3POEA

Crystal structure of the masp-1 cub2 domain bound to ca2+
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
CSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Mannan-binding lectin serine protease 1
total genus 20
structure length 112
sequence length 112
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3poeA00
5CISA 2QQLA 3POFA 5CKMA 2QQOA 4LOSA 3POGA 1SFPA 1SPPA 3POJA 1SZBA 3POBA 3POIA 2QQMA 4LORA 1SPPB 1NZIA 4LOTA 1NT0A 4LMFA 3DEMA 3KQ4B 5CKNA 2WNOA 2QQKA 5CKQA 4GZ9A 3POEA
chains in the Genus database with same CATH superfamily
1QEXA 5M0TA 1JOBA 1VPHA 3NNLA 5CFCA 1O91A 2AUYA 1QXRA 2C4XA 1XE7A 2JB4A 1COV1 5HPOA 2WAOA 2FDJA 3WHTA 3M1HA 2WZ8A 2A7AA 2WZR1 2OT7A 4C90A 2AR6A 2VG9A 2R061 1WCSA 4XE9A 4B7KA 2FMYA 5FZGA 4GWNA 1NT0A 5BXXA 3K2OA 3RVHA 4XUQA 5JOYA 4AEJA 4HK9A 1UX6A 4M3CF 2ZCWA 3AYDA 4N7IA 5A33B 4I09A 5J3UA 5LWBA 3V65A 5FYVA 4OMCA 4CXXA 2WR9A 1VP6A 1WLTA 3F2ZA 4Y1ZA 1AYN2 4M4RA 4GB33 1YJKA 2WFPA 1OMIA 3BALA 1VBA2 4NRPA 5DPNA 5CG8A 3C7HA 4XOGA 4YFZA 3VL9A 4E4ZA 2WFF2 5CG9A 1ZZ7A 1LAJA 3ACIA 3GJBA 1S2BA 5ERLA 4AI8A 1Y9GA 4BA6A 1U0AA 2QQMA 4META 5FUNA 3SEEA 2QCSB 3K4ZA 4K21A 2Q8DA 4LPLA 1RUG3 2HLEA 5FKBA 5IATA 1KRIA 4FOYA 4RFRB 1BCXA 5DQ0A 1QOTA 2JG9A 3W5NA 1OA2A 3UJQA 2HYXA 3P1IA 1QJY2 1LGNA 3SCFA 2Y64A 4CRQA 5I0RA 4PIXA 3RZMA 4S2DA 2VR4A 1VAMA 2VMFA 4Q4V1 5FJHA 2XQRA 2J1VA 3JXSA 1IG0A 2DUPA 1AYM2 2UY9A 1F5FA 4XAAA 1GQHA 1XSRA 3ZYPA 3RZZA 3WP4A 4FTSA 1M4WA 1YRZA 5HV0A 1C1FA 5FK7A 4I30A 4WM7C 1CIYA 4UW6A 5H9QA 4BQWA 1ZNPA 3N9LA 4UFKA 4FXKB 1UOJA 3B02A 2QBXA 4AGRA 4E4HA 4N8MA 3RPQA 4I0WB 4IW3A 4EN7B 4LBQB 4WBBA 3ECQA 2O8QA 4LE3A 5A7QA 3RZKA 1RUC3 1VBE1 2ZX3A 1PK6C 1RUOA 1ZM1A 1AR63 4GKYA 1CZVA 1PVC2 2VTXA 4YVWC 2A6ZA 3NV4A 4HN0A 4QXBA 3ZXGA 3H1YA 4CDWB 5A6QA 4CYDA 2CV6A 3DGTA 4AQ2A 5FY5A 4HKLA 1PM7A 1DBNA 4ARXA 2XXZA 3POBA 4W6WA 5EPAA 2WIIB 4Q29A 2DVGA 4YWAA 2ID4A 4OHVA 1V0AA 4DB5A 1UN1A 5JSRA 1L3JA 1TNFA 4KH9A 3VHNA 2GZWA 4L8QA 3WDVA 1YWKA 5FYMA 2WS92 3DEMA 3CF6E 1RTVA 2GU9A 4LLFA 4D69A 3WQBA 2A5ZA 4JKMA 4EN0A 4CA9A 4R9BA 1CR7A 2XUEA 3RJRA 4Q8KA 2YBPA 1HXS2 1OLQA 5FKCA 2G19A 4K6BA 5FYCA 3RRDA 1VBC2 1LEMA 3NKGA 1CZTA 1X8MA 4Y5SA 3S5AA 3W20A 1W2AX 3FUOA 2DTYA 5A3UA 5KWRA 4AK3A 1G6NA 3AYCA 3MW4A 3VBOB 2B4KA 3AP9A 3M3OA 1UWWA 4AR2A 4IEYA 2ZGSA 3AMHA 3M3QA 2BNNA 1I3HA 4Y1YA 5ISLA 1B35B 2WJSA 3NNJA 1ULEA 5E88A 3FC0A 4HSLA 3TN93 2GMEA 3D0JA 1RUD2 2Y6LA 1PHMA 1K42A 2RS31 1MS1A 4YZ5A 4LK6A 3AMNA 3AL6A 3VDAA 3BTAA 1W90A 1CAUA 1UY0A 1ULFA 2VOWA 3NKTA 1PZ8A 3VUOA 5FPUA 1K45A 3U75A 4EQVA 4OVEA 4AG4A 4XMIA 4D6RA 2EICA 5GLWA 4Q2FA 1AR91 3MW3A 2TNFA 4OZXA 4ARYA 3LFMA 4AFCA 2JDYA 3HNYM 4HLTA 3RWNA 5I0SA 1MZEA 4NAOA 4XVHA 1RUH2 2VW1A 3IKWA 4ES9A 1YFXA 4GWIA 5IVCA 1UOFA 4GQ7A 3OYWB 4YW3A 4QGNA 3BUCA 4UF0B 1POV1 2YGMA 3W5MA 3TEZA 2JDHA 4AVBA 4LE4A 3U07A 4UFMA 2HBUA 1PZ9A 3OUJA 2WNEA 2BOJA 2W1UA 2RDNA 1YUDA 1PGL2 1E57A 2MPFA 4M00A 2Y0OA 1F5JA 1N3QA 2Z79A 4BK5A 3BIEA 3ZYIB 1V6KA 3WNPA 2VVDA 5CFDB 4K8FA 3DN7A 1UMHA 2XQXA 5I8YA 3N9QA 5T5JA 3BYWA 1DGRA 1ULCA 4KWLA 1H4HA 4QMAA 1GICA 5FMOL 4BISA 2XL9A 2EVXA 2YGLA 3MW2A 1ZZCA 4DRRA 5LA9A 3CKHA 1CAVA 2HJIA 2FDKA 1QJZA 3VBHA 1QOSA 3VHRA 1I6XA 1UNBA 3NSTA 4FAHA 2VH9A 5KXEA 1K3IA 3ZFGA 5IAVA 1AL22 1V9U1 4S2HA 5CAZA 4LJHA 2GALA 2HYKA 3ZXKA 3AZVA 1BEV2 5ANNA 3ZXFA 1G9DA 5LRSA 2XJSA 2H6BA 4MO3M 1CWPA 3BOWA 5A3OA 1JZ4A 3WQ7A 1JZ5A 4CEWB 2QJVA 2D43A 1W6OB 4Q26A 2B42B 4BHPA 1BK0A 1VAKA 1SMVA 4HBNA 1GQPA 2WN3A 3E1F1 2P4EA 2VULA 2OA2A 4NWVA 4IEQA 3WG3A 1YHFA 4CDUA 1ENRA 1W6OA 4BPZA 2OQ6A 2WZR3 4RR3B 2XH6A 1LESA 1W3XA 2Q4SA 5C4WC 3MV01 1S0DA 4EWAA 5LASA 4Z2WA 1LJ7A 1SLAA 1K5JA 1W9TA 3OGVA 4E2QA 3AVRA 1NCRA 1LCLA 5CFCC 3C7OA 2PHUA 4UFJA 2XR4A 1S2EA 5LW9A 5C8CA 1OA3A 5GKAC 1UL9A 3S0MA 2Y34A 3CU7A 4XCBA 5SV5A 4BWOA 3AXDA 3KQ4B 3OBAA 2JE7A 2NP0A 1YEWA 4C1WA 5EV7A 3T0DA 1PO12 2DCYA 1ZBA1 4PDWA 2DVAA 3X29B 3HIFA 1TMF2 2E33A 4RGAA 2D6PA 3K51A 4H14A 2X5IC 3VBUA 2E7TA 1REEA 1OQDA 4XBNA 3KT4A 3VBFB 1FYUA 4LT5A 4B4RA 1JS9A 1CAUB 1Y43B 4L97A 5FY4A 4Y1VA 3NAPA 3IDCB 4QX8A 2A1XA 3WG2A 2IFWA 1W8ZA 4XF9A 3S57A 4CEYA 5FY8A 4AZZA 1GZ9A 2CTVA 3OUHA 1NQJA 1DZTA 4IL7A 4URTA 4ZZ5A 3ZFGC 3KCYA 2XJPA 5L7OA 1VAVA 3LFIA 3IBMA 2GC2A 1N3OA 4HT1T 5F37A 2CAVA 2DFCA 2OUJA 4QWNA 4P5HA 3RWKX 4CCEA 1R1ZA 2FZ1A 1MS3A 3T4HB 4EZHA 1AX1A 2X5IB 5GZDA 4EWEA 1JOPA 1OA4A 4Y20A 1NAEA 3SISA 5DG2A 4ZZ8A 5JPMB 2BERA 4XF4A 4HETA 4PJYA 3I2JA 5FXZA 2UYBA 2ZACA 4IESA 1C1LA 3RZGA 4ZS2A 5JXIA 1NOVA 1BQPA 2YBKA 5IYYA 5F1RA 1JYXA 1RUC1 1Q3EA 4IV1A 1VBE3 4MGIE 4YZ3A 2W47A 5E16A 3UKNA 4HPKA 3WEZA 4KG8A 3WNOA 5FYIA 3AZYA 1VMJA 2BZDA 4O7XA 4MH0E 4RGGA 2WNOA 1LNSA 5GZEA 4CP9A 5BNPA 3LOBA 3NMBA 4YM3A 3RDIA 5FZ8A 5HCHA 4BQ4A 1CN1A 3LEGA 1T6BX 3B01A 4XHXA 1HV1A 2I07B 5GJ6A 5H9RA 3S7EA 4UFLA 2D6MA 3QACA 2PHWA 1PIV1 2IXKA 3ZPOA 5BNQA 1W0PA 5CYYA 2B9UA 1SDWA 4B7EA 2EXJA 4FVVA 3VBUC 5FZ6A 3MIBA 3R6SA 1P8JA 5E8AA 5FP4A 1X36A 4BQ3A 1IS3A 5I0DA 2C1FA 3NV2A 1G7YA 4XYXA 3VBOA 3H50A 1RVF1 3GHNA 1A8DA 1QU0A 3WCRA 1UYXA 3ZFEA 3H8OA 1D4M1 4JDMA 3VBSC 4QT6A 1OXCA 1TME1 2ZEXA 4MADA 2WRAA 3H3LA 3OPTA 5FLHA 5F39A 3E5XA 4TZDA 4FTBA 3MI8A 1W39A 2CWMA 5AFBA 1WD4A 1NCQB 1V00A 5EFUA 2CGNA 4AYUA 5FTTC 1RUH3 3LWCA 2MHFA 2RMU2 3TN91 1CESA 2ZABA 3WZ1A 3I7DA 2V73A 1EAH1 1WWYA 3CLPA 2ZXQA 1PGL1 2GP3A 3MLLA 4IEXA 4QX5A 1FMD1 3LE0A 2RS52 2JDKA 4OUSA 4QX2A 4WVZA 4XETA 5FK8A 4E27A 5GLVA 2OW4A 4LMFA 5FZEA 1BVP1 3LEKA 1GWKA 1F31A 2GC0A 1HRV1 1IS5A 2D93A 5D2AA 5K8SA 2WZEA 4LUMA 1HN0A 2RS11 1GUIA 4IUGA 2WSUA 5L9BA 3U14A 5KHKA 5LA0A 1QJU2 4W50A 4CU7A 2HEVF 3N9PA 4HZFA 3EB7A 2JE8A 2PAMA 2C9KA 1RMU1 4RL7A 4DNYA 1D0HA 3MGUA 4EYUA 3ZXDA 3IM0A 1MQTA 1OC1A 2E31A 2BQPA 3C3VA 2OYZA 2JXAA 5FJKA 5A6YA 3NW4A 1WGPA 3AKTA 4XILA 1PGSA 3KCXA 1GZWA 1MR5A 3ITQA 5A7OA 3PVEA 4XFBA 5HV4A 3LPGA 1HQNA 1HJGA 1LOGA 1W8NA 2IC1A 1OOPB 4RHV2 1BYHA 3VL8A 4XFHA 3ZYBA 3UV9A 4DUWA 2OIIA 2GH2A 1DYOA 2AACA 5CNAA 1ULGA 1TQ5A 1W2TA 4XDPA 2DYCA 3VBOC 4BXSV 2YU2A 2FQPA 3ZKYA 4AFMA 4YARA 2FZ2A 3O12A 2IXJA 3B9CA 3IT8A 1O59A 4N43A 3BODA 4YGBA 4WV8A 4EZ4A 2P6CA 3J7HA 1H8TA 5CEHA 4MZUA 4N90A 2P3KA 3FUQA 1FX5A 4JZRA 2JG8C 4OULA 2QE3A 4Q4Y3 1OF3A 3HBKA 1C28A 3M70A 4MYEA 4HKWA 4AVTA 4LBMA 1H6XA 2VZQA 3OGJA 2R063 2W0XA 4M3CB 1L7RA 4LKFA 5A70A 5I91A 3KF3A 4QPGA 2ORXA 3IWZA 3VBHC 5EXOA 2HBTA 5JOWA 1TMF1 4XFAA 1OQEA 5C9AC 2Y6FA 1YQ6A 4JGYC 1W9SA 3WW1A 2D97A 5DZEA 4DRVA 1HLCA 3NJYA 1PO23 5CB7A 2VXJA 1VB2A 4QX7A 4MGTA 2HWB2 5CKMA 2XOMA 3ABZA 3WHUA 2QQOA 4HKOA 3THPA 2GC3A 4DOUA 1I5ZA 4P14A 3PHMA 5IVYA 1SFPA 1UZVA 2P3YA 4XW3A 2ARAA 4R4XA 4N9IA 4DUVA 1W9FA 1W6MB 2WT0A 4Q4X3 3KHBA 5GLUA 1WCQA 1UXZA 3V0BA 5JOZA 1UYZA 1QNWA 1AR62 3ES1A 4NVPA 4KL1A 2KXLA 3O0WA 3AKRA 4WVMB 1ULDA 2V72A 4H7MA 1DGLA 2OPWA 4GIQA 2HWB1 4KG0A 3RMXA 3BB6A 5DABA 1D0GA 2V5DA 4XZPA 2OUHA 1LOEA 2F17A 4CVUA 3RZLA 1W6QA 1O4YA 4Z92B 2LW8A 4O9EA 1O4ZA 2RS13 2WA4A 3ILFA 4X6QB 2WWJA 1QMJA 1SBDA 3W59A 4CUAA 5JMCA 1HB1A 2EIEA 2KD7A 1EV11 1GNYA 1ZRRA 3W58A 4GWJA 4YW5A 1XRUA 4JDNA 1UY4A 1XB9A 2K9ZA 1MZ5A 2AENA 2WYSA 2X5IA 4YVSA 4FPOB 3VHOA 2ZZQA 2KM2A 4XXPA 4YM1A 1CX1A 2BYVE 1GOHA 5IK7A 3WG4A 1RUF1 3HN3A 4LHLA 3ZSKA 4CP1A 3HQXA 1H6YA 3HN1A 2TBVA 4RGKA 1R64A 4BK4A 1TNRA 2ET7A 1R092 3MDPA 4QPGB 5FZCA 5B2GB 2A6YA 1HDKA 1REDA 4NE9A 5FV3A 3LAGA 1VE0A 2ZTNA 5L19A 1MQTB 2J1AA 4NIIA 1MEC1 4A41A 1W05A 5LBEA 4CDQB 2FCTA 3ROUA 4D0QA 4V2VA 2ZHNA 1KS5A 5DN2A 4A3ZA 3TYJA 4RS5B 1KEXA 1YJLA 3CNAA 4G4FA 2XKPA 3SHRA 4W8JA 3QH7A 3VKFC 2PXJA 1BZWA 3GBGA 4UWDA 5C9AA 2DVFA 1CAWA 1MEC2 1TMF3 4ZPIA 1S0BA 4RR3A 5FUIA 4AAXA 4Q8LA 5K0UC 4L92A 1BEV3 1N47A 3BPZA 1JUIA 4TN7A 4QU1A 1LGBA 4LULA 3VHPA 1SBEA 2UY8A 5KXDA 2RS51 1LOCA 1OI6A 3AFKA 3BTYA 5D8AC 3FLPA 1XOYA 2OQ7A 3O14A 1YIFA 3UGHA 2BUKA 1OPMA 2EIGA 2Y6KA 5A3NA 5HCBA 3V56A 1UU5A 4JGZB 4L99A 2GSYA 3URFA 3KMHA 3OOXA 1VBD1 4FOVA 1XNAA 1LOFC 1ZRDA 4QQLA 2ATFA 5LEKA 1DIWA 1RUH1 3KM5A 3HR9A 3N7KA 3PUIA 4FO9A 2HWF1 3OF1A 1LOBA 5FDBA 2BJSA 2W9XA 1FMD3 1CX4A 1OT5A 1EYBA 2JG9B 2UU8A 5FLIA 2CNAA 2VZOA 1WMXA 4CEWC 3BI3A 1EV13 3WDUA 2FD8A 5A3TA 4L11A 1KXGA 1S1AA 3EJKA 4P02B 2OVUA 1L7QA 5FO7B 2WNVA 1ZZ6A 1REFA 3OGSA 3KF5A 1Z0HA 4G3YC 2BWAA 1HRI2 2R32A 2ZX4A 4P9XA 2E63A 5FZ0A 2RJ2A 1RUF3 1BXHA 4Q4W2 1NXMA 3ACHA 3G6JB 4NPRA 3ZYHA 3A0NA 1RMU3 1FNZA 4Q27A 2WAAA 3ORJA 4LQRA 1SACA 2A71A 4COZA 1PZ7A 4I01A 1DCSA 1DGRN 4A42A 2K0GA 4YW4A 2VZPA 4IE7A 3AP6A 1PNFA 2BU9A 3O7OA 4YG6A 3P3NA 5FZKA 5A7PA 4NHXA 1S2KA 1NX9A 5G05L 2FDIA 4CDQC 4BMBA 4DPNA 3FX3A 1AR81 4Z8BA 2G9ZA 3OPWA 4FXGB 1UAIA 3NJZA 4YFWA 3GGLA 4OFGA 1ODNA 4M3CA 2XLFA 4FPYA 5FMBA 4DEQA 3N7MA 1A6CA 1LOFA 1NKGA 2ZGUA 1GYKA 4IE6A 4NOTA 4PT6A 5FBJA 2X10A 3LSDA 2HWC1 3NNFA 4BOWA 4GB32 4BH9A 4B29A 4D6QA 1IQAA 2BNOA 4OLLA 1ND2A 2LALA 3R05A 4O9GA 3WP6A 3U11A 3UYJA 2J1UA 2C5DA 1Q8SA 5JSPA 1V6JA 3LF7A 5HCFA 4C0HA 4IEVA 2VU9A 3USUB 2HWE3 3DPRA 5JVVA 3DV8A 4Q0SA 1PO21 5JCTA 3D5OA 4MVTA 1CPMA 4DXTA 5L9VA 4JTNA 1X9TA 1VBC3 4XIOA 5F6KA 5AVPA 2RMU3 2RDSA 1JZ8A 4JKLA 3CBNA 2D3RA 5DDJ3 3V0BB 4HOOA 3PDQA 5FUPA 3E6DA 2WT2A 4PBPA 5IW0A 3VD9A 2XBO3 4AHYA 1IPJA 3HVDA 2PLV1 1QJX2 2XONA 5FZOA 3R4SA 1VBA3 2AEZA 3LD8A 4K1ZA 1RUE2 4LO8A 2W92A 4XFCA 2WNVC 3ZYGA 5LY1A 3O0VA 3CIHA 3OYWA 2P3IA 3WINE 1QIQA 1QKQA 3HEIA 3KS7A 4KBBA 4PDWB 3MIFA 1NZCA 5F3CA 1Q8QA 4ZKTB 4QX0A 2JDUA 2AC1A 2ARXA 3EQEA 5GLTA 2ERFA 1W8TA 4XURA 3BKZA 4K40A 4QGMA 4I3PA 3MBWA 4NHMA 2ARBA 4QXHA 2BDRA 2W87A 4SLIA 3OG2A 5JXHA 1WLCA 5EWSA 4A45A 1PK6B 4QHOA 1Q8PA 1TME2 2D3PA 5C3PA 1J58A 3H0OA 2JG8B 1VR3A 1W6NA 1MZ6A 1RUD1 3BVCA 3KT1A 3OJBA 4LKDA 1ZBE1 3A22A 5FYSA 3I49A 3VBSB 3MPBA 4CDQA 1ND2C 4MV2A 4GMP3 2WWUA 1OUXA 1UOBA 3ON7A 4X8PA 1OPOA 1YNAA 1GBGA 2WSVA 3A7QA 2ZGMA 4OI0A 4ET7A 3LIHA 2VBBA 2WYFA 5BV6A 4GKXA 1I9RA 3NJVA 5BNOC 2QFEA 3LDKA 4AEDA 3VGIA 2CDPA 2ARCA 3FZ3A 5F3EA 1EY2A 2VM9A 4RHV3 5EQUA 1WUVA 1PIV3 1BHGA 2YB7A 4KGQA 5CA6A 1DYKA 5GZCA 1XNTA 1J3PA 3WP5A 3WNKA 4A44A 1L7LA 1GV9A 1AL23 2WL1A 4EE2A 1PMJX 4PF5A 5AFEA 5CVRA 2DUOA 3B00A 4LLOA 3OTFA 2YZ4A 4LBLA 4OI1A 3L2HA 1W3VA 2BRTA 1UKRA 2VMHA 3JQXA 2A3YA 3DPRC 1QY4A 3FL7A 3HQUA 4ZU4A 4GJZA 1SHWB 2WBKA 1COV2 1DDLA 1RVF3 1UY2A 1QJU3 2C24A 4FOQA 2JG9C 2WZR2 5F5IA 3IPVA 1D4M3 3I3MA 3OBRA 2OS2A 4IEPA 3KV6A 4FPFA 2GNMA 4ZXKA 1RL3A 2RMU1 3TN92 4NHYA 1JW6A 2JE9A 2W52A 1EAH2 2VQTA 1YC61 2YYOA 3I2HA 3SH4A 1W6MA 3RZHA 2Q8CA 1FMD2 4RR3C 5FY0A 1GSLA 5K0UA 1W2UA 4XDOA 5FPLA 2YG0A 3AKSA 1H1AA 1UZZA 1X50A 1LECA 2SBAA 2AH2A 3DYMA 4ONUA 4FAGA 1XPWA 1VBA1 2BW8A 4NN0A 1ALYA 2NMOA 1W6NB 2V4AA 2VUAA 4H2AA 4RQPC 3ZYFA 3LA2A 4GH4B 1OD5A 3VD5A 4WM8B 4QX3A 1C57A 5EZWA 4NUBA 5J36A 2R49A 4FSJA 5IWFA 1UO9A 5EP9A 1IZ3A 5FMCA 3M3EA 5FYTA 3M7AA 5F2SA 3WDWA 5DDJ1 2H0VA 1W2OA 1EP0A 4ATEA 2CYFA 4GD4A 4LOSA 1AR71 5F9TA 1FPN1 3POGA 3H3ZA 3RS6A 5LK7B 2TEPA 1Q56A 2VZVA 5F2WA 3V0AA 3KV5A 3OB8A 4XJ9A 2LM3A 1UW8A 4N43B 1O6UA 1YO8A 3USSA 2O1QA 1ZBE3 4INDA 4YZ1A 1B09A 1FXZA 1DQ0A 2JB8A 1ASJ3 2EXIA 4XCAA 5I8SA 2R043 1POQA 4GMP1 3ZKUA 3BOPA 3ZFFA 3MFAA 5ACA2 5C3QA 5JIAA 1CQ9A 2HWD2 4FFHA 1W2NA 2KR2A 4Y4RA 1UMZA 4WZFA 3BTZA 5C8CB 1PVXA 5E89A 3AL5A 4ZONA 2FBEA 2BBAA 4COWA 3T3YA 1LEDA 2XBO2 3MF6A 1RXGA 2C0ZA 1JU4A 3ACGA 3IPVB 3MIDA 2W94A 4LHKA 1JYNA 4Q4Y1 1AR83 5E1RA 3U78A 4FQ4A 1SPPA 4GA9A 4GWMA 2JKBA 5F3IA 1CAXA 3VZMA 1ZA4A 2BP6A 2GN7A 2IXIA 3KCCA 5IT6A 2DU1A 1PMHX 5IAXA 5F7UA 3PURA 2RM23 3I3DA 5IVVA 4N53C 4P9LA 3OCPA 3VD4A 2QQKA 1POV0 2A70A 2JIJA 4IE5A 5CBLA 2RS32 1HXS3 3A21A 4TSVA 5JLVA 4XPVA 1IHMA 4GMP0 4COYA 5C70A 1LULA 3O1VA 3VDDC 2VOVA 1QGLA 4A2UA 2ET1A 4D7TA 3TOJA 5JXGA 4IGOA 1O7FA 2D7FA 4C1XA 2WO3A 2VOXA 2HWE1 1C3HA 2DF7A 1SLCA 4GULA 4Q4X1 3THCA 3UL2A 4A4AA 2JD9A 4WM8C 5A6XA 2VMCA 3GHMA 3GXUA 1SEFA 3N35A 2V4VA 1TZOA 4FI9A 3I97A 3CL1A 3P6BA 4YZ4A 2BFUL 3H8UA 1HQWA 4BCUA 3DKWA 5DAXA 1W9YA 3ZYJB 2G1MA 1WKYA 3FFQA 2VNGA 3K46A 1YCIA 4E2GA 2QUOA 4BQYA 3ZN5A 1YXWA 2J22A 2BGPA 1GU3A 3PL0A 4NR1A 4FPGA 4DUXA 3JB8A 1WA4A 2R0HA 3IDEA 4K7JA 1WW4A 5FLJA 3P5BA 1FV3A 4XC9A 3WLUA 1RUI2 1GOFA 1KS4A 2XWJB 4AVVA 1QJX3 1XNCA 3O1TA 1UIKA 5I0UA 1NUKA 2VTXJ 4PCRA 1RUF2 2X8KA 3VN4A 4QKDA 2WQ4A 2B7YA 4DXRA 2YPJA 4KU8A 1RB8G 1AYN3 5FO8B 5A32A 3AMMA 4MX3A 1APNA 1V9U2 5HI0A 2WO2A 4FP3A 1D7PM 5JMOA 5IK4A 4Q0QA 3WDYA 1VMFA 4UI9L 4DS0A 3LIGA 4XTMA 2RM22 3JQWA 5JOXA 2XWBB 4ATFA 5E6HA 3RSJA 2VMEA 1W04A 2BVBA 3D0SA 3PJYA 5JWPA 4AQSA 1NLQA 1LR5A 2R30A 4HSJA 5A33A 2J7MA 2PHXA 3AKQA 4QQPA 4XIKA 1FOD2 1KJLA 4AHWA 1QXPA 4D6SA 3ZXAC 1RUJ1 4GAZA 4QHZA 4OHZA 3J7LA 2ZKNA 1H1IA 2C6SA 2RM21 2W3JA 4D3WA 5BY5A 4YW2A 1G8WA 2GAUA 5I93A 2H6CA 3K3NA 3T4VA 1GP5A 5DUXA 2JD4A 1BEV1 1RHI3 1NCRC 4DQAA 2NN8A 1HB4A 2WQ8A 2J42A 5FPAA 3AX4A 4COUA 3HPNA 3NO8A 3ZXJA 4YVWB 4CUBA 4GXLA 3DCQA 1C8M3 4BYYA 4UW5A 3USUA 5JPNB 2RR13 2E51A 4ITCA 2P17A 1RINA 1O5LA 1AF9A 2AYHA 1PM4A 2YFZA 3J7MA 4MHRA 1RUG2 2PN5A 4PDWC 4Y24A 5B4XA 3DF0A 2DCKA 5FZFA 2D6NA 5T50A 2A6WA 1QDOA 3T08A 2IUWA 2NPIA 2RJLA 4TTGA 2ZJCA 2JG8A 3CO2A 1UU4A 4IV3A 2HWF2 2R16A 1ZYBA 1XYOA 2Y6HA 1HQLA 1FPN2 5GALA 1JI6A 2HWF3 3PUAA 1RITA 1A78A 4OYUA 2XLAA 2YC4A 2G9GA 3VZNA 2GDFA 2XJVA 5AC91 1RGSA 2P34A 3RJ2X 3MEPA 4JGYA 3WF1A 2WKKA 4P9YA 4UFIA 3I59A 4BU2A 2YC0A 4YGEA 4CXWA 5FOBB 1W8OA 4IV1C 2LRPA 2PAEA 4NIDA 4JQRA 5SV8A 4IEZA 2LTNA 3M2MA 3QD6A 4CU6A 1ZZ9A 3F95A 3PVOA 4URAA 4LO5B 3DXUA 1JOJA 1JH5A 4FOWA 2D6LX 2CY6A 1XYNA 1ND3C 1AR73 2XPJA 4LIVA 1FPN3 5L73A 4AL9A 4AI1A 4LEJA 4ASLA 2K2SA 1S0JA 2E6VA 3TEXA 2QZ2A 1WW7A 4JKKA 3OPZA 2XVKA 2WA3A 4AVSA 1W03A 5A32B 3H3UA 2K46A 5BNNA 1PX4A 2R041 2VZUA 5C5TA 2ZBJA 1WMFA 3LKJA 4CDWC 5L36A 3KZ4C 3PLQA 1YI7A 3ZMNA 4PHZA 3DUIA 4XJUA 4Y22A 1QQP1 3OY8A 3HT1A 3IZOA 2DUQA 1YFUA 1OH4A 1BMV2 3O1RA 4V1PA 5IVBA 4UBHA 1RUC2 1BBT2 1Q43A 3FN9A 2VW0A 4XF3A 1DHKB 3TEWA 3I2FA 1DU3D 2HWC3 3ZR6A 1W6PB 1Y9QA 3N9MA 2NMNA 1A3KA 1D4M2 3PMSA 3AKPA 3AMQA 4RSUA 5GM0A 3FHAA 4AWDA 2Y0IA 2ZMKA 3WF0A 2E53A 2Z69A 3LCPA 4AVCA 1XU1A 5T5PA 3VD3A 4MG2A 4YSFA 4R52A 3U10A 4XJ8A 3GCWA 3UJOA 4P9IA 2ZZJA 4LORA 4CUCA 2PMWB 2RDQA 3WCSA 2CGPA 2RV9A 5FYUA 3R4UA 4PBOA 4XFIA 1Z7S2 4L9BA 1HXS1 4MGQA 4IV3C 4P9GA 3D6EA 1GP4A 3T2PA 1VBC1 3CZJA 3GF6A 3AVSA 2R073 5FXVA 2W46A 4LHSA 3LB9A 1SQ4A 4YM0A 4XJAA 1JYWA 1WMDA 2EXKA 2ZHMA 2HEWF 3J7NA 3OD0A 4JDOA 3WP3A 3AMPA 3IIIA 1VRH3 4JAAA 1UIJA 3RYKA 5IHRA 1B35A 1W8WA 2BFUS 3DL3A 3EBRA 3PUHA 1ND3A 3SLIA 3T1MA 3NAPB 2JX9A 3D3AA 1RJ8A 3H42B 4CCMA 3GDBA 2Q8OA 3MIGA 2E26A 4Q0UA 2ZKLA 4CDXA 1WCUA 1UY3A 3OEAA 2VXRA 3GCXA 3RFRA 4M0NA 5C8CC 2QDRA 4WVVA 5CFCB 3UKTA 2F4PA 3K48A 4J6GA 1KD7A 5FYBA 4BIOA 3D8CA 2C9AA 4QPIC 2BTVC 3CJXA 1JBCA 3E97A 1MACA 1OF4A 2R062 1J1TA 1LHNA 4N43C 3KB5A 1NQDA 2XJTA 4FPEA 1GZTA 1ZBE2 1OHFA 3LEMA 1OVSA 3NV1A 4XMAA 3SMHA 3KQRA 1AZDA 3E5QA 2ZAHA 4W6XA 2JICA 3VBFC 3J8F3 4RN5A 1Q8OA 4FTEA 1RUJ2 5F8PA 1ZRIA 1AYN1 4CDWA 5CFDA 3C2UA 3ZLIA 4B4PA 1RUNA 3AZWA 1S0GA 3S7IA 1K12A 2NLRA 5FCCA 1RMU2 4EN6B 3ZN4A 3FBMA 1H2NA 2NM1A 2PA7A 5T54A 4EV0A 4CXYA 3K75B 4RS5C 3DKQA 2W1SA 3FHQA 5FPZA 1H1MA 2ZX0A 3GZAA 4QPIB 1KDKA 1IQDC 2P2KA 1QJFA 1LOAA 2BGCA 1N1TA 4RHV1 5FZDA 2D5FA 3K4AA 4I2OA 2PELA 2HWD3 1R082 3ZPYA 1CPNA 4DXZA 1OLME 2WN2A 3FE5A 4MGKE 2EXHA 2QDNA 1AL21 3T1LA 2XG3A 1X8EA 4DIQA 1I1EA 5C4WB 1NLRA 2X05A 3R4DB 2WDBA 3O1SA 1PNGA 1W06A 4LR4A 4M0HA 1ND3B 4QHBA 2UYAA 3B9IA 3ETQA 2YDEA 1CZSA 1JN2P 1Y3TA 4FT8A 4MLOA 3WW4A 1KDMA 1NY72 1Q8VA 4IEWA 4CPBA 1RHI1 2E7QA 4RA0A 1VLNA 5D8AB 2D40A 1XNKA 3ATGA 4ZU5A 3RMYA 1ZZBA 5CZKA 5BNPC 1G86A 1O8SA 1JHJA 4XBLA 2X29A 3DPRB 3LOIA 5CKQA 5FPVA 4AQTA 1JZ7A 3UGFA 1FI2A 3I2OA 2E9QA 1QJEA 4FCAA 3POEA 3PU8A 1DQ4A 5FZ9A 3SH5A 1LHVA 5FZ4A 3ZM8A 5KR7A 1VIWB 3CHXA 1OBNA 2JKXA 3CZUA 5L9RA 2PHTA 5ACA3 2JDPA 3SNMA 5FOJB 4F8AA 3WF2A 3Q8BA 4KI5M 1DZQA 1S0IA 5FZ7A 5IJRA 3WQ1A 4AFDA 5EJ3A 1IG3A 3ASIA 4B1MA 4ASMB 2RR12 1ZVFA 3CQOA 4UF0A 2Z42A 3AZZA 1X7NA 1OLRA 1WCDJ 5FFOC 3MUY1 4RFT0 4YG3A 1SFNA 3ZO0B 4DFSA 4TLFA 3SQOA 3B7MA 2GMPA 3AM2A 3G7DA 1HJFA 2J1TA 3E6CC 2PQSA 5DG1A 5JZGA 2P3JA 1EPWA 1NA1B 1VBB2 1WCKA 2CSGA 2GC1A 3B3QE 4NJ4A 4QQHA 4E8CA 1XU2A 4JHTA 4CDXB 3AK0A 4JQTA 2VL4A 2PAKA 4ZU7A 1LU1A 3WG1A 3ME2A 3M8LA 3WY6A 3C8XA 3VZOA 1O3SA 2FMDA 3ZXLA 2VMIA 2W91A 3J8F1 3JD71 4AI0A 4NAMA 2ZGLA 4PQQA 3SITA 3KV9A 4PF1A 1W0OA 3EYPA 4TXWA 5C6CA 3IN9A 4JVAA 1EV12 4LBQA 2BV4A 2WQZC 2GNTA 3T0AA 5JSOA 3RYRA 1XBFA 1NCQC 4RS5A 3SH3A 2XKOA 1R1A3 3N3HA 1BLZA 2ZX1A 1H8TB 5DUUA 2B9VA 3PUSA 4JHZA 1MEC3 4B8EA 1FNYA 2JJ6A 2DTWA 1F8VA 1NA1C 2P6HA 3JBG3 4QXCA 3OSDA 1G9FA 2WUHA 1HV0A 3ALQA 2VTFA 3J8F2 1ULOA 2KA3A 2JEMA 5D8AA 2A6XA 2A75A 4WVMA 5IVEA 3FLTA 4YPJA 4AEMA 4QAWA 2XJRA 2F6BA 3C7FA 2QTWB 4W6YA 2HH9A 4A7KA 4WM7B 5DZFA 4D7SA 3HJRA 5JIUA 2XHKA 1X82A 3LDBA 4HONA 1RUI1 1STMA 1OVPA 1XSQA 5H9PA 1WW6A 1H9PA 4FPLA 4AXOA 2R1DA 1W9WA 1US3A 2P5BA 5FQ0A 5F6LB 2X53S 5IVFA 5C7GA 3WUDA 1H2KA 1MS4A 3VKNA 5A3PA 1JU3A 2MNGA 3ZN6B 1DP0A 1UPIA 4XFFA 1ODMA 1JXNA 4AI3A 3H1MA 3VKLA 2V09A 4BIFA 4AEKA 1ACCA 1H8VA 4UAPA 3T09A 5FYHA 2J1EA 4YW7A 1SLBA 5FBZA 4U2AA 4Q4X2 1YFWA 4HN1A 1UZWA 1GQGA 1AVBA 2VECA 3ELNA 3H7JA 5C3OA 1ENXA 5C9AB 3KT7A 5BYNA 2YUEA 1GP6A 3N7LA 3IMNA 1RUE3 1O4TA 1W8UA 3OBZA 2OKXA 3H8RA 1IPKA 1RVF2 1M06G 2Y8KA 1NXD1 2R071 2YHJA 3KD4A 1AJOA 1VBD3 4AHXA 1UXXX 3C7EA 4NIHA 3TB0A 1AYM3 3M3IA 2RG4A 2ZOEB 1YIPA 3B69A 4LXLA 3M3CA 4AW7A 3ZX7A 4Z1VA 1CONA 1OKOA 1NCQA 4P9WA 5JZGC 3GBFA 4WVWA 2Y26A 4FPCA 3H8XA 1CD3G 3WSOA 3D82A 2QQNA 2ZEWA 3I59B 3T2TA 1GANA 2FDHA 1VBD2 3AXEA 4QGLA 4G9SB 1JZ2A 2NYYA 4S2GA 5FP3A 1A34A 1V70A 4XUPA 2R072 3WV6A 2E32A 4ZHNA 4RQPA 2DBIA 4AQ6A 1OOPC 2G4IA 4DZGA 1H30A 3I4IA 1J59A 3WDTA 2ETEA 1X9PA 1ENQA 3JD73 1OD3A 3AB0A 3TAYA 3RYPA 4W65A 2VBPA 3QLQA 3DYPA 2ZEYA 4JV4A 2QQWA 5BUVA 3U37A 4Y3OA 1QOOA 2W39A 3POYA 3O1MA 2RS12 4BE3A 2QQPA 2R0FA 2VCCA 1XE0A 3VV1A 4CCCA 3GYDA 4DXSA 1GKBA 4X8NA 2FDGA 1UKGA 2JDNA 2IVJA 2NQYA 4PI0A 3MLKA 1K5MA 5FXWA 3ZIWA 1VJ2A 3ST7A 5BNPB 2P1BA 1SFYA 3BU7A 1U5YA 4Y1XA 4OMDA 4AGVA 2PHLA 1UZ0A 3Q8CA 3O0XA 1KITA 2ES3A 3KVAA 4YG0A 4B3NA 4GB31 4QKFA 1V6MA 5AC92 3Q9OA 1UMIA 4CCDA 1W99A 3T2OA 3O5SA 2BGOA 2GMMA 1QH6A 3AFGA 2QZ3A 5DZGA 2BBVA 2CAUA 4LOTA 2CL2A 2DVDA 2VW2A 3EO6A 3MV11 4AGGA 1RYYA 2Q1MA 1OKQA 1WLDA 1AX0A 2RJKA 3WOGA 2W68A 2YROA 3H7YA 4ASKA 1LKNA 1PO22 3CJIB 1CJPA 4Q4V2 3LZZA 5T55A 2Q5TA 1XE8A 2QVSB 3ZFEB 5LA2A 4LUKA 4NROA 1TEIA 4O65A 4IEOA 1O8PA 2A73B 2RR11 1N1SA 3KSCA 2D6KA 1KQRA 3GNEA 3KVBA 3CDZB 4IV3B 5KHHA 1Y9MA 4CPBD 2RHPA 3HNMA 4IGQA 3PVNA 1GFF2 2DCJA 1XNBA 2GP5A 1GNHA 2XLGA 4K3UA 1ULPA 3BN6A 2WS93 1DG6A 4Q4V3 4A7ZA 3ZVXA 5FO9B 4LO6B 4RQPB 4AOCA 1VBE2 2ADDA 4XJZA 3K3OA 2VMGA 3RGBA 3VBUB 3JUUA 1PGW1 2VNOA 4EN9B 4BLJA 4M01A 4COVA 1OURA 2EIBA 2CU5A 2WWSA 2XBO1 4N53B 4B1LA 2Z5WA 4PIYA 3J9SA 2XJQA 1QF3A 4IE4A 3SKVA 5H9SA 2QQLA 1BMV1 5AC93 2ORZA 5GZFA 4L0PA 4CP9B 4N53A 5D21A 4KU7A 2JDMA 2UURA 2VZTA 2XMLA 2JDZA 1AR61 2WNUA 3POJA 3POWA 4YGCA 2VOTA 3QCWA 1PK6A 5L7OB 1UOGA 1V6IA 4BJ0A 4I3GA 5ANQA 1LTEA 1YLLA 3QH6A 1AUYA 4M3CE 3VDDA 4EWDA 1OFNA 2VZ3A 2XB6C 2VVEA 1G9AA 3H9AA 1U12A 2IVIB 4HK8A 4QB6A 4D8MA 5EIYB 2BEOA 3JB4C 1HKDA 4Y20B 1S0FA 3MLJA 1JYCA 1Z7S1 5F5CA 2Q8EA 5HBAA 4P9JA 4SBVA 2XVLA 4HMZA 3VKMA 3DECA 2FCUA 1RUD3 1CVNA 3WF4A 3S5QA 1QWRA 4H7LA 4QQOA 4Q1RA 2WABA 1QJY3 4CEWA 4QDRA 2XJUA 3WT3A 3KV4A 4E8DA 4MSVA 2AREA 2ZGQA 4HPKB 4LA3A 1JYVA 5DUVA 4AEDB 2H0BA 2FDFA 3I2DA 5J98B 2B46X 4DINB 5FZAA 1UQXA 4CP2A 2BPA2 4CEYC 2Z4FA 1H4GA 4IE0A 4DO0A 3FJSA 1BBT1 2YXSA 1AXZA 4M4PA 4Q1PA 5LBCA 5T5LA 4OQ9A 3WNNA 3SXWA 2UWBA 3RZJA 1AXYA 3EHKA 4YNIA 5CIRA 2CWSA 1VALA 3DYOA 3MF9A 4XF0A 1U5XA 1S55A 2WFF3 1ST8A 1CAXB 2NZ9A 4GZ9A 3POSA 1J3RA 4ISRA 2JENA 4DMIA 1KFUL 3NVCA 1E5SA 4W4ZA 5CADA 1JZ3A 1RXFA 2D3SA 5A7SA 5A3LA 4P08A 4ISQA 1SBFA 4LBOA 1RUI3 4PLMA 2VUDA 1UYYA 3HQRA 1QXJA 4XQDA 3LEIA 4XAEA 2JWPA 1F35A 1QJU1 3U1XA 3VDCA 1IKQA 2I2SA 1ZRCA 4UBGA 4TYSA 5A1AA 3NRUA 3A23A 4FBFA 5A80A 2VZ1A 3WW3A 5I8TA 4MHUA 5FMOS 4C8DA 1U5IA 2BOIA 1W6PA 4FPHA 4LHNA 2WNVB 1GLHA 4K8RB 1I5PA 4XUTA 3S30A 1OSGA 1VRH1 1F4HA 4LO4B 4R4ZA 5FY7A 3TNPB 4CSWA 5JXJA 3T30A 4PQ9A 4V2WA 3RI8A 3B5LB 3WD5A 5KHJA 1DQ6A 1DFQA 1JTZX 1OLMA 1QHDA 1AXKA 3AZXA 4X6RB 2CDOA 5DDJ2 1R081 1XC6A 4GALA 3MICA 1W28A 1G9BA 4Z07A 1J1LA 4LBNA 1BKZA 3KWVA 1GZCA 3NQHA 4FFFA 4BLIA 3BPSA 4KWJA 1VRH2 5C8WA 1US2A 5FR3A 3MZHA 3E6BA 1JYTA 1CAVB 2Q30A 3LQCA 3BGAA 4QB1A 1BVVA 2YPDA 1MVQA 5FYYA 5FWEA 2ZHKA 3VBSA 2Q1FA 5BPXA 5J48A 4PI2A 5DAWA 5A1LA 2EAKA 1X33A 4EJRA 4ZXEA 1IKPA 2A6VA 2I45A 2ZGTA 4QM8A 3BIWE 4IQPA 1SDDB 2FCVA 5F32A 1RC6A 3ZFFC 3ZN6A 1ASJ1 2IXCA 4H3WA 1QJY1 5DAQA 2OXBA 3VKOA 5LZ6A 3I8TA 3QOPA 3HBZA 2QQJA 2AZ5A 1AR72 1SG3A 4F3JA 4KMQA 1CAWB 2IWGB 5FY1A 5GZGA 4XACA 4E4DX 4Q4W1 3QBQA 5D1IA 4IETA 2VNVA 3NNGA 3I2KA 3JCIA 4LBJA 5KHIA 1BBT3 1PX3A 3SC7X 4ZS3A 4JC1A 4YZ2A 5JR7B 2VY0A 1Y7BA 1DZRA 1O3RA 4LKEA 5A1FA 3SEPA 4FPJA 3U4XA 3WF3A 5KC5A 2HWD1 2P37A 1HW5A 1SCRA 2VPVA 3GZTB 1VRBA 4WM7A 5J7MA 3HAGA 3VB9A 2VOKA 3APBA 2DFBA 4UFHA 4CZSA 1DLCA 4WM8A 2ZGKA 3UGGA 2JECA 2VC9A 3TWIA 3VZKA 3ZXEA 4BQ5A 3N36A 1RHI2 1WLWA 4OUEA 3PNAA 5C71A 2F4LA 2J1SA 4Y1UA 4RD7A 3SKJE 1PGW2 5A6ZA 2YBSA 4FFGA 4N9HA 4Q4Y2 3WUCA 2HWE2 1PO11 5BNOB 1MPXA 1QNYA 2ZPXA 1N1VA 2PQQA 4YVWA 1UU6A 2VCAA 2XL7A 5APAA 1YFYA 3W21A 5B4NA 4YM2A 5BNOA 4AEDC 4Z82A 4YW6A 2R7EB 1ND2B 5FAXA 4I0AA 5LBBA 1AX2A 1WD3A 5KXBA 1C8NA 1R1A2 4QM9A 5T5OA 4NHLA 2V5YA 2W95A 2DCTA 4XDQA 4BZ4A 4QXKA 1H8TC 2RDRA 1ONAA 2RE9A 4UT5A 1R083 4CU8A 2A3WA 4OI4A 4NPLA 1CIWA 1T6GC 1LENA 5FPBA 1GNZA 2O0OA 2XDVA 2ILMA 3K4DA 5DMYA 5J96B 5ABJC 3EMRA 4LIUA 2LUWA 2QQVA 2C26A 3OGGA 5FZIA 4BB3A 3MHZA 3WNXA 2R1BA 2OZJA 3FFZA 1W0NA 4RYDA 4XQ4A 2Y38A 1WZXA 4CDXC 4OHYA 1QJX1 5FZOB 1MVEA 3FBYA 2UWCA 1LHWA 1XQNA 1E5RA 1MS0A 1OQ1A 4NO4A 3SCGA 1MS8A 2XUMA 2ZGOA 1NG0A 3LA7A 4QPWA 1AR92 1NE4A 1E5IA 3ZFFB 1COV3 2LS6A 3C7GA 4XABA 4BXFA 5A7WB 4D7YA 4PIZA 4CDUB 1D2SA 2O8OA 2YFUA 5F5AA 1Z7S3 1CJDA 3UK9A 5K4LA 4XUOA 4CCKA 3TNQA 1F15A 3HOBA 1O5UA 1IPSA 2PTMA 1S0CA 5LA1A 3N9OA 4N7UA 3H1WA 3OBTA 5F5QA 1DF0A 1PIV2 2G9FA 3RQ0A 3PIGA 5HCAA 1ZRFA 1WMEA 3IIAA 1H0BA 4R9AA 3OUIA 5LK5A 3M4FA 3VBRA 1UCXA 2Q1ZB 2DDUA 4QKBA 4QPIA 2ENRA 1TME3 1YQ2A 3PMEA 1QH7A 4GH4C 3ZFEC 1RUJ3 1MS9A 3ZYRA 4Y22B 1VB4A 5IK8A 1DGWX 2ZA9A 3MIHA 4FPKA 3B94A 4I0BA 4YRDA 3GJAA 5HXMA 2DWRA 3HD8B 4YVSC 4NWWA 2UWAA 1H2LA 4LA2A 3WR0A 1FV2A 2WFF1 3ZR5A 5LCWL 1URXA 1EUUA 1OFSA 4Q0PA 5FZMA 3VBFA 1FOD1 2IXHA 1RUG1 2WINB 4Q5OA 2R6QA 4KWKA 5FIXA 4Y33A 1PMIA 5ABJA 1C8M1 4JGZC 4NRMA 3I54A 4BDVB 4BQXA 4E4SA 1HRV3 4NPMA 2EALA 1JODA 1D2QA 1NYWA 3GBWA 4BM8A 4CP0A 5F3GA 1TE1B 3ENRA 3ZSEA 4KGGA 2Q0AA 1AL0G 2DCZA 1JMUB 3DXTA 4TWTA 1KJRA 3WQ0A 3O1UA 4XTPA 3N4MA 3FWEA 3OEBA 1AYM1 3MO4A 3Q8EA 5FZ3A 4FFIA 3UESA 4MXWB 1LODA 4KBZA 4HVQA 4Y26A 5K0UB 4OHWA 2E7AA 4UXAA 1JYIA 3I2IA 4YW1A 1BJQA 5FP7A 2VO5A 4CCNA 2QQIA 4K20A 2EIDA 4OZOA 2EAAA 4DY3A 4NHKA 4C91A 4CEYB 5FP8A 1JHNA 1S4CA 3VDDB 4CCJA 3THDA 5LB6A 2O14A 4R9CA 3GZEA 2B8MA 1WBFA 4TLGA 5JR2A 3R0RA 3AP4A 1WA6X 2XGXA 1NY71 3CJIC 4QPYA 1PVC1 2AGSA 2SLIA 1UX7A 3VBRC 4CDUC 2XVGA 4GH4A 3POIA 1YQ8A 2EA7A 4QQ2A 4XFGA 4LNVA 4YLZA 1C5IA 4IGPA 3OGRA 3WNLA 3KHCA 1MQTC 2DBNA 5C4WA 2N7GA 5J37A 5BNNB 2D44A 2WC2A 3VBHB 5FZBA 2FHRA 4QD2A 4D94A 4CCLA 4UOJA 5EJ1B 1GMMA 2ZGPA 5T3NA 5CKNA 2XHNA 4MUVA 1XJAA 5LBFA 2VCMA 3ZDSA 3SCHA 3NAPC 4YVSB 3VD7A 5A7WA 3J4UH 5A7NA 5FY9A 1N1YA 4A7YA 3POFA 3FMGA 4KWUA 4HL0A 5ABJB 1IOAA 4AHZA 5L7OC 5J09A 3ZSJA 1F2NA 3KLSA 1LGCA 1QQP3 3A0KA 2J1RA 4AVAA 1H2MA 1G9CA 1T2XA 5JUVA 1YQCA 4IEUA 4CUGA 1XXNA 4MXVA 4BQ1A 5FPXA 4QDQA 4Q0VA 3P3PA 1S0EA 4B4QA 2DURA 2PFWA 1FOD3 3GALA 3NL1A 1B35C 2ZMNA 1JZ6A 1J84A 4CU9A 5FQ0B 4JX0A 3ES4A 1QQP2 3AJYA 3JBG2 4JGZA 5FXXA 3IDBB 4HVOA 4A6SA 5KC6A 3N9NA 1ZREA 3I2GA 2HWB3 4LO7A 3ETPA 1AHSA 2VBDA 3LPFA 3O1PA 2WO7A 1OUSA 3RG0A 4Z2AA 3NWKA 5KBFA 3WDXA 1PO13 2ADEA 2MEV3 1UY1A 1HRI3 5DAPA 3PIJA 1U5ZA 4C0BA 4BQ2A 5JZGB 4AE2A 2WS91 1POV3 1EUTA 1YQ5A 3CJIA 3MUZ1 1W6QB 4AFBA 3ILNA 3I3QA 1XYPA 3LGRA 4XJWA 4AI2A 3U0ZA 2YC2A 5FWJA 2CHHA 4QDSA 2IFRA 4CE8A 3TBDA 4JGYB 3WXPA 2HKXA 1LB2A 2JDAA 1J3QA 1ZA7A 3ZDVA 2ZGNA 3PUQA 4Y5Z0 4J25A 3V64A 5DXDA 1GZWB 4OUMA 3UNPA 3HMYA 2VUJA 1J83A 4UYBA 4A3XA 4IDZA 4MXWA 1ZZ8A 5DAVA 2ZMLA 2W2IA 2VQ0A 2RVAA 1XNDA 2MEV2 4LK7A 2VCBA 5FYZA 5JDBA 4H55A 4AAPA 3RNSA 3JU9A 1LHUA 4LBKA 4AF9A 1F4AA 3THTA 5K9YA 4BMEA 3RI9A 5EHDA 2PHFA 3BU0A 5JI9A 4HANA 5LY2A 3S6PA 3PTYA 3B93A 5KHGA 5LRRA 5IFTA 1OH3A 2VQUA 3INAA 4HXCA 4ORFA 3UKVA 5IVJA 2BNMA 2VMDA 3NV3A 1HRV2 1VBB3 1W8FA 5IK5A 2W1QA 1MZFA 3IAPA 1IGOA 4JCKA 2D98A 4CCOA 1C4RA 4NMIA 1HB3A 3GZUC 3ZOIA 2I74A 1H9WA 1ZX5A 2RS53 2Y6JA 4LKSA 4GJYA 2OZ6A 2GH8A 3GM8A 5FZ1A 1C8M2 3D4KA 4DY5A 1FT9A 4LITA 2B5HA 3LDRA 5JI7A 2VE1A 3HNBM 3ACFA 1EPZA 5FMDA 2PYTA 4JRAA 2QKDA 3L9JT 1YI9A 2YY1A 3JZVA 3LSEA 3VZLA 3A4UA 4UW4A 4XQWA 1ZBA3 2WO1A 2ZHLA 3ACLA 1DGWA 1TVGA 2D5HA 3WNMA 2PHDA 1NCRB 1LHOA 1R093 1DQ5A 3AYEA 2TUNA 2VZRA 4NRQA 4O61A 4R9DA 4JTOA 3VLBB 5C3SA 3U4SA 3BTXA 5BNNC 1HB2A 3ZSLA 4F83A 1V6LA 3HWJA 4XUNA 3ZIXA 2VD7A 4J1WA 1HRI1 3LA3A 2VNRA 4IERA 4AI9A 1SLTA 1DLLA 3BCWA 3KGZA 5HXVA 5J1XA 3I3BA 3V0AB 2D6OX 3K77A 2VVFA 4I02A 1YYNA 1DQ1A 2DV9A 4F7ZA 3FHIB 1SLLA 2GN3A 2WLPA 3FLRA 3MYXA 4HVRA 1A8MA 1HIXA 3PTRB 4FQZA 5ACA1 4AFAA 5JAXA 2OPKA 5FP9A 3I3EA 4XBQA 2B39A 3AYAA 4OHXA 2ZS6B 4KNCA 5DUWA 1AR82 1IS4A 3WVJA 3T2QA 1D4VB 5C5UA 4QU2A 2VJXA 3OD4A 5TSWA 4DEVA 4IXLA 4OCTA 3TEYA 1GWLA 5FZLA 1TG7A 4LTAA 1AJKA 3T0BA 1K5MB 2Z2SB 4E2SA 4XHBA 4ZY9A 4E9KA 5AVAA 1FATA 1SPPB 4CTEA 1ZBA2 1UYPA 3JD72 3NJXA 4EN8B 2ZEZA 1NE6A 3EXUA 1WW5A 3AC0A 4UW3A 2L9LA 1FAYA 2OX0A 3MFCA 2YMZA 4LBQD 1Y4WA 5LEJA 1ENSA 1BK1A 3OY8B 1V6NA 4QPGC 1ASJ2 2VGDA 5EJZB 4YYOA 1PVC3 3KGLA 2QNKA 3MIEA 4HFSA 4K1YA 1GR3A 3WW2A 1LRHA 5C33A 1DQ2A 3CMGA 5EYYA 4EROA 1VBB1 4L2NA 1O3QA 1V6OA 2IZWA 3IB3A 3J26N 3ZMOA 4XXAA 5KXCA 2JIGA 2WLQA 4KQ7A 1R1A1 3O1OA 1JUHA 1DYPA 2LROA 1NA1A 2Y6GA 4Q4W3 4FP2A 1UPSA 5T52A 4A6OA 2CGOA 2QQUA 4PLNA 4QB2A 2GNDA 3JBG1 5FRAA 2Y33A 1NLSA 2WNUC 1UZYA 3Q8AA 3UT0A 3VBRB 2HWC2 1QDCA 2VAUA 1W8HA 2ZX2A 3Q8FA 3HT2A 1UD1A 2RS33 2YV8A 2VZSA 3ZFGB 2PLV2 1VMHA 3IAQA 2R042 5CISA 2BWCA 2EF6A 2W5FA 3VDBA 3PJQA 1C5HA 1R091 3IDAA 4XEZA 1KFXL 1SCSA 1AR93 1SZBA 1Z78A 3AP5A 4OI2A 5CFDC 4XF1A 5FZHA 3AJZA 4NIGA 1EAH3 3AP7A 4R8HA 2BVVA 3E5UA 1MS5A 2PLV3 5A3WA 5A3MA 5IFPA 4P00B 1NZIA 2WNUB 1Q5OA 2ZAAA 1F9KA 2PHRA 3TRSB 1CGPA 5I0TA 2DVBA 4U36A 4ES8A 2IXLA 5C3RA 3WX5A 3IMMA 2DU0A 4YGDA 2GNBA 1UF2C 5EYXA 3UETA 4PLOA 2WZPP 2W1WA 2A3XA 5G04L 2W08A 2MEV1 1IS6A 2YU1A 4HG6B 1RUE1 3VZJA 1WBLA 3NNMA 4MGZE 4K9SA 1OOPA 4S2FA 3W9AA 5FREA 4WZCA 4Y5TA 3PU3A 2VQAA 2Y60A 3L2YA 3ILRA 4NIAA 2VUCA 4J1XA 4MGYE 1E5HA 4XZUG 4MOAA 4QKNA 2WT1A 3ZSMA 1O3TA 1GOGA 3CEWA 5LATA 5GLZA 1RIRA 3PVBB 3MPPG 5CU1A 5K7PA 1HN1A 2X09A 4QX1A 1GWMA 3N7JA 1N3PA 4MGSA 4JRLA 1V9U3 4Y4YA 5IUQA 2B45X 2HEYF 1KGYA 1HX6A 2ZGRA 1K5MC 1LU2A 1RJ7A 4IV1B 4P5YA 4OQ8A 1SLIA 2AEYA
chains in the Genus database with same CATH topology
5CISA 2QQLA 3POFA 5CKMA 2QQOA 4LOSA 3POGA 1SFPA 1SPPA 3POJA 1SZBA 3POBA 3POIA 2QQMA 4LORA 1SPPB 1NZIA 4LOTA 1NT0A 4LMFA 3DEMA 3KQ4B 5CKNA 2WNOA 2QQKA 5CKQA 4GZ9A 3POEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIS A;  2QQL A;  3POF A;  5CKM A;  2QQO A;  4LOS A;  3POG A;  1SFP A;  1SPP A;  3POJ A;  1SZB A;  3POB A;  3POI A;  2QQM A;  4LOR A;  1SPP B;  1NZI A;  4LOT A;  1NT0 A;  4LMF A;  3DEM A;  3KQ4 B;  5CKN A;  2WNO A;  2QQK A;  5CKQ A;  4GZ9 A;  3POE A; 
#chains in the Genus database with same CATH topology
 1QEX A;  5M0T A;  1JOB A;  1VPH A;  3NNL A;  5CFC A;  1O91 A;  2AUY A;  1QXR A;  2C4X A;  1XE7 A;  2JB4 A;  1COV 1;  5HPO A;  2WAO A;  2FDJ A;  3WHT A;  3M1H A;  2WZ8 A;  2A7A A;  2WZR 1;  2OT7 A;  4C90 A;  2AR6 A;  2VG9 A;  2R06 1;  1WCS A;  4XE9 A;  4B7K A;  2FMY A;  5FZG A;  4GWN A;  1NT0 A;  5BXX A;  3K2O A;  3RVH A;  4XUQ A;  5JOY A;  4AEJ A;  4HK9 A;  1UX6 A;  4M3C F;  2ZCW A;  3AYD A;  4N7I A;  5A33 B;  4I09 A;  5J3U A;  5LWB A;  3V65 A;  5FYV A;  4OMC A;  4CXX A;  2WR9 A;  1VP6 A;  1WLT A;  3F2Z A;  4Y1Z A;  1AYN 2;  4M4R A;  4GB3 3;  1YJK A;  2WFP A;  1OMI A;  3BAL A;  1VBA 2;  4NRP A;  5DPN A;  5CG8 A;  3C7H A;  4XOG A;  4YFZ A;  3VL9 A;  4E4Z A;  2WFF 2;  5CG9 A;  1ZZ7 A;  1LAJ A;  3ACI A;  3GJB A;  1S2B A;  5ERL A;  4AI8 A;  1Y9G A;  4BA6 A;  1U0A A;  2QQM A;  4MET A;  5FUN A;  3SEE A;  2QCS B;  3K4Z A;  4K21 A;  2Q8D A;  4LPL A;  1RUG 3;  2HLE A;  5FKB A;  5IAT A;  1KRI A;  4FOY A;  4RFR B;  1BCX A;  5DQ0 A;  1QOT A;  2JG9 A;  3W5N A;  1OA2 A;  3UJQ A;  2HYX A;  3P1I A;  1QJY 2;  1LGN A;  3SCF A;  2Y64 A;  4CRQ A;  5I0R A;  4PIX A;  3RZM A;  4S2D A;  2VR4 A;  1VAM A;  2VMF A;  4Q4V 1;  5FJH A;  2XQR A;  2J1V A;  3JXS A;  1IG0 A;  2DUP A;  1AYM 2;  2UY9 A;  1F5F A;  4XAA A;  1GQH A;  1XSR A;  3ZYP A;  3RZZ A;  3WP4 A;  4FTS A;  1M4W A;  1YRZ A;  5HV0 A;  1C1F A;  5FK7 A;  4I30 A;  4WM7 C;  1CIY A;  4UW6 A;  5H9Q A;  4BQW A;  1ZNP A;  3N9L A;  4UFK A;  4FXK B;  1UOJ A;  3B02 A;  2QBX A;  4AGR A;  4E4H A;  4N8M A;  3RPQ A;  4I0W B;  4IW3 A;  4EN7 B;  4LBQ B;  4WBB A;  3ECQ A;  2O8Q A;  4LE3 A;  5A7Q A;  3RZK A;  1RUC 3;  1VBE 1;  2ZX3 A;  1PK6 C;  1RUO A;  1ZM1 A;  1AR6 3;  4GKY A;  1CZV A;  1PVC 2;  2VTX A;  4YVW C;  2A6Z A;  3NV4 A;  4HN0 A;  4QXB A;  3ZXG A;  3H1Y A;  4CDW B;  5A6Q A;  4CYD A;  2CV6 A;  3DGT A;  4AQ2 A;  5FY5 A;  4HKL A;  1PM7 A;  1DBN A;  4ARX A;  2XXZ A;  3POB A;  4W6W A;  5EPA A;  2WII B;  4Q29 A;  2DVG A;  4YWA A;  2ID4 A;  4OHV A;  1V0A A;  4DB5 A;  1UN1 A;  5JSR A;  1L3J A;  1TNF A;  4KH9 A;  3VHN A;  2GZW A;  4L8Q A;  3WDV A;  1YWK A;  5FYM A;  2WS9 2;  3DEM A;  3CF6 E;  1RTV A;  2GU9 A;  4LLF A;  4D69 A;  3WQB A;  2A5Z A;  4JKM A;  4EN0 A;  4CA9 A;  4R9B A;  1CR7 A;  2XUE A;  3RJR A;  4Q8K A;  2YBP A;  1HXS 2;  1OLQ A;  5FKC A;  2G19 A;  4K6B A;  5FYC A;  3RRD A;  1VBC 2;  1LEM A;  3NKG A;  1CZT A;  1X8M A;  4Y5S A;  3S5A A;  3W20 A;  1W2A X;  3FUO A;  2DTY A;  5A3U A;  5KWR A;  4AK3 A;  1G6N A;  3AYC A;  3MW4 A;  3VBO B;  2B4K A;  3AP9 A;  3M3O A;  1UWW A;  4AR2 A;  4IEY A;  2ZGS A;  3AMH A;  3M3Q A;  2BNN A;  1I3H A;  4Y1Y A;  5ISL A;  1B35 B;  2WJS A;  3NNJ A;  1ULE A;  5E88 A;  3FC0 A;  4HSL A;  3TN9 3;  2GME A;  3D0J A;  1RUD 2;  2Y6L A;  1PHM A;  1K42 A;  2RS3 1;  1MS1 A;  4YZ5 A;  4LK6 A;  3AMN A;  3AL6 A;  3VDA A;  3BTA A;  1W90 A;  1CAU A;  1UY0 A;  1ULF A;  2VOW A;  3NKT A;  1PZ8 A;  3VUO A;  5FPU A;  1K45 A;  3U75 A;  4EQV A;  4OVE A;  4AG4 A;  4XMI A;  4D6R A;  2EIC A;  5GLW A;  4Q2F A;  1AR9 1;  3MW3 A;  2TNF A;  4OZX A;  4ARY A;  3LFM A;  4AFC A;  2JDY A;  3HNY M;  4HLT A;  3RWN A;  5I0S A;  1MZE A;  4NAO A;  4XVH A;  1RUH 2;  2VW1 A;  3IKW A;  4ES9 A;  1YFX A;  4GWI A;  5IVC A;  1UOF A;  4GQ7 A;  3OYW B;  4YW3 A;  4QGN A;  3BUC A;  4UF0 B;  1POV 1;  2YGM A;  3W5M A;  3TEZ A;  2JDH A;  4AVB A;  4LE4 A;  3U07 A;  4UFM A;  2HBU A;  1PZ9 A;  3OUJ A;  2WNE A;  2BOJ A;  2W1U A;  2RDN A;  1YUD A;  1PGL 2;  1E57 A;  2MPF A;  4M00 A;  2Y0O A;  1F5J A;  1N3Q A;  2Z79 A;  4BK5 A;  3BIE A;  3ZYI B;  1V6K A;  3WNP A;  2VVD A;  5CFD B;  4K8F A;  3DN7 A;  1UMH A;  2XQX A;  5I8Y A;  3N9Q A;  5T5J A;  3BYW A;  1DGR A;  1ULC A;  4KWL A;  1H4H A;  4QMA A;  1GIC A;  5FMO L;  4BIS A;  2XL9 A;  2EVX A;  2YGL A;  3MW2 A;  1ZZC A;  4DRR A;  5LA9 A;  3CKH A;  1CAV A;  2HJI A;  2FDK A;  1QJZ A;  3VBH A;  1QOS A;  3VHR A;  1I6X A;  1UNB A;  3NST A;  4FAH A;  2VH9 A;  5KXE A;  1K3I A;  3ZFG A;  5IAV A;  1AL2 2;  1V9U 1;  4S2H A;  5CAZ A;  4LJH A;  2GAL A;  2HYK A;  3ZXK A;  3AZV A;  1BEV 2;  5ANN A;  3ZXF A;  1G9D A;  5LRS A;  2XJS A;  2H6B A;  4MO3 M;  1CWP A;  3BOW A;  5A3O A;  1JZ4 A;  3WQ7 A;  1JZ5 A;  4CEW B;  2QJV A;  2D43 A;  1W6O B;  4Q26 A;  2B42 B;  4BHP A;  1BK0 A;  1VAK A;  1SMV A;  4HBN A;  1GQP A;  2WN3 A;  3E1F 1;  2P4E A;  2VUL A;  2OA2 A;  4NWV A;  4IEQ A;  3WG3 A;  1YHF A;  4CDU A;  1ENR A;  1W6O A;  4BPZ A;  2OQ6 A;  2WZR 3;  4RR3 B;  2XH6 A;  1LES A;  1W3X A;  2Q4S A;  5C4W C;  3MV0 1;  1S0D A;  4EWA A;  5LAS A;  4Z2W A;  1LJ7 A;  1SLA A;  1K5J A;  1W9T A;  3OGV A;  4E2Q A;  3AVR A;  1NCR A;  1LCL A;  5CFC C;  3C7O A;  2PHU A;  4UFJ A;  2XR4 A;  1S2E A;  5LW9 A;  5C8C A;  1OA3 A;  5GKA C;  1UL9 A;  3S0M A;  2Y34 A;  3CU7 A;  4XCB A;  5SV5 A;  4BWO A;  3AXD A;  3KQ4 B;  3OBA A;  2JE7 A;  2NP0 A;  1YEW A;  4C1W A;  5EV7 A;  3T0D A;  1PO1 2;  2DCY A;  1ZBA 1;  4PDW A;  2DVA A;  3X29 B;  3HIF A;  1TMF 2;  2E33 A;  4RGA A;  2D6P A;  3K51 A;  4H14 A;  2X5I C;  3VBU A;  2E7T A;  1REE A;  1OQD A;  4XBN A;  3KT4 A;  3VBF B;  1FYU A;  4LT5 A;  4B4R A;  1JS9 A;  1CAU B;  1Y43 B;  4L97 A;  5FY4 A;  4Y1V A;  3NAP A;  3IDC B;  4QX8 A;  2A1X A;  3WG2 A;  2IFW A;  1W8Z A;  4XF9 A;  3S57 A;  4CEY A;  5FY8 A;  4AZZ A;  1GZ9 A;  2CTV A;  3OUH A;  1NQJ A;  1DZT A;  4IL7 A;  4URT A;  4ZZ5 A;  3ZFG C;  3KCY A;  2XJP A;  5L7O A;  1VAV A;  3LFI A;  3IBM A;  2GC2 A;  1N3O A;  4HT1 T;  5F37 A;  2CAV A;  2DFC A;  2OUJ A;  4QWN A;  4P5H A;  3RWK X;  4CCE A;  1R1Z A;  2FZ1 A;  1MS3 A;  3T4H B;  4EZH A;  1AX1 A;  2X5I B;  5GZD A;  4EWE A;  1JOP A;  1OA4 A;  4Y20 A;  1NAE A;  3SIS A;  5DG2 A;  4ZZ8 A;  5JPM B;  2BER A;  4XF4 A;  4HET A;  4PJY A;  3I2J A;  5FXZ A;  2UYB A;  2ZAC A;  4IES A;  1C1L A;  3RZG A;  4ZS2 A;  5JXI A;  1NOV A;  1BQP A;  2YBK A;  5IYY A;  5F1R A;  1JYX A;  1RUC 1;  1Q3E A;  4IV1 A;  1VBE 3;  4MGI E;  4YZ3 A;  2W47 A;  5E16 A;  3UKN A;  4HPK A;  3WEZ A;  4KG8 A;  3WNO A;  5FYI A;  3AZY A;  1VMJ A;  2BZD A;  4O7X A;  4MH0 E;  4RGG A;  2WNO A;  1LNS A;  5GZE A;  4CP9 A;  5BNP A;  3LOB A;  3NMB A;  4YM3 A;  3RDI A;  5FZ8 A;  5HCH A;  4BQ4 A;  1CN1 A;  3LEG A;  1T6B X;  3B01 A;  4XHX A;  1HV1 A;  2I07 B;  5GJ6 A;  5H9R A;  3S7E A;  4UFL A;  2D6M A;  3QAC A;  2PHW A;  1PIV 1;  2IXK A;  3ZPO A;  5BNQ A;  1W0P A;  5CYY A;  2B9U A;  1SDW A;  4B7E A;  2EXJ A;  4FVV A;  3VBU C;  5FZ6 A;  3MIB A;  3R6S A;  1P8J A;  5E8A A;  5FP4 A;  1X36 A;  4BQ3 A;  1IS3 A;  5I0D A;  2C1F A;  3NV2 A;  1G7Y A;  4XYX A;  3VBO A;  3H50 A;  1RVF 1;  3GHN A;  1A8D A;  1QU0 A;  3WCR A;  1UYX A;  3ZFE A;  3H8O A;  1D4M 1;  4JDM A;  3VBS C;  4QT6 A;  1OXC A;  1TME 1;  2ZEX A;  4MAD A;  2WRA A;  3H3L A;  3OPT A;  5FLH A;  5F39 A;  3E5X A;  4TZD A;  4FTB A;  3MI8 A;  1W39 A;  2CWM A;  5AFB A;  1WD4 A;  1NCQ B;  1V00 A;  5EFU A;  2CGN A;  4AYU A;  5FTT C;  1RUH 3;  3LWC A;  2MHF A;  2RMU 2;  3TN9 1;  1CES A;  2ZAB A;  3WZ1 A;  3I7D A;  2V73 A;  1EAH 1;  1WWY A;  3CLP A;  2ZXQ A;  1PGL 1;  2GP3 A;  3MLL A;  4IEX A;  4QX5 A;  1FMD 1;  3LE0 A;  2RS5 2;  2JDK A;  4OUS A;  4QX2 A;  4WVZ A;  4XET A;  5FK8 A;  4E27 A;  5GLV A;  2OW4 A;  4LMF A;  5FZE A;  1BVP 1;  3LEK A;  1GWK A;  1F31 A;  2GC0 A;  1HRV 1;  1IS5 A;  2D93 A;  5D2A A;  5K8S A;  2WZE A;  4LUM A;  1HN0 A;  2RS1 1;  1GUI A;  4IUG A;  2WSU A;  5L9B A;  3U14 A;  5KHK A;  5LA0 A;  1QJU 2;  4W50 A;  4CU7 A;  2HEV F;  3N9P A;  4HZF A;  3EB7 A;  2JE8 A;  2PAM A;  2C9K A;  1RMU 1;  4RL7 A;  4DNY A;  1D0H A;  3MGU A;  4EYU A;  3ZXD A;  3IM0 A;  1MQT A;  1OC1 A;  2E31 A;  2BQP A;  3C3V A;  2OYZ A;  2JXA A;  5FJK A;  5A6Y A;  3NW4 A;  1WGP A;  3AKT A;  4XIL A;  1PGS A;  3KCX A;  1GZW A;  1MR5 A;  3ITQ A;  5A7O A;  3PVE A;  4XFB A;  5HV4 A;  3LPG A;  1HQN A;  1HJG A;  1LOG A;  1W8N A;  2IC1 A;  1OOP B;  4RHV 2;  1BYH A;  3VL8 A;  4XFH A;  3ZYB A;  3UV9 A;  4DUW A;  2OII A;  2GH2 A;  1DYO A;  2AAC A;  5CNA A;  1ULG A;  1TQ5 A;  1W2T A;  4XDP A;  2DYC A;  3VBO C;  4BXS V;  2YU2 A;  2FQP A;  3ZKY A;  4AFM A;  4YAR A;  2FZ2 A;  3O12 A;  2IXJ A;  3B9C A;  3IT8 A;  1O59 A;  4N43 A;  3BOD A;  4YGB A;  4WV8 A;  4EZ4 A;  2P6C A;  3J7H A;  1H8T A;  5CEH A;  4MZU A;  4N90 A;  2P3K A;  3FUQ A;  1FX5 A;  4JZR A;  2JG8 C;  4OUL A;  2QE3 A;  4Q4Y 3;  1OF3 A;  3HBK A;  1C28 A;  3M70 A;  4MYE A;  4HKW A;  4AVT A;  4LBM A;  1H6X A;  2VZQ A;  3OGJ A;  2R06 3;  2W0X A;  4M3C B;  1L7R A;  4LKF A;  5A70 A;  5I91 A;  3KF3 A;  4QPG A;  2ORX A;  3IWZ A;  3VBH C;  5EXO A;  2HBT A;  5JOW A;  1TMF 1;  4XFA A;  1OQE A;  5C9A C;  2Y6F A;  1YQ6 A;  4JGY C;  1W9S A;  3WW1 A;  2D97 A;  5DZE A;  4DRV A;  1HLC A;  3NJY A;  1PO2 3;  5CB7 A;  2VXJ A;  1VB2 A;  4QX7 A;  4MGT A;  2HWB 2;  5CKM A;  2XOM A;  3ABZ A;  3WHU A;  2QQO A;  4HKO A;  3THP A;  2GC3 A;  4DOU A;  1I5Z A;  4P14 A;  3PHM A;  5IVY A;  1SFP A;  1UZV A;  2P3Y A;  4XW3 A;  2ARA A;  4R4X A;  4N9I A;  4DUV A;  1W9F A;  1W6M B;  2WT0 A;  4Q4X 3;  3KHB A;  5GLU A;  1WCQ A;  1UXZ A;  3V0B A;  5JOZ A;  1UYZ A;  1QNW A;  1AR6 2;  3ES1 A;  4NVP A;  4KL1 A;  2KXL A;  3O0W A;  3AKR A;  4WVM B;  1ULD A;  2V72 A;  4H7M A;  1DGL A;  2OPW A;  4GIQ A;  2HWB 1;  4KG0 A;  3RMX A;  3BB6 A;  5DAB A;  1D0G A;  2V5D A;  4XZP A;  2OUH A;  1LOE A;  2F17 A;  4CVU A;  3RZL A;  1W6Q A;  1O4Y A;  4Z92 B;  2LW8 A;  4O9E A;  1O4Z A;  2RS1 3;  2WA4 A;  3ILF A;  4X6Q B;  2WWJ A;  1QMJ A;  1SBD A;  3W59 A;  4CUA A;  5JMC A;  1HB1 A;  2EIE A;  2KD7 A;  1EV1 1;  1GNY A;  1ZRR A;  3W58 A;  4GWJ A;  4YW5 A;  1XRU A;  4JDN A;  1UY4 A;  1XB9 A;  2K9Z A;  1MZ5 A;  2AEN A;  2WYS A;  2X5I A;  4YVS A;  4FPO B;  3VHO A;  2ZZQ A;  2KM2 A;  4XXP A;  4YM1 A;  1CX1 A;  2BYV E;  1GOH A;  5IK7 A;  3WG4 A;  1RUF 1;  3HN3 A;  4LHL A;  3ZSK A;  4CP1 A;  3HQX A;  1H6Y A;  3HN1 A;  2TBV A;  4RGK A;  1R64 A;  4BK4 A;  1TNR A;  2ET7 A;  1R09 2;  3MDP A;  4QPG B;  5FZC A;  5B2G B;  2A6Y A;  1HDK A;  1RED A;  4NE9 A;  5FV3 A;  3LAG A;  1VE0 A;  2ZTN A;  5L19 A;  1MQT B;  2J1A A;  4NII A;  1MEC 1;  4A41 A;  1W05 A;  5LBE A;  4CDQ B;  2FCT A;  3ROU A;  4D0Q A;  4V2V A;  2ZHN A;  1KS5 A;  5DN2 A;  4A3Z A;  3TYJ A;  4RS5 B;  1KEX A;  1YJL A;  3CNA A;  4G4F A;  2XKP A;  3SHR A;  4W8J A;  3QH7 A;  3VKF C;  2PXJ A;  1BZW A;  3GBG A;  4UWD A;  5C9A A;  2DVF A;  1CAW A;  1MEC 2;  1TMF 3;  4ZPI A;  1S0B A;  4RR3 A;  5FUI A;  4AAX A;  4Q8L A;  5K0U C;  4L92 A;  1BEV 3;  1N47 A;  3BPZ A;  1JUI A;  4TN7 A;  4QU1 A;  1LGB A;  4LUL A;  3VHP A;  1SBE A;  2UY8 A;  5KXD A;  2RS5 1;  1LOC A;  1OI6 A;  3AFK A;  3BTY A;  5D8A C;  3FLP A;  1XOY A;  2OQ7 A;  3O14 A;  1YIF A;  3UGH A;  2BUK A;  1OPM A;  2EIG A;  2Y6K A;  5A3N A;  5HCB A;  3V56 A;  1UU5 A;  4JGZ B;  4L99 A;  2GSY A;  3URF A;  3KMH A;  3OOX A;  1VBD 1;  4FOV A;  1XNA A;  1LOF C;  1ZRD A;  4QQL A;  2ATF A;  5LEK A;  1DIW A;  1RUH 1;  3KM5 A;  3HR9 A;  3N7K A;  3PUI A;  4FO9 A;  2HWF 1;  3OF1 A;  1LOB A;  5FDB A;  2BJS A;  2W9X A;  1FMD 3;  1CX4 A;  1OT5 A;  1EYB A;  2JG9 B;  2UU8 A;  5FLI A;  2CNA A;  2VZO A;  1WMX A;  4CEW C;  3BI3 A;  1EV1 3;  3WDU A;  2FD8 A;  5A3T A;  4L11 A;  1KXG A;  1S1A A;  3EJK A;  4P02 B;  2OVU A;  1L7Q A;  5FO7 B;  2WNV A;  1ZZ6 A;  1REF A;  3OGS A;  3KF5 A;  1Z0H A;  4G3Y C;  2BWA A;  1HRI 2;  2R32 A;  2ZX4 A;  4P9X A;  2E63 A;  5FZ0 A;  2RJ2 A;  1RUF 3;  1BXH A;  4Q4W 2;  1NXM A;  3ACH A;  3G6J B;  4NPR A;  3ZYH A;  3A0N A;  1RMU 3;  1FNZ A;  4Q27 A;  2WAA A;  3ORJ A;  4LQR A;  1SAC A;  2A71 A;  4COZ A;  1PZ7 A;  4I01 A;  1DCS A;  1DGR N;  4A42 A;  2K0G A;  4YW4 A;  2VZP A;  4IE7 A;  3AP6 A;  1PNF A;  2BU9 A;  3O7O A;  4YG6 A;  3P3N A;  5FZK A;  5A7P A;  4NHX A;  1S2K A;  1NX9 A;  5G05 L;  2FDI A;  4CDQ C;  4BMB A;  4DPN A;  3FX3 A;  1AR8 1;  4Z8B A;  2G9Z A;  3OPW A;  4FXG B;  1UAI A;  3NJZ A;  4YFW A;  3GGL A;  4OFG A;  1ODN A;  4M3C A;  2XLF A;  4FPY A;  5FMB A;  4DEQ A;  3N7M A;  1A6C A;  1LOF A;  1NKG A;  2ZGU A;  1GYK A;  4IE6 A;  4NOT A;  4PT6 A;  5FBJ A;  2X10 A;  3LSD A;  2HWC 1;  3NNF A;  4BOW A;  4GB3 2;  4BH9 A;  4B29 A;  4D6Q A;  1IQA A;  2BNO A;  4OLL A;  1ND2 A;  2LAL A;  3R05 A;  4O9G A;  3WP6 A;  3U11 A;  3UYJ A;  2J1U A;  2C5D A;  1Q8S A;  5JSP A;  1V6J A;  3LF7 A;  5HCF A;  4C0H A;  4IEV A;  2VU9 A;  3USU B;  2HWE 3;  3DPR A;  5JVV A;  3DV8 A;  4Q0S A;  1PO2 1;  5JCT A;  3D5O A;  4MVT A;  1CPM A;  4DXT A;  5L9V A;  4JTN A;  1X9T A;  1VBC 3;  4XIO A;  5F6K A;  5AVP A;  2RMU 3;  2RDS A;  1JZ8 A;  4JKL A;  3CBN A;  2D3R A;  5DDJ 3;  3V0B B;  4HOO A;  3PDQ A;  5FUP A;  3E6D A;  2WT2 A;  4PBP A;  5IW0 A;  3VD9 A;  2XBO 3;  4AHY A;  1IPJ A;  3HVD A;  2PLV 1;  1QJX 2;  2XON A;  5FZO A;  3R4S A;  1VBA 3;  2AEZ A;  3LD8 A;  4K1Z A;  1RUE 2;  4LO8 A;  2W92 A;  4XFC A;  2WNV C;  3ZYG A;  5LY1 A;  3O0V A;  3CIH A;  3OYW A;  2P3I A;  3WIN E;  1QIQ A;  1QKQ A;  3HEI A;  3KS7 A;  4KBB A;  4PDW B;  3MIF A;  1NZC A;  5F3C A;  1Q8Q A;  4ZKT B;  4QX0 A;  2JDU A;  2AC1 A;  2ARX A;  3EQE A;  5GLT A;  2ERF A;  1W8T A;  4XUR A;  3BKZ A;  4K40 A;  4QGM A;  4I3P A;  3MBW A;  4NHM A;  2ARB A;  4QXH A;  2BDR A;  2W87 A;  4SLI A;  3OG2 A;  5JXH A;  1WLC A;  5EWS A;  4A45 A;  1PK6 B;  4QHO A;  1Q8P A;  1TME 2;  2D3P A;  5C3P A;  1J58 A;  3H0O A;  2JG8 B;  1VR3 A;  1W6N A;  1MZ6 A;  1RUD 1;  3BVC A;  3KT1 A;  3OJB A;  4LKD A;  1ZBE 1;  3A22 A;  5FYS A;  3I49 A;  3VBS B;  3MPB A;  4CDQ A;  1ND2 C;  4MV2 A;  4GMP 3;  2WWU A;  1OUX A;  1UOB A;  3ON7 A;  4X8P A;  1OPO A;  1YNA A;  1GBG A;  2WSV A;  3A7Q A;  2ZGM A;  4OI0 A;  4ET7 A;  3LIH A;  2VBB A;  2WYF A;  5BV6 A;  4GKX A;  1I9R A;  3NJV A;  5BNO C;  2QFE A;  3LDK A;  4AED A;  3VGI A;  2CDP A;  2ARC A;  3FZ3 A;  5F3E A;  1EY2 A;  2VM9 A;  4RHV 3;  5EQU A;  1WUV A;  1PIV 3;  1BHG A;  2YB7 A;  4KGQ A;  5CA6 A;  1DYK A;  5GZC A;  1XNT A;  1J3P A;  3WP5 A;  3WNK A;  4A44 A;  1L7L A;  1GV9 A;  1AL2 3;  2WL1 A;  4EE2 A;  1PMJ X;  4PF5 A;  5AFE A;  5CVR A;  2DUO A;  3B00 A;  4LLO A;  3OTF A;  2YZ4 A;  4LBL A;  4OI1 A;  3L2H A;  1W3V A;  2BRT A;  1UKR A;  2VMH A;  3JQX A;  2A3Y A;  3DPR C;  1QY4 A;  3FL7 A;  3HQU A;  4ZU4 A;  4GJZ A;  1SHW B;  2WBK A;  1COV 2;  1DDL A;  1RVF 3;  1UY2 A;  1QJU 3;  2C24 A;  4FOQ A;  2JG9 C;  2WZR 2;  5F5I A;  3IPV A;  1D4M 3;  3I3M A;  3OBR A;  2OS2 A;  4IEP A;  3KV6 A;  4FPF A;  2GNM A;  4ZXK A;  1RL3 A;  2RMU 1;  3TN9 2;  4NHY A;  1JW6 A;  2JE9 A;  2W52 A;  1EAH 2;  2VQT A;  1YC6 1;  2YYO A;  3I2H A;  3SH4 A;  1W6M A;  3RZH A;  2Q8C A;  1FMD 2;  4RR3 C;  5FY0 A;  1GSL A;  5K0U A;  1W2U A;  4XDO A;  5FPL A;  2YG0 A;  3AKS A;  1H1A A;  1UZZ A;  1X50 A;  1LEC A;  2SBA A;  2AH2 A;  3DYM A;  4ONU A;  4FAG A;  1XPW A;  1VBA 1;  2BW8 A;  4NN0 A;  1ALY A;  2NMO A;  1W6N B;  2V4A A;  2VUA A;  4H2A A;  4RQP C;  3ZYF A;  3LA2 A;  4GH4 B;  1OD5 A;  3VD5 A;  4WM8 B;  4QX3 A;  1C57 A;  5EZW A;  4NUB A;  5J36 A;  2R49 A;  4FSJ A;  5IWF A;  1UO9 A;  5EP9 A;  1IZ3 A;  5FMC A;  3M3E A;  5FYT A;  3M7A A;  5F2S A;  3WDW A;  5DDJ 1;  2H0V A;  1W2O A;  1EP0 A;  4ATE A;  2CYF A;  4GD4 A;  4LOS A;  1AR7 1;  5F9T A;  1FPN 1;  3POG A;  3H3Z A;  3RS6 A;  5LK7 B;  2TEP A;  1Q56 A;  2VZV A;  5F2W A;  3V0A A;  3KV5 A;  3OB8 A;  4XJ9 A;  2LM3 A;  1UW8 A;  4N43 B;  1O6U A;  1YO8 A;  3USS A;  2O1Q A;  1ZBE 3;  4IND A;  4YZ1 A;  1B09 A;  1FXZ A;  1DQ0 A;  2JB8 A;  1ASJ 3;  2EXI A;  4XCA A;  5I8S A;  2R04 3;  1POQ A;  4GMP 1;  3ZKU A;  3BOP A;  3ZFF A;  3MFA A;  5ACA 2;  5C3Q A;  5JIA A;  1CQ9 A;  2HWD 2;  4FFH A;  1W2N A;  2KR2 A;  4Y4R A;  1UMZ A;  4WZF A;  3BTZ A;  5C8C B;  1PVX A;  5E89 A;  3AL5 A;  4ZON A;  2FBE A;  2BBA A;  4COW A;  3T3Y A;  1LED A;  2XBO 2;  3MF6 A;  1RXG A;  2C0Z A;  1JU4 A;  3ACG A;  3IPV B;  3MID A;  2W94 A;  4LHK A;  1JYN A;  4Q4Y 1;  1AR8 3;  5E1R A;  3U78 A;  4FQ4 A;  1SPP A;  4GA9 A;  4GWM A;  2JKB A;  5F3I A;  1CAX A;  3VZM A;  1ZA4 A;  2BP6 A;  2GN7 A;  2IXI A;  3KCC A;  5IT6 A;  2DU1 A;  1PMH X;  5IAX A;  5F7U A;  3PUR A;  2RM2 3;  3I3D A;  5IVV A;  4N53 C;  4P9L A;  3OCP A;  3VD4 A;  2QQK A;  1POV 0;  2A70 A;  2JIJ A;  4IE5 A;  5CBL A;  2RS3 2;  1HXS 3;  3A21 A;  4TSV A;  5JLV A;  4XPV A;  1IHM A;  4GMP 0;  4COY A;  5C70 A;  1LUL A;  3O1V A;  3VDD C;  2VOV A;  1QGL A;  4A2U A;  2ET1 A;  4D7T A;  3TOJ A;  5JXG A;  4IGO A;  1O7F A;  2D7F A;  4C1X A;  2WO3 A;  2VOX A;  2HWE 1;  1C3H A;  2DF7 A;  1SLC A;  4GUL A;  4Q4X 1;  3THC A;  3UL2 A;  4A4A A;  2JD9 A;  4WM8 C;  5A6X A;  2VMC A;  3GHM A;  3GXU A;  1SEF A;  3N35 A;  2V4V A;  1TZO A;  4FI9 A;  3I97 A;  3CL1 A;  3P6B A;  4YZ4 A;  2BFU L;  3H8U A;  1HQW A;  4BCU A;  3DKW A;  5DAX A;  1W9Y A;  3ZYJ B;  2G1M A;  1WKY A;  3FFQ A;  2VNG A;  3K46 A;  1YCI A;  4E2G A;  2QUO A;  4BQY A;  3ZN5 A;  1YXW A;  2J22 A;  2BGP A;  1GU3 A;  3PL0 A;  4NR1 A;  4FPG A;  4DUX A;  3JB8 A;  1WA4 A;  2R0H A;  3IDE A;  4K7J A;  1WW4 A;  5FLJ A;  3P5B A;  1FV3 A;  4XC9 A;  3WLU A;  1RUI 2;  1GOF A;  1KS4 A;  2XWJ B;  4AVV A;  1QJX 3;  1XNC A;  3O1T A;  1UIK A;  5I0U A;  1NUK A;  2VTX J;  4PCR A;  1RUF 2;  2X8K A;  3VN4 A;  4QKD A;  2WQ4 A;  2B7Y A;  4DXR A;  2YPJ A;  4KU8 A;  1RB8 G;  1AYN 3;  5FO8 B;  5A32 A;  3AMM A;  4MX3 A;  1APN A;  1V9U 2;  5HI0 A;  2WO2 A;  4FP3 A;  1D7P M;  5JMO A;  5IK4 A;  4Q0Q A;  3WDY A;  1VMF A;  4UI9 L;  4DS0 A;  3LIG A;  4XTM A;  2RM2 2;  3JQW A;  5JOX A;  2XWB B;  4ATF A;  5E6H A;  3RSJ A;  2VME A;  1W04 A;  2BVB A;  3D0S A;  3PJY A;  5JWP A;  4AQS A;  1NLQ A;  1LR5 A;  2R30 A;  4HSJ A;  5A33 A;  2J7M A;  2PHX A;  3AKQ A;  4QQP A;  4XIK A;  1FOD 2;  1KJL A;  4AHW A;  1QXP A;  4D6S A;  3ZXA C;  1RUJ 1;  4GAZ A;  4QHZ A;  4OHZ A;  3J7L A;  2ZKN A;  1H1I A;  2C6S A;  2RM2 1;  2W3J A;  4D3W A;  5BY5 A;  4YW2 A;  1G8W A;  2GAU A;  5I93 A;  2H6C A;  3K3N A;  3T4V A;  1GP5 A;  5DUX A;  2JD4 A;  1BEV 1;  1RHI 3;  1NCR C;  4DQA A;  2NN8 A;  1HB4 A;  2WQ8 A;  2J42 A;  5FPA A;  3AX4 A;  4COU A;  3HPN A;  3NO8 A;  3ZXJ A;  4YVW B;  4CUB A;  4GXL A;  3DCQ A;  1C8M 3;  4BYY A;  4UW5 A;  3USU A;  5JPN B;  2RR1 3;  2E51 A;  4ITC A;  2P17 A;  1RIN A;  1O5L A;  1AF9 A;  2AYH A;  1PM4 A;  2YFZ A;  3J7M A;  4MHR A;  1RUG 2;  2PN5 A;  4PDW C;  4Y24 A;  5B4X A;  3DF0 A;  2DCK A;  5FZF A;  2D6N A;  5T50 A;  2A6W A;  1QDO A;  3T08 A;  2IUW A;  2NPI A;  2RJL A;  4TTG A;  2ZJC A;  2JG8 A;  3CO2 A;  1UU4 A;  4IV3 A;  2HWF 2;  2R16 A;  1ZYB A;  1XYO A;  2Y6H A;  1HQL A;  1FPN 2;  5GAL A;  1JI6 A;  2HWF 3;  3PUA A;  1RIT A;  1A78 A;  4OYU A;  2XLA A;  2YC4 A;  2G9G A;  3VZN A;  2GDF A;  2XJV A;  5AC9 1;  1RGS A;  2P34 A;  3RJ2 X;  3MEP A;  4JGY A;  3WF1 A;  2WKK A;  4P9Y A;  4UFI A;  3I59 A;  4BU2 A;  2YC0 A;  4YGE A;  4CXW A;  5FOB B;  1W8O A;  4IV1 C;  2LRP A;  2PAE A;  4NID A;  4JQR A;  5SV8 A;  4IEZ A;  2LTN A;  3M2M A;  3QD6 A;  4CU6 A;  1ZZ9 A;  3F95 A;  3PVO A;  4URA A;  4LO5 B;  3DXU A;  1JOJ A;  1JH5 A;  4FOW A;  2D6L X;  2CY6 A;  1XYN A;  1ND3 C;  1AR7 3;  2XPJ A;  4LIV A;  1FPN 3;  5L73 A;  4AL9 A;  4AI1 A;  4LEJ A;  4ASL A;  2K2S A;  1S0J A;  2E6V A;  3TEX A;  2QZ2 A;  1WW7 A;  4JKK A;  3OPZ A;  2XVK A;  2WA3 A;  4AVS A;  1W03 A;  5A32 B;  3H3U A;  2K46 A;  5BNN A;  1PX4 A;  2R04 1;  2VZU A;  5C5T A;  2ZBJ A;  1WMF A;  3LKJ A;  4CDW C;  5L36 A;  3KZ4 C;  3PLQ A;  1YI7 A;  3ZMN A;  4PHZ A;  3DUI A;  4XJU A;  4Y22 A;  1QQP 1;  3OY8 A;  3HT1 A;  3IZO A;  2DUQ A;  1YFU A;  1OH4 A;  1BMV 2;  3O1R A;  4V1P A;  5IVB A;  4UBH A;  1RUC 2;  1BBT 2;  1Q43 A;  3FN9 A;  2VW0 A;  4XF3 A;  1DHK B;  3TEW A;  3I2F A;  1DU3 D;  2HWC 3;  3ZR6 A;  1W6P B;  1Y9Q A;  3N9M A;  2NMN A;  1A3K A;  1D4M 2;  3PMS A;  3AKP A;  3AMQ A;  4RSU A;  5GM0 A;  3FHA A;  4AWD A;  2Y0I A;  2ZMK A;  3WF0 A;  2E53 A;  2Z69 A;  3LCP A;  4AVC A;  1XU1 A;  5T5P A;  3VD3 A;  4MG2 A;  4YSF A;  4R52 A;  3U10 A;  4XJ8 A;  3GCW A;  3UJO A;  4P9I A;  2ZZJ A;  4LOR A;  4CUC A;  2PMW B;  2RDQ A;  3WCS A;  2CGP A;  2RV9 A;  5FYU A;  3R4U A;  4PBO A;  4XFI A;  1Z7S 2;  4L9B A;  1HXS 1;  4MGQ A;  4IV3 C;  4P9G A;  3D6E A;  1GP4 A;  3T2P A;  1VBC 1;  3CZJ A;  3GF6 A;  3AVS A;  2R07 3;  5FXV A;  2W46 A;  4LHS A;  3LB9 A;  1SQ4 A;  4YM0 A;  4XJA A;  1JYW A;  1WMD A;  2EXK A;  2ZHM A;  2HEW F;  3J7N A;  3OD0 A;  4JDO A;  3WP3 A;  3AMP A;  3III A;  1VRH 3;  4JAA A;  1UIJ A;  3RYK A;  5IHR A;  1B35 A;  1W8W A;  2BFU S;  3DL3 A;  3EBR A;  3PUH A;  1ND3 A;  3SLI A;  3T1M A;  3NAP B;  2JX9 A;  3D3A A;  1RJ8 A;  3H42 B;  4CCM A;  3GDB A;  2Q8O A;  3MIG A;  2E26 A;  4Q0U A;  2ZKL A;  4CDX A;  1WCU A;  1UY3 A;  3OEA A;  2VXR A;  3GCX A;  3RFR A;  4M0N A;  5C8C C;  2QDR A;  4WVV A;  5CFC B;  3UKT A;  2F4P A;  3K48 A;  4J6G A;  1KD7 A;  5FYB A;  4BIO A;  3D8C A;  2C9A A;  4QPI C;  2BTV C;  3CJX A;  1JBC A;  3E97 A;  1MAC A;  1OF4 A;  2R06 2;  1J1T A;  1LHN A;  4N43 C;  3KB5 A;  1NQD A;  2XJT A;  4FPE A;  1GZT A;  1ZBE 2;  1OHF A;  3LEM A;  1OVS A;  3NV1 A;  4XMA A;  3SMH A;  3KQR A;  1AZD A;  3E5Q A;  2ZAH A;  4W6X A;  2JIC A;  3VBF C;  3J8F 3;  4RN5 A;  1Q8O A;  4FTE A;  1RUJ 2;  5F8P A;  1ZRI A;  1AYN 1;  4CDW A;  5CFD A;  3C2U A;  3ZLI A;  4B4P A;  1RUN A;  3AZW A;  1S0G A;  3S7I A;  1K12 A;  2NLR A;  5FCC A;  1RMU 2;  4EN6 B;  3ZN4 A;  3FBM A;  1H2N A;  2NM1 A;  2PA7 A;  5T54 A;  4EV0 A;  4CXY A;  3K75 B;  4RS5 C;  3DKQ A;  2W1S A;  3FHQ A;  5FPZ A;  1H1M A;  2ZX0 A;  3GZA A;  4QPI B;  1KDK A;  1IQD C;  2P2K A;  1QJF A;  1LOA A;  2BGC A;  1N1T A;  4RHV 1;  5FZD A;  2D5F A;  3K4A A;  4I2O A;  2PEL A;  2HWD 3;  1R08 2;  3ZPY A;  1CPN A;  4DXZ A;  1OLM E;  2WN2 A;  3FE5 A;  4MGK E;  2EXH A;  2QDN A;  1AL2 1;  3T1L A;  2XG3 A;  1X8E A;  4DIQ A;  1I1E A;  5C4W B;  1NLR A;  2X05 A;  3R4D B;  2WDB A;  3O1S A;  1PNG A;  1W06 A;  4LR4 A;  4M0H A;  1ND3 B;  4QHB A;  2UYA A;  3B9I A;  3ETQ A;  2YDE A;  1CZS A;  1JN2 P;  1Y3T A;  4FT8 A;  4MLO A;  3WW4 A;  1KDM A;  1NY7 2;  1Q8V A;  4IEW A;  4CPB A;  1RHI 1;  2E7Q A;  4RA0 A;  1VLN A;  5D8A B;  2D40 A;  1XNK A;  3ATG A;  4ZU5 A;  3RMY A;  1ZZB A;  5CZK A;  5BNP C;  1G86 A;  1O8S A;  1JHJ A;  4XBL A;  2X29 A;  3DPR B;  3LOI A;  5CKQ A;  5FPV A;  4AQT A;  1JZ7 A;  3UGF A;  1FI2 A;  3I2O A;  2E9Q A;  1QJE A;  4FCA A;  3POE A;  3PU8 A;  1DQ4 A;  5FZ9 A;  3SH5 A;  1LHV A;  5FZ4 A;  3ZM8 A;  5KR7 A;  1VIW B;  3CHX A;  1OBN A;  2JKX A;  3CZU A;  5L9R A;  2PHT A;  5ACA 3;  2JDP A;  3SNM A;  5FOJ B;  4F8A A;  3WF2 A;  3Q8B A;  4KI5 M;  1DZQ A;  1S0I A;  5FZ7 A;  5IJR A;  3WQ1 A;  4AFD A;  5EJ3 A;  1IG3 A;  3ASI A;  4B1M A;  4ASM B;  2RR1 2;  1ZVF A;  3CQO A;  4UF0 A;  2Z42 A;  3AZZ A;  1X7N A;  1OLR A;  1WCD J;  5FFO C;  3MUY 1;  4RFT 0;  4YG3 A;  1SFN A;  3ZO0 B;  4DFS A;  4TLF A;  3SQO A;  3B7M A;  2GMP A;  3AM2 A;  3G7D A;  1HJF A;  2J1T A;  3E6C C;  2PQS A;  5DG1 A;  5JZG A;  2P3J A;  1EPW A;  1NA1 B;  1VBB 2;  1WCK A;  2CSG A;  2GC1 A;  3B3Q E;  4NJ4 A;  4QQH A;  4E8C A;  1XU2 A;  4JHT A;  4CDX B;  3AK0 A;  4JQT A;  2VL4 A;  2PAK A;  4ZU7 A;  1LU1 A;  3WG1 A;  3ME2 A;  3M8L A;  3WY6 A;  3C8X A;  3VZO A;  1O3S A;  2FMD A;  3ZXL A;  2VMI A;  2W91 A;  3J8F 1;  3JD7 1;  4AI0 A;  4NAM A;  2ZGL A;  4PQQ A;  3SIT A;  3KV9 A;  4PF1 A;  1W0O A;  3EYP A;  4TXW A;  5C6C A;  3IN9 A;  4JVA A;  1EV1 2;  4LBQ A;  2BV4 A;  2WQZ C;  2GNT A;  3T0A A;  5JSO A;  3RYR A;  1XBF A;  1NCQ C;  4RS5 A;  3SH3 A;  2XKO A;  1R1A 3;  3N3H A;  1BLZ A;  2ZX1 A;  1H8T B;  5DUU A;  2B9V A;  3PUS A;  4JHZ A;  1MEC 3;  4B8E A;  1FNY A;  2JJ6 A;  2DTW A;  1F8V A;  1NA1 C;  2P6H A;  3JBG 3;  4QXC A;  3OSD A;  1G9F A;  2WUH A;  1HV0 A;  3ALQ A;  2VTF A;  3J8F 2;  1ULO A;  2KA3 A;  2JEM A;  5D8A A;  2A6X A;  2A75 A;  4WVM A;  5IVE A;  3FLT A;  4YPJ A;  4AEM A;  4QAW A;  2XJR A;  2F6B A;  3C7F A;  2QTW B;  4W6Y A;  2HH9 A;  4A7K A;  4WM7 B;  5DZF A;  4D7S A;  3HJR A;  5JIU A;  2XHK A;  1X82 A;  3LDB A;  4HON A;  1RUI 1;  1STM A;  1OVP A;  1XSQ A;  5H9P A;  1WW6 A;  1H9P A;  4FPL A;  4AXO A;  2R1D A;  1W9W A;  1US3 A;  2P5B A;  5FQ0 A;  5F6L B;  2X53 S;  5IVF A;  5C7G A;  3WUD A;  1H2K A;  1MS4 A;  3VKN A;  5A3P A;  1JU3 A;  2MNG A;  3ZN6 B;  1DP0 A;  1UPI A;  4XFF A;  1ODM A;  1JXN A;  4AI3 A;  3H1M A;  3VKL A;  2V09 A;  4BIF A;  4AEK A;  1ACC A;  1H8V A;  4UAP A;  3T09 A;  5FYH A;  2J1E A;  4YW7 A;  1SLB A;  5FBZ A;  4U2A A;  4Q4X 2;  1YFW A;  4HN1 A;  1UZW A;  1GQG A;  1AVB A;  2VEC A;  3ELN A;  3H7J A;  5C3O A;  1ENX A;  5C9A B;  3KT7 A;  5BYN A;  2YUE A;  1GP6 A;  3N7L A;  3IMN A;  1RUE 3;  1O4T A;  1W8U A;  3OBZ A;  2OKX A;  3H8R A;  1IPK A;  1RVF 2;  1M06 G;  2Y8K A;  1NXD 1;  2R07 1;  2YHJ A;  3KD4 A;  1AJO A;  1VBD 3;  4AHX A;  1UXX X;  3C7E A;  4NIH A;  3TB0 A;  1AYM 3;  3M3I A;  2RG4 A;  2ZOE B;  1YIP A;  3B69 A;  4LXL A;  3M3C A;  4AW7 A;  3ZX7 A;  4Z1V A;  1CON A;  1OKO A;  1NCQ A;  4P9W A;  5JZG C;  3GBF A;  4WVW A;  2Y26 A;  4FPC A;  3H8X A;  1CD3 G;  3WSO A;  3D82 A;  2QQN A;  2ZEW A;  3I59 B;  3T2T A;  1GAN A;  2FDH A;  1VBD 2;  3AXE A;  4QGL A;  4G9S B;  1JZ2 A;  2NYY A;  4S2G A;  5FP3 A;  1A34 A;  1V70 A;  4XUP A;  2R07 2;  3WV6 A;  2E32 A;  4ZHN A;  4RQP A;  2DBI A;  4AQ6 A;  1OOP C;  2G4I A;  4DZG A;  1H30 A;  3I4I A;  1J59 A;  3WDT A;  2ETE A;  1X9P A;  1ENQ A;  3JD7 3;  1OD3 A;  3AB0 A;  3TAY A;  3RYP A;  4W65 A;  2VBP A;  3QLQ A;  3DYP A;  2ZEY A;  4JV4 A;  2QQW A;  5BUV A;  3U37 A;  4Y3O A;  1QOO A;  2W39 A;  3POY A;  3O1M A;  2RS1 2;  4BE3 A;  2QQP A;  2R0F A;  2VCC A;  1XE0 A;  3VV1 A;  4CCC A;  3GYD A;  4DXS A;  1GKB A;  4X8N A;  2FDG A;  1UKG A;  2JDN A;  2IVJ A;  2NQY A;  4PI0 A;  3MLK A;  1K5M A;  5FXW A;  3ZIW A;  1VJ2 A;  3ST7 A;  5BNP B;  2P1B A;  1SFY A;  3BU7 A;  1U5Y A;  4Y1X A;  4OMD A;  4AGV A;  2PHL A;  1UZ0 A;  3Q8C A;  3O0X A;  1KIT A;  2ES3 A;  3KVA A;  4YG0 A;  4B3N A;  4GB3 1;  4QKF A;  1V6M A;  5AC9 2;  3Q9O A;  1UMI A;  4CCD A;  1W99 A;  3T2O A;  3O5S A;  2BGO A;  2GMM A;  1QH6 A;  3AFG A;  2QZ3 A;  5DZG A;  2BBV A;  2CAU A;  4LOT A;  2CL2 A;  2DVD A;  2VW2 A;  3EO6 A;  3MV1 1;  4AGG A;  1RYY A;  2Q1M A;  1OKQ A;  1WLD A;  1AX0 A;  2RJK A;  3WOG A;  2W68 A;  2YRO A;  3H7Y A;  4ASK A;  1LKN A;  1PO2 2;  3CJI B;  1CJP A;  4Q4V 2;  3LZZ A;  5T55 A;  2Q5T A;  1XE8 A;  2QVS B;  3ZFE B;  5LA2 A;  4LUK A;  4NRO A;  1TEI A;  4O65 A;  4IEO A;  1O8P A;  2A73 B;  2RR1 1;  1N1S A;  3KSC A;  2D6K A;  1KQR A;  3GNE A;  3KVB A;  3CDZ B;  4IV3 B;  5KHH A;  1Y9M A;  4CPB D;  2RHP A;  3HNM A;  4IGQ A;  3PVN A;  1GFF 2;  2DCJ A;  1XNB A;  2GP5 A;  1GNH A;  2XLG A;  4K3U A;  1ULP A;  3BN6 A;  2WS9 3;  1DG6 A;  4Q4V 3;  4A7Z A;  3ZVX A;  5FO9 B;  4LO6 B;  4RQP B;  4AOC A;  1VBE 2;  2ADD A;  4XJZ A;  3K3O A;  2VMG A;  3RGB A;  3VBU B;  3JUU A;  1PGW 1;  2VNO A;  4EN9 B;  4BLJ A;  4M01 A;  4COV A;  1OUR A;  2EIB A;  2CU5 A;  2WWS A;  2XBO 1;  4N53 B;  4B1L A;  2Z5W A;  4PIY A;  3J9S A;  2XJQ A;  1QF3 A;  4IE4 A;  3SKV A;  5H9S A;  2QQL A;  1BMV 1;  5AC9 3;  2ORZ A;  5GZF A;  4L0P A;  4CP9 B;  4N53 A;  5D21 A;  4KU7 A;  2JDM A;  2UUR A;  2VZT A;  2XML A;  2JDZ A;  1AR6 1;  2WNU A;  3POJ A;  3POW A;  4YGC A;  2VOT A;  3QCW A;  1PK6 A;  5L7O B;  1UOG A;  1V6I A;  4BJ0 A;  4I3G A;  5ANQ A;  1LTE A;  1YLL A;  3QH6 A;  1AUY A;  4M3C E;  3VDD A;  4EWD A;  1OFN A;  2VZ3 A;  2XB6 C;  2VVE A;  1G9A A;  3H9A A;  1U12 A;  2IVI B;  4HK8 A;  4QB6 A;  4D8M A;  5EIY B;  2BEO A;  3JB4 C;  1HKD A;  4Y20 B;  1S0F A;  3MLJ A;  1JYC A;  1Z7S 1;  5F5C A;  2Q8E A;  5HBA A;  4P9J A;  4SBV A;  2XVL A;  4HMZ A;  3VKM A;  3DEC A;  2FCU A;  1RUD 3;  1CVN A;  3WF4 A;  3S5Q A;  1QWR A;  4H7L A;  4QQO A;  4Q1R A;  2WAB A;  1QJY 3;  4CEW A;  4QDR A;  2XJU A;  3WT3 A;  3KV4 A;  4E8D A;  4MSV A;  2ARE A;  2ZGQ A;  4HPK B;  4LA3 A;  1JYV A;  5DUV A;  4AED B;  2H0B A;  2FDF A;  3I2D A;  5J98 B;  2B46 X;  4DIN B;  5FZA A;  1UQX A;  4CP2 A;  2BPA 2;  4CEY C;  2Z4F A;  1H4G A;  4IE0 A;  4DO0 A;  3FJS A;  1BBT 1;  2YXS A;  1AXZ A;  4M4P A;  4Q1P A;  5LBC A;  5T5L A;  4OQ9 A;  3WNN A;  3SXW A;  2UWB A;  3RZJ A;  1AXY A;  3EHK A;  4YNI A;  5CIR A;  2CWS A;  1VAL A;  3DYO A;  3MF9 A;  4XF0 A;  1U5X A;  1S55 A;  2WFF 3;  1ST8 A;  1CAX B;  2NZ9 A;  4GZ9 A;  3POS A;  1J3R A;  4ISR A;  2JEN A;  4DMI A;  1KFU L;  3NVC A;  1E5S A;  4W4Z A;  5CAD A;  1JZ3 A;  1RXF A;  2D3S A;  5A7S A;  5A3L A;  4P08 A;  4ISQ A;  1SBF A;  4LBO A;  1RUI 3;  4PLM A;  2VUD A;  1UYY A;  3HQR A;  1QXJ A;  4XQD A;  3LEI A;  4XAE A;  2JWP A;  1F35 A;  1QJU 1;  3U1X A;  3VDC A;  1IKQ A;  2I2S A;  1ZRC A;  4UBG A;  4TYS A;  5A1A A;  3NRU A;  3A23 A;  4FBF A;  5A80 A;  2VZ1 A;  3WW3 A;  5I8T A;  4MHU A;  5FMO S;  4C8D A;  1U5I A;  2BOI A;  1W6P A;  4FPH A;  4LHN A;  2WNV B;  1GLH A;  4K8R B;  1I5P A;  4XUT A;  3S30 A;  1OSG A;  1VRH 1;  1F4H A;  4LO4 B;  4R4Z A;  5FY7 A;  3TNP B;  4CSW A;  5JXJ A;  3T30 A;  4PQ9 A;  4V2W A;  3RI8 A;  3B5L B;  3WD5 A;  5KHJ A;  1DQ6 A;  1DFQ A;  1JTZ X;  1OLM A;  1QHD A;  1AXK A;  3AZX A;  4X6R B;  2CDO A;  5DDJ 2;  1R08 1;  1XC6 A;  4GAL A;  3MIC A;  1W28 A;  1G9B A;  4Z07 A;  1J1L A;  4LBN A;  1BKZ A;  3KWV A;  1GZC A;  3NQH A;  4FFF A;  4BLI A;  3BPS A;  4KWJ A;  1VRH 2;  5C8W A;  1US2 A;  5FR3 A;  3MZH A;  3E6B A;  1JYT A;  1CAV B;  2Q30 A;  3LQC A;  3BGA A;  4QB1 A;  1BVV A;  2YPD A;  1MVQ A;  5FYY A;  5FWE A;  2ZHK A;  3VBS A;  2Q1F A;  5BPX A;  5J48 A;  4PI2 A;  5DAW A;  5A1L A;  2EAK A;  1X33 A;  4EJR A;  4ZXE A;  1IKP A;  2A6V A;  2I45 A;  2ZGT A;  4QM8 A;  3BIW E;  4IQP A;  1SDD B;  2FCV A;  5F32 A;  1RC6 A;  3ZFF C;  3ZN6 A;  1ASJ 1;  2IXC A;  4H3W A;  1QJY 1;  5DAQ A;  2OXB A;  3VKO A;  5LZ6 A;  3I8T A;  3QOP A;  3HBZ A;  2QQJ A;  2AZ5 A;  1AR7 2;  1SG3 A;  4F3J A;  4KMQ A;  1CAW B;  2IWG B;  5FY1 A;  5GZG A;  4XAC A;  4E4D X;  4Q4W 1;  3QBQ A;  5D1I A;  4IET A;  2VNV A;  3NNG A;  3I2K A;  3JCI A;  4LBJ A;  5KHI A;  1BBT 3;  1PX3 A;  3SC7 X;  4ZS3 A;  4JC1 A;  4YZ2 A;  5JR7 B;  2VY0 A;  1Y7B A;  1DZR A;  1O3R A;  4LKE A;  5A1F A;  3SEP A;  4FPJ A;  3U4X A;  3WF3 A;  5KC5 A;  2HWD 1;  2P37 A;  1HW5 A;  1SCR A;  2VPV A;  3GZT B;  1VRB A;  4WM7 A;  5J7M A;  3HAG A;  3VB9 A;  2VOK A;  3APB A;  2DFB A;  4UFH A;  4CZS A;  1DLC A;  4WM8 A;  2ZGK A;  3UGG A;  2JEC A;  2VC9 A;  3TWI A;  3VZK A;  3ZXE A;  4BQ5 A;  3N36 A;  1RHI 2;  1WLW A;  4OUE A;  3PNA A;  5C71 A;  2F4L A;  2J1S A;  4Y1U A;  4RD7 A;  3SKJ E;  1PGW 2;  5A6Z A;  2YBS A;  4FFG A;  4N9H A;  4Q4Y 2;  3WUC A;  2HWE 2;  1PO1 1;  5BNO B;  1MPX A;  1QNY A;  2ZPX A;  1N1V A;  2PQQ A;  4YVW A;  1UU6 A;  2VCA A;  2XL7 A;  5APA A;  1YFY A;  3W21 A;  5B4N A;  4YM2 A;  5BNO A;  4AED C;  4Z82 A;  4YW6 A;  2R7E B;  1ND2 B;  5FAX A;  4I0A A;  5LBB A;  1AX2 A;  1WD3 A;  5KXB A;  1C8N A;  1R1A 2;  4QM9 A;  5T5O A;  4NHL A;  2V5Y A;  2W95 A;  2DCT A;  4XDQ A;  4BZ4 A;  4QXK A;  1H8T C;  2RDR A;  1ONA A;  2RE9 A;  4UT5 A;  1R08 3;  4CU8 A;  2A3W A;  4OI4 A;  4NPL A;  1CIW A;  1T6G C;  1LEN A;  5FPB A;  1GNZ A;  2O0O A;  2XDV A;  2ILM A;  3K4D A;  5DMY A;  5J96 B;  5ABJ C;  3EMR A;  4LIU A;  2LUW A;  2QQV A;  2C26 A;  3OGG A;  5FZI A;  4BB3 A;  3MHZ A;  3WNX A;  2R1B A;  2OZJ A;  3FFZ A;  1W0N A;  4RYD A;  4XQ4 A;  2Y38 A;  1WZX A;  4CDX C;  4OHY A;  1QJX 1;  5FZO B;  1MVE A;  3FBY A;  2UWC A;  1LHW A;  1XQN A;  1E5R A;  1MS0 A;  1OQ1 A;  4NO4 A;  3SCG A;  1MS8 A;  2XUM A;  2ZGO A;  1NG0 A;  3LA7 A;  4QPW A;  1AR9 2;  1NE4 A;  1E5I A;  3ZFF B;  1COV 3;  2LS6 A;  3C7G A;  4XAB A;  4BXF A;  5A7W B;  4D7Y A;  4PIZ A;  4CDU B;  1D2S A;  2O8O A;  2YFU A;  5F5A A;  1Z7S 3;  1CJD A;  3UK9 A;  5K4L A;  4XUO A;  4CCK A;  3TNQ A;  1F15 A;  3HOB A;  1O5U A;  1IPS A;  2PTM A;  1S0C A;  5LA1 A;  3N9O A;  4N7U A;  3H1W A;  3OBT A;  5F5Q A;  1DF0 A;  1PIV 2;  2G9F A;  3RQ0 A;  3PIG A;  5HCA A;  1ZRF A;  1WME A;  3IIA A;  1H0B A;  4R9A A;  3OUI A;  5LK5 A;  3M4F A;  3VBR A;  1UCX A;  2Q1Z B;  2DDU A;  4QKB A;  4QPI A;  2ENR A;  1TME 3;  1YQ2 A;  3PME A;  1QH7 A;  4GH4 C;  3ZFE C;  1RUJ 3;  1MS9 A;  3ZYR A;  4Y22 B;  1VB4 A;  5IK8 A;  1DGW X;  2ZA9 A;  3MIH A;  4FPK A;  3B94 A;  4I0B A;  4YRD A;  3GJA A;  5HXM A;  2DWR A;  3HD8 B;  4YVS C;  4NWW A;  2UWA A;  1H2L A;  4LA2 A;  3WR0 A;  1FV2 A;  2WFF 1;  3ZR5 A;  5LCW L;  1URX A;  1EUU A;  1OFS A;  4Q0P A;  5FZM A;  3VBF A;  1FOD 1;  2IXH A;  1RUG 1;  2WIN B;  4Q5O A;  2R6Q A;  4KWK A;  5FIX A;  4Y33 A;  1PMI A;  5ABJ A;  1C8M 1;  4JGZ C;  4NRM A;  3I54 A;  4BDV B;  4BQX A;  4E4S A;  1HRV 3;  4NPM A;  2EAL A;  1JOD A;  1D2Q A;  1NYW A;  3GBW A;  4BM8 A;  4CP0 A;  5F3G A;  1TE1 B;  3ENR A;  3ZSE A;  4KGG A;  2Q0A A;  1AL0 G;  2DCZ A;  1JMU B;  3DXT A;  4TWT A;  1KJR A;  3WQ0 A;  3O1U A;  4XTP A;  3N4M A;  3FWE A;  3OEB A;  1AYM 1;  3MO4 A;  3Q8E A;  5FZ3 A;  4FFI A;  3UES A;  4MXW B;  1LOD A;  4KBZ A;  4HVQ A;  4Y26 A;  5K0U B;  4OHW A;  2E7A A;  4UXA A;  1JYI A;  3I2I A;  4YW1 A;  1BJQ A;  5FP7 A;  2VO5 A;  4CCN A;  2QQI A;  4K20 A;  2EID A;  4OZO A;  2EAA A;  4DY3 A;  4NHK A;  4C91 A;  4CEY B;  5FP8 A;  1JHN A;  1S4C A;  3VDD B;  4CCJ A;  3THD A;  5LB6 A;  2O14 A;  4R9C A;  3GZE A;  2B8M A;  1WBF A;  4TLG A;  5JR2 A;  3R0R A;  3AP4 A;  1WA6 X;  2XGX A;  1NY7 1;  3CJI C;  4QPY A;  1PVC 1;  2AGS A;  2SLI A;  1UX7 A;  3VBR C;  4CDU C;  2XVG A;  4GH4 A;  3POI A;  1YQ8 A;  2EA7 A;  4QQ2 A;  4XFG A;  4LNV A;  4YLZ A;  1C5I A;  4IGP A;  3OGR A;  3WNL A;  3KHC A;  1MQT C;  2DBN A;  5C4W A;  2N7G A;  5J37 A;  5BNN B;  2D44 A;  2WC2 A;  3VBH B;  5FZB A;  2FHR A;  4QD2 A;  4D94 A;  4CCL A;  4UOJ A;  5EJ1 B;  1GMM A;  2ZGP A;  5T3N A;  5CKN A;  2XHN A;  4MUV A;  1XJA A;  5LBF A;  2VCM A;  3ZDS A;  3SCH A;  3NAP C;  4YVS B;  3VD7 A;  5A7W A;  3J4U H;  5A7N A;  5FY9 A;  1N1Y A;  4A7Y A;  3POF A;  3FMG A;  4KWU A;  4HL0 A;  5ABJ B;  1IOA A;  4AHZ A;  5L7O C;  5J09 A;  3ZSJ A;  1F2N A;  3KLS A;  1LGC A;  1QQP 3;  3A0K A;  2J1R A;  4AVA A;  1H2M A;  1G9C A;  1T2X A;  5JUV A;  1YQC A;  4IEU A;  4CUG A;  1XXN A;  4MXV A;  4BQ1 A;  5FPX A;  4QDQ A;  4Q0V A;  3P3P A;  1S0E A;  4B4Q A;  2DUR A;  2PFW A;  1FOD 3;  3GAL A;  3NL1 A;  1B35 C;  2ZMN A;  1JZ6 A;  1J84 A;  4CU9 A;  5FQ0 B;  4JX0 A;  3ES4 A;  1QQP 2;  3AJY A;  3JBG 2;  4JGZ A;  5FXX A;  3IDB B;  4HVO A;  4A6S A;  5KC6 A;  3N9N A;  1ZRE A;  3I2G A;  2HWB 3;  4LO7 A;  3ETP A;  1AHS A;  2VBD A;  3LPF A;  3O1P A;  2WO7 A;  1OUS A;  3RG0 A;  4Z2A A;  3NWK A;  5KBF A;  3WDX A;  1PO1 3;  2ADE A;  2MEV 3;  1UY1 A;  1HRI 3;  5DAP A;  3PIJ A;  1U5Z A;  4C0B A;  4BQ2 A;  5JZG B;  4AE2 A;  2WS9 1;  1POV 3;  1EUT A;  1YQ5 A;  3CJI A;  3MUZ 1;  1W6Q B;  4AFB A;  3ILN A;  3I3Q A;  1XYP A;  3LGR A;  4XJW A;  4AI2 A;  3U0Z A;  2YC2 A;  5FWJ A;  2CHH A;  4QDS A;  2IFR A;  4CE8 A;  3TBD A;  4JGY B;  3WXP A;  2HKX A;  1LB2 A;  2JDA A;  1J3Q A;  1ZA7 A;  3ZDV A;  2ZGN A;  3PUQ A;  4Y5Z 0;  4J25 A;  3V64 A;  5DXD A;  1GZW B;  4OUM A;  3UNP A;  3HMY A;  2VUJ A;  1J83 A;  4UYB A;  4A3X A;  4IDZ A;  4MXW A;  1ZZ8 A;  5DAV A;  2ZML A;  2W2I A;  2VQ0 A;  2RVA A;  1XND A;  2MEV 2;  4LK7 A;  2VCB A;  5FYZ A;  5JDB A;  4H55 A;  4AAP A;  3RNS A;  3JU9 A;  1LHU A;  4LBK A;  4AF9 A;  1F4A A;  3THT A;  5K9Y A;  4BME A;  3RI9 A;  5EHD A;  2PHF A;  3BU0 A;  5JI9 A;  4HAN A;  5LY2 A;  3S6P A;  3PTY A;  3B93 A;  5KHG A;  5LRR A;  5IFT A;  1OH3 A;  2VQU A;  3INA A;  4HXC A;  4ORF A;  3UKV A;  5IVJ A;  2BNM A;  2VMD A;  3NV3 A;  1HRV 2;  1VBB 3;  1W8F A;  5IK5 A;  2W1Q A;  1MZF A;  3IAP A;  1IGO A;  4JCK A;  2D98 A;  4CCO A;  1C4R A;  4NMI A;  1HB3 A;  3GZU C;  3ZOI A;  2I74 A;  1H9W A;  1ZX5 A;  2RS5 3;  2Y6J A;  4LKS A;  4GJY A;  2OZ6 A;  2GH8 A;  3GM8 A;  5FZ1 A;  1C8M 2;  3D4K A;  4DY5 A;  1FT9 A;  4LIT A;  2B5H A;  3LDR A;  5JI7 A;  2VE1 A;  3HNB M;  3ACF A;  1EPZ A;  5FMD A;  2PYT A;  4JRA A;  2QKD A;  3L9J T;  1YI9 A;  2YY1 A;  3JZV A;  3LSE A;  3VZL A;  3A4U A;  4UW4 A;  4XQW A;  1ZBA 3;  2WO1 A;  2ZHL A;  3ACL A;  1DGW A;  1TVG A;  2D5H A;  3WNM A;  2PHD A;  1NCR B;  1LHO A;  1R09 3;  1DQ5 A;  3AYE A;  2TUN A;  2VZR A;  4NRQ A;  4O61 A;  4R9D A;  4JTO A;  3VLB B;  5C3S A;  3U4S A;  3BTX A;  5BNN C;  1HB2 A;  3ZSL A;  4F83 A;  1V6L A;  3HWJ A;  4XUN A;  3ZIX A;  2VD7 A;  4J1W A;  1HRI 1;  3LA3 A;  2VNR A;  4IER A;  4AI9 A;  1SLT A;  1DLL A;  3BCW A;  3KGZ A;  5HXV A;  5J1X A;  3I3B A;  3V0A B;  2D6O X;  3K77 A;  2VVF A;  4I02 A;  1YYN A;  1DQ1 A;  2DV9 A;  4F7Z A;  3FHI B;  1SLL A;  2GN3 A;  2WLP A;  3FLR A;  3MYX A;  4HVR A;  1A8M A;  1HIX A;  3PTR B;  4FQZ A;  5ACA 1;  4AFA A;  5JAX A;  2OPK A;  5FP9 A;  3I3E A;  4XBQ A;  2B39 A;  3AYA A;  4OHX A;  2ZS6 B;  4KNC A;  5DUW A;  1AR8 2;  1IS4 A;  3WVJ A;  3T2Q A;  1D4V B;  5C5U A;  4QU2 A;  2VJX A;  3OD4 A;  5TSW A;  4DEV A;  4IXL A;  4OCT A;  3TEY A;  1GWL A;  5FZL A;  1TG7 A;  4LTA A;  1AJK A;  3T0B A;  1K5M B;  2Z2S B;  4E2S A;  4XHB A;  4ZY9 A;  4E9K A;  5AVA A;  1FAT A;  1SPP B;  4CTE A;  1ZBA 2;  1UYP A;  3JD7 2;  3NJX A;  4EN8 B;  2ZEZ A;  1NE6 A;  3EXU A;  1WW5 A;  3AC0 A;  4UW3 A;  2L9L A;  1FAY A;  2OX0 A;  3MFC A;  2YMZ A;  4LBQ D;  1Y4W A;  5LEJ A;  1ENS A;  1BK1 A;  3OY8 B;  1V6N A;  4QPG C;  1ASJ 2;  2VGD A;  5EJZ B;  4YYO A;  1PVC 3;  3KGL A;  2QNK A;  3MIE A;  4HFS A;  4K1Y A;  1GR3 A;  3WW2 A;  1LRH A;  5C33 A;  1DQ2 A;  3CMG A;  5EYY A;  4ERO A;  1VBB 1;  4L2N A;  1O3Q A;  1V6O A;  2IZW A;  3IB3 A;  3J26 N;  3ZMO A;  4XXA A;  5KXC A;  2JIG A;  2WLQ A;  4KQ7 A;  1R1A 1;  3O1O A;  1JUH A;  1DYP A;  2LRO A;  1NA1 A;  2Y6G A;  4Q4W 3;  4FP2 A;  1UPS A;  5T52 A;  4A6O A;  2CGO A;  2QQU A;  4PLN A;  4QB2 A;  2GND A;  3JBG 1;  5FRA A;  2Y33 A;  1NLS A;  2WNU C;  1UZY A;  3Q8A A;  3UT0 A;  3VBR B;  2HWC 2;  1QDC A;  2VAU A;  1W8H A;  2ZX2 A;  3Q8F A;  3HT2 A;  1UD1 A;  2RS3 3;  2YV8 A;  2VZS A;  3ZFG B;  2PLV 2;  1VMH A;  3IAQ A;  2R04 2;  5CIS A;  2BWC A;  2EF6 A;  2W5F A;  3VDB A;  3PJQ A;  1C5H A;  1R09 1;  3IDA A;  4XEZ A;  1KFX L;  1SCS A;  1AR9 3;  1SZB A;  1Z78 A;  3AP5 A;  4OI2 A;  5CFD C;  4XF1 A;  5FZH A;  3AJZ A;  4NIG A;  1EAH 3;  3AP7 A;  4R8H A;  2BVV A;  3E5U A;  1MS5 A;  2PLV 3;  5A3W A;  5A3M A;  5IFP A;  4P00 B;  1NZI A;  2WNU B;  1Q5O A;  2ZAA A;  1F9K A;  2PHR A;  3TRS B;  1CGP A;  5I0T A;  2DVB A;  4U36 A;  4ES8 A;  2IXL A;  5C3R A;  3WX5 A;  3IMM A;  2DU0 A;  4YGD A;  2GNB A;  1UF2 C;  5EYX A;  3UET A;  4PLO A;  2WZP P;  2W1W A;  2A3X A;  5G04 L;  2W08 A;  2MEV 1;  1IS6 A;  2YU1 A;  4HG6 B;  1RUE 1;  3VZJ A;  1WBL A;  3NNM A;  4MGZ E;  4K9S A;  1OOP A;  4S2F A;  3W9A A;  5FRE A;  4WZC A;  4Y5T A;  3PU3 A;  2VQA A;  2Y60 A;  3L2Y A;  3ILR A;  4NIA A;  2VUC A;  4J1X A;  4MGY E;  1E5H A;  4XZU G;  4MOA A;  4QKN A;  2WT1 A;  3ZSM A;  1O3T A;  1GOG A;  3CEW A;  5LAT A;  5GLZ A;  1RIR A;  3PVB B;  3MPP G;  5CU1 A;  5K7P A;  1HN1 A;  2X09 A;  4QX1 A;  1GWM A;  3N7J A;  1N3P A;  4MGS A;  4JRL A;  1V9U 3;  4Y4Y A;  5IUQ A;  2B45 X;  2HEY F;  1KGY A;  1HX6 A;  2ZGR A;  1K5M C;  1LU2 A;  1RJ7 A;  4IV1 B;  4P5Y A;  4OQ8 A;  1SLI A;  2AEY A; 
#chains in the Genus database with same CATH homology
 5CIS A;  2QQL A;  3POF A;  5CKM A;  2QQO A;  4LOS A;  3POG A;  1SFP A;  1SPP A;  3POJ A;  1SZB A;  3POB A;  3POI A;  2QQM A;  4LOR A;  1SPP B;  1NZI A;  4LOT A;  1NT0 A;  4LMF A;  3DEM A;  3KQ4 B;  5CKN A;  2WNO A;  2QQK A;  5CKQ A;  4GZ9 A;  3POE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...