3PO3J

Arrested rna polymerase ii reactivation intermediate
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3po3J00
2ECBA 5EDNA 4DZJA 3BR6A 1QRYA 2DA1A 2DJNA 2FQ4A 1ZKGA 1YRNA 1K83J 2N8GA 1Q1VA 4C3JJ 1BA5A 2NS8A 2O9LA 2YU9J 4DYCA 1HLVA 1H8AC 1WPKA 1H89C 2HXIA 2XGCA 3FIWA 1ZK8A 2DA4A 3PO3J 3B6AA 1JJ6C 2NVYJ 1JT6A 2CU7A 3JRAA 3G1OA 1JKRC 3H3VK 1BJZA 2XRLA 5GPAA 1GV5A 2K40A 3BR1A 1S7EA 1BL0A 1I50J 2COBA 1EF4A 4D5CA 3M4OJ 1ZR4A 1MBGA 5J1RA 3JRIA 1MSEC 3BR0A 3UKGA 2VKVA 1NK3P 3HKZN 2KDZA 2G0EA 1FJLA 2OPTA 1U78A 2D5VA 3QPLA 1FIAA 1JTYA 2MGQA 2JA8J 2E1OA 2HQ5A 1POGA 3GBGA 3ZQIA 4JP0A 2JMWA 2JA6J 2I10A 1GV2A 4MFDA 1DU6A 5FKLA 1TWCJ 2DMUA 1AKHB 3TW6A 2CUFA 4B1RA 3HOYJ 2JK3A 1QPIA 2X6OA 1UHSA 3TEDA 1R9TJ 4A3CJ 5F0CA 4W1UA 1IC8A 4MFEA 2QF7A 1WI3A 4QTRA 3JRGA 1IJWC 1TWFJ 4M3BA 3ZOBA 2JA7J 1X58A 1O4XA 5E3NA 2M0CA 4B4CA 1TWHJ 3BG3A 1ZGWA 4UUSA 3HOUJ 3PO2J 2VPRA 1U9OA 2DA2A 4GFBA 4B3AA 3HB9A 1FEXA 4BXXJ 4FISA 1IV6A 3MKLA 1FIPA 2LLKA 2TCTA 1X2MA 3BTIA 2DA3A 3HGGA 3NAUA 9ANTA 2ZB9A 5M3FJ 4Y7NJ 3LOCA 2LD5A 1W0UA 2HOSA 4V2FA 5EG0B 4I6ZA 5GP9A 4MLOA 1JJ8C 1I6HJ 4A3LJ 3HBLA 3GTJJ 1BW5A 2FX0A 3HOXJ 1ETYA 4A69C 1JGGA 2YS9A 2OF7A 1G2HA 2Y0SN 2JWTA 5C4XJ 4C2MJ 3HEFA 5FKKA 3Q0WA 2DMTA 2IAIA 3LSGA 1PUFB 3S1NJ 4XRMA 5EYRA 5FLMJ 1PUFA 3PM1A 4DZPA 1Y1WJ 2AO9A 2L7FP 4IHXA 1K61A 3DEWA 2O8KA 1ETXA 4NDLA 2JN6A 3S15J 3C2BA 4I76A 1A6IA 3A03A 2R5ZA 1B72B 4C3IJ 4C3HJ 3JRCA 2DTZA 3I4NJ 2DMQA 3S1QJ 5FKMA 4FCYA 1Y1VJ 3JRHA 5J1YA 2W48A 4AC0A 5FKNA 1XC5A 1NTCA 3GTOJ 5E3MA 5GPCA 3MVPA 3M3YJ 4XIDA 3O8GA 5K7FA 5M5YJ 2ID6A 4EEFG 1HCRA 2GLOA 1YRNB 3SDGA 2EQRA 5EEAA 1QVUA 3VPRA 1WH7A 2O7OA 4XICA 1QVTA 3IV5A 3SFIA 4M3GA 4M3FA 2DN0A 3BT9A 3LSRA 2XPVA 1WCMJ 3E7LA 1VI0A 2EZLA 1CQTA 2H8RA 5J1UA 2PMZN 2CRGA 4IHYA 1RESA 3OIOA 3H0GJ 2WV1A 1WH5A 2LK2A 2ME0A 3MN2A 5EF6A 2NVTJ 2GBYA 2HXOA 2R5YB 1XS9A 2EBIA 3CCYA 2E2HJ 3JREA 2DMPA 3O8HA 2R5YA 1B8IB 2VKEA 4XRSA 5K7HA 1SFOJ 1JT0A 1VNDA 2TRTA 3Q0VA 3S16J 5F08A 2EZIA 4QSHA 4RDUA 4DYRA 3RZDJ 5BNGA 5JLWA 3FISA 2RAEA 1ETWA 1JKQC 1JUSA 3K7AJ 3CMYA 2E19A 3FKIJ 2M34A 1LFBA 2R5ZB 4BBSJ 1B72A 1ETQA 4FE4A 2HI3A 2ME6A 1ETVA 3LSPA 2DMNA 1D5YA 3DCFA 1IG7A 4G12A 4AYBN 3BG9A 2IEKA 3IH4A 5IYCJ 3HGYA 1OCPA 2P81A 1GVDA 4M3EA 2HOTA 2CUEA 5E3OA 1Z0XA 2M8GX 2WAQN 1GUUA 5C44J 5IOYA 4ABZA 5F27A 2AHQA 3RKQA 1ZTRA 3GTPJ 2MW8A 2FD5A 3BTLA 3A01B 5IPAA 1W0TA 1OCTC 3D1NI 3JRBA 1AKHA 3BG5A 4IHWA 3A01A 4Y52J 4BY7J 1ORKA 4J19A 1ENHA 1RR7A 2LKXA 2EZHA 1JUMA 1MBJA 2ELKA 3S14J 3OOUA 3I4MJ 2CQQA 3Q3SA 3TW7A 5M5WJ 2GM4A 2LTPA 1MBHA 3JR9A 5HODA 1X2NA 2XGEA 5IP9J 5DTDA 2R0QC 1HDPA 1FTTA 4XK4A 2MSYA 4D5FA 2WB1N 3SJMA 2R92J 1OFCX 2M2EA 3BR2A 3IH3A 5EZGA 3L1PA 3W6VA 1Z77A 4DYQA 4X6AJ 1XG1A 1APLC 3ZQCA 4CYCA 4A3DJ 3GTLJ 2DA7A 5IYDJ 4BBRJ 3B6CA 3BR3A 5K7ZA 4A93J 3BQYA 4JX6A 4A3IJ 1BW6A 1AHDP 3GTMJ 2XPWA 4M3DA 2K9NA 2QCOA 4AUXA 4X1EA 4V2GA 3GTGJ 2NVQJ 5F0HA 1MBKA 1P7JA 3OSGA 3S1MJ 2Y9ZA 1F43A 2CQXA 1T33A 2L7MP 1UG2A 2XB0X 2NS7A 4W97A 3GTKJ 1ZQ3P 3OSFA 1HOMA 2B63J 2JJ7A 3HDDA 2LVSA 5E3LA 3BTCA 3S1RJ 3FK7A 2XGDA 1ITYA 5J3LA 2KT0A 3LNQA 3ZQFA 4JYKA 1LE8A 1JKPC 3K2AA 4JX4A 3CQZJ 3JRDA 3BR5A 3BTJA 5EGOB 1LE8B 5FJ8J 1MH4A 3IH2A 2LY9A 2K9QA 1RPWA 4RBOA 1LFUP 5EGOA 2VI6A 1U9NA 2CJJA 1VF9A 2LP0A 3ZQLA 2LFBA 1ETOA 1ETKA 3S2HJ 2X48A 2XSDC 2NOGA 2E2IJ 2R7ZJ 3HOVJ 2L9RA 3ZQHA 4FTHA 1IGNA 5IP7J 3Q0UA 5EG0A 1RKWA 5F1JA 4A3BJ 1IRZA 1E3OC 3RZOJ 1ZR2A 3HM5A 2VUMJ 4HNVA 4FE7A 3G1MA 2X9DA 4CYCB 1B8IA 4UUSB 4IEJA 4A3EJ 5FLVA 3BQZA 5IYBJ 2M9HA 3ZQGA 2Y2ZA 3NARA 1MBEA 2ECCA 4JX5A 1A5JA 2XPUA 5F0FA 2EH3A 1FTZA 2ID3A 2EZKA 2JA5J 2NVXJ 1T56A 1GT0C 1HF0A 4LOCA 4UUTA 4DW6A 2Y9YA 5DS9A 3HOZJ 2DA6A 4A3JJ 3F0CA 5C3EJ 2MG4A 1UMQA 1MSFC 3TP3A 2K9SA 2R93J 2Y30A 4BY1J 1NK2P 1SANA 2LR8A 5IOZA 3RQIA 1OJLA 1DU0A 4A3MJ 1MBFA 4IHVA 1IDZA 2HOAA 3A02A 4QIWN 2XB5A 3TP0A 1HDDC 1I3QJ 5F04A 2Y31A 3WHBA 1IUFA 3G1LA 5IP6A 2IBDA 5JLXA 5EZHA 4D7NA 1VFCA 3S2DJ 3FK6A 2DA5A 4A3GJ 4M6VA 1TWAJ 2E2JJ 4L5EA 5M5XJ 2HDDA 3HOWJ 1U8BA 2HYJA 5FKOA 4A3FJ 1RETA 2L0KA 4MIMA 3JRFA 1RKTA 1MH3A 2H1KA 1JTXA 3S17J 4XRSG 4S0HB 1MNMC 2YUSA 3GTQJ 4D7MA 1IDYA 1TWGJ 1WGXA 3LSJA 4BKXA 5C4JJ 2FJ1A 1JUPA 1JKOC 3QPSA 1H88C 1AU7A 4MO7A 1GDTA 3WHCA 4A3KJ 2L7ZA 5M3MJ 3QQAA 3CDLA 1F36A 1TC3C 1P7IA
chains in the Genus database with same CATH superfamily
2M8EA 4ZJZA 5EDNA 1BR2A 4NNJA 2P8TA 4YG2F 3BR6A 2V6CA 2A69F 2RREA 1YRNA 3PSIA 1K83J 1Q1VA 2IPQX 2KLOA 4C3JJ 4PFPA 5ILUA 2Z33A 2YU9J 3KIOA 3DPUA 3P5JA 5HOOA 1SFUA 1H8AC 3P9KA 1WPKA 1H89C 3O6BB 1IZ1A 2OQRA 2HXIA 5D5UB 3PO3J 3IAM2 2WBMA 1TP4A 2QQAA 4HSTA 4XR6A 1IXCA 3S93A 1JKRC 2EB7A 3CC2I 2L7KA 4BQAA 3CCMI 3HHGA 2YX7A 5CVRA 1EF4A 3PSFA 1FBQA 3M4OJ 2VJIA 4M72A 2H94A 3VFZA 1XCVA 2R4GA 3UKGA 2VKVA 2QKLB 2KDZA 1YW8A 4PDKA 1FIAA 1MZBA 3BZKA 2HQ5A 3ECOA 3GBGA 4GO1A 3MCZA 3ZQIA 4DIQA 2XC7A 2JA6J 4XONA 1YFHA 2I10A 5CKTA 1GV2A 2VB6A 2KRFA 1DU6A 2DMUA 3MKYB 4O3MA 4DBQA 2CUFA 1JGSA 4HQMA 4B1RA 3R0AA 1QPIA 2X6OA 5DCMB 4PJJA 5D6FA 3G6EI 4E6KG 1G3WA 3JAMZ 1MKMA 1V54H 4A3CJ 2VLAA 3F6OA 2OD5A 1IC8A 1DUXC 4MFEA 1WI3A 4KITB 3KLOA 4D0PA 4MNUA 5GAGJ 2QSHX 1J0RA 1YS6A 3I56I 4LIUA 2R3SA 1HSJA 2VBWA 1TWFJ 3PNTA 1J9IA 4M3BA 3DXJF 4XOPA 1X58A 1IRFA 4ESJA 1QPMA 2YPRA 5TRDA 4YFNF 3JTGA 1ODDA 1MGTA 1X3WB 2GXGA 3TO6A 3HOUJ 2BW3A 4IL6C 1K6OA 3QYBA 2A3SA 1VQ7I 2DA2A 3PO2J 1QGPA 4B3AA 1FEXA 3EDPA 3A0BC 1MMSA 2F4IA 2DT7B 4LLLA 5AIPA 3OYGA 2MYSA 5CYVA 3NAUA 4ETSA 2LKPA 2QGUA 3L2CA 5B3SH 1J2XA 2F4MB 4XNFA 5H20A 1QHHD 4BE1A 5GP9A 1ZREA 1T6SA 3FXRA 4BL0B 3BPVA 1JJ8C 2ZNYA 2V9VA 3ZN1A 3RPUA 1JE8A 4A3LJ 3FMRA 2XV4S 3DKXA 1KYZA 3GTJJ 1AOYA 1BW5A 4A69C 2WC2A 2YS9A 3I55I 1FOWA 2CMPA 1ZRCA 3ZMSA 4II3A 4A0XA 3EUHC 1MMDA 2DMTA 3LSGA 4BYYA 2E1NA 3H1CA 1FY7A 4OMZA 2PJRB 3VWBA 4G7HF 3C2HA 1PUFA 4Y13A 3OYFA 2KP6A 2L7FP 1ZH5A 2HS5A 2XASA 3E6BA 1X1AA 1OLTA 1ETXA 4XKWA 3S15J 3DU5A 4I76A 4ZYEA 1EH8A 2ZMEA 1R22A 4U0WA 5GAEJ 3QP5A 2V9PA 4B43A 2NVUB 3E5UA 3GLLA 2JSPA 5IY5H 2MD0A 3QU6A 1J5YA 2IRFG 2HU9A 3G71I 5J1YA 2W82A 3AFHA 1DPRA 1XC5A 3QYFA 4HAMA 3GTOJ 4A5MA 3KZZA 4NB5A 4KJZA 4M73A 2NNYA 2LYCA 4PJ0C 2A6EF 3C18A 1N25A 3SXYA 4KN7X 1IN7A 3ZMTA 2EJRA 1YRNB 2RGVA 1QVUA 1E2XA 1MJBA 4OINF 2O7OA 5E18F 1QVTA 5HLGA 3BT9A 1WCMJ 2EZLA 1R5GA 1CQTA 4N4OB 2PMZN 2LF8A 1RESA 1IN6A 2BY2A 3HXLA 4HRIA 3VOEA 4BUPA 3MN2A 4IQJA 1UELB 1YLFA 3WTUC 2HXOA 1R71A 4I2OA 2KJBA 2EBIA 1XS9A 2F5CA 2GOXB 2DMPA 4PUSA 3U9GA 4HX4A 3O8HA 3FXMA 3Q5FA 1RZ4A 2HQAA 2VKEA 2XAUA 1I1SA 4A2UA 2D1HA 5FRMA 3S16J 2Q0OA 4PZJA 4CCJA 1FPQA 2EZIA 1BIAA 4Y33A 4DYRA 2BZTA 3ABLH 4XRFA 3SZTA 2PEXA 4L9NA 4FT8A 1ETWA 1JI8A 3IRQA 2HTSA 5DDGA 1K4TA 1JKQC 2E19A 2EIJH 3FKIJ 3HC7A 1J09A 4L5JA 5HDKA 2R5ZB 4BBSJ 2HI3A 4FE4A 3E1SA 2AS5F 1V5FA 2LDUA 1F9NA 3FXKA 5DYMA 3OYDA 5LGUA 3BG9A 4G6TB 3W6JB 3QP6A 3HGYA 2XF5A 2W85A 2DTRA 2PMHA 1GVDA 3L2RA 2HOTA 2HVSA 4E7LA 3W2WA 3HSRA 1KU9A 1ZTRA 5E20A 4HOBA 4L9TA 3ABTA 3BTLA 3A01B 1P4AA 2M87A 5IPAA 4ZC3A 2CGPA 1YIOA 2DU9A 5FFXA 2Z3YA 3BG5A 1KYWA 2A6TA 4IHWA 2IA0A 1BBYA 3K4LA 2E36A 1KQ9A 4XN0A 2HEOA 2LKXA 2EZHA 4C2UA 2OA4A 2F5EA 3V7RA 3W2AA 2LF7A 3Q3SA 4RM3A 3DV8A 1XMAA 5FGMA 2FE3A 2OQGA 5M5WJ 3RPQA 4BDYA 2RVCA 2LTPA 1MBHA 3JR9A 1X2NA 1A36A 4HW0A 2L4AA 5DTDA 1BI2A 4Z6YA 1LB2A 1FTTA 3WTSC 2MSYA 2JZYA 1YTYA 2J5PA 2E5ZA 2HWVA 2KRCA 3GWZA 1XMXA 3J81K 1Z77A 1V4RA 2G9WA 3BJ6A 2HYFA 3O3KA 3ZQCA 2GIZA 2FMLA 3GTLJ 5J8FA 2KIFA 5HS8A 4BBRJ 4F93B 3BQYA 4JX6A 4A3IJ 3GTMJ 1AHDP 3CLOA 2XPWA 3HRTA 5LHHA 3K4NA 3IHUA 2LY2A 3S2WA 1V5GA 3Q9SA 4V2GA 3GTGJ 5F0HA 3V8LA 2I8DA 3C7JA 2VQHA 3S1MJ 3ZMVA 3ABUA 5FRNA 4XLNF 5FLXK 2WAFA 3HOTA 1LPQA 4AIJA 2L7MP 2GIVA 1B6AA 1PP7U 1PDNC 1T98A 2NS7A 3GTKJ 3VEPA 2ISZA 1ZQ3P 3MZ8A 3I9V2 3IC7A 4RB3C 2IT0A 4BJ5C 2V1XA 3BC8A 2MLGA 5E3LA 3PIPF 3S3NA 3ABKH 3BTCA 4PSWA 4QPOA 2J5OA 4Y15A 4CCNA 2GQQA 4E4HA 2KT0A 1VQNI 4HPQA 3OL4A 2DK8A 5D5XB 4BEHB 1LE8A 2LBFA 4XQFA 3RQ4A 4HX8A 4JX4A 1JXSA 1TW2A 5ILVA 2LG4A 2XAGA 3GFIA 3ZP5A 2COMA 2LY9A 1X4PA 2EA4A 3OWTA 4RS8A 1ON2A 1T0FC 1U5TC 4IQ4A 5CLSA 4KFCA 2QSGX 1TBXA 2M45A 3GZ6A 5LD2C 2E2IJ 1O7LA 5E1WA 4PGHA 1A6QA 1XD7A 2H8WA 4LMYA 4RGSA 3P9IA 1V3FA 3Q0UA 3HRSA 2VQGA 2CSOA 4L9JA 4HF1A 3HM5A 5B1BH 5J6XA 4I01A 3BP8A 2BY1A 4P96A 2W7NA 3VDXA 2MD5A 5H2FC 4F52A 3U2RA 1B8IA 4IEJA 4UXNA 4AYBA 5F64A 4OAYA 1D1AA 3LQQA 2EFNA 3S3MA 5IYBJ 2L3DA 1R6RA 3NARA 4F7ZA 2ECCA 2DQLA 3LA3A 5LHIA 3KP7A 2P7CB 1FTZA 4E7ZA 4LK0F 2EZKA 3CCQI 4UUTA 4DW6A 3HOZJ 1QNTA 2L01A 4A3JJ 4NC7A 1MMAA 1B9NA 2STTA 1MSFC 4FX4A 3CUQC 1VQ5I 2IJLA 1HQCA 2ZCWA 1NK2P 1SANA 1STZA 1U2WA 2R7FA 2BGCA 3GMEA 2IXSA 4IHVA 1IDZA 4QIWN 4KN4X 1D1BA 3T8RA 3WHBA 3RTRA 5LLQA 2CH0A 4JBAA 2JVHA 4D7NA 2P6SA 3LFKA 1VFCA 3W2VA 2V1DA 3FK6A 5LGTA 2V7FA 4I0AA 1S6LA 3KLNA 1XTAA 2K02A 3R61A 1U8BA 3PJRA 4DNCA 2Z1DA 5J40A 3CCSI 2L0KA 1JHFA 3U1DA 1N77A 1IXRC 3F8BA 2LY1A 2BHZA 1MH3A 1O3SA 4QWQA 3S17J 1OR7A 1HKTA 3JSOA 3GTQJ 2KIUA 2VN2A 4RGXA 2X51A 1WFXA 2BYVE 5ILSA 1M1EB 3TOAA 3F8CA 3SFZA 5ED4A 4RLFA 4BGDA 1MMNA 3V8KA 1O7FA 3DFGA 1UHMA 1TC3C 1DGWY 1P7IA 4XKVA 3FXLA 2E35A 3ECHA 2DJNA 2FQ4A 1ZKGA 1W5SA 3E6CC 3ZXSA 4KIFA 4C9YA 2N8GA 3WGGA 2JT1A 2BY0A 2BW3B 1H0MA 3RDIA 4ENNA 4IKFA 2FBIA 3BWGA 1OKRA 4O6JA 4DYCA 2CQ7A 2JTVA 2ZNZA 2M3AA 3EYIA 2XGCA 3E5QA 1ZK8A 1BN5A 1GHCA 2JA2A 3G2BA 4DGWB 3G1OA 3K6GA 2KDOA 1EJ9A 4BQQA 1GV5A 2K40A 4RAGA 1R36A 1B1BA 4UV8A 2NNNA 2DJIA 3K70D 1MJAA 3JRIA 5J1RA 4IVNA 4G7ZF 3H0DA 4WXHA 2BE5F 2BY3A 4LB5A 2PQ8A 2OPTA 2VKHA 2YR2A 1U78A 2D5VA 2OV7A 3QPLA 2JA8J 3T8TA 2E1OA 2NYXA 3V4GA 4IRHA 1GXQA 2JMWA 2JRTA 3MZHA 1ZGJA 3LA7A 3PIOF 3MD2A 3M1CA 1TWCJ 1AKHB 3OS1A 3IWZA 5FO5A 3HRMA 3HOYJ 2FOKA 1UHSA 4D1QA 1YHQI 1UFMA 4IZZA 4HV6A 1YW7A 2CUJA 1REPC 4LLNA 2CO5A 1A04A 4S04A 1PP8F 1FZPB 4W1UA 3BZ6A 2QF7A 4LB6B 1KU7A 2DFFA 1MNDA 4AVPA 4QTRA 3H9GA 3JRGA 5KAFC 5L3DA 5JR3A 4IXAA 4HNTA 3BROA 4ZYGA 3TGNA 1FMWA 2K9LA 2M4GA 4FX0A 3RKYA 5CVVA 4H0EA 2MFZA 2QVOA 1ERDA 5E3NA 1HW5A 2DFEA 4ANJA 5GTHC 4MTEA 1TWHJ 1UAAA 2Y0SA 2HGCA 1MDMA 2VPRA 3FM5A 3JCUC 1U9OA 1MJ9A 1WJBA 1VQ9I 2DYRH 1U5TB 5D6EA 4BXXJ 1KZHA 2DI3A 2LLKA 3I0TA 1L0OC 3CF2A 4RMNA 4HF0A 3MZYA 2ADUA 2HVQA 3LOCA 1D8JA 2LD5A 2KMUA 4V19K 1EH7A 4MLOA 1RIOH 1Y39A 2KFDA 1H9TA 2VC1A 2R7RA 3N05A 4G6DA 5JVGF 5FB2A 3HOXJ 2IGKA 2OF7A 3CCEI 1FMVA 2ESNA 2FNAA 2Y0SN 1IRGA 2PMUA 1SC7A 4CICA 2DPUA 3Q0WA 1WVRA 3HPHA 2IAIA 2OBPA 5FFZA 3WTXC 3L2WA 3S1NJ 2R7XA 2Q8KA 1KQ8A 2CYYA 3ZQQA 2O8XA 2X1CA 5FLMJ 3PM1A 3S8PA 3U1KA 4CHUA 3CMEI 4YFKF 1K61A 2PJRA 3IWFA 3WE3A 2A5YB 4NDLA 2JN6A 4ZYDA 4IHTA 5AIQA 1A6IA 3TDUC 2VT2A 5KAIC 3D5LA 4C3IJ 3H9JA 2XDVA 1W7PD 1HA8A 2DTZA 3I4NJ 4KDPA 2IGOA 3M7GA 4IJAA 5HDGA 1UB9A 4I09A 4BNCA 2FF4A 4FCYA 1HC8A 3HJEA 4B3XA 3KFWX 3JRHA 2LOOA 3GZ5A 4ESBA 2IS2A 1SAXA 3FXUA 3D0SA 4UV9A 1SFXA 2W48A 4AC0A 4E70A 2XF6A 4LD5A 4Y4RA 1XDSA 1TNSA 1UCRA 2QYOA 3RYRA 3JAMK 2LREA 2GLOA 1HXDA 3HL2A 3SDGA 2OUMA 3J80K 4AIHA 2JRMA 1XGOA 5CVJA 3IV5A 4B44A 1X1PA 3SFIA 2ZJ2A 3LSRA 2H1LA 1VI0A 4NBQA 3WG7H 3CDIA 4UY8I 3TQNA 2HZDA 2HYGD 3OIOA 5ICFA 2RNJA 4X0GA 4A12A 3H0GJ 4ENJA 1Y6IA 5D5WB 1WH5A 2ME0A 2OTJI 2GBYA 2ISYA 3BOQA 3SZGA 4BQNA 3CCYA 4LG0B 1YX5A 4BQOA 1S7AA 3J7AY 1ONVA 3BY6A 2WA0A 1I39A 1T39A 1TL8A 4XRSA 4HLYA 2UXXA 1JT0A 2TRTA 3L2UA 5ICGA 1FP2A 2STWA 1TZLA 4C30A 1BJAA 2GA2A 3RZDJ 1W5CC 5BNGA 3WODF 2P6TA 2A6HF 5JLWA 1FC3A 3CCUI 3FISA 2ZXJA 2HPMA 2A68F 2XIGA 4HNUA 5L3BA 5LHGA 4TV7A 4RB2C 3RKXA 1LFBA 3K2ZA 4DBRA 3HSFA 2ME6A 1ETVA 3LSPA 2DOFA 3ZQ7A 4G12A 3I5UA 4AYBN 3BPXA 2PI0A 2IEKA 1YS7A 2DT5A 2HTJA 5IYCJ 4ZTJA 1OCPA 4GYGA 4U0VA 4CZCA 3PQJA 2ELHA 4AIDA 3A2KA 2UXNA 4WXDA 5E3OA 4B09A 2M8GX 2LKSA 2LNBA 1WJFA 2WAQN 4UB8C 4BS9A 3ZMZA 5C44J 3IKVA 1D0YA 4ABZA 1OISA 3CCJI 4L9VA 1E17A 3RKQA 4XSZF 3KETA 3QOEA 4YRVA 1IAWA 4BAYA 5B5EC 1BOBA 4RAFA 3A01A 4Y52J 1XSDA 2K3PA 2B0LA 1ENHA 1RR7A 3OYHA 1I3AA 2ELKA 3S14J 3OOUA 3I4MJ 2CQQA 4OMYA 3QYEA 2ZSIB 1BR1A 3ZPLA 4ZDPA 3TW7A 4PK4A 2O6GE 3LSTA 1SD5A 2P0WA 1U3EM 1I27A 5DM7F 5B66C 4LITA 3IRRA 4OIQF 2GXBA 2JPBA 4E7HA 1V5EA 4EGZA 3FXOA 3DBHB 3SJMA 2MH9A 1Z7LA 3L1PA 3W6VA 3KZYA 4DYQA 3GW2A 1XG1A 3WU0A 4EJTA 4NHJA 4D9JA 4HX7A 5D8LB 4CYCA 3FXJA 2GZWA 1BR4A 5IYDJ 5A2QK 1E3PA 2CQKA 2Y48A 4P1WA 4OIOF 1DP7P 3DU6A 4XLAA 2K9NA 3U21A 1IW7F 6PAXA 4X1EA 1Z7UA 3WTVC 4GCVA 1MBKA 2X4HA 1QZYA 2TDXA 1F43A 2CQXA 1T33A 3TDZC 5DD8A 2JQ7A 4ZDLA 1G3SA 4JQFA 1ZRFA 1YQAA 2F5DA 2OC6A 3KP3A 3M8FA 2D45A 5LFAA 2B63J 3DEEA 5D4SA 1PYVA 2JJ7A 3HDDA 2LVSA 2ZJQF 3S1RJ 2K85A 4RB1A 2XGDA 2Y75A 1ZN2A 1EKEA 2W1OA 2K7LA 3DQVC 4ENMA 3I59B 3ZQFA 1JKPC 3DPTA 3CQZJ 3QRFF 3BTJA 3HRUA 1SD6A 5EJCA 2XKPA 1MH4A 3HIFA 4G7OF 3K1NA 4HSRA 1RPWA 3KEOA 1LFUP 5EGOA 1E0EA 1XN7A 1U9NA 2CJJA 4G94A 2LFBA 1ETOA 4RM2A 3CCVI 2X48A 2QQBA 2NOGA 3FF5A 2KHMA 2DCEA 3ZQHA 4FTHA 1W1WE 1A31A 3CD6I 1E3OC 5HVQC 1SAUA 2VUMJ 2AQEA 4FE7A 3OYCA 3LSIA 4CSWA 5FLVA 2EV5A 1P2FA 2X1DA 5E17F 5KNLA 1TW3A 2Y2ZA 3EYYA 1AWCA 3EQLF 1P4WA 1ZELA 4JX5A 1A5JA 2NRAC 5F0FA 5BQTA 2EH3A 2L9NA 1G59A 2XSJC 2CV2A 4LOCA 2Y9YA 4QPQA 2YSRA 2RC4A 2IS1A 5C3EJ 1USTA 3K4KA 1LVAA 1UMQA 2O03A 4HV5A 5TJJA 2R93J 3OR1C 2X1EA 5HS7A 2EPFA 2IA2A 2LR8A 4EJWA 3AG4H 5KVRA 5IOZA 5DCFA 4OOIA 2CFXA 2ACJA 3DTEA 4UVCA 3HG9A 1K6YA 3L2QA 4E7IA 1Z05A 3KP5A 2XB5A 3TP0A 3F23A 1I3QJ 4P5OA 5F04A 1XPXA 1HDDC 4AM3A 3L9FA 1SVMA 4ON0A 1DPUA 1K78A 3GEZA 2LBFB 1D3YA 3ASOH 4WXCA 3S2DJ 2KIMA 4CUGA 2VOPA 2PBIA 2RN7A 1TWAJ 2EA2A 2W24A 4L5EA 5M5XJ 2M7AA 3HOWJ 1ZAOA 3A4CA 2EWNA 3B73A 2P4WA 2VQCA 4MIMA 3JRFA 1RKTA 5DEQA 2M0MA 3FBIB 5ICEA 2FSWA 1JTXA 4M74A 1C0WA 1P4XA 3DF8A 2YUSA 4D7MA 3I58A 4P9FA 3LSJA 1J7KA 4BKXA 5C4JJ 3FX3A 1DQUA 3M9AA 2BEOA 3BZCA 4RA2A 2P5LC 1AU7A 5KHDA 1GDTA 3DBLB 3WHCA 3CDLA 3EPZA 4FETA 1FBUA 4IOCF 2ECBA 4IHSA 3PL8A 4DZJA 4XORA 3GVAA 4UNOA 2EFOA 4A6EA 3OYAA 3WU1B 3MMYB 5DV5A 2NS8A 4AU7A 3HTSB 2ELJA 2A61A 3DPLC 1HLVA 1Y8RB 2A07F 5L3GA 4YFXF 2IGNA 2FNPA 2LC2A 5FD6A 3FIWA 5HNFA 2DA4A 4NQWB 5KCMA 3B6AA 3KYLA 3I71A 4HYEA 1RRJA 2UUZA 4PGGA 4O5VA 2NVYJ 3G73A 1JT6A 2CU7A 3ONQA 3TBIA 4WWCA 1BJZA 4PFOA 3ABMH 3LSHA 2UWMA 1S7EA 2CW7A 4P55A 4EVIA 1BL0A 2MBFA 4D5CA 4MEXF 2GWRA 3VYSB 1BIBA 1R1TA 1X4OA 2BVMA 2JPCA 1NK3P 2QBYA 2X6XA 2VXZA 1TQMA 1NH3A 2QWWA 1Y0NA 2Y69H 4U7BA 4JP0A 2DFIA 4FASD 5JHFA 5CPRB 3MKWB 1X19A 5E8IA 3K10A 4CZZA 3OYIA 4UB6C 4PSXA 3H3UA 3FBNB 3K70C 3SEQA 3RIRA 3TEDA 2UV1A 2V1UA 1YOVB 5LRRA 2HDCA 3F8MA 2VL8A 3B02A 1R49A 3MAJA 2VXDA 2E1CA 2ZXIA 3J7AO 1IJWC 1H9GA 3NWTA 2VBZA 4IRGA 1LKXA 3GFLA 3J7ZI 2VODA 1O4XA 1UZCA 4G8XA 3G4SI 2M0CA 1T08B 4ZYHA 2OAZA 3BG3A 4JK1X 1Z21A 5FD5A 2DFHA 1ZGWA 5J8CA 3OYKA 5AONA 4ENKA 1FSEA 1RI7A 2ZFUA 4BXFA 5HDNA 2KZVA 4FISA 1IV6A 2R7WA 3N97A 2TCTA 3BTIA 3HGGA 3AKZA 1YE9A 4CCKA 2CQNA 4B47A 2M5WA 4BJTA 5M3FJ 1X1BA 3V7SA 5HS9A 2WV0A 4M6XA 1YI2I 4BACA 2ZMEC 3QWLA 2FQ3A 5BS6A 4XBFA 1IN8A 3CUQB 3K4JA 5BPIA 3E97A 1OYWA 3HBLA 3GO5A 4KT5C 4A6DA 4WK8F 1S9HA 2Q2EB 3I53A 1MD0A 2K27A 1ETYA 3L09A 4NUBA 1G3TA 3J7YJ 1JGGA 3E5XA 2AXTC 1G2HA 4K2EA 3PNVA 5C4XJ 3HTUA 1B9MA 3HEFA 2KISA 4HEA2 3DTKA 1BM9A 2QENA 5JI6A 1Y0UA 3MQ0A 5EYRA 2RDPA 2GAUA 3KEQA 3OIPA 4FQGA 3GF2A 4UVBA 5HLHA 2ESHA 4MEYF 4IHXA 2H6CA 2KRHA 1ZLJA 3DEWA 2CG4A 1HW2A 1R1VA 1L3LA 3C2BA 1R5HA 1KQ0A 3KPHA 1SMYF 4PJMA 1B72B 1X3ZB 2OCCH 4L0YB 4XLEA 4XLHA 1CF7A 4GDFA 3JRCA 1OMIA 2DOAA 3DP7A 1FX7A 4WF2A 3S1QJ 2IS6A 4KICA 3PUBA 1W36C 5JFRA 1Y1VJ 3DWLE 3HUGB 1T8IA 1TTYA 3H35A 2DQRA 1YITI 1QO0D 3OYEA 1IUYA 2V79A 4AWXB 4M6YA 5GPCA 3M3YJ 2FXAA 1OCRH 3O8GA 5K7FA 5CQEA 2ZC2A 2CWEA 1HCRA 1T0FA 1U5TA 5L3EA 5E79C 1G8XA 3V7CA 2EQRA 3FXQA 3EUKL 4OU0A 4GGGA 2HKXA 2Z99A 3DBRB 3VPRA 1WH7A 3K4BA 4IRIA 1FWZA 4M3GA 1B59A 1SMTA 2DN0A 2KPMA 4B48A 3E7LA 4LIVA 2FBHA 1FYLA 1XGMA 5J1UA 2R7UA 1N78A 3A0HC 4IHYA 1LEBA 4NQWA 3NWSA 2WV1A 4N9IA 1D0ZA 5EF6A 2X0LA 4XMYA 1F5TA 1I6XA 4HA8A 2E2HJ 3JREA 1GXPA 1LNWA 2WADA 3KP4A 3F6VA 2E1MC 4CCOA 4F55A 2CS3A 2R5YA 4ZYAA 3ZGKA 1WI9A 1B8IB 4JOMA 3L00A 4II2A 2VBXA 1AA7A 3LWFA 3Q0VA 3LSMA 2QKMB 4RDUA 3RCOA 4E7JA 2QBYB 3LAPA 2ZJRF 4RGRA 2HQRA 5E8GA 4XL9A 3X2QH 1UJ8A 3WG9A 3QOPA 3DLLF 3AG3H 3KYCB 2DLLA 2RAEA 2WWYA 1I5ZA 2V9KA 5LEKA 3LL7A 2E7XA 2R7TA 2EV0A 2M34A 2ZBKA 3A1YA 4MQVA 4BU2A 3ZN0A 1ETQA 2DDBA 3HHHA 2K86A 4S05A 2K4JA 2CUZA 2DMNA 2RQQA 3EUHA 1D5YA 1GLNA 1IG7A 2BVLA 5LEJA 2F4OB 4GXOA 4HDVA 2RV8A 4KISA 4RLQA 3P9CA 3EUAA 3K1PA 1R4MB 2E60A 2BV6A 1QA6A 1MW7A 4Q47A 2QQ8A 1Z0XA 2DK5A 2QQ9A 1J59A 1GUUA 1HW1A 4I98B 3BLYA 5F27A 2AHQA 5TISC 1PJRA 3GTPJ 2MW8A 2FD5A 1BI3A 2ZXHA 1W0TA 3RI4A 4GRIA 2MH2A 3D1NI 3JRBA 1AKHA 1R5ID 3NEUA 1XMKA 4U0YA 1SD4A 1S5LC 2GOMA 2PG4A 4J19A 3TKYA 1F1ZA 1JUMA 1RUNA 3C1DA 2FOWA 4F3QA 2RQPA 2KZGA 1ZHFA 3OYJA 4ZTFA 5HODA 4EATA 2VC0A 2L54A 2XGEA 5IP9J 2EV6A 3OOPA 2R0QC 5HNHA 1VQ8I 1HDPA 3KZIC 4XK4A 4F91B 2HFHA 3H5AA 2R92J 2M2EA 1V55H 5EZGA 4BXUA 3LMMA 3CJRB 4HF2A 1YJ9I 2HKOA 4RAYA 3GXOA 2E7WA 4Y3OA 3WGIA 3FDYA 4A3DJ 2VKDA 3CP8A 2R7SA 2FMYA 3B6CA 3BR3A 5K7ZA 4A93J 1T95A 1O3TA 1BW6A 4G6QA 2QCOA 2H09A 1WJ5A 1N75A 2DW4A 1O3RA 4MGRA 4EV0A 4CA0A 5IT3A 2OJED 2VJJA 1P7JA 4G9YA 2Y9ZA 1K4SA 1P9QC 2MC4A 2NS0A 2W4SA 4XLCA 4EMSA 3V8JA 2K4BA 4M9ZA 4HLXA 5K1YA 2E5NA 2XB0X 3CC7I 3CF5F 3OSFA 1A35A 3PNYA 1HOMA 3CJTB 2AXLA 1ULYA 2E71A 2XUBA 4ITVA 2HDWA 3I59A 1KU2A 1ACIA 5H6RA 3FK7A 3R4KA 2UZKA 1ITYA 5J3LA 4U88A 1YO5C 2R7OA 3J81Z 5D5VB 2BOLA 2WTEA 2VOOA 1XSXA 2IP2A 3JTHA 3LNQA 3G3ZA 4JYKA 4YIIA 2V26A 1LUJB 3K2AA 1VQMI 3JRDA 4J01A 2O3FA 5EGOB 3OYLA 2QZ8A 1QBJA 2K9QA 1OCOH 1K79A 1LDJA 4ZZDA 2DYSH 2LP0A 3DEUA 3ZQLA 1ETKA 5JVTA 3ESWB 2BBYA 2R7ZJ 2L9RA 2VJ4A 3IAS2 3F22A 2F2EA 3F8NA 2F5FA 1W36D 1IGNA 3ERMA 4CO8A 5H6QA 1RKWA 5F1JA 1IRZA 1U0JA 1OYIA 5EEGA 4MHGA 1ZR2A 2JUGA 3I3LA 3KP2A 1KONA 4HNVA 3GCMA 3G1MA 1FLIA 2K5CA 2EINH 2M7BA 3VSKA 4CYCB 4UUSB 2Z9OA 1MDMB 1YJWI 4A3EJ 4QLCU 4EGYA 3QODA 4PJLA 1FYMA 2WAQA 2YX4A 3WE2A 3BQZA 1SVOA 2M9HA 3H9QA 3ELKA 3OYBA 1KU3A 1ZLKA 4Y17A 4BH9A 3L2VA 2IGMA 2MA3A 3AAFA 2ZFWA 2XPUA 5A2QZ 1OCZH 2ID3A 2F6CA 2YU3A 3PQKA 3WTTC 3K69A 5DS9A 3KCCA 2W00A 3TO9A 5K5RA 4IOAF 2H27A 2X85A 4CGZA 1YG2A 2K9SA 2VPLA 3OY9A 3CO7C 3CCLI 4BY1J 4MTDA 1QHGA 1XGSA 2KJCA 4LJZF 1DU0A 4A3MJ 3I4PA 2BHYA 3PFYA 3OV8A 1VQLI 2X6YA 2FBKA 1UHWA 2Y31A 3OS2A 4BE0A 2EIKH 1IUFA 2F48A 2K3FA 2IBDA 5IP6A 4KMUX 5JLXA 4AVZA 4L5IA 4CH7A 4CDGA 2AQFA 3M8EA 4A3GJ 4M6VA 3DLAA 1WJAA 4YIFA 1G6NA 3CESA 3TO7A 3GX4X 1D8KA 2Z5UA 3SHFA 2HYJA 3BJOA 2OTLI 4A3FJ 5L3FA 1KA8A 4EM1A 1IXSB 1HKQA 1TQIA 2NOJB 2ZO4A 4LK1F 1IF1A 3NRVA 3BJAA 3QU3A 2QEXI 1QZEA 1OCCH 1MNEA 4S0HB 2GA1A 4CCMA 3ISPA 1IDYA 3F3XA 1TWGJ 2MC3A 3BG6A 1JKOC 1Z1DA 1Z6RA 1VQ4I 2WAEA 1LDKB 4A0YA 4L18B 2VASA 1Z3XA 5M3MJ 2C6YA 1FT9A 1F36A 2WY7Q 3LAJA 3QPTA 2A05A 2L4MA 4EQQA 3K0LA 4F92B 1FBSA 1QRYA 2DA1A 3H3ZA 4I0BA 4N9HA 2P7VB 3S3OA 4KIBA 2CV1A 1W4MA 1BA5A 2XRNA 4P9UA 4IO9F 5IT9K 2O9LA 4H4KC 1D5VA 4BHCA 5LBQA 1ZG5A 2OU2A 1FNNA 4RB0A 3E3VA 3VB2A 3VSLA 1Z91A 2XKOA 2KQRA 1O3QA 1JJ6C 1Z3YA 3JRAA 1XX5A 3H3VK 3ASNH 3QPHA 2ETHA 2P5VA 2XRLA 3MEXA 4U87A 5GPAA 1OYYA 4BHBA 1S29A 2VE9A 1VQKI 4HQEA 1S8NA 3BR1A 2VONA 5DUKA 1I50J 2COBA 4M9SA 1ZR4A 1MBGA 1VZ0A 1MSEC 1K78B 1JHHA 2M4KA 1WJCA 3BR0A 3HKZN 2DODA 2G0EA 1FJLA 2M1BA 3ML6A 3CMAI 2B9SA 5KK1A 4FHTA 3ERED 1JTYA 2MGQA 1POGA 5J4VA 2FRHA 4A5NA 5IT9Z 1ZG1A 1BOAA 1R4NB 3I64A 5DCMA 3LQRA 4MFDA 2Z2SB 5FKLA 3WGHA 3TW6A 2VE8A 1F4KA 2JK3A 4GYIA 2E1MB 2QA4I 1EH6A 1R9TJ 3H5RA 1HSTA 5F0CA 2DAOA 2ZKZA 4CYDA 2MABA 1T2KA 3IKTA 2HNHA 1FSHA 3CJQB 5DUIA 1RR8C 3HKZA 5CJ9A 3ZOBA 3REOA 3K4MA 2JA7J 4KUMA 4XM3A 4Q4ZF 3O2PE 4N4NB 2O61A 4B4CA 2D2WA 3MWMA 2DOEA 1BI1A 2EFQA 5DD4A 3CLQA 4UUSA 3HSEA 5LRSA 4GFBA 3HB9A 2M30A 3SYTA 3BCBA 5ERIA 3P7NA 4ZZLA 5D8KB 1XCBA 3K1MA 3MKLA 2XF7A 2VIXA 1FIPA 1P92A 4NC8A 1X2MA 4XOTA 2DA3A 4I99C 5GAHJ 9ANTA 2PJPA 2ZB9A 2EFWA 3GLXA 4PCQA 5TGTA 4Y7NJ 3ROUA 1W0UA 2HOSA 4MQ9F 4V2FA 4Z2YA 5EG0B 4I6ZA 5FROA 4C2TA 1WJEA 2Q2EA 3F21A 1I6HJ 1DGRM 3D5SC 1WKMA 3PUFA 2JSCA 1VQ6I 1I1GA 2FX0A 1EV7A 3OL3A 5BPDA 2JWTA 1VQOI 3L7WA 4PJNA 4C2MJ 5FKKA 2DO7A 1PUFB 2EK5A 2OZ6A 4XLFA 4NC6A 4XRMA 4UHTA 4XLPF 3R60A 4EJOA 3J80Z 1LEAA 4DZPA 1MMGA 3CTAA 4LLGF 1Y1WJ 3H5NA 1SD7A 2AO9A 4LGWA 4YEJA 3NQOA 2IW5A 2O8KA 4OAZA 2IA1A 5ICCA 3JSPA 1RNLA 3KYDB 2KKOA 3ULQB 1LDDA 3MKZA 4I02A 1W5TA 1LQ1A 3COAC 3OIQA 3A03A 4Q48A 1TT5B 1TT0A 2R5ZA 4BDZA 4E7SA 3BDDA 4IX7A 4C3HJ 4KA4A 2P5KA 3C3WA 2VQLA 2DMQA 1T38A 1E3HA 3OYMA 1YIJI 5FKMA 2XAFA 4RGUA 3AG2H 1DDNA 1ZRDA 2WY8Q 5FKNA 5DM6F 1MIJA 4EJVA 3OYNA 1NTCA 1J75A 2FUG2 5E3MA 1S3JA 3H92A 3HUGA 2R7QA 3MVPA 3Q9VA 4BJ6C 4XSXF 2ZSHB 3KEYA 4XIDA 1D1CA 2XHKA 1W7PA 2VT3A 2V1NA 2ID6A 3CZ6A 3F9KA 3HYIA 4EEFG 5M5YJ 2QSFX 3BCAA 1ZYRF 4YIRX 2A5WA 5EEAA 3H36A 1IN5A 4XICA 2W57A 4YELA 2QLZA 4M3FA 3GUDA 3CO6C 1YJNI 2L9SA 2XPVA 2JVGA 2H8RA 2B7EA 5F1RA 1CGPA 3RKWA 2CRGA 1K7AA 3M07A 1OR7C 2O0YA 3M1EA 2HR3A 1EA3A 2LK2A 3DKWA 5E1XA 2NVTJ 2R5YB 2EILH 3WTZA 2PLYA 1G3YA 3AL0C 3LFUA 5K5OA 4AIKA 2DT6A 4KT6A 1Y8QB 2FA5A 3C2GA 2LRDA 2VBYA 3JW4A 1O57A 3LSKA 3ZMDA 4M71A 3ZRGA 5K7HA 1SFOJ 1VNDA 4BE2A 2XVCA 5F08A 2LH9A 3LA2A 4QSHA 2IVMA 2OZUA 2KL4A 3WTWC 3F8FA 4DJAA 3TL4X 1JUSA 3K7AJ 3CMYA 2W84A 1KGSA 2ZMEB 4KYWA 1B72A 2V6EA 2DXIA 5D4RA 1S72I 1ZARA 3DCFA 3QAHA 1UG0A 1GVJA 1TNTA 3IH4A 3I54A 1VQPI 1BC7C 4DOZA 3W3CA 3FZVA 2W25A 2P81A 2Y0MA 5BMZA 3DKYA 4M3EA 3VYUB 1XGNA 5CVIA 2CUEA 1WHUA 1Y56A 1HBXG 3EETA 3GZNB 5IOYA 2DPDA 3N4MA 2DDAA 3D5RC 5K5QA 1BC8C 3RJPA 1XB4A 2D1VA 2HOEA 1OCTC 2H6BA 4BY7J 1ORKA 5JHUA 3RPUD 2RNGA 1MBJA 5E1ZB 2L02A 4KIGA 2XGXA 4UUVA 5CQGA 4ASNA 1OQYA 5J47A 2GM4A 1VTNC 3W6KB 1QZZA 1ON1A 4R79A 1R00A 2HQNA 3KP6A 2MLKA 2G7UA 3CDHA 2GXAA 3BG7A 2OCEA 4D5FA 4E7KA 2WB1N 2RKHA 1D0XA 3DTIA 1OFCX 1Z6TA 3BR2A 4HDUA 1G4DA 3IH3A 1NG7A 4EM2A 2L9VA 1RC9A 4UVAA 4X6AJ 3ZR8X 1X3UA 2V4JC 3SZPA 3HPGA 2R7DA 2EIMH 1APLC 3CJNA 3WU2C 3IP4B 2DA7A 3FM3A 3RYPA 4J00A 2I5UA 1IO2A 1NG6A 1YYVA 4HG2A 4M3DA 1WQ2A 2BXYA 4A0ZA 1FOKA 4AUXA 2L2OA 2ICWG 4RAZA 4LG3A 1Z9CA 3E6DA 2NVQJ 2HVRA 1LJ9A 1IV8A 1Q1HA 3OSGA 2WB1A 1U6GA 4OWRB 3TOBA 1FP1D 1WZ2A 1UG2A 3UR3C 2X6WA 2VJ5A 4W97A 2LSOA 2QM3A 1WWXA 2CW8A 3K4CA 3E6MA 3S32A 4CCLA 4M9XA 3VYTB 2PX9A 1NHAA 4R8HA 3RSNA 3K9TA 1HKSA 2XAHA 5GADJ 1YW9A 4HZFA 3SDBA 4B8XA 2PMZA 4BEHA 3CMMA 4EM0B 4IPAA 3FHZA 5L3CA 3T0YA 1R23A 1FOYA 1WJDA 2XAJA 1X1DA 5FLXZ 4U7DA 1W7PB 2K9MA 3BR5A 1RUOA 2R7VA 1LE8B 5FJ8J 3M8JA 3IH2A 4BHPA 3FWEA 3E0JB 3T5XA 4RBOA 1CF7B 2NXNB 4N0BA 4L0ZB 2VI6A 1VF9A 4OIPF 1QQIA 1SFEA 2Z16A 5F6FA 1DP3A 2JUCA 3S2HJ 2XSDC 3SEZA 2ZJPF 3FMQA 3HOVJ 1X1CA 1SEUA 3OR2C 4LFUA 4ZH4F 1B4AA 2EFPA 2XAQA 1SFKA 3CP2A 3IL2A 5IP7J 5EG0A 4A3BJ 3RZOJ 4ESFA 2KIQA 2F5VA 2FEZA 5HLIA 3GYHX 2LMDA 1FYKA 5GTIC 1ZG3A 2X9DA 1BI0A 4OIRF 2CW0F 1LFPA 3CCRI 4R1HA 2PN6A 4HBLA 4ZDOA 4WX9A 4XKBA 2NAZA 1WRJA 5EEHA 3ZQGA 2FU4A 2G7HA 3V42A 1MBEA 1ZGAA 2HPIA 2HZTA 3OMYA 2JA5J 3FKJA 2NVXJ 1T56A 1GT0C 4XKCA 1HF0A 3SQNA 4KNYA 1S7OA 1SVLA 3ZMUA 2DA6A 3AG1H 1IRXA 5LGNA 2QUFA 2E34A 3F0CA 1QU3A 2MG4A 1FOXA 3TP3A 1IN4A 5B1AH 5J4YA 3CUQA 3AL0B 5CVUA 2Y30A 1TQPA 1Z67A 3RQIA 1OJLA 1OPCA 2L5QA 2XROA 3WTYC 1U8RA 1MBFA 1YX3A 2BXZA 2PFBA 1TLHB 3KE2A 1R1UA 2HOAA 3R0JA 3VYRB 4EJUA 3FMSA 3A02A 4CXFA 3T1BA 3G1LA 3OS0A 2IS4A 4XN3A 5EZHA 1XSVA 1R58A 1PUEE 2DA5A 3CUOA 2O5RA 3HOSA 3IUOA 3KX2A 1WSUA 2E2JJ 3CC4I 4AD9A 2CV0A 2HDDA 3UNGC 4Q5SF 5HLTA 5FKOA 1RETA 3HZJA 4KMFA 5BOXA 3R6SA 3ZCOA 3FHNA 2H1KA 1R7JA 3F72A 2Q1ZB 4XRSG 1XDUA 1LVKA 1MNMC 3PFIA 4I7HA 1USSA 1P6RA 4IF4A 1WGXA 3TMOA 3GFMA 3VODA 2FJ1A 1JUPA 4DQ2A 3QPSA 1H88C 2DBBA 4MO7A 4WCGA 4A3KJ 3GFJA 2CFOA 2L7ZA 2ZXWH 3QQAA 4LG0A 3MFKA 1PVEA
chains in the Genus database with same CATH topology
2ECBA 5EDNA 4DZJA 3BR6A 1QRYA 2DA1A 2DJNA 2FQ4A 1ZKGA 1YRNA 1K83J 2N8GA 1Q1VA 4C3JJ 1BA5A 2NS8A 2O9LA 2YU9J 4DYCA 1HLVA 1H8AC 1WPKA 1H89C 2HXIA 2XGCA 3FIWA 1ZK8A 2DA4A 3PO3J 3B6AA 1JJ6C 2NVYJ 1JT6A 2CU7A 3JRAA 3G1OA 1JKRC 3H3VK 1BJZA 2XRLA 5GPAA 1GV5A 2K40A 3BR1A 1S7EA 1BL0A 1I50J 2COBA 1EF4A 4D5CA 3M4OJ 1ZR4A 1MBGA 5J1RA 3JRIA 1MSEC 3BR0A 3UKGA 2VKVA 1NK3P 3HKZN 2KDZA 2G0EA 1FJLA 2OPTA 1U78A 2D5VA 3QPLA 1FIAA 1JTYA 2MGQA 2JA8J 2E1OA 2HQ5A 1POGA 3GBGA 3ZQIA 4JP0A 2JMWA 2JA6J 2I10A 1GV2A 4MFDA 1DU6A 5FKLA 1TWCJ 2DMUA 1AKHB 3TW6A 2CUFA 4B1RA 3HOYJ 2JK3A 1QPIA 2X6OA 1UHSA 3TEDA 1R9TJ 4A3CJ 5F0CA 4W1UA 1IC8A 4MFEA 2QF7A 1WI3A 4QTRA 3JRGA 1IJWC 1TWFJ 4M3BA 3ZOBA 2JA7J 1X58A 1O4XA 5E3NA 2M0CA 4B4CA 1TWHJ 3BG3A 1ZGWA 4UUSA 3HOUJ 3PO2J 2VPRA 1U9OA 2DA2A 4GFBA 4B3AA 3HB9A 1FEXA 4BXXJ 4FISA 1IV6A 3MKLA 1FIPA 2LLKA 2TCTA 1X2MA 3BTIA 2DA3A 3HGGA 3NAUA 9ANTA 2ZB9A 5M3FJ 4Y7NJ 3LOCA 2LD5A 1W0UA 2HOSA 4V2FA 5EG0B 4I6ZA 5GP9A 4MLOA 1JJ8C 1I6HJ 4A3LJ 3HBLA 3GTJJ 1BW5A 2FX0A 3HOXJ 1ETYA 4A69C 1JGGA 2YS9A 2OF7A 1G2HA 2Y0SN 2JWTA 5C4XJ 4C2MJ 3HEFA 5FKKA 3Q0WA 2DMTA 2IAIA 3LSGA 1PUFB 3S1NJ 4XRMA 5EYRA 5FLMJ 1PUFA 3PM1A 4DZPA 1Y1WJ 2AO9A 2L7FP 4IHXA 1K61A 3DEWA 2O8KA 1ETXA 4NDLA 2JN6A 3S15J 3C2BA 4I76A 1A6IA 3A03A 2R5ZA 1B72B 4C3IJ 4C3HJ 3JRCA 2DTZA 3I4NJ 2DMQA 3S1QJ 5FKMA 4FCYA 1Y1VJ 3JRHA 5J1YA 2W48A 4AC0A 5FKNA 1XC5A 1NTCA 3GTOJ 5E3MA 5GPCA 3MVPA 3M3YJ 4XIDA 3O8GA 5K7FA 5M5YJ 2ID6A 4EEFG 1HCRA 2GLOA 1YRNB 3SDGA 2EQRA 5EEAA 1QVUA 3VPRA 1WH7A 2O7OA 4XICA 1QVTA 3IV5A 3SFIA 4M3GA 4M3FA 2DN0A 3BT9A 3LSRA 2XPVA 1WCMJ 3E7LA 1VI0A 2EZLA 1CQTA 2H8RA 5J1UA 2PMZN 2CRGA 4IHYA 1RESA 3OIOA 3H0GJ 2WV1A 1WH5A 2LK2A 2ME0A 3MN2A 5EF6A 2NVTJ 2GBYA 2HXOA 2R5YB 1XS9A 2EBIA 3CCYA 2E2HJ 3JREA 2DMPA 3O8HA 2R5YA 1B8IB 2VKEA 4XRSA 5K7HA 1SFOJ 1JT0A 1VNDA 2TRTA 3Q0VA 3S16J 5F08A 2EZIA 4QSHA 4RDUA 4DYRA 3RZDJ 5BNGA 5JLWA 3FISA 2RAEA 1ETWA 1JKQC 1JUSA 3K7AJ 3CMYA 2E19A 3FKIJ 2M34A 1LFBA 2R5ZB 4BBSJ 1B72A 1ETQA 4FE4A 2HI3A 2ME6A 1ETVA 3LSPA 2DMNA 1D5YA 3DCFA 1IG7A 4G12A 4AYBN 3BG9A 2IEKA 3IH4A 5IYCJ 3HGYA 1OCPA 2P81A 1GVDA 4M3EA 2HOTA 2CUEA 5E3OA 1Z0XA 2M8GX 2WAQN 1GUUA 5C44J 5IOYA 4ABZA 5F27A 2AHQA 3RKQA 1ZTRA 3GTPJ 2MW8A 2FD5A 3BTLA 3A01B 5IPAA 1W0TA 1OCTC 3D1NI 3JRBA 1AKHA 3BG5A 4IHWA 3A01A 4Y52J 4BY7J 1ORKA 4J19A 1ENHA 1RR7A 2LKXA 2EZHA 1JUMA 1MBJA 2ELKA 3S14J 3OOUA 3I4MJ 2CQQA 3Q3SA 3TW7A 5M5WJ 2GM4A 2LTPA 1MBHA 3JR9A 5HODA 1X2NA 2XGEA 5IP9J 5DTDA 2R0QC 1HDPA 1FTTA 4XK4A 2MSYA 4D5FA 2WB1N 3SJMA 2R92J 1OFCX 2M2EA 3BR2A 3IH3A 5EZGA 3L1PA 3W6VA 1Z77A 4DYQA 4X6AJ 1XG1A 1APLC 3ZQCA 4CYCA 4A3DJ 3GTLJ 2DA7A 5IYDJ 4BBRJ 3B6CA 3BR3A 5K7ZA 4A93J 3BQYA 4JX6A 4A3IJ 1BW6A 1AHDP 3GTMJ 2XPWA 4M3DA 2K9NA 2QCOA 4AUXA 4X1EA 4V2GA 3GTGJ 2NVQJ 5F0HA 1MBKA 1P7JA 3OSGA 3S1MJ 2Y9ZA 1F43A 2CQXA 1T33A 2L7MP 1UG2A 2XB0X 2NS7A 4W97A 3GTKJ 1ZQ3P 3OSFA 1HOMA 2B63J 2JJ7A 3HDDA 2LVSA 5E3LA 3BTCA 3S1RJ 3FK7A 2XGDA 1ITYA 5J3LA 2KT0A 3LNQA 3ZQFA 4JYKA 1LE8A 1JKPC 3K2AA 4JX4A 3CQZJ 3JRDA 3BR5A 3BTJA 5EGOB 1LE8B 5FJ8J 1MH4A 3IH2A 2LY9A 2K9QA 1RPWA 4RBOA 1LFUP 5EGOA 2VI6A 1U9NA 2CJJA 1VF9A 2LP0A 3ZQLA 2LFBA 1ETOA 1ETKA 3S2HJ 2X48A 2XSDC 2NOGA 2E2IJ 2R7ZJ 3HOVJ 2L9RA 3ZQHA 4FTHA 1IGNA 5IP7J 3Q0UA 5EG0A 1RKWA 5F1JA 4A3BJ 1IRZA 1E3OC 3RZOJ 1ZR2A 3HM5A 2VUMJ 4HNVA 4FE7A 3G1MA 2X9DA 4CYCB 1B8IA 4UUSB 4IEJA 4A3EJ 5FLVA 3BQZA 5IYBJ 2M9HA 3ZQGA 2Y2ZA 3NARA 1MBEA 2ECCA 4JX5A 1A5JA 2XPUA 5F0FA 2EH3A 1FTZA 2ID3A 2EZKA 2JA5J 2NVXJ 1T56A 1GT0C 1HF0A 4LOCA 4UUTA 4DW6A 2Y9YA 5DS9A 3HOZJ 2DA6A 4A3JJ 3F0CA 5C3EJ 2MG4A 1UMQA 1MSFC 3TP3A 2K9SA 2R93J 2Y30A 4BY1J 1NK2P 1SANA 2LR8A 5IOZA 3RQIA 1OJLA 1DU0A 4A3MJ 1MBFA 4IHVA 1IDZA 2HOAA 3A02A 4QIWN 2XB5A 3TP0A 1HDDC 1I3QJ 5F04A 2Y31A 3WHBA 1IUFA 3G1LA 5IP6A 2IBDA 5JLXA 5EZHA 4D7NA 1VFCA 3S2DJ 3FK6A 2DA5A 4A3GJ 4M6VA 1TWAJ 2E2JJ 4L5EA 5M5XJ 2HDDA 3HOWJ 1U8BA 2HYJA 5FKOA 4A3FJ 1RETA 2L0KA 4MIMA 3JRFA 1RKTA 1MH3A 2H1KA 1JTXA 3S17J 4XRSG 4S0HB 1MNMC 2YUSA 3GTQJ 4D7MA 1IDYA 1TWGJ 1WGXA 3LSJA 4BKXA 5C4JJ 2FJ1A 1JUPA 1JKOC 3QPSA 1H88C 1AU7A 4MO7A 1GDTA 3WHCA 4A3KJ 2L7ZA 5M3MJ 3QQAA 3CDLA 1F36A 1TC3C 1P7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECB A;  5EDN A;  4DZJ A;  3BR6 A;  1QRY A;  2DA1 A;  2DJN A;  2FQ4 A;  1ZKG A;  1YRN A;  1K83 J;  2N8G A;  1Q1V A;  4C3J J;  1BA5 A;  2NS8 A;  2O9L A;  2YU9 J;  4DYC A;  1HLV A;  1H8A C;  1WPK A;  1H89 C;  2HXI A;  2XGC A;  3FIW A;  1ZK8 A;  2DA4 A;  3PO3 J;  3B6A A;  1JJ6 C;  2NVY J;  1JT6 A;  2CU7 A;  3JRA A;  3G1O A;  1JKR C;  3H3V K;  1BJZ A;  2XRL A;  5GPA A;  1GV5 A;  2K40 A;  3BR1 A;  1S7E A;  1BL0 A;  1I50 J;  2COB A;  1EF4 A;  4D5C A;  3M4O J;  1ZR4 A;  1MBG A;  5J1R A;  3JRI A;  1MSE C;  3BR0 A;  3UKG A;  2VKV A;  1NK3 P;  3HKZ N;  2KDZ A;  2G0E A;  1FJL A;  2OPT A;  1U78 A;  2D5V A;  3QPL A;  1FIA A;  1JTY A;  2MGQ A;  2JA8 J;  2E1O A;  2HQ5 A;  1POG A;  3GBG A;  3ZQI A;  4JP0 A;  2JMW A;  2JA6 J;  2I10 A;  1GV2 A;  4MFD A;  1DU6 A;  5FKL A;  1TWC J;  2DMU A;  1AKH B;  3TW6 A;  2CUF A;  4B1R A;  3HOY J;  2JK3 A;  1QPI A;  2X6O A;  1UHS A;  3TED A;  1R9T J;  4A3C J;  5F0C A;  4W1U A;  1IC8 A;  4MFE A;  2QF7 A;  1WI3 A;  4QTR A;  3JRG A;  1IJW C;  1TWF J;  4M3B A;  3ZOB A;  2JA7 J;  1X58 A;  1O4X A;  5E3N A;  2M0C A;  4B4C A;  1TWH J;  3BG3 A;  1ZGW A;  4UUS A;  3HOU J;  3PO2 J;  2VPR A;  1U9O A;  2DA2 A;  4GFB A;  4B3A A;  3HB9 A;  1FEX A;  4BXX J;  4FIS A;  1IV6 A;  3MKL A;  1FIP A;  2LLK A;  2TCT A;  1X2M A;  3BTI A;  2DA3 A;  3HGG A;  3NAU A;  9ANT A;  2ZB9 A;  5M3F J;  4Y7N J;  3LOC A;  2LD5 A;  1W0U A;  2HOS A;  4V2F A;  5EG0 B;  4I6Z A;  5GP9 A;  4MLO A;  1JJ8 C;  1I6H J;  4A3L J;  3HBL A;  3GTJ J;  1BW5 A;  2FX0 A;  3HOX J;  1ETY A;  4A69 C;  1JGG A;  2YS9 A;  2OF7 A;  1G2H A;  2Y0S N;  2JWT A;  5C4X J;  4C2M J;  3HEF A;  5FKK A;  3Q0W A;  2DMT A;  2IAI A;  3LSG A;  1PUF B;  3S1N J;  4XRM A;  5EYR A;  5FLM J;  1PUF A;  3PM1 A;  4DZP A;  1Y1W J;  2AO9 A;  2L7F P;  4IHX A;  1K61 A;  3DEW A;  2O8K A;  1ETX A;  4NDL A;  2JN6 A;  3S15 J;  3C2B A;  4I76 A;  1A6I A;  3A03 A;  2R5Z A;  1B72 B;  4C3I J;  4C3H J;  3JRC A;  2DTZ A;  3I4N J;  2DMQ A;  3S1Q J;  5FKM A;  4FCY A;  1Y1V J;  3JRH A;  5J1Y A;  2W48 A;  4AC0 A;  5FKN A;  1XC5 A;  1NTC A;  3GTO J;  5E3M A;  5GPC A;  3MVP A;  3M3Y J;  4XID A;  3O8G A;  5K7F A;  5M5Y J;  2ID6 A;  4EEF G;  1HCR A;  2GLO A;  1YRN B;  3SDG A;  2EQR A;  5EEA A;  1QVU A;  3VPR A;  1WH7 A;  2O7O A;  4XIC A;  1QVT A;  3IV5 A;  3SFI A;  4M3G A;  4M3F A;  2DN0 A;  3BT9 A;  3LSR A;  2XPV A;  1WCM J;  3E7L A;  1VI0 A;  2EZL A;  1CQT A;  2H8R A;  5J1U A;  2PMZ N;  2CRG A;  4IHY A;  1RES A;  3OIO A;  3H0G J;  2WV1 A;  1WH5 A;  2LK2 A;  2ME0 A;  3MN2 A;  5EF6 A;  2NVT J;  2GBY A;  2HXO A;  2R5Y B;  1XS9 A;  2EBI A;  3CCY A;  2E2H J;  3JRE A;  2DMP A;  3O8H A;  2R5Y A;  1B8I B;  2VKE A;  4XRS A;  5K7H A;  1SFO J;  1JT0 A;  1VND A;  2TRT A;  3Q0V A;  3S16 J;  5F08 A;  2EZI A;  4QSH A;  4RDU A;  4DYR A;  3RZD J;  5BNG A;  5JLW A;  3FIS A;  2RAE A;  1ETW A;  1JKQ C;  1JUS A;  3K7A J;  3CMY A;  2E19 A;  3FKI J;  2M34 A;  1LFB A;  2R5Z B;  4BBS J;  1B72 A;  1ETQ A;  4FE4 A;  2HI3 A;  2ME6 A;  1ETV A;  3LSP A;  2DMN A;  1D5Y A;  3DCF A;  1IG7 A;  4G12 A;  4AYB N;  3BG9 A;  2IEK A;  3IH4 A;  5IYC J;  3HGY A;  1OCP A;  2P81 A;  1GVD A;  4M3E A;  2HOT A;  2CUE A;  5E3O A;  1Z0X A;  2M8G X;  2WAQ N;  1GUU A;  5C44 J;  5IOY A;  4ABZ A;  5F27 A;  2AHQ A;  3RKQ A;  1ZTR A;  3GTP J;  2MW8 A;  2FD5 A;  3BTL A;  3A01 B;  5IPA A;  1W0T A;  1OCT C;  3D1N I;  3JRB A;  1AKH A;  3BG5 A;  4IHW A;  3A01 A;  4Y52 J;  4BY7 J;  1ORK A;  4J19 A;  1ENH A;  1RR7 A;  2LKX A;  2EZH A;  1JUM A;  1MBJ A;  2ELK A;  3S14 J;  3OOU A;  3I4M J;  2CQQ A;  3Q3S A;  3TW7 A;  5M5W J;  2GM4 A;  2LTP A;  1MBH A;  3JR9 A;  5HOD A;  1X2N A;  2XGE A;  5IP9 J;  5DTD A;  2R0Q C;  1HDP A;  1FTT A;  4XK4 A;  2MSY A;  4D5F A;  2WB1 N;  3SJM A;  2R92 J;  1OFC X;  2M2E A;  3BR2 A;  3IH3 A;  5EZG A;  3L1P A;  3W6V A;  1Z77 A;  4DYQ A;  4X6A J;  1XG1 A;  1APL C;  3ZQC A;  4CYC A;  4A3D J;  3GTL J;  2DA7 A;  5IYD J;  4BBR J;  3B6C A;  3BR3 A;  5K7Z A;  4A93 J;  3BQY A;  4JX6 A;  4A3I J;  1BW6 A;  1AHD P;  3GTM J;  2XPW A;  4M3D A;  2K9N A;  2QCO A;  4AUX A;  4X1E A;  4V2G A;  3GTG J;  2NVQ J;  5F0H A;  1MBK A;  1P7J A;  3OSG A;  3S1M J;  2Y9Z A;  1F43 A;  2CQX A;  1T33 A;  2L7M P;  1UG2 A;  2XB0 X;  2NS7 A;  4W97 A;  3GTK J;  1ZQ3 P;  3OSF A;  1HOM A;  2B63 J;  2JJ7 A;  3HDD A;  2LVS A;  5E3L A;  3BTC A;  3S1R J;  3FK7 A;  2XGD A;  1ITY A;  5J3L A;  2KT0 A;  3LNQ A;  3ZQF A;  4JYK A;  1LE8 A;  1JKP C;  3K2A A;  4JX4 A;  3CQZ J;  3JRD A;  3BR5 A;  3BTJ A;  5EGO B;  1LE8 B;  5FJ8 J;  1MH4 A;  3IH2 A;  2LY9 A;  2K9Q A;  1RPW A;  4RBO A;  1LFU P;  5EGO A;  2VI6 A;  1U9N A;  2CJJ A;  1VF9 A;  2LP0 A;  3ZQL A;  2LFB A;  1ETO A;  1ETK A;  3S2H J;  2X48 A;  2XSD C;  2NOG A;  2E2I J;  2R7Z J;  3HOV J;  2L9R A;  3ZQH A;  4FTH A;  1IGN A;  5IP7 J;  3Q0U A;  5EG0 A;  1RKW A;  5F1J A;  4A3B J;  1IRZ A;  1E3O C;  3RZO J;  1ZR2 A;  3HM5 A;  2VUM J;  4HNV A;  4FE7 A;  3G1M A;  2X9D A;  4CYC B;  1B8I A;  4UUS B;  4IEJ A;  4A3E J;  5FLV A;  3BQZ A;  5IYB J;  2M9H A;  3ZQG A;  2Y2Z A;  3NAR A;  1MBE A;  2ECC A;  4JX5 A;  1A5J A;  2XPU A;  5F0F A;  2EH3 A;  1FTZ A;  2ID3 A;  2EZK A;  2JA5 J;  2NVX J;  1T56 A;  1GT0 C;  1HF0 A;  4LOC A;  4UUT A;  4DW6 A;  2Y9Y A;  5DS9 A;  3HOZ J;  2DA6 A;  4A3J J;  3F0C A;  5C3E J;  2MG4 A;  1UMQ A;  1MSF C;  3TP3 A;  2K9S A;  2R93 J;  2Y30 A;  4BY1 J;  1NK2 P;  1SAN A;  2LR8 A;  5IOZ A;  3RQI A;  1OJL A;  1DU0 A;  4A3M J;  1MBF A;  4IHV A;  1IDZ A;  2HOA A;  3A02 A;  4QIW N;  2XB5 A;  3TP0 A;  1HDD C;  1I3Q J;  5F04 A;  2Y31 A;  3WHB A;  1IUF A;  3G1L A;  5IP6 A;  2IBD A;  5JLX A;  5EZH A;  4D7N A;  1VFC A;  3S2D J;  3FK6 A;  2DA5 A;  4A3G J;  4M6V A;  1TWA J;  2E2J J;  4L5E A;  5M5X J;  2HDD A;  3HOW J;  1U8B A;  2HYJ A;  5FKO A;  4A3F J;  1RET A;  2L0K A;  4MIM A;  3JRF A;  1RKT A;  1MH3 A;  2H1K A;  1JTX A;  3S17 J;  4XRS G;  4S0H B;  1MNM C;  2YUS A;  3GTQ J;  4D7M A;  1IDY A;  1TWG J;  1WGX A;  3LSJ A;  4BKX A;  5C4J J;  2FJ1 A;  1JUP A;  1JKO C;  3QPS A;  1H88 C;  1AU7 A;  4MO7 A;  1GDT A;  3WHC A;  4A3K J;  2L7Z A;  5M3M J;  3QQA A;  3CDL A;  1F36 A;  1TC3 C;  1P7I A; 
#chains in the Genus database with same CATH topology
 2M8E A;  4ZJZ A;  5EDN A;  1BR2 A;  4NNJ A;  2P8T A;  4YG2 F;  3BR6 A;  2V6C A;  2A69 F;  2RRE A;  1YRN A;  3PSI A;  1K83 J;  1Q1V A;  2IPQ X;  2KLO A;  4C3J J;  4PFP A;  5ILU A;  2Z33 A;  2YU9 J;  3KIO A;  3DPU A;  3P5J A;  5HOO A;  1SFU A;  1H8A C;  3P9K A;  1WPK A;  1H89 C;  3O6B B;  1IZ1 A;  2OQR A;  2HXI A;  5D5U B;  3PO3 J;  3IAM 2;  2WBM A;  1TP4 A;  2QQA A;  4HST A;  4XR6 A;  1IXC A;  3S93 A;  1JKR C;  2EB7 A;  3CC2 I;  2L7K A;  4BQA A;  3CCM I;  3HHG A;  2YX7 A;  5CVR A;  1EF4 A;  3PSF A;  1FBQ A;  3M4O J;  2VJI A;  4M72 A;  2H94 A;  3VFZ A;  1XCV A;  2R4G A;  3UKG A;  2VKV A;  2QKL B;  2KDZ A;  1YW8 A;  4PDK A;  1FIA A;  1MZB A;  3BZK A;  2HQ5 A;  3ECO A;  3GBG A;  4GO1 A;  3MCZ A;  3ZQI A;  4DIQ A;  2XC7 A;  2JA6 J;  4XON A;  1YFH A;  2I10 A;  5CKT A;  1GV2 A;  2VB6 A;  2KRF A;  1DU6 A;  2DMU A;  3MKY B;  4O3M A;  4DBQ A;  2CUF A;  1JGS A;  4HQM A;  4B1R A;  3R0A A;  1QPI A;  2X6O A;  5DCM B;  4PJJ A;  5D6F A;  3G6E I;  4E6K G;  1G3W A;  3JAM Z;  1MKM A;  1V54 H;  4A3C J;  2VLA A;  3F6O A;  2OD5 A;  1IC8 A;  1DUX C;  4MFE A;  1WI3 A;  4KIT B;  3KLO A;  4D0P A;  4MNU A;  5GAG J;  2QSH X;  1J0R A;  1YS6 A;  3I56 I;  4LIU A;  2R3S A;  1HSJ A;  2VBW A;  1TWF J;  3PNT A;  1J9I A;  4M3B A;  3DXJ F;  4XOP A;  1X58 A;  1IRF A;  4ESJ A;  1QPM A;  2YPR A;  5TRD A;  4YFN F;  3JTG A;  1ODD A;  1MGT A;  1X3W B;  2GXG A;  3TO6 A;  3HOU J;  2BW3 A;  4IL6 C;  1K6O A;  3QYB A;  2A3S A;  1VQ7 I;  2DA2 A;  3PO2 J;  1QGP A;  4B3A A;  1FEX A;  3EDP A;  3A0B C;  1MMS A;  2F4I A;  2DT7 B;  4LLL A;  5AIP A;  3OYG A;  2MYS A;  5CYV A;  3NAU A;  4ETS A;  2LKP A;  2QGU A;  3L2C A;  5B3S H;  1J2X A;  2F4M B;  4XNF A;  5H20 A;  1QHH D;  4BE1 A;  5GP9 A;  1ZRE A;  1T6S A;  3FXR A;  4BL0 B;  3BPV A;  1JJ8 C;  2ZNY A;  2V9V A;  3ZN1 A;  3RPU A;  1JE8 A;  4A3L J;  3FMR A;  2XV4 S;  3DKX A;  1KYZ A;  3GTJ J;  1AOY A;  1BW5 A;  4A69 C;  2WC2 A;  2YS9 A;  3I55 I;  1FOW A;  2CMP A;  1ZRC A;  3ZMS A;  4II3 A;  4A0X A;  3EUH C;  1MMD A;  2DMT A;  3LSG A;  4BYY A;  2E1N A;  3H1C A;  1FY7 A;  4OMZ A;  2PJR B;  3VWB A;  4G7H F;  3C2H A;  1PUF A;  4Y13 A;  3OYF A;  2KP6 A;  2L7F P;  1ZH5 A;  2HS5 A;  2XAS A;  3E6B A;  1X1A A;  1OLT A;  1ETX A;  4XKW A;  3S15 J;  3DU5 A;  4I76 A;  4ZYE A;  1EH8 A;  2ZME A;  1R22 A;  4U0W A;  5GAE J;  3QP5 A;  2V9P A;  4B43 A;  2NVU B;  3E5U A;  3GLL A;  2JSP A;  5IY5 H;  2MD0 A;  3QU6 A;  1J5Y A;  2IRF G;  2HU9 A;  3G71 I;  5J1Y A;  2W82 A;  3AFH A;  1DPR A;  1XC5 A;  3QYF A;  4HAM A;  3GTO J;  4A5M A;  3KZZ A;  4NB5 A;  4KJZ A;  4M73 A;  2NNY A;  2LYC A;  4PJ0 C;  2A6E F;  3C18 A;  1N25 A;  3SXY A;  4KN7 X;  1IN7 A;  3ZMT A;  2EJR A;  1YRN B;  2RGV A;  1QVU A;  1E2X A;  1MJB A;  4OIN F;  2O7O A;  5E18 F;  1QVT A;  5HLG A;  3BT9 A;  1WCM J;  2EZL A;  1R5G A;  1CQT A;  4N4O B;  2PMZ N;  2LF8 A;  1RES A;  1IN6 A;  2BY2 A;  3HXL A;  4HRI A;  3VOE A;  4BUP A;  3MN2 A;  4IQJ A;  1UEL B;  1YLF A;  3WTU C;  2HXO A;  1R71 A;  4I2O A;  2KJB A;  2EBI A;  1XS9 A;  2F5C A;  2GOX B;  2DMP A;  4PUS A;  3U9G A;  4HX4 A;  3O8H A;  3FXM A;  3Q5F A;  1RZ4 A;  2HQA A;  2VKE A;  2XAU A;  1I1S A;  4A2U A;  2D1H A;  5FRM A;  3S16 J;  2Q0O A;  4PZJ A;  4CCJ A;  1FPQ A;  2EZI A;  1BIA A;  4Y33 A;  4DYR A;  2BZT A;  3ABL H;  4XRF A;  3SZT A;  2PEX A;  4L9N A;  4FT8 A;  1ETW A;  1JI8 A;  3IRQ A;  2HTS A;  5DDG A;  1K4T A;  1JKQ C;  2E19 A;  2EIJ H;  3FKI J;  3HC7 A;  1J09 A;  4L5J A;  5HDK A;  2R5Z B;  4BBS J;  2HI3 A;  4FE4 A;  3E1S A;  2AS5 F;  1V5F A;  2LDU A;  1F9N A;  3FXK A;  5DYM A;  3OYD A;  5LGU A;  3BG9 A;  4G6T B;  3W6J B;  3QP6 A;  3HGY A;  2XF5 A;  2W85 A;  2DTR A;  2PMH A;  1GVD A;  3L2R A;  2HOT A;  2HVS A;  4E7L A;  3W2W A;  3HSR A;  1KU9 A;  1ZTR A;  5E20 A;  4HOB A;  4L9T A;  3ABT A;  3BTL A;  3A01 B;  1P4A A;  2M87 A;  5IPA A;  4ZC3 A;  2CGP A;  1YIO A;  2DU9 A;  5FFX A;  2Z3Y A;  3BG5 A;  1KYW A;  2A6T A;  4IHW A;  2IA0 A;  1BBY A;  3K4L A;  2E36 A;  1KQ9 A;  4XN0 A;  2HEO A;  2LKX A;  2EZH A;  4C2U A;  2OA4 A;  2F5E A;  3V7R A;  3W2A A;  2LF7 A;  3Q3S A;  4RM3 A;  3DV8 A;  1XMA A;  5FGM A;  2FE3 A;  2OQG A;  5M5W J;  3RPQ A;  4BDY A;  2RVC A;  2LTP A;  1MBH A;  3JR9 A;  1X2N A;  1A36 A;  4HW0 A;  2L4A A;  5DTD A;  1BI2 A;  4Z6Y A;  1LB2 A;  1FTT A;  3WTS C;  2MSY A;  2JZY A;  1YTY A;  2J5P A;  2E5Z A;  2HWV A;  2KRC A;  3GWZ A;  1XMX A;  3J81 K;  1Z77 A;  1V4R A;  2G9W A;  3BJ6 A;  2HYF A;  3O3K A;  3ZQC A;  2GIZ A;  2FML A;  3GTL J;  5J8F A;  2KIF A;  5HS8 A;  4BBR J;  4F93 B;  3BQY A;  4JX6 A;  4A3I J;  3GTM J;  1AHD P;  3CLO A;  2XPW A;  3HRT A;  5LHH A;  3K4N A;  3IHU A;  2LY2 A;  3S2W A;  1V5G A;  3Q9S A;  4V2G A;  3GTG J;  5F0H A;  3V8L A;  2I8D A;  3C7J A;  2VQH A;  3S1M J;  3ZMV A;  3ABU A;  5FRN A;  4XLN F;  5FLX K;  2WAF A;  3HOT A;  1LPQ A;  4AIJ A;  2L7M P;  2GIV A;  1B6A A;  1PP7 U;  1PDN C;  1T98 A;  2NS7 A;  3GTK J;  3VEP A;  2ISZ A;  1ZQ3 P;  3MZ8 A;  3I9V 2;  3IC7 A;  4RB3 C;  2IT0 A;  4BJ5 C;  2V1X A;  3BC8 A;  2MLG A;  5E3L A;  3PIP F;  3S3N A;  3ABK H;  3BTC A;  4PSW A;  4QPO A;  2J5O A;  4Y15 A;  4CCN A;  2GQQ A;  4E4H A;  2KT0 A;  1VQN I;  4HPQ A;  3OL4 A;  2DK8 A;  5D5X B;  4BEH B;  1LE8 A;  2LBF A;  4XQF A;  3RQ4 A;  4HX8 A;  4JX4 A;  1JXS A;  1TW2 A;  5ILV A;  2LG4 A;  2XAG A;  3GFI A;  3ZP5 A;  2COM A;  2LY9 A;  1X4P A;  2EA4 A;  3OWT A;  4RS8 A;  1ON2 A;  1T0F C;  1U5T C;  4IQ4 A;  5CLS A;  4KFC A;  2QSG X;  1TBX A;  2M45 A;  3GZ6 A;  5LD2 C;  2E2I J;  1O7L A;  5E1W A;  4PGH A;  1A6Q A;  1XD7 A;  2H8W A;  4LMY A;  4RGS A;  3P9I A;  1V3F A;  3Q0U A;  3HRS A;  2VQG A;  2CSO A;  4L9J A;  4HF1 A;  3HM5 A;  5B1B H;  5J6X A;  4I01 A;  3BP8 A;  2BY1 A;  4P96 A;  2W7N A;  3VDX A;  2MD5 A;  5H2F C;  4F52 A;  3U2R A;  1B8I A;  4IEJ A;  4UXN A;  4AYB A;  5F64 A;  4OAY A;  1D1A A;  3LQQ A;  2EFN A;  3S3M A;  5IYB J;  2L3D A;  1R6R A;  3NAR A;  4F7Z A;  2ECC A;  2DQL A;  3LA3 A;  5LHI A;  3KP7 A;  2P7C B;  1FTZ A;  4E7Z A;  4LK0 F;  2EZK A;  3CCQ I;  4UUT A;  4DW6 A;  3HOZ J;  1QNT A;  2L01 A;  4A3J J;  4NC7 A;  1MMA A;  1B9N A;  2STT A;  1MSF C;  4FX4 A;  3CUQ C;  1VQ5 I;  2IJL A;  1HQC A;  2ZCW A;  1NK2 P;  1SAN A;  1STZ A;  1U2W A;  2R7F A;  2BGC A;  3GME A;  2IXS A;  4IHV A;  1IDZ A;  4QIW N;  4KN4 X;  1D1B A;  3T8R A;  3WHB A;  3RTR A;  5LLQ A;  2CH0 A;  4JBA A;  2JVH A;  4D7N A;  2P6S A;  3LFK A;  1VFC A;  3W2V A;  2V1D A;  3FK6 A;  5LGT A;  2V7F A;  4I0A A;  1S6L A;  3KLN A;  1XTA A;  2K02 A;  3R61 A;  1U8B A;  3PJR A;  4DNC A;  2Z1D A;  5J40 A;  3CCS I;  2L0K A;  1JHF A;  3U1D A;  1N77 A;  1IXR C;  3F8B A;  2LY1 A;  2BHZ A;  1MH3 A;  1O3S A;  4QWQ A;  3S17 J;  1OR7 A;  1HKT A;  3JSO A;  3GTQ J;  2KIU A;  2VN2 A;  4RGX A;  2X51 A;  1WFX A;  2BYV E;  5ILS A;  1M1E B;  3TOA A;  3F8C A;  3SFZ A;  5ED4 A;  4RLF A;  4BGD A;  1MMN A;  3V8K A;  1O7F A;  3DFG A;  1UHM A;  1TC3 C;  1DGW Y;  1P7I A;  4XKV A;  3FXL A;  2E35 A;  3ECH A;  2DJN A;  2FQ4 A;  1ZKG A;  1W5S A;  3E6C C;  3ZXS A;  4KIF A;  4C9Y A;  2N8G A;  3WGG A;  2JT1 A;  2BY0 A;  2BW3 B;  1H0M A;  3RDI A;  4ENN A;  4IKF A;  2FBI A;  3BWG A;  1OKR A;  4O6J A;  4DYC A;  2CQ7 A;  2JTV A;  2ZNZ A;  2M3A A;  3EYI A;  2XGC A;  3E5Q A;  1ZK8 A;  1BN5 A;  1GHC A;  2JA2 A;  3G2B A;  4DGW B;  3G1O A;  3K6G A;  2KDO A;  1EJ9 A;  4BQQ A;  1GV5 A;  2K40 A;  4RAG A;  1R36 A;  1B1B A;  4UV8 A;  2NNN A;  2DJI A;  3K70 D;  1MJA A;  3JRI A;  5J1R A;  4IVN A;  4G7Z F;  3H0D A;  4WXH A;  2BE5 F;  2BY3 A;  4LB5 A;  2PQ8 A;  2OPT A;  2VKH A;  2YR2 A;  1U78 A;  2D5V A;  2OV7 A;  3QPL A;  2JA8 J;  3T8T A;  2E1O A;  2NYX A;  3V4G A;  4IRH A;  1GXQ A;  2JMW A;  2JRT A;  3MZH A;  1ZGJ A;  3LA7 A;  3PIO F;  3MD2 A;  3M1C A;  1TWC J;  1AKH B;  3OS1 A;  3IWZ A;  5FO5 A;  3HRM A;  3HOY J;  2FOK A;  1UHS A;  4D1Q A;  1YHQ I;  1UFM A;  4IZZ A;  4HV6 A;  1YW7 A;  2CUJ A;  1REP C;  4LLN A;  2CO5 A;  1A04 A;  4S04 A;  1PP8 F;  1FZP B;  4W1U A;  3BZ6 A;  2QF7 A;  4LB6 B;  1KU7 A;  2DFF A;  1MND A;  4AVP A;  4QTR A;  3H9G A;  3JRG A;  5KAF C;  5L3D A;  5JR3 A;  4IXA A;  4HNT A;  3BRO A;  4ZYG A;  3TGN A;  1FMW A;  2K9L A;  2M4G A;  4FX0 A;  3RKY A;  5CVV A;  4H0E A;  2MFZ A;  2QVO A;  1ERD A;  5E3N A;  1HW5 A;  2DFE A;  4ANJ A;  5GTH C;  4MTE A;  1TWH J;  1UAA A;  2Y0S A;  2HGC A;  1MDM A;  2VPR A;  3FM5 A;  3JCU C;  1U9O A;  1MJ9 A;  1WJB A;  1VQ9 I;  2DYR H;  1U5T B;  5D6E A;  4BXX J;  1KZH A;  2DI3 A;  2LLK A;  3I0T A;  1L0O C;  3CF2 A;  4RMN A;  4HF0 A;  3MZY A;  2ADU A;  2HVQ A;  3LOC A;  1D8J A;  2LD5 A;  2KMU A;  4V19 K;  1EH7 A;  4MLO A;  1RIO H;  1Y39 A;  2KFD A;  1H9T A;  2VC1 A;  2R7R A;  3N05 A;  4G6D A;  5JVG F;  5FB2 A;  3HOX J;  2IGK A;  2OF7 A;  3CCE I;  1FMV A;  2ESN A;  2FNA A;  2Y0S N;  1IRG A;  2PMU A;  1SC7 A;  4CIC A;  2DPU A;  3Q0W A;  1WVR A;  3HPH A;  2IAI A;  2OBP A;  5FFZ A;  3WTX C;  3L2W A;  3S1N J;  2R7X A;  2Q8K A;  1KQ8 A;  2CYY A;  3ZQQ A;  2O8X A;  2X1C A;  5FLM J;  3PM1 A;  3S8P A;  3U1K A;  4CHU A;  3CME I;  4YFK F;  1K61 A;  2PJR A;  3IWF A;  3WE3 A;  2A5Y B;  4NDL A;  2JN6 A;  4ZYD A;  4IHT A;  5AIQ A;  1A6I A;  3TDU C;  2VT2 A;  5KAI C;  3D5L A;  4C3I J;  3H9J A;  2XDV A;  1W7P D;  1HA8 A;  2DTZ A;  3I4N J;  4KDP A;  2IGO A;  3M7G A;  4IJA A;  5HDG A;  1UB9 A;  4I09 A;  4BNC A;  2FF4 A;  4FCY A;  1HC8 A;  3HJE A;  4B3X A;  3KFW X;  3JRH A;  2LOO A;  3GZ5 A;  4ESB A;  2IS2 A;  1SAX A;  3FXU A;  3D0S A;  4UV9 A;  1SFX A;  2W48 A;  4AC0 A;  4E70 A;  2XF6 A;  4LD5 A;  4Y4R A;  1XDS A;  1TNS A;  1UCR A;  2QYO A;  3RYR A;  3JAM K;  2LRE A;  2GLO A;  1HXD A;  3HL2 A;  3SDG A;  2OUM A;  3J80 K;  4AIH A;  2JRM A;  1XGO A;  5CVJ A;  3IV5 A;  4B44 A;  1X1P A;  3SFI A;  2ZJ2 A;  3LSR A;  2H1L A;  1VI0 A;  4NBQ A;  3WG7 H;  3CDI A;  4UY8 I;  3TQN A;  2HZD A;  2HYG D;  3OIO A;  5ICF A;  2RNJ A;  4X0G A;  4A12 A;  3H0G J;  4ENJ A;  1Y6I A;  5D5W B;  1WH5 A;  2ME0 A;  2OTJ I;  2GBY A;  2ISY A;  3BOQ A;  3SZG A;  4BQN A;  3CCY A;  4LG0 B;  1YX5 A;  4BQO A;  1S7A A;  3J7A Y;  1ONV A;  3BY6 A;  2WA0 A;  1I39 A;  1T39 A;  1TL8 A;  4XRS A;  4HLY A;  2UXX A;  1JT0 A;  2TRT A;  3L2U A;  5ICG A;  1FP2 A;  2STW A;  1TZL A;  4C30 A;  1BJA A;  2GA2 A;  3RZD J;  1W5C C;  5BNG A;  3WOD F;  2P6T A;  2A6H F;  5JLW A;  1FC3 A;  3CCU I;  3FIS A;  2ZXJ A;  2HPM A;  2A68 F;  2XIG A;  4HNU A;  5L3B A;  5LHG A;  4TV7 A;  4RB2 C;  3RKX A;  1LFB A;  3K2Z A;  4DBR A;  3HSF A;  2ME6 A;  1ETV A;  3LSP A;  2DOF A;  3ZQ7 A;  4G12 A;  3I5U A;  4AYB N;  3BPX A;  2PI0 A;  2IEK A;  1YS7 A;  2DT5 A;  2HTJ A;  5IYC J;  4ZTJ A;  1OCP A;  4GYG A;  4U0V A;  4CZC A;  3PQJ A;  2ELH A;  4AID A;  3A2K A;  2UXN A;  4WXD A;  5E3O A;  4B09 A;  2M8G X;  2LKS A;  2LNB A;  1WJF A;  2WAQ N;  4UB8 C;  4BS9 A;  3ZMZ A;  5C44 J;  3IKV A;  1D0Y A;  4ABZ A;  1OIS A;  3CCJ I;  4L9V A;  1E17 A;  3RKQ A;  4XSZ F;  3KET A;  3QOE A;  4YRV A;  1IAW A;  4BAY A;  5B5E C;  1BOB A;  4RAF A;  3A01 A;  4Y52 J;  1XSD A;  2K3P A;  2B0L A;  1ENH A;  1RR7 A;  3OYH A;  1I3A A;  2ELK A;  3S14 J;  3OOU A;  3I4M J;  2CQQ A;  4OMY A;  3QYE A;  2ZSI B;  1BR1 A;  3ZPL A;  4ZDP A;  3TW7 A;  4PK4 A;  2O6G E;  3LST A;  1SD5 A;  2P0W A;  1U3E M;  1I27 A;  5DM7 F;  5B66 C;  4LIT A;  3IRR A;  4OIQ F;  2GXB A;  2JPB A;  4E7H A;  1V5E A;  4EGZ A;  3FXO A;  3DBH B;  3SJM A;  2MH9 A;  1Z7L A;  3L1P A;  3W6V A;  3KZY A;  4DYQ A;  3GW2 A;  1XG1 A;  3WU0 A;  4EJT A;  4NHJ A;  4D9J A;  4HX7 A;  5D8L B;  4CYC A;  3FXJ A;  2GZW A;  1BR4 A;  5IYD J;  5A2Q K;  1E3P A;  2CQK A;  2Y48 A;  4P1W A;  4OIO F;  1DP7 P;  3DU6 A;  4XLA A;  2K9N A;  3U21 A;  1IW7 F;  6PAX A;  4X1E A;  1Z7U A;  3WTV C;  4GCV A;  1MBK A;  2X4H A;  1QZY A;  2TDX A;  1F43 A;  2CQX A;  1T33 A;  3TDZ C;  5DD8 A;  2JQ7 A;  4ZDL A;  1G3S A;  4JQF A;  1ZRF A;  1YQA A;  2F5D A;  2OC6 A;  3KP3 A;  3M8F A;  2D45 A;  5LFA A;  2B63 J;  3DEE A;  5D4S A;  1PYV A;  2JJ7 A;  3HDD A;  2LVS A;  2ZJQ F;  3S1R J;  2K85 A;  4RB1 A;  2XGD A;  2Y75 A;  1ZN2 A;  1EKE A;  2W1O A;  2K7L A;  3DQV C;  4ENM A;  3I59 B;  3ZQF A;  1JKP C;  3DPT A;  3CQZ J;  3QRF F;  3BTJ A;  3HRU A;  1SD6 A;  5EJC A;  2XKP A;  1MH4 A;  3HIF A;  4G7O F;  3K1N A;  4HSR A;  1RPW A;  3KEO A;  1LFU P;  5EGO A;  1E0E A;  1XN7 A;  1U9N A;  2CJJ A;  4G94 A;  2LFB A;  1ETO A;  4RM2 A;  3CCV I;  2X48 A;  2QQB A;  2NOG A;  3FF5 A;  2KHM A;  2DCE A;  3ZQH A;  4FTH A;  1W1W E;  1A31 A;  3CD6 I;  1E3O C;  5HVQ C;  1SAU A;  2VUM J;  2AQE A;  4FE7 A;  3OYC A;  3LSI A;  4CSW A;  5FLV A;  2EV5 A;  1P2F A;  2X1D A;  5E17 F;  5KNL A;  1TW3 A;  2Y2Z A;  3EYY A;  1AWC A;  3EQL F;  1P4W A;  1ZEL A;  4JX5 A;  1A5J A;  2NRA C;  5F0F A;  5BQT A;  2EH3 A;  2L9N A;  1G59 A;  2XSJ C;  2CV2 A;  4LOC A;  2Y9Y A;  4QPQ A;  2YSR A;  2RC4 A;  2IS1 A;  5C3E J;  1UST A;  3K4K A;  1LVA A;  1UMQ A;  2O03 A;  4HV5 A;  5TJJ A;  2R93 J;  3OR1 C;  2X1E A;  5HS7 A;  2EPF A;  2IA2 A;  2LR8 A;  4EJW A;  3AG4 H;  5KVR A;  5IOZ A;  5DCF A;  4OOI A;  2CFX A;  2ACJ A;  3DTE A;  4UVC A;  3HG9 A;  1K6Y A;  3L2Q A;  4E7I A;  1Z05 A;  3KP5 A;  2XB5 A;  3TP0 A;  3F23 A;  1I3Q J;  4P5O A;  5F04 A;  1XPX A;  1HDD C;  4AM3 A;  3L9F A;  1SVM A;  4ON0 A;  1DPU A;  1K78 A;  3GEZ A;  2LBF B;  1D3Y A;  3ASO H;  4WXC A;  3S2D J;  2KIM A;  4CUG A;  2VOP A;  2PBI A;  2RN7 A;  1TWA J;  2EA2 A;  2W24 A;  4L5E A;  5M5X J;  2M7A A;  3HOW J;  1ZAO A;  3A4C A;  2EWN A;  3B73 A;  2P4W A;  2VQC A;  4MIM A;  3JRF A;  1RKT A;  5DEQ A;  2M0M A;  3FBI B;  5ICE A;  2FSW A;  1JTX A;  4M74 A;  1C0W A;  1P4X A;  3DF8 A;  2YUS A;  4D7M A;  3I58 A;  4P9F A;  3LSJ A;  1J7K A;  4BKX A;  5C4J J;  3FX3 A;  1DQU A;  3M9A A;  2BEO A;  3BZC A;  4RA2 A;  2P5L C;  1AU7 A;  5KHD A;  1GDT A;  3DBL B;  3WHC A;  3CDL A;  3EPZ A;  4FET A;  1FBU A;  4IOC F;  2ECB A;  4IHS A;  3PL8 A;  4DZJ A;  4XOR A;  3GVA A;  4UNO A;  2EFO A;  4A6E A;  3OYA A;  3WU1 B;  3MMY B;  5DV5 A;  2NS8 A;  4AU7 A;  3HTS B;  2ELJ A;  2A61 A;  3DPL C;  1HLV A;  1Y8R B;  2A07 F;  5L3G A;  4YFX F;  2IGN A;  2FNP A;  2LC2 A;  5FD6 A;  3FIW A;  5HNF A;  2DA4 A;  4NQW B;  5KCM A;  3B6A A;  3KYL A;  3I71 A;  4HYE A;  1RRJ A;  2UUZ A;  4PGG A;  4O5V A;  2NVY J;  3G73 A;  1JT6 A;  2CU7 A;  3ONQ A;  3TBI A;  4WWC A;  1BJZ A;  4PFO A;  3ABM H;  3LSH A;  2UWM A;  1S7E A;  2CW7 A;  4P55 A;  4EVI A;  1BL0 A;  2MBF A;  4D5C A;  4MEX F;  2GWR A;  3VYS B;  1BIB A;  1R1T A;  1X4O A;  2BVM A;  2JPC A;  1NK3 P;  2QBY A;  2X6X A;  2VXZ A;  1TQM A;  1NH3 A;  2QWW A;  1Y0N A;  2Y69 H;  4U7B A;  4JP0 A;  2DFI A;  4FAS D;  5JHF A;  5CPR B;  3MKW B;  1X19 A;  5E8I A;  3K10 A;  4CZZ A;  3OYI A;  4UB6 C;  4PSX A;  3H3U A;  3FBN B;  3K70 C;  3SEQ A;  3RIR A;  3TED A;  2UV1 A;  2V1U A;  1YOV B;  5LRR A;  2HDC A;  3F8M A;  2VL8 A;  3B02 A;  1R49 A;  3MAJ A;  2VXD A;  2E1C A;  2ZXI A;  3J7A O;  1IJW C;  1H9G A;  3NWT A;  2VBZ A;  4IRG A;  1LKX A;  3GFL A;  3J7Z I;  2VOD A;  1O4X A;  1UZC A;  4G8X A;  3G4S I;  2M0C A;  1T08 B;  4ZYH A;  2OAZ A;  3BG3 A;  4JK1 X;  1Z21 A;  5FD5 A;  2DFH A;  1ZGW A;  5J8C A;  3OYK A;  5AON A;  4ENK A;  1FSE A;  1RI7 A;  2ZFU A;  4BXF A;  5HDN A;  2KZV A;  4FIS A;  1IV6 A;  2R7W A;  3N97 A;  2TCT A;  3BTI A;  3HGG A;  3AKZ A;  1YE9 A;  4CCK A;  2CQN A;  4B47 A;  2M5W A;  4BJT A;  5M3F J;  1X1B A;  3V7S A;  5HS9 A;  2WV0 A;  4M6X A;  1YI2 I;  4BAC A;  2ZME C;  3QWL A;  2FQ3 A;  5BS6 A;  4XBF A;  1IN8 A;  3CUQ B;  3K4J A;  5BPI A;  3E97 A;  1OYW A;  3HBL A;  3GO5 A;  4KT5 C;  4A6D A;  4WK8 F;  1S9H A;  2Q2E B;  3I53 A;  1MD0 A;  2K27 A;  1ETY A;  3L09 A;  4NUB A;  1G3T A;  3J7Y J;  1JGG A;  3E5X A;  2AXT C;  1G2H A;  4K2E A;  3PNV A;  5C4X J;  3HTU A;  1B9M A;  3HEF A;  2KIS A;  4HEA 2;  3DTK A;  1BM9 A;  2QEN A;  5JI6 A;  1Y0U A;  3MQ0 A;  5EYR A;  2RDP A;  2GAU A;  3KEQ A;  3OIP A;  4FQG A;  3GF2 A;  4UVB A;  5HLH A;  2ESH A;  4MEY F;  4IHX A;  2H6C A;  2KRH A;  1ZLJ A;  3DEW A;  2CG4 A;  1HW2 A;  1R1V A;  1L3L A;  3C2B A;  1R5H A;  1KQ0 A;  3KPH A;  1SMY F;  4PJM A;  1B72 B;  1X3Z B;  2OCC H;  4L0Y B;  4XLE A;  4XLH A;  1CF7 A;  4GDF A;  3JRC A;  1OMI A;  2DOA A;  3DP7 A;  1FX7 A;  4WF2 A;  3S1Q J;  2IS6 A;  4KIC A;  3PUB A;  1W36 C;  5JFR A;  1Y1V J;  3DWL E;  3HUG B;  1T8I A;  1TTY A;  3H35 A;  2DQR A;  1YIT I;  1QO0 D;  3OYE A;  1IUY A;  2V79 A;  4AWX B;  4M6Y A;  5GPC A;  3M3Y J;  2FXA A;  1OCR H;  3O8G A;  5K7F A;  5CQE A;  2ZC2 A;  2CWE A;  1HCR A;  1T0F A;  1U5T A;  5L3E A;  5E79 C;  1G8X A;  3V7C A;  2EQR A;  3FXQ A;  3EUK L;  4OU0 A;  4GGG A;  2HKX A;  2Z99 A;  3DBR B;  3VPR A;  1WH7 A;  3K4B A;  4IRI A;  1FWZ A;  4M3G A;  1B59 A;  1SMT A;  2DN0 A;  2KPM A;  4B48 A;  3E7L A;  4LIV A;  2FBH A;  1FYL A;  1XGM A;  5J1U A;  2R7U A;  1N78 A;  3A0H C;  4IHY A;  1LEB A;  4NQW A;  3NWS A;  2WV1 A;  4N9I A;  1D0Z A;  5EF6 A;  2X0L A;  4XMY A;  1F5T A;  1I6X A;  4HA8 A;  2E2H J;  3JRE A;  1GXP A;  1LNW A;  2WAD A;  3KP4 A;  3F6V A;  2E1M C;  4CCO A;  4F55 A;  2CS3 A;  2R5Y A;  4ZYA A;  3ZGK A;  1WI9 A;  1B8I B;  4JOM A;  3L00 A;  4II2 A;  2VBX A;  1AA7 A;  3LWF A;  3Q0V A;  3LSM A;  2QKM B;  4RDU A;  3RCO A;  4E7J A;  2QBY B;  3LAP A;  2ZJR F;  4RGR A;  2HQR A;  5E8G A;  4XL9 A;  3X2Q H;  1UJ8 A;  3WG9 A;  3QOP A;  3DLL F;  3AG3 H;  3KYC B;  2DLL A;  2RAE A;  2WWY A;  1I5Z A;  2V9K A;  5LEK A;  3LL7 A;  2E7X A;  2R7T A;  2EV0 A;  2M34 A;  2ZBK A;  3A1Y A;  4MQV A;  4BU2 A;  3ZN0 A;  1ETQ A;  2DDB A;  3HHH A;  2K86 A;  4S05 A;  2K4J A;  2CUZ A;  2DMN A;  2RQQ A;  3EUH A;  1D5Y A;  1GLN A;  1IG7 A;  2BVL A;  5LEJ A;  2F4O B;  4GXO A;  4HDV A;  2RV8 A;  4KIS A;  4RLQ A;  3P9C A;  3EUA A;  3K1P A;  1R4M B;  2E60 A;  2BV6 A;  1QA6 A;  1MW7 A;  4Q47 A;  2QQ8 A;  1Z0X A;  2DK5 A;  2QQ9 A;  1J59 A;  1GUU A;  1HW1 A;  4I98 B;  3BLY A;  5F27 A;  2AHQ A;  5TIS C;  1PJR A;  3GTP J;  2MW8 A;  2FD5 A;  1BI3 A;  2ZXH A;  1W0T A;  3RI4 A;  4GRI A;  2MH2 A;  3D1N I;  3JRB A;  1AKH A;  1R5I D;  3NEU A;  1XMK A;  4U0Y A;  1SD4 A;  1S5L C;  2GOM A;  2PG4 A;  4J19 A;  3TKY A;  1F1Z A;  1JUM A;  1RUN A;  3C1D A;  2FOW A;  4F3Q A;  2RQP A;  2KZG A;  1ZHF A;  3OYJ A;  4ZTF A;  5HOD A;  4EAT A;  2VC0 A;  2L54 A;  2XGE A;  5IP9 J;  2EV6 A;  3OOP A;  2R0Q C;  5HNH A;  1VQ8 I;  1HDP A;  3KZI C;  4XK4 A;  4F91 B;  2HFH A;  3H5A A;  2R92 J;  2M2E A;  1V55 H;  5EZG A;  4BXU A;  3LMM A;  3CJR B;  4HF2 A;  1YJ9 I;  2HKO A;  4RAY A;  3GXO A;  2E7W A;  4Y3O A;  3WGI A;  3FDY A;  4A3D J;  2VKD A;  3CP8 A;  2R7S A;  2FMY A;  3B6C A;  3BR3 A;  5K7Z A;  4A93 J;  1T95 A;  1O3T A;  1BW6 A;  4G6Q A;  2QCO A;  2H09 A;  1WJ5 A;  1N75 A;  2DW4 A;  1O3R A;  4MGR A;  4EV0 A;  4CA0 A;  5IT3 A;  2OJE D;  2VJJ A;  1P7J A;  4G9Y A;  2Y9Z A;  1K4S A;  1P9Q C;  2MC4 A;  2NS0 A;  2W4S A;  4XLC A;  4EMS A;  3V8J A;  2K4B A;  4M9Z A;  4HLX A;  5K1Y A;  2E5N A;  2XB0 X;  3CC7 I;  3CF5 F;  3OSF A;  1A35 A;  3PNY A;  1HOM A;  3CJT B;  2AXL A;  1ULY A;  2E71 A;  2XUB A;  4ITV A;  2HDW A;  3I59 A;  1KU2 A;  1ACI A;  5H6R A;  3FK7 A;  3R4K A;  2UZK A;  1ITY A;  5J3L A;  4U88 A;  1YO5 C;  2R7O A;  3J81 Z;  5D5V B;  2BOL A;  2WTE A;  2VOO A;  1XSX A;  2IP2 A;  3JTH A;  3LNQ A;  3G3Z A;  4JYK A;  4YII A;  2V26 A;  1LUJ B;  3K2A A;  1VQM I;  3JRD A;  4J01 A;  2O3F A;  5EGO B;  3OYL A;  2QZ8 A;  1QBJ A;  2K9Q A;  1OCO H;  1K79 A;  1LDJ A;  4ZZD A;  2DYS H;  2LP0 A;  3DEU A;  3ZQL A;  1ETK A;  5JVT A;  3ESW B;  2BBY A;  2R7Z J;  2L9R A;  2VJ4 A;  3IAS 2;  3F22 A;  2F2E A;  3F8N A;  2F5F A;  1W36 D;  1IGN A;  3ERM A;  4CO8 A;  5H6Q A;  1RKW A;  5F1J A;  1IRZ A;  1U0J A;  1OYI A;  5EEG A;  4MHG A;  1ZR2 A;  2JUG A;  3I3L A;  3KP2 A;  1KON A;  4HNV A;  3GCM A;  3G1M A;  1FLI A;  2K5C A;  2EIN H;  2M7B A;  3VSK A;  4CYC B;  4UUS B;  2Z9O A;  1MDM B;  1YJW I;  4A3E J;  4QLC U;  4EGY A;  3QOD A;  4PJL A;  1FYM A;  2WAQ A;  2YX4 A;  3WE2 A;  3BQZ A;  1SVO A;  2M9H A;  3H9Q A;  3ELK A;  3OYB A;  1KU3 A;  1ZLK A;  4Y17 A;  4BH9 A;  3L2V A;  2IGM A;  2MA3 A;  3AAF A;  2ZFW A;  2XPU A;  5A2Q Z;  1OCZ H;  2ID3 A;  2F6C A;  2YU3 A;  3PQK A;  3WTT C;  3K69 A;  5DS9 A;  3KCC A;  2W00 A;  3TO9 A;  5K5R A;  4IOA F;  2H27 A;  2X85 A;  4CGZ A;  1YG2 A;  2K9S A;  2VPL A;  3OY9 A;  3CO7 C;  3CCL I;  4BY1 J;  4MTD A;  1QHG A;  1XGS A;  2KJC A;  4LJZ F;  1DU0 A;  4A3M J;  3I4P A;  2BHY A;  3PFY A;  3OV8 A;  1VQL I;  2X6Y A;  2FBK A;  1UHW A;  2Y31 A;  3OS2 A;  4BE0 A;  2EIK H;  1IUF A;  2F48 A;  2K3F A;  2IBD A;  5IP6 A;  4KMU X;  5JLX A;  4AVZ A;  4L5I A;  4CH7 A;  4CDG A;  2AQF A;  3M8E A;  4A3G J;  4M6V A;  3DLA A;  1WJA A;  4YIF A;  1G6N A;  3CES A;  3TO7 A;  3GX4 X;  1D8K A;  2Z5U A;  3SHF A;  2HYJ A;  3BJO A;  2OTL I;  4A3F J;  5L3F A;  1KA8 A;  4EM1 A;  1IXS B;  1HKQ A;  1TQI A;  2NOJ B;  2ZO4 A;  4LK1 F;  1IF1 A;  3NRV A;  3BJA A;  3QU3 A;  2QEX I;  1QZE A;  1OCC H;  1MNE A;  4S0H B;  2GA1 A;  4CCM A;  3ISP A;  1IDY A;  3F3X A;  1TWG J;  2MC3 A;  3BG6 A;  1JKO C;  1Z1D A;  1Z6R A;  1VQ4 I;  2WAE A;  1LDK B;  4A0Y A;  4L18 B;  2VAS A;  1Z3X A;  5M3M J;  2C6Y A;  1FT9 A;  1F36 A;  2WY7 Q;  3LAJ A;  3QPT A;  2A05 A;  2L4M A;  4EQQ A;  3K0L A;  4F92 B;  1FBS A;  1QRY A;  2DA1 A;  3H3Z A;  4I0B A;  4N9H A;  2P7V B;  3S3O A;  4KIB A;  2CV1 A;  1W4M A;  1BA5 A;  2XRN A;  4P9U A;  4IO9 F;  5IT9 K;  2O9L A;  4H4K C;  1D5V A;  4BHC A;  5LBQ A;  1ZG5 A;  2OU2 A;  1FNN A;  4RB0 A;  3E3V A;  3VB2 A;  3VSL A;  1Z91 A;  2XKO A;  2KQR A;  1O3Q A;  1JJ6 C;  1Z3Y A;  3JRA A;  1XX5 A;  3H3V K;  3ASN H;  3QPH A;  2ETH A;  2P5V A;  2XRL A;  3MEX A;  4U87 A;  5GPA A;  1OYY A;  4BHB A;  1S29 A;  2VE9 A;  1VQK I;  4HQE A;  1S8N A;  3BR1 A;  2VON A;  5DUK A;  1I50 J;  2COB A;  4M9S A;  1ZR4 A;  1MBG A;  1VZ0 A;  1MSE C;  1K78 B;  1JHH A;  2M4K A;  1WJC A;  3BR0 A;  3HKZ N;  2DOD A;  2G0E A;  1FJL A;  2M1B A;  3ML6 A;  3CMA I;  2B9S A;  5KK1 A;  4FHT A;  3ERE D;  1JTY A;  2MGQ A;  1POG A;  5J4V A;  2FRH A;  4A5N A;  5IT9 Z;  1ZG1 A;  1BOA A;  1R4N B;  3I64 A;  5DCM A;  3LQR A;  4MFD A;  2Z2S B;  5FKL A;  3WGH A;  3TW6 A;  2VE8 A;  1F4K A;  2JK3 A;  4GYI A;  2E1M B;  2QA4 I;  1EH6 A;  1R9T J;  3H5R A;  1HST A;  5F0C A;  2DAO A;  2ZKZ A;  4CYD A;  2MAB A;  1T2K A;  3IKT A;  2HNH A;  1FSH A;  3CJQ B;  5DUI A;  1RR8 C;  3HKZ A;  5CJ9 A;  3ZOB A;  3REO A;  3K4M A;  2JA7 J;  4KUM A;  4XM3 A;  4Q4Z F;  3O2P E;  4N4N B;  2O61 A;  4B4C A;  2D2W A;  3MWM A;  2DOE A;  1BI1 A;  2EFQ A;  5DD4 A;  3CLQ A;  4UUS A;  3HSE A;  5LRS A;  4GFB A;  3HB9 A;  2M30 A;  3SYT A;  3BCB A;  5ERI A;  3P7N A;  4ZZL A;  5D8K B;  1XCB A;  3K1M A;  3MKL A;  2XF7 A;  2VIX A;  1FIP A;  1P92 A;  4NC8 A;  1X2M A;  4XOT A;  2DA3 A;  4I99 C;  5GAH J;  9ANT A;  2PJP A;  2ZB9 A;  2EFW A;  3GLX A;  4PCQ A;  5TGT A;  4Y7N J;  3ROU A;  1W0U A;  2HOS A;  4MQ9 F;  4V2F A;  4Z2Y A;  5EG0 B;  4I6Z A;  5FRO A;  4C2T A;  1WJE A;  2Q2E A;  3F21 A;  1I6H J;  1DGR M;  3D5S C;  1WKM A;  3PUF A;  2JSC A;  1VQ6 I;  1I1G A;  2FX0 A;  1EV7 A;  3OL3 A;  5BPD A;  2JWT A;  1VQO I;  3L7W A;  4PJN A;  4C2M J;  5FKK A;  2DO7 A;  1PUF B;  2EK5 A;  2OZ6 A;  4XLF A;  4NC6 A;  4XRM A;  4UHT A;  4XLP F;  3R60 A;  4EJO A;  3J80 Z;  1LEA A;  4DZP A;  1MMG A;  3CTA A;  4LLG F;  1Y1W J;  3H5N A;  1SD7 A;  2AO9 A;  4LGW A;  4YEJ A;  3NQO A;  2IW5 A;  2O8K A;  4OAZ A;  2IA1 A;  5ICC A;  3JSP A;  1RNL A;  3KYD B;  2KKO A;  3ULQ B;  1LDD A;  3MKZ A;  4I02 A;  1W5T A;  1LQ1 A;  3COA C;  3OIQ A;  3A03 A;  4Q48 A;  1TT5 B;  1TT0 A;  2R5Z A;  4BDZ A;  4E7S A;  3BDD A;  4IX7 A;  4C3H J;  4KA4 A;  2P5K A;  3C3W A;  2VQL A;  2DMQ A;  1T38 A;  1E3H A;  3OYM A;  1YIJ I;  5FKM A;  2XAF A;  4RGU A;  3AG2 H;  1DDN A;  1ZRD A;  2WY8 Q;  5FKN A;  5DM6 F;  1MIJ A;  4EJV A;  3OYN A;  1NTC A;  1J75 A;  2FUG 2;  5E3M A;  1S3J A;  3H92 A;  3HUG A;  2R7Q A;  3MVP A;  3Q9V A;  4BJ6 C;  4XSX F;  2ZSH B;  3KEY A;  4XID A;  1D1C A;  2XHK A;  1W7P A;  2VT3 A;  2V1N A;  2ID6 A;  3CZ6 A;  3F9K A;  3HYI A;  4EEF G;  5M5Y J;  2QSF X;  3BCA A;  1ZYR F;  4YIR X;  2A5W A;  5EEA A;  3H36 A;  1IN5 A;  4XIC A;  2W57 A;  4YEL A;  2QLZ A;  4M3F A;  3GUD A;  3CO6 C;  1YJN I;  2L9S A;  2XPV A;  2JVG A;  2H8R A;  2B7E A;  5F1R A;  1CGP A;  3RKW A;  2CRG A;  1K7A A;  3M07 A;  1OR7 C;  2O0Y A;  3M1E A;  2HR3 A;  1EA3 A;  2LK2 A;  3DKW A;  5E1X A;  2NVT J;  2R5Y B;  2EIL H;  3WTZ A;  2PLY A;  1G3Y A;  3AL0 C;  3LFU A;  5K5O A;  4AIK A;  2DT6 A;  4KT6 A;  1Y8Q B;  2FA5 A;  3C2G A;  2LRD A;  2VBY A;  3JW4 A;  1O57 A;  3LSK A;  3ZMD A;  4M71 A;  3ZRG A;  5K7H A;  1SFO J;  1VND A;  4BE2 A;  2XVC A;  5F08 A;  2LH9 A;  3LA2 A;  4QSH A;  2IVM A;  2OZU A;  2KL4 A;  3WTW C;  3F8F A;  4DJA A;  3TL4 X;  1JUS A;  3K7A J;  3CMY A;  2W84 A;  1KGS A;  2ZME B;  4KYW A;  1B72 A;  2V6E A;  2DXI A;  5D4R A;  1S72 I;  1ZAR A;  3DCF A;  3QAH A;  1UG0 A;  1GVJ A;  1TNT A;  3IH4 A;  3I54 A;  1VQP I;  1BC7 C;  4DOZ A;  3W3C A;  3FZV A;  2W25 A;  2P81 A;  2Y0M A;  5BMZ A;  3DKY A;  4M3E A;  3VYU B;  1XGN A;  5CVI A;  2CUE A;  1WHU A;  1Y56 A;  1HBX G;  3EET A;  3GZN B;  5IOY A;  2DPD A;  3N4M A;  2DDA A;  3D5R C;  5K5Q A;  1BC8 C;  3RJP A;  1XB4 A;  2D1V A;  2HOE A;  1OCT C;  2H6B A;  4BY7 J;  1ORK A;  5JHU A;  3RPU D;  2RNG A;  1MBJ A;  5E1Z B;  2L02 A;  4KIG A;  2XGX A;  4UUV A;  5CQG A;  4ASN A;  1OQY A;  5J47 A;  2GM4 A;  1VTN C;  3W6K B;  1QZZ A;  1ON1 A;  4R79 A;  1R00 A;  2HQN A;  3KP6 A;  2MLK A;  2G7U A;  3CDH A;  2GXA A;  3BG7 A;  2OCE A;  4D5F A;  4E7K A;  2WB1 N;  2RKH A;  1D0X A;  3DTI A;  1OFC X;  1Z6T A;  3BR2 A;  4HDU A;  1G4D A;  3IH3 A;  1NG7 A;  4EM2 A;  2L9V A;  1RC9 A;  4UVA A;  4X6A J;  3ZR8 X;  1X3U A;  2V4J C;  3SZP A;  3HPG A;  2R7D A;  2EIM H;  1APL C;  3CJN A;  3WU2 C;  3IP4 B;  2DA7 A;  3FM3 A;  3RYP A;  4J00 A;  2I5U A;  1IO2 A;  1NG6 A;  1YYV A;  4HG2 A;  4M3D A;  1WQ2 A;  2BXY A;  4A0Z A;  1FOK A;  4AUX A;  2L2O A;  2ICW G;  4RAZ A;  4LG3 A;  1Z9C A;  3E6D A;  2NVQ J;  2HVR A;  1LJ9 A;  1IV8 A;  1Q1H A;  3OSG A;  2WB1 A;  1U6G A;  4OWR B;  3TOB A;  1FP1 D;  1WZ2 A;  1UG2 A;  3UR3 C;  2X6W A;  2VJ5 A;  4W97 A;  2LSO A;  2QM3 A;  1WWX A;  2CW8 A;  3K4C A;  3E6M A;  3S32 A;  4CCL A;  4M9X A;  3VYT B;  2PX9 A;  1NHA A;  4R8H A;  3RSN A;  3K9T A;  1HKS A;  2XAH A;  5GAD J;  1YW9 A;  4HZF A;  3SDB A;  4B8X A;  2PMZ A;  4BEH A;  3CMM A;  4EM0 B;  4IPA A;  3FHZ A;  5L3C A;  3T0Y A;  1R23 A;  1FOY A;  1WJD A;  2XAJ A;  1X1D A;  5FLX Z;  4U7D A;  1W7P B;  2K9M A;  3BR5 A;  1RUO A;  2R7V A;  1LE8 B;  5FJ8 J;  3M8J A;  3IH2 A;  4BHP A;  3FWE A;  3E0J B;  3T5X A;  4RBO A;  1CF7 B;  2NXN B;  4N0B A;  4L0Z B;  2VI6 A;  1VF9 A;  4OIP F;  1QQI A;  1SFE A;  2Z16 A;  5F6F A;  1DP3 A;  2JUC A;  3S2H J;  2XSD C;  3SEZ A;  2ZJP F;  3FMQ A;  3HOV J;  1X1C A;  1SEU A;  3OR2 C;  4LFU A;  4ZH4 F;  1B4A A;  2EFP A;  2XAQ A;  1SFK A;  3CP2 A;  3IL2 A;  5IP7 J;  5EG0 A;  4A3B J;  3RZO J;  4ESF A;  2KIQ A;  2F5V A;  2FEZ A;  5HLI A;  3GYH X;  2LMD A;  1FYK A;  5GTI C;  1ZG3 A;  2X9D A;  1BI0 A;  4OIR F;  2CW0 F;  1LFP A;  3CCR I;  4R1H A;  2PN6 A;  4HBL A;  4ZDO A;  4WX9 A;  4XKB A;  2NAZ A;  1WRJ A;  5EEH A;  3ZQG A;  2FU4 A;  2G7H A;  3V42 A;  1MBE A;  1ZGA A;  2HPI A;  2HZT A;  3OMY A;  2JA5 J;  3FKJ A;  2NVX J;  1T56 A;  1GT0 C;  4XKC A;  1HF0 A;  3SQN A;  4KNY A;  1S7O A;  1SVL A;  3ZMU A;  2DA6 A;  3AG1 H;  1IRX A;  5LGN A;  2QUF A;  2E34 A;  3F0C A;  1QU3 A;  2MG4 A;  1FOX A;  3TP3 A;  1IN4 A;  5B1A H;  5J4Y A;  3CUQ A;  3AL0 B;  5CVU A;  2Y30 A;  1TQP A;  1Z67 A;  3RQI A;  1OJL A;  1OPC A;  2L5Q A;  2XRO A;  3WTY C;  1U8R A;  1MBF A;  1YX3 A;  2BXZ A;  2PFB A;  1TLH B;  3KE2 A;  1R1U A;  2HOA A;  3R0J A;  3VYR B;  4EJU A;  3FMS A;  3A02 A;  4CXF A;  3T1B A;  3G1L A;  3OS0 A;  2IS4 A;  4XN3 A;  5EZH A;  1XSV A;  1R58 A;  1PUE E;  2DA5 A;  3CUO A;  2O5R A;  3HOS A;  3IUO A;  3KX2 A;  1WSU A;  2E2J J;  3CC4 I;  4AD9 A;  2CV0 A;  2HDD A;  3UNG C;  4Q5S F;  5HLT A;  5FKO A;  1RET A;  3HZJ A;  4KMF A;  5BOX A;  3R6S A;  3ZCO A;  3FHN A;  2H1K A;  1R7J A;  3F72 A;  2Q1Z B;  4XRS G;  1XDU A;  1LVK A;  1MNM C;  3PFI A;  4I7H A;  1USS A;  1P6R A;  4IF4 A;  1WGX A;  3TMO A;  3GFM A;  3VOD A;  2FJ1 A;  1JUP A;  4DQ2 A;  3QPS A;  1H88 C;  2DBB A;  4MO7 A;  4WCG A;  4A3K J;  3GFJ A;  2CFO A;  2L7Z A;  2ZXW H;  3QQA A;  4LG0 A;  3MFK A;  1PVE A; 
#chains in the Genus database with same CATH homology
 2ECB A;  5EDN A;  4DZJ A;  3BR6 A;  1QRY A;  2DA1 A;  2DJN A;  2FQ4 A;  1ZKG A;  1YRN A;  1K83 J;  2N8G A;  1Q1V A;  4C3J J;  1BA5 A;  2NS8 A;  2O9L A;  2YU9 J;  4DYC A;  1HLV A;  1H8A C;  1WPK A;  1H89 C;  2HXI A;  2XGC A;  3FIW A;  1ZK8 A;  2DA4 A;  3PO3 J;  3B6A A;  1JJ6 C;  2NVY J;  1JT6 A;  2CU7 A;  3JRA A;  3G1O A;  1JKR C;  3H3V K;  1BJZ A;  2XRL A;  5GPA A;  1GV5 A;  2K40 A;  3BR1 A;  1S7E A;  1BL0 A;  1I50 J;  2COB A;  1EF4 A;  4D5C A;  3M4O J;  1ZR4 A;  1MBG A;  5J1R A;  3JRI A;  1MSE C;  3BR0 A;  3UKG A;  2VKV A;  1NK3 P;  3HKZ N;  2KDZ A;  2G0E A;  1FJL A;  2OPT A;  1U78 A;  2D5V A;  3QPL A;  1FIA A;  1JTY A;  2MGQ A;  2JA8 J;  2E1O A;  2HQ5 A;  1POG A;  3GBG A;  3ZQI A;  4JP0 A;  2JMW A;  2JA6 J;  2I10 A;  1GV2 A;  4MFD A;  1DU6 A;  5FKL A;  1TWC J;  2DMU A;  1AKH B;  3TW6 A;  2CUF A;  4B1R A;  3HOY J;  2JK3 A;  1QPI A;  2X6O A;  1UHS A;  3TED A;  1R9T J;  4A3C J;  5F0C A;  4W1U A;  1IC8 A;  4MFE A;  2QF7 A;  1WI3 A;  4QTR A;  3JRG A;  1IJW C;  1TWF J;  4M3B A;  3ZOB A;  2JA7 J;  1X58 A;  1O4X A;  5E3N A;  2M0C A;  4B4C A;  1TWH J;  3BG3 A;  1ZGW A;  4UUS A;  3HOU J;  3PO2 J;  2VPR A;  1U9O A;  2DA2 A;  4GFB A;  4B3A A;  3HB9 A;  1FEX A;  4BXX J;  4FIS A;  1IV6 A;  3MKL A;  1FIP A;  2LLK A;  2TCT A;  1X2M A;  3BTI A;  2DA3 A;  3HGG A;  3NAU A;  9ANT A;  2ZB9 A;  5M3F J;  4Y7N J;  3LOC A;  2LD5 A;  1W0U A;  2HOS A;  4V2F A;  5EG0 B;  4I6Z A;  5GP9 A;  4MLO A;  1JJ8 C;  1I6H J;  4A3L J;  3HBL A;  3GTJ J;  1BW5 A;  2FX0 A;  3HOX J;  1ETY A;  4A69 C;  1JGG A;  2YS9 A;  2OF7 A;  1G2H A;  2Y0S N;  2JWT A;  5C4X J;  4C2M J;  3HEF A;  5FKK A;  3Q0W A;  2DMT A;  2IAI A;  3LSG A;  1PUF B;  3S1N J;  4XRM A;  5EYR A;  5FLM J;  1PUF A;  3PM1 A;  4DZP A;  1Y1W J;  2AO9 A;  2L7F P;  4IHX A;  1K61 A;  3DEW A;  2O8K A;  1ETX A;  4NDL A;  2JN6 A;  3S15 J;  3C2B A;  4I76 A;  1A6I A;  3A03 A;  2R5Z A;  1B72 B;  4C3I J;  4C3H J;  3JRC A;  2DTZ A;  3I4N J;  2DMQ A;  3S1Q J;  5FKM A;  4FCY A;  1Y1V J;  3JRH A;  5J1Y A;  2W48 A;  4AC0 A;  5FKN A;  1XC5 A;  1NTC A;  3GTO J;  5E3M A;  5GPC A;  3MVP A;  3M3Y J;  4XID A;  3O8G A;  5K7F A;  5M5Y J;  2ID6 A;  4EEF G;  1HCR A;  2GLO A;  1YRN B;  3SDG A;  2EQR A;  5EEA A;  1QVU A;  3VPR A;  1WH7 A;  2O7O A;  4XIC A;  1QVT A;  3IV5 A;  3SFI A;  4M3G A;  4M3F A;  2DN0 A;  3BT9 A;  3LSR A;  2XPV A;  1WCM J;  3E7L A;  1VI0 A;  2EZL A;  1CQT A;  2H8R A;  5J1U A;  2PMZ N;  2CRG A;  4IHY A;  1RES A;  3OIO A;  3H0G J;  2WV1 A;  1WH5 A;  2LK2 A;  2ME0 A;  3MN2 A;  5EF6 A;  2NVT J;  2GBY A;  2HXO A;  2R5Y B;  1XS9 A;  2EBI A;  3CCY A;  2E2H J;  3JRE A;  2DMP A;  3O8H A;  2R5Y A;  1B8I B;  2VKE A;  4XRS A;  5K7H A;  1SFO J;  1JT0 A;  1VND A;  2TRT A;  3Q0V A;  3S16 J;  5F08 A;  2EZI A;  4QSH A;  4RDU A;  4DYR A;  3RZD J;  5BNG A;  5JLW A;  3FIS A;  2RAE A;  1ETW A;  1JKQ C;  1JUS A;  3K7A J;  3CMY A;  2E19 A;  3FKI J;  2M34 A;  1LFB A;  2R5Z B;  4BBS J;  1B72 A;  1ETQ A;  4FE4 A;  2HI3 A;  2ME6 A;  1ETV A;  3LSP A;  2DMN A;  1D5Y A;  3DCF A;  1IG7 A;  4G12 A;  4AYB N;  3BG9 A;  2IEK A;  3IH4 A;  5IYC J;  3HGY A;  1OCP A;  2P81 A;  1GVD A;  4M3E A;  2HOT A;  2CUE A;  5E3O A;  1Z0X A;  2M8G X;  2WAQ N;  1GUU A;  5C44 J;  5IOY A;  4ABZ A;  5F27 A;  2AHQ A;  3RKQ A;  1ZTR A;  3GTP J;  2MW8 A;  2FD5 A;  3BTL A;  3A01 B;  5IPA A;  1W0T A;  1OCT C;  3D1N I;  3JRB A;  1AKH A;  3BG5 A;  4IHW A;  3A01 A;  4Y52 J;  4BY7 J;  1ORK A;  4J19 A;  1ENH A;  1RR7 A;  2LKX A;  2EZH A;  1JUM A;  1MBJ A;  2ELK A;  3S14 J;  3OOU A;  3I4M J;  2CQQ A;  3Q3S A;  3TW7 A;  5M5W J;  2GM4 A;  2LTP A;  1MBH A;  3JR9 A;  5HOD A;  1X2N A;  2XGE A;  5IP9 J;  5DTD A;  2R0Q C;  1HDP A;  1FTT A;  4XK4 A;  2MSY A;  4D5F A;  2WB1 N;  3SJM A;  2R92 J;  1OFC X;  2M2E A;  3BR2 A;  3IH3 A;  5EZG A;  3L1P A;  3W6V A;  1Z77 A;  4DYQ A;  4X6A J;  1XG1 A;  1APL C;  3ZQC A;  4CYC A;  4A3D J;  3GTL J;  2DA7 A;  5IYD J;  4BBR J;  3B6C A;  3BR3 A;  5K7Z A;  4A93 J;  3BQY A;  4JX6 A;  4A3I J;  1BW6 A;  1AHD P;  3GTM J;  2XPW A;  4M3D A;  2K9N A;  2QCO A;  4AUX A;  4X1E A;  4V2G A;  3GTG J;  2NVQ J;  5F0H A;  1MBK A;  1P7J A;  3OSG A;  3S1M J;  2Y9Z A;  1F43 A;  2CQX A;  1T33 A;  2L7M P;  1UG2 A;  2XB0 X;  2NS7 A;  4W97 A;  3GTK J;  1ZQ3 P;  3OSF A;  1HOM A;  2B63 J;  2JJ7 A;  3HDD A;  2LVS A;  5E3L A;  3BTC A;  3S1R J;  3FK7 A;  2XGD A;  1ITY A;  5J3L A;  2KT0 A;  3LNQ A;  3ZQF A;  4JYK A;  1LE8 A;  1JKP C;  3K2A A;  4JX4 A;  3CQZ J;  3JRD A;  3BR5 A;  3BTJ A;  5EGO B;  1LE8 B;  5FJ8 J;  1MH4 A;  3IH2 A;  2LY9 A;  2K9Q A;  1RPW A;  4RBO A;  1LFU P;  5EGO A;  2VI6 A;  1U9N A;  2CJJ A;  1VF9 A;  2LP0 A;  3ZQL A;  2LFB A;  1ETO A;  1ETK A;  3S2H J;  2X48 A;  2XSD C;  2NOG A;  2E2I J;  2R7Z J;  3HOV J;  2L9R A;  3ZQH A;  4FTH A;  1IGN A;  5IP7 J;  3Q0U A;  5EG0 A;  1RKW A;  5F1J A;  4A3B J;  1IRZ A;  1E3O C;  3RZO J;  1ZR2 A;  3HM5 A;  2VUM J;  4HNV A;  4FE7 A;  3G1M A;  2X9D A;  4CYC B;  1B8I A;  4UUS B;  4IEJ A;  4A3E J;  5FLV A;  3BQZ A;  5IYB J;  2M9H A;  3ZQG A;  2Y2Z A;  3NAR A;  1MBE A;  2ECC A;  4JX5 A;  1A5J A;  2XPU A;  5F0F A;  2EH3 A;  1FTZ A;  2ID3 A;  2EZK A;  2JA5 J;  2NVX J;  1T56 A;  1GT0 C;  1HF0 A;  4LOC A;  4UUT A;  4DW6 A;  2Y9Y A;  5DS9 A;  3HOZ J;  2DA6 A;  4A3J J;  3F0C A;  5C3E J;  2MG4 A;  1UMQ A;  1MSF C;  3TP3 A;  2K9S A;  2R93 J;  2Y30 A;  4BY1 J;  1NK2 P;  1SAN A;  2LR8 A;  5IOZ A;  3RQI A;  1OJL A;  1DU0 A;  4A3M J;  1MBF A;  4IHV A;  1IDZ A;  2HOA A;  3A02 A;  4QIW N;  2XB5 A;  3TP0 A;  1HDD C;  1I3Q J;  5F04 A;  2Y31 A;  3WHB A;  1IUF A;  3G1L A;  5IP6 A;  2IBD A;  5JLX A;  5EZH A;  4D7N A;  1VFC A;  3S2D J;  3FK6 A;  2DA5 A;  4A3G J;  4M6V A;  1TWA J;  2E2J J;  4L5E A;  5M5X J;  2HDD A;  3HOW J;  1U8B A;  2HYJ A;  5FKO A;  4A3F J;  1RET A;  2L0K A;  4MIM A;  3JRF A;  1RKT A;  1MH3 A;  2H1K A;  1JTX A;  3S17 J;  4XRS G;  4S0H B;  1MNM C;  2YUS A;  3GTQ J;  4D7M A;  1IDY A;  1TWG J;  1WGX A;  3LSJ A;  4BKX A;  5C4J J;  2FJ1 A;  1JUP A;  1JKO C;  3QPS A;  1H88 C;  1AU7 A;  4MO7 A;  1GDT A;  3WHC A;  4A3K J;  2L7Z A;  5M3M J;  3QQA A;  3CDL A;  1F36 A;  1TC3 C;  1P7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...