HYE A;  4M9Z A;  2VOO A;  3MEX A;  1RKT A;  1D0Z A;  1O4X A;  1QGP A;  2OUM A;  1I1G A;  3LAP A;  3CCY A;  4BY7 J;  1B1B A;  4OWR B;  2F48 A;  3GYH X;  4II3 A;  4W1U A;  3LSM A;  2MSY A;  3ZN1 A;  1BL0 A;  5D6E A;  3OYH A;  4IHS A;  4IOC F;  1EA3 A;  1ODD A;  4RAF A;  1FBU A;  4MGR A;  5M3F J;  1BW5 A;  2GQQ A;  4A0Z A;  5CQE A;  2LP0 A;  2PMH A;  3MMY B;  4HX8 A;  3FBN B;  1IW7 F;  2TDX A;  1SFK A;  1MH4 A;  3TP0 A;  3V8L A;  3GZ6 A;  2PI0 A;  4BHC A;  3I55 I;  4MTD A;  2KLO A;  3FK6 A;  5GP9 A;  2CW0 F;  4G7Z F;  4IHY A;  1Y0U A;  1X4P A;  4BE1 A;  1TQM A;  2LF7 A;  2Z2S B;  5LFA A;  3S17 J;  2GIZ A;  3PIO F;  4YRV A;  3FMR A;  4U88 A;  2DT6 A;  3S3M A;  4AIJ A;  2KIU A;  4HX7 A;  4AIH A;  4WX9 A;  3IC7 A;  2DA5 A;  1EV7 A;  2WAE A;  4ESB A;  2XGC A;  3SXY A;  3M9A A;  1SMT A;  4BXU A;  2BE5 F;  4L5I A;  2Q8K A;  2QEN A;  1TWF J;  1YTY A;  4F7Z A;  3CCM I;  3E5X A;  4BEH A;  2J5P A;  4BJ5 C;  3GEZ A;  1U8B A;  1BJA A;  2ZXW H;  1YIO A;  3V7R A;  3TW6 A;  1UHS A;  3FKI J;  1HBX G;  1IGN A;  3GFJ A;  3GTO J;  1W5T A;  1Z6T A;  5JVT A;  4I98 B;  5CKT A;  1YJN I;  2K9Q A;  2BY2 A;  1EH7 A;  1XN7 A;  4RB3 C;  1ZLK A;  2M5W A;  2BY1 A;  3RZO J;  4O5V A;  4UY8 I;  1Z3X A;  2F6C A;  2G9W A;  4U0V A;  1PP8 F;  1P4A A;  1Y56 A;  3U21 A;  2O03 A;  2HVQ A;  3MZ8 A;  3GWZ A;  1I3Q J;  1LEB A;  2F5E A;  3V7S A;  4ZYG A;  1VQ4 I;  3KX2 A;  3BJ6 A;  3EDP A;  4JX4 A;  3AG4 H;  4G7H F;  3FK7 A;  1IN5 A;  4MFE A;  2IXS A;  4YFK F;  4J19 A;  3PO2 J;  1WJ5 A;  1D8K A;  2HFH A;  4OMY A;  1MH3 A;  4Q47 A;  1D1C A;  2RNJ A;  2VB6 A;  2ZFW A;  4TV7 A;  1Z21 A;  5EG0 B;  3ISP A;  2XV4 S;  5FLX K;  1M1E B;  2QEX I;  1H9T A;  2LR8 A;  1S7E A;  1A6Q A;  2EFQ A;  3AFH A;  3KLO A;  3RKW A;  5KK1 A;  4C2U A;  4KT5 C;  1R49 A;  2HVS A;  4PJ0 C;  3BCB A;  3IUO A;  2H1L A;  2WA0 A;  1EKE A;  1BIA A;  1FT9 A;  3DLL F;  3SJM A;  2M1B A;  2RRE A;  1IN4 A;  2JWT A;  3KIO A;  1H9G A;  1DUX C;  1T0F C;  1QQI A;  3V8K A;  5HNF A;  3MCZ A;  4Y7N J;  2Z1D A;  3OY9 A;  3BR2 A;  1B72 B;  2KFD A;  1WJA A;  1ETX A;  3W2W A;  3HSF A;  5EYR A;  2L4M A;  4LOC A;  1TT5 B;  3KFW X;  2E2J J;  1VQO I;  3VOD A;  2ME6 A;  2STW A;  1B6A A;  4LD5 A;  4V2G A;  2X1E A;  1WH7 A;  2HS5 A;  4IRH A;  4CHU A;  1Z91 A;  5EJC A;  2LF8 A;  3BPV A;  1ZGW A;  1R4N B;  2ESH A;  5F0F A;  1IUF A;  3DBH B;  3WTW C;  4A3G J;  3FDY A;  4I7H A;  3NWS A;  2W85 A;  4IL6 C;  3SZP A;  3M1C A;  1SD4 A;  3OYB A;  4UVB A;  1XPX A;  3I59 B;  3I54 A;  3NAR A;  1QVT A;  2JVG A;  5HLI A;  3OYI A;  2YX4 A;  2ZB9 A;  5KNL A;  2XRO A;  1FIP A;  2V1X A;  2DMU A;  4B8X A;  4XSZ F;  2CFX A;  3IL2 A;  1J09 A;  4RAG A;  2OQG A;  3BR6 A;  2WV1 A;  5F04 A;  1R22 A;  2XVC A;  3S1N J;  2R7V A;  4HSR A;  4HST A;  3ERE D;  3OYM A;  3LSR A;  2NVT J;  3TMO A;  3VOE A;  5IP7 J;  2OCC H;  3C2B A;  3I64 A;  2E60 A;  4Q5S F;  1TWH J;  1T39 A;  4P5O A;  2O5R A;  3H5A A;  3TP3 A;  3RIR A;  2CW8 A;  3SZT A;  1YLF A;  4H0E A;  2YSR A;  3ASN H;  5DCM A;  1U3E M;  3HSE A;  1XGO A;  2JSP A;  5LRS A;  1ZGJ A;  1WFX A;  4F3Q A;  2WAQ A;  3HRM A;  3HZJ A;  1BR1 A;  2X51 A;  1X1B A;  2KJB A;  3OYE A;  1MKM A;  1J2X A;  1OMI A;  1FOY A;  5F08 A;  1YRN B;  3S2W A;  4DYC A;  2BW3 B;  3LST A;  1LE8 A;  1ZQ3 P;  2GM4 A;  5CQG A;  2CJJ A;  2NNY A;  2QYO A;  2ELH A;  4U7D A;  1PUF A;  1HST A;  4XLA A;  4B3X A;  2AO9 A;  2IPQ X;  2VE8 A;  4OU0 A;  3U1K A;  5L3G A;  2LRD A;  2LBF A;  3T5X A;  2R4G A;  1UJ8 A;  1AU7 A;  1AOY A;  4BHP A;  1PUE E;  2CGP A;  4II2 A;  5FFZ A;  3JAM K;  1LNW A;  2KRC A;  4BHB A;  1IN7 A;  4BAC A;  5JLW A;  2QQ9 A;  4FT8 A;  2OF7 A;  3C7J A;  4E7Z A;  3QAH A;  2GIV A;  4RMN A;  3U2R A;  4EM1 A;  1N25 A;  2QM3 A;  2A68 F;  2IGO A;  3G1O A;  1W7P B;  3JTH A;  3DV8 A;  2ZSH B;  2LDU A;  5DM7 F;  2P0W A;  3LQQ A;  3I56 I;  1YJ9 I;  5DS9 A;  4G7O F;  1YS7 A;  3HKZ A;  2ECC A;  2LLK A;  4DYQ A;  4X0G A;  1E17 A;  2B0L A;  5CVR A;  4HV5 A;  3REO A;  2GAU A;  2EIL H;  5CJ9 A;  4GO1 A;  1HDP A;  1XDU A;  2B9S A;  3VYR B;  3A2K A;  2E1M B;  1XMK A;  3TKY A;  2ISZ A;  3GVA A;  2CO5 A;  3JRI A;  5C4X J;  5JHF A;  3F3X A;  3BJA A;  5M3M J;  2CMP A;  4IF4 A;  5IPA A;  2L7M P;  2ZXJ A;  1J59 A;  3ASO H;  2EV5 A;  1HLV A;  3MN2 A;  1X1P A;  2YUS A;  4AU7 A;  1KQ9 A;  3AG2 H;  4XRM A;  1RET A;  3B73 A;  4UUT A;  1H8A C;  5J47 A;  3QOP A;  3TED A;  1UG0 A;  1YX3 A;  3F8F A;  1T56 A;  4IEJ A;  1SD6 A;  2DFH A;  3IH2 A;  4WF2 A;  5IOY A;  4D7N A;  3K4J A;  1IRX A;  1GV5 A;  2DLL A;  2ELK A;  3CUO A;  1NTC A;  3HOT A;  4PSW A;  1X1A A;  3GCM A;  1K6O A;  1U6G A;  1QRY A;  4RB0 A;  2QLZ A;  3DTE A;  4ZYE A;  3SDG A;  2HXO A;  2BY3 A;  1ETV A;  4BXX J;  1UEL B;  2HYG D;  1MMD A;  3S3O A;  2RC4 A;  5AIQ A;  3KP3 A;  4DZP A;  2KPM A;  4NDL A;  5LGU A;  1BBY A;  3DBR B;  3WTT C;  3TDZ C;  2CUJ A;  1GHC A;  2ZNY A;  4EM0 B;  1UMQ A;  3GBG A;  3QPS A;  3DEU A;  2MA3 A;  4NB5 A;  2AQF A;  2DFI A;  2PBI A;  4YG2 F;  2DT5 A;  1KU3 A;  3AG1 H;  3NQO A;  2DJI A;  2IW5 A;  1QBJ A;  2FNA A;  3BCA A;  5D8K B;  1G2H A;  2R7F A;  3KET A;  1QHG A;  1VI0 A;  4JX6 A;  5FD6 A;  3CUQ A;  3GUD A;  2NOG A;  3QYB A;  1ZG1 A;  1EJ9 A;  2V26 A;  3R61 A;  5DUI A;  2ECB A;  3RSN A;  2FBK A;  2P6S A;  4E7K A;  4Y4R A;  3CD6 I;  5CVI A;  3GTM J;  1MMG A;  2DK5 A;  4XK4 A;  5KHD A;  1JJ6 C;  2EFN A;  4EVI A;  2NRA C;  2X0L A;  3JRC A;  2X6W A;  4AWX B;  2MYS A;  3LSH A;  3ABT A;  2JA6 J;  4Q4Z F;  3ZXS A;  1USS A;  3V42 A;  1S8N A;  5F64 A;  1KZH A;  1HDD C;  1E3H A;  3DF8 A;  1G3Y A;  2FMY A;  1R58 A;  1V3F A;  4AVP A;  2BXY A;  1W0T A;  2H8R A;  4G6Q A;  1BC7 C;  2KL4 A;  3FIW A;  3A4C A;  3LSI A;  3RYP A;  3ZPL A;  2HZD A;  4ZDL A;  4C30 A;  4FCY A;  4FAS D;  2MH2 A;  1JUM A;  1ZLJ A;  3O6B B;  2OZ6 A;  2IS2 A;  5DV5 A;  2ZNZ A;  3R0A A;  5B1B H;  1AWC A;  2IA1 A;  1IRZ A;  2XGD A;  3K4L A;  1FYL A;  1XD7 A;  3GTG J;  3IAS 2;  2VQH A;  5JFR A;  3WTX C;  1G3W A;  1FSE A;  3FBI B;  4Z2Y A;  3CMM A;  1BR4 A;  2Z99 A;  2E1C A;  1I27 A;  3TBI A;  4IJA A;  4Y3O A;  5H6R A;  1D1A A;  4XKW A;  3VB2 A;  4A93 J;  1UHW A;  1ZRD A;  1V55 H;  1OIS A;  3Q0W A;  3S1Q J;  2EA4 A;  5FKN A;  3CCS I;  4A3J J;  2M34 A;  2XF5 A;  4I99 C;  2QQB A;  2VJ5 A;  2EJR A;  3P9I A;  1V4R A;  4DBQ A;  2E1N A;  3O8H A;  5CVV A;  1ZAO A;  4M3D A;  4U87 A;  2M8E A;  1SVL A;  1OFC X;  4CZC A;  1R5G A;  1R23 A;  4BGD A;  1TBX A;  2LRE A;  1VQ6 I;  2W24 A;  1IO2 A;  5J3L A;  3RKY A;  2JJ7 A;  1FX7 A;  2M0C A;  4XOT A;  1P92 A;  2DT7 B;  4UV9 A;  2EIM H;  2DMT A;  4HOB A;  3OIQ A;  2ME0 A;  1T8I A;  4CA0 A;  4ZZL A;  4U0Y A;  3L2U A;  3K9T A;  2ZME B;  4XM3 A;  3GME A;  2LKP A;  2PX9 A;  1GT0 C;  1MDM A;  3EUA A;  4YFN F;  3GXO A;  1JKR C;  2DXI A;  3WU1 B;  3Q0U A;  5IT9 Z;  2ISY A;  4G94 A;  3ECO A;  1LFP A;  2WB1 A;  3D5R C;  3ECH A;  5HS9 A;  3WHB A;  1SVO A;  3RPQ A;  2FQ4 A;  1NHA A;  3EUH C;  3KEO A;  3MZH A;  2E71 A;  2L7F P;  3K4M A;  4XOR A;  4J00 A;  2VJJ A;  1FY7 A;  5IT3 A;  5L3E A;  5FKM A;  4MQ9 F;  1O7L A;  2W4S A;  3N97 A;  3FXO A;  4IXA A;  1HXD A;  3PO3 J;  2E35 A;  4XKB A;  4HF2 A;  1JI8 A;  3F6V A;  4FQG A;  3VDX A;  3SHF A;  2A69 F;  1W4M A;  1IXR C;  2PMZ A;  2ZXI A;  4HQE A;  3E7L A;  5LEJ A;  1Y6I A;  1T95 A;  4FIS A;  2L5Q A;  3DEE A;  1XSX A;  4C9Y A;  4RA2 A;  3TQN A;  1WJE A;  5E8G A;  4IOA F;  4L0Y B;  4ON0 A;  5LRR A;  2MW8 A;  1MBF A;  4EEF G;  5A2Q Z;  4ZC3 A;  2JTV A;  1RUO A;  3R4K A;  4JK1 X;  2UV1 A;  2QF7 A;  5GTH C;  4CIC A;  5FRO A;  2VPR A;  3GLX A;  4N9I A;  5D5X B;  3L9F A;  2OJE D;  2CUE A;  3L2V A;  2VJ4 A;  3H3V K;  4L9T A;  5LBQ A;  2LMD A;  2EZI A;  4C2M J;  2PG4 A;  1IXS B;  4EJW A;  2NVU B;  5DCM B;  3I58 A;  4A3K J;  4B4C A;  1MJ9 A;  2CUF A;  1QZZ A;  1XG1 A;  3HBL A;  5LHH A;  1GDT A;  4XLH A;  2R5Z A;  1R5I D;  2W1O A;  3J81 K;  4YEJ A;  2QBY A;  3FXL A;  1KU7 A;  3DCF A;  3JSO A;  3RZD J;  3J7Y J;  5DDG A;  1W5S A;  4DJA A;  2R7O A;  1LE8 B;  1C0W A;  4F55 A;  1IRG A;  2O6G E;  4RDU A;  2F2E A;  2EH3 A;  3WTV C;  1WZ2 A;  3LSG A;  5D5V B;  5EEH A;  2F5F A;  4I2O A;  1XGM A;  2LBF B;  4UXN A;  1U78 A;  2K9M A;  5HLT A;  4HBL A;  3MKL A;  2V4J C;  3CMY A;  1ETY A;  1A36 A;  2L2O A;  2PJR B;  2K86 A;  2FOK A;  2DTR A;  3H9J A;  5DD4 A;  5EGO A;  1DDN A;  3BTC A;  3DPT A;  1IZ1 A;  2LY9 A;  2XAU A;  3HKZ N;  5FJ8 J;  2X1C A;  1F36 A;  2XPU A;  2P5L C;  2NAZ A;  3S14 J;  4KIC A;  1IN8 A;  1Z77 A;  4DGW B;  2PFB A;  3ZP5 A;  3B02 A;  1ZRE A;  1R7J A;  3ABK H;  2DOF A;  4GYI A;  2YR2 A;  4M71 A;  4A3M J;  2R7U A;  2VKH A;  1X19 A;  2A6E F;  4CXF A;  5HNH A;  2DI3 A;  2L7Z A;  5FLM J;  4XN3 A;  2EK5 A;  2H27 A;  4YEL A;  3GTP J;  2NS7 A;  2WTE A;  4Y13 A;  2FRH A;  2FX0 A;  2DO7 A;  5IYB J;  3HOV J;  2HYF A;  2VAS A;  2VLA A;  1JGS A;  1LVK A;  4YIR X;  3IKT A;  2M30 A;  1DU0 A;  5KCM A;  3WHC A;  1QVU A;  2ADU A;  1F9N A;  2R7Z J;  2JVH A;  5HDK A;  4LB5 A;  2IAI A;  3VWB A;  1WWX A;  3RPU D;  3LSP A;  3AL0 B;  2KDZ A;  3HSR A;  4A3B J;  1QU3 A;  1JE8 A;  2E2I J;  2L4A A;  4FTH A;  2E19 A;  1T33 A;  4AID A;  1Z9C A;  1F4K A;  3OS1 A;  1WVR A;  5BNG A;  3CCL I;  4OMZ A;  4ZJZ A;  1VQK I;  2XDV A;  3J7A Y;  4XBF A;  4NBQ A;  3GTK J;  5CYV A;  2CQX A;  1GVJ A;  1U5T C;  3K6G A;  1AKH B;  3Q5F A;  2HNH A;  2Y30 A;  3ZQF A;  3N4M A;  2FXA A;  2WC2 A;  3PQJ A;  2UXX A;  1DP3 A;  2JA8 J;  5H6Q A;  5IY5 H;  3D1N I;  2K85 A;  2FBH A;  1E3O C;  3IHU A;  2CFO A;  2ZFU A;  4XIC A;  3OYF A;  4BQO A;  2K40 A;  1I50 J;  1SAN A;  2LYC A;  5B3S H;  4M6X A;  1Z7U A;  2QGU A;  4M74 A;  5DYM A;  3M3Y J;  5FO5 A;  2ZME C;  1ON2 A;  4EV0 A;  2NVX J;  1ACI A;  5E1Z B;  4D5F A;  1K7A A;  5BPI A;  3DKY A;  4MO7 A;  1MMA A;  2X48 A;  4PJL A;  2Q2E B;  1TNT A;  2F4M B;  2LTP A;  3DP7 A;  2X6O A;  4HNV A;  2X6Y A;  2O8K A;  3E1S A;  5E20 A;  1H0M A;  3E3V A;  1XCB A;  1IDZ A;  1PVE A;  2GXA A;  3PUB A;  3JRA A;  1DPR A;  5LGT A;  4LLN A;  2XAF A;  4IHV A;  3IWF A;  4N4N B;  3OYN A;  2W57 A;  2Q1Z B;  2OV7 A;  3CES A;  3CUQ B;  4MLO A;  4JYK A;  1S7A A;  4BJT A;  3CC4 I;  5GAH J;  4KIG A;  1VQ9 I;  2QWW A;  3RYR A;  4BKX A;  4DBR A;  2K02 A;  2ZO4 A;  3M07 A;  5FLX Z;  1R71 A;  2M2E A;  3E6D A;  3I4N J;  3QYF A;  2V9K A;  3S32 A;  3K1N A;  4DZJ A;  2BGC A;  4JP0 A;  1LVA A;  1XS9 A;  1G59 A;  3JR9 A;  1ZHF A;  4BYY A;  1J75 A;  2BY0 A;  2O9L A;  1G8X A;  1N77 A;  1RNL A;  5IYC J;  2DBB A;  1FMW A;  1Y8R B;  3KP4 A;  4ZDO A;  1P4W A;  3COA C;  1FBQ A;  2P7V B;  1ZKG A;  4B09 A;  2R5Y A;  2KQR A;  1UAA A;  2W84 A;  2EB7 A;  5K5R A;  2JQ7 A;  3S93 A;  3E5U A;  2VJI A;  4C3J J;  3HB9 A;  3E6C C;  1MNE A;  2NS8 A;  3OYC A;  1YHQ I;  4WXD A;  2FD5 A;  4GFB A;  2JMW A;  5CVJ A;  1BI0 A;  4KDP A;  2YU9 J;  2XB5 A;  1YIT I;  3P7N A;  3GF2 A;  4RM3 A;  1LQ1 A;  1G6N A;  4M3G A;  5B5E C;  2B7E A;  5GAE J;  2JPC A;  3E6M A;  5E3N A;  3K70 C;  1YX5 A;  1FOK A;  2VC1 A;  1Y8Q B;  3O8G A;  4ESF A;  1V54 H;  2L3D A;  2V1D A; 
#chains in the Genus database with same CATH homology
 1VFC A;  5DS9 A;  1JT6 A;  2DMQ A;  1P7J A;  2ECC A;  4Y52 J;  2LLK A;  4DYQ A;  1JUP A;  1P7I A;  3RQI A;  4XRS A;  1ETQ A;  2MGQ A;  1HDP A;  2IBD A;  4A3C J;  2WB1 N;  2LFB A;  1ZR2 A;  3A03 A;  5IYD J;  2CRG A;  5K7Z A;  4A3I J;  2Y31 A;  3JRI A;  5C4X J;  5M3M J;  5IPA A;  2L7M P;  5F0C A;  5F1J A;  3JRE A;  1HLV A;  1U9O A;  1SFO J;  1RKW A;  3MN2 A;  2DA7 A;  2YUS A;  1HCR A;  2HQ5 A;  5M5W J;  2JN6 A;  4XRM A;  1RET A;  4UUT A;  1H8A C;  1FJL A;  3TED A;  1W0U A;  1T56 A;  4IEJ A;  3L1P A;  1Q1V A;  3IH2 A;  5F27 A;  5IOY A;  4CYC A;  5JLX A;  4D7N A;  1WGX A;  1JTY A;  4RBO A;  1IC8 A;  1MSE C;  1GV5 A;  2PMZ N;  1HF0 A;  2ELK A;  1NTC A;  4M3E A;  3S2H J;  2NVY J;  3DEW A;  3Q0V A;  1QPI A;  1QRY A;  4I6Z A;  3BG9 A;  1MBK A;  3ZQI A;  3SDG A;  1K61 A;  1BA5 A;  2HXO A;  2VKE A;  1ETV A;  4BXX J;  2LVS A;  5EZH A;  3G1M A;  5IOZ A;  1LFU P;  2XB0 X;  1MBH A;  1BW6 A;  4M6V A;  4DZP A;  2D5V A;  5J1R A;  2CU7 A;  4NDL A;  2H1K A;  2B63 J;  2K9N A;  4FE7 A;  5M5Y J;  3OSF A;  1UMQ A;  3GBG A;  3BTJ A;  3QPS A;  3VPR A;  1AHD P;  4W97 A;  1B8I B;  3HOX J;  3GTJ J;  4MFD A;  4A3E J;  1G2H A;  1VND A;  5J1Y A;  1VI0 A;  4BBR J;  4JX6 A;  4M3F A;  4QIW N;  2MG4 A;  1ORK A;  2NOG A;  2DA2 A;  3JRB A;  2ECB A;  1WPK A;  2DJN A;  3BQZ A;  4I76 A;  1Y1V J;  3GTM J;  4MIM A;  3A01 A;  3HOZ J;  2HOT A;  4BBS J;  2XPW A;  4XK4 A;  1JJ6 C;  3B6C A;  1Z0X A;  5F0H A;  5E3O A;  3QPL A;  1X2M A;  4IHX A;  3JRC A;  3GTQ J;  1CQT A;  1OCP A;  1YRN A;  2QCO A;  2IEK A;  2JA6 J;  5K7H A;  1HDD C;  4S0H B;  3ZQG A;  1UG2 A;  2H8R A;  1W0T A;  2W48 A;  2HDD A;  3FIW A;  1RES A;  1ETW A;  1ETK A;  4FCY A;  2XGE A;  1A6I A;  1JUM A;  3BTI A;  1H89 C;  1VF9 A;  2L9R A;  2DTZ A;  3HEF A;  4D5C A;  1JJ8 C;  2Y2Z A;  3HM5 A;  2XGD A;  4ABZ A;  1RPW A;  1ZK8 A;  4X6A J;  3GTG J;  3NAU A;  3IH4 A;  4D7M A;  4XID A;  1Y1W J;  3S1M J;  5FKL A;  3CQZ J;  3PM1 A;  5E3M A;  4B3A A;  1R9T J;  2P81 A;  3BTL A;  4A93 J;  1TWC J;  1I6H J;  5EGO B;  5IP6 A;  3Q0W A;  3LSJ A;  3S1Q J;  4UUS A;  2AHQ A;  2DA6 A;  1ENH A;  5FKN A;  4A3J J;  2COB A;  2M34 A;  4B1R A;  1MBE A;  2G0E A;  3Q3S A;  3O8H A;  2DA4 A;  4M3D A;  4M3B A;  3HOW J;  1IRZ A;  3B6A A;  5K7F A;  1OFC X;  1POG A;  3HGG A;  3HGY A;  1X58 A;  5J3L A;  2JJ7 A;  2M0C A;  2L0K A;  1BJZ A;  3BG5 A;  2O7O A;  1LFB A;  2CQQ A;  2DMT A;  3LNQ A;  2JA5 J;  2EBI A;  3JRH A;  2M9H A;  4V2F A;  2ME0 A;  2Y0S N;  2LK2 A;  3HDD A;  1TWA J;  3JRD A;  2ID6 A;  1GT0 C;  1JKR C;  1TWG J;  3Q0U A;  5HOD A;  2X9D A;  5C4J J;  3WHB A;  2XSD C;  1GVD A;  3BR3 A;  2FQ4 A;  4FE4 A;  5M5X J;  2L7F P;  2VI6 A;  1XC5 A;  5FKM A;  5GPC A;  2EZH A;  3PO3 J;  2HOS A;  3QQA A;  4A69 C;  2E1O A;  2EZL A;  4G12 A;  3UKG A;  2DMP A;  1WI3 A;  1ITY A;  3E7L A;  3K2A A;  4FIS A;  2FJ1 A;  2R93 J;  3CDL A;  3A02 A;  1RKT A;  1O4X A;  3S15 J;  5IP9 J;  2LKX A;  1B8I A;  2MW8 A;  2RAE A;  1MBF A;  3CCY A;  4BY7 J;  4EEF G;  3HOY J;  4W1U A;  2XRL A;  2MSY A;  2ID3 A;  1BL0 A;  2QF7 A;  1JUS A;  5M3F J;  2VPR A;  1JKP C;  1BW5 A;  3S1R J;  1MNM C;  2LP0 A;  1NK3 P;  2CUE A;  3TP0 A;  3H3V K;  1D5Y A;  1MH4 A;  2EZI A;  1JTX A;  4C2M J;  4QTR A;  3BR5 A;  2M8G X;  3FK6 A;  5GP9 A;  3W6V A;  2R5Z B;  1K83 J;  1WH5 A;  2DA3 A;  4B4C A;  4A3K J;  2CUF A;  4IHY A;  1XG1 A;  3HBL A;  3MVP A;  1GDT A;  2TCT A;  3S17 J;  2R5Z A;  3LOC A;  4AC0 A;  2EZK A;  5EEA A;  3DCF A;  3BR1 A;  2DA5 A;  2R0Q C;  3ZQC A;  2XGC A;  3RZD J;  4L5E A;  1LE8 B;  4A3L J;  1X2N A;  4JX5 A;  1TWF J;  4RDU A;  2JK3 A;  3S2D J;  2EH3 A;  3LSG A;  1U8B A;  5FLV A;  3TW6 A;  1UHS A;  3FKI J;  1IGN A;  1U78 A;  3F0C A;  3GTO J;  2GBY A;  1RR7 A;  3MKL A;  1ETY A;  3CMY A;  1H88 C;  2K9Q A;  5EGO A;  5C3E J;  3BTC A;  5EZG A;  2LY9 A;  3HKZ N;  5FJ8 J;  1F36 A;  2XPU A;  2HI3 A;  3RZO J;  1GV2 A;  3BQY A;  1IV6 A;  5DTD A;  3IH3 A;  3S14 J;  1Z77 A;  4AUX A;  2XPV A;  3ZOB A;  4A3M J;  3JRF A;  1FTZ A;  1I3Q J;  2L7Z A;  5FLM J;  3ZQH A;  2LD5 A;  2DMN A;  2JA7 J;  4JX4 A;  3GTP J;  1TC3 C;  2NS7 A;  3FK7 A;  4MFE A;  5C44 J;  1JGG A;  2FX0 A;  5IYB J;  2EQR A;  5EF6 A;  4J19 A;  3HOV J;  2VUM J;  3PO2 J;  3FIS A;  4QSH A;  1MH3 A;  3ZQL A;  1DU0 A;  3WHC A;  1QVU A;  1JKQ C;  5EG0 B;  3IV5 A;  2R7Z J;  4DW6 A;  1FTT A;  5E3L A;  1MBJ A;  2IAI A;  3HOU J;  3LSP A;  1NK2 P;  2KDZ A;  2LR8 A;  4A3B J;  5EG0 A;  1S7E A;  1F43 A;  2E2I J;  3SFI A;  3OSG A;  4FTH A;  2E19 A;  1T33 A;  2OPT A;  1ETO A;  1JKO C;  3SJM A;  1MBG A;  5BNG A;  2JWT A;  1U9N A;  3GTK J;  3BG3 A;  2CQX A;  4Y7N J;  1AKH B;  2Y30 A;  3ZQF A;  3BR2 A;  1B72 B;  4CYC B;  1ETX A;  5FKK A;  2JA8 J;  4XRS G;  1AKH A;  5EYR A;  4LOC A;  5EDN A;  3D1N I;  1HOM A;  1B72 A;  1E3O C;  2E2J J;  5J1U A;  1FEX A;  2HYJ A;  2ME6 A;  4XIC A;  1IDY A;  3K7A J;  2I10 A;  2R92 J;  2DN0 A;  1I50 J;  2K40 A;  4V2G A;  1SAN A;  1WH7 A;  1ZTR A;  3M3Y J;  2VKV A;  2Y9Z A;  1ZGW A;  2NVX J;  4X1E A;  5F0F A;  1IUF A;  4A3G J;  4D5F A;  2TRT A;  4MO7 A;  3S16 J;  2N8G A;  2X48 A;  3H0G J;  3BR0 A;  3GTL J;  3G1L A;  3NAR A;  1QVT A;  1OCT C;  2LTP A;  2ZB9 A;  3M4O J;  2X6O A;  4HNV A;  2O8K A;  2WAQ N;  1FIP A;  2DMU A;  1IDZ A;  3JRA A;  2E2H J;  3BR6 A;  1WCM J;  2WV1 A;  5F04 A;  1APL C;  4IHV A;  3S1N J;  3LSR A;  2NVT J;  5IP7 J;  5FKO A;  3C2B A;  4MLO A;  1TWH J;  1ZR4 A;  3TP3 A;  4JYK A;  3BT9 A;  4C3H J;  4BKX A;  3A01 B;  1DU6 A;  2Y9Y A;  3TW7 A;  2M2E A;  3I4N J;  4DZJ A;  1EF4 A;  4JP0 A;  1XS9 A;  5F08 A;  1YRN B;  3JR9 A;  4DYC A;  1PUF B;  1MSF C;  1ZQ3 P;  4A3F J;  4DYR A;  1LE8 A;  2GM4 A;  2O9L A;  1IG7 A;  4A3D J;  1GUU A;  3RKQ A;  2CJJ A;  5IYC J;  2R5Y B;  1IJW C;  4BY1 J;  1PUF A;  1FIA A;  1ZKG A;  2AO9 A;  2R5Y A;  1JT0 A;  1A5J A;  1OJL A;  2GLO A;  3OOU A;  2HXI A;  5GPA A;  1AU7 A;  4C3J J;  3HB9 A;  2NS8 A;  2NVQ J;  2FD5 A;  4GFB A;  2K9S A;  2JMW A;  2HOA A;  2YS9 A;  2KT0 A;  2YU9 J;  4AYB N;  2XB5 A;  3I4M J;  5JLW A;  4M3G A;  2OF7 A;  3JRG A;  2DA1 A;  5E3N A;  4IHW A;  4UUS B;  3OIO A;  3O8G A;  3G1O A;  9ANT A;  4C3I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...