3PO3J

Arrested rna polymerase ii reactivation intermediate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3po3J00
4D5FA 1ZTRA 1HOMA 2M34A 2YS9A 4EEFG 2IAIA 1JJ8C 2CJJA 1FTZA 3HM5A 5EF6A 2ECBA 1NTCA 2K9SA 1TWGJ 1MSEC 1H88C 4MIMA 2K40A 1IDYA 3NAUA 1S7EA 4ABZA 1LFBA 3JRBA 3GTMJ 1RPWA 4D7MA 1XC5A 4XK4A 2L0KA 5JLWA 5J1YA 2NS7A 2XPWA 1FIAA 2Y31A 4HNVA 4W1UA 2O8KA 1A5JA 3BTLA 5E3NA 3PO2J 2DMNA 3HDDA 3CCYA 3RQIA 1X2MA 3FK6A 2E2HJ 1JTYA 4JX4A 5C4XJ 5GPCA 1POGA 9ANTA 1X2NA 3L1PA 5F0CA 3JRDA 1B8IB 1PUFB 3B6AA 2NVYJ 3RZDJ 2VKVA 3HGGA 4BY7J 1AU7A 5C3EJ 3RZOJ 5EEAA 3TEDA 3UKGA 3HGYA 4FTHA 3H3VK 2L7FP 1MSFC 3GTJJ 4X1EA 3QPLA 3HOVJ 3C2BA 3I4MJ 2YU9J 4Y52J 2WV1A 1WCMJ 3GTKJ 1Z77A 2ME6A 1QPIA 3A03A 5EZHA 1MH3A 3OSGA 1HLVA 3LNQA 3S2HJ 3FK7A 3HOXJ 1VF9A 4V2GA 2EZLA 3TW6A 2X9DA 4C3JJ 1JUPA 2M9HA 2CUFA 2R0QC 5IP9J 1HDPA 5FLMJ 1MBKA 4IHWA 1OFCX 3FKIJ 1PUFA 4DZPA 2I10A 3M3YJ 1ZGWA 5M5XJ 3IH4A 2R7ZJ 2AHQA 4AC0A 3DEWA 1HCRA 2O7OA 1AHDP 2LD5A 3Q3SA 4BY1J 3SFIA 5J1UA 2XB5A 4D5CA 2FX0A 3TW7A 4JX6A 2JWTA 4W97A 3GTLJ 3A02A 5BNGA 3O8HA 1I3QJ 4C2MJ 3PO3J 2JK3A 3JRGA 3HOWJ 4QTRA 2LVSA 1GV5A 4DZJA 4A3MJ 3JRCA 2JJ7A 1FTTA 2H8RA 2COBA 3HOZJ 1BA5A 2GM4A 4AYBN 3S16J 1JKOC 1WPKA 3CQZJ 4BBSJ 1WH7A 4DW6A 1JUSA 3HKZN 2XPVA 2XB0X 2LK2A 1JKRC 1SANA 1U78A 1MNMC 2R5ZB 1OJLA 1UHSA 2CUEA 1LE8B 4B1RA 2LR8A 3Q0VA 2LP0A 4M3BA 1GT0C 2L7ZA 1GUUA 3MN2A 1I6HJ 3TP3A 5J1RA 3O8GA 5M3FJ 2XGDA 4UUSB 2LKXA 5F1JA 2R5YA 5EGOA 3S1QJ 3QPSA 5FLVA 2EH3A 4A3FJ 1ZR4A 3HBLA 1BW6A 4A3EJ 4A3KJ 3S1NJ 1RR7A 4CYCA 2M2EA 1WGXA 1OCPA 2DMUA 2FQ4A 2XRLA 3G1OA 1DU0A 5DS9A 2X48A 1ZR2A 2H1KA 2LFBA 2R5ZA 3D1NI 1NK2P 2M8GX 3I4NJ 1R9TJ 2DTZA 2XPUA 1LE8A 3B6CA 3FIWA 4FE4A 5F0FA 1ZQ3P 3NARA 2E19A 2ZB9A 1QRYA 2HOTA 4NDLA 1U9OA 3S1RJ 3BR5A 3FISA 4DYCA 3F0CA 3MVPA 2MW8A 3MKLA 1JKQC 2ID6A 4UUSA 2HXIA 1D5YA 1XG1A 2JA7J 4M3EA 5DTDA 2QCOA 1O4XA 1VNDA 1W0TA 4XICA 1ZKGA 1TWCJ 1ITYA 4XRSA 3A01B 5E3LA 4A3BJ 2LTPA 2L7MP 5IOZA 4JP0A 3S17J 2KDZA 1FIPA 3S14J 4A69C 2XGEA 1IC8A 1Y1WJ 2FD5A 1W0UA 2TRTA 2P81A 3JRIA 5IP6A 3S1MJ 1IUFA 3BR1A 3G1LA 3BG3A 3BR6A 2XSDC 2ECCA 4JYKA 2R93J 2Y9YA 3BG5A 1UG2A 4QIWN 1B8IA 2DJNA 3HOYJ 4A3CJ 4I76A 5GPAA 1ETYA 4GFBA 1VI0A 2CRGA 3WHCA 4AUXA 1RKWA 2CQQA 5C4JJ 5FKMA 4MO7A 4A3LJ 3OSFA 2ME0A 5M5YJ 1JGGA 2WB1N 5EG0B 2ID3A 1JUMA 3A01A 1JT6A 2JN6A 4V2FA 2VUMJ 5K7FA 3CMYA 2G0EA 3H0GJ 1EF4A 2DA5A 2VPRA 1T33A 1F43A 1X58A 5JLXA 5IYBJ 5FKNA 2IBDA 5IP7J 2JA8J 5E3MA 1BJZA 3ZQFA 4MFEA 1P7IA 2HXOA 3LOCA 4BBRJ 2CQXA 1MBFA 1JTXA 1ORKA 4XRMA 3IV5A 2DMTA 5C44J 1MH4A 2DMPA 3ZQCA 2NVXJ 2VKEA 3G1MA 2DA1A 4MFDA 3WHBA 1HDDC 1TWHJ 5M3MJ 1K83J 3BTIA 3CDLA 4BXXJ 2CU7A 1CQTA 5EG0A 3ZQLA 2N8GA 3OIOA 3HOUJ 1HF0A 1BL0A 1ETKA 1APLC 3E7LA 1WI3A 2YUSA 1F36A 5IPAA 1MBHA 2HYJA 2VI6A 4L5EA 2L9RA 1B72B 4M3GA 4UUTA 2HDDA 4M6VA 2ELKA 1RKTA 1VFCA 4A3GJ 2NOGA 1ETXA 1A6IA 2RAEA 3RKQA 1JKPC 2MSYA 1RETA 5F04A 3PM1A 5J3LA 4A3IJ 1FJLA 1IGNA 4J19A 1YRNB 2LY9A 1IJWC 2JMWA 2Y2ZA 1IV6A 3ZOBA 2WAQN 1TWFJ 4G12A 3JRHA 4B4CA 1U8BA 4RDUA 3OOUA 1Y1VJ 3QQAA 2TCTA 3GTGJ 1Q1VA 2HOAA 3Q0WA 5IOYA 3JRAA 2B63J 2HQ5A 3LSJA 1FEXA 5GP9A 2DA2A 4S0HB 1JT0A 1ENHA 4XIDA 2OF7A 4FE7A 5F08A 1T56A 3TP0A 3GTQJ 1U9NA 2W48A 2FJ1A 3GBGA 4D7NA 1B72A 5FKKA 4B3AA 3BR0A 3JREA 1K61A 5IYCJ 1NK3P 4IHVA 1GVDA 3W6VA 2EZHA 5IYDJ 2AO9A 1ZK8A 3SDGA 1QVUA 1YRNA 5K7HA 3K2AA 1XS9A 3GTOJ 3SJMA 2EQRA 3BR2A 3K7AJ 3BR3A 1ETWA 2M0CA 2PMZN 5EDNA 4C3HJ 3LSGA 2NS8A 2NVTJ 3JRFA 1UMQA 4I6ZA 4DYRA 2MG4A 5EZGA 4X6AJ 1G2HA 3VPRA 4MLOA 2HI3A 3HB9A 2D5VA 2DA3A 2JA6J 3LSRA 1WH5A 1GDTA 1IG7A 1BW5A 1MBEA 1GV2A 3IH3A 3BTJA 2QF7A 2X6OA 4Y7NJ 1IRZA 2KT0A 1SFOJ 1MBJA 5EYRA 4LOCA 2GBYA 2XGCA 2JA5J 3DCFA 2EZIA 2K9NA 2MGQA 3BQZA 5E3OA 2DA7A 5F0HA 3IH2A 1I50J 3BT9A 2HOSA 4IEJA 2DN0A 5FKOA 3ZQIA 2EBIA 4BKXA 3BTCA 1LFUP 1AKHB 3BQYA 1QVTA 3Q0UA 1TC3C 1ETVA 3LSPA 2DMQA 4DYQA 5M5WJ 4QSHA 3BG9A 2IEKA 2O9LA 5K7ZA 2Y30A 2GLOA 1Z0XA 4M3DA 5F27A 2DA4A 4XRSG 4FISA 4A3DJ 1H89C 5FJ8J 1TWAJ 3M4OJ 4C3IJ 4FCYA 3JR9A 1JJ6C 1ETQA 2E1OA 4IHYA 2R5YB 5EGOB 4A93J 1E3OC 3GTPJ 1RESA 4M3FA 1ETOA 2LLKA 2OPTA 5FKLA 1AKHA 1H8AC 2DA6A 2Y9ZA 2R92J 1IDZA 4CYCB 4A3JJ 1OCTC 2EZKA 2K9QA 2E2IJ 3HEFA 3S15J 4RBOA 4JX5A 3ZQHA 1MBGA 1DU6A 2NVQJ 2Y0SN 2E2JJ 4IHXA 5HODA 3ZQGA 1P7JA 3S2DJ
chains in the Genus database with same CATH superfamily
2JZYA 3SZPA 2M4GA 2YS9A 3EUHC 2COMA 2IAIA 5TRDA 1FZPB 5D5WB 1RZ4A 2WV0A 1T39A 2V9KA 5DM7F 3M8EA 1EA3A 1YOVB 5K5QA 2K9SA 3LA7A 2RDPA 1TP4A 1MSEC 2ZXWH 2K85A 4R1HA 2DDAA 2K40A 1YO5C 1T08B 2CFOA 1IDYA 4G7ZF 3D5SC 2HGCA 3BROA 1T6SA 1S7EA 1VQPI 1QGPA 2VJIA 2IS4A 2MLKA 3FMRA 1V5GA 2KZGA 2L0KA 4O5VA 2EIJH 5JLWA 2CO5A 2PFBA 1KZHA 4F92B 3S3MA 2EK5A 3F23A 4XL9A 4W1UA 3T8TA 3S3NA 3J7ZI 3PO2J 1A5JA 3ZMDA 2RREA 1X2MA 3K1PA 4JX4A 3PIOF 2P0WA 4G6TB 4RM3A 4AVPA 4KFCA 2L7KA 1POGA 1XPXA 2JVGA 2M7AA 3GFLA 2EINH 2XKPA 1X2NA 3L1PA 5F0CA 3JRDA 2R7OA 1GVJA 2B7EA 3DP7A 1W5CC 2M5WA 4ZYAA 4BJ6C 2DYSH 3B6AA 3G3ZA 1T98A 2D1VA 2NVYJ 2V9VA 1X3UA 1WJFA 3D5LA 2QKLB 2EIMH 1AU7A 2XUBA 1O3QA 1MIJA 2KMUA 3ASNH 1SD5A 3HHGA 5CVUA 5EEAA 4IPAA 3F8MA 4N4OB 1Z6RA 4BACA 4FTHA 3H3VK 3ONQA 4IRIA 4UB6C 3OYBA 4X1EA 3CLOA 3QPLA 3CD6I 4Y52J 4P1WA 2Y69H 1UELB 2WV1A 4DGWB 2JQ7A 3KLNA 1Z77A 4JBAA 2J5PA 5EZHA 1MH3A 5A2QZ 1HLVA 3S2HJ 3FK7A 2PJRA 4HQMA 3IRQA 1TLHB 2IW5A 2X9DA 2HDWA 4YELA 2IGMA 3RYRA 4EJWA 4CCOA 3LSKA 2KIQA 4BHCA 1HDPA 4MTDA 3E0JB 3VOEA 4BH9A 3FKIJ 1VQKI 4DZPA 3AL0B 2I10A 2CUZA 1M1EB 5ILUA 1SVOA 3HHHA 5CQEA 4HLYA 5DV5A 2O5RA 4HX7A 2B0LA 2LD5A 4R79A 3Q3SA 4BY1J 3CUQB 3SFIA 5J1UA 5E18F 3N4MA 3H36A 4W97A 3GTLJ 3ZQ7A 4QLCU 3IUOA 5LGNA 2Y48A 3MKYB 3RDIA 1LDJA 2BBYA 3MKWB 1REPC 1OCCH 4WXCA 1FOYA 4ENMA 3O8HA 1I3QJ 2DODA 3H9QA 3HOWJ 2MC3A 2QQ8A 4A3MJ 4N4NB 1K7AA 1W5SA 2JJ7A 1UHWA 4OOIA 2F5FA 1CF7A 2H8RA 5E20A 4IJAA 2WWYA 5LHIA 5B5EC 2JRMA 1G59A 1WPKA 1ON1A 3M8FA 2LBFA 3IP4B 4HNTA 2B9SA 3ZMZA 1JUSA 3CF5F 2XB0X 5FRMA 4AM3A 3DPTA 2LK2A 2P7VB 2NVUB 1N75A 1SANA 1IN8A 1S7OA 2XAFA 3K4NA 2V4JC 1R5GA 1UHSA 3WTWC 1N78A 2HQRA 1QPMA 4B1RA 5J47A 3Q0VA 1GT0C 4C2TA 3WTSC 4HBLA 5J1RA 2UXXA 1R49A 4IQ4A 1H0MA 2A6EF 1XGNA 2RNGA 3K70C 1AOYA 2D2WA 2IPQX 3VYRB 4UUSB 2R5YA 2HPIA 3QPSA 4QPQA 4B43A 1ZR4A 1WSUA 2L2OA 3HBLA 2XDVA 4HYEA 2CUJA 3ZMUA 5DUKA 1G3TA 4A3KJ 3W2AA 1RR7A 2HZDA 4Y17A 5L3CA 2RKHA 4CYCA 2DDBA 4B3XA 2QSGX 5CJ9A 1IN4A 2PG4A 3BC8A 4LK1F 3SQNA 1DU0A 1STZA 1F4KA 1XMKA 1D0YA 3MFKA 1LE8A 3LA3A 4E7ZA 3BG6A 5JI6A 3NARA 4BAYA 4E6KG 3EYIA 5H6RA 2HOTA 2YSRA 2EWNA 1U9OA 3OL3A 1U8RA 2X6WA 3DBLB 3BR5A 2FOWA 3FISA 4BGDA 2LC2A 2MW8A 1TQMA 1FBSA 3VFZA 2NNNA 4FQGA 3K4KA 4U7DA 3VYTB 2YX7A 4XICA 5ICFA 4Z6YA 1IN5A 3TOBA 5AIQA 4AIHA 5E3LA 2LTPA 4P55A 2X4HA 3OIQA 1KQ9A 4J00A 2RQQA 3CDIA 2KDZA 5HDGA 3S14J 1IC8A 2HTJA 2A69F 2OD5A 3HRSA 2X51A 4MQ9F 2HVSA 3I0TA 3ZMTA 2QBYB 4BJTA 1KU9A 3BG3A 3BR6A 3WE2A 4RB3C 2ECCA 2XV4S 3PFIA 3EPZA 4EV0A 2Y9YA 2H27A 3R0AA 4QIWN 1KONA 3RYPA 2HKOA 3HRMA 1YYVA 4Q47A 3M1EA 2CRGA 4AUXA 5ED4A 4IX7A 2LG4A 1OR7C 4GO1A 4A3LJ 1G3SA 1JGGA 2AXTC 2BVMA 4BEHB 1ZN2A 5FRNA 2LNBA 3CCMI 3CMYA 4ZZDA 2P5LC 1A04A 4YFXF 2G0EA 3JAMZ 3H0GJ 3JSOA 4IRHA 1T33A 3BG7A 4F91B 1F43A 4B44A 1Y8QB 5IP7J 2JA8J 1X1DA 5E3MA 3ZQFA 1TTYA 1P7IA 3LOCA 4BBRJ 3T1BA 3JAMK 1WVRA 4RS8A 1JTXA 1BIBA 1FBQA 4HPQA 3F8BA 2DMTA 3DLAA 2DMPA 3NRVA 4A5NA 2X6YA 2JUGA 4LLLA 3DKXA 5DYMA 5IY5H 3ZQCA 1BC7C 2VKEA 4ITVA 4HX8A 4MFDA 3TO6A 2PBIA 3WHBA 2RC4A 2W57A 2E36A 3PQKA 2GWRA 2ZC2A 5M3MJ 1R4NB 1O57A 2ADUA 3ZQLA 3CC4I 3A2KA 5CKTA 4ESJA 1HF0A 1U0JA 4O6JA 1LEAA 2M30A 2DQRA 1LFPA 3REOA 2A6HF 1D5VA 2VI6A 3K4LA 4PDKA 2ZMEC 2DOAA 4M3GA 2VT2A 4BXFA 2IJLA 1X4PA 1UAAA 3HPHA 3C7JA 2KPMA 2NOGA 4XKBA 1ETXA 1PYVA 3N97A 2O0YA 1WZ2A 4J19A 2ACJA 1YRNB 2Q0OA 2DU9A 3I4PA 1IV6A 1W36D 2JSCA 2WAQN 3LSIA 2BYVE 4YIFA 2W85A 4RDUA 2VONA 1Y1VJ 2R4GA 3QQAA 1J09A 1AWCA 2CW8A 2ELHA 5GAGJ 3RPUD 3I59A 4UNOA 2PEXA 1ENHA 3WGHA 4XIDA 2XC7A 2OTLI 1GXQA 1WHUA 3MCZA 3U21A 2W48A 2FJ1A 4LLNA 3GBGA 4XKWA 2W7NA 5EJCA 2UZKA 2LMDA 3RPUA 3F22A 1K61A 4V19K 4IZZA 4YFNF 3PNTA 3O6BB 2K3PA 3CCEI 2BY2A 1IAWA 4XKCA 2HFHA 1XS9A 3RTRA 2EQRA 3BR2A 4II3A 4LG0A 4WX9A 1LVAA 1SMYF 3OY9A 3LSGA 2NS8A 1R4MB 2NVTJ 3JRFA 2I5UA 1UMQA 5DD8A 4HSRA 1ZGAA 4G7OF 4MLOA 3OIPA 4XOTA 1D0ZA 3HB9A 4BE2A 1SEUA 2BE5F 2VASA 3HSRA 2JA6J 3LSRA 3EUAA 1MKMA 4PGGA 3KLOA 3I3LA 3IH3A 4MHGA 3IRRA 3BTJA 2QF7A 2X6OA 3AAFA 3GZNB 4PJNA 5L3GA 3LL7A 2H6CA 2XASA 2MA3A 5LHHA 2JA5J 2EZIA 1MJAA 2K9NA 5HLTA 1MDMB 3CCUI 4OIRF 1UJ8A 2OA4A 1LVKA 3HTUA 1E3HA 3CTAA 5F0HA 3E6CC 2K4JA 2MC4A 3FDYA 2DN0A 4FETA 2VE9A 2WBMA 3H5RA 2HEOA 3CP8A 1QVTA 4PCQA 3Q0UA 3V7CA 4ZC3A 3WE3A 1Z7UA 4WF2A 3QYFA 1MMNA 3OYDA 1ETVA 1E17A 3BG9A 1KU3A 3AKZA 4GXOA 1IF1A 4O3MA 1HC8A 4A6DA 2AQEA 2RVCA 1FOXA 1ZRFA 5H2FC 5F27A 5FGMA 1WJ5A 2BY1A 5BMZA 4HG2A 1TWAJ 2IP2A 1ZRDA 3S93A 1BI0A 2VQCA 1UCRA 1JJ6C 2OQRA 3L2RA 1BOBA 4A0ZA 4IHYA 1G3WA 1T0FA 5EGOB 5TGTA 3KP4A 3GTPJ 2W25A 3E6BA 1HSJA 2OPTA 4H4KC 3COAC 1AKHA 4XBFA 3RIRA 3FXJA 4PUSA 3VEPA 4PJMA 4I2OA 2MBFA 2FF4A 5D4RA 1Y0UA 1KU7A 3HEFA 3K4JA 4RBOA 3VB2A 3B02A 2E7XA 2XF5A 2V79A 2CV0A 1XX5A 2E2JJ 3OYJA 2Y0MA 1ZTRA 4ENJA 1HOMA 2VBXA 3PL8A 1W7PD 4LITA 3ZMVA 1X19A 3QAHA 5D5UB 2AS5F 1OYIA 1P6RA 3K2ZA 1X1BA 3MAJA 2GQQA 5E17F 2M1BA 5EF6A 4DOZA 2KJCA 4MTEA 3Q9SA 1W7PA 2X1CA 1QA6A 4RMNA 1R23A 3DEEA 5HLHA 3RKWA 5DUIA 4EGYA 1LUJB 2IGNA 2BEOA 3OL4A 4F55A 2HNHA 3NAUA 5DDGA 1V5EA 3LAJA 1LFBA 5HNFA 1R36A 2L9NA 3F8FA 3ERMA 2R7TA 1RPWA 1QHHD 2XPWA 3DBRB 3ELKA 2L5QA 2Y31A 5AIPA 2DFHA 3FXLA 3JTGA 3MD2A 2O8KA 3BTLA 4L9VA 3CCYA 2RQPA 1ZHFA 3CCRI 2DXIA 1YG2A 1SVMA 1E2XA 5GPCA 1FY7A 1RUNA 3DWLE 4F52A 1B8IB 2DOFA 3OYAA 4EJUA 5LGTA 4CH7A 3RZDJ 3WU1B 4XRFA 4E7HA 4L18B 4CCNA 2HS5A 3QOPA 4UXNA 4BYYA 3QOEA 3LA2A 2QM3A 2DFEA 4BU2A 3TEDA 3QODA 2WY8Q 3S8PA 3HGYA 1K6YA 1YITI 1MSFC 2DOEA 5DEQA 4E7JA 3GTJJ 2VJ5A 3C2BA 2CW7A 1WCMJ 2KRFA 4HF0A 4NQWA 2ME6A 1I3AA 2XAQA 1FLIA 3N05A 5LGUA 3PIPF 4NHJA 3OYEA 3HOXJ 1VF9A 2EZLA 3TW6A 2DBBA 2GA2A 2BOLA 1XSXA 1ZG5A 4B8XA 4B47A 4ZYDA 1MBKA 4IHWA 2WADA 4ON0A 3M3YJ 3I71A 1ZGWA 1Y0NA 1J59A 5CVJA 3C1DA 4I01A 3DEWA 2O7OA 2P4WA 4BDZA 2OC6A 2X1EA 4NC8A 4IF4A 2FX0A 4IOCF 4JX6A 2JWTA 4RB2C 1YI2I 1Z9CA 4A12A 4IVNA 5BNGA 3I53A 4KJZA 4C2MJ 1V3FA 3GFMA 3M7GA 2JK3A 3QRFF 3PO3J 3JRGA 4QTRA 1X1AA 1GV5A 1R58A 2X1DA 1HQCA 2VOOA 2E60A 3WTTC 1YQAA 4C2UA 2OCEA 4XLFA 2EA2A 1FTTA 2COBA 1WJCA 4HF2A 1BA5A 1YHQI 4D0PA 4E70A 2M3AA 4A2UA 1U5TC 3I56I 3KIOA 1U2WA 1V5FA 4IOAF 2JRTA 4E7SA 1JKOC 1K79A 1HW2A 2JPCA 1WH7A 1DP7P 4ZTJA 3HKZN 1SD4A 2XPVA 4JOMA 1P4AA 2HKXA 4DBRA 1VQ5I 2FU4A 1U3EM 2KQRA 3SZTA 2R5ZB 1OJLA 1RRJA 2CUEA 3C2HA 3CUQA 1D1CA 4LIVA 4IHSA 3CESA 1YJWI 2KRCA 2HQNA 3R0JA 3O8GA 1W36C 4HQEA 1J7KA 3GW2A 1W4MA 1HW5A 3ABLH 4EJTA 2XGDA 2HOEA 2CQKA 3C3WA 3S1QJ 5FLVA 2OTJI 4PFOA 2PLYA 4BQQA 3WTZA 1IRGA 1YX3A 2K9MA 4CSWA 2QA4I 3C18A 1WGXA 1ZELA 1P9QC 2OU2A 2ZFWA 1FOWA 4KIGA 3I55I 1FC3A 4CZCA 2MFZA 4KT6A 5DS9A 4M71A 2X48A 2R7FA 3D1NI 3I4NJ 4FE4A 2E19A 5FO5A 3OWTA 1TQPA 3PNVA 1NHAA 4NDLA 3RJPA 4NUBA 4XN3A 4XMYA 3F0CA 1QBJA 3MVPA 2V1UA 3FF5A 2OAZA 3ASOH 1FSHA 3ERED 4UUSA 1R1UA 2HXIA 4XORA 1XG1A 2JA7J 3E5XA 4M3EA 2C6YA 5DTDA 2QCOA 1O4XA 3QP5A 3O2PE 1OQYA 1W0TA 3K10A 1YW8A 4I0AA 1UFMA 1ZKGA 3NQOA 1WWXA 4U87A 1WKMA 3A01B 3CO7C 1K4TA 3CMMA 4PGHA 2Q2EB 3MZ8A 4JP0A 3S17J 1FIPA 3VODA 2FRHA 1I5ZA 3J80Z 2H1LA 3KCCA 3JRIA 2P81A 3KYCB 1SFEA 4KIBA 2F48A 3S1MJ 1MNDA 1Z3XA 1IV8A 1V54H 2ZKZA 2XSDC 3F6VA 3QYEA 3V8JA 4LGWA 4YIRX 3KZZA 2PJPA 2F5DA 4WK8F 2XRNA 3V8KA 1UG2A 4PZJA 4PJ0C 5GPAA 4AVZA 3OR1C 3DPLC 3WHCA 5A2QK 5HDNA 3WGIA 1RKWA 3KP2A 2GIZA 4OAYA 3GF2A 2CQQA 5C4JJ 1BR1A 2ME0A 3G2BA 1T95A 1VQOI 2K27A 1GLNA 2A61A 1OPCA 5EG0B 4ESBA 1JT6A 1EH7A 3L2VA 4HX4A 2QLZA 4Q48A 4WXDA 4B09A 1MD0A 4G6QA 5J4YA 1T38A 1T0FC 3DKYA 2R3SA 2VL8A 3WTUC 5JLXA 4PFPA 4E7IA 3LMMA 1PP7U 2QBYA 4WCGA 4ZYGA 4Y13A 3HZJA 4L5IA 3ABTA 2LYCA 2UXNA 3K6GA 5J40A 1OYWA 2CQXA 4XRMA 1B9NA 3KETA 1HKQA 1MNEA 1MH4A 4XQFA 4I0BA 2NVXJ 3A4CA 2XIGA 3HSFA 2DA1A 1FYKA 2KFDA 3RCOA 4AU7A 2M4KA 1TWHJ 2R7QA 2LREA 2OZUA 3QWLA 3GEZA 4OU0A 3BTIA 3CDLA 2DTRA 2Z16A 3J7AO 2TDXA 3KEOA 2DK5A 5ICEA 2ZMEB 1HW1A 1APLC 4KMFA 3TO7A 5LLQA 5HVQC 1BM9A 2YUSA 5IPAA 1MBHA 3W2VA 3JW4A 3HKZA 3T8RA 1D1BA 5KAFC 2WAFA 2R7UA 3ZN1A 2P5VA 3QU3A 4BS9A 3CCJI 4UB8C 3CC7I 4BL0B 4CYDA 2EPFA 4IHTA 3CLQA 3H35A 1XGMA 1A6IA 4MGRA 3J81Z 2BY3A 3RKQA 1JKPC 2ZO4A 4G7HF 3IL2A 1V55H 1P4XA 2KIFA 4ETSA 5J3LA 4A3IJ 1FJLA 1JE8A 2BW3B 2GAUA 2LY9A 3P9IA 1IJWC 3ZOBA 4RGXA 3OR2C 3DKWA 3IWZA 5BOXA 2K3FA 3FMQA 1U8BA 1L3LA 3HRTA 2CFXA 2JTVA 4KNYA 3OOUA 3LFKA 4KICA 3Q0WA 2B63J 2KRHA 1FEXA 1KU2A 1SAUA 2OF7A 2XAGA 3CF2A 1T56A 3TP0A 3GTQJ 3KEQA 2V6CA 5CPRB 3PQJA 1BI3A 2VBYA 3MZYA 2NAZA 3ULQB 3WTYC 5LD2C 2W24A 4S04A 2VQHA 2EZHA 5HS8A 5IYDJ 4UVAA 3UR3C 3SDGA 1QVUA 1YRNA 4EVIA 1R5HA 5JHUA 2DLLA 4U0VA 3K7AJ 2M0CA 5E8IA 3LSMA 5HLGA 2HDCA 2DFFA 2RN7A 4DYRA 1G2HA 1X1CA 3DXJF 2HI3A 3I64A 3FWEA 1SC7A 2OZ6A 4RGUA 5GTHC 1A6QA 3AG2H 5K5RA 2LSOA 1MBEA 1GV2A 1O3RA 4OIQF 2A5YB 3BJAA 3VYSB 5D8LB 3W6KB 1IRZA 1SFOJ 3KPHA 2YU3A 5EYRA 3EETA 3FHNA 2GBYA 1HSTA 4GGGA 3H5AA 2XGCA 2FA5A 2QENA 2ZNYA 3K0LA 1LJ9A 2MGQA 3FKJA 5HS9A 3RPQA 3BQZA 5E3OA 1PP8F 5AONA 1ZG3A 2HOSA 2PQ8A 4KISA 2WY7Q 4YEJA 1ZREA 5KNLA 2VKDA 2EBIA 1LFUP 4RAZA 3BQYA 3LQRA 1Z7LA 4DJAA 2DMQA 4DYQA 2IEKA 3JSPA 3TGNA 1IW7F 1MMDA 3FXQA 3F72A 3IAM2 2Y30A 1DGWY 3M9AA 2DPDA 2GLOA 2J5OA 1Z0XA 3EQLF 3A1YA 4XRSG 4FISA 1H89C 3HIFA 5J4VA 4EM1A 4FCYA 1Z67A 3CZ6A 1ETQA 3Q9VA 3HPGA 3OV8A 3V4GA 4ZYEA 1MDMA 1VQNI 2R5YB 2RGVA 2M8EA 3BJ6A 1WJDA 4MQVA 2FEZA 2LLKA 3FXMA 2Y9ZA 3P9KA 4II2A 2WTEA 1NG6A 4CYCB 1RUOA 3L09A 5FD6A 2EZKA 3OS0A 2E2IJ 1IN7A 3S15J 2W4SA 2VBZA 3RKYA 3ZQHA 5H20A 1W5TA 2E34A 3X2QH 2KP6A 2HYFA 4IHXA 2IXSA 3FXUA 1FX7A 2KHMA 3BPVA 2A07F 4NC7A 5EEGA 1BI2A 3OYKA 2M34A 4BUPA 4EEFG 1J2XA 1XTAA 2QSHX 2DT7B 2HZTA 2K7LA 2R7RA 3ABUA 4EGZA 1QNTA 2ECBA 4XN0A 4IRGA 1G4DA 1TWGJ 4G94A 1FYLA 2BVLA 3ECOA 1H88C 3WU0A 1A36A 4MIMA 1FWZA 2O61A 1XCVA 4Y33A 4L5JA 5GADJ 2PMHA 4ABZA 3HYIA 3JRBA 4RAYA 4WXHA 3WG7H 1EJ9A 3ZP5A 5LRRA 1TQIA 3GTMJ 3E1SA 4D7MA 2HYGD 3GFIA 4E7LA 5J1YA 2NS7A 1FIAA 3EUHA 3PFYA 4YG2F 4HNVA 1HXDA 2LRDA 3C2GA 2HTSA 1SMTA 2E1MC 2O6GE 3HL2A 3E5UA 3RQIA 1UZCA 3FK6A 5BS6A 1TW2A 3CCLI 2VXDA 9ANTA 2VXZA 2LY1A 2NYXA 4CA0A 2F4IA 3ZMSA 1PUFB 2VKVA 5BPDA 2FBKA 3HGGA 3PSIA 5C3EJ 3SYTA 3ZCOA 3ZN0A 2W84A 3DV8A 2KZVA 3QU6A 5KVRA 2CV2A 6PAXA 4R8HA 2L4MA 2WAEA 3OOPA 3AG4H 2L7FP 1J5YA 3GLXA 3OYNA 3OYFA 3VWBA 5LHGA 3HOVJ 4L0ZB 2E7WA 1VQ8I 1XSDA 1QPIA 2K02A 3A03A 2JSPA 3OSGA 3G73A 2GOXB 1KYZA 3IC7A 3KE2A 2VB6A 1YFHA 3EDPA 1JUPA 5CVIA 2R0QC 3ZQQA 3ZXSA 4FASD 1OFCX 2P7CB 1OCOH 1X4OA 5J8CA 5M5XJ 2JPBA 1ACIA 2K4BA 1G8XA 2R7ZJ 2AHQA 4AC0A 1YE9A 4IQJA 3I9V2 5CVRA 2EFOA 1WI9A 2FE3A 2R7VA 3FM5A 4D5CA 4HDVA 5D8KB 4ZYHA 3TW7A 2V1NA 2QUFA 2KDOA 2W1OA 4TV7A 4RLFA 1ZLJA 2JUCA 5JR3A 2H6BA 3K69A 4HA8A 5ERIA 1Y56A 3HUGB 1Y39A 5GAHJ 4I99C 2CSOA 1U5TB 1R1VA 2DPUA 3JRCA 4XONA 2KLOA 4NNJA 2ESHA 4BQAA 1BR4A 2GM4A 3DTEA 5B1AH 2QYOA 3DEUA 4BBSJ 3KP7A 1U6GA 4DW6A 1B4AA 2CMPA 3L2CA 2W00A 1IN6A 5L3DA 1YW7A 3ABKH 1JKRC 5BPIA 3DPUA 5J6XA 1Z05A 4ZZLA 2V7FA 2LR8A 3P9CA 4XLPF 3I59B 1LDDA 4LG3A 3MN2A 4HRIA 4D1QA 2OCCH 4CDGA 3TP3A 4PSXA 2DI3A 1XGSA 2ETHA 2ZJ2A 3GZ5A 5JFRA 1Y8RB 2L54A 2G9WA 4OAZA 2LKXA 2Y75A 1R00A 5B1BH 4RB1A 2ZXHA 1MMAA 3OS1A 5DD4A 4A3EJ 3AG1H 5TISC 1K78B 4M9SA 3GO5A 4LFUA 2M2EA 4UVBA 2DMUA 2FBHA 5IT3A 4LG0B 1MJBA 2XRLA 3G1OA 2NOJB 3IKVA 4HOBA 2H1KA 2R5ZA 3H1CA 1NK2P 1R9TJ 2KIMA 2L9SA 3B6CA 3FIWA 5F6FA 2A6TA 1ZQ3P 1QRYA 3G71I 2XF6A 4CICA 5JHFA 3S1RJ 1Z91A 5LRSA 5L3BA 2MABA 1Z21A 1JI8A 4ZH4F 3VSLA 2L02A 2EJRA 3U1KA 4IL6C 3HJEA 4CZZA 4KT5C 4NC6A 4S05A 1O3SA 4E4HA 3O3KA 1XDUA 1ZYRF 2V26A 1TWCJ 3ZPLA 1LDKB 1OKRA 3H5NA 1EH8A 4A3BJ 4ESFA 2L7MP 4X0GA 2O03A 1XN7A 2E1NA 4C9YA 3NWSA 3SEQA 2EB7A 2OBPA 2QQAA 1TNTA 2TRTA 4UHTA 1LQ1A 2L4AA 4M73A 5DCMB 1ZRCA 1IUFA 3BR1A 3G1LA 3TBIA 4XM3A 2JVHA 1YJ9I 2H09A 4JYKA 3BP8A 2V1DA 3GWZA 2R93J 1Z3YA 3BG5A 2CQ7A 3I5UA 1XB4A 2RV8A 2KL4A 3NWTA 2VC1A 3SEZA 1FNNA 4A5MA 4A3CJ 1S5LC 1ETYA 4OWRB 4GFBA 3OYLA 1VI0A 3AFHA 3U1DA 1KGSA 1C0WA 2IS6A 3ESWB 2CW0F 3ROUA 3DFGA 2Z2SB 3GCMA 3OYIA 4MO7A 3OSFA 3H9GA 2D45A 4DNCA 4G8XA 1ULYA 1JUMA 4CHUA 3A01A 2JN6A 4V2FA 3CCQI 4N0BA 5K7FA 5JVGF 1R5ID 2IGOA 2Q2EA 1XD7A 3IHUA 2EFQA 2DA5A 2P6TA 3A0HC 4E7KA 2VPRA 3KYDB 2EA4A 3KEYA 1VQ7I 3OMYA 4XLCA 3RI4A 1X58A 2MLGA 1MZBA 2FXAA 1TW3A 2F5EA 4A0XA 3OYCA 1QZYA 4J01A 3LQQA 4ZDOA 3LFUA 4A6EA 2ZBKA 3E5QA 2P8TA 4CO8A 1IUYA 1S72I 1G3YA 3V7SA 2CYYA 3IV5A 1JHHA 1R1TA 4D9JA 5FLXZ 4ZDLA 3R60A 5FROA 4EM0B 4NBQA 5E1XA 1A35A 3H92A 3G1MA 3ABMH 3QPTA 2Q8KA 1LPQA 4MEXF 1BIAA 4XLEA 1K83J 4GCVA 4XSZF 4ZJZA 4BXXJ 1D8KA 2CU7A 4XNFA 3S2WA 5EG0A 2HVQA 3HXLA 3HOUJ 5FLXK 4HSTA 5D5VB 1ETKA 1BL0A 3I58A 2HWVA 2IRFG 2WC2A 3JCUC 2EFNA 1F36A 4BNCA 4L9JA 2HYJA 4G9YA 4L5EA 1JGSA 2L9RA 1O7FA 2LOOA 1IZ1A 1B72B 4UUTA 2HDDA 2CH0A 4M6VA 1RKTA 1VFCA 1OLTA 3HRUA 4UV9A 1PDNC 4A3GJ 2FQ3A 2ESNA 1S29A 2F2EA 1RETA 5F04A 4ENNA 3CUOA 1ERDA 1IGNA 3H9JA 3V8LA 2CGPA 1FP1D 2R7XA 5IT9Z 4G12A 2Z33A 2VODA 3JRHA 4ANJA 2L01A 4I09A 2GXBA 4MNUA 4ZTFA 2HR3A 3GTGJ 1Q1VA 2HOAA 5IOYA 3MKZA 2UUZA 2ZMEA 2HQ5A 3LSJA 5CLSA 5GP9A 2DA2A 3FZVA 2DYRH 2XAUA 4FE7A 5IT9K 3FHZA 5F08A 2DK8A 1J9IA 2HU9A 1VQ6I 4D7NA 5FKKA 4G6DA 2VOPA 1JHFA 1YS6A 5L3EA 3JREA 5IYCJ 4PJJA 2P6SA 4IHVA 4LJZF 3W6VA 4YIIA 1YW9A 4NQWB 3P7NA 5H6QA 3R6SA 2ZNZA 3WG9A 1ZK8A 4KN7X 1S9HA 3DU6A 1FBUA 5E79C 1E3PA 2BW3A 5K7HA 5LFAA 3K2AA 3MMYB 4H0EA 4F7ZA 2FMYA 3SJMA 2Z99A 1UHMA 1SFKA 3E97A 3MEXA 3BR3A 2PMZN 5EDNA 2VPLA 3LSTA 4C3HJ 2F4OB 1YLFA 2H8WA 4CCMA 1S7AA 3DU5A 3PSFA 1J75A 4I6ZA 1FYMA 2MG4A 5EZGA 4X6AJ 3VPRA 2K86A 2X85A 2M7BA 2EV6A 3W2WA 2DA3A 1WRJA 1CGPA 2GZWA 1WH5A 1Y6IA 3P5JA 3A0BC 1VQMI 4EATA 1B9MA 1G6NA 1IG7A 4DIQA 2VIXA 1DDNA 3J80K 1FOKA 3BOQA 2E1CA 2KT0A 1MBJA 5DCFA 5D5XB 3TL4X 4LOCA 2X6XA 3KYLA 4RAGA 4OIPF 2AQFA 3DCFA 5CYVA 4BQNA 3ZR8X 2DA7A 2M0MA 3IH2A 4IEJA 4PJLA 2A05A 2W82A 3KP5A 4BKXA 1QQIA 3BTCA 5HDKA 3G4SI 3D5RC 3SXYA 4KITB 1S3JA 2L9VA 4U0YA 1ODDA 2FNAA 3BJOA 4IO9F 4EJVA 5M5WJ 1DGRM 4XKVA 1F1ZA 5B3SH 5JVTA 4KA4A 1HBXG 3M07A 4XLNF 1GXPA 3K9TA 1T2KA 1JXSA 4XSXF 4I7HA 3WGGA 5KCMA 4M3DA 4HAMA 2RNJA 2XROA 4A3DJ 4HZFA 3HTSB 2E5ZA 3CDHA 4M72A 4FX0A 2E1OA 2H94A 2DW4A 2A3SA 4BEHA 3GFJA 1ZH5A 4Q5SF 2BHYA 2ZXJA 1E3OC 1RESA 4RA2A 2MD0A 3PUFA 4M3FA 1ETOA 1PJRA 3GVAA 3CJQB 2DA6A 2JA2A 1IDZA 4GYGA 4HLXA 5LEJA 3OYMA 2K9QA 2M45A 2MD5A 1E0EA 1MBGA 2F5CA 2Y0SN 3M1CA 2PMUA 4M74A 3SDBA 3UNGC 4U0WA 1P7JA 4P96A 4D5FA 2M87A 2G7HA 2EV5A 1B1BA 1RC9A 1JJ8C 2CJJA 3CC2I 3J81K 3ZRGA 1FTZA 4FT8A 2I8DA 2UV1A 3D0SA 3HM5A 1FSEA 3ZGKA 3CCVI 4AIJA 3EYYA 1NTCA 3H3UA 2ISYA 1ONVA 5FB2A 1MMSA 3E3VA 2LKPA 4HV6A 3LWFA 2E35A 3F8NA 2IA1A 2XKOA 4RGSA 3BCAA 2OQGA 1HKSA 2E1MB 3VDXA 4I98B 3CP2A 5FFZA 1QZZA 4BHBA 1XC5A 4HW0A 4XK4A 1SFXA 2IGKA 1TZLA 1FT9A 3FXOA 5ICGA 5E3NA 2PI0A 2DMNA 2IA0A 3HDDA 3J7YJ 2R7SA 3PNYA 1SAXA 1K4SA 5E1ZB 4U88A 2CV1A 4EM2A 1JTYA 2E2HJ 2XF7A 4K2EA 2PJRB 5C4XJ 3IWFA 3KFWX 4C30A 4UVCA 4KDPA 1EH6A 1MGTA 2VJ4A 1R6RA 1BBYA 4DBQA 1USTA 5HOOA 2BZTA 5KK1A 1B59A 1DQUA 4BY7J 3V7RA 4FX4A 3RZOJ 2XSJC 3CJTB 3TMOA 2PMZA 5ILVA 3UKGA 1I1GA 2HVRA 1ZAOA 4GDFA 1EV7A 2ZCWA 1VQ9I 1RI7A 3I4MJ 2YU9J 1J0RA 2VQGA 4CXFA 2KJBA 2CWEA 3QPHA 3GTKJ 2QWWA 3U2RA 1Q1HA 4JK1X 3LNQA 1A31A 2EILH 1CF7B 2E71A 4V2GA 5D6EA 3SZGA 4C3JJ 1MW7A 2M9HA 2CUFA 3ISPA 5IP9J 5FLMJ 2LBFB 1PUFA 3DTIA 2UWMA 3U9GA 2VN2A 2HQAA 2V6EA 3CJNA 2HPMA 2V9PA 2DAOA 3IH4A 2FNPA 1SD7A 1S8NA 1ON2A 1HCRA 2FOKA 1UB9A 4ZDPA 1AHDP 2QGUA 2AXLA 3AL0C 4HF1A 4BE1A 4KMUX 2XB5A 4CCKA 3BPXA 2DO7A 2Z1DA 3ECHA 5EEHA 1D1AA 3A02A 1BI1A 2WA0A 3CUQC 3TOAA 5B66C 1RR8C 4IKFA 1O7LA 1D0XA 1YX5A 2LVSA 4KUMA 4HEA2 5CQGA 4DZJA 1R22A 4RLQA 5HNHA 2QEXI 4KYWA 3HOZJ 3KP6A 4AYBN 3S16J 2ZSHB 3CQZJ 4LLGF 2YPRA 1O3TA 4L9TA 3TO9A 2CQNA 2F6CA 1QU3A 1U78A 1MNMC 3GXOA 4L9NA 5ILSA 3WTVC 2VT3A 1SFUA 1LE8B 1XSVA 2CG4A 1YS7A 3JTHA 2OJED 3RKXA 2LP0A 3DTKA 4M3BA 2L7ZA 4WWCA 2PN6A 1GUUA 1I1SA 1XMXA 3F9KA 4PSWA 1I6HJ 5HLIA 1VQLI 4Z2YA 3NEUA 4Y3OA 1TBXA 1R7JA 2EFPA 2BXYA 3HC7A 5M3FJ 4CGZA 1MMGA 3K4MA 3HUGA 3BZCA 2Y0SA 2GA1A 3T0YA 1U5TA 3GMEA 4BHPA 1SVLA 2G7UA 5F1JA 4GYIA 5EGOA 1F5TA 2EV0A 2EH3A 3CMEI 3B73A 4A3FJ 1BW6A 4LD5A 5FFXA 3S1NJ 1IRFA 1BC8C 3BY6A 4RGRA 4BDYA 1D3YA 1P4WA 1OCPA 1SD6A 4LMYA 1VTNC 2FQ4A 3QP6A 4QPOA 3HOTA 2NXNB 1ZR2A 2LFBA 3TDUC 1YIJI 1OCZH 2ZXIA 3FMSA 2M8GX 3GLLA 2Z3YA 2DTZA 2XPUA 3FM3A 1IXSB 5J8FA 5E1WA 5F0FA 4NB5A 4KN4X 2ZB9A 1GHCA 1OYYA 3FBIB 4KIFA 4Y4RA 4EJOA 1T8IA 1WFXA 3DQVC 4XR6A 1IXRC 4DYCA 2O8XA 2LDUA 2DT6A 3CO6C 3L9FA 2DFIA 3MKLA 1JKQC 2QZ8A 2ID6A 3HSEA 3BZKA 3F3XA 3L00A 1D5YA 3QYBA 2STTA 4FHTA 4CCJA 1VNDA 5LEKA 3BCBA 3F8CA 1D8JA 1V4RA 1K78A 1ITYA 4P5OA 4XRSA 1PVEA 3BWGA 5IOZA 1H9TA 1YIOA 3VSKA 4UUVA 4A69C 2XGEA 3K4CA 5K1YA 3GX4X 1Y1WJ 2FD5A 1W0UA 3W6JB 5IP6A 3ML6A 2YX4A 3SHFA 4YFKF 2JT1A 2BV6A 2XAHA 1ZG1A 2DQLA 4UY8I 3WODF 2STWA 1PUEE 4OIOF 2QSFX 1B8IA 4OMZA 2DJNA 3H0DA 1NG7A 4I76A 2E5NA 2GXGA 4M9ZA 3HOYJ 2MYSA 1IRXA 1B6AA 2R7DA 1KYWA 3TKYA 2KIUA 2GOMA 4BXUA 4A0YA 2NS0A 5FKMA 1UG0A 5M5YJ 3S3OA 2VJJA 2EIKH 1FP2A 2WB1N 1LNWA 4XLHA 2ID3A 3PJRA 2ISZA 1I27A 2QVOA 3R4KA 3OS2A 2FMLA 2X0LA 1USSA 5TJJA 3HOSA 2QQBA 2VUMJ 5ICCA 4M6XA 3IAS2 4GRIA 1EF4A 3T5XA 4PK4A 5GAEJ 4ASNA 2IS1A 2ZFUA 1YTYA 1X3ZB 5L3FA 4OMYA 5IYBJ 5FKNA 2IBDA 5DCMA 4HV5A 2IS2A 1X3WB 3TDZC 1BJZA 1OISA 2YR2A 3KZIC 4MFEA 3V42A 2KKOA 2HXOA 3BDDA 1Z6TA 4EQQA 2LKSA 1MBFA 1ORKA 2XVCA 4BJ5C 2NRAC 1N77A 4HDUA 2FUG2 4AD9A 2CS3A 5C44J 2D1HA 4IXAA 2ZSIB 2ZJRF 2A68F 4BE0A 2VE8A 1HDDC 4RM2A 2VBWA 3WTXC 1CQTA 1FMWA 3I54A 1DP3A 1EKEA 1H9GA 2N8GA 3OIOA 5DM6F 4LB5A 4UV8A 2GIVA 4AYBA 3E7LA 1WI3A 5D6FA 3K1MA 1FPQA 3VYUB 3R61A 4F3QA 3BLYA 4DQ2A 4P9UA 3OYHA 1F9NA 1OMIA 2FBIA 2ELKA 3MQ0A 3EUKL 1XDSA 5D4SA 3H3ZA 2RAEA 1TNSA 1MJ9A 1DPUA 5F1RA 2MSYA 1WJEA 3PM1A 2IT0A 1DUXC 1XGOA 2BXZA 4EMSA 2LF7A 4CUGA 3L2UA 3W3CA 2JMWA 2Y2ZA 1ZGJA 3GUDA 3G6EI 1TWFJ 2QQ9A 2Q1ZB 3K70D 4B4CA 3CCSI 1XCBA 4QWQA 2ZJPF 2VQLA 2BGCA 2EFWA 2TCTA 2XAJA 3PUBA 4F93B 3JRAA 2NNYA 1VQ4I 2XHKA 1TT0A 1QZEA 4S0HB 4LB6B 1JT0A 2LH9A 5HS7A 3FBNB 4L0YB 2BY0A 2WAQA 1TL8A 1U9NA 3F6OA 2KISA 1P92A 1BN5A 1L0OC 3KX2A 1FMVA 1B72A 4B3AA 3BR0A 4U7BA 4Q4ZF 2F5VA 2VLAA 4MEYF 1KQ8A 4AIDA 4HNUA 1NK3P 3K4BA 1HA8A 1BOAA 3RSNA 2MH2A 1N25A 1GVDA 3CJRB 2LF8A 3MWMA 2OV7A 5LBQA 1IO2A 2AO9A 1BR2A 3KP3A 4LIUA 4N9IA 3F21A 2V1XA 3HG9A 4RAFA 2LY2A 1R71A 3GTOJ 2OUMA 1LEBA 3WU2C 2GXAA 2A5WA 1ETWA 5K5OA 2K9LA 3LAPA 1AA7A 1KA8A 1ZARA 5FD5A 3SFZA 2DT5A 1QO0D 2DCEA 3CMAI 1HKTA 3DF8A 4JQFA 4P9FA 2D5VA 1X1PA 3K1NA 2R7WA 1W1WE 1WJBA 1GDTA 4XOPA 1OCRH 2O3FA 1BW5A 3BZ6A 3IKTA 1YJNI 2DJIA 4Y7NJ 3E6DA 3TQNA 1QHGA 2QKMB 1P2FA 2IVMA 1LKXA 2BHZA 1RIOH 5GTIC 1ZLKA 2VC0A 3KZYA 3GYHX 3E6MA 2ZJQF 1DPRA 3RQ4A 1I50J 3BT9A 5FKOA 1WJAA 3OYGA 3MZHA 3ZQIA 1AKHB 5F64A 4AIKA 4I02A 1TC3C 4BQOA 3DLLF 2FSWA 3Q5FA 3L2WA 3LSPA 1NH3A 4N9HA 4QSHA 2WB1A 5CVVA 3S32A 3M8JA 4AWXB 2O9LA 1LB2A 5K7ZA 1WQ2A 5BQTA 1BJAA 2Z5UA 2VKHA 1KQ0A 1OR7A 5KHDA 4M6YA 4LK0F 2DA4A 1I6XA 1XMAA 5FJ8J 3GZ6A 3DBHB 5KAIC 4CCLA 3L2QA 3M4OJ 4C3IJ 2XGXA 2MH9A 4M9XA 4XLAA 3JR9A 1I39A 1IXCA 1W7PB 3FXKA 2PX9A 4A93J 2L3DA 2Z9OA 1S6LA 2ELJA 4OINF 1VZ0A 5FKLA 1H8AC 4RB0A 1RNLA 3FXRA 2R92J 3L7WA 1TT5B 3LSHA 4A3JJ 4YRVA 1OCTC 2IA2A 3AG3H 1K6OA 2ICWG 4JX5A 2K5CA 5E8GA 2F4MB 2P5KA 2NVQJ 1DU6A 5HODA 3FX3A 4B48A 3ZQGA 4Y15A 1Z1DA 4ENKA 3J7AY 3S2DJ
chains in the Genus database with same CATH topology
4D5FA 1ZTRA 1HOMA 2M34A 2YS9A 4EEFG 2IAIA 1JJ8C 2CJJA 1FTZA 3HM5A 5EF6A 2ECBA 1NTCA 2K9SA 1TWGJ 1MSEC 1H88C 4MIMA 2K40A 1IDYA 3NAUA 1S7EA 4ABZA 1LFBA 3JRBA 3GTMJ 1RPWA 4D7MA 1XC5A 4XK4A 2L0KA 5JLWA 5J1YA 2NS7A 2XPWA 1FIAA 2Y31A 4HNVA 4W1UA 2O8KA 1A5JA 3BTLA 5E3NA 3PO2J 2DMNA 3HDDA 3CCYA 3RQIA 1X2MA 3FK6A 2E2HJ 1JTYA 4JX4A 5C4XJ 5GPCA 1POGA 9ANTA 1X2NA 3L1PA 5F0CA 3JRDA 1B8IB 1PUFB 3B6AA 2NVYJ 3RZDJ 2VKVA 3HGGA 4BY7J 1AU7A 5C3EJ 3RZOJ 5EEAA 3TEDA 3UKGA 3HGYA 4FTHA 3H3VK 2L7FP 1MSFC 3GTJJ 4X1EA 3QPLA 3HOVJ 3C2BA 3I4MJ 2YU9J 4Y52J 2WV1A 1WCMJ 3GTKJ 1Z77A 2ME6A 1QPIA 3A03A 5EZHA 1MH3A 3OSGA 1HLVA 3LNQA 3S2HJ 3FK7A 3HOXJ 1VF9A 4V2GA 2EZLA 3TW6A 2X9DA 4C3JJ 1JUPA 2M9HA 2CUFA 2R0QC 5IP9J 1HDPA 5FLMJ 1MBKA 4IHWA 1OFCX 3FKIJ 1PUFA 4DZPA 2I10A 3M3YJ 1ZGWA 5M5XJ 3IH4A 2R7ZJ 2AHQA 4AC0A 3DEWA 1HCRA 2O7OA 1AHDP 2LD5A 3Q3SA 4BY1J 3SFIA 5J1UA 2XB5A 4D5CA 2FX0A 3TW7A 4JX6A 2JWTA 4W97A 3GTLJ 3A02A 5BNGA 3O8HA 1I3QJ 4C2MJ 3PO3J 2JK3A 3JRGA 3HOWJ 4QTRA 2LVSA 1GV5A 4DZJA 4A3MJ 3JRCA 2JJ7A 1FTTA 2H8RA 2COBA 3HOZJ 1BA5A 2GM4A 4AYBN 3S16J 1JKOC 1WPKA 3CQZJ 4BBSJ 1WH7A 4DW6A 1JUSA 3HKZN 2XPVA 2XB0X 2LK2A 1JKRC 1SANA 1U78A 1MNMC 2R5ZB 1OJLA 1UHSA 2CUEA 1LE8B 4B1RA 2LR8A 3Q0VA 2LP0A 4M3BA 1GT0C 2L7ZA 1GUUA 3MN2A 1I6HJ 3TP3A 5J1RA 3O8GA 5M3FJ 2XGDA 4UUSB 2LKXA 5F1JA 2R5YA 5EGOA 3S1QJ 3QPSA 5FLVA 2EH3A 4A3FJ 1ZR4A 3HBLA 1BW6A 4A3EJ 4A3KJ 3S1NJ 1RR7A 4CYCA 2M2EA 1WGXA 1OCPA 2DMUA 2FQ4A 2XRLA 3G1OA 1DU0A 5DS9A 2X48A 1ZR2A 2H1KA 2LFBA 2R5ZA 3D1NI 1NK2P 2M8GX 3I4NJ 1R9TJ 2DTZA 2XPUA 1LE8A 3B6CA 3FIWA 4FE4A 5F0FA 1ZQ3P 3NARA 2E19A 2ZB9A 1QRYA 2HOTA 4NDLA 1U9OA 3S1RJ 3BR5A 3FISA 4DYCA 3F0CA 3MVPA 2MW8A 3MKLA 1JKQC 2ID6A 4UUSA 2HXIA 1D5YA 1XG1A 2JA7J 4M3EA 5DTDA 2QCOA 1O4XA 1VNDA 1W0TA 4XICA 1ZKGA 1TWCJ 1ITYA 4XRSA 3A01B 5E3LA 4A3BJ 2LTPA 2L7MP 5IOZA 4JP0A 3S17J 2KDZA 1FIPA 3S14J 4A69C 2XGEA 1IC8A 1Y1WJ 2FD5A 1W0UA 2TRTA 2P81A 3JRIA 5IP6A 3S1MJ 1IUFA 3BR1A 3G1LA 3BG3A 3BR6A 2XSDC 2ECCA 4JYKA 2R93J 2Y9YA 3BG5A 1UG2A 4QIWN 1B8IA 2DJNA 3HOYJ 4A3CJ 4I76A 5GPAA 1ETYA 4GFBA 1VI0A 2CRGA 3WHCA 4AUXA 1RKWA 2CQQA 5C4JJ 5FKMA 4MO7A 4A3LJ 3OSFA 2ME0A 5M5YJ 1JGGA 2WB1N 5EG0B 2ID3A 1JUMA 3A01A 1JT6A 2JN6A 4V2FA 2VUMJ 5K7FA 3CMYA 2G0EA 3H0GJ 1EF4A 2DA5A 2VPRA 1T33A 1F43A 1X58A 5JLXA 5IYBJ 5FKNA 2IBDA 5IP7J 2JA8J 5E3MA 1BJZA 3ZQFA 4MFEA 1P7IA 2HXOA 3LOCA 4BBRJ 2CQXA 1MBFA 1JTXA 1ORKA 4XRMA 3IV5A 2DMTA 5C44J 1MH4A 2DMPA 3ZQCA 2NVXJ 2VKEA 3G1MA 2DA1A 4MFDA 3WHBA 1HDDC 1TWHJ 5M3MJ 1K83J 3BTIA 3CDLA 4BXXJ 2CU7A 1CQTA 5EG0A 3ZQLA 2N8GA 3OIOA 3HOUJ 1HF0A 1BL0A 1ETKA 1APLC 3E7LA 1WI3A 2YUSA 1F36A 5IPAA 1MBHA 2HYJA 2VI6A 4L5EA 2L9RA 1B72B 4M3GA 4UUTA 2HDDA 4M6VA 2ELKA 1RKTA 1VFCA 4A3GJ 2NOGA 1ETXA 1A6IA 2RAEA 3RKQA 1JKPC 2MSYA 1RETA 5F04A 3PM1A 5J3LA 4A3IJ 1FJLA 1IGNA 4J19A 1YRNB 2LY9A 1IJWC 2JMWA 2Y2ZA 1IV6A 3ZOBA 2WAQN 1TWFJ 4G12A 3JRHA 4B4CA 1U8BA 4RDUA 3OOUA 1Y1VJ 3QQAA 2TCTA 3GTGJ 1Q1VA 2HOAA 3Q0WA 5IOYA 3JRAA 2B63J 2HQ5A 3LSJA 1FEXA 5GP9A 2DA2A 4S0HB 1JT0A 1ENHA 4XIDA 2OF7A 4FE7A 5F08A 1T56A 3TP0A 3GTQJ 1U9NA 2W48A 2FJ1A 3GBGA 4D7NA 1B72A 5FKKA 4B3AA 3BR0A 3JREA 1K61A 5IYCJ 1NK3P 4IHVA 1GVDA 3W6VA 2EZHA 5IYDJ 2AO9A 1ZK8A 3SDGA 1QVUA 1YRNA 5K7HA 3K2AA 1XS9A 3GTOJ 3SJMA 2EQRA 3BR2A 3K7AJ 3BR3A 1ETWA 2M0CA 2PMZN 5EDNA 4C3HJ 3LSGA 2NS8A 2NVTJ 3JRFA 1UMQA 4I6ZA 4DYRA 2MG4A 5EZGA 4X6AJ 1G2HA 3VPRA 4MLOA 2HI3A 3HB9A 2D5VA 2DA3A 2JA6J 3LSRA 1WH5A 1GDTA 1IG7A 1BW5A 1MBEA 1GV2A 3IH3A 3BTJA 2QF7A 2X6OA 4Y7NJ 1IRZA 2KT0A 1SFOJ 1MBJA 5EYRA 4LOCA 2GBYA 2XGCA 2JA5J 3DCFA 2EZIA 2K9NA 2MGQA 3BQZA 5E3OA 2DA7A 5F0HA 3IH2A 1I50J 3BT9A 2HOSA 4IEJA 2DN0A 5FKOA 3ZQIA 2EBIA 4BKXA 3BTCA 1LFUP 1AKHB 3BQYA 1QVTA 3Q0UA 1TC3C 1ETVA 3LSPA 2DMQA 4DYQA 5M5WJ 4QSHA 3BG9A 2IEKA 2O9LA 5K7ZA 2Y30A 2GLOA 1Z0XA 4M3DA 5F27A 2DA4A 4XRSG 4FISA 4A3DJ 1H89C 5FJ8J 1TWAJ 3M4OJ 4C3IJ 4FCYA 3JR9A 1JJ6C 1ETQA 2E1OA 4IHYA 2R5YB 5EGOB 4A93J 1E3OC 3GTPJ 1RESA 4M3FA 1ETOA 2LLKA 2OPTA 5FKLA 1AKHA 1H8AC 2DA6A 2Y9ZA 2R92J 1IDZA 4CYCB 4A3JJ 1OCTC 2EZKA 2K9QA 2E2IJ 3HEFA 3S15J 4RBOA 4JX5A 3ZQHA 1MBGA 1DU6A 2NVQJ 2Y0SN 2E2JJ 4IHXA 5HODA 3ZQGA 1P7JA 3S2DJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D5F A;  1ZTR A;  1HOM A;  2M34 A;  2YS9 A;  4EEF G;  2IAI A;  1JJ8 C;  2CJJ A;  1FTZ A;  3HM5 A;  5EF6 A;  2ECB A;  1NTC A;  2K9S A;  1TWG J;  1MSE C;  1H88 C;  4MIM A;  2K40 A;  1IDY A;  3NAU A;  1S7E A;  4ABZ A;  1LFB A;  3JRB A;  3GTM J;  1RPW A;  4D7M A;  1XC5 A;  4XK4 A;  2L0K A;  5JLW A;  5J1Y A;  2NS7 A;  2XPW A;  1FIA A;  2Y31 A;  4HNV A;  4W1U A;  2O8K A;  1A5J A;  3BTL A;  5E3N A;  3PO2 J;  2DMN A;  3HDD A;  3CCY A;  3RQI A;  1X2M A;  3FK6 A;  2E2H J;  1JTY A;  4JX4 A;  5C4X J;  5GPC A;  1POG A;  9ANT A;  1X2N A;  3L1P A;  5F0C A;  3JRD A;  1B8I B;  1PUF B;  3B6A A;  2NVY J;  3RZD J;  2VKV A;  3HGG A;  4BY7 J;  1AU7 A;  5C3E J;  3RZO J;  5EEA A;  3TED A;  3UKG A;  3HGY A;  4FTH A;  3H3V K;  2L7F P;  1MSF C;  3GTJ J;  4X1E A;  3QPL A;  3HOV J;  3C2B A;  3I4M J;  2YU9 J;  4Y52 J;  2WV1 A;  1WCM J;  3GTK J;  1Z77 A;  2ME6 A;  1QPI A;  3A03 A;  5EZH A;  1MH3 A;  3OSG A;  1HLV A;  3LNQ A;  3S2H J;  3FK7 A;  3HOX J;  1VF9 A;  4V2G A;  2EZL A;  3TW6 A;  2X9D A;  4C3J J;  1JUP A;  2M9H A;  2CUF A;  2R0Q C;  5IP9 J;  1HDP A;  5FLM J;  1MBK A;  4IHW A;  1OFC X;  3FKI J;  1PUF A;  4DZP A;  2I10 A;  3M3Y J;  1ZGW A;  5M5X J;  3IH4 A;  2R7Z J;  2AHQ A;  4AC0 A;  3DEW A;  1HCR A;  2O7O A;  1AHD P;  2LD5 A;  3Q3S A;  4BY1 J;  3SFI A;  5J1U A;  2XB5 A;  4D5C A;  2FX0 A;  3TW7 A;  4JX6 A;  2JWT A;  4W97 A;  3GTL J;  3A02 A;  5BNG A;  3O8H A;  1I3Q J;  4C2M J;  3PO3 J;  2JK3 A;  3JRG A;  3HOW J;  4QTR A;  2LVS A;  1GV5 A;  4DZJ A;  4A3M J;  3JRC A;  2JJ7 A;  1FTT A;  2H8R A;  2COB A;  3HOZ J;  1BA5 A;  2GM4 A;  4AYB N;  3S16 J;  1JKO C;  1WPK A;  3CQZ J;  4BBS J;  1WH7 A;  4DW6 A;  1JUS A;  3HKZ N;  2XPV A;  2XB0 X;  2LK2 A;  1JKR C;  1SAN A;  1U78 A;  1MNM C;  2R5Z B;  1OJL A;  1UHS A;  2CUE A;  1LE8 B;  4B1R A;  2LR8 A;  3Q0V A;  2LP0 A;  4M3B A;  1GT0 C;  2L7Z A;  1GUU A;  3MN2 A;  1I6H J;  3TP3 A;  5J1R A;  3O8G A;  5M3F J;  2XGD A;  4UUS B;  2LKX A;  5F1J A;  2R5Y A;  5EGO A;  3S1Q J;  3QPS A;  5FLV A;  2EH3 A;  4A3F J;  1ZR4 A;  3HBL A;  1BW6 A;  4A3E J;  4A3K J;  3S1N J;  1RR7 A;  4CYC A;  2M2E A;  1WGX A;  1OCP A;  2DMU A;  2FQ4 A;  2XRL A;  3G1O A;  1DU0 A;  5DS9 A;  2X48 A;  1ZR2 A;  2H1K A;  2LFB A;  2R5Z A;  3D1N I;  1NK2 P;  2M8G X;  3I4N J;  1R9T J;  2DTZ A;  2XPU A;  1LE8 A;  3B6C A;  3FIW A;  4FE4 A;  5F0F A;  1ZQ3 P;  3NAR A;  2E19 A;  2ZB9 A;  1QRY A;  2HOT A;  4NDL A;  1U9O A;  3S1R J;  3BR5 A;  3FIS A;  4DYC A;  3F0C A;  3MVP A;  2MW8 A;  3MKL A;  1JKQ C;  2ID6 A;  4UUS A;  2HXI A;  1D5Y A;  1XG1 A;  2JA7 J;  4M3E A;  5DTD A;  2QCO A;  1O4X A;  1VND A;  1W0T A;  4XIC A;  1ZKG A;  1TWC J;  1ITY A;  4XRS A;  3A01 B;  5E3L A;  4A3B J;  2LTP A;  2L7M P;  5IOZ A;  4JP0 A;  3S17 J;  2KDZ A;  1FIP A;  3S14 J;  4A69 C;  2XGE A;  1IC8 A;  1Y1W J;  2FD5 A;  1W0U A;  2TRT A;  2P81 A;  3JRI A;  5IP6 A;  3S1M J;  1IUF A;  3BR1 A;  3G1L A;  3BG3 A;  3BR6 A;  2XSD C;  2ECC A;  4JYK A;  2R93 J;  2Y9Y A;  3BG5 A;  1UG2 A;  4QIW N;  1B8I A;  2DJN A;  3HOY J;  4A3C J;  4I76 A;  5GPA A;  1ETY A;  4GFB A;  1VI0 A;  2CRG A;  3WHC A;  4AUX A;  1RKW A;  2CQQ A;  5C4J J;  5FKM A;  4MO7 A;  4A3L J;  3OSF A;  2ME0 A;  5M5Y J;  1JGG A;  2WB1 N;  5EG0 B;  2ID3 A;  1JUM A;  3A01 A;  1JT6 A;  2JN6 A;  4V2F A;  2VUM J;  5K7F A;  3CMY A;  2G0E A;  3H0G J;  1EF4 A;  2DA5 A;  2VPR A;  1T33 A;  1F43 A;  1X58 A;  5JLX A;  5IYB J;  5FKN A;  2IBD A;  5IP7 J;  2JA8 J;  5E3M A;  1BJZ A;  3ZQF A;  4MFE A;  1P7I A;  2HXO A;  3LOC A;  4BBR J;  2CQX A;  1MBF A;  1JTX A;  1ORK A;  4XRM A;  3IV5 A;  2DMT A;  5C44 J;  1MH4 A;  2DMP A;  3ZQC A;  2NVX J;  2VKE A;  3G1M A;  2DA1 A;  4MFD A;  3WHB A;  1HDD C;  1TWH J;  5M3M J;  1K83 J;  3BTI A;  3CDL A;  4BXX J;  2CU7 A;  1CQT A;  5EG0 A;  3ZQL A;  2N8G A;  3OIO A;  3HOU J;  1HF0 A;  1BL0 A;  1ETK A;  1APL C;  3E7L A;  1WI3 A;  2YUS A;  1F36 A;  5IPA A;  1MBH A;  2HYJ A;  2VI6 A;  4L5E A;  2L9R A;  1B72 B;  4M3G A;  4UUT A;  2HDD A;  4M6V A;  2ELK A;  1RKT A;  1VFC A;  4A3G J;  2NOG A;  1ETX A;  1A6I A;  2RAE A;  3RKQ A;  1JKP C;  2MSY A;  1RET A;  5F04 A;  3PM1 A;  5J3L A;  4A3I J;  1FJL A;  1IGN A;  4J19 A;  1YRN B;  2LY9 A;  1IJW C;  2JMW A;  2Y2Z A;  1IV6 A;  3ZOB A;  2WAQ N;  1TWF J;  4G12 A;  3JRH A;  4B4C A;  1U8B A;  4RDU A;  3OOU A;  1Y1V J;  3QQA A;  2TCT A;  3GTG J;  1Q1V A;  2HOA A;  3Q0W A;  5IOY A;  3JRA A;  2B63 J;  2HQ5 A;  3LSJ A;  1FEX A;  5GP9 A;  2DA2 A;  4S0H B;  1JT0 A;  1ENH A;  4XID A;  2OF7 A;  4FE7 A;  5F08 A;  1T56 A;  3TP0 A;  3GTQ J;  1U9N A;  2W48 A;  2FJ1 A;  3GBG A;  4D7N A;  1B72 A;  5FKK A;  4B3A A;  3BR0 A;  3JRE A;  1K61 A;  5IYC J;  1NK3 P;  4IHV A;  1GVD A;  3W6V A;  2EZH A;  5IYD J;  2AO9 A;  1ZK8 A;  3SDG A;  1QVU A;  1YRN A;  5K7H A;  3K2A A;  1XS9 A;  3GTO J;  3SJM A;  2EQR A;  3BR2 A;  3K7A J;  3BR3 A;  1ETW A;  2M0C A;  2PMZ N;  5EDN A;  4C3H J;  3LSG A;  2NS8 A;  2NVT J;  3JRF A;  1UMQ A;  4I6Z A;  4DYR A;  2MG4 A;  5EZG A;  4X6A J;  1G2H A;  3VPR A;  4MLO A;  2HI3 A;  3HB9 A;  2D5V A;  2DA3 A;  2JA6 J;  3LSR A;  1WH5 A;  1GDT A;  1IG7 A;  1BW5 A;  1MBE A;  1GV2 A;  3IH3 A;  3BTJ A;  2QF7 A;  2X6O A;  4Y7N J;  1IRZ A;  2KT0 A;  1SFO J;  1MBJ A;  5EYR A;  4LOC A;  2GBY A;  2XGC A;  2JA5 J;  3DCF A;  2EZI A;  2K9N A;  2MGQ A;  3BQZ A;  5E3O A;  2DA7 A;  5F0H A;  3IH2 A;  1I50 J;  3BT9 A;  2HOS A;  4IEJ A;  2DN0 A;  5FKO A;  3ZQI A;  2EBI A;  4BKX A;  3BTC A;  1LFU P;  1AKH B;  3BQY A;  1QVT A;  3Q0U A;  1TC3 C;  1ETV A;  3LSP A;  2DMQ A;  4DYQ A;  5M5W J;  4QSH A;  3BG9 A;  2IEK A;  2O9L A;  5K7Z A;  2Y30 A;  2GLO A;  1Z0X A;  4M3D A;  5F27 A;  2DA4 A;  4XRS G;  4FIS A;  4A3D J;  1H89 C;  5FJ8 J;  1TWA J;  3M4O J;  4C3I J;  4FCY A;  3JR9 A;  1JJ6 C;  1ETQ A;  2E1O A;  4IHY A;  2R5Y B;  5EGO B;  4A93 J;  1E3O C;  3GTP J;  1RES A;  4M3F A;  1ETO A;  2LLK A;  2OPT A;  5FKL A;  1AKH A;  1H8A C;  2DA6 A;  2Y9Z A;  2R92 J;  1IDZ A;  4CYC B;  4A3J J;  1OCT C;  2EZK A;  2K9Q A;  2E2I J;  3HEF A;  3S15 J;  4RBO A;  4JX5 A;  3ZQH A;  1MBG A;  1DU6 A;  2NVQ J;  2Y0S N;  2E2J J;  4IHX A;  5HOD A;  3ZQG A;  1P7J A;  3S2D J; 
#chains in the Genus database with same CATH topology
 2JZY A;  3SZP A;  2M4G A;  2YS9 A;  3EUH C;  2COM A;  2IAI A;  5TRD A;  1FZP B;  5D5W B;  1RZ4 A;  2WV0 A;  1T39 A;  2V9K A;  5DM7 F;  3M8E A;  1EA3 A;  1YOV B;  5K5Q A;  2K9S A;  3LA7 A;  2RDP A;  1TP4 A;  1MSE C;  2ZXW H;  2K85 A;  4R1H A;  2DDA A;  2K40 A;  1YO5 C;  1T08 B;  2CFO A;  1IDY A;  4G7Z F;  3D5S C;  2HGC A;  3BRO A;  1T6S A;  1S7E A;  1VQP I;  1QGP A;  2VJI A;  2IS4 A;  2MLK A;  3FMR A;  1V5G A;  2KZG A;  2L0K A;  4O5V A;  2EIJ H;  5JLW A;  2CO5 A;  2PFB A;  1KZH A;  4F92 B;  3S3M A;  2EK5 A;  3F23 A;  4XL9 A;  4W1U A;  3T8T A;  3S3N A;  3J7Z I;  3PO2 J;  1A5J A;  3ZMD A;  2RRE A;  1X2M A;  3K1P A;  4JX4 A;  3PIO F;  2P0W A;  4G6T B;  4RM3 A;  4AVP A;  4KFC A;  2L7K A;  1POG A;  1XPX A;  2JVG A;  2M7A A;  3GFL A;  2EIN H;  2XKP A;  1X2N A;  3L1P A;  5F0C A;  3JRD A;  2R7O A;  1GVJ A;  2B7E A;  3DP7 A;  1W5C C;  2M5W A;  4ZYA A;  4BJ6 C;  2DYS H;  3B6A A;  3G3Z A;  1T98 A;  2D1V A;  2NVY J;  2V9V A;  1X3U A;  1WJF A;  3D5L A;  2QKL B;  2EIM H;  1AU7 A;  2XUB A;  1O3Q A;  1MIJ A;  2KMU A;  3ASN H;  1SD5 A;  3HHG A;  5CVU A;  5EEA A;  4IPA A;  3F8M A;  4N4O B;  1Z6R A;  4BAC A;  4FTH A;  3H3V K;  3ONQ A;  4IRI A;  4UB6 C;  3OYB A;  4X1E A;  3CLO A;  3QPL A;  3CD6 I;  4Y52 J;  4P1W A;  2Y69 H;  1UEL B;  2WV1 A;  4DGW B;  2JQ7 A;  3KLN A;  1Z77 A;  4JBA A;  2J5P A;  5EZH A;  1MH3 A;  5A2Q Z;  1HLV A;  3S2H J;  3FK7 A;  2PJR A;  4HQM A;  3IRQ A;  1TLH B;  2IW5 A;  2X9D A;  2HDW A;  4YEL A;  2IGM A;  3RYR A;  4EJW A;  4CCO A;  3LSK A;  2KIQ A;  4BHC A;  1HDP A;  4MTD A;  3E0J B;  3VOE A;  4BH9 A;  3FKI J;  1VQK I;  4DZP A;  3AL0 B;  2I10 A;  2CUZ A;  1M1E B;  5ILU A;  1SVO A;  3HHH A;  5CQE A;  4HLY A;  5DV5 A;  2O5R A;  4HX7 A;  2B0L A;  2LD5 A;  4R79 A;  3Q3S A;  4BY1 J;  3CUQ B;  3SFI A;  5J1U A;  5E18 F;  3N4M A;  3H36 A;  4W97 A;  3GTL J;  3ZQ7 A;  4QLC U;  3IUO A;  5LGN A;  2Y48 A;  3MKY B;  3RDI A;  1LDJ A;  2BBY A;  3MKW B;  1REP C;  1OCC H;  4WXC A;  1FOY A;  4ENM A;  3O8H A;  1I3Q J;  2DOD A;  3H9Q A;  3HOW J;  2MC3 A;  2QQ8 A;  4A3M J;  4N4N B;  1K7A A;  1W5S A;  2JJ7 A;  1UHW A;  4OOI A;  2F5F A;  1CF7 A;  2H8R A;  5E20 A;  4IJA A;  2WWY A;  5LHI A;  5B5E C;  2JRM A;  1G59 A;  1WPK A;  1ON1 A;  3M8F A;  2LBF A;  3IP4 B;  4HNT A;  2B9S A;  3ZMZ A;  1JUS A;  3CF5 F;  2XB0 X;  5FRM A;  4AM3 A;  3DPT A;  2LK2 A;  2P7V B;  2NVU B;  1N75 A;  1SAN A;  1IN8 A;  1S7O A;  2XAF A;  3K4N A;  2V4J C;  1R5G A;  1UHS A;  3WTW C;  1N78 A;  2HQR A;  1QPM A;  4B1R A;  5J47 A;  3Q0V A;  1GT0 C;  4C2T A;  3WTS C;  4HBL A;  5J1R A;  2UXX A;  1R49 A;  4IQ4 A;  1H0M A;  2A6E F;  1XGN A;  2RNG A;  3K70 C;  1AOY A;  2D2W A;  2IPQ X;  3VYR B;  4UUS B;  2R5Y A;  2HPI A;  3QPS A;  4QPQ A;  4B43 A;  1ZR4 A;  1WSU A;  2L2O A;  3HBL A;  2XDV A;  4HYE A;  2CUJ A;  3ZMU A;  5DUK A;  1G3T A;  4A3K J;  3W2A A;  1RR7 A;  2HZD A;  4Y17 A;  5L3C A;  2RKH A;  4CYC A;  2DDB A;  4B3X A;  2QSG X;  5CJ9 A;  1IN4 A;  2PG4 A;  3BC8 A;  4LK1 F;  3SQN A;  1DU0 A;  1STZ A;  1F4K A;  1XMK A;  1D0Y A;  3MFK A;  1LE8 A;  3LA3 A;  4E7Z A;  3BG6 A;  5JI6 A;  3NAR A;  4BAY A;  4E6K G;  3EYI A;  5H6R A;  2HOT A;  2YSR A;  2EWN A;  1U9O A;  3OL3 A;  1U8R A;  2X6W A;  3DBL B;  3BR5 A;  2FOW A;  3FIS A;  4BGD A;  2LC2 A;  2MW8 A;  1TQM A;  1FBS A;  3VFZ A;  2NNN A;  4FQG A;  3K4K A;  4U7D A;  3VYT B;  2YX7 A;  4XIC A;  5ICF A;  4Z6Y A;  1IN5 A;  3TOB A;  5AIQ A;  4AIH A;  5E3L A;  2LTP A;  4P55 A;  2X4H A;  3OIQ A;  1KQ9 A;  4J00 A;  2RQQ A;  3CDI A;  2KDZ A;  5HDG A;  3S14 J;  1IC8 A;  2HTJ A;  2A69 F;  2OD5 A;  3HRS A;  2X51 A;  4MQ9 F;  2HVS A;  3I0T A;  3ZMT A;  2QBY B;  4BJT A;  1KU9 A;  3BG3 A;  3BR6 A;  3WE2 A;  4RB3 C;  2ECC A;  2XV4 S;  3PFI A;  3EPZ A;  4EV0 A;  2Y9Y A;  2H27 A;  3R0A A;  4QIW N;  1KON A;  3RYP A;  2HKO A;  3HRM A;  1YYV A;  4Q47 A;  3M1E A;  2CRG A;  4AUX A;  5ED4 A;  4IX7 A;  2LG4 A;  1OR7 C;  4GO1 A;  4A3L J;  1G3S A;  1JGG A;  2AXT C;  2BVM A;  4BEH B;  1ZN2 A;  5FRN A;  2LNB A;  3CCM I;  3CMY A;  4ZZD A;  2P5L C;  1A04 A;  4YFX F;  2G0E A;  3JAM Z;  3H0G J;  3JSO A;  4IRH A;  1T33 A;  3BG7 A;  4F91 B;  1F43 A;  4B44 A;  1Y8Q B;  5IP7 J;  2JA8 J;  1X1D A;  5E3M A;  3ZQF A;  1TTY A;  1P7I A;  3LOC A;  4BBR J;  3T1B A;  3JAM K;  1WVR A;  4RS8 A;  1JTX A;  1BIB A;  1FBQ A;  4HPQ A;  3F8B A;  2DMT A;  3DLA A;  2DMP A;  3NRV A;  4A5N A;  2X6Y A;  2JUG A;  4LLL A;  3DKX A;  5DYM A;  5IY5 H;  3ZQC A;  1BC7 C;  2VKE A;  4ITV A;  4HX8 A;  4MFD A;  3TO6 A;  2PBI A;  3WHB A;  2RC4 A;  2W57 A;  2E36 A;  3PQK A;  2GWR A;  2ZC2 A;  5M3M J;  1R4N B;  1O57 A;  2ADU A;  3ZQL A;  3CC4 I;  3A2K A;  5CKT A;  4ESJ A;  1HF0 A;  1U0J A;  4O6J A;  1LEA A;  2M30 A;  2DQR A;  1LFP A;  3REO A;  2A6H F;  1D5V A;  2VI6 A;  3K4L A;  4PDK A;  2ZME C;  2DOA A;  4M3G A;  2VT2 A;  4BXF A;  2IJL A;  1X4P A;  1UAA A;  3HPH A;  3C7J A;  2KPM A;  2NOG A;  4XKB A;  1ETX A;  1PYV A;  3N97 A;  2O0Y A;  1WZ2 A;  4J19 A;  2ACJ A;  1YRN B;  2Q0O A;  2DU9 A;  3I4P A;  1IV6 A;  1W36 D;  2JSC A;  2WAQ N;  3LSI A;  2BYV E;  4YIF A;  2W85 A;  4RDU A;  2VON A;  1Y1V J;  2R4G A;  3QQA A;  1J09 A;  1AWC A;  2CW8 A;  2ELH A;  5GAG J;  3RPU D;  3I59 A;  4UNO A;  2PEX A;  1ENH A;  3WGH A;  4XID A;  2XC7 A;  2OTL I;  1GXQ A;  1WHU A;  3MCZ A;  3U21 A;  2W48 A;  2FJ1 A;  4LLN A;  3GBG A;  4XKW A;  2W7N A;  5EJC A;  2UZK A;  2LMD A;  3RPU A;  3F22 A;  1K61 A;  4V19 K;  4IZZ A;  4YFN F;  3PNT A;  3O6B B;  2K3P A;  3CCE I;  2BY2 A;  1IAW A;  4XKC A;  2HFH A;  1XS9 A;  3RTR A;  2EQR A;  3BR2 A;  4II3 A;  4LG0 A;  4WX9 A;  1LVA A;  1SMY F;  3OY9 A;  3LSG A;  2NS8 A;  1R4M B;  2NVT J;  3JRF A;  2I5U A;  1UMQ A;  5DD8 A;  4HSR A;  1ZGA A;  4G7O F;  4MLO A;  3OIP A;  4XOT A;  1D0Z A;  3HB9 A;  4BE2 A;  1SEU A;  2BE5 F;  2VAS A;  3HSR A;  2JA6 J;  3LSR A;  3EUA A;  1MKM A;  4PGG A;  3KLO A;  3I3L A;  3IH3 A;  4MHG A;  3IRR A;  3BTJ A;  2QF7 A;  2X6O A;  3AAF A;  3GZN B;  4PJN A;  5L3G A;  3LL7 A;  2H6C A;  2XAS A;  2MA3 A;  5LHH A;  2JA5 J;  2EZI A;  1MJA A;  2K9N A;  5HLT A;  1MDM B;  3CCU I;  4OIR F;  1UJ8 A;  2OA4 A;  1LVK A;  3HTU A;  1E3H A;  3CTA A;  5F0H A;  3E6C C;  2K4J A;  2MC4 A;  3FDY A;  2DN0 A;  4FET A;  2VE9 A;  2WBM A;  3H5R A;  2HEO A;  3CP8 A;  1QVT A;  4PCQ A;  3Q0U A;  3V7C A;  4ZC3 A;  3WE3 A;  1Z7U A;  4WF2 A;  3QYF A;  1MMN A;  3OYD A;  1ETV A;  1E17 A;  3BG9 A;  1KU3 A;  3AKZ A;  4GXO A;  1IF1 A;  4O3M A;  1HC8 A;  4A6D A;  2AQE A;  2RVC A;  1FOX A;  1ZRF A;  5H2F C;  5F27 A;  5FGM A;  1WJ5 A;  2BY1 A;  5BMZ A;  4HG2 A;  1TWA J;  2IP2 A;  1ZRD A;  3S93 A;  1BI0 A;  2VQC A;  1UCR A;  1JJ6 C;  2OQR A;  3L2R A;  1BOB A;  4A0Z A;  4IHY A;  1G3W A;  1T0F A;  5EGO B;  5TGT A;  3KP4 A;  3GTP J;  2W25 A;  3E6B A;  1HSJ A;  2OPT A;  4H4K C;  3COA C;  1AKH A;  4XBF A;  3RIR A;  3FXJ A;  4PUS A;  3VEP A;  4PJM A;  4I2O A;  2MBF A;  2FF4 A;  5D4R A;  1Y0U A;  1KU7 A;  3HEF A;  3K4J A;  4RBO A;  3VB2 A;  3B02 A;  2E7X A;  2XF5 A;  2V79 A;  2CV0 A;  1XX5 A;  2E2J J;  3OYJ A;  2Y0M A;  1ZTR A;  4ENJ A;  1HOM A;  2VBX A;  3PL8 A;  1W7P D;  4LIT A;  3ZMV A;  1X19 A;  3QAH A;  5D5U B;  2AS5 F;  1OYI A;  1P6R A;  3K2Z A;  1X1B A;  3MAJ A;  2GQQ A;  5E17 F;  2M1B A;  5EF6 A;  4DOZ A;  2KJC A;  4MTE A;  3Q9S A;  1W7P A;  2X1C A;  1QA6 A;  4RMN A;  1R23 A;  3DEE A;  5HLH A;  3RKW A;  5DUI A;  4EGY A;  1LUJ B;  2IGN A;  2BEO A;  3OL4 A;  4F55 A;  2HNH A;  3NAU A;  5DDG A;  1V5E A;  3LAJ A;  1LFB A;  5HNF A;  1R36 A;  2L9N A;  3F8F A;  3ERM A;  2R7T A;  1RPW A;  1QHH D;  2XPW A;  3DBR B;  3ELK A;  2L5Q A;  2Y31 A;  5AIP A;  2DFH A;  3FXL A;  3JTG A;  3MD2 A;  2O8K A;  3BTL A;  4L9V A;  3CCY A;  2RQP A;  1ZHF A;  3CCR I;  2DXI A;  1YG2 A;  1SVM A;  1E2X A;  5GPC A;  1FY7 A;  1RUN A;  3DWL E;  4F52 A;  1B8I B;  2DOF A;  3OYA A;  4EJU A;  5LGT A;  4CH7 A;  3RZD J;  3WU1 B;  4XRF A;  4E7H A;  4L18 B;  4CCN A;  2HS5 A;  3QOP A;  4UXN A;  4BYY A;  3QOE A;  3LA2 A;  2QM3 A;  2DFE A;  4BU2 A;  3TED A;  3QOD A;  2WY8 Q;  3S8P A;  3HGY A;  1K6Y A;  1YIT I;  1MSF C;  2DOE A;  5DEQ A;  4E7J A;  3GTJ J;  2VJ5 A;  3C2B A;  2CW7 A;  1WCM J;  2KRF A;  4HF0 A;  4NQW A;  2ME6 A;  1I3A A;  2XAQ A;  1FLI A;  3N05 A;  5LGU A;  3PIP F;  4NHJ A;  3OYE A;  3HOX J;  1VF9 A;  2EZL A;  3TW6 A;  2DBB A;  2GA2 A;  2BOL A;  1XSX A;  1ZG5 A;  4B8X A;  4B47 A;  4ZYD A;  1MBK A;  4IHW A;  2WAD A;  4ON0 A;  3M3Y J;  3I71 A;  1ZGW A;  1Y0N A;  1J59 A;  5CVJ A;  3C1D A;  4I01 A;  3DEW A;  2O7O A;  2P4W A;  4BDZ A;  2OC6 A;  2X1E A;  4NC8 A;  4IF4 A;  2FX0 A;  4IOC F;  4JX6 A;  2JWT A;  4RB2 C;  1YI2 I;  1Z9C A;  4A12 A;  4IVN A;  5BNG A;  3I53 A;  4KJZ A;  4C2M J;  1V3F A;  3GFM A;  3M7G A;  2JK3 A;  3QRF F;  3PO3 J;  3JRG A;  4QTR A;  1X1A A;  1GV5 A;  1R58 A;  2X1D A;  1HQC A;  2VOO A;  2E60 A;  3WTT C;  1YQA A;  4C2U A;  2OCE A;  4XLF A;  2EA2 A;  1FTT A;  2COB A;  1WJC A;  4HF2 A;  1BA5 A;  1YHQ I;  4D0P A;  4E70 A;  2M3A A;  4A2U A;  1U5T C;  3I56 I;  3KIO A;  1U2W A;  1V5F A;  4IOA F;  2JRT A;  4E7S A;  1JKO C;  1K79 A;  1HW2 A;  2JPC A;  1WH7 A;  1DP7 P;  4ZTJ A;  3HKZ N;  1SD4 A;  2XPV A;  4JOM A;  1P4A A;  2HKX A;  4DBR A;  1VQ5 I;  2FU4 A;  1U3E M;  2KQR A;  3SZT A;  2R5Z B;  1OJL A;  1RRJ A;  2CUE A;  3C2H A;  3CUQ A;  1D1C A;  4LIV A;  4IHS A;  3CES A;  1YJW I;  2KRC A;  2HQN A;  3R0J A;  3O8G A;  1W36 C;  4HQE A;  1J7K A;  3GW2 A;  1W4M A;  1HW5 A;  3ABL H;  4EJT A;  2XGD A;  2HOE A;  2CQK A;  3C3W A;  3S1Q J;  5FLV A;  2OTJ I;  4PFO A;  2PLY A;  4BQQ A;  3WTZ A;  1IRG A;  1YX3 A;  2K9M A;  4CSW A;  2QA4 I;  3C18 A;  1WGX A;  1ZEL A;  1P9Q C;  2OU2 A;  2ZFW A;  1FOW A;  4KIG A;  3I55 I;  1FC3 A;  4CZC A;  2MFZ A;  4KT6 A;  5DS9 A;  4M71 A;  2X48 A;  2R7F A;  3D1N I;  3I4N J;  4FE4 A;  2E19 A;  5FO5 A;  3OWT A;  1TQP A;  3PNV A;  1NHA A;  4NDL A;  3RJP A;  4NUB A;  4XN3 A;  4XMY A;  3F0C A;  1QBJ A;  3MVP A;  2V1U A;  3FF5 A;  2OAZ A;  3ASO H;  1FSH A;  3ERE D;  4UUS A;  1R1U A;  2HXI A;  4XOR A;  1XG1 A;  2JA7 J;  3E5X A;  4M3E A;  2C6Y A;  5DTD A;  2QCO A;  1O4X A;  3QP5 A;  3O2P E;  1OQY A;  1W0T A;  3K10 A;  1YW8 A;  4I0A A;  1UFM A;  1ZKG A;  3NQO A;  1WWX A;  4U87 A;  1WKM A;  3A01 B;  3CO7 C;  1K4T A;  3CMM A;  4PGH A;  2Q2E B;  3MZ8 A;  4JP0 A;  3S17 J;  1FIP A;  3VOD A;  2FRH A;  1I5Z A;  3J80 Z;  2H1L A;  3KCC A;  3JRI A;  2P81 A;  3KYC B;  1SFE A;  4KIB A;  2F48 A;  3S1M J;  1MND A;  1Z3X A;  1IV8 A;  1V54 H;  2ZKZ A;  2XSD C;  3F6V A;  3QYE A;  3V8J A;  4LGW A;  4YIR X;  3KZZ A;  2PJP A;  2F5D A;  4WK8 F;  2XRN A;  3V8K A;  1UG2 A;  4PZJ A;  4PJ0 C;  5GPA A;  4AVZ A;  3OR1 C;  3DPL C;  3WHC A;  5A2Q K;  5HDN A;  3WGI A;  1RKW A;  3KP2 A;  2GIZ A;  4OAY A;  3GF2 A;  2CQQ A;  5C4J J;  1BR1 A;  2ME0 A;  3G2B A;  1T95 A;  1VQO I;  2K27 A;  1GLN A;  2A61 A;  1OPC A;  5EG0 B;  4ESB A;  1JT6 A;  1EH7 A;  3L2V A;  4HX4 A;  2QLZ A;  4Q48 A;  4WXD A;  4B09 A;  1MD0 A;  4G6Q A;  5J4Y A;  1T38 A;  1T0F C;  3DKY A;  2R3S A;  2VL8 A;  3WTU C;  5JLX A;  4PFP A;  4E7I A;  3LMM A;  1PP7 U;  2QBY A;  4WCG A;  4ZYG A;  4Y13 A;  3HZJ A;  4L5I A;  3ABT A;  2LYC A;  2UXN A;  3K6G A;  5J40 A;  1OYW A;  2CQX A;  4XRM A;  1B9N A;  3KET A;  1HKQ A;  1MNE A;  1MH4 A;  4XQF A;  4I0B A;  2NVX J;  3A4C A;  2XIG A;  3HSF A;  2DA1 A;  1FYK A;  2KFD A;  3RCO A;  4AU7 A;  2M4K A;  1TWH J;  2R7Q A;  2LRE A;  2OZU A;  3QWL A;  3GEZ A;  4OU0 A;  3BTI A;  3CDL A;  2DTR A;  2Z16 A;  3J7A O;  2TDX A;  3KEO A;  2DK5 A;  5ICE A;  2ZME B;  1HW1 A;  1APL C;  4KMF A;  3TO7 A;  5LLQ A;  5HVQ C;  1BM9 A;  2YUS A;  5IPA A;  1MBH A;  3W2V A;  3JW4 A;  3HKZ A;  3T8R A;  1D1B A;  5KAF C;  2WAF A;  2R7U A;  3ZN1 A;  2P5V A;  3QU3 A;  4BS9 A;  3CCJ I;  4UB8 C;  3CC7 I;  4BL0 B;  4CYD A;  2EPF A;  4IHT A;  3CLQ A;  3H35 A;  1XGM A;  1A6I A;  4MGR A;  3J81 Z;  2BY3 A;  3RKQ A;  1JKP C;  2ZO4 A;  4G7H F;  3IL2 A;  1V55 H;  1P4X A;  2KIF A;  4ETS A;  5J3L A;  4A3I J;  1FJL A;  1JE8 A;  2BW3 B;  2GAU A;  2LY9 A;  3P9I A;  1IJW C;  3ZOB A;  4RGX A;  3OR2 C;  3DKW A;  3IWZ A;  5BOX A;  2K3F A;  3FMQ A;  1U8B A;  1L3L A;  3HRT A;  2CFX A;  2JTV A;  4KNY A;  3OOU A;  3LFK A;  4KIC A;  3Q0W A;  2B63 J;  2KRH A;  1FEX A;  1KU2 A;  1SAU A;  2OF7 A;  2XAG A;  3CF2 A;  1T56 A;  3TP0 A;  3GTQ J;  3KEQ A;  2V6C A;  5CPR B;  3PQJ A;  1BI3 A;  2VBY A;  3MZY A;  2NAZ A;  3ULQ B;  3WTY C;  5LD2 C;  2W24 A;  4S04 A;  2VQH A;  2EZH A;  5HS8 A;  5IYD J;  4UVA A;  3UR3 C;  3SDG A;  1QVU A;  1YRN A;  4EVI A;  1R5H A;  5JHU A;  2DLL A;  4U0V A;  3K7A J;  2M0C A;  5E8I A;  3LSM A;  5HLG A;  2HDC A;  2DFF A;  2RN7 A;  4DYR A;  1G2H A;  1X1C A;  3DXJ F;  2HI3 A;  3I64 A;  3FWE A;  1SC7 A;  2OZ6 A;  4RGU A;  5GTH C;  1A6Q A;  3AG2 H;  5K5R A;  2LSO A;  1MBE A;  1GV2 A;  1O3R A;  4OIQ F;  2A5Y B;  3BJA A;  3VYS B;  5D8L B;  3W6K B;  1IRZ A;  1SFO J;  3KPH A;  2YU3 A;  5EYR A;  3EET A;  3FHN A;  2GBY A;  1HST A;  4GGG A;  3H5A A;  2XGC A;  2FA5 A;  2QEN A;  2ZNY A;  3K0L A;  1LJ9 A;  2MGQ A;  3FKJ A;  5HS9 A;  3RPQ A;  3BQZ A;  5E3O A;  1PP8 F;  5AON A;  1ZG3 A;  2HOS A;  2PQ8 A;  4KIS A;  2WY7 Q;  4YEJ A;  1ZRE A;  5KNL A;  2VKD A;  2EBI A;  1LFU P;  4RAZ A;  3BQY A;  3LQR A;  1Z7L A;  4DJA A;  2DMQ A;  4DYQ A;  2IEK A;  3JSP A;  3TGN A;  1IW7 F;  1MMD A;  3FXQ A;  3F72 A;  3IAM 2;  2Y30 A;  1DGW Y;  3M9A A;  2DPD A;  2GLO A;  2J5O A;  1Z0X A;  3EQL F;  3A1Y A;  4XRS G;  4FIS A;  1H89 C;  3HIF A;  5J4V A;  4EM1 A;  4FCY A;  1Z67 A;  3CZ6 A;  1ETQ A;  3Q9V A;  3HPG A;  3OV8 A;  3V4G A;  4ZYE A;  1MDM A;  1VQN I;  2R5Y B;  2RGV A;  2M8E A;  3BJ6 A;  1WJD A;  4MQV A;  2FEZ A;  2LLK A;  3FXM A;  2Y9Z A;  3P9K A;  4II2 A;  2WTE A;  1NG6 A;  4CYC B;  1RUO A;  3L09 A;  5FD6 A;  2EZK A;  3OS0 A;  2E2I J;  1IN7 A;  3S15 J;  2W4S A;  2VBZ A;  3RKY A;  3ZQH A;  5H20 A;  1W5T A;  2E34 A;  3X2Q H;  2KP6 A;  2HYF A;  4IHX A;  2IXS A;  3FXU A;  1FX7 A;  2KHM A;  3BPV A;  2A07 F;  4NC7 A;  5EEG A;  1BI2 A;  3OYK A;  2M34 A;  4BUP A;  4EEF G;  1J2X A;  1XTA A;  2QSH X;  2DT7 B;  2HZT A;  2K7L A;  2R7R A;  3ABU A;  4EGZ A;  1QNT A;  2ECB A;  4XN0 A;  4IRG A;  1G4D A;  1TWG J;  4G94 A;  1FYL A;  2BVL A;  3ECO A;  1H88 C;  3WU0 A;  1A36 A;  4MIM A;  1FWZ A;  2O61 A;  1XCV A;  4Y33 A;  4L5J A;  5GAD J;  2PMH A;  4ABZ A;  3HYI A;  3JRB A;  4RAY A;  4WXH A;  3WG7 H;  1EJ9 A;  3ZP5 A;  5LRR A;  1TQI A;  3GTM J;  3E1S A;  4D7M A;  2HYG D;  3GFI A;  4E7L A;  5J1Y A;  2NS7 A;  1FIA A;  3EUH A;  3PFY A;  4YG2 F;  4HNV A;  1HXD A;  2LRD A;  3C2G A;  2HTS A;  1SMT A;  2E1M C;  2O6G E;  3HL2 A;  3E5U A;  3RQI A;  1UZC A;  3FK6 A;  5BS6 A;  1TW2 A;  3CCL I;  2VXD A;  9ANT A;  2VXZ A;  2LY1 A;  2NYX A;  4CA0 A;  2F4I A;  3ZMS A;  1PUF B;  2VKV A;  5BPD A;  2FBK A;  3HGG A;  3PSI A;  5C3E J;  3SYT A;  3ZCO A;  3ZN0 A;  2W84 A;  3DV8 A;  2KZV A;  3QU6 A;  5KVR A;  2CV2 A;  6PAX A;  4R8H A;  2L4M A;  2WAE A;  3OOP A;  3AG4 H;  2L7F P;  1J5Y A;  3GLX A;  3OYN A;  3OYF A;  3VWB A;  5LHG A;  3HOV J;  4L0Z B;  2E7W A;  1VQ8 I;  1XSD A;  1QPI A;  2K02 A;  3A03 A;  2JSP A;  3OSG A;  3G73 A;  2GOX B;  1KYZ A;  3IC7 A;  3KE2 A;  2VB6 A;  1YFH A;  3EDP A;  1JUP A;  5CVI A;  2R0Q C;  3ZQQ A;  3ZXS A;  4FAS D;  1OFC X;  2P7C B;  1OCO H;  1X4O A;  5J8C A;  5M5X J;  2JPB A;  1ACI A;  2K4B A;  1G8X A;  2R7Z J;  2AHQ A;  4AC0 A;  1YE9 A;  4IQJ A;  3I9V 2;  5CVR A;  2EFO A;  1WI9 A;  2FE3 A;  2R7V A;  3FM5 A;  4D5C A;  4HDV A;  5D8K B;  4ZYH A;  3TW7 A;  2V1N A;  2QUF A;  2KDO A;  2W1O A;  4TV7 A;  4RLF A;  1ZLJ A;  2JUC A;  5JR3 A;  2H6B A;  3K69 A;  4HA8 A;  5ERI A;  1Y56 A;  3HUG B;  1Y39 A;  5GAH J;  4I99 C;  2CSO A;  1U5T B;  1R1V A;  2DPU A;  3JRC A;  4XON A;  2KLO A;  4NNJ A;  2ESH A;  4BQA A;  1BR4 A;  2GM4 A;  3DTE A;  5B1A H;  2QYO A;  3DEU A;  4BBS J;  3KP7 A;  1U6G A;  4DW6 A;  1B4A A;  2CMP A;  3L2C A;  2W00 A;  1IN6 A;  5L3D A;  1YW7 A;  3ABK H;  1JKR C;  5BPI A;  3DPU A;  5J6X A;  1Z05 A;  4ZZL A;  2V7F A;  2LR8 A;  3P9C A;  4XLP F;  3I59 B;  1LDD A;  4LG3 A;  3MN2 A;  4HRI A;  4D1Q A;  2OCC H;  4CDG A;  3TP3 A;  4PSX A;  2DI3 A;  1XGS A;  2ETH A;  2ZJ2 A;  3GZ5 A;  5JFR A;  1Y8R B;  2L54 A;  2G9W A;  4OAZ A;  2LKX A;  2Y75 A;  1R00 A;  5B1B H;  4RB1 A;  2ZXH A;  1MMA A;  3OS1 A;  5DD4 A;  4A3E J;  3AG1 H;  5TIS C;  1K78 B;  4M9S A;  3GO5 A;  4LFU A;  2M2E A;  4UVB A;  2DMU A;  2FBH A;  5IT3 A;  4LG0 B;  1MJB A;  2XRL A;  3G1O A;  2NOJ B;  3IKV A;  4HOB A;  2H1K A;  2R5Z A;  3H1C A;  1NK2 P;  1R9T J;  2KIM A;  2L9S A;  3B6C A;  3FIW A;  5F6F A;  2A6T A;  1ZQ3 P;  1QRY A;  3G71 I;  2XF6 A;  4CIC A;  5JHF A;  3S1R J;  1Z91 A;  5LRS A;  5L3B A;  2MAB A;  1Z21 A;  1JI8 A;  4ZH4 F;  3VSL A;  2L02 A;  2EJR A;  3U1K A;  4IL6 C;  3HJE A;  4CZZ A;  4KT5 C;  4NC6 A;  4S05 A;  1O3S A;  4E4H A;  3O3K A;  1XDU A;  1ZYR F;  2V26 A;  1TWC J;  3ZPL A;  1LDK B;  1OKR A;  3H5N A;  1EH8 A;  4A3B J;  4ESF A;  2L7M P;  4X0G A;  2O03 A;  1XN7 A;  2E1N A;  4C9Y A;  3NWS A;  3SEQ A;  2EB7 A;  2OBP A;  2QQA A;  1TNT A;  2TRT A;  4UHT A;  1LQ1 A;  2L4A A;  4M73 A;  5DCM B;  1ZRC A;  1IUF A;  3BR1 A;  3G1L A;  3TBI A;  4XM3 A;  2JVH A;  1YJ9 I;  2H09 A;  4JYK A;  3BP8 A;  2V1D A;  3GWZ A;  2R93 J;  1Z3Y A;  3BG5 A;  2CQ7 A;  3I5U A;  1XB4 A;  2RV8 A;  2KL4 A;  3NWT A;  2VC1 A;  3SEZ A;  1FNN A;  4A5M A;  4A3C J;  1S5L C;  1ETY A;  4OWR B;  4GFB A;  3OYL A;  1VI0 A;  3AFH A;  3U1D A;  1KGS A;  1C0W A;  2IS6 A;  3ESW B;  2CW0 F;  3ROU A;  3DFG A;  2Z2S B;  3GCM A;  3OYI A;  4MO7 A;  3OSF A;  3H9G A;  2D45 A;  4DNC A;  4G8X A;  1ULY A;  1JUM A;  4CHU A;  3A01 A;  2JN6 A;  4V2F A;  3CCQ I;  4N0B A;  5K7F A;  5JVG F;  1R5I D;  2IGO A;  2Q2E A;  1XD7 A;  3IHU A;  2EFQ A;  2DA5 A;  2P6T A;  3A0H C;  4E7K A;  2VPR A;  3KYD B;  2EA4 A;  3KEY A;  1VQ7 I;  3OMY A;  4XLC A;  3RI4 A;  1X58 A;  2MLG A;  1MZB A;  2FXA A;  1TW3 A;  2F5E A;  4A0X A;  3OYC A;  1QZY A;  4J01 A;  3LQQ A;  4ZDO A;  3LFU A;  4A6E A;  2ZBK A;  3E5Q A;  2P8T A;  4CO8 A;  1IUY A;  1S72 I;  1G3Y A;  3V7S A;  2CYY A;  3IV5 A;  1JHH A;  1R1T A;  4D9J A;  5FLX Z;  4ZDL A;  3R60 A;  5FRO A;  4EM0 B;  4NBQ A;  5E1X A;  1A35 A;  3H92 A;  3G1M A;  3ABM H;  3QPT A;  2Q8K A;  1LPQ A;  4MEX F;  1BIA A;  4XLE A;  1K83 J;  4GCV A;  4XSZ F;  4ZJZ A;  4BXX J;  1D8K A;  2CU7 A;  4XNF A;  3S2W A;  5EG0 A;  2HVQ A;  3HXL A;  3HOU J;  5FLX K;  4HST A;  5D5V B;  1ETK A;  1BL0 A;  3I58 A;  2HWV A;  2IRF G;  2WC2 A;  3JCU C;  2EFN A;  1F36 A;  4BNC A;  4L9J A;  2HYJ A;  4G9Y A;  4L5E A;  1JGS A;  2L9R A;  1O7F A;  2LOO A;  1IZ1 A;  1B72 B;  4UUT A;  2HDD A;  2CH0 A;  4M6V A;  1RKT A;  1VFC A;  1OLT A;  3HRU A;  4UV9 A;  1PDN C;  4A3G J;  2FQ3 A;  2ESN A;  1S29 A;  2F2E A;  1RET A;  5F04 A;  4ENN A;  3CUO A;  1ERD A;  1IGN A;  3H9J A;  3V8L A;  2CGP A;  1FP1 D;  2R7X A;  5IT9 Z;  4G12 A;  2Z33 A;  2VOD A;  3JRH A;  4ANJ A;  2L01 A;  4I09 A;  2GXB A;  4MNU A;  4ZTF A;  2HR3 A;  3GTG J;  1Q1V A;  2HOA A;  5IOY A;  3MKZ A;  2UUZ A;  2ZME A;  2HQ5 A;  3LSJ A;  5CLS A;  5GP9 A;  2DA2 A;  3FZV A;  2DYR H;  2XAU A;  4FE7 A;  5IT9 K;  3FHZ A;  5F08 A;  2DK8 A;  1J9I A;  2HU9 A;  1VQ6 I;  4D7N A;  5FKK A;  4G6D A;  2VOP A;  1JHF A;  1YS6 A;  5L3E A;  3JRE A;  5IYC J;  4PJJ A;  2P6S A;  4IHV A;  4LJZ F;  3W6V A;  4YII A;  1YW9 A;  4NQW B;  3P7N A;  5H6Q A;  3R6S A;  2ZNZ A;  3WG9 A;  1ZK8 A;  4KN7 X;  1S9H A;  3DU6 A;  1FBU A;  5E79 C;  1E3P A;  2BW3 A;  5K7H A;  5LFA A;  3K2A A;  3MMY B;  4H0E A;  4F7Z A;  2FMY A;  3SJM A;  2Z99 A;  1UHM A;  1SFK A;  3E97 A;  3MEX A;  3BR3 A;  2PMZ N;  5EDN A;  2VPL A;  3LST A;  4C3H J;  2F4O B;  1YLF A;  2H8W A;  4CCM A;  1S7A A;  3DU5 A;  3PSF A;  1J75 A;  4I6Z A;  1FYM A;  2MG4 A;  5EZG A;  4X6A J;  3VPR A;  2K86 A;  2X85 A;  2M7B A;  2EV6 A;  3W2W A;  2DA3 A;  1WRJ A;  1CGP A;  2GZW A;  1WH5 A;  1Y6I A;  3P5J A;  3A0B C;  1VQM I;  4EAT A;  1B9M A;  1G6N A;  1IG7 A;  4DIQ A;  2VIX A;  1DDN A;  3J80 K;  1FOK A;  3BOQ A;  2E1C A;  2KT0 A;  1MBJ A;  5DCF A;  5D5X B;  3TL4 X;  4LOC A;  2X6X A;  3KYL A;  4RAG A;  4OIP F;  2AQF A;  3DCF A;  5CYV A;  4BQN A;  3ZR8 X;  2DA7 A;  2M0M A;  3IH2 A;  4IEJ A;  4PJL A;  2A05 A;  2W82 A;  3KP5 A;  4BKX A;  1QQI A;  3BTC A;  5HDK A;  3G4S I;  3D5R C;  3SXY A;  4KIT B;  1S3J A;  2L9V A;  4U0Y A;  1ODD A;  2FNA A;  3BJO A;  4IO9 F;  4EJV A;  5M5W J;  1DGR M;  4XKV A;  1F1Z A;  5B3S H;  5JVT A;  4KA4 A;  1HBX G;  3M07 A;  4XLN F;  1GXP A;  3K9T A;  1T2K A;  1JXS A;  4XSX F;  4I7H A;  3WGG A;  5KCM A;  4M3D A;  4HAM A;  2RNJ A;  2XRO A;  4A3D J;  4HZF A;  3HTS B;  2E5Z A;  3CDH A;  4M72 A;  4FX0 A;  2E1O A;  2H94 A;  2DW4 A;  2A3S A;  4BEH A;  3GFJ A;  1ZH5 A;  4Q5S F;  2BHY A;  2ZXJ A;  1E3O C;  1RES A;  4RA2 A;  2MD0 A;  3PUF A;  4M3F A;  1ETO A;  1PJR A;  3GVA A;  3CJQ B;  2DA6 A;  2JA2 A;  1IDZ A;  4GYG A;  4HLX A;  5LEJ A;  3OYM A;  2K9Q A;  2M45 A;  2MD5 A;  1E0E A;  1MBG A;  2F5C A;  2Y0S N;  3M1C A;  2PMU A;  4M74 A;  3SDB A;  3UNG C;  4U0W A;  1P7J A;  4P96 A;  4D5F A;  2M87 A;  2G7H A;  2EV5 A;  1B1B A;  1RC9 A;  1JJ8 C;  2CJJ A;  3CC2 I;  3J81 K;  3ZRG A;  1FTZ A;  4FT8 A;  2I8D A;  2UV1 A;  3D0S A;  3HM5 A;  1FSE A;  3ZGK A;  3CCV I;  4AIJ A;  3EYY A;  1NTC A;  3H3U A;  2ISY A;  1ONV A;  5FB2 A;  1MMS A;  3E3V A;  2LKP A;  4HV6 A;  3LWF A;  2E35 A;  3F8N A;  2IA1 A;  2XKO A;  4RGS A;  3BCA A;  2OQG A;  1HKS A;  2E1M B;  3VDX A;  4I98 B;  3CP2 A;  5FFZ A;  1QZZ A;  4BHB A;  1XC5 A;  4HW0 A;  4XK4 A;  1SFX A;  2IGK A;  1TZL A;  1FT9 A;  3FXO A;  5ICG A;  5E3N A;  2PI0 A;  2DMN A;  2IA0 A;  3HDD A;  3J7Y J;  2R7S A;  3PNY A;  1SAX A;  1K4S A;  5E1Z B;  4U88 A;  2CV1 A;  4EM2 A;  1JTY A;  2E2H J;  2XF7 A;  4K2E A;  2PJR B;  5C4X J;  3IWF A;  3KFW X;  4C30 A;  4UVC A;  4KDP A;  1EH6 A;  1MGT A;  2VJ4 A;  1R6R A;  1BBY A;  4DBQ A;  1UST A;  5HOO A;  2BZT A;  5KK1 A;  1B59 A;  1DQU A;  4BY7 J;  3V7R A;  4FX4 A;  3RZO J;  2XSJ C;  3CJT B;  3TMO A;  2PMZ A;  5ILV A;  3UKG A;  1I1G A;  2HVR A;  1ZAO A;  4GDF A;  1EV7 A;  2ZCW A;  1VQ9 I;  1RI7 A;  3I4M J;  2YU9 J;  1J0R A;  2VQG A;  4CXF A;  2KJB A;  2CWE A;  3QPH A;  3GTK J;  2QWW A;  3U2R A;  1Q1H A;  4JK1 X;  3LNQ A;  1A31 A;  2EIL H;  1CF7 B;  2E71 A;  4V2G A;  5D6E A;  3SZG A;  4C3J J;  1MW7 A;  2M9H A;  2CUF A;  3ISP A;  5IP9 J;  5FLM J;  2LBF B;  1PUF A;  3DTI A;  2UWM A;  3U9G A;  2VN2 A;  2HQA A;  2V6E A;  3CJN A;  2HPM A;  2V9P A;  2DAO A;  3IH4 A;  2FNP A;  1SD7 A;  1S8N A;  1ON2 A;  1HCR A;  2FOK A;  1UB9 A;  4ZDP A;  1AHD P;  2QGU A;  2AXL A;  3AL0 C;  4HF1 A;  4BE1 A;  4KMU X;  2XB5 A;  4CCK A;  3BPX A;  2DO7 A;  2Z1D A;  3ECH A;  5EEH A;  1D1A A;  3A02 A;  1BI1 A;  2WA0 A;  3CUQ C;  3TOA A;  5B66 C;  1RR8 C;  4IKF A;  1O7L A;  1D0X A;  1YX5 A;  2LVS A;  4KUM A;  4HEA 2;  5CQG A;  4DZJ A;  1R22 A;  4RLQ A;  5HNH A;  2QEX I;  4KYW A;  3HOZ J;  3KP6 A;  4AYB N;  3S16 J;  2ZSH B;  3CQZ J;  4LLG F;  2YPR A;  1O3T A;  4L9T A;  3TO9 A;  2CQN A;  2F6C A;  1QU3 A;  1U78 A;  1MNM C;  3GXO A;  4L9N A;  5ILS A;  3WTV C;  2VT3 A;  1SFU A;  1LE8 B;  1XSV A;  2CG4 A;  1YS7 A;  3JTH A;  2OJE D;  3RKX A;  2LP0 A;  3DTK A;  4M3B A;  2L7Z A;  4WWC A;  2PN6 A;  1GUU A;  1I1S A;  1XMX A;  3F9K A;  4PSW A;  1I6H J;  5HLI A;  1VQL I;  4Z2Y A;  3NEU A;  4Y3O A;  1TBX A;  1R7J A;  2EFP A;  2BXY A;  3HC7 A;  5M3F J;  4CGZ A;  1MMG A;  3K4M A;  3HUG A;  3BZC A;  2Y0S A;  2GA1 A;  3T0Y A;  1U5T A;  3GME A;  4BHP A;  1SVL A;  2G7U A;  5F1J A;  4GYI A;  5EGO A;  1F5T A;  2EV0 A;  2EH3 A;  3CME I;  3B73 A;  4A3F J;  1BW6 A;  4LD5 A;  5FFX A;  3S1N J;  1IRF A;  1BC8 C;  3BY6 A;  4RGR A;  4BDY A;  1D3Y A;  1P4W A;  1OCP A;  1SD6 A;  4LMY A;  1VTN C;  2FQ4 A;  3QP6 A;  4QPO A;  3HOT A;  2NXN B;  1ZR2 A;  2LFB A;  3TDU C;  1YIJ I;  1OCZ H;  2ZXI A;  3FMS A;  2M8G X;  3GLL A;  2Z3Y A;  2DTZ A;  2XPU A;  3FM3 A;  1IXS B;  5J8F A;  5E1W A;  5F0F A;  4NB5 A;  4KN4 X;  2ZB9 A;  1GHC A;  1OYY A;  3FBI B;  4KIF A;  4Y4R A;  4EJO A;  1T8I A;  1WFX A;  3DQV C;  4XR6 A;  1IXR C;  4DYC A;  2O8X A;  2LDU A;  2DT6 A;  3CO6 C;  3L9F A;  2DFI A;  3MKL A;  1JKQ C;  2QZ8 A;  2ID6 A;  3HSE A;  3BZK A;  3F3X A;  3L00 A;  1D5Y A;  3QYB A;  2STT A;  4FHT A;  4CCJ A;  1VND A;  5LEK A;  3BCB A;  3F8C A;  1D8J A;  1V4R A;  1K78 A;  1ITY A;  4P5O A;  4XRS A;  1PVE A;  3BWG A;  5IOZ A;  1H9T A;  1YIO A;  3VSK A;  4UUV A;  4A69 C;  2XGE A;  3K4C A;  5K1Y A;  3GX4 X;  1Y1W J;  2FD5 A;  1W0U A;  3W6J B;  5IP6 A;  3ML6 A;  2YX4 A;  3SHF A;  4YFK F;  2JT1 A;  2BV6 A;  2XAH A;  1ZG1 A;  2DQL A;  4UY8 I;  3WOD F;  2STW A;  1PUE E;  4OIO F;  2QSF X;  1B8I A;  4OMZ A;  2DJN A;  3H0D A;  1NG7 A;  4I76 A;  2E5N A;  2GXG A;  4M9Z A;  3HOY J;  2MYS A;  1IRX A;  1B6A A;  2R7D A;  1KYW A;  3TKY A;  2KIU A;  2GOM A;  4BXU A;  4A0Y A;  2NS0 A;  5FKM A;  1UG0 A;  5M5Y J;  3S3O A;  2VJJ A;  2EIK H;  1FP2 A;  2WB1 N;  1LNW A;  4XLH A;  2ID3 A;  3PJR A;  2ISZ A;  1I27 A;  2QVO A;  3R4K A;  3OS2 A;  2FML A;  2X0L A;  1USS A;  5TJJ A;  3HOS A;  2QQB A;  2VUM J;  5ICC A;  4M6X A;  3IAS 2;  4GRI A;  1EF4 A;  3T5X A;  4PK4 A;  5GAE J;  4ASN A;  2IS1 A;  2ZFU A;  1YTY A;  1X3Z B;  5L3F A;  4OMY A;  5IYB J;  5FKN A;  2IBD A;  5DCM A;  4HV5 A;  2IS2 A;  1X3W B;  3TDZ C;  1BJZ A;  1OIS A;  2YR2 A;  3KZI C;  4MFE A;  3V42 A;  2KKO A;  2HXO A;  3BDD A;  1Z6T A;  4EQQ A;  2LKS A;  1MBF A;  1ORK A;  2XVC A;  4BJ5 C;  2NRA C;  1N77 A;  4HDU A;  2FUG 2;  4AD9 A;  2CS3 A;  5C44 J;  2D1H A;  4IXA A;  2ZSI B;  2ZJR F;  2A68 F;  4BE0 A;  2VE8 A;  1HDD C;  4RM2 A;  2VBW A;  3WTX C;  1CQT A;  1FMW A;  3I54 A;  1DP3 A;  1EKE A;  1H9G A;  2N8G A;  3OIO A;  5DM6 F;  4LB5 A;  4UV8 A;  2GIV A;  4AYB A;  3E7L A;  1WI3 A;  5D6F A;  3K1M A;  1FPQ A;  3VYU B;  3R61 A;  4F3Q A;  3BLY A;  4DQ2 A;  4P9U A;  3OYH A;  1F9N A;  1OMI A;  2FBI A;  2ELK A;  3MQ0 A;  3EUK L;  1XDS A;  5D4S A;  3H3Z A;  2RAE A;  1TNS A;  1MJ9 A;  1DPU A;  5F1R A;  2MSY A;  1WJE A;  3PM1 A;  2IT0 A;  1DUX C;  1XGO A;  2BXZ A;  4EMS A;  2LF7 A;  4CUG A;  3L2U A;  3W3C A;  2JMW A;  2Y2Z A;  1ZGJ A;  3GUD A;  3G6E I;  1TWF J;  2QQ9 A;  2Q1Z B;  3K70 D;  4B4C A;  3CCS I;  1XCB A;  4QWQ A;  2ZJP F;  2VQL A;  2BGC A;  2EFW A;  2TCT A;  2XAJ A;  3PUB A;  4F93 B;  3JRA A;  2NNY A;  1VQ4 I;  2XHK A;  1TT0 A;  1QZE A;  4S0H B;  4LB6 B;  1JT0 A;  2LH9 A;  5HS7 A;  3FBN B;  4L0Y B;  2BY0 A;  2WAQ A;  1TL8 A;  1U9N A;  3F6O A;  2KIS A;  1P92 A;  1BN5 A;  1L0O C;  3KX2 A;  1FMV A;  1B72 A;  4B3A A;  3BR0 A;  4U7B A;  4Q4Z F;  2F5V A;  2VLA A;  4MEY F;  1KQ8 A;  4AID A;  4HNU A;  1NK3 P;  3K4B A;  1HA8 A;  1BOA A;  3RSN A;  2MH2 A;  1N25 A;  1GVD A;  3CJR B;  2LF8 A;  3MWM A;  2OV7 A;  5LBQ A;  1IO2 A;  2AO9 A;  1BR2 A;  3KP3 A;  4LIU A;  4N9I A;  3F21 A;  2V1X A;  3HG9 A;  4RAF A;  2LY2 A;  1R71 A;  3GTO J;  2OUM A;  1LEB A;  3WU2 C;  2GXA A;  2A5W A;  1ETW A;  5K5O A;  2K9L A;  3LAP A;  1AA7 A;  1KA8 A;  1ZAR A;  5FD5 A;  3SFZ A;  2DT5 A;  1QO0 D;  2DCE A;  3CMA I;  1HKT A;  3DF8 A;  4JQF A;  4P9F A;  2D5V A;  1X1P A;  3K1N A;  2R7W A;  1W1W E;  1WJB A;  1GDT A;  4XOP A;  1OCR H;  2O3F A;  1BW5 A;  3BZ6 A;  3IKT A;  1YJN I;  2DJI A;  4Y7N J;  3E6D A;  3TQN A;  1QHG A;  2QKM B;  1P2F A;  2IVM A;  1LKX A;  2BHZ A;  1RIO H;  5GTI C;  1ZLK A;  2VC0 A;  3KZY A;  3GYH X;  3E6M A;  2ZJQ F;  1DPR A;  3RQ4 A;  1I50 J;  3BT9 A;  5FKO A;  1WJA A;  3OYG A;  3MZH A;  3ZQI A;  1AKH B;  5F64 A;  4AIK A;  4I02 A;  1TC3 C;  4BQO A;  3DLL F;  2FSW A;  3Q5F A;  3L2W A;  3LSP A;  1NH3 A;  4N9H A;  4QSH A;  2WB1 A;  5CVV A;  3S32 A;  3M8J A;  4AWX B;  2O9L A;  1LB2 A;  5K7Z A;  1WQ2 A;  5BQT A;  1BJA A;  2Z5U A;  2VKH A;  1KQ0 A;  1OR7 A;  5KHD A;  4M6Y A;  4LK0 F;  2DA4 A;  1I6X A;  1XMA A;  5FJ8 J;  3GZ6 A;  3DBH B;  5KAI C;  4CCL A;  3L2Q A;  3M4O J;  4C3I J;  2XGX A;  2MH9 A;  4M9X A;  4XLA A;  3JR9 A;  1I39 A;  1IXC A;  1W7P B;  3FXK A;  2PX9 A;  4A93 J;  2L3D A;  2Z9O A;  1S6L A;  2ELJ A;  4OIN F;  1VZ0 A;  5FKL A;  1H8A C;  4RB0 A;  1RNL A;  3FXR A;  2R92 J;  3L7W A;  1TT5 B;  3LSH A;  4A3J J;  4YRV A;  1OCT C;  2IA2 A;  3AG3 H;  1K6O A;  2ICW G;  4JX5 A;  2K5C A;  5E8G A;  2F4M B;  2P5K A;  2NVQ J;  1DU6 A;  5HOD A;  3FX3 A;  4B48 A;  3ZQG A;  4Y15 A;  1Z1D A;  4ENK A;  3J7A Y;  3S2D J; 
#chains in the Genus database with same CATH homology
 4D5F A;  1ZTR A;  1HOM A;  2M34 A;  2YS9 A;  4EEF G;  2IAI A;  1JJ8 C;  2CJJ A;  1FTZ A;  3HM5 A;  5EF6 A;  2ECB A;  1NTC A;  2K9S A;  1TWG J;  1MSE C;  1H88 C;  4MIM A;  2K40 A;  1IDY A;  3NAU A;  1S7E A;  4ABZ A;  1LFB A;  3JRB A;  3GTM J;  1RPW A;  4D7M A;  1XC5 A;  4XK4 A;  2L0K A;  5JLW A;  5J1Y A;  2NS7 A;  2XPW A;  1FIA A;  2Y31 A;  4HNV A;  4W1U A;  2O8K A;  1A5J A;  3BTL A;  5E3N A;  3PO2 J;  2DMN A;  3HDD A;  3CCY A;  3RQI A;  1X2M A;  3FK6 A;  2E2H J;  1JTY A;  4JX4 A;  5C4X J;  5GPC A;  1POG A;  9ANT A;  1X2N A;  3L1P A;  5F0C A;  3JRD A;  1B8I B;  1PUF B;  3B6A A;  2NVY J;  3RZD J;  2VKV A;  3HGG A;  4BY7 J;  1AU7 A;  5C3E J;  3RZO J;  5EEA A;  3TED A;  3UKG A;  3HGY A;  4FTH A;  3H3V K;  2L7F P;  1MSF C;  3GTJ J;  4X1E A;  3QPL A;  3HOV J;  3C2B A;  3I4M J;  2YU9 J;  4Y52 J;  2WV1 A;  1WCM J;  3GTK J;  1Z77 A;  2ME6 A;  1QPI A;  3A03 A;  5EZH A;  1MH3 A;  3OSG A;  1HLV A;  3LNQ A;  3S2H J;  3FK7 A;  3HOX J;  1VF9 A;  4V2G A;  2EZL A;  3TW6 A;  2X9D A;  4C3J J;  1JUP A;  2M9H A;  2CUF A;  2R0Q C;  5IP9 J;  1HDP A;  5FLM J;  1MBK A;  4IHW A;  1OFC X;  3FKI J;  1PUF A;  4DZP A;  2I10 A;  3M3Y J;  1ZGW A;  5M5X J;  3IH4 A;  2R7Z J;  2AHQ A;  4AC0 A;  3DEW A;  1HCR A;  2O7O A;  1AHD P;  2LD5 A;  3Q3S A;  4BY1 J;  3SFI A;  5J1U A;  2XB5 A;  4D5C A;  2FX0 A;  3TW7 A;  4JX6 A;  2JWT A;  4W97 A;  3GTL J;  3A02 A;  5BNG A;  3O8H A;  1I3Q J;  4C2M J;  3PO3 J;  2JK3 A;  3JRG A;  3HOW J;  4QTR A;  2LVS A;  1GV5 A;  4DZJ A;  4A3M J;  3JRC A;  2JJ7 A;  1FTT A;  2H8R A;  2COB A;  3HOZ J;  1BA5 A;  2GM4 A;  4AYB N;  3S16 J;  1JKO C;  1WPK A;  3CQZ J;  4BBS J;  1WH7 A;  4DW6 A;  1JUS A;  3HKZ N;  2XPV A;  2XB0 X;  2LK2 A;  1JKR C;  1SAN A;  1U78 A;  1MNM C;  2R5Z B;  1OJL A;  1UHS A;  2CUE A;  1LE8 B;  4B1R A;  2LR8 A;  3Q0V A;  2LP0 A;  4M3B A;  1GT0 C;  2L7Z A;  1GUU A;  3MN2 A;  1I6H J;  3TP3 A;  5J1R A;  3O8G A;  5M3F J;  2XGD A;  4UUS B;  2LKX A;  5F1J A;  2R5Y A;  5EGO A;  3S1Q J;  3QPS A;  5FLV A;  2EH3 A;  4A3F J;  1ZR4 A;  3HBL A;  1BW6 A;  4A3E J;  4A3K J;  3S1N J;  1RR7 A;  4CYC A;  2M2E A;  1WGX A;  1OCP A;  2DMU A;  2FQ4 A;  2XRL A;  3G1O A;  1DU0 A;  5DS9 A;  2X48 A;  1ZR2 A;  2H1K A;  2LFB A;  2R5Z A;  3D1N I;  1NK2 P;  2M8G X;  3I4N J;  1R9T J;  2DTZ A;  2XPU A;  1LE8 A;  3B6C A;  3FIW A;  4FE4 A;  5F0F A;  1ZQ3 P;  3NAR A;  2E19 A;  2ZB9 A;  1QRY A;  2HOT A;  4NDL A;  1U9O A;  3S1R J;  3BR5 A;  3FIS A;  4DYC A;  3F0C A;  3MVP A;  2MW8 A;  3MKL A;  1JKQ C;  2ID6 A;  4UUS A;  2HXI A;  1D5Y A;  1XG1 A;  2JA7 J;  4M3E A;  5DTD A;  2QCO A;  1O4X A;  1VND A;  1W0T A;  4XIC A;  1ZKG A;  1TWC J;  1ITY A;  4XRS A;  3A01 B;  5E3L A;  4A3B J;  2LTP A;  2L7M P;  5IOZ A;  4JP0 A;  3S17 J;  2KDZ A;  1FIP A;  3S14 J;  4A69 C;  2XGE A;  1IC8 A;  1Y1W J;  2FD5 A;  1W0U A;  2TRT A;  2P81 A;  3JRI A;  5IP6 A;  3S1M J;  1IUF A;  3BR1 A;  3G1L A;  3BG3 A;  3BR6 A;  2XSD C;  2ECC A;  4JYK A;  2R93 J;  2Y9Y A;  3BG5 A;  1UG2 A;  4QIW N;  1B8I A;  2DJN A;  3HOY J;  4A3C J;  4I76 A;  5GPA A;  1ETY A;  4GFB A;  1VI0 A;  2CRG A;  3WHC A;  4AUX A;  1RKW A;  2CQQ A;  5C4J J;  5FKM A;  4MO7 A;  4A3L J;  3OSF A;  2ME0 A;  5M5Y J;  1JGG A;  2WB1 N;  5EG0 B;  2ID3 A;  1JUM A;  3A01 A;  1JT6 A;  2JN6 A;  4V2F A;  2VUM J;  5K7F A;  3CMY A;  2G0E A;  3H0G J;  1EF4 A;  2DA5 A;  2VPR A;  1T33 A;  1F43 A;  1X58 A;  5JLX A;  5IYB J;  5FKN A;  2IBD A;  5IP7 J;  2JA8 J;  5E3M A;  1BJZ A;  3ZQF A;  4MFE A;  1P7I A;  2HXO A;  3LOC A;  4BBR J;  2CQX A;  1MBF A;  1JTX A;  1ORK A;  4XRM A;  3IV5 A;  2DMT A;  5C44 J;  1MH4 A;  2DMP A;  3ZQC A;  2NVX J;  2VKE A;  3G1M A;  2DA1 A;  4MFD A;  3WHB A;  1HDD C;  1TWH J;  5M3M J;  1K83 J;  3BTI A;  3CDL A;  4BXX J;  2CU7 A;  1CQT A;  5EG0 A;  3ZQL A;  2N8G A;  3OIO A;  3HOU J;  1HF0 A;  1BL0 A;  1ETK A;  1APL C;  3E7L A;  1WI3 A;  2YUS A;  1F36 A;  5IPA A;  1MBH A;  2HYJ A;  2VI6 A;  4L5E A;  2L9R A;  1B72 B;  4M3G A;  4UUT A;  2HDD A;  4M6V A;  2ELK A;  1RKT A;  1VFC A;  4A3G J;  2NOG A;  1ETX A;  1A6I A;  2RAE A;  3RKQ A;  1JKP C;  2MSY A;  1RET A;  5F04 A;  3PM1 A;  5J3L A;  4A3I J;  1FJL A;  1IGN A;  4J19 A;  1YRN B;  2LY9 A;  1IJW C;  2JMW A;  2Y2Z A;  1IV6 A;  3ZOB A;  2WAQ N;  1TWF J;  4G12 A;  3JRH A;  4B4C A;  1U8B A;  4RDU A;  3OOU A;  1Y1V J;  3QQA A;  2TCT A;  3GTG J;  1Q1V A;  2HOA A;  3Q0W A;  5IOY A;  3JRA A;  2B63 J;  2HQ5 A;  3LSJ A;  1FEX A;  5GP9 A;  2DA2 A;  4S0H B;  1JT0 A;  1ENH A;  4XID A;  2OF7 A;  4FE7 A;  5F08 A;  1T56 A;  3TP0 A;  3GTQ J;  1U9N A;  2W48 A;  2FJ1 A;  3GBG A;  4D7N A;  1B72 A;  5FKK A;  4B3A A;  3BR0 A;  3JRE A;  1K61 A;  5IYC J;  1NK3 P;  4IHV A;  1GVD A;  3W6V A;  2EZH A;  5IYD J;  2AO9 A;  1ZK8 A;  3SDG A;  1QVU A;  1YRN A;  5K7H A;  3K2A A;  1XS9 A;  3GTO J;  3SJM A;  2EQR A;  3BR2 A;  3K7A J;  3BR3 A;  1ETW A;  2M0C A;  2PMZ N;  5EDN A;  4C3H J;  3LSG A;  2NS8 A;  2NVT J;  3JRF A;  1UMQ A;  4I6Z A;  4DYR A;  2MG4 A;  5EZG A;  4X6A J;  1G2H A;  3VPR A;  4MLO A;  2HI3 A;  3HB9 A;  2D5V A;  2DA3 A;  2JA6 J;  3LSR A;  1WH5 A;  1GDT A;  1IG7 A;  1BW5 A;  1MBE A;  1GV2 A;  3IH3 A;  3BTJ A;  2QF7 A;  2X6O A;  4Y7N J;  1IRZ A;  2KT0 A;  1SFO J;  1MBJ A;  5EYR A;  4LOC A;  2GBY A;  2XGC A;  2JA5 J;  3DCF A;  2EZI A;  2K9N A;  2MGQ A;  3BQZ A;  5E3O A;  2DA7 A;  5F0H A;  3IH2 A;  1I50 J;  3BT9 A;  2HOS A;  4IEJ A;  2DN0 A;  5FKO A;  3ZQI A;  2EBI A;  4BKX A;  3BTC A;  1LFU P;  1AKH B;  3BQY A;  1QVT A;  3Q0U A;  1TC3 C;  1ETV A;  3LSP A;  2DMQ A;  4DYQ A;  5M5W J;  4QSH A;  3BG9 A;  2IEK A;  2O9L A;  5K7Z A;  2Y30 A;  2GLO A;  1Z0X A;  4M3D A;  5F27 A;  2DA4 A;  4XRS G;  4FIS A;  4A3D J;  1H89 C;  5FJ8 J;  1TWA J;  3M4O J;  4C3I J;  4FCY A;  3JR9 A;  1JJ6 C;  1ETQ A;  2E1O A;  4IHY A;  2R5Y B;  5EGO B;  4A93 J;  1E3O C;  3GTP J;  1RES A;  4M3F A;  1ETO A;  2LLK A;  2OPT A;  5FKL A;  1AKH A;  1H8A C;  2DA6 A;  2Y9Z A;  2R92 J;  1IDZ A;  4CYC B;  4A3J J;  1OCT C;  2EZK A;  2K9Q A;  2E2I J;  3HEF A;  3S15 J;  4RBO A;  4JX5 A;  3ZQH A;  1MBG A;  1DU6 A;  2NVQ J;  2Y0S N;  2E2J J;  4IHX A;  5HOD A;  3ZQG A;  1P7J A;  3S2D J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...