3PO3J

Arrested rna polymerase ii reactivation intermediate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3po3J00
5JLWA 1JJ6C 3DCFA 3UKGA 1H89C 4RBOA 1X58A 1FTZA 5IP6A 3IH2A 2FQ4A 2D5VA 2H1KA 5C4XJ 1LFBA 1XG1A 1NK3P 3FKIJ 3PO3J 4QSHA 3BTLA 4BBSJ 2X6OA 1MBKA 4ABZA 5K7FA 1BL0A 3OSGA 3TW6A 1LE8A 5IOZA 2Y31A 1UG2A 5K7ZA 1ETWA 2XGDA 2R92J 4UUSA 3GTJJ 4JX6A 2DA6A 3Q0WA 4I76A 4C2MJ 2LLKA 4JYKA 2VI6A 1ORKA 3O8GA 3ZQFA 1ETKA 2E2HJ 3CDLA 4FCYA 4BY7J 2H8RA 4MLOA 1ZR4A 1HF0A 4D7MA 1PUFB 4W1UA 5FKLA 2EZHA 2LFBA 3JRBA 2ID3A 2XGCA 1R9TJ 4XK4A 4DZPA 4A3JJ 2TCTA 3CMYA 4A3MJ 2R93J 2Y2ZA 3SFIA 3C2BA 3G1LA 1P7JA 3HOXJ 1VNDA 1U8BA 5FKKA 2JA8J 1RR7A 2IAIA 5F08A 1JTXA 1AHDP 5F0FA 3GTPJ 4DYRA 2L9RA 2M0CA 4BBRJ 4D5CA 1HDPA 5E3MA 3TP0A 3S1NJ 2VKVA 1OFCX 4NDLA 2HXIA 2Y0SN 3BTJA 1F43A 1QVUA 3BR6A 4B4CA 2DTZA 3BR2A 3BG9A 5M5YJ 4XRSG 5EYRA 1MSFC 2OF7A 2M2EA 3S2DJ 1O4XA 4A3DJ 3LSPA 4QIWN 4HNVA 1JKQC 1IDZA 3GTMJ 3FK7A 1FIAA 2R7ZJ 5J1YA 3WHBA 1UHSA 3HB9A 1MH4A 2GBYA 3FISA 3JRFA 1JUMA 1X2MA 3B6CA 3Q0UA 1I6HJ 1NK2P 2P81A 3MN2A 1D5YA 2WAQN 1MSEC 2Y9YA 2O7OA 4IHVA 4CYCA 4JX4A 1UMQA 4B1RA 4A3KJ 3HGGA 1H8AC 1FIPA 3GTKJ 4UUTA 3A03A 5F04A 3SDGA 2DA3A 3ZOBA 2JK3A 2CRGA 3HBLA 3LNQA 5DS9A 3NARA 4IHWA 5IP7J 1ETYA 2AO9A 3BG5A 1JJ8C 5M5XJ 1VI0A 3S15J 2HXOA 2XGEA 3HEFA 1IRZA 2MG4A 2XPUA 4M3BA 1RESA 4D7NA 3FK6A 2R5ZB 2YS9A 2XRLA 1K83J 3M3YJ 2JWTA 4XIDA 3BTIA 2ME6A 4QTRA 3BR3A 3ZQGA 1IDYA 1GVDA 2DA7A 3JRHA 1TWAJ 1LFUP 2LKXA 3RZDJ 3TP3A 4B3AA 1BA5A 5E3OA 3BTCA 3S1MJ 1RKTA 3MVPA 1ZTRA 3JREA 1VF9A 3ZQLA 2XPVA 4EEFG 2LK2A 5F27A 2NVTJ 1A5JA 2EZIA 3G1MA 3A01A 1G2HA 1XC5A 3OSFA 3HOVJ 2DMUA 2KT0A 3BQYA 3E7LA 1MBFA 3OIOA 5HODA 4FTHA 1IV6A 1FJLA 5C44J 5IPAA 4CYCB 2L7ZA 2JN6A 2IBDA 2DMTA 2IEKA 1JT6A 1IGNA 2GLOA 1TWFJ 5GPAA 5C3EJ 2AHQA 1AKHA 2M9HA 2YUSA 2JJ7A 4A3LJ 2O9LA 1BJZA 2DMQA 3BG3A 5EZHA 3CCYA 1BW6A 1T33A 2I10A 5E3NA 1FEXA 4IHXA 2OPTA 3K7AJ 1MBGA 1QRYA 3BT9A 4M3EA 2NVYJ 1YRNB 2HQ5A 3H0GJ 2DA1A 2LD5A 2WB1N 1HDDC 2QF7A 2X48A 1SFOJ 2DA2A 1OCTC 1DU0A 1U9NA 5IYCJ 5GP9A 3GTLJ 2CUEA 3A02A 1AU7A 9ANTA 2DMNA 2LTPA 5EGOA 4X6AJ 4S0HB 3BQZA 1BW5A 4A3GJ 3JRGA 3HOWJ 5F1JA 4MIMA 1LE8B 4Y7NJ 3A01B 4A3CJ 2YU9J 1H88C 3ZQIA 1IC8A 4UUSB 1T56A 2NS7A 3BR1A 1Y1WJ 1WH7A 2MSYA 1Y1VJ 4L5EA 2XB5A 3PM1A 5M3MJ 5IYBJ 4DYQA 2K9QA 4XRSA 4MFEA 1K61A 3IV5A 1QPIA 3VPRA 1SANA 4X1EA 2E19A 3IH4A 1JKOC 1P7IA 2EQRA 2JA7J 4J19A 4D5FA 1MBJA 2NS8A 2RAEA 1OCPA 5IP9J 3S16J 1TWHJ 2FX0A 2VPRA 1RKWA 2M8GX 3HOZJ 1TWGJ 1WCMJ 4JX5A 5C4JJ 1JKRC 4DYCA 2KDZA 2R5YA 4A93J 1OJLA 3GBGA 4A3IJ 4A3EJ 2XSDC 1HLVA 3RKQA 3Q3SA 4IEJA 1JUSA 3QPSA 2FD5A 4M3FA 3HOYJ 1PUFA 2NVXJ 1W0TA 2VUMJ 2NOGA 3W6VA 2X9DA 2XPWA 1ZR2A 4V2FA 5IOYA 1FTTA 1ENHA 5EGOB 2L7MP 2CU7A 4A3FJ 3GTOJ 4M3GA 2EH3A 4XRMA 5J1RA 1ZKGA 2ECCA 3RQIA 4AC0A 3LSRA 3LSGA 1WPKA 1ZQ3P 3LOCA 3JRAA 3S14J 3HDDA 1ETQA 2TRTA 1Z77A 1A6IA 1MNMC 5FJ8J 2L0KA 1GT0C 3OOUA 1VFCA 1APLC 4G12A 3GTQJ 3K2AA 1WH5A 1ZGWA 4BXXJ 3B6AA 2K40A 2WV1A 3FIWA 3RZOJ 5J1UA 2M34A 2DJNA 2HDDA 5GPCA 1S7EA 4LOCA 3JRCA 1Z0XA 3CQZJ 3HKZN 2COBA 5FKNA 1B72A 3HGYA 2L7FP 1X2NA 1TWCJ 2CJJA 1GV2A 4FE7A 1Q1VA 2ZB9A 1GUUA 1E3OC 3DEWA 5BNGA 2MW8A 2Y9ZA 1RETA 2R5YB 2EZLA 1MBHA 4JP0A 1HCRA 3SJMA 5F0CA 3JRIA 1ITYA 2QCOA 2LP0A 3MKLA 4DW6A 2E1OA 4AUXA 1WGXA 5EG0A 2VKEA 2W48A 5JLXA 1W0UA 3D1NI 3S1QJ 1B8IA 1CQTA 1XS9A 3GTGJ 4Y52J 1ZK8A 2EBIA 1GDTA 5DTDA 1U9OA 4C3JJ 2XB0X 4V2GA 2LY9A 2K9NA 3I4NJ 2E2IJ 2JA6J 1JTYA 4XICA 3QPLA 3NAUA 3ZQHA 1JKPC 3JRDA 5EF6A 4C3IJ 1I3QJ 2DMPA 2JA5J 5FLMJ 1MBEA 5M5WJ 1WI3A 2DN0A 3O8HA 5FLVA 5M3FJ 4W97A 2JMWA 3S17J 2ECBA 2R5ZA 3HOUJ 2K9SA 2EZKA 4IHYA 1HOMA 3M4OJ 2LR8A 5K7HA 5EDNA 3BR0A 5E3LA 1B72B 1NTCA 1ETVA 2ID6A 5FKOA 1MH3A 5F0HA 2DA4A 2HOTA 2CUFA 1JT0A 2E2JJ 2CQXA 3I4MJ 3TW7A 4BKXA 1AKHB 3F0CA 1POGA 3LSJA 1JUPA 3H3VK 3BR5A 2HI3A 1EF4A 4A3BJ 5IYDJ 2HOSA 3PO2J 2MGQA 2LVSA 4MFDA 2R0QC 4C3HJ 5EG0B 4I6ZA 2B63J 3S2HJ 4RDUA 4DZJA 3IH3A 1I50J 4FE4A 2DA5A 3JR9A 4GFBA 1B8IB 3G1OA 2CQQA 5FKMA 1DU6A 1IUFA 3S1RJ 2ME0A 2N8GA 3ZQCA 1QVTA 1U78A 2FJ1A 5J3LA 2NVQJ 4M3DA 4FISA 2G0EA 4A69C 1IG7A 2HYJA 2PMZN 1YRNA 3Q0VA 4M6VA 5EEAA 1F36A 2Y30A 2GM4A 2ELKA 3QQAA 3TEDA 4AYBN 2HOAA 3L1PA 4BY1J 1IJWC 4MO7A 3HM5A 1JGGA 1ETOA 5EZGA 2O8KA 1ETXA 3WHCA 1TC3C 1RPWA 1GV5A
chains in the Genus database with same CATH superfamily
5ILUA 1R58A 1H89C 3LSKA 4I02A 3HSFA 2GXBA 4YIIA 2DW4A 2RDPA 2VLAA 5CPRB 3IH2A 1CF7B 2D5VA 4BL0B 1ZARA 2EB7A 3FXOA 3QWLA 3R6SA 1ZHFA 1KYWA 5J8FA 1H0MA 2EK5A 3BTLA 4QSHA 1I1SA 2WWYA 4BE0A 3LA2A 4AD9A 1BL0A 3TW6A 4O5VA 3F22A 3IRRA 2M45A 2Y31A 5K7ZA 3VB2A 2R92J 5CQEA 1T8IA 3EYYA 1R4NB 2FMYA 3F8NA 1G4DA 4CXFA 1ORKA 1BM9A 3TKYA 1ETKA 4FCYA 5GTIC 2BY0A 4U88A 2ZSIB 4W1UA 3NQOA 1FBQA 2HTJA 3PSFA 4BEHA 4CZZA 3MFKA 4UV9A 2CW0F 5EEHA 4XK4A 1B1BA 2QM3A 1OKRA 3GFIA 1LEBA 3I64A 2JZYA 3SFIA 1AOYA 1P7JA 3FMQA 4ZZLA 1EKEA 1LDKB 4EV0A 3OS1A 2JA8J 1RR7A 1MGTA 2KKOA 2IAIA 4HAMA 1SMYF 5F08A 3MKWB 2L02A 3BPVA 3I53A 1AHDP 2IS1A 1OYWA 2L9RA 3Q9VA 2KFDA 4OINF 4ESFA 1WI9A 5E17F 5E3MA 3CDHA 3P5JA 3TP0A 2M0MA 1AA7A 2M4KA 1WJCA 1E2XA 1TLHB 3BOQA 3K1NA 2K4BA 3BR2A 2EJRA 3BG9A 5M5YJ 3RQ4A 3WU2C 1YFHA 1ZLKA 4HF2A 1E3HA 1YE9A 2NRAC 2M5WA 2OF7A 3MCZA 3S2DJ 3HXLA 1UHMA 4HNVA 1S72I 4G7HF 3L9FA 3DU6A 4XN3A 1B9MA 3WTSC 1FIAA 2PEXA 2V1DA 5L3DA 5K1YA 1G3SA 2FRHA 5JVGF 4XM3A 3KFWX 2K5CA 3FDYA 1B6AA 2JA2A 4U7DA 4HV5A 5L3BA 3K10A 4A6EA 2BY2A 5CVRA 1NK2P 2P81A 1D5YA 2JUGA 5FB2A 2R7OA 1UMQA 2JRMA 3TGNA 3HGGA 2GQQA 1FIPA 2CS3A 2K86A 1YO5C 1MJBA 1IF1A 5J4VA 2Z33A 4LG0B 1SFKA 3OOPA 1Y6IA 4HSTA 4MQ9F 4AWXB 3IRQA 3SDGA 4HV6A 3ZQQA 1ETYA 2Z3YA 1TW2A 1K6YA 3GZNB 1JJ8C 3K4LA 3FMSA 3VSLA 4PK4A 4LJZF 4BAYA 2M87A 3FK6A 2FBIA 2VE8A 2C6YA 4P96A 4IO9F 2A6HF 2O0YA 4II2A 1WJ5A 3M3YJ 2XSJC 1Z9CA 3BTIA 1KQ0A 4H4KC 2PBIA 4A5NA 2DA7A 4KN7X 1TWAJ 3JRHA 3FHZA 1TL8A 1HSJA 2QSFX 4E7ZA 1BA5A 1FP1D 1G8XA 3BTCA 3DBHB 5LEKA 3Q5FA 3F3XA 2KPMA 3MVPA 1ZTRA 5HNHA 3ISPA 2A07F 3JAMZ 1VF9A 3VSKA 3EETA 4WXHA 4EEFG 2LK2A 3OYEA 2EZIA 5LRSA 3A01A 1XDUA 2E34A 5HS9A 4EQQA 3OSFA 2MYSA 2DMUA 2KT0A 3BQYA 3OYLA 5HODA 2JQ7A 1YS7A 2QZ8A 2CO5A 1OYIA 3ZN1A 1V5FA 1XMKA 2JN6A 3DQVC 2IEKA 2DK5A 3JCUC 5E1XA 3DXJF 3WU0A 1YYVA 2LSOA 5J4YA 5CYVA 3PUFA 4G94A 1EH8A 4NC6A 1OCZH 1YJWI 4G7OF 1BJZA 4E4HA 3EUHC 1FSHA 5EZHA 2XV4S 2V6CA 1VQMI 2V4JC 3ZGKA 2DTRA 1YQAA 3E3VA 3U21A 3OIPA 4ZYHA 4H0EA 4LB5A 2HVQA 2R7FA 2NAZA 1QRYA 4XBFA 2DPUA 2UXNA 2NVYJ 3MZ8A 3HTSB 3PJRA 4OMYA 1YRNB 1QZZA 2HVSA 2DA1A 1ZYRF 5HOOA 4O3MA 4LB6B 1LVAA 2HFHA 3RYPA 1DU0A 4UY8I 1U9NA 5IYCJ 4AIJA 2DFIA 3CUQC 3QOPA 5GP9A 3GTLJ 9ANTA 2DMNA 4MEXF 3CJTB 4N4NB 4X6AJ 4S0HB 2ACJA 1F1ZA 3I59B 4LGWA 2VN2A 2AQFA 4KT6A 3MQ0A 5ICCA 2R7RA 2OQRA 5J47A 3A01B 4AIHA 2B9SA 3BCAA 4UUSB 2NS7A 1IXSB 2VC0A 2XB5A 5IYBJ 4DYQA 2K9QA 3IV5A 1R71A 3HPHA 3HOSA 1P7IA 1W36C 1PDNC 2EQRA 3MD2A 3RYRA 2RNJA 2NS8A 2PQ8A 3CO6C 3J7AO 1QBJA 3ABTA 3CJNA 2P6TA 2VPRA 1D0YA 1RUOA 1J5YA 4IOCF 1F4KA 2QGUA 5FLXK 2LH9A 4DYCA 4EATA 2KDZA 2O8XA 1OJLA 2K02A 3GBGA 4RAYA 2ICWG 3OWTA 1WHUA 4KITB 3HPGA 2XSDC 1HLVA 4ZDOA 4A0YA 2CUJA 3Q3SA 2KJBA 1SAXA 4XKBA 3DEUA 4YELA 1FOWA 4BYYA 2TDXA 1N25A 2AQEA 2YX7A 3QU3A 2R7TA 1VQ7I 2XPWA 3COAC 3BJ6A 2DCEA 1ENHA 1R5HA 2L7MP 3NWTA 1IRXA 3L2UA 2QA4I 3GTOJ 2FBHA 4PGHA 1ZKGA 2ECCA 3RQIA 4AC0A 3LSGA 3DWLE 5HLTA 1MKMA 2PMUA 3PIPF 4E7KA 2HDCA 2PJRA 5HDKA 1UB9A 3JRAA 1W4MA 3CO7C 1IUYA 2XIGA 1KU9A 1DUXC 4A6DA 5GTHC 1A6IA 5FFXA 5FJ8J 3J80K 1YW8A 1VFCA 4PGGA 3LQRA 1RR8C 5K5RA 2Q8KA 2EFPA 3W6JB 5ED4A 4WK8F 1ZREA 1ZGWA 2WV1A 2Y75A 3RZOJ 3QYBA 5GPCA 3HKZN 5LHGA 3A2KA 3HGYA 2IGOA 1T2KA 1WJEA 3DP7A 1X2NA 2CJJA 1Q1VA 2K3PA 3WGGA 2OTJI 2LKSA 3S3NA 2ETHA 5ERIA 4XKWA 1D8KA 1XGMA 5L3FA 1WVRA 1R5GA 2LP0A 1KONA 1D1CA 1XGNA 2VKEA 3RDIA 3G3ZA 4RB2C 1R1TA 1KQ8A 2BY1A 2BOLA 1SEUA 2W48A 2CMPA 1W0UA 2LOOA 4XLPF 3S3OA 1B8IA 1LDDA 4Y15A 4Y52J 2BV6A 1ZK8A 4K2EA 2V6EA 3RCOA 2IS2A 4CA0A 3PNTA 3ABUA 2BVLA 2CWEA 5F1RA 4BH9A 2LY9A 5HS8A 3I4NJ 2JA6J 4XICA 1B4AA 1JKPC 1S5LC 2IW5A 2Z99A 3LA3A 5EF6A 2PJRB 1IZ1A 1IN8A 2OD5A 1SFEA 2DMPA 1X1CA 3E6MA 3S3MA 1WI3A 3I55I 2VJ4A 3O8HA 3VDXA 4PJLA 4HLXA 3V7CA 1LKXA 3IC7A 2K9SA 3IKVA 2EZKA 4EMSA 3FF5A 3SFZA 1FBSA 3JSOA 3S2WA 1KYZA 2Z2SB 2FXAA 3PQKA 3DKXA 3OYIA 3ABKH 3I4PA 2EWNA 2UUZA 1NTCA 1ETVA 3GX4X 2BW3A 4HOBA 3I54A 2DA4A 3CC7I 2HOTA 3GXOA 1IN5A 2DDBA 1ZRDA 5IT9K 4XOPA 4EJTA 2A61A 4MTEA 3LSJA 2DFHA 2M7BA 2R7VA 1FP2A 2D1VA 1EF4A 3PO2J 2R0QC 2LVSA 2Q1ZB 2YPRA 4C3HJ 3H0DA 1UG0A 3LFKA 1QA6A 3IH3A 4C2UA 2XAHA 3HJEA 3SZGA 1B8IB 3G1OA 2L9SA 1FYKA 4G7ZF 5LGNA 4EJWA 3L2VA 1IUFA 1R00A 2ME0A 2HYFA 3QODA 3LFUA 2VC1A 3PL8A 1ZH5A 1Y39A 1FT9A 1STZA 1T0FA 3FZVA 1IRGA 1FBUA 3HZJA 1IXRC 4NQWA 3VYUB 4FISA 1W5SA 3IWFA 4E7IA 1IG7A 4ZTJA 4XMYA 3HIFA 1KA8A 3ESWB 3FXMA 2E60A 2GM4A 1XSDA 1MMDA 4CSWA 4Y3OA 3T8TA 1BJAA 3ZMSA 3ECOA 4IRGA 4MHGA 2D2WA 3DBRB 4P1WA 1U0JA 1ETXA 4HEA2 5HS7A 1X58A 3M07A 1W1WE 1O7LA 1VTNC 1JE8A 1D5VA 2QEXI 4NC7A 2FQ4A 2BW3B 2FOKA 2JVHA 2H1KA 3K70D 3WTVC 5HLIA 1LFBA 1XG1A 3LQQA 3FKIJ 3R61A 4PCQA 4RB3C 2IT0A 4BBSJ 2X6OA 2DAOA 2O61A 3OIQA 3ZCOA 2WTEA 1QO0D 3V8JA 4P9UA 1UG2A 2F5FA 4UNOA 4N9HA 2EFNA 4I76A 4N4OB 2STTA 3W2VA 2DQRA 2QKMB 3V4GA 1Z21A 2EIJH 4KIBA 5LD2C 5FKLA 2LFBA 1BR4A 3JRBA 1ZELA 2QENA 4NQWB 2DFEA 2W4SA 4WX9A 4GO1A 1BBYA 3CMYA 2UWMA 3H35A 3TDUC 1YIOA 4L0YB 3HOXJ 2Z1DA 3KZYA 3AL0C 1U8BA 5FKKA 3HKZA 2YSRA 1MD0A 1DP7P 1D1BA 3CCSI 3HRSA 1RRJA 1MJAA 1V4RA 2QQ9A 4ESBA 4ANJA 4XL9A 6PAXA 1OR7C 3KCCA 3GUDA 4RAZA 5CJ9A 4FT8A 2VKVA 2BZTA 1MZBA 1TBXA 4LITA 3RIRA 4PJJA 1MJ9A 4DGWB 5A2QZ 1X1PA 2Y0SN 3BTJA 4EGZA 1EH7A 2I8DA 3R60A 4FX0A 1QVUA 2ZJRF 3ASOH 3K4CA 4B4CA 4PJNA 3HUGA 2DTZA 4KICA 4BHBA 1FOXA 2G7UA 3GEZA 4F3QA 3K4MA 3ZP5A 4A3DJ 4OU0A 4QIWN 3JTGA 2PMHA 5L3EA 3J81Z 1IDZA 2IPQX 1YG2A 4NB5A 4B09A 4IOAF 3OYBA 2R7ZJ 1LJ9A 3OL4A 1QQIA 4HX8A 1XN7A 5KAIC 3HB9A 1MH4A 2W24A 3GO5A 1FYLA 4KMFA 1WZ2A 1FX7A 1Y56A 1Q1HA 2E5NA 2HNHA 4XQFA 3V8KA 4OAYA 3B6CA 2KRCA 2J5OA 3PSIA 4YEJA 2UZKA 3C2GA 2WAQN 2ZO4A 2KIMA 2O7OA 2L3DA 1RI7A 3KP4A 1EV7A 3VWBA 2FNAA 3GTKJ 1U5TA 1Z7UA 4TV7A 5ICFA 3GFLA 3A03A 3HRMA 4RM3A 1USTA 1TQMA 4BS9A 4GCVA 3M1CA 4XKCA 2CRGA 5DS9A 5ICEA 1OCCH 3NWSA 4E70A 2W7NA 1LUJB 1ZG5A 4IHTA 4HQEA 4HZFA 1VI0A 5DUIA 5FRNA 1IRZA 1RESA 2VQLA 3ABMH 1MMAA 2ZXIA 5GAEJ 3X2QH 2R5ZB 4ESJA 2H94A 2XRLA 3REOA 3M9AA 2JWTA 2JSCA 1H9GA 5DM7F 3HUGB 2DOAA 3BR3A 3DEEA 4U87A 3H9QA 3ZQGA 4HF1A 4S05A 1IDYA 2HZDA 2W1OA 3AL0B 1LFUP 1R23A 2ZSHB 2MBFA 3SHFA 2CV2A 1ZG1A 1UZCA 2DYSH 3K1PA 3TP3A 1W7PD 3U9GA 3LMMA 3FWEA 3S1MJ 5DD8A 1RKTA 1V5GA 3CESA 4BNCA 1V5EA 3HRUA 5F27A 2NVTJ 2VB6A 2CV0A 1JHHA 1G2HA 2RVCA 1QHGA 2O6GE 3HHGA 2EV6A 2BBYA 3JSPA 1GVJA 1VQ5I 2KL4A 3VODA 2VBZA 5JHUA 4FTHA 4MNUA 3BDDA 1FJLA 5C44J 4XLAA 1YW7A 2L7ZA 2GXAA 1IXCA 2DMTA 5CLSA 3KP5A 4L9NA 3GF2A 1YS6A 3F9KA 2W25A 2KZVA 5GPAA 5LRRA 3LSHA 2AHQA 3OYCA 4BE2A 2HU9A 1XSXA 4A3LJ 3LL7A 1KGSA 3BG3A 2Q0OA 1BW6A 1T33A 2M7AA 2RQPA 5D8KB 4WCGA 3ZPLA 4IHXA 2OPTA 3K7AJ 1ON2A 1DPRA 4BQAA 3N97A 2VT2A 2IP2A 3U2RA 2HPIA 4PFPA 1N75A 2HQ5A 2ZFUA 2OTLI 1A6QA 2RGVA 3IHUA 2BXYA 2H27A 2VQCA 3OS2A 3H0GJ 3A4CA 1D0XA 2WB1N 2LD5A 2GIVA 2QF7A 4EM0B 2L4MA 2F5CA 1SFOJ 2DA2A 1OCTC 4IPAA 2ZFWA 2CQNA 4A12A 1J75A 3JAMK 1EH6A 5FD5A 2LTPA 2QKLB 5EGOA 2WV0A 2HTSA 1N77A 2FSWA 3LWFA 4M6XA 2K27A 1HW1A 1NHAA 4F52A 3HOWJ 2Y48A 4V19K 1TT0A 1K6OA 3L2CA 4Z6YA 1T95A 4CZCA 1OCOH 2LY2A 2QLZA 1H88C 4ITVA 1UAAA 4WWCA 1T56A 1Y1WJ 3CJRB 2CFXA 2L54A 1WH7A 2R7XA 3BZ6A 3PFIA 3QPTA 2X85A 3BG7A 1CGPA 4MFEA 1K61A 3OYMA 3H9GA 4J01A 1SANA 2V1UA 2E19A 2VODA 4O6JA 4BEHB 3GLLA 2JA7J 2P5KA 4D5FA 1YX5A 3DPTA 4IQ4A 2HS5A 1Y8RB 3GW2A 3S16J 4GXOA 4OIRF 1TWHJ 2Y0SA 3U1KA 3VOEA 4CCOA 1SD7A 5KAFC 1ZRCA 2E1MC 4Q5SF 2CH0A 1EA3A 5C4JJ 1JKRC 3GWZA 4HA8A 1XD7A 5KHDA 3CMEI 4A93J 3EDPA 2V9VA 2PG4A 2PLYA 1UCRA 4A3EJ 1A31A 3ROUA 3HTUA 4IEJA 3IAS2 2MLGA 2FD5A 3WTZA 3GFJA 1ODDA 2LG4A 3KE2A 4II3A 4M9ZA 3H5RA 1PUFA 2NVXJ 5AONA 4PUSA 1FLIA 4LIUA 4WXCA 4OAZA 1BN5A 3RJPA 3MZHA 3C1DA 4OMZA 1ZR2A 4V2FA 3BY6A 4M73A 5AIPA 1R36A 5EGOB 1KQ9A 4IZZA 4AVPA 4M3GA 4XRMA 3FXQA 2WAQA 1FYMA 2LY1A 3I3LA 4ENKA 1WPKA 3CJQB 2L4AA 4CCMA 2IS6A 2MC4A 2O3FA 2VOOA 2QBYA 4RAFA 1LQ1A 2XUBA 5HDGA 2HQNA 3LSMA 1O3TA 4BE1A 2CFOA 2L0KA 2XRNA 4HNUA 3OOUA 3OYKA 4BHPA 2JPCA 3GTQJ 3Q9SA 2XC7A 3B6AA 1PYVA 3ZMVA 3KEYA 2M34A 3CCLI 4ZC3A 2F48A 1VQOI 2VIXA 4LOCA 3N4MA 3ZMZA 4FQGA 3ERED 1Z7LA 2A5YB 3GYHX 3F21A 2IS4A 1OISA 4B47A 4ZDLA 1MW7A 2L7FP 1G3TA 3FBNB 4FE7A 1GV2A 4RLFA 3ULQB 2ZB9A 2XF5A 4WF2A 3BJAA 2K9MA 2F5DA 3L00A 4KT5C 5BNGA 2MW8A 2Y9ZA 4CHUA 1RETA 4LMYA 5F0CA 3JRIA 3C18A 5D6EA 2AXLA 4DW6A 2GIZA 2E1OA 2FEZA 4Q48A 3TOBA 3QRFF 2A5WA 2ADUA 4IXAA 3KLOA 5D8LB 1WKMA 5JLXA 2V7FA 4IVNA 1QU3A 3A1YA 2NVUB 1XS9A 3GTGJ 2EBIA 2WC2A 1IV8A 4KDPA 2GOMA 3BLYA 4NC8A 3RPUD 3C2HA 4C3JJ 1H9TA 5H2FC 2E1MB 2XHKA 1P9QC 2FU4A 3E5UA 3F8FA 2E2IJ 2FUG2 3QPLA 3BWGA 2LC2A 1J9IA 3FM5A 3CLQA 3JRDA 4R79A 5E8GA 3VYSB 2WAFA 2QBYB 2ZC2A 3EUKL 3J7AY 2JA5J 1OPCA 3ZMUA 5FLMJ 2OAZA 3F6VA 1DDNA 1D1AA 1LEAA 4QPOA 4KNYA 5M3FJ 4W97A 2GZWA 1U8RA 3WTYC 3S17J 2BE5F 2LRDA 2WADA 1TT5B 1R1VA 1HOMA 5E20A 3BZCA 3K70C 3M4OJ 3D0SA 2CUZA 3BR0A 4U0VA 5B3SH 5EDNA 2ID6A 3OYGA 5F0HA 4U7BA 3DU5A 2CYYA 4XSZF 4UUVA 1YJNI 2ZJPF 4JBAA 4RB1A 3CP8A 2EA2A 1JT0A 3I4MJ 1VQ9I 1MMNA 2L2OA 2M4GA 2WB1A 3K0LA 4IKFA 2PFBA 3CMMA 3MWMA 2LYCA 1JUPA 4Q4ZF 3VYTB 2IVMA 2HKOA 3E97A 4U0WA 3CMAI 2HOSA 3F8CA 1TP4A 4I6ZA 3DPLC 2MABA 2EFOA 2ZKZA 1G3YA 3JR9A 3KYCB 1P92A 3O3KA 1YOVB 2HKXA 2BHYA 1KZHA 3V7SA 3S1RJ 4KFCA 3ZQCA 2OCCH 2FJ1A 2NVQJ 5E18F 2V9PA 3A0HC 3I0TA 2A6TA 2HYGD 2G0EA 4ZYGA 3S8PA 1S7OA 3I56I 2K7LA 1ZRFA 1R22A 2EIKH 3W2WA 1F36A 4LG3A 3QQAA 1M1EB 4E6KG 2NS0A 4HNTA 4EJVA 2HOAA 3MKYB 1KU7A 4XLEA 4BY1J 1IJWC 4XR6A 3SYTA 3BJOA 4JK1X 3HM5A 1OCRH 3B02A 5EZGA 1O3SA 3GVAA 5FD6A 1JGGA 2NNNA 3EQLF 3SEQA 5GADJ 2O8KA 3WHCA 1P4XA 1OQYA 3AKZA 3GZ6A 3E6CC 1RPWA 2IGMA 2ESNA 1JJ6C 1FTZA 1SFUA 3HYIA 1LFPA 3WTTC 3H5AA 3G71I 4XOTA 5CVIA 1NK3P 3MKZA 1ULYA 3PO3J 3OS0A 1X1AA 3H3UA 4PSXA 3UR3C 3ECHA 2H6BA 4ABZA 1A04A 2YX4A 3UNGC 1R49A 1XX5A 3O2PE 5EEGA 3OSGA 2WA0A 2R7DA 4JOMA 1Y8QB 1LE8A 3T8RA 2PMZA 4M9XA 1E3PA 2DLLA 1Z91A 2XGDA 5LGUA 4D1QA 1UFMA 3GTJJ 2R4GA 1WJFA 4JX6A 5K5QA 3Q0WA 1RIOH 4C2MJ 4JYKA 4AYBA 1HC8A 3SQNA 1I6XA 4KA4A 3O8GA 3CDLA 4BY7J 2H8RA 1ZR4A 1HF0A 1RNLA 1W5TA 4D7MA 5BPIA 4RA2A 1XGOA 2K4JA 4OIQF 2HPMA 5TISC 3ZR8X 2KIUA 2RN7A 5GAGJ 2ISZA 4DZPA 4A3JJ 2TCTA 3PFYA 4HYEA 4A3MJ 3CCJI 2Y2ZA 3DF8A 3G1LA 1PJRA 5AIQA 2QSGX 4LFUA 4XSXF 2PX9A 1LB2A 1ERDA 1D8JA 1VNDA 2D1HA 2FOWA 1A35A 2JUCA 4GDFA 1JTXA 3WG7H 5BQTA 2L5QA 5FLXZ 3GTPJ 4DYRA 4RM2A 2M0CA 5JI6A 4BBRJ 2Z16A 2ELJA 2XGXA 4CCNA 1NG7A 3S1NJ 1OFCX 3SXYA 2YR2A 2QSHX 1YHQI 5LHHA 2W82A 1QZEA 4A0XA 3BR6A 1T6SA 2HGCA 1W5CC 3L2QA 1BC7C 3EUAA 1HXDA 4DBQA 4BDYA 2LMDA 5EYRA 1P4AA 1MSFC 2EA4A 2M2EA 1T0FC 1O4XA 5FGMA 3WE3A 1OMIA 1V54H 1TQPA 1FSEA 3GTMJ 1USSA 4UB8C 5CKTA 2F2EA 2P7CB 5J1YA 1LPQA 1WFXA 2A05A 2MD5A 2ZJ2A 2HZTA 2XAUA 2K3FA 3WGIA 4J00A 3FISA 5CQGA 3JRFA 2ZXWH 3V42A 1JUMA 1FZPB 1SVLA 2DO7A 2HWVA 2MD0A 5E1WA 1X2MA 1YTYA 2L01A 3TO9A 3FX3A 3MN2A 4P55A 3T1BA 4RLQA 1MSEC 1R5ID 2Y9YA 2BEOA 1MIJA 1W7PA 4IHVA 3QYEA 4JX4A 2W57A 4B1RA 4A3KJ 2ZNZA 3DBLB 4RAGA 2XAJA 1NH3A 2JK3A 3LNQA 4IHWA 2VJ5A 4DBRA 1Z1DA 2KJCA 5D4SA 1Z3YA 5HLGA 1VQNI 3H5NA 1XGSA 5M5XJ 2HXOA 2EIMH 2FMLA 2HDWA 2XGEA 3HEFA 3M1EA 4M3BA 3GMEA 2EINH 3KYDB 3T0YA 2E35A 3CCMI 3ZMDA 4JQFA 3MEXA 4G8XA 1ZG3A 2LF8A 3B73A 2ME6A 4QTRA 1JGSA 1X3WB 4KISA 5J8CA 4R8HA 4FHTA 2GOXB 2E7WA 4AU7A 4F91B 3RZDJ 2PI0A 2X1CA 1J2XA 5J6XA 4M6YA 2EILH 4E7JA 4UB6C 2DT5A 2X51A 4HDVA 1BOBA 1VQ4I 4P9FA 3QAHA 4M71A 2XPVA 2XAGA 2ESHA 1FWZA 4FETA 3CCQI 3KZIC 1XC5A 4KIGA 2V1XA 3CCVI 1QGPA 4ZYDA 3H92A 2O03A 1LVKA 3E7LA 3OYDA 1MBFA 1DP3A 2LNBA 3OIOA 2ZMEC 1E17A 3MZYA 2E71A 1K79A 1IV6A 1GHCA 1W7PB 5IPAA 3PNYA 1L0OC 2IBDA 2R3SA 1S7AA 2DOEA 2VKHA 1W36D 4BXFA 1JT6A 1IGNA 4WXDA 4KJZA 2GLOA 1TWFJ 4UXNA 1YW9A 2VOPA 2VL8A 4HX4A 4X0GA 1AKHA 2M9HA 1G59A 2LF7A 2E36A 4BHCA 3E5XA 3K6GA 4U0YA 5IT9Z 4NNJA 4ENMA 2ZXJA 3JTHA 1U2WA 5E3NA 1OLTA 3DLAA 3H36A 4CUGA 2ZMEA 3IWZA 4HQMA 1WSUA 3BT9A 4M3EA 5J40A 3ZMTA 1MNEA 2MA3A 1IN6A 3QOEA 2HEOA 3DFGA 4L0ZB 2MH2A 2HR3A 4PFOA 5F64A 2X48A 3CP2A 3MMYB 3DKWA 3WTXC 3LAJA 2CUEA 2P7VB 3A02A 2W85A 3K2ZA 4F92B 1XCVA 2G7HA 1O3RA 1BW5A 4GRIA 1GLNA 4A3GJ 2FQ3A 1U5TC 3HOTA 5F1JA 1BOAA 1XMXA 4Y7NJ 3AG2H 2YU9J 2OU2A 1KU2A 3TL4X 1IC8A 1TNSA 3BR1A 2COMA 2DFFA 3F8MA 3D5SC 1Y1VJ 1R6RA 2FA5A 3PM1A 4UV8A 4A5MA 3WG9A 3CF5F 1QPIA 4L9VA 1RUNA 5H20A 2K85A 2X1EA 5H6QA 4X1EA 2CW7A 3IH4A 1PVEA 3CLOA 1JKOC 2OZUA 4HLYA 4BJ5C 2DQLA 4DIQA 5TRDA 2RAEA 1OCPA 3OYAA 3V8LA 1WJBA 4KMUX 3BP8A 2M8GX 2F5VA 3HOZJ 2Y0MA 4DOZA 5IT3A 4JX5A 3WE2A 1P4WA 4OWRB 3G2BA 2R5YA 3C7JA 4XRFA 3MAJA 4XLNF 2R7SA 2IJLA 3TO6A 5KNLA 4A3IJ 3PUBA 2ZMEB 2QWWA 2A68F 1BIAA 1JUSA 3QPSA 3J7ZI 4HW0A 4RGRA 3HC7A 1WJAA 3H1CA 3FXUA 2X1DA 2ZNYA 3TO7A 1W0TA 2KQRA 1QPMA 2VUMJ 2NOGA 2ISYA 4EJOA 5K5OA 1Y0UA 3G73A 3VYRB 2PN6A 3C3WA 1FTTA 3ASNH 2CU7A 1VQ8I 2EH3A 5DV5A 4CICA 2R7WA 1SC7A 2DK8A 2ZXHA 3RKXA 2W00A 5DM6F 3LSRA 2H6CA 1FPQA 1UELB 3D5RC 4B8XA 1DPUA 2XDVA 1ZQ3P 4Y13A 1HKTA 3LOCA 3ERMA 5HNFA 3S14J 5DD4A 2XAFA 1ETQA 2VASA 3CCEI 2DODA 1K78A 1MNMC 2JRTA 2JT1A 1I27A 3K4JA 3AG1H 3KIOA 4RGUA 3RPUA 3CD6I 3I58A 3IKTA 3CDIA 3K2AA 4AVZA 3FIWA 3VEPA 3W2AA 2L9VA 4EM2A 5L3GA 2BGCA 2OBPA 3HSRA 3JRCA 1R1UA 4LLLA 2LREA 3CQZJ 3K9TA 2COBA 1WQ2A 5FKNA 5JHFA 3F23A 2WBMA 4OIPF 3AG4H 1QHHD 3TQNA 1S9HA 1U5TB 1TWCJ 3OYFA 3U1DA 4XONA 2WY7Q 3QP5A 5B5EC 1GUUA 1NG6A 2F5EA 2E1CA 1S29A 2R5YB 2EZLA 4KYWA 1MBHA 1ACIA 4JP0A 4I09A 1TW3A 5LBQA 1ITYA 2QCOA 4L5IA 3KEQA 3MKLA 4I99C 2H09A 2VE9A 1WGXA 3K4BA 5CVJA 2XAQA 3F72A 2M1BA 5CVUA 2DI3A 2GAUA 1X1DA 3D1NI 3S1QJ 2X0LA 1J7KA 4CGZA 3PIOF 1U9OA 2P4WA 4LG0A 4YRVA 5F6FA 2XB0X 4B43A 1FOKA 5HLHA 3CC2I 3SZPA 2Q2EA 2M3AA 4P5OA 3OYHA 3ZQHA 2BYVE 4CH7A 1FY7A 4Y4RA 4IQJA 1F9NA 5D6FA 3E1SA 3L09A 1X4PA 1Y0NA 4C2TA 1FNNA 1KU3A 3E6DA 5M5WJ 3GZ5A 1K78B 5HDNA 5LEJA 2P5LC 5EJCA 2V1NA 2JMWA 2XKOA 2AS5F 5DDGA 1O7FA 2DJIA 2F4OB 2DYRH 2ECBA 2WY8Q 1G3WA 4IHYA 4N9IA 2MH9A 1BI1A 3M8EA 1TQIA 2LR8A 4CCKA 3OL3A 1RZ4A 5FKOA 4BQQA 3HG9A 4MQVA 4RB0A 3KEOA 3WODF 2R7QA 3H3ZA 4A0ZA 3T5XA 1XSVA 2RKHA 3FHNA 3L7WA 1T39A 1HW2A 3TW7A 2IRFG 4BKXA 4PZJA 1P2FA 3NRVA 1X19A 5LLQA 2DPDA 1POGA 3H3VK 3W6KB 1SAUA 2DXIA 5IYDJ 2L9NA 1S8NA 4MFDA 1Z3XA 2LKPA 2ELHA 4FX4A 2XROA 3P9KA 1IN7A 3FXJA 1VZ0A 4IJAA 3WGHA 4CYDA 4DZJA 2DA5A 2STWA 1I1GA 4I0BA 2X6WA 4L5JA 1R7JA 2CQQA 3FM3A 1MDMA 5FKMA 1U3EM 5D5XB 4YFKF 1DU6A 1E0EA 5BS6A 2P5VA 4AIKA 3AG3H 1QVTA 1G6NA 5TJJA 1F5TA 4PDKA 3GLXA 5J3LA 3IL2A 3KP2A 4M3DA 3CCUI 3QP6A 4UVCA 4G6DA 1FMVA 2Q2EB 2HVRA 2KIQA 4A69C 2HYJA 2PMZN 3Q0VA 4M6VA 2P0WA 2Y30A 4ENNA 4L18B 2ELKA 1HKQA 1K4TA 5LFAA 2RREA 4RGXA 4AYBN 4BUPA 1X3ZB 3E0JB 5L3CA 3J7YJ 3L1PA 1VQLI 2LBFA 5LHIA 4MO7A 2B7EA 2JVGA 4BQOA 2EV0A 1ETOA 1SD5A 3W3CA 2KDOA 3IAM2 5BOXA 4ZTFA 1YRNA 4UVAA 1P6RA 5JLWA 1YIJI 1DGRM 5CVVA 3DCFA 3V7RA 3UKGA 4RBOA 5IP6A 3OYNA 2VBYA 3CZ6A 4HG2A 3H9JA 5DUKA 2Y69H 4FASD 4BGDA 5C4XJ 4XN0A 3RPQA 3HHHA 4B3XA 1JXSA 2JTVA 4XLCA 2CGPA 3I59A 1MBKA 5K7FA 2CG4A 2L7KA 2BHZA 4DQ2A 2V9KA 2H1LA 5IOZA 2QQBA 2ZBKA 3FXLA 4I7HA 1VQPI 1ETWA 1C0WA 2XF7A 4UUSA 3CTAA 4Q47A 2DA6A 3TOAA 2LLKA 3QPHA 2VI6A 1MDMB 3ZQFA 3ML6A 2E2HJ 2QUFA 3BC8A 2CQ7A 4MLOA 5KVRA 1PUFB 2UV1A 3BZKA 3DTKA 2CW8A 2EZHA 4B48A 4D0PA 1GXQA 2ID3A 5JFRA 2XGCA 4IRIA 2A6EF 1R9TJ 5E79C 4HRIA 1Z6RA 2PJPA 1REPC 2R93J 3C2BA 3K4KA 2DOFA 2NOJB 3A0BC 4BJ6C 4ZH4F 2LBFB 5D5UB 5F0FA 1IRFA 2EV5A 1B59A 4D5CA 1BI0A 4R1HA 2KZGA 1HDPA 5D5VB 4YFNF 3SEZA 2KRFA 1LNWA 4NDLA 5JR3A 4HSRA 2HXIA 4KN4X 1F43A 1U6GA 2DT6A 2RQQA 4IHSA 1B9NA 3HRTA 4HPQA 3EUHA 2XVCA 4NBQA 4XRSG 4ETSA 1S3JA 2A69F 1BI3A 3BG6A 1YI2I 2V26A 1DGWY 3F6OA 4C30A 4CCJA 3LSPA 3K69A 2XF6A 1JKQC 3E5QA 2E7XA 3FK7A 4E7SA 1X4OA 2CSOA 1BIBA 3WHBA 1UHSA 2VONA 1D3YA 3ELKA 4M72A 4XLHA 2GBYA 2GXGA 2OZ6A 3KPHA 4ENJA 3I71A 3Q0UA 4S04A 2F6CA 5FRMA 1I6HJ 4G6TB 5FROA 4CCLA 3CUQA 1LDJA 1UHWA 3RKWA 2HOEA 2IA2A 1O3QA 4N0BA 2E1NA 2HQRA 4CYCA 2M30A 3O6BB 4HX7A 2NNYA 4BACA 1H8AC 5JVTA 2Z9OA 1O57A 1SVMA 1DQUA 2P8TA 1Z05A 3KLNA 4UUTA 4YIFA 3KETA 2OCEA 5F04A 2DA3A 3ZOBA 1MMGA 3HBLA 1QNTA 3NARA 4XKVA 5IP7J 2G9WA 2KRHA 2HQAA 2KIFA 4I01A 4RS8A 3LSTA 3G6EI 2AO9A 5E1ZB 3BG5A 5D5WB 4L9JA 5DEQA 3S15J 2VPLA 2O5RA 2MG4A 2XPUA 3VFZA 1XPXA 4D7NA 3EYIA 4EVIA 2X6YA 2YS9A 4I0AA 4BJTA 4ZJZA 1X3UA 1K83J 1A36A 4ASNA 1PP7U 4BU2A 4I2OA 4XIDA 4MEYF 4XLFA 1S6LA 1OYYA 2QVOA 3OV8A 1GVDA 4EGYA 2LKXA 3OY9A 4B3AA 5E3OA 4LIVA 4QLCU 5IY5H 5ILVA 3OR2C 3JREA 3ZQLA 2OJED 5GAHJ 1A5JA 4YG2F 3G1MA 2CQKA 2VQGA 4C9YA 4EM1A 2EPFA 4DJAA 1T38A 2VQHA 4UVBA 1J59A 4PJ0C 3HOVJ 4EJUA 4NHJA 2OUMA 1JI8A 1YJ9I 5B1AH 3CUQB 1SVOA 2OA4A 4DNCA 4MTDA 3JW4A 1ZAOA 3S93A 1I5ZA 4CYCB 1YX3A 2YU3A 4XNFA 5BPDA 2E5ZA 2V79A 3IP4B 4Z2YA 1ZLJA 4AM3A 5H6RA 4NUBA 3ZXSA 2QQ8A 1FC3A 5C3EJ 3PQJA 4LK0F 3ABLH 2YUSA 2JJ7A 5TGTA 2O9LA 3OMYA 2DMQA 3KX2A 3CCYA 2I10A 2XASA 5BMZA 2WAEA 1YLFA 1Z6TA 2VBWA 1FEXA 4ON0A 1MBGA 2FE3A 5ICGA 2KISA 1BR2A 3SDBA 3CC4I 4I98B 3AAFA 4MGRA 1XCBA 3WU1B 4GGGA 1HDDC 2H8WA 2NXNB 2BVMA 2IXSA 3RI4A 1AU7A 3CUOA 3TBIA 2M8EA 3N05A 2GA1A 3BROA 4GYIA 1ZN2A 3BQZA 1T98A 4L9TA 2VKDA 3JRGA 1VQKI 4MIMA 1LE8B 4LD5A 2KP6A 2MFZA 4A3CJ 4GYGA 3ZQIA 4PJMA 2VT3A 3FBIB 2VXDA 4HBLA 1K7AA 1XMAA 2MSYA 1X1BA 4L5EA 4Y33A 4LK1F 5M3MJ 1TNTA 2DBBA 4XRSA 4YIRX 2FBKA 3VPRA 4E7HA 1V3FA 3J80Z 2OC6A 4Y17A 2DT7B 2J5PA 4J19A 3LSIA 2QQAA 1MBJA 2A3SA 5DYMA 5DCFA 4ZYEA 5IP9J 2FX0A 4G6QA 1RKWA 1WJDA 5FFZA 1TWGJ 2KMUA 3DV8A 1WCMJ 5B1BH 3E6BA 5E8IA 3D5LA 2XKPA 4IX7A 3QYFA 1V55H 1SFXA 1PP8F 1ZGJA 3RKQA 2EFWA 1XB4A 4F55A 4RGSA 1SD4A 2X4HA 5A2QK 3OYJA 2W84A 1FMWA 4M3FA 1BI2A 3HOYJ 1MNDA 1I3AA 1IO2A 4AIDA 2ZJQF 3DPUA 2QYOA 1HSTA 3HL2A 3P9CA 2X9DA 3W6VA 4IRHA 3M8JA 2F4IA 3S32A 2LDUA 3OR1C 5IOYA 2CV1A 1RC9A 4A3FJ 1HA8A 1EJ9A 3J81K 1VQ6I 5DCMA 2AXTC 5J1RA 4ZZDA 2Z5UA 2BY3A 2DU9A 2VJJA 1ON1A 3K4NA 3EPZA 1FOYA 1JHFA 3WTUC 1GXPA 1HQCA 2GA2A 3HDDA 2BXZA 4BXUA 3I5UA 1UJ8A 2TRTA 5LGTA 1Z77A 4F7ZA 2GWRA 3TDZC 1GT0C 2MLKA 4UHTA 5ILSA 1BR1A 1K4SA 4M9SA 1BC8C 4G12A 1APLC 3BCBA 2JPBA 2JSPA 1PUEE 4OOIA 1WH5A 4BXXJ 2FNPA 2K40A 3FMRA 1XDSA 5FO5A 3ZRGA 5J1UA 2DJNA 2HDDA 1S7EA 1HBXG 3HSEA 3L2WA 1Z0XA 2UXXA 1HKSA 1B72A 2K9LA 3KP7A 3IUOA 2RNGA 4BDZA 2KHMA 2RC4A 3DLLF 1SD6A 1YITI 1E3OC 3DEWA 3KP3A 1T08B 3R4KA 1IN4A 2DDAA 3SJMA 1HCRA 4B44A 3FXKA 2OQGA 4AUXA 3P9IA 5EG0A 2F4MB 2OV7A 3RTRA 2IA0A 4PSWA 1I39A 1CQTA 4ZYAA 1GDTA 5DTDA 4KIFA 1WWXA 4QWQA 4V2GA 5DCMB 2NYXA 1IW7F 2K9NA 3BPXA 4CO8A 1JTYA 3K1MA 3DTEA 1ZGAA 4CDGA 3NAUA 4LLNA 4OIOF 4C3IJ 3M8FA 4ZDPA 1I3QJ 2I5UA 4D9JA 2EFQA 4HF0A 4YFXF 3NEUA 3DKYA 2IA1A 3R0AA 5KCMA 1MBEA 4M74A 2IGNA 4BQNA 3ONQA 2DN0A 5FLVA 3KP6A 2RV8A 3L2RA 2ZCWA 1WRJA 3AFHA 4E7LA 1J09A 2R5ZA 3HOUJ 4G9YA 4RMNA 5KK1A 2D45A 1MMSA 1IAWA 3ZQ7A 3FXRA 5K7HA 1SMTA 5E3LA 1B72B 3P7NA 1MH3A 2R7UA 1CF7A 1ONVA 1TZLA 1R4MB 3LA7A 1D0ZA 2CUFA 3ZN0A 2E2JJ 2CQXA 5B66C 1AKHB 4XORA 3F0CA 2MC3A 3BR5A 2HI3A 1Z67A 4A3BJ 1OR7A 3LAPA 2MGQA 2KLOA 3CCRI 5EG0B 2P6SA 4LLGF 2B63J 3S2HJ 4RDUA 5D4RA 1I50J 4FE4A 2VXZA 4GFBA 3KYLA 1J0RA 3GFMA 2B0LA 2VJIA 3PNVA 4IL6C 3TMOA 1AWCA 2N8GA 2VBXA 3R0JA 3SZTA 1U78A 4IF4A 4A2UA 3DTIA 1TTYA 5HVQC 2FF4A 3QU6A 1QZYA 4QPQA 4F93B 5EEAA 1XTAA 3F8BA 3CF2A 1N78A 3RKYA 3GCMA 3TEDA 3I9V2 3KZZA 2IGKA 3FKJA 4KUMA 1L3LA 3M7GA 4HDUA 2X6XA 3RSNA 3WTWC 1HW5A 1TC3C 3G4SI 1GV5A
chains in the Genus database with same CATH topology
5JLWA 1JJ6C 3DCFA 3UKGA 1H89C 4RBOA 1X58A 1FTZA 5IP6A 3IH2A 2FQ4A 2D5VA 2H1KA 5C4XJ 1LFBA 1XG1A 1NK3P 3FKIJ 3PO3J 4QSHA 3BTLA 4BBSJ 2X6OA 1MBKA 4ABZA 5K7FA 1BL0A 3OSGA 3TW6A 1LE8A 5IOZA 2Y31A 1UG2A 5K7ZA 1ETWA 2XGDA 2R92J 4UUSA 3GTJJ 4JX6A 2DA6A 3Q0WA 4I76A 4C2MJ 2LLKA 4JYKA 2VI6A 1ORKA 3O8GA 3ZQFA 1ETKA 2E2HJ 3CDLA 4FCYA 4BY7J 2H8RA 4MLOA 1ZR4A 1HF0A 4D7MA 1PUFB 4W1UA 5FKLA 2EZHA 2LFBA 3JRBA 2ID3A 2XGCA 1R9TJ 4XK4A 4DZPA 4A3JJ 2TCTA 3CMYA 4A3MJ 2R93J 2Y2ZA 3SFIA 3C2BA 3G1LA 1P7JA 3HOXJ 1VNDA 1U8BA 5FKKA 2JA8J 1RR7A 2IAIA 5F08A 1JTXA 1AHDP 5F0FA 3GTPJ 4DYRA 2L9RA 2M0CA 4BBRJ 4D5CA 1HDPA 5E3MA 3TP0A 3S1NJ 2VKVA 1OFCX 4NDLA 2HXIA 2Y0SN 3BTJA 1F43A 1QVUA 3BR6A 4B4CA 2DTZA 3BR2A 3BG9A 5M5YJ 4XRSG 5EYRA 1MSFC 2OF7A 2M2EA 3S2DJ 1O4XA 4A3DJ 3LSPA 4QIWN 4HNVA 1JKQC 1IDZA 3GTMJ 3FK7A 1FIAA 2R7ZJ 5J1YA 3WHBA 1UHSA 3HB9A 1MH4A 2GBYA 3FISA 3JRFA 1JUMA 1X2MA 3B6CA 3Q0UA 1I6HJ 1NK2P 2P81A 3MN2A 1D5YA 2WAQN 1MSEC 2Y9YA 2O7OA 4IHVA 4CYCA 4JX4A 1UMQA 4B1RA 4A3KJ 3HGGA 1H8AC 1FIPA 3GTKJ 4UUTA 3A03A 5F04A 3SDGA 2DA3A 3ZOBA 2JK3A 2CRGA 3HBLA 3LNQA 5DS9A 3NARA 4IHWA 5IP7J 1ETYA 2AO9A 3BG5A 1JJ8C 5M5XJ 1VI0A 3S15J 2HXOA 2XGEA 3HEFA 1IRZA 2MG4A 2XPUA 4M3BA 1RESA 4D7NA 3FK6A 2R5ZB 2YS9A 2XRLA 1K83J 3M3YJ 2JWTA 4XIDA 3BTIA 2ME6A 4QTRA 3BR3A 3ZQGA 1IDYA 1GVDA 2DA7A 3JRHA 1TWAJ 1LFUP 2LKXA 3RZDJ 3TP3A 4B3AA 1BA5A 5E3OA 3BTCA 3S1MJ 1RKTA 3MVPA 1ZTRA 3JREA 1VF9A 3ZQLA 2XPVA 4EEFG 2LK2A 5F27A 2NVTJ 1A5JA 2EZIA 3G1MA 3A01A 1G2HA 1XC5A 3OSFA 3HOVJ 2DMUA 2KT0A 3BQYA 3E7LA 1MBFA 3OIOA 5HODA 4FTHA 1IV6A 1FJLA 5C44J 5IPAA 4CYCB 2L7ZA 2JN6A 2IBDA 2DMTA 2IEKA 1JT6A 1IGNA 2GLOA 1TWFJ 5GPAA 5C3EJ 2AHQA 1AKHA 2M9HA 2YUSA 2JJ7A 4A3LJ 2O9LA 1BJZA 2DMQA 3BG3A 5EZHA 3CCYA 1BW6A 1T33A 2I10A 5E3NA 1FEXA 4IHXA 2OPTA 3K7AJ 1MBGA 1QRYA 3BT9A 4M3EA 2NVYJ 1YRNB 2HQ5A 3H0GJ 2DA1A 2LD5A 2WB1N 1HDDC 2QF7A 2X48A 1SFOJ 2DA2A 1OCTC 1DU0A 1U9NA 5IYCJ 5GP9A 3GTLJ 2CUEA 3A02A 1AU7A 9ANTA 2DMNA 2LTPA 5EGOA 4X6AJ 4S0HB 3BQZA 1BW5A 4A3GJ 3JRGA 3HOWJ 5F1JA 4MIMA 1LE8B 4Y7NJ 3A01B 4A3CJ 2YU9J 1H88C 3ZQIA 1IC8A 4UUSB 1T56A 2NS7A 3BR1A 1Y1WJ 1WH7A 2MSYA 1Y1VJ 4L5EA 2XB5A 3PM1A 5M3MJ 5IYBJ 4DYQA 2K9QA 4XRSA 4MFEA 1K61A 3IV5A 1QPIA 3VPRA 1SANA 4X1EA 2E19A 3IH4A 1JKOC 1P7IA 2EQRA 2JA7J 4J19A 4D5FA 1MBJA 2NS8A 2RAEA 1OCPA 5IP9J 3S16J 1TWHJ 2FX0A 2VPRA 1RKWA 2M8GX 3HOZJ 1TWGJ 1WCMJ 4JX5A 5C4JJ 1JKRC 4DYCA 2KDZA 2R5YA 4A93J 1OJLA 3GBGA 4A3IJ 4A3EJ 2XSDC 1HLVA 3RKQA 3Q3SA 4IEJA 1JUSA 3QPSA 2FD5A 4M3FA 3HOYJ 1PUFA 2NVXJ 1W0TA 2VUMJ 2NOGA 3W6VA 2X9DA 2XPWA 1ZR2A 4V2FA 5IOYA 1FTTA 1ENHA 5EGOB 2L7MP 2CU7A 4A3FJ 3GTOJ 4M3GA 2EH3A 4XRMA 5J1RA 1ZKGA 2ECCA 3RQIA 4AC0A 3LSRA 3LSGA 1WPKA 1ZQ3P 3LOCA 3JRAA 3S14J 3HDDA 1ETQA 2TRTA 1Z77A 1A6IA 1MNMC 5FJ8J 2L0KA 1GT0C 3OOUA 1VFCA 1APLC 4G12A 3GTQJ 3K2AA 1WH5A 1ZGWA 4BXXJ 3B6AA 2K40A 2WV1A 3FIWA 3RZOJ 5J1UA 2M34A 2DJNA 2HDDA 5GPCA 1S7EA 4LOCA 3JRCA 1Z0XA 3CQZJ 3HKZN 2COBA 5FKNA 1B72A 3HGYA 2L7FP 1X2NA 1TWCJ 2CJJA 1GV2A 4FE7A 1Q1VA 2ZB9A 1GUUA 1E3OC 3DEWA 5BNGA 2MW8A 2Y9ZA 1RETA 2R5YB 2EZLA 1MBHA 4JP0A 1HCRA 3SJMA 5F0CA 3JRIA 1ITYA 2QCOA 2LP0A 3MKLA 4DW6A 2E1OA 4AUXA 1WGXA 5EG0A 2VKEA 2W48A 5JLXA 1W0UA 3D1NI 3S1QJ 1B8IA 1CQTA 1XS9A 3GTGJ 4Y52J 1ZK8A 2EBIA 1GDTA 5DTDA 1U9OA 4C3JJ 2XB0X 4V2GA 2LY9A 2K9NA 3I4NJ 2E2IJ 2JA6J 1JTYA 4XICA 3QPLA 3NAUA 3ZQHA 1JKPC 3JRDA 5EF6A 4C3IJ 1I3QJ 2DMPA 2JA5J 5FLMJ 1MBEA 5M5WJ 1WI3A 2DN0A 3O8HA 5FLVA 5M3FJ 4W97A 2JMWA 3S17J 2ECBA 2R5ZA 3HOUJ 2K9SA 2EZKA 4IHYA 1HOMA 3M4OJ 2LR8A 5K7HA 5EDNA 3BR0A 5E3LA 1B72B 1NTCA 1ETVA 2ID6A 5FKOA 1MH3A 5F0HA 2DA4A 2HOTA 2CUFA 1JT0A 2E2JJ 2CQXA 3I4MJ 3TW7A 4BKXA 1AKHB 3F0CA 1POGA 3LSJA 1JUPA 3H3VK 3BR5A 2HI3A 1EF4A 4A3BJ 5IYDJ 2HOSA 3PO2J 2MGQA 2LVSA 4MFDA 2R0QC 4C3HJ 5EG0B 4I6ZA 2B63J 3S2HJ 4RDUA 4DZJA 3IH3A 1I50J 4FE4A 2DA5A 3JR9A 4GFBA 1B8IB 3G1OA 2CQQA 5FKMA 1DU6A 1IUFA 3S1RJ 2ME0A 2N8GA 3ZQCA 1QVTA 1U78A 2FJ1A 5J3LA 2NVQJ 4M3DA 4FISA 2G0EA 4A69C 1IG7A 2HYJA 2PMZN 1YRNA 3Q0VA 4M6VA 5EEAA 1F36A 2Y30A 2GM4A 2ELKA 3QQAA 3TEDA 4AYBN 2HOAA 3L1PA 4BY1J 1IJWC 4MO7A 3HM5A 1JGGA 1ETOA 5EZGA 2O8KA 1ETXA 3WHCA 1TC3C 1RPWA 1GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLW A;  1JJ6 C;  3DCF A;  3UKG A;  1H89 C;  4RBO A;  1X58 A;  1FTZ A;  5IP6 A;  3IH2 A;  2FQ4 A;  2D5V A;  2H1K A;  5C4X J;  1LFB A;  1XG1 A;  1NK3 P;  3FKI J;  3PO3 J;  4QSH A;  3BTL A;  4BBS J;  2X6O A;  1MBK A;  4ABZ A;  5K7F A;  1BL0 A;  3OSG A;  3TW6 A;  1LE8 A;  5IOZ A;  2Y31 A;  1UG2 A;  5K7Z A;  1ETW A;  2XGD A;  2R92 J;  4UUS A;  3GTJ J;  4JX6 A;  2DA6 A;  3Q0W A;  4I76 A;  4C2M J;  2LLK A;  4JYK A;  2VI6 A;  1ORK A;  3O8G A;  3ZQF A;  1ETK A;  2E2H J;  3CDL A;  4FCY A;  4BY7 J;  2H8R A;  4MLO A;  1ZR4 A;  1HF0 A;  4D7M A;  1PUF B;  4W1U A;  5FKL A;  2EZH A;  2LFB A;  3JRB A;  2ID3 A;  2XGC A;  1R9T J;  4XK4 A;  4DZP A;  4A3J J;  2TCT A;  3CMY A;  4A3M J;  2R93 J;  2Y2Z A;  3SFI A;  3C2B A;  3G1L A;  1P7J A;  3HOX J;  1VND A;  1U8B A;  5FKK A;  2JA8 J;  1RR7 A;  2IAI A;  5F08 A;  1JTX A;  1AHD P;  5F0F A;  3GTP J;  4DYR A;  2L9R A;  2M0C A;  4BBR J;  4D5C A;  1HDP A;  5E3M A;  3TP0 A;  3S1N J;  2VKV A;  1OFC X;  4NDL A;  2HXI A;  2Y0S N;  3BTJ A;  1F43 A;  1QVU A;  3BR6 A;  4B4C A;  2DTZ A;  3BR2 A;  3BG9 A;  5M5Y J;  4XRS G;  5EYR A;  1MSF C;  2OF7 A;  2M2E A;  3S2D J;  1O4X A;  4A3D J;  3LSP A;  4QIW N;  4HNV A;  1JKQ C;  1IDZ A;  3GTM J;  3FK7 A;  1FIA A;  2R7Z J;  5J1Y A;  3WHB A;  1UHS A;  3HB9 A;  1MH4 A;  2GBY A;  3FIS A;  3JRF A;  1JUM A;  1X2M A;  3B6C A;  3Q0U A;  1I6H J;  1NK2 P;  2P81 A;  3MN2 A;  1D5Y A;  2WAQ N;  1MSE C;  2Y9Y A;  2O7O A;  4IHV A;  4CYC A;  4JX4 A;  1UMQ A;  4B1R A;  4A3K J;  3HGG A;  1H8A C;  1FIP A;  3GTK J;  4UUT A;  3A03 A;  5F04 A;  3SDG A;  2DA3 A;  3ZOB A;  2JK3 A;  2CRG A;  3HBL A;  3LNQ A;  5DS9 A;  3NAR A;  4IHW A;  5IP7 J;  1ETY A;  2AO9 A;  3BG5 A;  1JJ8 C;  5M5X J;  1VI0 A;  3S15 J;  2HXO A;  2XGE A;  3HEF A;  1IRZ A;  2MG4 A;  2XPU A;  4M3B A;  1RES A;  4D7N A;  3FK6 A;  2R5Z B;  2YS9 A;  2XRL A;  1K83 J;  3M3Y J;  2JWT A;  4XID A;  3BTI A;  2ME6 A;  4QTR A;  3BR3 A;  3ZQG A;  1IDY A;  1GVD A;  2DA7 A;  3JRH A;  1TWA J;  1LFU P;  2LKX A;  3RZD J;  3TP3 A;  4B3A A;  1BA5 A;  5E3O A;  3BTC A;  3S1M J;  1RKT A;  3MVP A;  1ZTR A;  3JRE A;  1VF9 A;  3ZQL A;  2XPV A;  4EEF G;  2LK2 A;  5F27 A;  2NVT J;  1A5J A;  2EZI A;  3G1M A;  3A01 A;  1G2H A;  1XC5 A;  3OSF A;  3HOV J;  2DMU A;  2KT0 A;  3BQY A;  3E7L A;  1MBF A;  3OIO A;  5HOD A;  4FTH A;  1IV6 A;  1FJL A;  5C44 J;  5IPA A;  4CYC B;  2L7Z A;  2JN6 A;  2IBD A;  2DMT A;  2IEK A;  1JT6 A;  1IGN A;  2GLO A;  1TWF J;  5GPA A;  5C3E J;  2AHQ A;  1AKH A;  2M9H A;  2YUS A;  2JJ7 A;  4A3L J;  2O9L A;  1BJZ A;  2DMQ A;  3BG3 A;  5EZH A;  3CCY A;  1BW6 A;  1T33 A;  2I10 A;  5E3N A;  1FEX A;  4IHX A;  2OPT A;  3K7A J;  1MBG A;  1QRY A;  3BT9 A;  4M3E A;  2NVY J;  1YRN B;  2HQ5 A;  3H0G J;  2DA1 A;  2LD5 A;  2WB1 N;  1HDD C;  2QF7 A;  2X48 A;  1SFO J;  2DA2 A;  1OCT C;  1DU0 A;  1U9N A;  5IYC J;  5GP9 A;  3GTL J;  2CUE A;  3A02 A;  1AU7 A;  9ANT A;  2DMN A;  2LTP A;  5EGO A;  4X6A J;  4S0H B;  3BQZ A;  1BW5 A;  4A3G J;  3JRG A;  3HOW J;  5F1J A;  4MIM A;  1LE8 B;  4Y7N J;  3A01 B;  4A3C J;  2YU9 J;  1H88 C;  3ZQI A;  1IC8 A;  4UUS B;  1T56 A;  2NS7 A;  3BR1 A;  1Y1W J;  1WH7 A;  2MSY A;  1Y1V J;  4L5E A;  2XB5 A;  3PM1 A;  5M3M J;  5IYB J;  4DYQ A;  2K9Q A;  4XRS A;  4MFE A;  1K61 A;  3IV5 A;  1QPI A;  3VPR A;  1SAN A;  4X1E A;  2E19 A;  3IH4 A;  1JKO C;  1P7I A;  2EQR A;  2JA7 J;  4J19 A;  4D5F A;  1MBJ A;  2NS8 A;  2RAE A;  1OCP A;  5IP9 J;  3S16 J;  1TWH J;  2FX0 A;  2VPR A;  1RKW A;  2M8G X;  3HOZ J;  1TWG J;  1WCM J;  4JX5 A;  5C4J J;  1JKR C;  4DYC A;  2KDZ A;  2R5Y A;  4A93 J;  1OJL A;  3GBG A;  4A3I J;  4A3E J;  2XSD C;  1HLV A;  3RKQ A;  3Q3S A;  4IEJ A;  1JUS A;  3QPS A;  2FD5 A;  4M3F A;  3HOY J;  1PUF A;  2NVX J;  1W0T A;  2VUM J;  2NOG A;  3W6V A;  2X9D A;  2XPW A;  1ZR2 A;  4V2F A;  5IOY A;  1FTT A;  1ENH A;  5EGO B;  2L7M P;  2CU7 A;  4A3F J;  3GTO J;  4M3G A;  2EH3 A;  4XRM A;  5J1R A;  1ZKG A;  2ECC A;  3RQI A;  4AC0 A;  3LSR A;  3LSG A;  1WPK A;  1ZQ3 P;  3LOC A;  3JRA A;  3S14 J;  3HDD A;  1ETQ A;  2TRT A;  1Z77 A;  1A6I A;  1MNM C;  5FJ8 J;  2L0K A;  1GT0 C;  3OOU A;  1VFC A;  1APL C;  4G12 A;  3GTQ J;  3K2A A;  1WH5 A;  1ZGW A;  4BXX J;  3B6A A;  2K40 A;  2WV1 A;  3FIW A;  3RZO J;  5J1U A;  2M34 A;  2DJN A;  2HDD A;  5GPC A;  1S7E A;  4LOC A;  3JRC A;  1Z0X A;  3CQZ J;  3HKZ N;  2COB A;  5FKN A;  1B72 A;  3HGY A;  2L7F P;  1X2N A;  1TWC J;  2CJJ A;  1GV2 A;  4FE7 A;  1Q1V A;  2ZB9 A;  1GUU A;  1E3O C;  3DEW A;  5BNG A;  2MW8 A;  2Y9Z A;  1RET A;  2R5Y B;  2EZL A;  1MBH A;  4JP0 A;  1HCR A;  3SJM A;  5F0C A;  3JRI A;  1ITY A;  2QCO A;  2LP0 A;  3MKL A;  4DW6 A;  2E1O A;  4AUX A;  1WGX A;  5EG0 A;  2VKE A;  2W48 A;  5JLX A;  1W0U A;  3D1N I;  3S1Q J;  1B8I A;  1CQT A;  1XS9 A;  3GTG J;  4Y52 J;  1ZK8 A;  2EBI A;  1GDT A;  5DTD A;  1U9O A;  4C3J J;  2XB0 X;  4V2G A;  2LY9 A;  2K9N A;  3I4N J;  2E2I J;  2JA6 J;  1JTY A;  4XIC A;  3QPL A;  3NAU A;  3ZQH A;  1JKP C;  3JRD A;  5EF6 A;  4C3I J;  1I3Q J;  2DMP A;  2JA5 J;  5FLM J;  1MBE A;  5M5W J;  1WI3 A;  2DN0 A;  3O8H A;  5FLV A;  5M3F J;  4W97 A;  2JMW A;  3S17 J;  2ECB A;  2R5Z A;  3HOU J;  2K9S A;  2EZK A;  4IHY A;  1HOM A;  3M4O J;  2LR8 A;  5K7H A;  5EDN A;  3BR0 A;  5E3L A;  1B72 B;  1NTC A;  1ETV A;  2ID6 A;  5FKO A;  1MH3 A;  5F0H A;  2DA4 A;  2HOT A;  2CUF A;  1JT0 A;  2E2J J;  2CQX A;  3I4M J;  3TW7 A;  4BKX A;  1AKH B;  3F0C A;  1POG A;  3LSJ A;  1JUP A;  3H3V K;  3BR5 A;  2HI3 A;  1EF4 A;  4A3B J;  5IYD J;  2HOS A;  3PO2 J;  2MGQ A;  2LVS A;  4MFD A;  2R0Q C;  4C3H J;  5EG0 B;  4I6Z A;  2B63 J;  3S2H J;  4RDU A;  4DZJ A;  3IH3 A;  1I50 J;  4FE4 A;  2DA5 A;  3JR9 A;  4GFB A;  1B8I B;  3G1O A;  2CQQ A;  5FKM A;  1DU6 A;  1IUF A;  3S1R J;  2ME0 A;  2N8G A;  3ZQC A;  1QVT A;  1U78 A;  2FJ1 A;  5J3L A;  2NVQ J;  4M3D A;  4FIS A;  2G0E A;  4A69 C;  1IG7 A;  2HYJ A;  2PMZ N;  1YRN A;  3Q0V A;  4M6V A;  5EEA A;  1F36 A;  2Y30 A;  2GM4 A;  2ELK A;  3QQA A;  3TED A;  4AYB N;  2HOA A;  3L1P A;  4BY1 J;  1IJW C;  4MO7 A;  3HM5 A;  1JGG A;  1ETO A;  5EZG A;  2O8K A;  1ETX A;  3WHC A;  1TC3 C;  1RPW A;  1GV5 A; 
#chains in the Genus database with same CATH topology
 5ILU A;  1R58 A;  1H89 C;  3LSK A;  4I02 A;  3HSF A;  2GXB A;  4YII A;  2DW4 A;  2RDP A;  2VLA A;  5CPR B;  3IH2 A;  1CF7 B;  2D5V A;  4BL0 B;  1ZAR A;  2EB7 A;  3FXO A;  3QWL A;  3R6S A;  1ZHF A;  1KYW A;  5J8F A;  1H0M A;  2EK5 A;  3BTL A;  4QSH A;  1I1S A;  2WWY A;  4BE0 A;  3LA2 A;  4AD9 A;  1BL0 A;  3TW6 A;  4O5V A;  3F22 A;  3IRR A;  2M45 A;  2Y31 A;  5K7Z A;  3VB2 A;  2R92 J;  5CQE A;  1T8I A;  3EYY A;  1R4N B;  2FMY A;  3F8N A;  1G4D A;  4CXF A;  1ORK A;  1BM9 A;  3TKY A;  1ETK A;  4FCY A;  5GTI C;  2BY0 A;  4U88 A;  2ZSI B;  4W1U A;  3NQO A;  1FBQ A;  2HTJ A;  3PSF A;  4BEH A;  4CZZ A;  3MFK A;  4UV9 A;  2CW0 F;  5EEH A;  4XK4 A;  1B1B A;  2QM3 A;  1OKR A;  3GFI A;  1LEB A;  3I64 A;  2JZY A;  3SFI A;  1AOY A;  1P7J A;  3FMQ A;  4ZZL A;  1EKE A;  1LDK B;  4EV0 A;  3OS1 A;  2JA8 J;  1RR7 A;  1MGT A;  2KKO A;  2IAI A;  4HAM A;  1SMY F;  5F08 A;  3MKW B;  2L02 A;  3BPV A;  3I53 A;  1AHD P;  2IS1 A;  1OYW A;  2L9R A;  3Q9V A;  2KFD A;  4OIN F;  4ESF A;  1WI9 A;  5E17 F;  5E3M A;  3CDH A;  3P5J A;  3TP0 A;  2M0M A;  1AA7 A;  2M4K A;  1WJC A;  1E2X A;  1TLH B;  3BOQ A;  3K1N A;  2K4B A;  3BR2 A;  2EJR A;  3BG9 A;  5M5Y J;  3RQ4 A;  3WU2 C;  1YFH A;  1ZLK A;  4HF2 A;  1E3H A;  1YE9 A;  2NRA C;  2M5W A;  2OF7 A;  3MCZ A;  3S2D J;  3HXL A;  1UHM A;  4HNV A;  1S72 I;  4G7H F;  3L9F A;  3DU6 A;  4XN3 A;  1B9M A;  3WTS C;  1FIA A;  2PEX A;  2V1D A;  5L3D A;  5K1Y A;  1G3S A;  2FRH A;  5JVG F;  4XM3 A;  3KFW X;  2K5C A;  3FDY A;  1B6A A;  2JA2 A;  4U7D A;  4HV5 A;  5L3B A;  3K10 A;  4A6E A;  2BY2 A;  5CVR A;  1NK2 P;  2P81 A;  1D5Y A;  2JUG A;  5FB2 A;  2R7O A;  1UMQ A;  2JRM A;  3TGN A;  3HGG A;  2GQQ A;  1FIP A;  2CS3 A;  2K86 A;  1YO5 C;  1MJB A;  1IF1 A;  5J4V A;  2Z33 A;  4LG0 B;  1SFK A;  3OOP A;  1Y6I A;  4HST A;  4MQ9 F;  4AWX B;  3IRQ A;  3SDG A;  4HV6 A;  3ZQQ A;  1ETY A;  2Z3Y A;  1TW2 A;  1K6Y A;  3GZN B;  1JJ8 C;  3K4L A;  3FMS A;  3VSL A;  4PK4 A;  4LJZ F;  4BAY A;  2M87 A;  3FK6 A;  2FBI A;  2VE8 A;  2C6Y A;  4P96 A;  4IO9 F;  2A6H F;  2O0Y A;  4II2 A;  1WJ5 A;  3M3Y J;  2XSJ C;  1Z9C A;  3BTI A;  1KQ0 A;  4H4K C;  2PBI A;  4A5N A;  2DA7 A;  4KN7 X;  1TWA J;  3JRH A;  3FHZ A;  1TL8 A;  1HSJ A;  2QSF X;  4E7Z A;  1BA5 A;  1FP1 D;  1G8X A;  3BTC A;  3DBH B;  5LEK A;  3Q5F A;  3F3X A;  2KPM A;  3MVP A;  1ZTR A;  5HNH A;  3ISP A;  2A07 F;  3JAM Z;  1VF9 A;  3VSK A;  3EET A;  4WXH A;  4EEF G;  2LK2 A;  3OYE A;  2EZI A;  5LRS A;  3A01 A;  1XDU A;  2E34 A;  5HS9 A;  4EQQ A;  3OSF A;  2MYS A;  2DMU A;  2KT0 A;  3BQY A;  3OYL A;  5HOD A;  2JQ7 A;  1YS7 A;  2QZ8 A;  2CO5 A;  1OYI A;  3ZN1 A;  1V5F A;  1XMK A;  2JN6 A;  3DQV C;  2IEK A;  2DK5 A;  3JCU C;  5E1X A;  3DXJ F;  3WU0 A;  1YYV A;  2LSO A;  5J4Y A;  5CYV A;  3PUF A;  4G94 A;  1EH8 A;  4NC6 A;  1OCZ H;  1YJW I;  4G7O F;  1BJZ A;  4E4H A;  3EUH C;  1FSH A;  5EZH A;  2XV4 S;  2V6C A;  1VQM I;  2V4J C;  3ZGK A;  2DTR A;  1YQA A;  3E3V A;  3U21 A;  3OIP A;  4ZYH A;  4H0E A;  4LB5 A;  2HVQ A;  2R7F A;  2NAZ A;  1QRY A;  4XBF A;  2DPU A;  2UXN A;  2NVY J;  3MZ8 A;  3HTS B;  3PJR A;  4OMY A;  1YRN B;  1QZZ A;  2HVS A;  2DA1 A;  1ZYR F;  5HOO A;  4O3M A;  4LB6 B;  1LVA A;  2HFH A;  3RYP A;  1DU0 A;  4UY8 I;  1U9N A;  5IYC J;  4AIJ A;  2DFI A;  3CUQ C;  3QOP A;  5GP9 A;  3GTL J;  9ANT A;  2DMN A;  4MEX F;  3CJT B;  4N4N B;  4X6A J;  4S0H B;  2ACJ A;  1F1Z A;  3I59 B;  4LGW A;  2VN2 A;  2AQF A;  4KT6 A;  3MQ0 A;  5ICC A;  2R7R A;  2OQR A;  5J47 A;  3A01 B;  4AIH A;  2B9S A;  3BCA A;  4UUS B;  2NS7 A;  1IXS B;  2VC0 A;  2XB5 A;  5IYB J;  4DYQ A;  2K9Q A;  3IV5 A;  1R71 A;  3HPH A;  3HOS A;  1P7I A;  1W36 C;  1PDN C;  2EQR A;  3MD2 A;  3RYR A;  2RNJ A;  2NS8 A;  2PQ8 A;  3CO6 C;  3J7A O;  1QBJ A;  3ABT A;  3CJN A;  2P6T A;  2VPR A;  1D0Y A;  1RUO A;  1J5Y A;  4IOC F;  1F4K A;  2QGU A;  5FLX K;  2LH9 A;  4DYC A;  4EAT A;  2KDZ A;  2O8X A;  1OJL A;  2K02 A;  3GBG A;  4RAY A;  2ICW G;  3OWT A;  1WHU A;  4KIT B;  3HPG A;  2XSD C;  1HLV A;  4ZDO A;  4A0Y A;  2CUJ A;  3Q3S A;  2KJB A;  1SAX A;  4XKB A;  3DEU A;  4YEL A;  1FOW A;  4BYY A;  2TDX A;  1N25 A;  2AQE A;  2YX7 A;  3QU3 A;  2R7T A;  1VQ7 I;  2XPW A;  3COA C;  3BJ6 A;  2DCE A;  1ENH A;  1R5H A;  2L7M P;  3NWT A;  1IRX A;  3L2U A;  2QA4 I;  3GTO J;  2FBH A;  4PGH A;  1ZKG A;  2ECC A;  3RQI A;  4AC0 A;  3LSG A;  3DWL E;  5HLT A;  1MKM A;  2PMU A;  3PIP F;  4E7K A;  2HDC A;  2PJR A;  5HDK A;  1UB9 A;  3JRA A;  1W4M A;  3CO7 C;  1IUY A;  2XIG A;  1KU9 A;  1DUX C;  4A6D A;  5GTH C;  1A6I A;  5FFX A;  5FJ8 J;  3J80 K;  1YW8 A;  1VFC A;  4PGG A;  3LQR A;  1RR8 C;  5K5R A;  2Q8K A;  2EFP A;  3W6J B;  5ED4 A;  4WK8 F;  1ZRE A;  1ZGW A;  2WV1 A;  2Y75 A;  3RZO J;  3QYB A;  5GPC A;  3HKZ N;  5LHG A;  3A2K A;  3HGY A;  2IGO A;  1T2K A;  1WJE A;  3DP7 A;  1X2N A;  2CJJ A;  1Q1V A;  2K3P A;  3WGG A;  2OTJ I;  2LKS A;  3S3N A;  2ETH A;  5ERI A;  4XKW A;  1D8K A;  1XGM A;  5L3F A;  1WVR A;  1R5G A;  2LP0 A;  1KON A;  1D1C A;  1XGN A;  2VKE A;  3RDI A;  3G3Z A;  4RB2 C;  1R1T A;  1KQ8 A;  2BY1 A;  2BOL A;  1SEU A;  2W48 A;  2CMP A;  1W0U A;  2LOO A;  4XLP F;  3S3O A;  1B8I A;  1LDD A;  4Y15 A;  4Y52 J;  2BV6 A;  1ZK8 A;  4K2E A;  2V6E A;  3RCO A;  2IS2 A;  4CA0 A;  3PNT A;  3ABU A;  2BVL A;  2CWE A;  5F1R A;  4BH9 A;  2LY9 A;  5HS8 A;  3I4N J;  2JA6 J;  4XIC A;  1B4A A;  1JKP C;  1S5L C;  2IW5 A;  2Z99 A;  3LA3 A;  5EF6 A;  2PJR B;  1IZ1 A;  1IN8 A;  2OD5 A;  1SFE A;  2DMP A;  1X1C A;  3E6M A;  3S3M A;  1WI3 A;  3I55 I;  2VJ4 A;  3O8H A;  3VDX A;  4PJL A;  4HLX A;  3V7C A;  1LKX A;  3IC7 A;  2K9S A;  3IKV A;  2EZK A;  4EMS A;  3FF5 A;  3SFZ A;  1FBS A;  3JSO A;  3S2W A;  1KYZ A;  2Z2S B;  2FXA A;  3PQK A;  3DKX A;  3OYI A;  3ABK H;  3I4P A;  2EWN A;  2UUZ A;  1NTC A;  1ETV A;  3GX4 X;  2BW3 A;  4HOB A;  3I54 A;  2DA4 A;  3CC7 I;  2HOT A;  3GXO A;  1IN5 A;  2DDB A;  1ZRD A;  5IT9 K;  4XOP A;  4EJT A;  2A61 A;  4MTE A;  3LSJ A;  2DFH A;  2M7B A;  2R7V A;  1FP2 A;  2D1V A;  1EF4 A;  3PO2 J;  2R0Q C;  2LVS A;  2Q1Z B;  2YPR A;  4C3H J;  3H0D A;  1UG0 A;  3LFK A;  1QA6 A;  3IH3 A;  4C2U A;  2XAH A;  3HJE A;  3SZG A;  1B8I B;  3G1O A;  2L9S A;  1FYK A;  4G7Z F;  5LGN A;  4EJW A;  3L2V A;  1IUF A;  1R00 A;  2ME0 A;  2HYF A;  3QOD A;  3LFU A;  2VC1 A;  3PL8 A;  1ZH5 A;  1Y39 A;  1FT9 A;  1STZ A;  1T0F A;  3FZV A;  1IRG A;  1FBU A;  3HZJ A;  1IXR C;  4NQW A;  3VYU B;  4FIS A;  1W5S A;  3IWF A;  4E7I A;  1IG7 A;  4ZTJ A;  4XMY A;  3HIF A;  1KA8 A;  3ESW B;  3FXM A;  2E60 A;  2GM4 A;  1XSD A;  1MMD A;  4CSW A;  4Y3O A;  3T8T A;  1BJA A;  3ZMS A;  3ECO A;  4IRG A;  4MHG A;  2D2W A;  3DBR B;  4P1W A;  1U0J A;  1ETX A;  4HEA 2;  5HS7 A;  1X58 A;  3M07 A;  1W1W E;  1O7L A;  1VTN C;  1JE8 A;  1D5V A;  2QEX I;  4NC7 A;  2FQ4 A;  2BW3 B;  2FOK A;  2JVH A;  2H1K A;  3K70 D;  3WTV C;  5HLI A;  1LFB A;  1XG1 A;  3LQQ A;  3FKI J;  3R61 A;  4PCQ A;  4RB3 C;  2IT0 A;  4BBS J;  2X6O A;  2DAO A;  2O61 A;  3OIQ A;  3ZCO A;  2WTE A;  1QO0 D;  3V8J A;  4P9U A;  1UG2 A;  2F5F A;  4UNO A;  4N9H A;  2EFN A;  4I76 A;  4N4O B;  2STT A;  3W2V A;  2DQR A;  2QKM B;  3V4G A;  1Z21 A;  2EIJ H;  4KIB A;  5LD2 C;  5FKL A;  2LFB A;  1BR4 A;  3JRB A;  1ZEL A;  2QEN A;  4NQW B;  2DFE A;  2W4S A;  4WX9 A;  4GO1 A;  1BBY A;  3CMY A;  2UWM A;  3H35 A;  3TDU C;  1YIO A;  4L0Y B;  3HOX J;  2Z1D A;  3KZY A;  3AL0 C;  1U8B A;  5FKK A;  3HKZ A;  2YSR A;  1MD0 A;  1DP7 P;  1D1B A;  3CCS I;  3HRS A;  1RRJ A;  1MJA A;  1V4R A;  2QQ9 A;  4ESB A;  4ANJ A;  4XL9 A;  6PAX A;  1OR7 C;  3KCC A;  3GUD A;  4RAZ A;  5CJ9 A;  4FT8 A;  2VKV A;  2BZT A;  1MZB A;  1TBX A;  4LIT A;  3RIR A;  4PJJ A;  1MJ9 A;  4DGW B;  5A2Q Z;  1X1P A;  2Y0S N;  3BTJ A;  4EGZ A;  1EH7 A;  2I8D A;  3R60 A;  4FX0 A;  1QVU A;  2ZJR F;  3ASO H;  3K4C A;  4B4C A;  4PJN A;  3HUG A;  2DTZ A;  4KIC A;  4BHB A;  1FOX A;  2G7U A;  3GEZ A;  4F3Q A;  3K4M A;  3ZP5 A;  4A3D J;  4OU0 A;  4QIW N;  3JTG A;  2PMH A;  5L3E A;  3J81 Z;  1IDZ A;  2IPQ X;  1YG2 A;  4NB5 A;  4B09 A;  4IOA F;  3OYB A;  2R7Z J;  1LJ9 A;  3OL4 A;  1QQI A;  4HX8 A;  1XN7 A;  5KAI C;  3HB9 A;  1MH4 A;  2W24 A;  3GO5 A;  1FYL A;  4KMF A;  1WZ2 A;  1FX7 A;  1Y56 A;  1Q1H A;  2E5N A;  2HNH A;  4XQF A;  3V8K A;  4OAY A;  3B6C A;  2KRC A;  2J5O A;  3PSI A;  4YEJ A;  2UZK A;  3C2G A;  2WAQ N;  2ZO4 A;  2KIM A;  2O7O A;  2L3D A;  1RI7 A;  3KP4 A;  1EV7 A;  3VWB A;  2FNA A;  3GTK J;  1U5T A;  1Z7U A;  4TV7 A;  5ICF A;  3GFL A;  3A03 A;  3HRM A;  4RM3 A;  1UST A;  1TQM A;  4BS9 A;  4GCV A;  3M1C A;  4XKC A;  2CRG A;  5DS9 A;  5ICE A;  1OCC H;  3NWS A;  4E70 A;  2W7N A;  1LUJ B;  1ZG5 A;  4IHT A;  4HQE A;  4HZF A;  1VI0 A;  5DUI A;  5FRN A;  1IRZ A;  1RES A;  2VQL A;  3ABM H;  1MMA A;  2ZXI A;  5GAE J;  3X2Q H;  2R5Z B;  4ESJ A;  2H94 A;  2XRL A;  3REO A;  3M9A A;  2JWT A;  2JSC A;  1H9G A;  5DM7 F;  3HUG B;  2DOA A;  3BR3 A;  3DEE A;  4U87 A;  3H9Q A;  3ZQG A;  4HF1 A;  4S05 A;  1IDY A;  2HZD A;  2W1O A;  3AL0 B;  1LFU P;  1R23 A;  2ZSH B;  2MBF A;  3SHF A;  2CV2 A;  1ZG1 A;  1UZC A;  2DYS H;  3K1P A;  3TP3 A;  1W7P D;  3U9G A;  3LMM A;  3FWE A;  3S1M J;  5DD8 A;  1RKT A;  1V5G A;  3CES A;  4BNC A;  1V5E A;  3HRU A;  5F27 A;  2NVT J;  2VB6 A;  2CV0 A;  1JHH A;  1G2H A;  2RVC A;  1QHG A;  2O6G E;  3HHG A;  2EV6 A;  2BBY A;  3JSP A;  1GVJ A;  1VQ5 I;  2KL4 A;  3VOD A;  2VBZ A;  5JHU A;  4FTH A;  4MNU A;  3BDD A;  1FJL A;  5C44 J;  4XLA A;  1YW7 A;  2L7Z A;  2GXA A;  1IXC A;  2DMT A;  5CLS A;  3KP5 A;  4L9N A;  3GF2 A;  1YS6 A;  3F9K A;  2W25 A;  2KZV A;  5GPA A;  5LRR A;  3LSH A;  2AHQ A;  3OYC A;  4BE2 A;  2HU9 A;  1XSX A;  4A3L J;  3LL7 A;  1KGS A;  3BG3 A;  2Q0O A;  1BW6 A;  1T33 A;  2M7A A;  2RQP A;  5D8K B;  4WCG A;  3ZPL A;  4IHX A;  2OPT A;  3K7A J;  1ON2 A;  1DPR A;  4BQA A;  3N97 A;  2VT2 A;  2IP2 A;  3U2R A;  2HPI A;  4PFP A;  1N75 A;  2HQ5 A;  2ZFU A;  2OTL I;  1A6Q A;  2RGV A;  3IHU A;  2BXY A;  2H27 A;  2VQC A;  3OS2 A;  3H0G J;  3A4C A;  1D0X A;  2WB1 N;  2LD5 A;  2GIV A;  2QF7 A;  4EM0 B;  2L4M A;  2F5C A;  1SFO J;  2DA2 A;  1OCT C;  4IPA A;  2ZFW A;  2CQN A;  4A12 A;  1J75 A;  3JAM K;  1EH6 A;  5FD5 A;  2LTP A;  2QKL B;  5EGO A;  2WV0 A;  2HTS A;  1N77 A;  2FSW A;  3LWF A;  4M6X A;  2K27 A;  1HW1 A;  1NHA A;  4F52 A;  3HOW J;  2Y48 A;  4V19 K;  1TT0 A;  1K6O A;  3L2C A;  4Z6Y A;  1T95 A;  4CZC A;  1OCO H;  2LY2 A;  2QLZ A;  1H88 C;  4ITV A;  1UAA A;  4WWC A;  1T56 A;  1Y1W J;  3CJR B;  2CFX A;  2L54 A;  1WH7 A;  2R7X A;  3BZ6 A;  3PFI A;  3QPT A;  2X85 A;  3BG7 A;  1CGP A;  4MFE A;  1K61 A;  3OYM A;  3H9G A;  4J01 A;  1SAN A;  2V1U A;  2E19 A;  2VOD A;  4O6J A;  4BEH B;  3GLL A;  2JA7 J;  2P5K A;  4D5F A;  1YX5 A;  3DPT A;  4IQ4 A;  2HS5 A;  1Y8R B;  3GW2 A;  3S16 J;  4GXO A;  4OIR F;  1TWH J;  2Y0S A;  3U1K A;  3VOE A;  4CCO A;  1SD7 A;  5KAF C;  1ZRC A;  2E1M C;  4Q5S F;  2CH0 A;  1EA3 A;  5C4J J;  1JKR C;  3GWZ A;  4HA8 A;  1XD7 A;  5KHD A;  3CME I;  4A93 J;  3EDP A;  2V9V A;  2PG4 A;  2PLY A;  1UCR A;  4A3E J;  1A31 A;  3ROU A;  3HTU A;  4IEJ A;  3IAS 2;  2MLG A;  2FD5 A;  3WTZ A;  3GFJ A;  1ODD A;  2LG4 A;  3KE2 A;  4II3 A;  4M9Z A;  3H5R A;  1PUF A;  2NVX J;  5AON A;  4PUS A;  1FLI A;  4LIU A;  4WXC A;  4OAZ A;  1BN5 A;  3RJP A;  3MZH A;  3C1D A;  4OMZ A;  1ZR2 A;  4V2F A;  3BY6 A;  4M73 A;  5AIP A;  1R36 A;  5EGO B;  1KQ9 A;  4IZZ A;  4AVP A;  4M3G A;  4XRM A;  3FXQ A;  2WAQ A;  1FYM A;  2LY1 A;  3I3L A;  4ENK A;  1WPK A;  3CJQ B;  2L4A A;  4CCM A;  2IS6 A;  2MC4 A;  2O3F A;  2VOO A;  2QBY A;  4RAF A;  1LQ1 A;  2XUB A;  5HDG A;  2HQN A;  3LSM A;  1O3T A;  4BE1 A;  2CFO A;  2L0K A;  2XRN A;  4HNU A;  3OOU A;  3OYK A;  4BHP A;  2JPC A;  3GTQ J;  3Q9S A;  2XC7 A;  3B6A A;  1PYV A;  3ZMV A;  3KEY A;  2M34 A;  3CCL I;  4ZC3 A;  2F48 A;  1VQO I;  2VIX A;  4LOC A;  3N4M A;  3ZMZ A;  4FQG A;  3ERE D;  1Z7L A;  2A5Y B;  3GYH X;  3F21 A;  2IS4 A;  1OIS A;  4B47 A;  4ZDL A;  1MW7 A;  2L7F P;  1G3T A;  3FBN B;  4FE7 A;  1GV2 A;  4RLF A;  3ULQ B;  2ZB9 A;  2XF5 A;  4WF2 A;  3BJA A;  2K9M A;  2F5D A;  3L00 A;  4KT5 C;  5BNG A;  2MW8 A;  2Y9Z A;  4CHU A;  1RET A;  4LMY A;  5F0C A;  3JRI A;  3C18 A;  5D6E A;  2AXL A;  4DW6 A;  2GIZ A;  2E1O A;  2FEZ A;  4Q48 A;  3TOB A;  3QRF F;  2A5W A;  2ADU A;  4IXA A;  3KLO A;  5D8L B;  1WKM A;  5JLX A;  2V7F A;  4IVN A;  1QU3 A;  3A1Y A;  2NVU B;  1XS9 A;  3GTG J;  2EBI A;  2WC2 A;  1IV8 A;  4KDP A;  2GOM A;  3BLY A;  4NC8 A;  3RPU D;  3C2H A;  4C3J J;  1H9T A;  5H2F C;  2E1M B;  2XHK A;  1P9Q C;  2FU4 A;  3E5U A;  3F8F A;  2E2I J;  2FUG 2;  3QPL A;  3BWG A;  2LC2 A;  1J9I A;  3FM5 A;  3CLQ A;  3JRD A;  4R79 A;  5E8G A;  3VYS B;  2WAF A;  2QBY B;  2ZC2 A;  3EUK L;  3J7A Y;  2JA5 J;  1OPC A;  3ZMU A;  5FLM J;  2OAZ A;  3F6V A;  1DDN A;  1D1A A;  1LEA A;  4QPO A;  4KNY A;  5M3F J;  4W97 A;  2GZW A;  1U8R A;  3WTY C;  3S17 J;  2BE5 F;  2LRD A;  2WAD A;  1TT5 B;  1R1V A;  1HOM A;  5E20 A;  3BZC A;  3K70 C;  3M4O J;  3D0S A;  2CUZ A;  3BR0 A;  4U0V A;  5B3S H;  5EDN A;  2ID6 A;  3OYG A;  5F0H A;  4U7B A;  3DU5 A;  2CYY A;  4XSZ F;  4UUV A;  1YJN I;  2ZJP F;  4JBA A;  4RB1 A;  3CP8 A;  2EA2 A;  1JT0 A;  3I4M J;  1VQ9 I;  1MMN A;  2L2O A;  2M4G A;  2WB1 A;  3K0L A;  4IKF A;  2PFB A;  3CMM A;  3MWM A;  2LYC A;  1JUP A;  4Q4Z F;  3VYT B;  2IVM A;  2HKO A;  3E97 A;  4U0W A;  3CMA I;  2HOS A;  3F8C A;  1TP4 A;  4I6Z A;  3DPL C;  2MAB A;  2EFO A;  2ZKZ A;  1G3Y A;  3JR9 A;  3KYC B;  1P92 A;  3O3K A;  1YOV B;  2HKX A;  2BHY A;  1KZH A;  3V7S A;  3S1R J;  4KFC A;  3ZQC A;  2OCC H;  2FJ1 A;  2NVQ J;  5E18 F;  2V9P A;  3A0H C;  3I0T A;  2A6T A;  2HYG D;  2G0E A;  4ZYG A;  3S8P A;  1S7O A;  3I56 I;  2K7L A;  1ZRF A;  1R22 A;  2EIK H;  3W2W A;  1F36 A;  4LG3 A;  3QQA A;  1M1E B;  4E6K G;  2NS0 A;  4HNT A;  4EJV A;  2HOA A;  3MKY B;  1KU7 A;  4XLE A;  4BY1 J;  1IJW C;  4XR6 A;  3SYT A;  3BJO A;  4JK1 X;  3HM5 A;  1OCR H;  3B02 A;  5EZG A;  1O3S A;  3GVA A;  5FD6 A;  1JGG A;  2NNN A;  3EQL F;  3SEQ A;  5GAD J;  2O8K A;  3WHC A;  1P4X A;  1OQY A;  3AKZ A;  3GZ6 A;  3E6C C;  1RPW A;  2IGM A;  2ESN A;  1JJ6 C;  1FTZ A;  1SFU A;  3HYI A;  1LFP A;  3WTT C;  3H5A A;  3G71 I;  4XOT A;  5CVI A;  1NK3 P;  3MKZ A;  1ULY A;  3PO3 J;  3OS0 A;  1X1A A;  3H3U A;  4PSX A;  3UR3 C;  3ECH A;  2H6B A;  4ABZ A;  1A04 A;  2YX4 A;  3UNG C;  1R49 A;  1XX5 A;  3O2P E;  5EEG A;  3OSG A;  2WA0 A;  2R7D A;  4JOM A;  1Y8Q B;  1LE8 A;  3T8R A;  2PMZ A;  4M9X A;  1E3P A;  2DLL A;  1Z91 A;  2XGD A;  5LGU A;  4D1Q A;  1UFM A;  3GTJ J;  2R4G A;  1WJF A;  4JX6 A;  5K5Q A;  3Q0W A;  1RIO H;  4C2M J;  4JYK A;  4AYB A;  1HC8 A;  3SQN A;  1I6X A;  4KA4 A;  3O8G A;  3CDL A;  4BY7 J;  2H8R A;  1ZR4 A;  1HF0 A;  1RNL A;  1W5T A;  4D7M A;  5BPI A;  4RA2 A;  1XGO A;  2K4J A;  4OIQ F;  2HPM A;  5TIS C;  3ZR8 X;  2KIU A;  2RN7 A;  5GAG J;  2ISZ A;  4DZP A;  4A3J J;  2TCT A;  3PFY A;  4HYE A;  4A3M J;  3CCJ I;  2Y2Z A;  3DF8 A;  3G1L A;  1PJR A;  5AIQ A;  2QSG X;  4LFU A;  4XSX F;  2PX9 A;  1LB2 A;  1ERD A;  1D8J A;  1VND A;  2D1H A;  2FOW A;  1A35 A;  2JUC A;  4GDF A;  1JTX A;  3WG7 H;  5BQT A;  2L5Q A;  5FLX Z;  3GTP J;  4DYR A;  4RM2 A;  2M0C A;  5JI6 A;  4BBR J;  2Z16 A;  2ELJ A;  2XGX A;  4CCN A;  1NG7 A;  3S1N J;  1OFC X;  3SXY A;  2YR2 A;  2QSH X;  1YHQ I;  5LHH A;  2W82 A;  1QZE A;  4A0X A;  3BR6 A;  1T6S A;  2HGC A;  1W5C C;  3L2Q A;  1BC7 C;  3EUA A;  1HXD A;  4DBQ A;  4BDY A;  2LMD A;  5EYR A;  1P4A A;  1MSF C;  2EA4 A;  2M2E A;  1T0F C;  1O4X A;  5FGM A;  3WE3 A;  1OMI A;  1V54 H;  1TQP A;  1FSE A;  3GTM J;  1USS A;  4UB8 C;  5CKT A;  2F2E A;  2P7C B;  5J1Y A;  1LPQ A;  1WFX A;  2A05 A;  2MD5 A;  2ZJ2 A;  2HZT A;  2XAU A;  2K3F A;  3WGI A;  4J00 A;  3FIS A;  5CQG A;  3JRF A;  2ZXW H;  3V42 A;  1JUM A;  1FZP B;  1SVL A;  2DO7 A;  2HWV A;  2MD0 A;  5E1W A;  1X2M A;  1YTY A;  2L01 A;  3TO9 A;  3FX3 A;  3MN2 A;  4P55 A;  3T1B A;  4RLQ A;  1MSE C;  1R5I D;  2Y9Y A;  2BEO A;  1MIJ A;  1W7P A;  4IHV A;  3QYE A;  4JX4 A;  2W57 A;  4B1R A;  4A3K J;  2ZNZ A;  3DBL B;  4RAG A;  2XAJ A;  1NH3 A;  2JK3 A;  3LNQ A;  4IHW A;  2VJ5 A;  4DBR A;  1Z1D A;  2KJC A;  5D4S A;  1Z3Y A;  5HLG A;  1VQN I;  3H5N A;  1XGS A;  5M5X J;  2HXO A;  2EIM H;  2FML A;  2HDW A;  2XGE A;  3HEF A;  3M1E A;  4M3B A;  3GME A;  2EIN H;  3KYD B;  3T0Y A;  2E35 A;  3CCM I;  3ZMD A;  4JQF A;  3MEX A;  4G8X A;  1ZG3 A;  2LF8 A;  3B73 A;  2ME6 A;  4QTR A;  1JGS A;  1X3W B;  4KIS A;  5J8C A;  4R8H A;  4FHT A;  2GOX B;  2E7W A;  4AU7 A;  4F91 B;  3RZD J;  2PI0 A;  2X1C A;  1J2X A;  5J6X A;  4M6Y A;  2EIL H;  4E7J A;  4UB6 C;  2DT5 A;  2X51 A;  4HDV A;  1BOB A;  1VQ4 I;  4P9F A;  3QAH A;  4M71 A;  2XPV A;  2XAG A;  2ESH A;  1FWZ A;  4FET A;  3CCQ I;  3KZI C;  1XC5 A;  4KIG A;  2V1X A;  3CCV I;  1QGP A;  4ZYD A;  3H92 A;  2O03 A;  1LVK A;  3E7L A;  3OYD A;  1MBF A;  1DP3 A;  2LNB A;  3OIO A;  2ZME C;  1E17 A;  3MZY A;  2E71 A;  1K79 A;  1IV6 A;  1GHC A;  1W7P B;  5IPA A;  3PNY A;  1L0O C;  2IBD A;  2R3S A;  1S7A A;  2DOE A;  2VKH A;  1W36 D;  4BXF A;  1JT6 A;  1IGN A;  4WXD A;  4KJZ A;  2GLO A;  1TWF J;  4UXN A;  1YW9 A;  2VOP A;  2VL8 A;  4HX4 A;  4X0G A;  1AKH A;  2M9H A;  1G59 A;  2LF7 A;  2E36 A;  4BHC A;  3E5X A;  3K6G A;  4U0Y A;  5IT9 Z;  4NNJ A;  4ENM A;  2ZXJ A;  3JTH A;  1U2W A;  5E3N A;  1OLT A;  3DLA A;  3H36 A;  4CUG A;  2ZME A;  3IWZ A;  4HQM A;  1WSU A;  3BT9 A;  4M3E A;  5J40 A;  3ZMT A;  1MNE A;  2MA3 A;  1IN6 A;  3QOE A;  2HEO A;  3DFG A;  4L0Z B;  2MH2 A;  2HR3 A;  4PFO A;  5F64 A;  2X48 A;  3CP2 A;  3MMY B;  3DKW A;  3WTX C;  3LAJ A;  2CUE A;  2P7V B;  3A02 A;  2W85 A;  3K2Z A;  4F92 B;  1XCV A;  2G7H A;  1O3R A;  1BW5 A;  4GRI A;  1GLN A;  4A3G J;  2FQ3 A;  1U5T C;  3HOT A;  5F1J A;  1BOA A;  1XMX A;  4Y7N J;  3AG2 H;  2YU9 J;  2OU2 A;  1KU2 A;  3TL4 X;  1IC8 A;  1TNS A;  3BR1 A;  2COM A;  2DFF A;  3F8M A;  3D5S C;  1Y1V J;  1R6R A;  2FA5 A;  3PM1 A;  4UV8 A;  4A5M A;  3WG9 A;  3CF5 F;  1QPI A;  4L9V A;  1RUN A;  5H20 A;  2K85 A;  2X1E A;  5H6Q A;  4X1E A;  2CW7 A;  3IH4 A;  1PVE A;  3CLO A;  1JKO C;  2OZU A;  4HLY A;  4BJ5 C;  2DQL A;  4DIQ A;  5TRD A;  2RAE A;  1OCP A;  3OYA A;  3V8L A;  1WJB A;  4KMU X;  3BP8 A;  2M8G X;  2F5V A;  3HOZ J;  2Y0M A;  4DOZ A;  5IT3 A;  4JX5 A;  3WE2 A;  1P4W A;  4OWR B;  3G2B A;  2R5Y A;  3C7J A;  4XRF A;  3MAJ A;  4XLN F;  2R7S A;  2IJL A;  3TO6 A;  5KNL A;  4A3I J;  3PUB A;  2ZME B;  2QWW A;  2A68 F;  1BIA A;  1JUS A;  3QPS A;  3J7Z I;  4HW0 A;  4RGR A;  3HC7 A;  1WJA A;  3H1C A;  3FXU A;  2X1D A;  2ZNY A;  3TO7 A;  1W0T A;  2KQR A;  1QPM A;  2VUM J;  2NOG A;  2ISY A;  4EJO A;  5K5O A;  1Y0U A;  3G73 A;  3VYR B;  2PN6 A;  3C3W A;  1FTT A;  3ASN H;  2CU7 A;  1VQ8 I;  2EH3 A;  5DV5 A;  4CIC A;  2R7W A;  1SC7 A;  2DK8 A;  2ZXH A;  3RKX A;  2W00 A;  5DM6 F;  3LSR A;  2H6C A;  1FPQ A;  1UEL B;  3D5R C;  4B8X A;  1DPU A;  2XDV A;  1ZQ3 P;  4Y13 A;  1HKT A;  3LOC A;  3ERM A;  5HNF A;  3S14 J;  5DD4 A;  2XAF A;  1ETQ A;  2VAS A;  3CCE I;  2DOD A;  1K78 A;  1MNM C;  2JRT A;  2JT1 A;  1I27 A;  3K4J A;  3AG1 H;  3KIO A;  4RGU A;  3RPU A;  3CD6 I;  3I58 A;  3IKT A;  3CDI A;  3K2A A;  4AVZ A;  3FIW A;  3VEP A;  3W2A A;  2L9V A;  4EM2 A;  5L3G A;  2BGC A;  2OBP A;  3HSR A;  3JRC A;  1R1U A;  4LLL A;  2LRE A;  3CQZ J;  3K9T A;  2COB A;  1WQ2 A;  5FKN A;  5JHF A;  3F23 A;  2WBM A;  4OIP F;  3AG4 H;  1QHH D;  3TQN A;  1S9H A;  1U5T B;  1TWC J;  3OYF A;  3U1D A;  4XON A;  2WY7 Q;  3QP5 A;  5B5E C;  1GUU A;  1NG6 A;  2F5E A;  2E1C A;  1S29 A;  2R5Y B;  2EZL A;  4KYW A;  1MBH A;  1ACI A;  4JP0 A;  4I09 A;  1TW3 A;  5LBQ A;  1ITY A;  2QCO A;  4L5I A;  3KEQ A;  3MKL A;  4I99 C;  2H09 A;  2VE9 A;  1WGX A;  3K4B A;  5CVJ A;  2XAQ A;  3F72 A;  2M1B A;  5CVU A;  2DI3 A;  2GAU A;  1X1D A;  3D1N I;  3S1Q J;  2X0L A;  1J7K A;  4CGZ A;  3PIO F;  1U9O A;  2P4W A;  4LG0 A;  4YRV A;  5F6F A;  2XB0 X;  4B43 A;  1FOK A;  5HLH A;  3CC2 I;  3SZP A;  2Q2E A;  2M3A A;  4P5O A;  3OYH A;  3ZQH A;  2BYV E;  4CH7 A;  1FY7 A;  4Y4R A;  4IQJ A;  1F9N A;  5D6F A;  3E1S A;  3L09 A;  1X4P A;  1Y0N A;  4C2T A;  1FNN A;  1KU3 A;  3E6D A;  5M5W J;  3GZ5 A;  1K78 B;  5HDN A;  5LEJ A;  2P5L C;  5EJC A;  2V1N A;  2JMW A;  2XKO A;  2AS5 F;  5DDG A;  1O7F A;  2DJI A;  2F4O B;  2DYR H;  2ECB A;  2WY8 Q;  1G3W A;  4IHY A;  4N9I A;  2MH9 A;  1BI1 A;  3M8E A;  1TQI A;  2LR8 A;  4CCK A;  3OL3 A;  1RZ4 A;  5FKO A;  4BQQ A;  3HG9 A;  4MQV A;  4RB0 A;  3KEO A;  3WOD F;  2R7Q A;  3H3Z A;  4A0Z A;  3T5X A;  1XSV A;  2RKH A;  3FHN A;  3L7W A;  1T39 A;  1HW2 A;  3TW7 A;  2IRF G;  4BKX A;  4PZJ A;  1P2F A;  3NRV A;  1X19 A;  5LLQ A;  2DPD A;  1POG A;  3H3V K;  3W6K B;  1SAU A;  2DXI A;  5IYD J;  2L9N A;  1S8N A;  4MFD A;  1Z3X A;  2LKP A;  2ELH A;  4FX4 A;  2XRO A;  3P9K A;  1IN7 A;  3FXJ A;  1VZ0 A;  4IJA A;  3WGH A;  4CYD A;  4DZJ A;  2DA5 A;  2STW A;  1I1G A;  4I0B A;  2X6W A;  4L5J A;  1R7J A;  2CQQ A;  3FM3 A;  1MDM A;  5FKM A;  1U3E M;  5D5X B;  4YFK F;  1DU6 A;  1E0E A;  5BS6 A;  2P5V A;  4AIK A;  3AG3 H;  1QVT A;  1G6N A;  5TJJ A;  1F5T A;  4PDK A;  3GLX A;  5J3L A;  3IL2 A;  3KP2 A;  4M3D A;  3CCU I;  3QP6 A;  4UVC A;  4G6D A;  1FMV A;  2Q2E B;  2HVR A;  2KIQ A;  4A69 C;  2HYJ A;  2PMZ N;  3Q0V A;  4M6V A;  2P0W A;  2Y30 A;  4ENN A;  4L18 B;  2ELK A;  1HKQ A;  1K4T A;  5LFA A;  2RRE A;  4RGX A;  4AYB N;  4BUP A;  1X3Z B;  3E0J B;  5L3C A;  3J7Y J;  3L1P A;  1VQL I;  2LBF A;  5LHI A;  4MO7 A;  2B7E A;  2JVG A;  4BQO A;  2EV0 A;  1ETO A;  1SD5 A;  3W3C A;  2KDO A;  3IAM 2;  5BOX A;  4ZTF A;  1YRN A;  4UVA A;  1P6R A;  5JLW A;  1YIJ I;  1DGR M;  5CVV A;  3DCF A;  3V7R A;  3UKG A;  4RBO A;  5IP6 A;  3OYN A;  2VBY A;  3CZ6 A;  4HG2 A;  3H9J A;  5DUK A;  2Y69 H;  4FAS D;  4BGD A;  5C4X J;  4XN0 A;  3RPQ A;  3HHH A;  4B3X A;  1JXS A;  2JTV A;  4XLC A;  2CGP A;  3I59 A;  1MBK A;  5K7F A;  2CG4 A;  2L7K A;  2BHZ A;  4DQ2 A;  2V9K A;  2H1L A;  5IOZ A;  2QQB A;  2ZBK A;  3FXL A;  4I7H A;  1VQP I;  1ETW A;  1C0W A;  2XF7 A;  4UUS A;  3CTA A;  4Q47 A;  2DA6 A;  3TOA A;  2LLK A;  3QPH A;  2VI6 A;  1MDM B;  3ZQF A;  3ML6 A;  2E2H J;  2QUF A;  3BC8 A;  2CQ7 A;  4MLO A;  5KVR A;  1PUF B;  2UV1 A;  3BZK A;  3DTK A;  2CW8 A;  2EZH A;  4B48 A;  4D0P A;  1GXQ A;  2ID3 A;  5JFR A;  2XGC A;  4IRI A;  2A6E F;  1R9T J;  5E79 C;  4HRI A;  1Z6R A;  2PJP A;  1REP C;  2R93 J;  3C2B A;  3K4K A;  2DOF A;  2NOJ B;  3A0B C;  4BJ6 C;  4ZH4 F;  2LBF B;  5D5U B;  5F0F A;  1IRF A;  2EV5 A;  1B59 A;  4D5C A;  1BI0 A;  4R1H A;  2KZG A;  1HDP A;  5D5V B;  4YFN F;  3SEZ A;  2KRF A;  1LNW A;  4NDL A;  5JR3 A;  4HSR A;  2HXI A;  4KN4 X;  1F43 A;  1U6G A;  2DT6 A;  2RQQ A;  4IHS A;  1B9N A;  3HRT A;  4HPQ A;  3EUH A;  2XVC A;  4NBQ A;  4XRS G;  4ETS A;  1S3J A;  2A69 F;  1BI3 A;  3BG6 A;  1YI2 I;  2V26 A;  1DGW Y;  3F6O A;  4C30 A;  4CCJ A;  3LSP A;  3K69 A;  2XF6 A;  1JKQ C;  3E5Q A;  2E7X A;  3FK7 A;  4E7S A;  1X4O A;  2CSO A;  1BIB A;  3WHB A;  1UHS A;  2VON A;  1D3Y A;  3ELK A;  4M72 A;  4XLH A;  2GBY A;  2GXG A;  2OZ6 A;  3KPH A;  4ENJ A;  3I71 A;  3Q0U A;  4S04 A;  2F6C A;  5FRM A;  1I6H J;  4G6T B;  5FRO A;  4CCL A;  3CUQ A;  1LDJ A;  1UHW A;  3RKW A;  2HOE A;  2IA2 A;  1O3Q A;  4N0B A;  2E1N A;  2HQR A;  4CYC A;  2M30 A;  3O6B B;  4HX7 A;  2NNY A;  4BAC A;  1H8A C;  5JVT A;  2Z9O A;  1O57 A;  1SVM A;  1DQU A;  2P8T A;  1Z05 A;  3KLN A;  4UUT A;  4YIF A;  3KET A;  2OCE A;  5F04 A;  2DA3 A;  3ZOB A;  1MMG A;  3HBL A;  1QNT A;  3NAR A;  4XKV A;  5IP7 J;  2G9W A;  2KRH A;  2HQA A;  2KIF A;  4I01 A;  4RS8 A;  3LST A;  3G6E I;  2AO9 A;  5E1Z B;  3BG5 A;  5D5W B;  4L9J A;  5DEQ A;  3S15 J;  2VPL A;  2O5R A;  2MG4 A;  2XPU A;  3VFZ A;  1XPX A;  4D7N A;  3EYI A;  4EVI A;  2X6Y A;  2YS9 A;  4I0A A;  4BJT A;  4ZJZ A;  1X3U A;  1K83 J;  1A36 A;  4ASN A;  1PP7 U;  4BU2 A;  4I2O A;  4XID A;  4MEY F;  4XLF A;  1S6L A;  1OYY A;  2QVO A;  3OV8 A;  1GVD A;  4EGY A;  2LKX A;  3OY9 A;  4B3A A;  5E3O A;  4LIV A;  4QLC U;  5IY5 H;  5ILV A;  3OR2 C;  3JRE A;  3ZQL A;  2OJE D;  5GAH J;  1A5J A;  4YG2 F;  3G1M A;  2CQK A;  2VQG A;  4C9Y A;  4EM1 A;  2EPF A;  4DJA A;  1T38 A;  2VQH A;  4UVB A;  1J59 A;  4PJ0 C;  3HOV J;  4EJU A;  4NHJ A;  2OUM A;  1JI8 A;  1YJ9 I;  5B1A H;  3CUQ B;  1SVO A;  2OA4 A;  4DNC A;  4MTD A;  3JW4 A;  1ZAO A;  3S93 A;  1I5Z A;  4CYC B;  1YX3 A;  2YU3 A;  4XNF A;  5BPD A;  2E5Z A;  2V79 A;  3IP4 B;  4Z2Y A;  1ZLJ A;  4AM3 A;  5H6R A;  4NUB A;  3ZXS A;  2QQ8 A;  1FC3 A;  5C3E J;  3PQJ A;  4LK0 F;  3ABL H;  2YUS A;  2JJ7 A;  5TGT A;  2O9L A;  3OMY A;  2DMQ A;  3KX2 A;  3CCY A;  2I10 A;  2XAS A;  5BMZ A;  2WAE A;  1YLF A;  1Z6T A;  2VBW A;  1FEX A;  4ON0 A;  1MBG A;  2FE3 A;  5ICG A;  2KIS A;  1BR2 A;  3SDB A;  3CC4 I;  4I98 B;  3AAF A;  4MGR A;  1XCB A;  3WU1 B;  4GGG A;  1HDD C;  2H8W A;  2NXN B;  2BVM A;  2IXS A;  3RI4 A;  1AU7 A;  3CUO A;  3TBI A;  2M8E A;  3N05 A;  2GA1 A;  3BRO A;  4GYI A;  1ZN2 A;  3BQZ A;  1T98 A;  4L9T A;  2VKD A;  3JRG A;  1VQK I;  4MIM A;  1LE8 B;  4LD5 A;  2KP6 A;  2MFZ A;  4A3C J;  4GYG A;  3ZQI A;  4PJM A;  2VT3 A;  3FBI B;  2VXD A;  4HBL A;  1K7A A;  1XMA A;  2MSY A;  1X1B A;  4L5E A;  4Y33 A;  4LK1 F;  5M3M J;  1TNT A;  2DBB A;  4XRS A;  4YIR X;  2FBK A;  3VPR A;  4E7H A;  1V3F A;  3J80 Z;  2OC6 A;  4Y17 A;  2DT7 B;  2J5P A;  4J19 A;  3LSI A;  2QQA A;  1MBJ A;  2A3S A;  5DYM A;  5DCF A;  4ZYE A;  5IP9 J;  2FX0 A;  4G6Q A;  1RKW A;  1WJD A;  5FFZ A;  1TWG J;  2KMU A;  3DV8 A;  1WCM J;  5B1B H;  3E6B A;  5E8I A;  3D5L A;  2XKP A;  4IX7 A;  3QYF A;  1V55 H;  1SFX A;  1PP8 F;  1ZGJ A;  3RKQ A;  2EFW A;  1XB4 A;  4F55 A;  4RGS A;  1SD4 A;  2X4H A;  5A2Q K;  3OYJ A;  2W84 A;  1FMW A;  4M3F A;  1BI2 A;  3HOY J;  1MND A;  1I3A A;  1IO2 A;  4AID A;  2ZJQ F;  3DPU A;  2QYO A;  1HST A;  3HL2 A;  3P9C A;  2X9D A;  3W6V A;  4IRH A;  3M8J A;  2F4I A;  3S32 A;  2LDU A;  3OR1 C;  5IOY A;  2CV1 A;  1RC9 A;  4A3F J;  1HA8 A;  1EJ9 A;  3J81 K;  1VQ6 I;  5DCM A;  2AXT C;  5J1R A;  4ZZD A;  2Z5U A;  2BY3 A;  2DU9 A;  2VJJ A;  1ON1 A;  3K4N A;  3EPZ A;  1FOY A;  1JHF A;  3WTU C;  1GXP A;  1HQC A;  2GA2 A;  3HDD A;  2BXZ A;  4BXU A;  3I5U A;  1UJ8 A;  2TRT A;  5LGT A;  1Z77 A;  4F7Z A;  2GWR A;  3TDZ C;  1GT0 C;  2MLK A;  4UHT A;  5ILS A;  1BR1 A;  1K4S A;  4M9S A;  1BC8 C;  4G12 A;  1APL C;  3BCB A;  2JPB A;  2JSP A;  1PUE E;  4OOI A;  1WH5 A;  4BXX J;  2FNP A;  2K40 A;  3FMR A;  1XDS A;  5FO5 A;  3ZRG A;  5J1U A;  2DJN A;  2HDD A;  1S7E A;  1HBX G;  3HSE A;  3L2W A;  1Z0X A;  2UXX A;  1HKS A;  1B72 A;  2K9L A;  3KP7 A;  3IUO A;  2RNG A;  4BDZ A;  2KHM A;  2RC4 A;  3DLL F;  1SD6 A;  1YIT I;  1E3O C;  3DEW A;  3KP3 A;  1T08 B;  3R4K A;  1IN4 A;  2DDA A;  3SJM A;  1HCR A;  4B44 A;  3FXK A;  2OQG A;  4AUX A;  3P9I A;  5EG0 A;  2F4M B;  2OV7 A;  3RTR A;  2IA0 A;  4PSW A;  1I39 A;  1CQT A;  4ZYA A;  1GDT A;  5DTD A;  4KIF A;  1WWX A;  4QWQ A;  4V2G A;  5DCM B;  2NYX A;  1IW7 F;  2K9N A;  3BPX A;  4CO8 A;  1JTY A;  3K1M A;  3DTE A;  1ZGA A;  4CDG A;  3NAU A;  4LLN A;  4OIO F;  4C3I J;  3M8F A;  4ZDP A;  1I3Q J;  2I5U A;  4D9J A;  2EFQ A;  4HF0 A;  4YFX F;  3NEU A;  3DKY A;  2IA1 A;  3R0A A;  5KCM A;  1MBE A;  4M74 A;  2IGN A;  4BQN A;  3ONQ A;  2DN0 A;  5FLV A;  3KP6 A;  2RV8 A;  3L2R A;  2ZCW A;  1WRJ A;  3AFH A;  4E7L A;  1J09 A;  2R5Z A;  3HOU J;  4G9Y A;  4RMN A;  5KK1 A;  2D45 A;  1MMS A;  1IAW A;  3ZQ7 A;  3FXR A;  5K7H A;  1SMT A;  5E3L A;  1B72 B;  3P7N A;  1MH3 A;  2R7U A;  1CF7 A;  1ONV A;  1TZL A;  1R4M B;  3LA7 A;  1D0Z A;  2CUF A;  3ZN0 A;  2E2J J;  2CQX A;  5B66 C;  1AKH B;  4XOR A;  3F0C A;  2MC3 A;  3BR5 A;  2HI3 A;  1Z67 A;  4A3B J;  1OR7 A;  3LAP A;  2MGQ A;  2KLO A;  3CCR I;  5EG0 B;  2P6S A;  4LLG F;  2B63 J;  3S2H J;  4RDU A;  5D4R A;  1I50 J;  4FE4 A;  2VXZ A;  4GFB A;  3KYL A;  1J0R A;  3GFM A;  2B0L A;  2VJI A;  3PNV A;  4IL6 C;  3TMO A;  1AWC A;  2N8G A;  2VBX A;  3R0J A;  3SZT A;  1U78 A;  4IF4 A;  4A2U A;  3DTI A;  1TTY A;  5HVQ C;  2FF4 A;  3QU6 A;  1QZY A;  4QPQ A;  4F93 B;  5EEA A;  1XTA A;  3F8B A;  3CF2 A;  1N78 A;  3RKY A;  3GCM A;  3TED A;  3I9V 2;  3KZZ A;  2IGK A;  3FKJ A;  4KUM A;  1L3L A;  3M7G A;  4HDU A;  2X6X A;  3RSN A;  3WTW C;  1HW5 A;  1TC3 C;  3G4S I;  1GV5 A; 
#chains in the Genus database with same CATH homology
 5JLW A;  1JJ6 C;  3DCF A;  3UKG A;  1H89 C;  4RBO A;  1X58 A;  1FTZ A;  5IP6 A;  3IH2 A;  2FQ4 A;  2D5V A;  2H1K A;  5C4X J;  1LFB A;  1XG1 A;  1NK3 P;  3FKI J;  3PO3 J;  4QSH A;  3BTL A;  4BBS J;  2X6O A;  1MBK A;  4ABZ A;  5K7F A;  1BL0 A;  3OSG A;  3TW6 A;  1LE8 A;  5IOZ A;  2Y31 A;  1UG2 A;  5K7Z A;  1ETW A;  2XGD A;  2R92 J;  4UUS A;  3GTJ J;  4JX6 A;  2DA6 A;  3Q0W A;  4I76 A;  4C2M J;  2LLK A;  4JYK A;  2VI6 A;  1ORK A;  3O8G A;  3ZQF A;  1ETK A;  2E2H J;  3CDL A;  4FCY A;  4BY7 J;  2H8R A;  4MLO A;  1ZR4 A;  1HF0 A;  4D7M A;  1PUF B;  4W1U A;  5FKL A;  2EZH A;  2LFB A;  3JRB A;  2ID3 A;  2XGC A;  1R9T J;  4XK4 A;  4DZP A;  4A3J J;  2TCT A;  3CMY A;  4A3M J;  2R93 J;  2Y2Z A;  3SFI A;  3C2B A;  3G1L A;  1P7J A;  3HOX J;  1VND A;  1U8B A;  5FKK A;  2JA8 J;  1RR7 A;  2IAI A;  5F08 A;  1JTX A;  1AHD P;  5F0F A;  3GTP J;  4DYR A;  2L9R A;  2M0C A;  4BBR J;  4D5C A;  1HDP A;  5E3M A;  3TP0 A;  3S1N J;  2VKV A;  1OFC X;  4NDL A;  2HXI A;  2Y0S N;  3BTJ A;  1F43 A;  1QVU A;  3BR6 A;  4B4C A;  2DTZ A;  3BR2 A;  3BG9 A;  5M5Y J;  4XRS G;  5EYR A;  1MSF C;  2OF7 A;  2M2E A;  3S2D J;  1O4X A;  4A3D J;  3LSP A;  4QIW N;  4HNV A;  1JKQ C;  1IDZ A;  3GTM J;  3FK7 A;  1FIA A;  2R7Z J;  5J1Y A;  3WHB A;  1UHS A;  3HB9 A;  1MH4 A;  2GBY A;  3FIS A;  3JRF A;  1JUM A;  1X2M A;  3B6C A;  3Q0U A;  1I6H J;  1NK2 P;  2P81 A;  3MN2 A;  1D5Y A;  2WAQ N;  1MSE C;  2Y9Y A;  2O7O A;  4IHV A;  4CYC A;  4JX4 A;  1UMQ A;  4B1R A;  4A3K J;  3HGG A;  1H8A C;  1FIP A;  3GTK J;  4UUT A;  3A03 A;  5F04 A;  3SDG A;  2DA3 A;  3ZOB A;  2JK3 A;  2CRG A;  3HBL A;  3LNQ A;  5DS9 A;  3NAR A;  4IHW A;  5IP7 J;  1ETY A;  2AO9 A;  3BG5 A;  1JJ8 C;  5M5X J;  1VI0 A;  3S15 J;  2HXO A;  2XGE A;  3HEF A;  1IRZ A;  2MG4 A;  2XPU A;  4M3B A;  1RES A;  4D7N A;  3FK6 A;  2R5Z B;  2YS9 A;  2XRL A;  1K83 J;  3M3Y J;  2JWT A;  4XID A;  3BTI A;  2ME6 A;  4QTR A;  3BR3 A;  3ZQG A;  1IDY A;  1GVD A;  2DA7 A;  3JRH A;  1TWA J;  1LFU P;  2LKX A;  3RZD J;  3TP3 A;  4B3A A;  1BA5 A;  5E3O A;  3BTC A;  3S1M J;  1RKT A;  3MVP A;  1ZTR A;  3JRE A;  1VF9 A;  3ZQL A;  2XPV A;  4EEF G;  2LK2 A;  5F27 A;  2NVT J;  1A5J A;  2EZI A;  3G1M A;  3A01 A;  1G2H A;  1XC5 A;  3OSF A;  3HOV J;  2DMU A;  2KT0 A;  3BQY A;  3E7L A;  1MBF A;  3OIO A;  5HOD A;  4FTH A;  1IV6 A;  1FJL A;  5C44 J;  5IPA A;  4CYC B;  2L7Z A;  2JN6 A;  2IBD A;  2DMT A;  2IEK A;  1JT6 A;  1IGN A;  2GLO A;  1TWF J;  5GPA A;  5C3E J;  2AHQ A;  1AKH A;  2M9H A;  2YUS A;  2JJ7 A;  4A3L J;  2O9L A;  1BJZ A;  2DMQ A;  3BG3 A;  5EZH A;  3CCY A;  1BW6 A;  1T33 A;  2I10 A;  5E3N A;  1FEX A;  4IHX A;  2OPT A;  3K7A J;  1MBG A;  1QRY A;  3BT9 A;  4M3E A;  2NVY J;  1YRN B;  2HQ5 A;  3H0G J;  2DA1 A;  2LD5 A;  2WB1 N;  1HDD C;  2QF7 A;  2X48 A;  1SFO J;  2DA2 A;  1OCT C;  1DU0 A;  1U9N A;  5IYC J;  5GP9 A;  3GTL J;  2CUE A;  3A02 A;  1AU7 A;  9ANT A;  2DMN A;  2LTP A;  5EGO A;  4X6A J;  4S0H B;  3BQZ A;  1BW5 A;  4A3G J;  3JRG A;  3HOW J;  5F1J A;  4MIM A;  1LE8 B;  4Y7N J;  3A01 B;  4A3C J;  2YU9 J;  1H88 C;  3ZQI A;  1IC8 A;  4UUS B;  1T56 A;  2NS7 A;  3BR1 A;  1Y1W J;  1WH7 A;  2MSY A;  1Y1V J;  4L5E A;  2XB5 A;  3PM1 A;  5M3M J;  5IYB J;  4DYQ A;  2K9Q A;  4XRS A;  4MFE A;  1K61 A;  3IV5 A;  1QPI A;  3VPR A;  1SAN A;  4X1E A;  2E19 A;  3IH4 A;  1JKO C;  1P7I A;  2EQR A;  2JA7 J;  4J19 A;  4D5F A;  1MBJ A;  2NS8 A;  2RAE A;  1OCP A;  5IP9 J;  3S16 J;  1TWH J;  2FX0 A;  2VPR A;  1RKW A;  2M8G X;  3HOZ J;  1TWG J;  1WCM J;  4JX5 A;  5C4J J;  1JKR C;  4DYC A;  2KDZ A;  2R5Y A;  4A93 J;  1OJL A;  3GBG A;  4A3I J;  4A3E J;  2XSD C;  1HLV A;  3RKQ A;  3Q3S A;  4IEJ A;  1JUS A;  3QPS A;  2FD5 A;  4M3F A;  3HOY J;  1PUF A;  2NVX J;  1W0T A;  2VUM J;  2NOG A;  3W6V A;  2X9D A;  2XPW A;  1ZR2 A;  4V2F A;  5IOY A;  1FTT A;  1ENH A;  5EGO B;  2L7M P;  2CU7 A;  4A3F J;  3GTO J;  4M3G A;  2EH3 A;  4XRM A;  5J1R A;  1ZKG A;  2ECC A;  3RQI A;  4AC0 A;  3LSR A;  3LSG A;  1WPK A;  1ZQ3 P;  3LOC A;  3JRA A;  3S14 J;  3HDD A;  1ETQ A;  2TRT A;  1Z77 A;  1A6I A;  1MNM C;  5FJ8 J;  2L0K A;  1GT0 C;  3OOU A;  1VFC A;  1APL C;  4G12 A;  3GTQ J;  3K2A A;  1WH5 A;  1ZGW A;  4BXX J;  3B6A A;  2K40 A;  2WV1 A;  3FIW A;  3RZO J;  5J1U A;  2M34 A;  2DJN A;  2HDD A;  5GPC A;  1S7E A;  4LOC A;  3JRC A;  1Z0X A;  3CQZ J;  3HKZ N;  2COB A;  5FKN A;  1B72 A;  3HGY A;  2L7F P;  1X2N A;  1TWC J;  2CJJ A;  1GV2 A;  4FE7 A;  1Q1V A;  2ZB9 A;  1GUU A;  1E3O C;  3DEW A;  5BNG A;  2MW8 A;  2Y9Z A;  1RET A;  2R5Y B;  2EZL A;  1MBH A;  4JP0 A;  1HCR A;  3SJM A;  5F0C A;  3JRI A;  1ITY A;  2QCO A;  2LP0 A;  3MKL A;  4DW6 A;  2E1O A;  4AUX A;  1WGX A;  5EG0 A;  2VKE A;  2W48 A;  5JLX A;  1W0U A;  3D1N I;  3S1Q J;  1B8I A;  1CQT A;  1XS9 A;  3GTG J;  4Y52 J;  1ZK8 A;  2EBI A;  1GDT A;  5DTD A;  1U9O A;  4C3J J;  2XB0 X;  4V2G A;  2LY9 A;  2K9N A;  3I4N J;  2E2I J;  2JA6 J;  1JTY A;  4XIC A;  3QPL A;  3NAU A;  3ZQH A;  1JKP C;  3JRD A;  5EF6 A;  4C3I J;  1I3Q J;  2DMP A;  2JA5 J;  5FLM J;  1MBE A;  5M5W J;  1WI3 A;  2DN0 A;  3O8H A;  5FLV A;  5M3F J;  4W97 A;  2JMW A;  3S17 J;  2ECB A;  2R5Z A;  3HOU J;  2K9S A;  2EZK A;  4IHY A;  1HOM A;  3M4O J;  2LR8 A;  5K7H A;  5EDN A;  3BR0 A;  5E3L A;  1B72 B;  1NTC A;  1ETV A;  2ID6 A;  5FKO A;  1MH3 A;  5F0H A;  2DA4 A;  2HOT A;  2CUF A;  1JT0 A;  2E2J J;  2CQX A;  3I4M J;  3TW7 A;  4BKX A;  1AKH B;  3F0C A;  1POG A;  3LSJ A;  1JUP A;  3H3V K;  3BR5 A;  2HI3 A;  1EF4 A;  4A3B J;  5IYD J;  2HOS A;  3PO2 J;  2MGQ A;  2LVS A;  4MFD A;  2R0Q C;  4C3H J;  5EG0 B;  4I6Z A;  2B63 J;  3S2H J;  4RDU A;  4DZJ A;  3IH3 A;  1I50 J;  4FE4 A;  2DA5 A;  3JR9 A;  4GFB A;  1B8I B;  3G1O A;  2CQQ A;  5FKM A;  1DU6 A;  1IUF A;  3S1R J;  2ME0 A;  2N8G A;  3ZQC A;  1QVT A;  1U78 A;  2FJ1 A;  5J3L A;  2NVQ J;  4M3D A;  4FIS A;  2G0E A;  4A69 C;  1IG7 A;  2HYJ A;  2PMZ N;  1YRN A;  3Q0V A;  4M6V A;  5EEA A;  1F36 A;  2Y30 A;  2GM4 A;  2ELK A;  3QQA A;  3TED A;  4AYB N;  2HOA A;  3L1P A;  4BY1 J;  1IJW C;  4MO7 A;  3HM5 A;  1JGG A;  1ETO A;  5EZG A;  2O8K A;  1ETX A;  3WHC A;  1TC3 C;  1RPW A;  1GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...