3PO3J

Arrested rna polymerase ii reactivation intermediate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3po3J00
1IDZA 2GLOA 4C3HJ 1PUFB 2G0EA 4D7MA 3D1NI 5J1UA 1P7IA 3BTJA 3WHBA 3PO2J 4MO7A 2N8GA 4A3JJ 1Y1WJ 5IP9J 1Z0XA 2R92J 1HLVA 3UKGA 1UG2A 4JX5A 2EZLA 1IDYA 5M5WJ 2YUSA 1IGNA 3JRFA 1ETYA 4MLOA 2ID6A 1JJ6C 2DA3A 1B72B 1ITYA 4DW6A 3ZQFA 3LSRA 2VUMJ 1A6IA 3HBLA 1I3QJ 2DMNA 1RESA 2DMTA 2GM4A 3ZQIA 3SDGA 2Y0SN 3WHCA 2LKXA 1BW6A 5EZHA 4DYCA 4XK4A 1MNMC 1ETOA 2GBYA 1JUPA 4IHWA 5EEAA 2Y9ZA 1JKRC 2ECCA 2YU9J 3TEDA 4W1UA 1FIPA 4D5CA 5FKOA 5J1RA 4V2GA 3BTCA 3TP0A 3JRIA 2NS8A 1YRNB 2FX0A 1JTYA 2X48A 3RQIA 2DA6A 1GV5A 3Q0WA 4ABZA 1RETA 3JREA 3JR9A 1ZGWA 1MH3A 4M3GA 4BBSJ 4XRSA 1UMQA 4Y7NJ 9ANTA 1FTZA 2E2HJ 2M0CA 3BR6A 2OF7A 3HEFA 3ZOBA 3OOUA 5EG0A 3PO3J 4CYCB 2XRLA 2D5VA 1H8AC 5GP9A 1MBEA 1JT0A 2DMQA 4BY1J 2L7MP 1U8BA 2VKEA 5EDNA 1QVUA 2VPRA 1IG7A 2L0KA 4M3BA 3L1PA 2L7ZA 3S16J 3SJMA 1X2NA 5IOYA 3A03A 2DJNA 3E7LA 3QQAA 1BL0A 3GTMJ 1HOMA 1W0TA 3I4NJ 2AHQA 2LVSA 1Z77A 1JKPC 3G1OA 2FJ1A 5FLMJ 2O8KA 1YRNA 4A3EJ 1K61A 2DN0A 1B8IB 2IBDA 1LFBA 4I76A 2LTPA 4M6VA 4AYBN 3HOUJ 2NVQJ 5F0CA 2XSDC 2K40A 1ETXA 3HB9A 2HOAA 1JJ8C 3I4MJ 1ZK8A 2ID3A 5DTDA 5FKNA 4D5FA 3DCFA 1GVDA 3CDLA 1ETQA 4AC0A 3BQZA 1QVTA 3GTOJ 2HDDA 4DZJA 3GTPJ 2LK2A 4A3GJ 1JKQC 4QSHA 5JLWA 4DYQA 1UHSA 2R93J 2JA5J 4A3LJ 4XRMA 5IP7J 4W97A 3A01B 2IAIA 5K7FA 3JRDA 1TWAJ 3JRBA 4FTHA 2WB1N 3Q0VA 4J19A 1B8IA 1XC5A 1A5JA 1AU7A 4GFBA 3BR0A 1F36A 2LFBA 5IPAA 3C2BA 2XGDA 4XRSG 5E3MA 2NVXJ 2DA7A 3FK6A 1LE8A 5K7HA 4JX4A 2EH3A 3MN2A 1GDTA 4B4CA 2TRTA 4XIDA 2ME0A 2K9SA 1TWGJ 2MSYA 2LD5A 3BTLA 2DA2A 3G1MA 1MBHA 5M5XJ 1MSFC 2PMZN 4XICA 1NK2P 1VF9A 2COBA 3BR5A 1O4XA 4IHXA 5EZGA 1VFCA 3K2AA 3S1MJ 4BXXJ 5F08A 3BT9A 4C2MJ 1MBKA 3B6AA 3IH4A 2B63J 2Y9YA 4IHYA 1HF0A 2HI3A 3JRGA 5JLXA 4DZPA 2JK3A 1PUFA 1S7EA 2CQQA 2MGQA 1SFOJ 5K7ZA 4A3DJ 5GPAA 1I6HJ 1POGA 2Y31A 1T56A 5EGOB 1FTTA 2JJ7A 4RDUA 4UUTA 1TWHJ 2TCTA 2ECBA 5C4XJ 3BR2A 2ELKA 5FKLA 2WV1A 3M4OJ 2EBIA 2JMWA 4L5EA 1Y1VJ 2DA1A 3TW6A 3JRAA 1OFCX 1G2HA 2EQRA 1B72A 4V2FA 2KT0A 1BW5A 4C3JJ 2DA4A 1ZKGA 3BR3A 3ZQLA 2JA6J 1E3OC 2VI6A 3NARA 1RPWA 1ZTRA 4MFDA 1W0UA 2CQXA 2XGEA 1ETVA 3HOYJ 1JKOC 1MSEC 3IH2A 1TWFJ 3IH3A 1BJZA 3S14J 2R5YB 1T33A 1U9OA 2JWTA 2E2IJ 3B6CA 1AKHB 2IEKA 2R5ZB 4RBOA 2Y2ZA 2R0QC 1QPIA 1FEXA 5M3MJ 3LNQA 1MBGA 4M3EA 5EGOA 1IRZA 3F0CA 2EZIA 2DTZA 1ZQ3P 2R7ZJ 4JYKA 2YS9A 4A3KJ 3QPLA 4FISA 2WAQN 1VNDA 3Q0UA 5C3EJ 3G1LA 3S2HJ 4JP0A 3RZDJ 3LSJA 1OCTC 1K83J 1H89C 1U78A 2E19A 2NS7A 1MH4A 2LY9A 4CYCA 1ENHA 3BTIA 4B1RA 1H88C 1WGXA 3W6VA 1APLC 5F27A 5E3OA 2XPVA 2R5YA 1GV2A 1X2MA 1R9TJ 1QRYA 2VKVA 1FJLA 2R5ZA 2K9QA 1IUFA 3H0GJ 4FE4A 3GTQJ 2O9LA 2P81A 1NK3P 1TWCJ 3BR1A 2LP0A 1WCMJ 5BNGA 3S1QJ 3CCYA 3GTGJ 4UUSB 1Q1VA 2HXIA 1RKTA 2I10A 1HCRA 1RR7A 2JN6A 3MKLA 2HOTA 1TC3C 2HYJA 5J1YA 3TP3A 1RKWA 1DU0A 3HGGA 5IYCJ 5FKKA 5EYRA 2NVTJ 1XG1A 4A3FJ 2W48A 4A93J 2X9DA 1EF4A 4A3IJ 4EEFG 2K9NA 5EF6A 2AO9A 3IV5A 2XGCA 1VI0A 2XPUA 2H8RA 1AHDP 2LLKA 2XPWA 3S15J 2QF7A 3ZQGA 1IC8A 2ME6A 3SFIA 4X6AJ 1WH5A 5C4JJ 1ZR4A 5IYDJ 3FKIJ 3A01A 2EZHA 3LSGA 1MBJA 2CJJA 4M3FA 5GPCA 3JRCA 3OIOA 2O7OA 5IOZA 1OCPA 4MFEA 3DEWA 2CU7A 3Q3SA 2HXOA 3TW7A 3RZOJ 4UUSA 1JUMA 3HGYA 4FCYA 1HDPA 4IEJA 3BG9A 5EG0B 4JX6A 5F04A 4G12A 3LSPA 3HOVJ 5DS9A 3RKQA 3FISA 1CQTA 3A02A 5F0HA 3JRHA 5FKMA 3S17J 3GTLJ 4BKXA 2XB0X 2E2JJ 3CMYA 4QTRA 4Y52J 1OJLA 1GT0C 3NAUA 3FIWA 3OSGA 1NTCA 5FJ8J 2L7FP 1DU6A 1JUSA 3GTJJ 5J3LA 3ZQHA 4NDLA 3ZQCA 1WPKA 4QIWN 1F43A 2H1KA 2X6OA 4M3DA 3GBGA 2HOSA 1WI3A 3MVPA 4A69C 2CUEA 2XB5A 1BA5A 5F1JA 2DA5A 2HQ5A 3BQYA 3S1NJ 1X58A 1IV6A 5M3FJ 4AUXA 4S0HB 4C3IJ 2CUFA 2M8GX 2M34A 4MIMA 1ETWA 1HDDC 4I6ZA 2RAEA 1JT6A 4A3CJ 1U9NA 5HODA 2JA8J 2L9RA 2KDZA 5FLVA 1WH7A 2EZKA 2ZB9A 5F0FA 4A3MJ 4A3BJ 4IHVA 4FE7A 3HOWJ 3H3VK 1ETKA 3BG5A 2CRGA 1D5YA 2FD5A 2QCOA 3VPRA 3LOCA 2OPTA 2DMUA 4D7NA 3OSFA 1JTXA 1IJWC 1SANA 3HDDA 2NOGA 2LR8A 1ZR2A 3S1RJ 1AKHA 5M5YJ 3HKZN 1ORKA 3PM1A 3K7AJ 2M2EA 3HOXJ 2FQ4A 1JGGA 3O8GA 1LE8B 3HM5A 2NVYJ 3BG3A 2E1OA 4HNVA 1P7JA 3FK7A 4BBRJ 4LOCA 3S2DJ 3CQZJ 3M3YJ 2JA7J 3HOZJ 5C44J 2M9HA 2DMPA 1XS9A 5IP6A 5E3NA 1LFUP 3GTKJ 2Y30A 1MBFA 5E3LA 4B3AA 4X1EA 1FIAA 2MG4A 4DYRA 1GUUA 1I50J 3O8HA 3QPSA 2MW8A 4BY7J 5IYBJ
chains in the Genus database with same CATH superfamily
1ZRFA 1ON2A 1OLTA 3OYLA 4WWCA 4CCOA 3WODF 3GYHX 3EUKL 1ZG3A 2BHZA 2RGVA 3D1NI 1X3ZB 4UVAA 2F4IA 3G3ZA 4A0YA 4XQFA 2CUZA 1KU7A 1BN5A 4FX4A 4MQ9F 5JR3A 2VIXA 2DQRA 3VSKA 2GAUA 5IP9J 1O57A 2R92J 1IF1A 2ZSIB 2EZLA 2K4JA 1Z6TA 5M5WJ 2PMUA 1G8XA 4O3MA 3FZVA 1MGTA 3CJRB 1JJ6C 2ID6A 2M7BA 3KEYA 1X1BA 1ITYA 4XBFA 3K4NA 3ZQFA 4DW6A 1U8RA 3FWEA 1NG6A 2DDAA 4XNFA 3S2WA 3MKWB 1BR2A 4B3XA 4A5MA 1WJCA 2MA3A 2GM4A 1S7AA 3SDGA 3TO7A 2LKXA 2R7SA 3H9JA 4PDKA 2GBYA 3DFGA 3V8JA 4KMFA 2DPDA 2Y9ZA 1QBJA 3BP8A 3MKZA 2YU9J 3M8FA 5ERIA 3CUQC 3TEDA 2FSWA 4D5CA 4KJZA 3WTWC 3JRIA 4PGHA 4BU2A 1JI8A 3H5NA 2VQHA 1IXCA 4KMUX 1I1SA 3DWLE 2DA6A 2QM3A 1GV5A 3F72A 3Q0WA 4XLCA 2NVUB 3JR9A 3ZCOA 1ZGWA 4CGZA 2F6CA 3KYLA 4YIIA 3IKVA 2EJRA 3WU0A 2M0CA 1B4AA 4CH7A 5L3DA 5FFZA 2LNBA 1TNSA 3SHFA 3JAMZ 1U6GA 4Y13A 1H8AC 1ZELA 3BPXA 2K3FA 2VL8A 3TDZC 1MMSA 3ASNH 3HPGA 4R79A 3L2UA 5EDNA 4NBQA 2VPRA 5IT3A 4BGDA 2L0KA 4XM3A 4Q47A 4G9YA 2UXNA 3E7LA 4IJAA 3N05A 2A68F 3TOBA 1HOMA 1TL8A 1KQ8A 3MWMA 3CLOA 3FXLA 1BI0A 3G1OA 3DP7A 3FHZA 2F4OB 2L5QA 2KKOA 1LFBA 1U2WA 3OYCA 1RNLA 2XROA 3TO6A 2EIKH 3MKYB 3DKWA 3E6BA 5F0CA 3AG2H 2K40A 2K85A 2VE8A 1JJ8C 3L09A 4Z2YA 1XGSA 4ZDPA 3GZ5A 3AG4H 5IY5H 1HKSA 4O5VA 1Y56A 1HKQA 5BPDA 4P1WA 1R49A 1S7OA 2WTEA 5DCFA 4N4NB 3CDLA 1OISA 2ZNYA 4AC0A 2WAFA 5LFAA 3GTOJ 4M9ZA 4ENNA 3CC7I 4A3GJ 1LEAA 4Y15A 5JLWA 5FB2A 2C6YA 5FD5A 4CZCA 2R3SA 3ZMUA 4ASNA 4DYQA 3D0SA 3IWFA 2WB1A 4JOMA 4A3LJ 4XRMA 4W97A 2BE5F 4OIPF 3CP2A 4CO8A 2XVCA 2FMYA 5K7FA 2KMUA 4MHGA 3K1NA 1BIBA 3OOPA 3RQ4A 4FTHA 1B6AA 1FC3A 2R7TA 1Y8RB 2EK5A 1FBUA 1XC5A 1X19A 3V7SA 3PSFA 2GXBA 2E7XA 4F93B 4IXAA 5ILUA 4CCMA 1F36A 4P9FA 4BNCA 1SFKA 2LFBA 1DQUA 2ETHA 5IPAA 5E3MA 2KPMA 2NVXJ 2DA7A 4QWQA 2NXNB 2WBMA 1D0YA 3DPLC 5K7HA 3MN2A 2PMZA 4ZDLA 2F5FA 1LNWA 2MSYA 2XAFA 2DA2A 2QBYB 2V9PA 1QGPA 3KEQA 1MBHA 4HOBA 1R7JA 5M5XJ 1MSFC 2Z1DA 1S5LC 2L01A 4HF2A 3OL3A 1W5CC 2HTJA 2VQCA 3HOTA 4E7SA 3K2AA 3FDYA 1SMYF 1WKMA 5F08A 2I5UA 1WSUA 3ZMTA 2X6XA 2DU9A 2HI3A 3CC2I 3A0BC 1T0FA 4RGRA 2IA2A 2MLGA 1TQMA 1I6HJ 3MZ8A 3CCSI 1WHUA 2JPBA 2MD5A 1T56A 5AIQA 4Q48A 5EGOB 2JJ7A 2HR3A 4GO1A 4ZTFA 4RDUA 1J09A 3F9KA 3ROUA 2DFFA 3O3KA 2Y69H 1IW7F 3BCAA 3J80K 1CGPA 4CICA 5IT9K 5LHIA 1WQ2A 2JMWA 1V3FA 3K6GA 2EIJH 3Q9VA 4R1HA 3TW6A 3JRAA 2EQRA 2EFWA 4RB0A 4V2FA 1UELB 3QP5A 1A35A 3MZYA 4BE1A 2PJRB 2VASA 2DA4A 2ZMEA 3OMYA 3BR3A 4ON0A 2EINH 2LSOA 5BOXA 1RPWA 1YJ9I 4PSWA 2XDVA 2CQXA 3E3VA 2IA1A 2F5EA 3IH2A 3LA7A 3I56I 5JHFA 2VE9A 2VQGA 4EGZA 2VB6A 3REOA 2E2IJ 2IEKA 3DU5A 2R5ZB 4KISA 2Y2ZA 1FEXA 4M3EA 2LMDA 2VJJA 3G71I 4RLQA 3F0CA 2EZIA 2DTZA 3KETA 5DD8A 2KP6A 5HS9A 5E20A 3ERED 2YS9A 3ONQA 1BBYA 2L54A 1WVRA 4FETA 5BS6A 1PDNC 1JHHA 3QOPA 1EH6A 3F8FA 1OKRA 2FU4A 3G1LA 3S2HJ 5GTIC 3EUHA 2OU2A 3LSJA 1VQOI 1GXQA 3E97A 1XPXA 1N75A 2UZKA 2AXTC 1OQYA 2DBBA 1J75A 3SZPA 1H88C 3N4MA 3SDBA 1APLC 5J8CA 2B7EA 2FNPA 1LJ9A 5TGTA 5HLIA 1QRYA 2M30A 2VKVA 4ZH4F 1FJLA 3OYAA 3HSEA 5FLXK 3OYKA 1LEBA 1W5TA 2ZC2A 3SQNA 1MW7A 2R7DA 3BWGA 3H92A 3P5JA 5E18F 1PVEA 3HJEA 1IRXA 1TWCJ 4BXFA 2LP0A 4BE2A 2MD0A 3GTGJ 4UUSB 5GADJ 1Q1VA 2OJED 5FO5A 1HCRA 1RR7A 1YQAA 2JN6A 3GLXA 1P4XA 3VEPA 2HOTA 2ZJ2A 3GO5A 3KYCB 1DU0A 2LREA 4E6KG 1W4MA 2CG4A 3LSTA 5EYRA 2NVTJ 3A1YA 4ENKA 1EF4A 4A3IJ 1W36C 3RKWA 4NHJA 3KP5A 2K9NA 2H8WA 3ZPLA 2BHYA 2VC1A 3Q9SA 2XGCA 2XPUA 4NB5A 5D5UB 2LLKA 4L18B 3S15J 3ZQGA 1IC8A 3I4PA 3SFIA 3I3LA 1ZR4A 3W3CA 3CF2A 1ULYA 2YX7A 4WXHA 5ILVA 2EA4A 1PJRA 2GWRA 2O03A 1LDDA 4M3FA 4DBRA 1S72I 5DYMA 3OIOA 2B9SA 1OYWA 1YYVA 2CU7A 3L2VA 5LHGA 3W2WA 4IQ4A 2VBYA 4UY8I 3WTYC 1YJNI 2A07F 1TQPA 3LSPA 4HLXA 4S04A 1JGSA 2VOPA 2KDOA 4MQVA 5CJ9A 3LMMA 4FHTA 1R5HA 3LA2A 3FX3A 2XB0X 2GA1A 2NS0A 4G7OF 5KAIC 1GT0C 4E4HA 5K5QA 1FWZA 1QHHD 6PAXA 1DU6A 1YLFA 3K9TA 1X3UA 2X1EA 2HWVA 5J3LA 4AIJA 3QU3A 1FMVA 4AVZA 1J5YA 1U5TA 4G94A 3GFIA 5JVTA 2CUEA 1BA5A 3CUQB 2DA5A 1BI2A 2TDXA 1YITI 2ZNZA 1BR4A 2K4BA 2UUZA 3OWTA 5CQGA 2W84A 5DCMA 2KIUA 2FXAA 3GF2A 1FYKA 2GIZA 3HUGA 3QWLA 2Z16A 1XMXA 1FPQA 3IWZA 1R1TA 1YW7A 1HDDC 4X0GA 1J59A 2RAEA 1JT6A 4A3CJ 4K2EA 2IVMA 1RUNA 5FLVA 1SFUA 5AONA 1TNTA 1PUEE 4A3BJ 2P5LC 2IS2A 4U87A 2QQAA 2ADUA 5CYVA 4ANJA 3BG5A 4CYDA 1STZA 3VPRA 3LOCA 3W6JB 4L5IA 3V8LA 1QNTA 2CH0A 2A61A 4BL0B 1BI3A 2DFIA 2IS1A 2LR8A 1V55H 2FE3A 1ZR2A 1IN4A 1AKHA 3NWTA 5M5YJ 3WE3A 3S8PA 3F21A 3PUFA 2P6TA 5LGTA 4HNVA 2K9LA 1X1CA 4BBRJ 3EETA 4LOCA 2PJPA 3HIFA 4KIFA 5E79C 2XF6A 4I0BA 5C44J 3BZ6A 1YI2I 4CDGA 3QPTA 3SYTA 5IP6A 1HQCA 4IKFA 2Y30A 1MBFA 5F6FA 4KFCA 4B47A 1FX7A 4MTEA 3K4CA 3PQJA 5TISC 4S05A 1O3QA 4HV5A 3ZQQA 3VSLA 2JZYA 4J00A 2EFPA 2MW8A 3RCOA 3S1MJ 1IDZA 2GLOA 2MH2A 2E34A 3H5RA 4IF4A 2W82A 4RMNA 1BC8C 4D0PA 5J1UA 2JSCA 5KCMA 1R71A 4HQEA 3TQNA 3BOQA 3WTXC 3PO2J 4MO7A 1Y1WJ 2L9NA 3OIPA 2W25A 1HKTA 1DGRM 1O7FA 3NWSA 3UKGA 1IDYA 4MEXF 2GXAA 1P2FA 3DPTA 4HNUA 2ELJA 2XF7A 2KISA 4HSRA 1ETYA 3K10A 3V42A 2A05A 3MD2A 1G3TA 1SFEA 4E70A 1F9NA 2D2WA 4EJTA 2DTRA 3C3WA 4RA2A 2Q1ZB 2Y0SA 2VUMJ 1A6IA 2E71A 1OPCA 2V6EA 2K7LA 3PFIA 5GTHC 4HX7A 2YSRA 1FT9A 1RESA 3E6MA 3FXMA 2DMTA 2LY2A 5FRNA 1T8IA 3JTGA 2HPMA 2VXZA 2STTA 1BW6A 3B02A 3K4BA 4XK4A 1JUPA 2DT6A 3K0LA 5B66C 5EEAA 5E8GA 1JKRC 1T38A 2ESNA 1Z7UA 5CVIA 2EFQA 2H1LA 2XIGA 5J1RA 4V2GA 2O5RA 3BTCA 2Z99A 1YRNB 3HYIA 2X85A 4LLGF 1R4NB 2LDUA 3J80Z 4KN4X 1JTYA 5IT9Z 2H27A 3LSKA 3DEUA 4WX9A 3RQIA 4CXFA 4C9YA 1D8KA 5EEHA 1UMQA 4Y7NJ 9ANTA 1XD7A 2XGXA 5E1WA 2IA0A 2OF7A 3HEFA 3I64A 1T08B 3PO3J 2IGKA 4MGRA 2VPLA 3RPQA 3VYTB 4OWRB 1PP7U 3RYRA 3PFYA 2VXDA 4N9IA 1VQ5I 1MBEA 3KEOA 2MYSA 3OS0A 2L7MP 4YRVA 2VKEA 1QQIA 4AM3A 4ZYDA 4XN0A 1IN8A 2R7OA 3L1PA 3HSRA 2L7ZA 2VODA 2L7KA 2DJNA 2QKLB 4P55A 3QQAA 1BL0A 5H6RA 3GTMJ 1JKPC 2FJ1A 2O8KA 4L5JA 1SFXA 2CW8A 2JTVA 1DP7P 1XSDA 1NH3A 3KP2A 2K9MA 3FXRA 5D8LB 2BGCA 4AYBN 1FYMA 4KNYA 4PJLA 1FYLA 2XSDC 1S29A 2ZXWH 3DLLF 4F55A 3G73A 1R5ID 3OS1A 4WXCA 4D5FA 3BCBA 5E17F 3DCFA 1GVDA 1P92A 3E5XA 3TMOA 4DQ2A 2IT0A 4RAFA 3GLLA 1QVTA 1Z3YA 3RYPA 3HRSA 4DZJA 2HDDA 2LK2A 1S9HA 1JKQC 2LKSA 4BHBA 2L3DA 5ICGA 3CO6C 1MMGA 2QUFA 3K4KA 3PJRA 2R93J 5IP7J 2IP2A 3EYIA 2EIMH 4EM2A 2IAIA 4KICA 3JRDA 4ZYEA 3LQQA 4UUVA 1I27A 4RAYA 3CF5F 1TWAJ 4IL6C 1B8IA 3MQ0A 4YG2F 2HOEA 4RGXA 1DPRA 2A6TA 4U0VA 3WU2C 2OC6A 4OMYA 2AXLA 3ZMSA 3AKZA 2XGDA 4A6DA 3NEUA 1X3WB 2K3PA 3ECHA 3KZZA 1LE8A 4JX4A 5ILSA 5HLGA 5DEQA 4KUMA 2PEXA 3BC8A 3BTLA 1VQKI 2HKOA 3H3UA 3BPVA 2NOJB 1LPQA 1RC9A 3F22A 4XICA 3A4CA 5L3GA 4NC6A 3F6VA 3IAM2 4PFOA 5AIPA 3ZRGA 4BQNA 4IHXA 2ZKZA 1XDUA 3WTZA 3BT9A 5CVJA 3VWBA 1MBKA 1GHCA 2Y75A 2DQLA 3IH4A 2BBYA 5LLQA 2B63J 5CVUA 1U5TB 4CCNA 3JRGA 3BJOA 5JLXA 1YW9A 4GCVA 4DZPA 1PUFA 5CQEA 1S7EA 1V4RA 2CQQA 1F5TA 1XMKA 1M1EB 5K7ZA 4E7IA 2LBFB 1VQNI 3VDXA 1FZPB 1V5FA 2KJBA 4EM1A 2QENA 3L2WA 5DCMB 2A6HF 2RQPA 1TWHJ 5HNFA 3V7CA 1YW8A 2H09A 3HUGB 4KIGA 2KIQA 5KVRA 5C4XJ 3BR2A 1MMDA 1MDMA 3HZJA 3V8KA 5D4RA 1Y1VJ 4BACA 2M4KA 1X1DA 2KT0A 1BW5A 2HNHA 3GEZA 3VB2A 1JHFA 2DO7A 2XKPA 3ZQLA 2UXXA 2JA6J 3J7AY 1E3OC 2L02A 3NARA 4YIFA 1O7LA 1FOKA 2NAZA 3DF8A 1UZCA 4MFDA 4Z6YA 5FGMA 2XGEA 2D1VA 5B3SH 5CPRB 2BY1A 2P6SA 3IH3A 5D8KB 1ZRDA 1BJZA 1RI7A 1QZZA 1SVOA 2P5KA 3GUDA 5TJJA 5J4VA 2R5YB 1GXPA 1AKHB 4II2A 2A3SA 4NC7A 2CS3A 4DBQA 1ERDA 2WAQA 3WU1B 4E7JA 2R7ZJ 1K79A 3H0DA 3C2GA 3D5RC 4KT5C 4LIVA 2IW5A 3ERMA 2HU9A 2FBIA 5A2QK 3RZDJ 1OCTC 2R7XA 2HFHA 1H89C 5KK1A 4G7HF 2CW0F 2CQNA 3OYHA 2BZTA 1MH4A 1MJBA 1K4TA 2FOKA 3GFLA 5HVQC 4CYCA 1ENHA 5TRDA 1DP3A 5F64A 4B1RA 3AAFA 1WGXA 3W6VA 3RKYA 4I09A 4BQQA 4H4KC 4Y4RA 3ZQ7A 4ZC3A 2G7UA 1GV2A 2JPCA 2PBIA 3T1BA 1K78A 1T0FC 2CQKA 3E5QA 2X51A 2J5PA 3NRVA 1IUFA 3V7RA 4FE4A 2A5WA 3GZNB 4M6YA 3M07A 4LG0A 2VC0A 1QHGA 1KQ9A 5LRRA 3FBIB 3DKXA 1U0JA 4R8HA 2DOFA 1NK3P 3BR1A 1WCMJ 2DCEA 3CJQB 3FM5A 3SEZA 5BNGA 3S1QJ 1EH7A 2HXIA 3O2PE 5J40A 2YPRA 4ZZDA 1CF7A 2MBFA 4KA4A 4BJTA 1OCRH 3LSIA 1TC3C 3ULQB 3TP3A 1USTA 2QQ8A 3I59A 1VQMI 3WTTC 2Q2EA 1MMNA 1XG1A 3C18A 4IOCF 1N77A 2X9DA 2ZMEC 3I54A 1WWXA 1X4PA 1TT0A 4EEFG 1A31A 4YEJA 2H8RA 2IRFG 3QOEA 1ZGAA 4IHSA 1UFMA 5E1ZB 4X6AJ 3SEQA 2ZSHB 3A01A 1XSVA 2EZHA 2R7RA 1MBJA 2LRDA 4CA0A 5L3BA 2HVRA 1Z21A 2RREA 1LQ1A 2O7OA 3VYRB 3HTSB 1OCPA 3DEWA 2VKDA 3Q3SA 3GCMA 1G6NA 4CZZA 3OYBA 1OCCH 1OCOH 2V6CA 3HGYA 4YELA 1WZ2A 2VT2A 2PG4A 3JSOA 1LVAA 1GLNA 2A69F 2D1HA 3CJNA 3EUHC 3QYFA 3B73A 4G12A 3TDUC 3RKQA 3CP8A 2O6GE 3QODA 3FISA 4U7DA 3A02A 4G6QA 3S3NA 4TV7A 4LB5A 3JRHA 5FKMA 1MKMA 3IUOA 1MIJA 2E2JJ 3RI4A 4EQQA 2RDPA 1OJLA 2JRTA 4HEA2 1NTCA 1ZH5A 5FJ8J 4HDVA 2L7FP 2BEOA 2W85A 2G7HA 5D6EA 4IPAA 1AOYA 1P6RA 2Z2SB 1SEUA 3ESWB 4DIQA 2CW7A 5CVVA 4RB3C 2H1KA 2FBHA 1G3SA 3L00A 3P7NA 4LK0F 2DOAA 3RPUA 5DUKA 4JQFA 2XB5A 4LITA 1TLHB 3OYGA 3S1NJ 2DFHA 3H3ZA 4AUXA 2E5NA 2F5DA 3KFWX 2Z5UA 3AG3H 1VQ9I 2CUFA 2M34A 2P7VB 4GYIA 2QLZA 2JUCA 4IRGA 2P4WA 1N78A 2X1CA 4I6ZA 1IRGA 2M87A 3PQKA 3M1EA 4UB6C 3RPUD 5D5XB 1RR8C 2DT7B 1U9NA 1BR1A 2L9RA 3K4JA 2ZB9A 2EZKA 4XONA 4KITB 4E7HA 5LEJA 2OTLI 3PIPF 3K1PA 3HOWJ 2FF4A 1FOXA 3H3VK 4OOIA 4LMYA 4ESFA 2QEXI 3KE2A 3ZMZA 2WWYA 3RIRA 1IZ1A 2XASA 1ZAOA 1Y0NA 2IGMA 2O61A 3ELKA 2COMA 3WTSC 1SD7A 1FMWA 2VN2A 1SANA 2RNJA 4HQMA 1I1GA 1QZEA 5J8FA 2NOGA 1F1ZA 5LHHA 2OUMA 1Z67A 5KHDA 3CUOA 1R58A 2HGCA 3A0HC 3HKZN 3G6EI 2BXZA 2V9VA 3ABLH 2M2EA 2QQBA 2XAJA 3K7AJ 4XSZF 3HOXJ 3O8GA 4EJUA 4BDZA 1VQLI 1YOVB 1LE8B 2CUJA 4E7ZA 1UJ8A 3FK7A 5GAEJ 2RV8A 3CQZJ 3M3YJ 1I3AA 3P9IA 5KNLA 3PNYA 2DMPA 3G2BA 3GW2A 4UB8C 3WE2A 1LFUP 3EYYA 1R1UA 4X1EA 2ELHA 3DKYA 1R36A 2WY7Q 3VFZA 1GUUA 1IXRC 3A2KA 1WJFA 4BY7J 2OD5A 2IS6A 3K70D 2G0EA 1PUFB 2AQEA 1U5TC 3GVAA 3QYBA 3QPHA 1KU3A 1IV8A 3BTJA 4EJVA 2OV7A 2QWWA 2N8GA 1ACIA 1Z7LA 2NYXA 4BE0A 3DXJF 3S3OA 3CZ6A 1Z0XA 3E6DA 2OQRA 2EWNA 4NQWA 3GXOA 4M72A 1ZHFA 4JX5A 2VT3A 4EJWA 2YUSA 2CFXA 3W2AA 3C1DA 1VQ4I 1BJAA 3CD6I 1TW3A 2DA3A 3WTUC 3OYMA 3I71A 2V9KA 4FQGA 3HBLA 1W5SA 1IAWA 1KZHA 1UCRA 1I3QJ 3T8TA 3E1SA 2VBWA 3S32A 4UHTA 3ZQIA 4NC8A 3U21A 1L0OC 5EZHA 3PNVA 3CCQI 1MNMC 2DDBA 1ETOA 4EGYA 1T95A 2H6CA 1V5GA 2K27A 2ZFUA 3HPHA 1ZG1A 2FOWA 2GIVA 4W1UA 1FIPA 2ZO4A 3ABMH 4XKVA 5FKOA 4EATA 3ZN1A 1IN7A 3TP0A 1ZN2A 2X6WA 1TW2A 3BG6A 3M9AA 3CCJI 1KYZA 1QPMA 1N25A 4I0AA 3AL0C 1RETA 2M4GA 1MH3A 2RNGA 3BDDA 4CUGA 3CCRI 4XRSA 4MTDA 3LFKA 2HQAA 3DQVC 1FTZA 2CO5A 2XKOA 3LAJA 4PJNA 3OOUA 3C2HA 4CYCB 2XRLA 3CCUI 2D5VA 1T2KA 2ZBKA 3BROA 1WJEA 4IQJA 1JT0A 2WA0A 2HVQA 4P96A 1U8BA 1QVUA 2XAGA 2KL4A 2XV4S 5IOYA 2DYSH 4AWXB 3CO7C 1G59A 1REPC 2I8DA 5FD6A 2AHQA 4CCLA 2LVSA 5FLMJ 1Q1HA 4BYYA 3L2CA 4PGGA 2DN0A 2MC3A 2QGUA 4I76A 4JBAA 2JVHA 2LTPA 4U0YA 4QLCU 2A6EF 1E2XA 4PJ0C 2ZXHA 3HOUJ 4CSWA 2NVQJ 4ESBA 3VODA 1ETXA 1BIAA 2E60A 2HOAA 2RVCA 3CLQA 3I4MJ 4V19K 1OR7A 1Z3XA 1Y39A 4A5NA 4UNOA 1OYIA 5DTDA 5GAHJ 4HBLA 2Q2EB 1ETQA 2KIMA 2VOOA 3BQZA 4WXDA 3LL7A 1BOBA 1RRJA 2BVMA 4AD9A 1D5VA 1HA8A 3QYEA 4UV8A 1TBXA 1O3RA 3TL4X 2M7AA 1S6LA 4M9XA 4XL9A 2JT1A 5HNHA 4E7LA 3A01B 2XF5A 2KJCA 3H9QA 3J7YJ 2CGPA 5K5OA 2WB1N 3LSHA 4N0BA 1MJ9A 4BEHA 4B09A 3FXKA 2DAOA 4HLYA 2O0YA 3BR0A 5LBQA 4BQAA 4RB1A 3CC4I 3C2BA 4XRSG 4A2UA 2VONA 3L2RA 2EH3A 4XSXF 2KLOA 2Z3YA 4P5OA 1ZG5A 1MJAA 3M1CA 2ME0A 3KPHA 1YIJI 4DGWB 1LDKB 2LD5A 2CV1A 2BOLA 4XRFA 4NUBA 2K86A 5H6QA 2PMZN 5DM7F 1VF9A 2COBA 1O4XA 3FBNB 2ZMEB 5EZGA 2VLAA 1T39A 3W2VA 5DV5A 4BXXJ 3KZIC 3K1MA 4KIBA 1WJ5A 5B1AH 1FNNA 4IHYA 5E8IA 4UXNA 1J7KA 1MZBA 2JK3A 4F7ZA 2MGQA 2DPUA 4A3DJ 5GPAA 2JUGA 3NQOA 2HYGD 2Y31A 4LLLA 1SC7A 1FY7A 1WJDA 1FSEA 3DLAA 4RGUA 4UUTA 2TCTA 1IUYA 2E7WA 2ECBA 3J81K 4I2OA 4OIQF 5LRSA 3T0YA 2ELKA 5FKLA 2QBYA 4RLFA 2WV1A 2O3FA 1I39A 1WFXA 2EBIA 3M4OJ 3HRTA 2ZXJA 1OFCX 4A0ZA 1G2HA 1B72A 3RTRA 2KRCA 2EV6A 2WC2A 1GVJA 4EMSA 3EDPA 4KN7X 1ZKGA 2A5YB 4M9SA 3HL2A 4EM0B 3D5SC 5ED4A 2V26A 2STWA 3GFJA 3KCCA 3F8MA 1ZTRA 3F6OA 2CQ7A 3WGIA 1W0UA 1ETVA 3HOYJ 5K1YA 2KFDA 1TWFJ 1EA3A 3I53A 3SZGA 2P5VA 4ZTJA 4RAZA 2M1BA 5KAFC 2OA4A 4F91B 3S14J 4LFUA 2JWTA 4L9VA 3FHNA 2R0QC 1QPIA 2NRAC 3LA3A 4L9TA 3RJPA 1MBGA 4I01A 3FXJA 5FROA 5M3MJ 4GRIA 5EGOA 1IRZA 1ZQ3P 3E6CC 4HNTA 1E3HA 3FM3A 2VJ5A 2E1MC 1A04A 3QPLA 2L9VA 3ZMVA 1VNDA 1UAAA 3Q0UA 3LAPA 3CCEI 2BVLA 4U88A 2V1UA 4XR6A 1FOWA 1V5EA 2OTJI 4C2TA 1U78A 2PQ8A 5HDNA 2LY9A 1HSTA 2HS5A 3BTIA 3F8NA 3AFHA 3HXLA 3I5UA 4BHPA 1Y6IA 2KRHA 1VTNC 3VYUB 1OYYA 2X6YA 5FLXZ 4M74A 4RS8A 2ZJRF 2XPVA 5GAGJ 1X2MA 4ZYHA 2H6BA 3IP4B 3R6SA 2YR2A 2R5ZA 3LWFA 2K9QA 3H0GJ 3MEXA 3U2RA 1H9GA 1YHQI 4F52A 1IN6A 1B9MA 4IVNA 3UR3C 4NQWB 2QSFX 2W4SA 5JFRA 1RUOA 2O9LA 2LC2A 2XAHA 4XOPA 4G6DA 3CCYA 2BXYA 2I10A 4LIUA 3DTIA 3MKLA 3GZ6A 2B0LA 3IRRA 2KZGA 4ESJA 4ZDOA 5J1YA 1XDSA 4PUSA 1DGWY 1RKWA 3F8CA 3SXYA 3HGGA 4OINF 5FKKA 3IRQA 2GQQA 1XMAA 4A3FJ 2W48A 3BG7A 3E0JB 1LFPA 5LGNA 5CLSA 5JI6A 1YFHA 2M0MA 1VI0A 1AHDP 5L3CA 2XAQA 2P8TA 3JCUC 2QF7A 1Y8QB 1Z1DA 1WH5A 5E1XA 5H2FC 1K4SA 5FRMA 5IYDJ 4PZJA 3LSGA 4AIHA 3N97A 2BW3A 1QA6A 5GPCA 3BLYA 4L9NA 2XC7A 3JRCA 3ASOH 3RDIA 1SMTA 2ACJA 2HTSA 4MFEA 3TW7A 4AVPA 4ZJZA 3RZOJ 4UUSA 1YS7A 5J6XA 2R7FA 3J7AO 4IO9F 1HDPA 3WTVC 3MFKA 2MABA 2L9SA 1H9TA 3ML6A 4JK1X 4JX6A 4PFPA 2OBPA 5DS9A 2E36A 1FP2A 1CQTA 2W1OA 5BMZA 1KQ0A 1K6YA 5L3EA 3O6BB 5ICFA 3S17J 3GTLJ 2JVGA 3OV8A 5L3FA 1KYWA 4BJ5C 2JSPA 2IJLA 2DK8A 4YFXF 3NAUA 4YFKF 3JSPA 3OSGA 4Y3OA 2FRHA 3S93A 3ZQHA 4NDLA 3CJTB 3X2QH 3ABKH 4QIWN 1UB9A 1F43A 2F5CA 2X6OA 4M3DA 3BZCA 1PYVA 2K02A 3KLNA 4M6XA 2W00A 3I55I 2HOSA 4M71A 4RM3A 2IPQX 1W7PA 4ETSA 1DDNA 4QPQA 3ABTA 2HQ5A 1LUJB 3BQYA 3I58A 3OYDA 1HW5A 4RB2C 3PUBA 1NG7A 1SAUA 1X58A 1IV6A 1SVLA 4HYEA 4Y17A 4C3IJ 3IC7A 4U7BA 2CV2A 3AL0B 4RAGA 2M8GX 1ZLJA 4ENMA 4BJ6C 1K7AA 2R4GA 2DLLA 5HODA 2JA8J 1W7PD 2KDZA 4HV6A 3ZXSA 1FLIA 3OYEA 4IHVA 2LY1A 2HPIA 2KRFA 1R22A 1FP1D 2XRNA 2V4JC 1ETKA 3P9KA 3AG1H 1D5YA 3GX4X 2P0WA 2QCOA 4BS9A 2OPTA 4LD5A 2DMUA 4D7NA 3OSFA 4BEHB 2Y0MA 1JTXA 3MZHA 1IJWC 1D1AA 3HDDA 1TT5B 3BY6A 1YE9A 4NNJA 4IX7A 3TOAA 3CUQA 2AQFA 3GWZA 3PM1A 2W7NA 1G3WA 1JGGA 3FMSA 2HEOA 1VZ0A 4IRIA 1SVMA 4XKCA 4BAYA 1X4OA 1A36A 2E1OA 1P7JA 3TO9A 4Q5SF 1FSHA 3EUAA 2HVSA 3KLOA 1VQ6I 1IO2A 1XTAA 2JA7J 3HOZJ 2M9HA 4C2UA 1XS9A 5E3NA 3GTKJ 3RKXA 2DK5A 3I0TA 5E3LA 2FA5A 4ZYGA 1J9IA 3OR1C 1FIAA 2OAZA 2FQ3A 1E17A 1I5ZA 5EEGA 3M7GA 1DUXC 5J4YA 4D1QA 2QYOA 4PSXA 1I50J 3O8HA 2XHKA 1R6RA 2F5VA 3PIOF 2MLKA 1T98A 4C3HJ 2PMHA 4A0XA 4D7MA 5LD2C 2UV1A 5HS8A 5H20A 3W6KB 1P7IA 4II3A 3WHBA 4AIDA 3KP7A 4OIRF 4B43A 2R7WA 3H35A 5ICCA 4A3JJ 2OZ6A 3IKTA 3KP4A 1HLVA 2XUBA 1NHAA 2EILH 1UG2A 4HW0A 3IL2A 1C0WA 4G8XA 1BOAA 1J2XA 2QVOA 3CTAA 1IGNA 1YJWI 3JRFA 4B48A 4I02A 4MLOA 4HAMA 4A6EA 1B72B 3HHHA 3LSRA 2D45A 3TGNA 2DMNA 3CCVI 2VBXA 3IHUA 4HDUA 4XOTA 1BM9A 1EJ9A 4HPQA 3M8EA 2Y0SN 3WHCA 4LGWA 4B44A 4DYCA 1XCVA 3SFZA 2FUG2 2M3AA 5BPIA 3OYJA 2QA4I 4IHWA 2BYVE 1DPUA 4FX0A 3BJ6A 1Z91A 2ECCA 4E7KA 2IGNA 3OIQA 4GYGA 1RIOH 2CSOA 2NS8A 3GFMA 3J81Z 1HW1A 3HTUA 2DW4A 2FX0A 5DUIA 2EV5A 3K2ZA 2X48A 2FMLA 4Y33A 4KYWA 2KZVA 4ABZA 3JREA 1USSA 4M73A 1EH8A 2XAUA 4M3GA 4BBSJ 2BY3A 4LB6B 5B5EC 4IRHA 3K70C 2E2HJ 3BR6A 4Q4ZF 2WY8Q 3ZOBA 5EG0A 4BUPA 3JTHA 5J47A 3ABUA 3OYIA 2L4MA 2HZDA 2KIFA 1J0RA 5GP9A 2HQNA 2GZWA 3U1KA 1ZRCA 2DMQA 4LG3A 2CWEA 5D4SA 4BY1J 3CMAI 1EKEA 2F2EA 1IG7A 4G7ZF 1A6QA 4M3BA 4QPOA 3S16J 3SJMA 1X2NA 3K69A 3A03A 2GA2A 4PJMA 4IHTA 2DT5A 2R7UA 3U9GA 4AYBA 2QKMB 1W0TA 4L0ZB 2E35A 2X4HA 3I4NJ 1Z77A 3H5AA 3HSFA 3WG7H 1YRNA 4A3EJ 4OMZA 5D5WB 1K61A 2DFEA 1B8IB 2IBDA 2V1XA 3CDHA 3PL8A 2PN6A 4XKBA 4I99C 4M6VA 2LH9A 3BZKA 3ISPA 4DNCA 4WCGA 3HB9A 1JXSA 2Q0OA 1KU9A 2PX9A 4YIRX 1ZK8A 2E1MB 2ID3A 2LG4A 4HX8A 1YG2A 3MCZA 5FKNA 4XLFA 1VQ8I 3GMEA 3R60A 2FEZA 3ZR8X 1F4KA 4A12A 2RN7A 2LF8A 2QQ9A 2QZ8A 2IXSA 4OAZA 3T8RA 3GTPJ 2DYRH 1X1PA 2ISZA 2F4MB 4QSHA 3KP3A 3L2QA 1UHWA 1BC7C 2DODA 2VJIA 4OIOF 1UHSA 3H36A 1HSJA 1WJBA 4I98B 4OU0A 2JA5J 2Z33A 4FASD 2QSHX 4L0YB 2V1DA 4HX4A 4RGSA 4XMYA 4PK4A 2OQGA 4KT6A 2BW3B 1QU3A 1IN5A 3QRFF 2DI3A 3UNGC 3JRBA 1ZREA 1BI1A 1D1CA 2G9WA 3Q0VA 4J19A 1ON1A 4LK1F 2IS4A 1AU7A 1A5JA 1ZYRF 4GFBA 4HF0A 2QSGX 2BV6A 3R0JA 3DEEA 1JE8A 4UVCA 4FT8A 1RZ4A 1E0EA 3KP6A 3WG9A 2OCCH 2WAEA 3FK6A 3L9FA 1GDTA 2BY2A 4BDYA 4B4CA 4B8XA 1X1AA 1HW2A 2TRTA 4XIDA 2K9SA 1TWGJ 1XSXA 1O3SA 3G1MA 1R1VA 4N4OB 4DOZA 1MDMB 2GOXB 4DJAA 1FBSA 3CESA 3MAJA 3RSNA 3VOEA 2W24A 1B9NA 3R61A 1LDJA 1NK2P 3BR5A 3SZTA 2CMPA 3K4MA 1VFCA 1LKXA 4PCQA 5FFXA 2ICWG 4C2MJ 2O8XA 1ZARA 3B6AA 4WK8F 2Y9YA 1HF0A 4OAYA 1YX3A 3MMYB 1ODDA 1TP4A 4EJOA 1TTYA 1SFOJ 2ZXIA 1W7PB 2HKXA 2ZCWA 1POGA 3JW4A 5LEKA 1KGSA 3OYFA 1FTTA 3KX2A 2EB7A 4PJJA 1R5GA 1D8JA 2AS5F 2LOOA 3S3MA 2HDWA 3BJAA 1OR7C 1D0ZA 4BH9A 2HZTA 3OY9A 3G4SI 4HZFA 1D1BA 3R4KA 3CCMI 1OMIA 2DXIA 4L5EA 2DA1A 3DBHB 3Q5FA 1G4DA 5DD4A 1IXSB 2ISYA 2X1DA 1Z05A 4C3JJ 3HC7A 2YU3A 1AA7A 2MC4A 4XLEA 5EJCA 4KDPA 2VI6A 3QP6A 3JAMK 2EPFA 1HC8A 5JHUA 3FXQA 1JKOC 3DPUA 1MSEC 3ECOA 2Q8KA 3OL4A 1XGNA 3I9V2 1VQ7I 2JA2A 2M5WA 2J5OA 1K78B 1T33A 1U9OA 2LBFA 3B6CA 2NNYA 4I7HA 4RBOA 1S3JA 3LNQA 3F3XA 3LFUA 2KQRA 1W36D 4UVBA 4LG0B 2JRMA 4JYKA 4A3KJ 4HA8A 2VJ4A 1D0XA 4N9HA 2EFNA 4FISA 1YS6A 2WAQN 1P4WA 5A2QZ 2K5CA 5HDGA 4O6JA 5C3EJ 1CF7B 4JP0A 1MNDA 1K83J 5CVRA 2HYFA 1SD5A 1Z9CA 2E19A 2NS7A 3D5LA 3I59B 5K5RA 2ZFWA 4CHUA 1ZGJA 1LVKA 3DBLB 3OS2A 3FXOA 3M8JA 2ZJPF 2H94A 2F48A 2L4AA 5HLHA 2W57A 5F27A 1UG0A 2DOEA 2OCEA 3K4LA 5E3OA 5DM6F 2R5YA 1R9TJ 3R0AA 2VKHA 1Y0UA 2E1NA 4U0WA 4ZZLA 2JQ7A 4HG2A 4XORA 4HF1A 3QU6A 1R00A 2LKPA 1R4MB 1SD6A 4XLHA 3GTQJ 2V79A 3KIOA 2XSJC 2KHMA 5ICEA 1H0MA 1K6OA 3TKYA 2P81A 3FMQA 1FOYA 3QAHA 2GOMA 1RKTA 4CCJA 3ZP5A 3CMEI 1B59A 4YFNF 2HYJA 3HRMA 4P9UA 5IYCJ 3T5XA 4G6TB 2R7VA 2X0LA 2LF7A 4H0EA 4A93J 4XKWA 4XLPF 2CV0A 3DV8A 1G3YA 4RM2A 5CKTA 4IOAF 2E1CA 2GXGA 3F8BA 5EF6A 1S8NA 2AO9A 2FBKA 3H9GA 3U1DA 3IV5A 5HS7A 1ZLKA 2YX4A 2XPWA 4D9JA 2BY0A 2ME6A 1KA8A 3DU6A 4GGGA 5C4JJ 2UWMA 4XLNF 1XCBA 3FKIJ 5DDGA 2EV0A 2CJJA 2CYYA 2WADA 5BQTA 4F92B 3FKJA 4L9JA 5IOZA 2PFBA 5D6FA 1E3PA 1L3LA 2HXOA 3VYSB 2FNAA 5F1RA 1TZLA 1JUMA 4UV9A 3V4GA 4GDFA 4FCYA 3DTEA 4IEJA 2IGOA 3CMMA 1QO0D 3BG9A 2RC4A 1XN7A 5EG0B 2MFZA 5F04A 2EFOA 4CCKA 3HOVJ 3WGGA 5F0HA 3L7WA 4HSTA 1YIOA 4J01A 1O3TA 4MNUA 1EV7A 4BKXA 1XX5A 3ZN0A 1WI9A 3CMYA 4QTRA 5LGUA 1SAXA 4Y52J 2M45A 3FIWA 3LSMA 1KU2A 5HLTA 1JUSA 3GTJJ 1TQIA 3C7JA 1V54H 4F3QA 3CCLI 3ZGKA 3ZQCA 1WPKA 1I6XA 4LLNA 4BHCA 2M8EA 3F23A 1IRFA 5HDKA 2P7CB 4MEYF 1P4AA 4EVIA 4IZZA 1KONA 3GBGA 1D3YA 1P9QC 1WI3A 3MVPA 4A69C 4BQOA 2L2OA 3E5UA 4LJZF 5F1JA 4AIKA 1HBXG 1MD0A 1FBQA 3J7ZI 3EQLF 1Z6RA 5M3FJ 1T6SA 5D5VB 3PSIA 2NNNA 4C30A 1SD4A 4WF2A 4S0HB 2RQQA 4EV0A 4MIMA 3HG9A 3H1CA 3FMRA 3FXUA 3OYNA 1ETWA 3HHGA 2PI0A 2RKHA 2LYCA 5JVGF 1YTYA 5HOOA 3COAC 3CDIA 1MMAA 1UHMA 1WH7A 1XB4A 5F0FA 4A3MJ 1ONVA 4FE7A 1OCZH 1YX5A 3OR2C 2PJRA 3TBIA 2CFOA 1HXDA 4ZYAA 4ITVA 2CRGA 3FF5A 1AWCA 2E5ZA 4XLAA 2FD5A 2HDCA 2V7FA 5B1BH 2PLYA 3HKZA 1R23A 1XGOA 2Y48A 1MNEA 4XN3A 2HQRA 2VBZA 3S1RJ 4HRIA 2EA2A 2DJIA 1ORKA 4BXUA 2ZJQF 2FQ4A 4GXOA 1U3EM 3HRUA 1PP8F 3HM5A 3ZMDA 2NVYJ 3BG3A 2VQLA 3S2DJ 3KZYA 3P9CA 3WGHA 1QZYA 1VQPI 1XGMA 3KYDB 2R7QA 2WV0A 2Z9OA 3LQRA 1WJAA 4ENJA 4B3AA 1LB2A 2OZUA 4AU7A 1B1BA 1W1WE 2V1NA 1YO5C 3PNTA 2MG4A 4DYRA 3EPZA 3HOSA 3IAS2 3DBRB 1WRJA 3DTKA 2MH9A 3QPSA 2ESHA 5IYBJ
chains in the Genus database with same CATH topology
1IDZA 2GLOA 4C3HJ 1PUFB 2G0EA 4D7MA 3D1NI 5J1UA 1P7IA 3BTJA 3WHBA 3PO2J 4MO7A 2N8GA 4A3JJ 1Y1WJ 5IP9J 1Z0XA 2R92J 1HLVA 3UKGA 1UG2A 4JX5A 2EZLA 1IDYA 5M5WJ 2YUSA 1IGNA 3JRFA 1ETYA 4MLOA 2ID6A 1JJ6C 2DA3A 1B72B 1ITYA 4DW6A 3ZQFA 3LSRA 2VUMJ 1A6IA 3HBLA 1I3QJ 2DMNA 1RESA 2DMTA 2GM4A 3ZQIA 3SDGA 2Y0SN 3WHCA 2LKXA 1BW6A 5EZHA 4DYCA 4XK4A 1MNMC 1ETOA 2GBYA 1JUPA 4IHWA 5EEAA 2Y9ZA 1JKRC 2ECCA 2YU9J 3TEDA 4W1UA 1FIPA 4D5CA 5FKOA 5J1RA 4V2GA 3BTCA 3TP0A 3JRIA 2NS8A 1YRNB 2FX0A 1JTYA 2X48A 3RQIA 2DA6A 1GV5A 3Q0WA 4ABZA 1RETA 3JREA 3JR9A 1ZGWA 1MH3A 4M3GA 4BBSJ 4XRSA 1UMQA 4Y7NJ 9ANTA 1FTZA 2E2HJ 2M0CA 3BR6A 2OF7A 3HEFA 3ZOBA 3OOUA 5EG0A 3PO3J 4CYCB 2XRLA 2D5VA 1H8AC 5GP9A 1MBEA 1JT0A 2DMQA 4BY1J 2L7MP 1U8BA 2VKEA 5EDNA 1QVUA 2VPRA 1IG7A 2L0KA 4M3BA 3L1PA 2L7ZA 3S16J 3SJMA 1X2NA 5IOYA 3A03A 2DJNA 3E7LA 3QQAA 1BL0A 3GTMJ 1HOMA 1W0TA 3I4NJ 2AHQA 2LVSA 1Z77A 1JKPC 3G1OA 2FJ1A 5FLMJ 2O8KA 1YRNA 4A3EJ 1K61A 2DN0A 1B8IB 2IBDA 1LFBA 4I76A 2LTPA 4M6VA 4AYBN 3HOUJ 2NVQJ 5F0CA 2XSDC 2K40A 1ETXA 3HB9A 2HOAA 1JJ8C 3I4MJ 1ZK8A 2ID3A 5DTDA 5FKNA 4D5FA 3DCFA 1GVDA 3CDLA 1ETQA 4AC0A 3BQZA 1QVTA 3GTOJ 2HDDA 4DZJA 3GTPJ 2LK2A 4A3GJ 1JKQC 4QSHA 5JLWA 4DYQA 1UHSA 2R93J 2JA5J 4A3LJ 4XRMA 5IP7J 4W97A 3A01B 2IAIA 5K7FA 3JRDA 1TWAJ 3JRBA 4FTHA 2WB1N 3Q0VA 4J19A 1B8IA 1XC5A 1A5JA 1AU7A 4GFBA 3BR0A 1F36A 2LFBA 5IPAA 3C2BA 2XGDA 4XRSG 5E3MA 2NVXJ 2DA7A 3FK6A 1LE8A 5K7HA 4JX4A 2EH3A 3MN2A 1GDTA 4B4CA 2TRTA 4XIDA 2ME0A 2K9SA 1TWGJ 2MSYA 2LD5A 3BTLA 2DA2A 3G1MA 1MBHA 5M5XJ 1MSFC 2PMZN 4XICA 1NK2P 1VF9A 2COBA 3BR5A 1O4XA 4IHXA 5EZGA 1VFCA 3K2AA 3S1MJ 4BXXJ 5F08A 3BT9A 4C2MJ 1MBKA 3B6AA 3IH4A 2B63J 2Y9YA 4IHYA 1HF0A 2HI3A 3JRGA 5JLXA 4DZPA 2JK3A 1PUFA 1S7EA 2CQQA 2MGQA 1SFOJ 5K7ZA 4A3DJ 5GPAA 1I6HJ 1POGA 2Y31A 1T56A 5EGOB 1FTTA 2JJ7A 4RDUA 4UUTA 1TWHJ 2TCTA 2ECBA 5C4XJ 3BR2A 2ELKA 5FKLA 2WV1A 3M4OJ 2EBIA 2JMWA 4L5EA 1Y1VJ 2DA1A 3TW6A 3JRAA 1OFCX 1G2HA 2EQRA 1B72A 4V2FA 2KT0A 1BW5A 4C3JJ 2DA4A 1ZKGA 3BR3A 3ZQLA 2JA6J 1E3OC 2VI6A 3NARA 1RPWA 1ZTRA 4MFDA 1W0UA 2CQXA 2XGEA 1ETVA 3HOYJ 1JKOC 1MSEC 3IH2A 1TWFJ 3IH3A 1BJZA 3S14J 2R5YB 1T33A 1U9OA 2JWTA 2E2IJ 3B6CA 1AKHB 2IEKA 2R5ZB 4RBOA 2Y2ZA 2R0QC 1QPIA 1FEXA 5M3MJ 3LNQA 1MBGA 4M3EA 5EGOA 1IRZA 3F0CA 2EZIA 2DTZA 1ZQ3P 2R7ZJ 4JYKA 2YS9A 4A3KJ 3QPLA 4FISA 2WAQN 1VNDA 3Q0UA 5C3EJ 3G1LA 3S2HJ 4JP0A 3RZDJ 3LSJA 1OCTC 1K83J 1H89C 1U78A 2E19A 2NS7A 1MH4A 2LY9A 4CYCA 1ENHA 3BTIA 4B1RA 1H88C 1WGXA 3W6VA 1APLC 5F27A 5E3OA 2XPVA 2R5YA 1GV2A 1X2MA 1R9TJ 1QRYA 2VKVA 1FJLA 2R5ZA 2K9QA 1IUFA 3H0GJ 4FE4A 3GTQJ 2O9LA 2P81A 1NK3P 1TWCJ 3BR1A 2LP0A 1WCMJ 5BNGA 3S1QJ 3CCYA 3GTGJ 4UUSB 1Q1VA 2HXIA 1RKTA 2I10A 1HCRA 1RR7A 2JN6A 3MKLA 2HOTA 1TC3C 2HYJA 5J1YA 3TP3A 1RKWA 1DU0A 3HGGA 5IYCJ 5FKKA 5EYRA 2NVTJ 1XG1A 4A3FJ 2W48A 4A93J 2X9DA 1EF4A 4A3IJ 4EEFG 2K9NA 5EF6A 2AO9A 3IV5A 2XGCA 1VI0A 2XPUA 2H8RA 1AHDP 2LLKA 2XPWA 3S15J 2QF7A 3ZQGA 1IC8A 2ME6A 3SFIA 4X6AJ 1WH5A 5C4JJ 1ZR4A 5IYDJ 3FKIJ 3A01A 2EZHA 3LSGA 1MBJA 2CJJA 4M3FA 5GPCA 3JRCA 3OIOA 2O7OA 5IOZA 1OCPA 4MFEA 3DEWA 2CU7A 3Q3SA 2HXOA 3TW7A 3RZOJ 4UUSA 1JUMA 3HGYA 4FCYA 1HDPA 4IEJA 3BG9A 5EG0B 4JX6A 5F04A 4G12A 3LSPA 3HOVJ 5DS9A 3RKQA 3FISA 1CQTA 3A02A 5F0HA 3JRHA 5FKMA 3S17J 3GTLJ 4BKXA 2XB0X 2E2JJ 3CMYA 4QTRA 4Y52J 1OJLA 1GT0C 3NAUA 3FIWA 3OSGA 1NTCA 5FJ8J 2L7FP 1DU6A 1JUSA 3GTJJ 5J3LA 3ZQHA 4NDLA 3ZQCA 1WPKA 4QIWN 1F43A 2H1KA 2X6OA 4M3DA 3GBGA 2HOSA 1WI3A 3MVPA 4A69C 2CUEA 2XB5A 1BA5A 5F1JA 2DA5A 2HQ5A 3BQYA 3S1NJ 1X58A 1IV6A 5M3FJ 4AUXA 4S0HB 4C3IJ 2CUFA 2M8GX 2M34A 4MIMA 1ETWA 1HDDC 4I6ZA 2RAEA 1JT6A 4A3CJ 1U9NA 5HODA 2JA8J 2L9RA 2KDZA 5FLVA 1WH7A 2EZKA 2ZB9A 5F0FA 4A3MJ 4A3BJ 4IHVA 4FE7A 3HOWJ 3H3VK 1ETKA 3BG5A 2CRGA 1D5YA 2FD5A 2QCOA 3VPRA 3LOCA 2OPTA 2DMUA 4D7NA 3OSFA 1JTXA 1IJWC 1SANA 3HDDA 2NOGA 2LR8A 1ZR2A 3S1RJ 1AKHA 5M5YJ 3HKZN 1ORKA 3PM1A 3K7AJ 2M2EA 3HOXJ 2FQ4A 1JGGA 3O8GA 1LE8B 3HM5A 2NVYJ 3BG3A 2E1OA 4HNVA 1P7JA 3FK7A 4BBRJ 4LOCA 3S2DJ 3CQZJ 3M3YJ 2JA7J 3HOZJ 5C44J 2M9HA 2DMPA 1XS9A 5IP6A 5E3NA 1LFUP 3GTKJ 2Y30A 1MBFA 5E3LA 4B3AA 4X1EA 1FIAA 2MG4A 4DYRA 1GUUA 1I50J 3O8HA 3QPSA 2MW8A 4BY7J 5IYBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDZ A;  2GLO A;  4C3H J;  1PUF B;  2G0E A;  4D7M A;  3D1N I;  5J1U A;  1P7I A;  3BTJ A;  3WHB A;  3PO2 J;  4MO7 A;  2N8G A;  4A3J J;  1Y1W J;  5IP9 J;  1Z0X A;  2R92 J;  1HLV A;  3UKG A;  1UG2 A;  4JX5 A;  2EZL A;  1IDY A;  5M5W J;  2YUS A;  1IGN A;  3JRF A;  1ETY A;  4MLO A;  2ID6 A;  1JJ6 C;  2DA3 A;  1B72 B;  1ITY A;  4DW6 A;  3ZQF A;  3LSR A;  2VUM J;  1A6I A;  3HBL A;  1I3Q J;  2DMN A;  1RES A;  2DMT A;  2GM4 A;  3ZQI A;  3SDG A;  2Y0S N;  3WHC A;  2LKX A;  1BW6 A;  5EZH A;  4DYC A;  4XK4 A;  1MNM C;  1ETO A;  2GBY A;  1JUP A;  4IHW A;  5EEA A;  2Y9Z A;  1JKR C;  2ECC A;  2YU9 J;  3TED A;  4W1U A;  1FIP A;  4D5C A;  5FKO A;  5J1R A;  4V2G A;  3BTC A;  3TP0 A;  3JRI A;  2NS8 A;  1YRN B;  2FX0 A;  1JTY A;  2X48 A;  3RQI A;  2DA6 A;  1GV5 A;  3Q0W A;  4ABZ A;  1RET A;  3JRE A;  3JR9 A;  1ZGW A;  1MH3 A;  4M3G A;  4BBS J;  4XRS A;  1UMQ A;  4Y7N J;  9ANT A;  1FTZ A;  2E2H J;  2M0C A;  3BR6 A;  2OF7 A;  3HEF A;  3ZOB A;  3OOU A;  5EG0 A;  3PO3 J;  4CYC B;  2XRL A;  2D5V A;  1H8A C;  5GP9 A;  1MBE A;  1JT0 A;  2DMQ A;  4BY1 J;  2L7M P;  1U8B A;  2VKE A;  5EDN A;  1QVU A;  2VPR A;  1IG7 A;  2L0K A;  4M3B A;  3L1P A;  2L7Z A;  3S16 J;  3SJM A;  1X2N A;  5IOY A;  3A03 A;  2DJN A;  3E7L A;  3QQA A;  1BL0 A;  3GTM J;  1HOM A;  1W0T A;  3I4N J;  2AHQ A;  2LVS A;  1Z77 A;  1JKP C;  3G1O A;  2FJ1 A;  5FLM J;  2O8K A;  1YRN A;  4A3E J;  1K61 A;  2DN0 A;  1B8I B;  2IBD A;  1LFB A;  4I76 A;  2LTP A;  4M6V A;  4AYB N;  3HOU J;  2NVQ J;  5F0C A;  2XSD C;  2K40 A;  1ETX A;  3HB9 A;  2HOA A;  1JJ8 C;  3I4M J;  1ZK8 A;  2ID3 A;  5DTD A;  5FKN A;  4D5F A;  3DCF A;  1GVD A;  3CDL A;  1ETQ A;  4AC0 A;  3BQZ A;  1QVT A;  3GTO J;  2HDD A;  4DZJ A;  3GTP J;  2LK2 A;  4A3G J;  1JKQ C;  4QSH A;  5JLW A;  4DYQ A;  1UHS A;  2R93 J;  2JA5 J;  4A3L J;  4XRM A;  5IP7 J;  4W97 A;  3A01 B;  2IAI A;  5K7F A;  3JRD A;  1TWA J;  3JRB A;  4FTH A;  2WB1 N;  3Q0V A;  4J19 A;  1B8I A;  1XC5 A;  1A5J A;  1AU7 A;  4GFB A;  3BR0 A;  1F36 A;  2LFB A;  5IPA A;  3C2B A;  2XGD A;  4XRS G;  5E3M A;  2NVX J;  2DA7 A;  3FK6 A;  1LE8 A;  5K7H A;  4JX4 A;  2EH3 A;  3MN2 A;  1GDT A;  4B4C A;  2TRT A;  4XID A;  2ME0 A;  2K9S A;  1TWG J;  2MSY A;  2LD5 A;  3BTL A;  2DA2 A;  3G1M A;  1MBH A;  5M5X J;  1MSF C;  2PMZ N;  4XIC A;  1NK2 P;  1VF9 A;  2COB A;  3BR5 A;  1O4X A;  4IHX A;  5EZG A;  1VFC A;  3K2A A;  3S1M J;  4BXX J;  5F08 A;  3BT9 A;  4C2M J;  1MBK A;  3B6A A;  3IH4 A;  2B63 J;  2Y9Y A;  4IHY A;  1HF0 A;  2HI3 A;  3JRG A;  5JLX A;  4DZP A;  2JK3 A;  1PUF A;  1S7E A;  2CQQ A;  2MGQ A;  1SFO J;  5K7Z A;  4A3D J;  5GPA A;  1I6H J;  1POG A;  2Y31 A;  1T56 A;  5EGO B;  1FTT A;  2JJ7 A;  4RDU A;  4UUT A;  1TWH J;  2TCT A;  2ECB A;  5C4X J;  3BR2 A;  2ELK A;  5FKL A;  2WV1 A;  3M4O J;  2EBI A;  2JMW A;  4L5E A;  1Y1V J;  2DA1 A;  3TW6 A;  3JRA A;  1OFC X;  1G2H A;  2EQR A;  1B72 A;  4V2F A;  2KT0 A;  1BW5 A;  4C3J J;  2DA4 A;  1ZKG A;  3BR3 A;  3ZQL A;  2JA6 J;  1E3O C;  2VI6 A;  3NAR A;  1RPW A;  1ZTR A;  4MFD A;  1W0U A;  2CQX A;  2XGE A;  1ETV A;  3HOY J;  1JKO C;  1MSE C;  3IH2 A;  1TWF J;  3IH3 A;  1BJZ A;  3S14 J;  2R5Y B;  1T33 A;  1U9O A;  2JWT A;  2E2I J;  3B6C A;  1AKH B;  2IEK A;  2R5Z B;  4RBO A;  2Y2Z A;  2R0Q C;  1QPI A;  1FEX A;  5M3M J;  3LNQ A;  1MBG A;  4M3E A;  5EGO A;  1IRZ A;  3F0C A;  2EZI A;  2DTZ A;  1ZQ3 P;  2R7Z J;  4JYK A;  2YS9 A;  4A3K J;  3QPL A;  4FIS A;  2WAQ N;  1VND A;  3Q0U A;  5C3E J;  3G1L A;  3S2H J;  4JP0 A;  3RZD J;  3LSJ A;  1OCT C;  1K83 J;  1H89 C;  1U78 A;  2E19 A;  2NS7 A;  1MH4 A;  2LY9 A;  4CYC A;  1ENH A;  3BTI A;  4B1R A;  1H88 C;  1WGX A;  3W6V A;  1APL C;  5F27 A;  5E3O A;  2XPV A;  2R5Y A;  1GV2 A;  1X2M A;  1R9T J;  1QRY A;  2VKV A;  1FJL A;  2R5Z A;  2K9Q A;  1IUF A;  3H0G J;  4FE4 A;  3GTQ J;  2O9L A;  2P81 A;  1NK3 P;  1TWC J;  3BR1 A;  2LP0 A;  1WCM J;  5BNG A;  3S1Q J;  3CCY A;  3GTG J;  4UUS B;  1Q1V A;  2HXI A;  1RKT A;  2I10 A;  1HCR A;  1RR7 A;  2JN6 A;  3MKL A;  2HOT A;  1TC3 C;  2HYJ A;  5J1Y A;  3TP3 A;  1RKW A;  1DU0 A;  3HGG A;  5IYC J;  5FKK A;  5EYR A;  2NVT J;  1XG1 A;  4A3F J;  2W48 A;  4A93 J;  2X9D A;  1EF4 A;  4A3I J;  4EEF G;  2K9N A;  5EF6 A;  2AO9 A;  3IV5 A;  2XGC A;  1VI0 A;  2XPU A;  2H8R A;  1AHD P;  2LLK A;  2XPW A;  3S15 J;  2QF7 A;  3ZQG A;  1IC8 A;  2ME6 A;  3SFI A;  4X6A J;  1WH5 A;  5C4J J;  1ZR4 A;  5IYD J;  3FKI J;  3A01 A;  2EZH A;  3LSG A;  1MBJ A;  2CJJ A;  4M3F A;  5GPC A;  3JRC A;  3OIO A;  2O7O A;  5IOZ A;  1OCP A;  4MFE A;  3DEW A;  2CU7 A;  3Q3S A;  2HXO A;  3TW7 A;  3RZO J;  4UUS A;  1JUM A;  3HGY A;  4FCY A;  1HDP A;  4IEJ A;  3BG9 A;  5EG0 B;  4JX6 A;  5F04 A;  4G12 A;  3LSP A;  3HOV J;  5DS9 A;  3RKQ A;  3FIS A;  1CQT A;  3A02 A;  5F0H A;  3JRH A;  5FKM A;  3S17 J;  3GTL J;  4BKX A;  2XB0 X;  2E2J J;  3CMY A;  4QTR A;  4Y52 J;  1OJL A;  1GT0 C;  3NAU A;  3FIW A;  3OSG A;  1NTC A;  5FJ8 J;  2L7F P;  1DU6 A;  1JUS A;  3GTJ J;  5J3L A;  3ZQH A;  4NDL A;  3ZQC A;  1WPK A;  4QIW N;  1F43 A;  2H1K A;  2X6O A;  4M3D A;  3GBG A;  2HOS A;  1WI3 A;  3MVP A;  4A69 C;  2CUE A;  2XB5 A;  1BA5 A;  5F1J A;  2DA5 A;  2HQ5 A;  3BQY A;  3S1N J;  1X58 A;  1IV6 A;  5M3F J;  4AUX A;  4S0H B;  4C3I J;  2CUF A;  2M8G X;  2M34 A;  4MIM A;  1ETW A;  1HDD C;  4I6Z A;  2RAE A;  1JT6 A;  4A3C J;  1U9N A;  5HOD A;  2JA8 J;  2L9R A;  2KDZ A;  5FLV A;  1WH7 A;  2EZK A;  2ZB9 A;  5F0F A;  4A3M J;  4A3B J;  4IHV A;  4FE7 A;  3HOW J;  3H3V K;  1ETK A;  3BG5 A;  2CRG A;  1D5Y A;  2FD5 A;  2QCO A;  3VPR A;  3LOC A;  2OPT A;  2DMU A;  4D7N A;  3OSF A;  1JTX A;  1IJW C;  1SAN A;  3HDD A;  2NOG A;  2LR8 A;  1ZR2 A;  3S1R J;  1AKH A;  5M5Y J;  3HKZ N;  1ORK A;  3PM1 A;  3K7A J;  2M2E A;  3HOX J;  2FQ4 A;  1JGG A;  3O8G A;  1LE8 B;  3HM5 A;  2NVY J;  3BG3 A;  2E1O A;  4HNV A;  1P7J A;  3FK7 A;  4BBR J;  4LOC A;  3S2D J;  3CQZ J;  3M3Y J;  2JA7 J;  3HOZ J;  5C44 J;  2M9H A;  2DMP A;  1XS9 A;  5IP6 A;  5E3N A;  1LFU P;  3GTK J;  2Y30 A;  1MBF A;  5E3L A;  4B3A A;  4X1E A;  1FIA A;  2MG4 A;  4DYR A;  1GUU A;  1I50 J;  3O8H A;  3QPS A;  2MW8 A;  4BY7 J;  5IYB J; 
#chains in the Genus database with same CATH topology
 1ZRF A;  1ON2 A;  1OLT A;  3OYL A;  4WWC A;  4CCO A;  3WOD F;  3GYH X;  3EUK L;  1ZG3 A;  2BHZ A;  2RGV A;  3D1N I;  1X3Z B;  4UVA A;  2F4I A;  3G3Z A;  4A0Y A;  4XQF A;  2CUZ A;  1KU7 A;  1BN5 A;  4FX4 A;  4MQ9 F;  5JR3 A;  2VIX A;  2DQR A;  3VSK A;  2GAU A;  5IP9 J;  1O57 A;  2R92 J;  1IF1 A;  2ZSI B;  2EZL A;  2K4J A;  1Z6T A;  5M5W J;  2PMU A;  1G8X A;  4O3M A;  3FZV A;  1MGT A;  3CJR B;  1JJ6 C;  2ID6 A;  2M7B A;  3KEY A;  1X1B A;  1ITY A;  4XBF A;  3K4N A;  3ZQF A;  4DW6 A;  1U8R A;  3FWE A;  1NG6 A;  2DDA A;  4XNF A;  3S2W A;  3MKW B;  1BR2 A;  4B3X A;  4A5M A;  1WJC A;  2MA3 A;  2GM4 A;  1S7A A;  3SDG A;  3TO7 A;  2LKX A;  2R7S A;  3H9J A;  4PDK A;  2GBY A;  3DFG A;  3V8J A;  4KMF A;  2DPD A;  2Y9Z A;  1QBJ A;  3BP8 A;  3MKZ A;  2YU9 J;  3M8F A;  5ERI A;  3CUQ C;  3TED A;  2FSW A;  4D5C A;  4KJZ A;  3WTW C;  3JRI A;  4PGH A;  4BU2 A;  1JI8 A;  3H5N A;  2VQH A;  1IXC A;  4KMU X;  1I1S A;  3DWL E;  2DA6 A;  2QM3 A;  1GV5 A;  3F72 A;  3Q0W A;  4XLC A;  2NVU B;  3JR9 A;  3ZCO A;  1ZGW A;  4CGZ A;  2F6C A;  3KYL A;  4YII A;  3IKV A;  2EJR A;  3WU0 A;  2M0C A;  1B4A A;  4CH7 A;  5L3D A;  5FFZ A;  2LNB A;  1TNS A;  3SHF A;  3JAM Z;  1U6G A;  4Y13 A;  1H8A C;  1ZEL A;  3BPX A;  2K3F A;  2VL8 A;  3TDZ C;  1MMS A;  3ASN H;  3HPG A;  4R79 A;  3L2U A;  5EDN A;  4NBQ A;  2VPR A;  5IT3 A;  4BGD A;  2L0K A;  4XM3 A;  4Q47 A;  4G9Y A;  2UXN A;  3E7L A;  4IJA A;  3N05 A;  2A68 F;  3TOB A;  1HOM A;  1TL8 A;  1KQ8 A;  3MWM A;  3CLO A;  3FXL A;  1BI0 A;  3G1O A;  3DP7 A;  3FHZ A;  2F4O B;  2L5Q A;  2KKO A;  1LFB A;  1U2W A;  3OYC A;  1RNL A;  2XRO A;  3TO6 A;  2EIK H;  3MKY B;  3DKW A;  3E6B A;  5F0C A;  3AG2 H;  2K40 A;  2K85 A;  2VE8 A;  1JJ8 C;  3L09 A;  4Z2Y A;  1XGS A;  4ZDP A;  3GZ5 A;  3AG4 H;  5IY5 H;  1HKS A;  4O5V A;  1Y56 A;  1HKQ A;  5BPD A;  4P1W A;  1R49 A;  1S7O A;  2WTE A;  5DCF A;  4N4N B;  3CDL A;  1OIS A;  2ZNY A;  4AC0 A;  2WAF A;  5LFA A;  3GTO J;  4M9Z A;  4ENN A;  3CC7 I;  4A3G J;  1LEA A;  4Y15 A;  5JLW A;  5FB2 A;  2C6Y A;  5FD5 A;  4CZC A;  2R3S A;  3ZMU A;  4ASN A;  4DYQ A;  3D0S A;  3IWF A;  2WB1 A;  4JOM A;  4A3L J;  4XRM A;  4W97 A;  2BE5 F;  4OIP F;  3CP2 A;  4CO8 A;  2XVC A;  2FMY A;  5K7F A;  2KMU A;  4MHG A;  3K1N A;  1BIB A;  3OOP A;  3RQ4 A;  4FTH A;  1B6A A;  1FC3 A;  2R7T A;  1Y8R B;  2EK5 A;  1FBU A;  1XC5 A;  1X19 A;  3V7S A;  3PSF A;  2GXB A;  2E7X A;  4F93 B;  4IXA A;  5ILU A;  4CCM A;  1F36 A;  4P9F A;  4BNC A;  1SFK A;  2LFB A;  1DQU A;  2ETH A;  5IPA A;  5E3M A;  2KPM A;  2NVX J;  2DA7 A;  4QWQ A;  2NXN B;  2WBM A;  1D0Y A;  3DPL C;  5K7H A;  3MN2 A;  2PMZ A;  4ZDL A;  2F5F A;  1LNW A;  2MSY A;  2XAF A;  2DA2 A;  2QBY B;  2V9P A;  1QGP A;  3KEQ A;  1MBH A;  4HOB A;  1R7J A;  5M5X J;  1MSF C;  2Z1D A;  1S5L C;  2L01 A;  4HF2 A;  3OL3 A;  1W5C C;  2HTJ A;  2VQC A;  3HOT A;  4E7S A;  3K2A A;  3FDY A;  1SMY F;  1WKM A;  5F08 A;  2I5U A;  1WSU A;  3ZMT A;  2X6X A;  2DU9 A;  2HI3 A;  3CC2 I;  3A0B C;  1T0F A;  4RGR A;  2IA2 A;  2MLG A;  1TQM A;  1I6H J;  3MZ8 A;  3CCS I;  1WHU A;  2JPB A;  2MD5 A;  1T56 A;  5AIQ A;  4Q48 A;  5EGO B;  2JJ7 A;  2HR3 A;  4GO1 A;  4ZTF A;  4RDU A;  1J09 A;  3F9K A;  3ROU A;  2DFF A;  3O3K A;  2Y69 H;  1IW7 F;  3BCA A;  3J80 K;  1CGP A;  4CIC A;  5IT9 K;  5LHI A;  1WQ2 A;  2JMW A;  1V3F A;  3K6G A;  2EIJ H;  3Q9V A;  4R1H A;  3TW6 A;  3JRA A;  2EQR A;  2EFW A;  4RB0 A;  4V2F A;  1UEL B;  3QP5 A;  1A35 A;  3MZY A;  4BE1 A;  2PJR B;  2VAS A;  2DA4 A;  2ZME A;  3OMY A;  3BR3 A;  4ON0 A;  2EIN H;  2LSO A;  5BOX A;  1RPW A;  1YJ9 I;  4PSW A;  2XDV A;  2CQX A;  3E3V A;  2IA1 A;  2F5E A;  3IH2 A;  3LA7 A;  3I56 I;  5JHF A;  2VE9 A;  2VQG A;  4EGZ A;  2VB6 A;  3REO A;  2E2I J;  2IEK A;  3DU5 A;  2R5Z B;  4KIS A;  2Y2Z A;  1FEX A;  4M3E A;  2LMD A;  2VJJ A;  3G71 I;  4RLQ A;  3F0C A;  2EZI A;  2DTZ A;  3KET A;  5DD8 A;  2KP6 A;  5HS9 A;  5E20 A;  3ERE D;  2YS9 A;  3ONQ A;  1BBY A;  2L54 A;  1WVR A;  4FET A;  5BS6 A;  1PDN C;  1JHH A;  3QOP A;  1EH6 A;  3F8F A;  1OKR A;  2FU4 A;  3G1L A;  3S2H J;  5GTI C;  3EUH A;  2OU2 A;  3LSJ A;  1VQO I;  1GXQ A;  3E97 A;  1XPX A;  1N75 A;  2UZK A;  2AXT C;  1OQY A;  2DBB A;  1J75 A;  3SZP A;  1H88 C;  3N4M A;  3SDB A;  1APL C;  5J8C A;  2B7E A;  2FNP A;  1LJ9 A;  5TGT A;  5HLI A;  1QRY A;  2M30 A;  2VKV A;  4ZH4 F;  1FJL A;  3OYA A;  3HSE A;  5FLX K;  3OYK A;  1LEB A;  1W5T A;  2ZC2 A;  3SQN A;  1MW7 A;  2R7D A;  3BWG A;  3H92 A;  3P5J A;  5E18 F;  1PVE A;  3HJE A;  1IRX A;  1TWC J;  4BXF A;  2LP0 A;  4BE2 A;  2MD0 A;  3GTG J;  4UUS B;  5GAD J;  1Q1V A;  2OJE D;  5FO5 A;  1HCR A;  1RR7 A;  1YQA A;  2JN6 A;  3GLX A;  1P4X A;  3VEP A;  2HOT A;  2ZJ2 A;  3GO5 A;  3KYC B;  1DU0 A;  2LRE A;  4E6K G;  1W4M A;  2CG4 A;  3LST A;  5EYR A;  2NVT J;  3A1Y A;  4ENK A;  1EF4 A;  4A3I J;  1W36 C;  3RKW A;  4NHJ A;  3KP5 A;  2K9N A;  2H8W A;  3ZPL A;  2BHY A;  2VC1 A;  3Q9S A;  2XGC A;  2XPU A;  4NB5 A;  5D5U B;  2LLK A;  4L18 B;  3S15 J;  3ZQG A;  1IC8 A;  3I4P A;  3SFI A;  3I3L A;  1ZR4 A;  3W3C A;  3CF2 A;  1ULY A;  2YX7 A;  4WXH A;  5ILV A;  2EA4 A;  1PJR A;  2GWR A;  2O03 A;  1LDD A;  4M3F A;  4DBR A;  1S72 I;  5DYM A;  3OIO A;  2B9S A;  1OYW A;  1YYV A;  2CU7 A;  3L2V A;  5LHG A;  3W2W A;  4IQ4 A;  2VBY A;  4UY8 I;  3WTY C;  1YJN I;  2A07 F;  1TQP A;  3LSP A;  4HLX A;  4S04 A;  1JGS A;  2VOP A;  2KDO A;  4MQV A;  5CJ9 A;  3LMM A;  4FHT A;  1R5H A;  3LA2 A;  3FX3 A;  2XB0 X;  2GA1 A;  2NS0 A;  4G7O F;  5KAI C;  1GT0 C;  4E4H A;  5K5Q A;  1FWZ A;  1QHH D;  6PAX A;  1DU6 A;  1YLF A;  3K9T A;  1X3U A;  2X1E A;  2HWV A;  5J3L A;  4AIJ A;  3QU3 A;  1FMV A;  4AVZ A;  1J5Y A;  1U5T A;  4G94 A;  3GFI A;  5JVT A;  2CUE A;  1BA5 A;  3CUQ B;  2DA5 A;  1BI2 A;  2TDX A;  1YIT I;  2ZNZ A;  1BR4 A;  2K4B A;  2UUZ A;  3OWT A;  5CQG A;  2W84 A;  5DCM A;  2KIU A;  2FXA A;  3GF2 A;  1FYK A;  2GIZ A;  3HUG A;  3QWL A;  2Z16 A;  1XMX A;  1FPQ A;  3IWZ A;  1R1T A;  1YW7 A;  1HDD C;  4X0G A;  1J59 A;  2RAE A;  1JT6 A;  4A3C J;  4K2E A;  2IVM A;  1RUN A;  5FLV A;  1SFU A;  5AON A;  1TNT A;  1PUE E;  4A3B J;  2P5L C;  2IS2 A;  4U87 A;  2QQA A;  2ADU A;  5CYV A;  4ANJ A;  3BG5 A;  4CYD A;  1STZ A;  3VPR A;  3LOC A;  3W6J B;  4L5I A;  3V8L A;  1QNT A;  2CH0 A;  2A61 A;  4BL0 B;  1BI3 A;  2DFI A;  2IS1 A;  2LR8 A;  1V55 H;  2FE3 A;  1ZR2 A;  1IN4 A;  1AKH A;  3NWT A;  5M5Y J;  3WE3 A;  3S8P A;  3F21 A;  3PUF A;  2P6T A;  5LGT A;  4HNV A;  2K9L A;  1X1C A;  4BBR J;  3EET A;  4LOC A;  2PJP A;  3HIF A;  4KIF A;  5E79 C;  2XF6 A;  4I0B A;  5C44 J;  3BZ6 A;  1YI2 I;  4CDG A;  3QPT A;  3SYT A;  5IP6 A;  1HQC A;  4IKF A;  2Y30 A;  1MBF A;  5F6F A;  4KFC A;  4B47 A;  1FX7 A;  4MTE A;  3K4C A;  3PQJ A;  5TIS C;  4S05 A;  1O3Q A;  4HV5 A;  3ZQQ A;  3VSL A;  2JZY A;  4J00 A;  2EFP A;  2MW8 A;  3RCO A;  3S1M J;  1IDZ A;  2GLO A;  2MH2 A;  2E34 A;  3H5R A;  4IF4 A;  2W82 A;  4RMN A;  1BC8 C;  4D0P A;  5J1U A;  2JSC A;  5KCM A;  1R71 A;  4HQE A;  3TQN A;  3BOQ A;  3WTX C;  3PO2 J;  4MO7 A;  1Y1W J;  2L9N A;  3OIP A;  2W25 A;  1HKT A;  1DGR M;  1O7F A;  3NWS A;  3UKG A;  1IDY A;  4MEX F;  2GXA A;  1P2F A;  3DPT A;  4HNU A;  2ELJ A;  2XF7 A;  2KIS A;  4HSR A;  1ETY A;  3K10 A;  3V42 A;  2A05 A;  3MD2 A;  1G3T A;  1SFE A;  4E70 A;  1F9N A;  2D2W A;  4EJT A;  2DTR A;  3C3W A;  4RA2 A;  2Q1Z B;  2Y0S A;  2VUM J;  1A6I A;  2E71 A;  1OPC A;  2V6E A;  2K7L A;  3PFI A;  5GTH C;  4HX7 A;  2YSR A;  1FT9 A;  1RES A;  3E6M A;  3FXM A;  2DMT A;  2LY2 A;  5FRN A;  1T8I A;  3JTG A;  2HPM A;  2VXZ A;  2STT A;  1BW6 A;  3B02 A;  3K4B A;  4XK4 A;  1JUP A;  2DT6 A;  3K0L A;  5B66 C;  5EEA A;  5E8G A;  1JKR C;  1T38 A;  2ESN A;  1Z7U A;  5CVI A;  2EFQ A;  2H1L A;  2XIG A;  5J1R A;  4V2G A;  2O5R A;  3BTC A;  2Z99 A;  1YRN B;  3HYI A;  2X85 A;  4LLG F;  1R4N B;  2LDU A;  3J80 Z;  4KN4 X;  1JTY A;  5IT9 Z;  2H27 A;  3LSK A;  3DEU A;  4WX9 A;  3RQI A;  4CXF A;  4C9Y A;  1D8K A;  5EEH A;  1UMQ A;  4Y7N J;  9ANT A;  1XD7 A;  2XGX A;  5E1W A;  2IA0 A;  2OF7 A;  3HEF A;  3I64 A;  1T08 B;  3PO3 J;  2IGK A;  4MGR A;  2VPL A;  3RPQ A;  3VYT B;  4OWR B;  1PP7 U;  3RYR A;  3PFY A;  2VXD A;  4N9I A;  1VQ5 I;  1MBE A;  3KEO A;  2MYS A;  3OS0 A;  2L7M P;  4YRV A;  2VKE A;  1QQI A;  4AM3 A;  4ZYD A;  4XN0 A;  1IN8 A;  2R7O A;  3L1P A;  3HSR A;  2L7Z A;  2VOD A;  2L7K A;  2DJN A;  2QKL B;  4P55 A;  3QQA A;  1BL0 A;  5H6R A;  3GTM J;  1JKP C;  2FJ1 A;  2O8K A;  4L5J A;  1SFX A;  2CW8 A;  2JTV A;  1DP7 P;  1XSD A;  1NH3 A;  3KP2 A;  2K9M A;  3FXR A;  5D8L B;  2BGC A;  4AYB N;  1FYM A;  4KNY A;  4PJL A;  1FYL A;  2XSD C;  1S29 A;  2ZXW H;  3DLL F;  4F55 A;  3G73 A;  1R5I D;  3OS1 A;  4WXC A;  4D5F A;  3BCB A;  5E17 F;  3DCF A;  1GVD A;  1P92 A;  3E5X A;  3TMO A;  4DQ2 A;  2IT0 A;  4RAF A;  3GLL A;  1QVT A;  1Z3Y A;  3RYP A;  3HRS A;  4DZJ A;  2HDD A;  2LK2 A;  1S9H A;  1JKQ C;  2LKS A;  4BHB A;  2L3D A;  5ICG A;  3CO6 C;  1MMG A;  2QUF A;  3K4K A;  3PJR A;  2R93 J;  5IP7 J;  2IP2 A;  3EYI A;  2EIM H;  4EM2 A;  2IAI A;  4KIC A;  3JRD A;  4ZYE A;  3LQQ A;  4UUV A;  1I27 A;  4RAY A;  3CF5 F;  1TWA J;  4IL6 C;  1B8I A;  3MQ0 A;  4YG2 F;  2HOE A;  4RGX A;  1DPR A;  2A6T A;  4U0V A;  3WU2 C;  2OC6 A;  4OMY A;  2AXL A;  3ZMS A;  3AKZ A;  2XGD A;  4A6D A;  3NEU A;  1X3W B;  2K3P A;  3ECH A;  3KZZ A;  1LE8 A;  4JX4 A;  5ILS A;  5HLG A;  5DEQ A;  4KUM A;  2PEX A;  3BC8 A;  3BTL A;  1VQK I;  2HKO A;  3H3U A;  3BPV A;  2NOJ B;  1LPQ A;  1RC9 A;  3F22 A;  4XIC A;  3A4C A;  5L3G A;  4NC6 A;  3F6V A;  3IAM 2;  4PFO A;  5AIP A;  3ZRG A;  4BQN A;  4IHX A;  2ZKZ A;  1XDU A;  3WTZ A;  3BT9 A;  5CVJ A;  3VWB A;  1MBK A;  1GHC A;  2Y75 A;  2DQL A;  3IH4 A;  2BBY A;  5LLQ A;  2B63 J;  5CVU A;  1U5T B;  4CCN A;  3JRG A;  3BJO A;  5JLX A;  1YW9 A;  4GCV A;  4DZP A;  1PUF A;  5CQE A;  1S7E A;  1V4R A;  2CQQ A;  1F5T A;  1XMK A;  1M1E B;  5K7Z A;  4E7I A;  2LBF B;  1VQN I;  3VDX A;  1FZP B;  1V5F A;  2KJB A;  4EM1 A;  2QEN A;  3L2W A;  5DCM B;  2A6H F;  2RQP A;  1TWH J;  5HNF A;  3V7C A;  1YW8 A;  2H09 A;  3HUG B;  4KIG A;  2KIQ A;  5KVR A;  5C4X J;  3BR2 A;  1MMD A;  1MDM A;  3HZJ A;  3V8K A;  5D4R A;  1Y1V J;  4BAC A;  2M4K A;  1X1D A;  2KT0 A;  1BW5 A;  2HNH A;  3GEZ A;  3VB2 A;  1JHF A;  2DO7 A;  2XKP A;  3ZQL A;  2UXX A;  2JA6 J;  3J7A Y;  1E3O C;  2L02 A;  3NAR A;  4YIF A;  1O7L A;  1FOK A;  2NAZ A;  3DF8 A;  1UZC A;  4MFD A;  4Z6Y A;  5FGM A;  2XGE A;  2D1V A;  5B3S H;  5CPR B;  2BY1 A;  2P6S A;  3IH3 A;  5D8K B;  1ZRD A;  1BJZ A;  1RI7 A;  1QZZ A;  1SVO A;  2P5K A;  3GUD A;  5TJJ A;  5J4V A;  2R5Y B;  1GXP A;  1AKH B;  4II2 A;  2A3S A;  4NC7 A;  2CS3 A;  4DBQ A;  1ERD A;  2WAQ A;  3WU1 B;  4E7J A;  2R7Z J;  1K79 A;  3H0D A;  3C2G A;  3D5R C;  4KT5 C;  4LIV A;  2IW5 A;  3ERM A;  2HU9 A;  2FBI A;  5A2Q K;  3RZD J;  1OCT C;  2R7X A;  2HFH A;  1H89 C;  5KK1 A;  4G7H F;  2CW0 F;  2CQN A;  3OYH A;  2BZT A;  1MH4 A;  1MJB A;  1K4T A;  2FOK A;  3GFL A;  5HVQ C;  4CYC A;  1ENH A;  5TRD A;  1DP3 A;  5F64 A;  4B1R A;  3AAF A;  1WGX A;  3W6V A;  3RKY A;  4I09 A;  4BQQ A;  4H4K C;  4Y4R A;  3ZQ7 A;  4ZC3 A;  2G7U A;  1GV2 A;  2JPC A;  2PBI A;  3T1B A;  1K78 A;  1T0F C;  2CQK A;  3E5Q A;  2X51 A;  2J5P A;  3NRV A;  1IUF A;  3V7R A;  4FE4 A;  2A5W A;  3GZN B;  4M6Y A;  3M07 A;  4LG0 A;  2VC0 A;  1QHG A;  1KQ9 A;  5LRR A;  3FBI B;  3DKX A;  1U0J A;  4R8H A;  2DOF A;  1NK3 P;  3BR1 A;  1WCM J;  2DCE A;  3CJQ B;  3FM5 A;  3SEZ A;  5BNG A;  3S1Q J;  1EH7 A;  2HXI A;  3O2P E;  5J40 A;  2YPR A;  4ZZD A;  1CF7 A;  2MBF A;  4KA4 A;  4BJT A;  1OCR H;  3LSI A;  1TC3 C;  3ULQ B;  3TP3 A;  1UST A;  2QQ8 A;  3I59 A;  1VQM I;  3WTT C;  2Q2E A;  1MMN A;  1XG1 A;  3C18 A;  4IOC F;  1N77 A;  2X9D A;  2ZME C;  3I54 A;  1WWX A;  1X4P A;  1TT0 A;  4EEF G;  1A31 A;  4YEJ A;  2H8R A;  2IRF G;  3QOE A;  1ZGA A;  4IHS A;  1UFM A;  5E1Z B;  4X6A J;  3SEQ A;  2ZSH B;  3A01 A;  1XSV A;  2EZH A;  2R7R A;  1MBJ A;  2LRD A;  4CA0 A;  5L3B A;  2HVR A;  1Z21 A;  2RRE A;  1LQ1 A;  2O7O A;  3VYR B;  3HTS B;  1OCP A;  3DEW A;  2VKD A;  3Q3S A;  3GCM A;  1G6N A;  4CZZ A;  3OYB A;  1OCC H;  1OCO H;  2V6C A;  3HGY A;  4YEL A;  1WZ2 A;  2VT2 A;  2PG4 A;  3JSO A;  1LVA A;  1GLN A;  2A69 F;  2D1H A;  3CJN A;  3EUH C;  3QYF A;  3B73 A;  4G12 A;  3TDU C;  3RKQ A;  3CP8 A;  2O6G E;  3QOD A;  3FIS A;  4U7D A;  3A02 A;  4G6Q A;  3S3N A;  4TV7 A;  4LB5 A;  3JRH A;  5FKM A;  1MKM A;  3IUO A;  1MIJ A;  2E2J J;  3RI4 A;  4EQQ A;  2RDP A;  1OJL A;  2JRT A;  4HEA 2;  1NTC A;  1ZH5 A;  5FJ8 J;  4HDV A;  2L7F P;  2BEO A;  2W85 A;  2G7H A;  5D6E A;  4IPA A;  1AOY A;  1P6R A;  2Z2S B;  1SEU A;  3ESW B;  4DIQ A;  2CW7 A;  5CVV A;  4RB3 C;  2H1K A;  2FBH A;  1G3S A;  3L00 A;  3P7N A;  4LK0 F;  2DOA A;  3RPU A;  5DUK A;  4JQF A;  2XB5 A;  4LIT A;  1TLH B;  3OYG A;  3S1N J;  2DFH A;  3H3Z A;  4AUX A;  2E5N A;  2F5D A;  3KFW X;  2Z5U A;  3AG3 H;  1VQ9 I;  2CUF A;  2M34 A;  2P7V B;  4GYI A;  2QLZ A;  2JUC A;  4IRG A;  2P4W A;  1N78 A;  2X1C A;  4I6Z A;  1IRG A;  2M87 A;  3PQK A;  3M1E A;  4UB6 C;  3RPU D;  5D5X B;  1RR8 C;  2DT7 B;  1U9N A;  1BR1 A;  2L9R A;  3K4J A;  2ZB9 A;  2EZK A;  4XON A;  4KIT B;  4E7H A;  5LEJ A;  2OTL I;  3PIP F;  3K1P A;  3HOW J;  2FF4 A;  1FOX A;  3H3V K;  4OOI A;  4LMY A;  4ESF A;  2QEX I;  3KE2 A;  3ZMZ A;  2WWY A;  3RIR A;  1IZ1 A;  2XAS A;  1ZAO A;  1Y0N A;  2IGM A;  2O61 A;  3ELK A;  2COM A;  3WTS C;  1SD7 A;  1FMW A;  2VN2 A;  1SAN A;  2RNJ A;  4HQM A;  1I1G A;  1QZE A;  5J8F A;  2NOG A;  1F1Z A;  5LHH A;  2OUM A;  1Z67 A;  5KHD A;  3CUO A;  1R58 A;  2HGC A;  3A0H C;  3HKZ N;  3G6E I;  2BXZ A;  2V9V A;  3ABL H;  2M2E A;  2QQB A;  2XAJ A;  3K7A J;  4XSZ F;  3HOX J;  3O8G A;  4EJU A;  4BDZ A;  1VQL I;  1YOV B;  1LE8 B;  2CUJ A;  4E7Z A;  1UJ8 A;  3FK7 A;  5GAE J;  2RV8 A;  3CQZ J;  3M3Y J;  1I3A A;  3P9I A;  5KNL A;  3PNY A;  2DMP A;  3G2B A;  3GW2 A;  4UB8 C;  3WE2 A;  1LFU P;  3EYY A;  1R1U A;  4X1E A;  2ELH A;  3DKY A;  1R36 A;  2WY7 Q;  3VFZ A;  1GUU A;  1IXR C;  3A2K A;  1WJF A;  4BY7 J;  2OD5 A;  2IS6 A;  3K70 D;  2G0E A;  1PUF B;  2AQE A;  1U5T C;  3GVA A;  3QYB A;  3QPH A;  1KU3 A;  1IV8 A;  3BTJ A;  4EJV A;  2OV7 A;  2QWW A;  2N8G A;  1ACI A;  1Z7L A;  2NYX A;  4BE0 A;  3DXJ F;  3S3O A;  3CZ6 A;  1Z0X A;  3E6D A;  2OQR A;  2EWN A;  4NQW A;  3GXO A;  4M72 A;  1ZHF A;  4JX5 A;  2VT3 A;  4EJW A;  2YUS A;  2CFX A;  3W2A A;  3C1D A;  1VQ4 I;  1BJA A;  3CD6 I;  1TW3 A;  2DA3 A;  3WTU C;  3OYM A;  3I71 A;  2V9K A;  4FQG A;  3HBL A;  1W5S A;  1IAW A;  1KZH A;  1UCR A;  1I3Q J;  3T8T A;  3E1S A;  2VBW A;  3S32 A;  4UHT A;  3ZQI A;  4NC8 A;  3U21 A;  1L0O C;  5EZH A;  3PNV A;  3CCQ I;  1MNM C;  2DDB A;  1ETO A;  4EGY A;  1T95 A;  2H6C A;  1V5G A;  2K27 A;  2ZFU A;  3HPH A;  1ZG1 A;  2FOW A;  2GIV A;  4W1U A;  1FIP A;  2ZO4 A;  3ABM H;  4XKV A;  5FKO A;  4EAT A;  3ZN1 A;  1IN7 A;  3TP0 A;  1ZN2 A;  2X6W A;  1TW2 A;  3BG6 A;  3M9A A;  3CCJ I;  1KYZ A;  1QPM A;  1N25 A;  4I0A A;  3AL0 C;  1RET A;  2M4G A;  1MH3 A;  2RNG A;  3BDD A;  4CUG A;  3CCR I;  4XRS A;  4MTD A;  3LFK A;  2HQA A;  3DQV C;  1FTZ A;  2CO5 A;  2XKO A;  3LAJ A;  4PJN A;  3OOU A;  3C2H A;  4CYC B;  2XRL A;  3CCU I;  2D5V A;  1T2K A;  2ZBK A;  3BRO A;  1WJE A;  4IQJ A;  1JT0 A;  2WA0 A;  2HVQ A;  4P96 A;  1U8B A;  1QVU A;  2XAG A;  2KL4 A;  2XV4 S;  5IOY A;  2DYS H;  4AWX B;  3CO7 C;  1G59 A;  1REP C;  2I8D A;  5FD6 A;  2AHQ A;  4CCL A;  2LVS A;  5FLM J;  1Q1H A;  4BYY A;  3L2C A;  4PGG A;  2DN0 A;  2MC3 A;  2QGU A;  4I76 A;  4JBA A;  2JVH A;  2LTP A;  4U0Y A;  4QLC U;  2A6E F;  1E2X A;  4PJ0 C;  2ZXH A;  3HOU J;  4CSW A;  2NVQ J;  4ESB A;  3VOD A;  1ETX A;  1BIA A;  2E60 A;  2HOA A;  2RVC A;  3CLQ A;  3I4M J;  4V19 K;  1OR7 A;  1Z3X A;  1Y39 A;  4A5N A;  4UNO A;  1OYI A;  5DTD A;  5GAH J;  4HBL A;  2Q2E B;  1ETQ A;  2KIM A;  2VOO A;  3BQZ A;  4WXD A;  3LL7 A;  1BOB A;  1RRJ A;  2BVM A;  4AD9 A;  1D5V A;  1HA8 A;  3QYE A;  4UV8 A;  1TBX A;  1O3R A;  3TL4 X;  2M7A A;  1S6L A;  4M9X A;  4XL9 A;  2JT1 A;  5HNH A;  4E7L A;  3A01 B;  2XF5 A;  2KJC A;  3H9Q A;  3J7Y J;  2CGP A;  5K5O A;  2WB1 N;  3LSH A;  4N0B A;  1MJ9 A;  4BEH A;  4B09 A;  3FXK A;  2DAO A;  4HLY A;  2O0Y A;  3BR0 A;  5LBQ A;  4BQA A;  4RB1 A;  3CC4 I;  3C2B A;  4XRS G;  4A2U A;  2VON A;  3L2R A;  2EH3 A;  4XSX F;  2KLO A;  2Z3Y A;  4P5O A;  1ZG5 A;  1MJA A;  3M1C A;  2ME0 A;  3KPH A;  1YIJ I;  4DGW B;  1LDK B;  2LD5 A;  2CV1 A;  2BOL A;  4XRF A;  4NUB A;  2K86 A;  5H6Q A;  2PMZ N;  5DM7 F;  1VF9 A;  2COB A;  1O4X A;  3FBN B;  2ZME B;  5EZG A;  2VLA A;  1T39 A;  3W2V A;  5DV5 A;  4BXX J;  3KZI C;  3K1M A;  4KIB A;  1WJ5 A;  5B1A H;  1FNN A;  4IHY A;  5E8I A;  4UXN A;  1J7K A;  1MZB A;  2JK3 A;  4F7Z A;  2MGQ A;  2DPU A;  4A3D J;  5GPA A;  2JUG A;  3NQO A;  2HYG D;  2Y31 A;  4LLL A;  1SC7 A;  1FY7 A;  1WJD A;  1FSE A;  3DLA A;  4RGU A;  4UUT A;  2TCT A;  1IUY A;  2E7W A;  2ECB A;  3J81 K;  4I2O A;  4OIQ F;  5LRS A;  3T0Y A;  2ELK A;  5FKL A;  2QBY A;  4RLF A;  2WV1 A;  2O3F A;  1I39 A;  1WFX A;  2EBI A;  3M4O J;  3HRT A;  2ZXJ A;  1OFC X;  4A0Z A;  1G2H A;  1B72 A;  3RTR A;  2KRC A;  2EV6 A;  2WC2 A;  1GVJ A;  4EMS A;  3EDP A;  4KN7 X;  1ZKG A;  2A5Y B;  4M9S A;  3HL2 A;  4EM0 B;  3D5S C;  5ED4 A;  2V26 A;  2STW A;  3GFJ A;  3KCC A;  3F8M A;  1ZTR A;  3F6O A;  2CQ7 A;  3WGI A;  1W0U A;  1ETV A;  3HOY J;  5K1Y A;  2KFD A;  1TWF J;  1EA3 A;  3I53 A;  3SZG A;  2P5V A;  4ZTJ A;  4RAZ A;  2M1B A;  5KAF C;  2OA4 A;  4F91 B;  3S14 J;  4LFU A;  2JWT A;  4L9V A;  3FHN A;  2R0Q C;  1QPI A;  2NRA C;  3LA3 A;  4L9T A;  3RJP A;  1MBG A;  4I01 A;  3FXJ A;  5FRO A;  5M3M J;  4GRI A;  5EGO A;  1IRZ A;  1ZQ3 P;  3E6C C;  4HNT A;  1E3H A;  3FM3 A;  2VJ5 A;  2E1M C;  1A04 A;  3QPL A;  2L9V A;  3ZMV A;  1VND A;  1UAA A;  3Q0U A;  3LAP A;  3CCE I;  2BVL A;  4U88 A;  2V1U A;  4XR6 A;  1FOW A;  1V5E A;  2OTJ I;  4C2T A;  1U78 A;  2PQ8 A;  5HDN A;  2LY9 A;  1HST A;  2HS5 A;  3BTI A;  3F8N A;  3AFH A;  3HXL A;  3I5U A;  4BHP A;  1Y6I A;  2KRH A;  1VTN C;  3VYU B;  1OYY A;  2X6Y A;  5FLX Z;  4M74 A;  4RS8 A;  2ZJR F;  2XPV A;  5GAG J;  1X2M A;  4ZYH A;  2H6B A;  3IP4 B;  3R6S A;  2YR2 A;  2R5Z A;  3LWF A;  2K9Q A;  3H0G J;  3MEX A;  3U2R A;  1H9G A;  1YHQ I;  4F52 A;  1IN6 A;  1B9M A;  4IVN A;  3UR3 C;  4NQW B;  2QSF X;  2W4S A;  5JFR A;  1RUO A;  2O9L A;  2LC2 A;  2XAH A;  4XOP A;  4G6D A;  3CCY A;  2BXY A;  2I10 A;  4LIU A;  3DTI A;  3MKL A;  3GZ6 A;  2B0L A;  3IRR A;  2KZG A;  4ESJ A;  4ZDO A;  5J1Y A;  1XDS A;  4PUS A;  1DGW Y;  1RKW A;  3F8C A;  3SXY A;  3HGG A;  4OIN F;  5FKK A;  3IRQ A;  2GQQ A;  1XMA A;  4A3F J;  2W48 A;  3BG7 A;  3E0J B;  1LFP A;  5LGN A;  5CLS A;  5JI6 A;  1YFH A;  2M0M A;  1VI0 A;  1AHD P;  5L3C A;  2XAQ A;  2P8T A;  3JCU C;  2QF7 A;  1Y8Q B;  1Z1D A;  1WH5 A;  5E1X A;  5H2F C;  1K4S A;  5FRM A;  5IYD J;  4PZJ A;  3LSG A;  4AIH A;  3N97 A;  2BW3 A;  1QA6 A;  5GPC A;  3BLY A;  4L9N A;  2XC7 A;  3JRC A;  3ASO H;  3RDI A;  1SMT A;  2ACJ A;  2HTS A;  4MFE A;  3TW7 A;  4AVP A;  4ZJZ A;  3RZO J;  4UUS A;  1YS7 A;  5J6X A;  2R7F A;  3J7A O;  4IO9 F;  1HDP A;  3WTV C;  3MFK A;  2MAB A;  2L9S A;  1H9T A;  3ML6 A;  4JK1 X;  4JX6 A;  4PFP A;  2OBP A;  5DS9 A;  2E36 A;  1FP2 A;  1CQT A;  2W1O A;  5BMZ A;  1KQ0 A;  1K6Y A;  5L3E A;  3O6B B;  5ICF A;  3S17 J;  3GTL J;  2JVG A;  3OV8 A;  5L3F A;  1KYW A;  4BJ5 C;  2JSP A;  2IJL A;  2DK8 A;  4YFX F;  3NAU A;  4YFK F;  3JSP A;  3OSG A;  4Y3O A;  2FRH A;  3S93 A;  3ZQH A;  4NDL A;  3CJT B;  3X2Q H;  3ABK H;  4QIW N;  1UB9 A;  1F43 A;  2F5C A;  2X6O A;  4M3D A;  3BZC A;  1PYV A;  2K02 A;  3KLN A;  4M6X A;  2W00 A;  3I55 I;  2HOS A;  4M71 A;  4RM3 A;  2IPQ X;  1W7P A;  4ETS A;  1DDN A;  4QPQ A;  3ABT A;  2HQ5 A;  1LUJ B;  3BQY A;  3I58 A;  3OYD A;  1HW5 A;  4RB2 C;  3PUB A;  1NG7 A;  1SAU A;  1X58 A;  1IV6 A;  1SVL A;  4HYE A;  4Y17 A;  4C3I J;  3IC7 A;  4U7B A;  2CV2 A;  3AL0 B;  4RAG A;  2M8G X;  1ZLJ A;  4ENM A;  4BJ6 C;  1K7A A;  2R4G A;  2DLL A;  5HOD A;  2JA8 J;  1W7P D;  2KDZ A;  4HV6 A;  3ZXS A;  1FLI A;  3OYE A;  4IHV A;  2LY1 A;  2HPI A;  2KRF A;  1R22 A;  1FP1 D;  2XRN A;  2V4J C;  1ETK A;  3P9K A;  3AG1 H;  1D5Y A;  3GX4 X;  2P0W A;  2QCO A;  4BS9 A;  2OPT A;  4LD5 A;  2DMU A;  4D7N A;  3OSF A;  4BEH B;  2Y0M A;  1JTX A;  3MZH A;  1IJW C;  1D1A A;  3HDD A;  1TT5 B;  3BY6 A;  1YE9 A;  4NNJ A;  4IX7 A;  3TOA A;  3CUQ A;  2AQF A;  3GWZ A;  3PM1 A;  2W7N A;  1G3W A;  1JGG A;  3FMS A;  2HEO A;  1VZ0 A;  4IRI A;  1SVM A;  4XKC A;  4BAY A;  1X4O A;  1A36 A;  2E1O A;  1P7J A;  3TO9 A;  4Q5S F;  1FSH A;  3EUA A;  2HVS A;  3KLO A;  1VQ6 I;  1IO2 A;  1XTA A;  2JA7 J;  3HOZ J;  2M9H A;  4C2U A;  1XS9 A;  5E3N A;  3GTK J;  3RKX A;  2DK5 A;  3I0T A;  5E3L A;  2FA5 A;  4ZYG A;  1J9I A;  3OR1 C;  1FIA A;  2OAZ A;  2FQ3 A;  1E17 A;  1I5Z A;  5EEG A;  3M7G A;  1DUX C;  5J4Y A;  4D1Q A;  2QYO A;  4PSX A;  1I50 J;  3O8H A;  2XHK A;  1R6R A;  2F5V A;  3PIO F;  2MLK A;  1T98 A;  4C3H J;  2PMH A;  4A0X A;  4D7M A;  5LD2 C;  2UV1 A;  5HS8 A;  5H20 A;  3W6K B;  1P7I A;  4II3 A;  3WHB A;  4AID A;  3KP7 A;  4OIR F;  4B43 A;  2R7W A;  3H35 A;  5ICC A;  4A3J J;  2OZ6 A;  3IKT A;  3KP4 A;  1HLV A;  2XUB A;  1NHA A;  2EIL H;  1UG2 A;  4HW0 A;  3IL2 A;  1C0W A;  4G8X A;  1BOA A;  1J2X A;  2QVO A;  3CTA A;  1IGN A;  1YJW I;  3JRF A;  4B48 A;  4I02 A;  4MLO A;  4HAM A;  4A6E A;  1B72 B;  3HHH A;  3LSR A;  2D45 A;  3TGN A;  2DMN A;  3CCV I;  2VBX A;  3IHU A;  4HDU A;  4XOT A;  1BM9 A;  1EJ9 A;  4HPQ A;  3M8E A;  2Y0S N;  3WHC A;  4LGW A;  4B44 A;  4DYC A;  1XCV A;  3SFZ A;  2FUG 2;  2M3A A;  5BPI A;  3OYJ A;  2QA4 I;  4IHW A;  2BYV E;  1DPU A;  4FX0 A;  3BJ6 A;  1Z91 A;  2ECC A;  4E7K A;  2IGN A;  3OIQ A;  4GYG A;  1RIO H;  2CSO A;  2NS8 A;  3GFM A;  3J81 Z;  1HW1 A;  3HTU A;  2DW4 A;  2FX0 A;  5DUI A;  2EV5 A;  3K2Z A;  2X48 A;  2FML A;  4Y33 A;  4KYW A;  2KZV A;  4ABZ A;  3JRE A;  1USS A;  4M73 A;  1EH8 A;  2XAU A;  4M3G A;  4BBS J;  2BY3 A;  4LB6 B;  5B5E C;  4IRH A;  3K70 C;  2E2H J;  3BR6 A;  4Q4Z F;  2WY8 Q;  3ZOB A;  5EG0 A;  4BUP A;  3JTH A;  5J47 A;  3ABU A;  3OYI A;  2L4M A;  2HZD A;  2KIF A;  1J0R A;  5GP9 A;  2HQN A;  2GZW A;  3U1K A;  1ZRC A;  2DMQ A;  4LG3 A;  2CWE A;  5D4S A;  4BY1 J;  3CMA I;  1EKE A;  2F2E A;  1IG7 A;  4G7Z F;  1A6Q A;  4M3B A;  4QPO A;  3S16 J;  3SJM A;  1X2N A;  3K69 A;  3A03 A;  2GA2 A;  4PJM A;  4IHT A;  2DT5 A;  2R7U A;  3U9G A;  4AYB A;  2QKM B;  1W0T A;  4L0Z B;  2E35 A;  2X4H A;  3I4N J;  1Z77 A;  3H5A A;  3HSF A;  3WG7 H;  1YRN A;  4A3E J;  4OMZ A;  5D5W B;  1K61 A;  2DFE A;  1B8I B;  2IBD A;  2V1X A;  3CDH A;  3PL8 A;  2PN6 A;  4XKB A;  4I99 C;  4M6V A;  2LH9 A;  3BZK A;  3ISP A;  4DNC A;  4WCG A;  3HB9 A;  1JXS A;  2Q0O A;  1KU9 A;  2PX9 A;  4YIR X;  1ZK8 A;  2E1M B;  2ID3 A;  2LG4 A;  4HX8 A;  1YG2 A;  3MCZ A;  5FKN A;  4XLF A;  1VQ8 I;  3GME A;  3R60 A;  2FEZ A;  3ZR8 X;  1F4K A;  4A12 A;  2RN7 A;  2LF8 A;  2QQ9 A;  2QZ8 A;  2IXS A;  4OAZ A;  3T8R A;  3GTP J;  2DYR H;  1X1P A;  2ISZ A;  2F4M B;  4QSH A;  3KP3 A;  3L2Q A;  1UHW A;  1BC7 C;  2DOD A;  2VJI A;  4OIO F;  1UHS A;  3H36 A;  1HSJ A;  1WJB A;  4I98 B;  4OU0 A;  2JA5 J;  2Z33 A;  4FAS D;  2QSH X;  4L0Y B;  2V1D A;  4HX4 A;  4RGS A;  4XMY A;  4PK4 A;  2OQG A;  4KT6 A;  2BW3 B;  1QU3 A;  1IN5 A;  3QRF F;  2DI3 A;  3UNG C;  3JRB A;  1ZRE A;  1BI1 A;  1D1C A;  2G9W A;  3Q0V A;  4J19 A;  1ON1 A;  4LK1 F;  2IS4 A;  1AU7 A;  1A5J A;  1ZYR F;  4GFB A;  4HF0 A;  2QSG X;  2BV6 A;  3R0J A;  3DEE A;  1JE8 A;  4UVC A;  4FT8 A;  1RZ4 A;  1E0E A;  3KP6 A;  3WG9 A;  2OCC H;  2WAE A;  3FK6 A;  3L9F A;  1GDT A;  2BY2 A;  4BDY A;  4B4C A;  4B8X A;  1X1A A;  1HW2 A;  2TRT A;  4XID A;  2K9S A;  1TWG J;  1XSX A;  1O3S A;  3G1M A;  1R1V A;  4N4O B;  4DOZ A;  1MDM B;  2GOX B;  4DJA A;  1FBS A;  3CES A;  3MAJ A;  3RSN A;  3VOE A;  2W24 A;  1B9N A;  3R61 A;  1LDJ A;  1NK2 P;  3BR5 A;  3SZT A;  2CMP A;  3K4M A;  1VFC A;  1LKX A;  4PCQ A;  5FFX A;  2ICW G;  4C2M J;  2O8X A;  1ZAR A;  3B6A A;  4WK8 F;  2Y9Y A;  1HF0 A;  4OAY A;  1YX3 A;  3MMY B;  1ODD A;  1TP4 A;  4EJO A;  1TTY A;  1SFO J;  2ZXI A;  1W7P B;  2HKX A;  2ZCW A;  1POG A;  3JW4 A;  5LEK A;  1KGS A;  3OYF A;  1FTT A;  3KX2 A;  2EB7 A;  4PJJ A;  1R5G A;  1D8J A;  2AS5 F;  2LOO A;  3S3M A;  2HDW A;  3BJA A;  1OR7 C;  1D0Z A;  4BH9 A;  2HZT A;  3OY9 A;  3G4S I;  4HZF A;  1D1B A;  3R4K A;  3CCM I;  1OMI A;  2DXI A;  4L5E A;  2DA1 A;  3DBH B;  3Q5F A;  1G4D A;  5DD4 A;  1IXS B;  2ISY A;  2X1D A;  1Z05 A;  4C3J J;  3HC7 A;  2YU3 A;  1AA7 A;  2MC4 A;  4XLE A;  5EJC A;  4KDP A;  2VI6 A;  3QP6 A;  3JAM K;  2EPF A;  1HC8 A;  5JHU A;  3FXQ A;  1JKO C;  3DPU A;  1MSE C;  3ECO A;  2Q8K A;  3OL4 A;  1XGN A;  3I9V 2;  1VQ7 I;  2JA2 A;  2M5W A;  2J5O A;  1K78 B;  1T33 A;  1U9O A;  2LBF A;  3B6C A;  2NNY A;  4I7H A;  4RBO A;  1S3J A;  3LNQ A;  3F3X A;  3LFU A;  2KQR A;  1W36 D;  4UVB A;  4LG0 B;  2JRM A;  4JYK A;  4A3K J;  4HA8 A;  2VJ4 A;  1D0X A;  4N9H A;  2EFN A;  4FIS A;  1YS6 A;  2WAQ N;  1P4W A;  5A2Q Z;  2K5C A;  5HDG A;  4O6J A;  5C3E J;  1CF7 B;  4JP0 A;  1MND A;  1K83 J;  5CVR A;  2HYF A;  1SD5 A;  1Z9C A;  2E19 A;  2NS7 A;  3D5L A;  3I59 B;  5K5R A;  2ZFW A;  4CHU A;  1ZGJ A;  1LVK A;  3DBL B;  3OS2 A;  3FXO A;  3M8J A;  2ZJP F;  2H94 A;  2F48 A;  2L4A A;  5HLH A;  2W57 A;  5F27 A;  1UG0 A;  2DOE A;  2OCE A;  3K4L A;  5E3O A;  5DM6 F;  2R5Y A;  1R9T J;  3R0A A;  2VKH A;  1Y0U A;  2E1N A;  4U0W A;  4ZZL A;  2JQ7 A;  4HG2 A;  4XOR A;  4HF1 A;  3QU6 A;  1R00 A;  2LKP A;  1R4M B;  1SD6 A;  4XLH A;  3GTQ J;  2V79 A;  3KIO A;  2XSJ C;  2KHM A;  5ICE A;  1H0M A;  1K6O A;  3TKY A;  2P81 A;  3FMQ A;  1FOY A;  3QAH A;  2GOM A;  1RKT A;  4CCJ A;  3ZP5 A;  3CME I;  1B59 A;  4YFN F;  2HYJ A;  3HRM A;  4P9U A;  5IYC J;  3T5X A;  4G6T B;  2R7V A;  2X0L A;  2LF7 A;  4H0E A;  4A93 J;  4XKW A;  4XLP F;  2CV0 A;  3DV8 A;  1G3Y A;  4RM2 A;  5CKT A;  4IOA F;  2E1C A;  2GXG A;  3F8B A;  5EF6 A;  1S8N A;  2AO9 A;  2FBK A;  3H9G A;  3U1D A;  3IV5 A;  5HS7 A;  1ZLK A;  2YX4 A;  2XPW A;  4D9J A;  2BY0 A;  2ME6 A;  1KA8 A;  3DU6 A;  4GGG A;  5C4J J;  2UWM A;  4XLN F;  1XCB A;  3FKI J;  5DDG A;  2EV0 A;  2CJJ A;  2CYY A;  2WAD A;  5BQT A;  4F92 B;  3FKJ A;  4L9J A;  5IOZ A;  2PFB A;  5D6F A;  1E3P A;  1L3L A;  2HXO A;  3VYS B;  2FNA A;  5F1R A;  1TZL A;  1JUM A;  4UV9 A;  3V4G A;  4GDF A;  4FCY A;  3DTE A;  4IEJ A;  2IGO A;  3CMM A;  1QO0 D;  3BG9 A;  2RC4 A;  1XN7 A;  5EG0 B;  2MFZ A;  5F04 A;  2EFO A;  4CCK A;  3HOV J;  3WGG A;  5F0H A;  3L7W A;  4HST A;  1YIO A;  4J01 A;  1O3T A;  4MNU A;  1EV7 A;  4BKX A;  1XX5 A;  3ZN0 A;  1WI9 A;  3CMY A;  4QTR A;  5LGU A;  1SAX A;  4Y52 J;  2M45 A;  3FIW A;  3LSM A;  1KU2 A;  5HLT A;  1JUS A;  3GTJ J;  1TQI A;  3C7J A;  1V54 H;  4F3Q A;  3CCL I;  3ZGK A;  3ZQC A;  1WPK A;  1I6X A;  4LLN A;  4BHC A;  2M8E A;  3F23 A;  1IRF A;  5HDK A;  2P7C B;  4MEY F;  1P4A A;  4EVI A;  4IZZ A;  1KON A;  3GBG A;  1D3Y A;  1P9Q C;  1WI3 A;  3MVP A;  4A69 C;  4BQO A;  2L2O A;  3E5U A;  4LJZ F;  5F1J A;  4AIK A;  1HBX G;  1MD0 A;  1FBQ A;  3J7Z I;  3EQL F;  1Z6R A;  5M3F J;  1T6S A;  5D5V B;  3PSI A;  2NNN A;  4C30 A;  1SD4 A;  4WF2 A;  4S0H B;  2RQQ A;  4EV0 A;  4MIM A;  3HG9 A;  3H1C A;  3FMR A;  3FXU A;  3OYN A;  1ETW A;  3HHG A;  2PI0 A;  2RKH A;  2LYC A;  5JVG F;  1YTY A;  5HOO A;  3COA C;  3CDI A;  1MMA A;  1UHM A;  1WH7 A;  1XB4 A;  5F0F A;  4A3M J;  1ONV A;  4FE7 A;  1OCZ H;  1YX5 A;  3OR2 C;  2PJR A;  3TBI A;  2CFO A;  1HXD A;  4ZYA A;  4ITV A;  2CRG A;  3FF5 A;  1AWC A;  2E5Z A;  4XLA A;  2FD5 A;  2HDC A;  2V7F A;  5B1B H;  2PLY A;  3HKZ A;  1R23 A;  1XGO A;  2Y48 A;  1MNE A;  4XN3 A;  2HQR A;  2VBZ A;  3S1R J;  4HRI A;  2EA2 A;  2DJI A;  1ORK A;  4BXU A;  2ZJQ F;  2FQ4 A;  4GXO A;  1U3E M;  3HRU A;  1PP8 F;  3HM5 A;  3ZMD A;  2NVY J;  3BG3 A;  2VQL A;  3S2D J;  3KZY A;  3P9C A;  3WGH A;  1QZY A;  1VQP I;  1XGM A;  3KYD B;  2R7Q A;  2WV0 A;  2Z9O A;  3LQR A;  1WJA A;  4ENJ A;  4B3A A;  1LB2 A;  2OZU A;  4AU7 A;  1B1B A;  1W1W E;  2V1N A;  1YO5 C;  3PNT A;  2MG4 A;  4DYR A;  3EPZ A;  3HOS A;  3IAS 2;  3DBR B;  1WRJ A;  3DTK A;  2MH9 A;  3QPS A;  2ESH A;  5IYB J; 
#chains in the Genus database with same CATH homology
 1IDZ A;  2GLO A;  4C3H J;  1PUF B;  2G0E A;  4D7M A;  3D1N I;  5J1U A;  1P7I A;  3BTJ A;  3WHB A;  3PO2 J;  4MO7 A;  2N8G A;  4A3J J;  1Y1W J;  5IP9 J;  1Z0X A;  2R92 J;  1HLV A;  3UKG A;  1UG2 A;  4JX5 A;  2EZL A;  1IDY A;  5M5W J;  2YUS A;  1IGN A;  3JRF A;  1ETY A;  4MLO A;  2ID6 A;  1JJ6 C;  2DA3 A;  1B72 B;  1ITY A;  4DW6 A;  3ZQF A;  3LSR A;  2VUM J;  1A6I A;  3HBL A;  1I3Q J;  2DMN A;  1RES A;  2DMT A;  2GM4 A;  3ZQI A;  3SDG A;  2Y0S N;  3WHC A;  2LKX A;  1BW6 A;  5EZH A;  4DYC A;  4XK4 A;  1MNM C;  1ETO A;  2GBY A;  1JUP A;  4IHW A;  5EEA A;  2Y9Z A;  1JKR C;  2ECC A;  2YU9 J;  3TED A;  4W1U A;  1FIP A;  4D5C A;  5FKO A;  5J1R A;  4V2G A;  3BTC A;  3TP0 A;  3JRI A;  2NS8 A;  1YRN B;  2FX0 A;  1JTY A;  2X48 A;  3RQI A;  2DA6 A;  1GV5 A;  3Q0W A;  4ABZ A;  1RET A;  3JRE A;  3JR9 A;  1ZGW A;  1MH3 A;  4M3G A;  4BBS J;  4XRS A;  1UMQ A;  4Y7N J;  9ANT A;  1FTZ A;  2E2H J;  2M0C A;  3BR6 A;  2OF7 A;  3HEF A;  3ZOB A;  3OOU A;  5EG0 A;  3PO3 J;  4CYC B;  2XRL A;  2D5V A;  1H8A C;  5GP9 A;  1MBE A;  1JT0 A;  2DMQ A;  4BY1 J;  2L7M P;  1U8B A;  2VKE A;  5EDN A;  1QVU A;  2VPR A;  1IG7 A;  2L0K A;  4M3B A;  3L1P A;  2L7Z A;  3S16 J;  3SJM A;  1X2N A;  5IOY A;  3A03 A;  2DJN A;  3E7L A;  3QQA A;  1BL0 A;  3GTM J;  1HOM A;  1W0T A;  3I4N J;  2AHQ A;  2LVS A;  1Z77 A;  1JKP C;  3G1O A;  2FJ1 A;  5FLM J;  2O8K A;  1YRN A;  4A3E J;  1K61 A;  2DN0 A;  1B8I B;  2IBD A;  1LFB A;  4I76 A;  2LTP A;  4M6V A;  4AYB N;  3HOU J;  2NVQ J;  5F0C A;  2XSD C;  2K40 A;  1ETX A;  3HB9 A;  2HOA A;  1JJ8 C;  3I4M J;  1ZK8 A;  2ID3 A;  5DTD A;  5FKN A;  4D5F A;  3DCF A;  1GVD A;  3CDL A;  1ETQ A;  4AC0 A;  3BQZ A;  1QVT A;  3GTO J;  2HDD A;  4DZJ A;  3GTP J;  2LK2 A;  4A3G J;  1JKQ C;  4QSH A;  5JLW A;  4DYQ A;  1UHS A;  2R93 J;  2JA5 J;  4A3L J;  4XRM A;  5IP7 J;  4W97 A;  3A01 B;  2IAI A;  5K7F A;  3JRD A;  1TWA J;  3JRB A;  4FTH A;  2WB1 N;  3Q0V A;  4J19 A;  1B8I A;  1XC5 A;  1A5J A;  1AU7 A;  4GFB A;  3BR0 A;  1F36 A;  2LFB A;  5IPA A;  3C2B A;  2XGD A;  4XRS G;  5E3M A;  2NVX J;  2DA7 A;  3FK6 A;  1LE8 A;  5K7H A;  4JX4 A;  2EH3 A;  3MN2 A;  1GDT A;  4B4C A;  2TRT A;  4XID A;  2ME0 A;  2K9S A;  1TWG J;  2MSY A;  2LD5 A;  3BTL A;  2DA2 A;  3G1M A;  1MBH A;  5M5X J;  1MSF C;  2PMZ N;  4XIC A;  1NK2 P;  1VF9 A;  2COB A;  3BR5 A;  1O4X A;  4IHX A;  5EZG A;  1VFC A;  3K2A A;  3S1M J;  4BXX J;  5F08 A;  3BT9 A;  4C2M J;  1MBK A;  3B6A A;  3IH4 A;  2B63 J;  2Y9Y A;  4IHY A;  1HF0 A;  2HI3 A;  3JRG A;  5JLX A;  4DZP A;  2JK3 A;  1PUF A;  1S7E A;  2CQQ A;  2MGQ A;  1SFO J;  5K7Z A;  4A3D J;  5GPA A;  1I6H J;  1POG A;  2Y31 A;  1T56 A;  5EGO B;  1FTT A;  2JJ7 A;  4RDU A;  4UUT A;  1TWH J;  2TCT A;  2ECB A;  5C4X J;  3BR2 A;  2ELK A;  5FKL A;  2WV1 A;  3M4O J;  2EBI A;  2JMW A;  4L5E A;  1Y1V J;  2DA1 A;  3TW6 A;  3JRA A;  1OFC X;  1G2H A;  2EQR A;  1B72 A;  4V2F A;  2KT0 A;  1BW5 A;  4C3J J;  2DA4 A;  1ZKG A;  3BR3 A;  3ZQL A;  2JA6 J;  1E3O C;  2VI6 A;  3NAR A;  1RPW A;  1ZTR A;  4MFD A;  1W0U A;  2CQX A;  2XGE A;  1ETV A;  3HOY J;  1JKO C;  1MSE C;  3IH2 A;  1TWF J;  3IH3 A;  1BJZ A;  3S14 J;  2R5Y B;  1T33 A;  1U9O A;  2JWT A;  2E2I J;  3B6C A;  1AKH B;  2IEK A;  2R5Z B;  4RBO A;  2Y2Z A;  2R0Q C;  1QPI A;  1FEX A;  5M3M J;  3LNQ A;  1MBG A;  4M3E A;  5EGO A;  1IRZ A;  3F0C A;  2EZI A;  2DTZ A;  1ZQ3 P;  2R7Z J;  4JYK A;  2YS9 A;  4A3K J;  3QPL A;  4FIS A;  2WAQ N;  1VND A;  3Q0U A;  5C3E J;  3G1L A;  3S2H J;  4JP0 A;  3RZD J;  3LSJ A;  1OCT C;  1K83 J;  1H89 C;  1U78 A;  2E19 A;  2NS7 A;  1MH4 A;  2LY9 A;  4CYC A;  1ENH A;  3BTI A;  4B1R A;  1H88 C;  1WGX A;  3W6V A;  1APL C;  5F27 A;  5E3O A;  2XPV A;  2R5Y A;  1GV2 A;  1X2M A;  1R9T J;  1QRY A;  2VKV A;  1FJL A;  2R5Z A;  2K9Q A;  1IUF A;  3H0G J;  4FE4 A;  3GTQ J;  2O9L A;  2P81 A;  1NK3 P;  1TWC J;  3BR1 A;  2LP0 A;  1WCM J;  5BNG A;  3S1Q J;  3CCY A;  3GTG J;  4UUS B;  1Q1V A;  2HXI A;  1RKT A;  2I10 A;  1HCR A;  1RR7 A;  2JN6 A;  3MKL A;  2HOT A;  1TC3 C;  2HYJ A;  5J1Y A;  3TP3 A;  1RKW A;  1DU0 A;  3HGG A;  5IYC J;  5FKK A;  5EYR A;  2NVT J;  1XG1 A;  4A3F J;  2W48 A;  4A93 J;  2X9D A;  1EF4 A;  4A3I J;  4EEF G;  2K9N A;  5EF6 A;  2AO9 A;  3IV5 A;  2XGC A;  1VI0 A;  2XPU A;  2H8R A;  1AHD P;  2LLK A;  2XPW A;  3S15 J;  2QF7 A;  3ZQG A;  1IC8 A;  2ME6 A;  3SFI A;  4X6A J;  1WH5 A;  5C4J J;  1ZR4 A;  5IYD J;  3FKI J;  3A01 A;  2EZH A;  3LSG A;  1MBJ A;  2CJJ A;  4M3F A;  5GPC A;  3JRC A;  3OIO A;  2O7O A;  5IOZ A;  1OCP A;  4MFE A;  3DEW A;  2CU7 A;  3Q3S A;  2HXO A;  3TW7 A;  3RZO J;  4UUS A;  1JUM A;  3HGY A;  4FCY A;  1HDP A;  4IEJ A;  3BG9 A;  5EG0 B;  4JX6 A;  5F04 A;  4G12 A;  3LSP A;  3HOV J;  5DS9 A;  3RKQ A;  3FIS A;  1CQT A;  3A02 A;  5F0H A;  3JRH A;  5FKM A;  3S17 J;  3GTL J;  4BKX A;  2XB0 X;  2E2J J;  3CMY A;  4QTR A;  4Y52 J;  1OJL A;  1GT0 C;  3NAU A;  3FIW A;  3OSG A;  1NTC A;  5FJ8 J;  2L7F P;  1DU6 A;  1JUS A;  3GTJ J;  5J3L A;  3ZQH A;  4NDL A;  3ZQC A;  1WPK A;  4QIW N;  1F43 A;  2H1K A;  2X6O A;  4M3D A;  3GBG A;  2HOS A;  1WI3 A;  3MVP A;  4A69 C;  2CUE A;  2XB5 A;  1BA5 A;  5F1J A;  2DA5 A;  2HQ5 A;  3BQY A;  3S1N J;  1X58 A;  1IV6 A;  5M3F J;  4AUX A;  4S0H B;  4C3I J;  2CUF A;  2M8G X;  2M34 A;  4MIM A;  1ETW A;  1HDD C;  4I6Z A;  2RAE A;  1JT6 A;  4A3C J;  1U9N A;  5HOD A;  2JA8 J;  2L9R A;  2KDZ A;  5FLV A;  1WH7 A;  2EZK A;  2ZB9 A;  5F0F A;  4A3M J;  4A3B J;  4IHV A;  4FE7 A;  3HOW J;  3H3V K;  1ETK A;  3BG5 A;  2CRG A;  1D5Y A;  2FD5 A;  2QCO A;  3VPR A;  3LOC A;  2OPT A;  2DMU A;  4D7N A;  3OSF A;  1JTX A;  1IJW C;  1SAN A;  3HDD A;  2NOG A;  2LR8 A;  1ZR2 A;  3S1R J;  1AKH A;  5M5Y J;  3HKZ N;  1ORK A;  3PM1 A;  3K7A J;  2M2E A;  3HOX J;  2FQ4 A;  1JGG A;  3O8G A;  1LE8 B;  3HM5 A;  2NVY J;  3BG3 A;  2E1O A;  4HNV A;  1P7J A;  3FK7 A;  4BBR J;  4LOC A;  3S2D J;  3CQZ J;  3M3Y J;  2JA7 J;  3HOZ J;  5C44 J;  2M9H A;  2DMP A;  1XS9 A;  5IP6 A;  5E3N A;  1LFU P;  3GTK J;  2Y30 A;  1MBF A;  5E3L A;  4B3A A;  4X1E A;  1FIA A;  2MG4 A;  4DYR A;  1GUU A;  1I50 J;  3O8H A;  3QPS A;  2MW8 A;  4BY7 J;  5IYB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...