3POAA

Structural and functional analysis of phosphothreonine-dependent fha domain interactions
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
TSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of phosphothreonine-dependent FHA domain interactions
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptide binding protein
molecule keywords Putative uncharacterized protein TB39.8
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3poaA00
1K2NA 2JKDA 3UN0A 1GXCA 5E50A 1J4OA 1G6GA 2W3OA 5A8IA 1G3GA 1K3NA 4G2SA 1UHTA 4H87A 1J4PA 3VA1A 1YJ5C 3I6UA 3KT9A 1QU5A 2FF4A 4EGXA 3I0MA 1FHRA 2KB3A 2LC1A 1J4LA 1UJXA 3ELSA 3PO8A 3UMZA 1K3QA 1K2MA 2G1LA 3UV0A 1J4KA 1J4QA 2CSWA 3VA4A 1WV3A 2JQJA 3I6WA 1YJMA 1FHQA 1K3JA 3UNNA 2A0TA 2BRFA 2EH0A 3I0NA 2JPEA 1LGPA 2AFFA 2PIEA 2JQIA 5DJOA 2XT9B 3HX1A 4A0EA 2FEZA 3ELVA 2JQLA 3GQSA 3POAA 3VPYA 4EJQA 1LGQA 1R21A 2KB4A 2KFUA 3HUFA 4QCJA 3UNMA 3HUEA 3OUNA 1MZKA 1WLNA 1DMZA 4D9VA 4JONA 3UOTA 2KKLA 3MDBA 3FM8A
chains in the Genus database with same CATH superfamily
1K2NA 2JKDA 4JIVD 4H87A 1UHTA 3VA1A 3V8MA 1FHRA 1QU5A 2FF4A 3V8QA 1J4LA 1MK2A 1K3QA 3PFNA 3V7YA 1J4QA 5DHRA 5JEOA 1WV3A 3V7UA 1YJMA 2I2FA 1ZOQA 1QWTA 1YT5A 5JEKA 2JPEA 2P1RA 1KHXA 5DHUA 5EJFA 2XT9B 4A4YA 5JEMA 5BVIA 3V7WA 1U7VB 3GMJA 2I2CA 1R21A 3UNMA 3V8RA 3V8NA 3V8PA 4JONA 3VZCA 1U7VA 1GXCA 1J4OA 4KU0D 1DD1A 1G3GA 4G2SA 5EJIA 4EGXA 1MR1A 2I2DA 1U0TA 2KB3A 3PO8A 3VZDA 1SUWA 1Y3IA 1J4KA 4HAOA 5DHTA 1Z0UA 3I0NA 1Z0SA 3A77A 2PIEA 5EJGA 3HX1A 3AFOA 5DHQA 3VZBA 3HUFA 1MZKA 3T5PA 5A8IA 1K3NA 3UOTA 2KKLA 2I2AA 3FM8A 4D9VA 3S40A 4V24A 5E50A 2I29A 1J4PA 1YJ5C 3I6UA 4JIWD 2QV7A 4WERA 1YGSA 3DSHA 3UMZA 4DY6A 5C4VA 1K2MA 1U0RA 3UV0A 3VA4A 1DEVA 2JQJA 5DHSA 1J2FA 3UNNA 2A0TA 2AN1A 2BONA 2BRFA 1Z0ZA 2EH0A 1LGPA 2AFFA 2QVLA 5DJOA 2FEZA 1G88A 2JQLA 3ELVA 3POAA 4R9PA 1LGQA 2KFUA 2KB4A 4QCJA 2I1WA 3DITA 3OUNA 5DHPA 1WLNA 1MJSA 3UN0A 5JEJA 5JELA 4WRRA 2XXSA 1G6GA 2W3OA 4EJQA 5JERA 3KT9A 3I0MA 2LC1A 1UJXA 3ELSA 1U7FA 1U7FB 2G1LA 2CSWA 3I6WA 1FHQA 1K3JA 3V80A 2Q5FA 2JQIA 4A0EA 3GQSA 1KHUA 3VPYA 1DMZA 1Y3HA 2I2BA 3HUEA 2JGRA 5EJHA 4L02A 3MDBA
chains in the Genus database with same CATH topology
1K2NA 2JKDA 4JIVD 4H87A 1UHTA 3VA1A 1FHRA 1QU5A 2FF4A 1J4LA 1MK2A 1K3QA 1J4QA 5JEOA 1WV3A 1YJMA 1ZOQA 1QWTA 5JEKA 2JPEA 2P1RA 1KHXA 2XT9B 4A4YA 5JEMA 5BVIA 1U7VB 3GMJA 1R21A 3UNMA 4JONA 3VZCA 1U7VA 1GXCA 1J4OA 4KU0D 1DD1A 1G3GA 4G2SA 4EGXA 1MR1A 2KB3A 3PO8A 3VZDA 1J4KA 3I0NA 3A77A 2PIEA 3HX1A 3VZBA 3HUFA 1MZKA 3T5PA 5A8IA 1K3NA 3UOTA 2KKLA 3FM8A 4D9VA 3S40A 4V24A 5E50A 1J4PA 1YJ5C 3I6UA 4JIWD 2QV7A 4WERA 1YGSA 3DSHA 3UMZA 5C4VA 1K2MA 3UV0A 3VA4A 1DEVA 2JQJA 1J2FA 3UNNA 2A0TA 2BONA 2BRFA 2EH0A 1LGPA 2AFFA 2QVLA 5DJOA 2FEZA 1G88A 2JQLA 3ELVA 3POAA 4R9PA 1LGQA 2KFUA 2KB4A 4QCJA 3DITA 3OUNA 1WLNA 1MJSA 3UN0A 5JEJA 5JELA 4WRRA 2XXSA 1G6GA 2W3OA 4EJQA 5JERA 3KT9A 3I0MA 2LC1A 1UJXA 3ELSA 1U7FA 1U7FB 2G1LA 2CSWA 3I6WA 1FHQA 1K3JA 2JQIA 4A0EA 3GQSA 1KHUA 3VPYA 1DMZA 3HUEA 2JGRA 4L02A 3MDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2N A;  2JKD A;  3UN0 A;  1GXC A;  5E50 A;  1J4O A;  1G6G A;  2W3O A;  5A8I A;  1G3G A;  1K3N A;  4G2S A;  1UHT A;  4H87 A;  1J4P A;  3VA1 A;  1YJ5 C;  3I6U A;  3KT9 A;  1QU5 A;  2FF4 A;  4EGX A;  3I0M A;  1FHR A;  2KB3 A;  2LC1 A;  1J4L A;  1UJX A;  3ELS A;  3PO8 A;  3UMZ A;  1K3Q A;  1K2M A;  2G1L A;  3UV0 A;  1J4K A;  1J4Q A;  2CSW A;  3VA4 A;  1WV3 A;  2JQJ A;  3I6W A;  1YJM A;  1FHQ A;  1K3J A;  3UNN A;  2A0T A;  2BRF A;  2EH0 A;  3I0N A;  2JPE A;  1LGP A;  2AFF A;  2PIE A;  2JQI A;  5DJO A;  2XT9 B;  3HX1 A;  4A0E A;  2FEZ A;  3ELV A;  2JQL A;  3GQS A;  3POA A;  3VPY A;  4EJQ A;  1LGQ A;  1R21 A;  2KB4 A;  2KFU A;  3HUF A;  4QCJ A;  3UNM A;  3HUE A;  3OUN A;  1MZK A;  1WLN A;  1DMZ A;  4D9V A;  4JON A;  3UOT A;  2KKL A;  3MDB A;  3FM8 A; 
#chains in the Genus database with same CATH topology
 1K2N A;  2JKD A;  4JIV D;  4H87 A;  1UHT A;  3VA1 A;  3V8M A;  1FHR A;  1QU5 A;  2FF4 A;  3V8Q A;  1J4L A;  1MK2 A;  1K3Q A;  3PFN A;  3V7Y A;  1J4Q A;  5DHR A;  5JEO A;  1WV3 A;  3V7U A;  1YJM A;  2I2F A;  1ZOQ A;  1QWT A;  1YT5 A;  5JEK A;  2JPE A;  2P1R A;  1KHX A;  5DHU A;  5EJF A;  2XT9 B;  4A4Y A;  5JEM A;  5BVI A;  3V7W A;  1U7V B;  3GMJ A;  2I2C A;  1R21 A;  3UNM A;  3V8R A;  3V8N A;  3V8P A;  4JON A;  3VZC A;  1U7V A;  1GXC A;  1J4O A;  4KU0 D;  1DD1 A;  1G3G A;  4G2S A;  5EJI A;  4EGX A;  1MR1 A;  2I2D A;  1U0T A;  2KB3 A;  3PO8 A;  3VZD A;  1SUW A;  1Y3I A;  1J4K A;  4HAO A;  5DHT A;  1Z0U A;  3I0N A;  1Z0S A;  3A77 A;  2PIE A;  5EJG A;  3HX1 A;  3AFO A;  5DHQ A;  3VZB A;  3HUF A;  1MZK A;  3T5P A;  5A8I A;  1K3N A;  3UOT A;  2KKL A;  2I2A A;  3FM8 A;  4D9V A;  3S40 A;  4V24 A;  5E50 A;  2I29 A;  1J4P A;  1YJ5 C;  3I6U A;  4JIW D;  2QV7 A;  4WER A;  1YGS A;  3DSH A;  3UMZ A;  4DY6 A;  5C4V A;  1K2M A;  1U0R A;  3UV0 A;  3VA4 A;  1DEV A;  2JQJ A;  5DHS A;  1J2F A;  3UNN A;  2A0T A;  2AN1 A;  2BON A;  2BRF A;  1Z0Z A;  2EH0 A;  1LGP A;  2AFF A;  2QVL A;  5DJO A;  2FEZ A;  1G88 A;  2JQL A;  3ELV A;  3POA A;  4R9P A;  1LGQ A;  2KFU A;  2KB4 A;  4QCJ A;  2I1W A;  3DIT A;  3OUN A;  5DHP A;  1WLN A;  1MJS A;  3UN0 A;  5JEJ A;  5JEL A;  4WRR A;  2XXS A;  1G6G A;  2W3O A;  4EJQ A;  5JER A;  3KT9 A;  3I0M A;  2LC1 A;  1UJX A;  3ELS A;  1U7F A;  1U7F B;  2G1L A;  2CSW A;  3I6W A;  1FHQ A;  1K3J A;  3V80 A;  2Q5F A;  2JQI A;  4A0E A;  3GQS A;  1KHU A;  3VPY A;  1DMZ A;  1Y3H A;  2I2B A;  3HUE A;  2JGR A;  5EJH A;  4L02 A;  3MDB A; 
#chains in the Genus database with same CATH homology
 1K2N A;  2JKD A;  4JIV D;  4H87 A;  1UHT A;  3VA1 A;  1FHR A;  1QU5 A;  2FF4 A;  1J4L A;  1MK2 A;  1K3Q A;  1J4Q A;  5JEO A;  1WV3 A;  1YJM A;  1ZOQ A;  1QWT A;  5JEK A;  2JPE A;  2P1R A;  1KHX A;  2XT9 B;  4A4Y A;  5JEM A;  5BVI A;  1U7V B;  3GMJ A;  1R21 A;  3UNM A;  4JON A;  3VZC A;  1U7V A;  1GXC A;  1J4O A;  4KU0 D;  1DD1 A;  1G3G A;  4G2S A;  4EGX A;  1MR1 A;  2KB3 A;  3PO8 A;  3VZD A;  1J4K A;  3I0N A;  3A77 A;  2PIE A;  3HX1 A;  3VZB A;  3HUF A;  1MZK A;  3T5P A;  5A8I A;  1K3N A;  3UOT A;  2KKL A;  3FM8 A;  4D9V A;  3S40 A;  4V24 A;  5E50 A;  1J4P A;  1YJ5 C;  3I6U A;  4JIW D;  2QV7 A;  4WER A;  1YGS A;  3DSH A;  3UMZ A;  5C4V A;  1K2M A;  3UV0 A;  3VA4 A;  1DEV A;  2JQJ A;  1J2F A;  3UNN A;  2A0T A;  2BON A;  2BRF A;  2EH0 A;  1LGP A;  2AFF A;  2QVL A;  5DJO A;  2FEZ A;  1G88 A;  2JQL A;  3ELV A;  3POA A;  4R9P A;  1LGQ A;  2KFU A;  2KB4 A;  4QCJ A;  3DIT A;  3OUN A;  1WLN A;  1MJS A;  3UN0 A;  5JEJ A;  5JEL A;  4WRR A;  2XXS A;  1G6G A;  2W3O A;  4EJQ A;  5JER A;  3KT9 A;  3I0M A;  2LC1 A;  1UJX A;  3ELS A;  1U7F A;  1U7F B;  2G1L A;  2CSW A;  3I6W A;  1FHQ A;  1K3J A;  2JQI A;  4A0E A;  3GQS A;  1KHU A;  3VPY A;  1DMZ A;  3HUE A;  2JGR A;  4L02 A;  3MDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...