3POJA

Crystal structure of masp-1 cub2 domain bound to ethylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Mannan-binding lectin serine protease 1
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pojA00
4LMFA 1SPPB 1SPPA 2QQOA 4GZ9A 1NZIA 1SFPA 3KQ4B 5CISA 3POJA 3POIA 2QQKA 3POGA 1SZBA 4LORA 4LOSA 1NT0A 2QQLA 3DEMA 2WNOA 3POBA 3POFA 5CKMA 3POEA 2QQMA 4LOTA 5CKQA 5CKNA
chains in the Genus database with same CATH superfamily
4CCLA 1W8HA 1I1EA 3P1IA 5LATA 3FL7A 1HRI1 1JUIA 1UMIA 1ZBA1 1F15A 4PIXA 2Y6GA 4GD4A 4K3UA 4YZ4A 3ZYIB 2FCVA 3ZXJA 1RMU2 3ELNA 1J83A 1JH5A 3AXDA 4K8RB 1W8FA 3RI8A 1EPWA 5JCTA 3DPRB 1O7FA 3KZ4C 1AVBA 3ROUA 4UOJA 1PX4A 2JDAA 1XPWA 4Y24A 1UW8A 2WNVC 3B01A 1A8DA 4Y26A 5FZGA 2D6MA 3T09A 1FOD3 4EN7B 3IM0A 3E1F1 2CWMA 2DCKA 5AVPA 5KHHA 3T08A 5DZGA 2ZKNA 2JICA 5FTTC 4EROA 4QM9A 3I2HA 4DNYA 1V6NA 1HLCA 5A3LA 3Q8FA 3WZ1A 4F3JA 4JVAA 5GLUA 2GC1A 5FZHA 1UPSA 3FUQA 4BWOA 1S0JA 1W0PA 1R081 5LY1A 1RUH3 5A3PA 3SLIA 2Y0IA 3TEWA 2RVAA 4Q4Y3 3GGLA 5C9AA 4Q4Y1 2HWB3 2RMU3 2VCCA 2WO3A 2VY0A 4MX3A 4YVSB 4UFIA 4QKNA 5LEJA 4YVWC 1QJY2 4E9KA 4FPHA 1Z0HA 3I4IA 4WVZA 4QPIB 3ZDSA 4QGMA 2QUOA 3IPVB 5L73A 4AQTA 4J1WA 2VVDA 3LDRA 3FHQA 4XVHA 3U10A 3WF0A 1UKRA 3SH4A 5IVCA 2VZQA 1FV3A 2HWE3 5GM0A 3S57A 3WF2A 3ZMNA 4XTMA 2V4AA 1W6OA 3KT4A 4Q4V3 4N43B 3DYMA 4A2UA 1AR92 1AR91 3N9QA 1E5SA 3O1OA 4LO7A 4P00B 4HOOA 3LSDA 5F8PA 3ZYGA 5BNPC 2WNUA 2WWUA 5JI9A 1QDOA 2DVAA 1YRZA 5EPAA 4N43C 1AXYA 1Q3EA 2JB8A 2XR4A 3CL1A 4K1ZA 4MGSA 4OUSA 4Y1VA 3ZR5A 3V56A 2JEMA 2HKXA 3RS6A 2NN8A 3GM8A 3RG0A 4I3PA 1LU1A 1QEXA 5A1AA 3TEYA 3B7MA 5FYZA 1D0GA 2VO5A 3VBHA 5CKMA 1K5MA 3VBUA 3PUAA 3BALA 1KS4A 2JKXA 5HI0A 1S1AA 1CAVB 2QQJA 2X5IA 1WGPA 5FY4A 4AHZA 4B7EA 1F8VA 1GR3A 2R7EB 1OD3A 1U5ZA 4QGLA 3KGLA 4IERA 3UKNA 5KWRA 1H8TB 2NQYA 1HX6A 2R062 2VULA 1R082 2CGOA 3A22A 4MHRA 4KWKA 4OI1A 1GOHA 1FNZA 2F4PA 2Q5TA 3C7FA 3KMHA 4WVMB 4Y4RA 2WT2A 3POWA 5T5JA 2PHTA 1PVXA 2G9GA 2IFRA 3MV01 3LE0A 1W28A 2UY9A 4Z2WA 5IK5A 2IXJA 2VM9A 4XBNA 3PVNA 5FXWA 4XJ9A 2J1VA 4NUBA 2GH2A 4D8MA 1AR83 1SBDA 1ZZ7A 2J42A 1TMF3 3ENRA 3KSCA 5GZDA 4LOTA 4YSFA 5J3UA 1GANA 5L36A 5FQ0A 4XJAA 1ALYA 1YJLA 4AVCA 3ZFFB 4LBJA 4Z82A 3WHUA 4H14A 1YQ6A 4N9HA 1RMU1 1E5IA 4IEQA 1UOJA 2Y8KA 4QM8A 4CUGA 3P3NA 1HN0A 1MEC1 5LK5A 1SG3A 4XUNA 3BTYA 2G4IA 4B4PA 3ZXDA 5FZMA 4XJZA 2WZR2 5JIAA 5BY5A 1OLME 4LUMA 4MH0E 4LHSA 4M4RA 5EFUA 1NA1A 2HWD1 2WNVA 4YVWB 1FXZA 2HWE2 2LALA 1VBC2 5CAZA 4D6QA 4QU1A 1XB9A 3R0RA 5F37A 2A73B 3J7NA 3WP5A 5B2GB 3VKNA 1Q43A 5J96B 1BKZA 4COZA 5A3TA 3KQ4B 5CG9A 2NMOA 1MQTB 1O6UA 3KQRA 4Q4W1 2WYFA 1DGWX 1LULA 3MGUA 4H2AA 4QU2A 4NRMA 4OMDA 4XAAA 1ZX5A 2QQLA 3MFCA 2D5FA 2PYTA 1UXXX 5BNOA 5IYYA 4FTBA 2IVIB 2KXLA 2WQ8A 4NMIA 4XE9A 1REFA 2P34A 1YQ5A 1W6MA 1RUC2 2P17A 1FI2A 4A7YA 2XKPA 3A4UA 1QDCA 3R05A 1QJX1 4QHOA 5EJ1B 3S7EA 4YWAA 4S2DA 2VTXJ 4M3CF 4LHKA 4Q8LA 3W21A 1OVPA 4LBQD 1SCSA 5AFBA 5APAA 4OHXA 4R4XA 4ASKA 3EHKA 4W4ZA 1JYXA 5A3UA 2JECA 3MHZA 2WWJA 3R4SA 5EXOA 1SZBA 3B93A 4LORA 2JKBA 1XSRA 1K42A 1K3IA 1VAKA 3PMEA 1X7NA 3NJVA 2W1WA 5A32B 3C8XA 3B69A 4AK3A 3D0JA 3E6CC 2DVBA 2RJLA 2BBAA 2RV9A 1LOEA 5A6ZA 2W0XA 2J22A 5F3GA 4XFFA 5I0UA 4HANA 2IXCA 5EWSA 2ZGOA 2B7YA 3UGGA 5FWJA 1LGNA 3PLQA 1MQTA 2YBPA 2XQRA 2WL1A 1FMD1 3CBNA 4HKOA 1WCQA 2GNTA 3Q8BA 4RN5A 5DABA 5DZEA 4MZUA 5F5AA 4RQPA 4HN0A 1GZTA 2OXBA 2VECA 4QPIA 5F2WA 1AUYA 3WF4A 3ZN6A 3U07A 1ST8A 2K9ZA 3CU7A 4UBHA 3UKTA 5BNOC 1PGL1 3EBRA 3KT7A 2VXJA 2I07B 1J59A 1D7PM 3M3IA 2IXLA 3E6BA 4P9LA 4XF9A 1BCXA 1W2NA 5EZWA 2Y6KA 2Z2SB 1QJU2 4DEVA 2JG8B 3JD73 1JMUB 3Q8CA 3WF3A 2Y26A 3PUHA 5IWFA 5A3WA 4DOUA 1VAVA 3R6SA 4DUXA 1BVP1 3VD9A 5EP9A 5CZKA 4R4ZA 1COV2 1PVC2 1SLIA 4R9BA 5KHKA 1AYM3 4YFZA 1PGSA 3NMBA 5FQ0B 5FDBA 1H2LA 1I6XA 4CDWC 2ARXA 1TZOA 3CJXA 5L7OC 4N7IA 4ISRA 5DUVA 4FPYA 5HV4A 1UNBA 4AHXA 5LBEA 3H8OA 5I0DA 3GYDA 4YW5A 4Q5OA 5GZGA 1CAWA 5FJKA 1PVC1 3SCHA 2CHHA 5FOJB 5L7OB 1MS4A 4NJ4A 2XH6A 1IKPA 4CDXA 4L97A 3U4XA 1KDMA 4CCOA 5HCAA 4YW2A 4L0PA 5JZGC 1VB4A 2QCSB 4NWVA 1QJU1 4LQRA 1RUF1 1CPMA 2BDRA 3JB8A 4HSLA 4IEZA 5FZBA 3ACHA 4E2GA 1VP6A 2R6QA 4JAAA 4QGNA 4AI9A 2QE3A 5FCCA 1HQLA 1VBD3 4JTNA 5FMBA 2W87A 3OUHA 3RMXA 3VGIA 1XU2A 3WDTA 1K5MB 2B9VA 1QJX3 3VBUB 2F6BA 4B3NA 4I0AA 4LEJA 3EJKA 3TN93 2A6WA 2I2SA 3INAA 4LLOA 5FZ0A 3POEA 3E5XA 1NE4A 3WP4A 1GYKA 3KM5A 3IKWA 1AR81 1FOD2 1HRI3 1O4ZA 1ZBA3 3IDBB 1LOFA 4XETA 5FPVA 5JSOA 4CXYA 2PHWA 2X5IC 1GNZA 3NQHA 4PIYA 4QX7A 2CDPA 1BEV2 1W6OB 2PXJA 3K4AA 3V64A 4BU2A 3UESA 4CP1A 5C6CA 3BTZA 3RZGA 2PTMA 1F9KA 4S2HA 2BWAA 5H9SA 3ZFEA 2ENRA 4Y3OA 1URXA 2ZMNA 5DDJ3 5GLZA 3KD4A 1NQDA 1XE0A 2DCTA 1E57A 1WLWA 4Q4X2 2WLQA 4XXPA 2ZOEB 1QOTA 2RDSA 3HOBA 3UETA 2JG9C 5JMCA 1WCUA 1PM7A 3IPVA 5DG1A 2RR11 2CGNA 2VR4A 1PZ8A 2ZBJA 2ZZQA 4H7MA 1F4AA 5C3RA 1NX9A 2WINB 2GMMA 2CV6A 1CQ9A 1NA1C 4PBOA 4Y1UA 4AVTA 2ZHNA 2J1AA 3HQUA 1AR63 1LENA 1OA4A 2P1BA 4IEWA 3VBRA 3B3QE 1G9AA 5KXCA 3K4DA 5CKQA 3KF3A 5CEHA 4U36A 3V65A 3ABZA 1OQEA 1RUC3 4CP2A 5KBFA 1HN1A 3AM2A 2X10A 5HCFA 1OVSA 4OHWA 3WW1A 2IC1A 4B7KA 4EQVA 1V6OA 1HV1A 4DINB 2XBO3 3ZR6A 1ACCA 5F7UA 4D6RA 4AVSA 4BIOA 1HQNA 2UWAA 2HWF1 1PO13 2NPIA 1IQDC 4P9GA 4MLOA 5FYSA 5HXMA 4XUOA 4NWWA 1O3TA 4E2QA 2VMHA 1WW7A 4RHV3 5FO9B 3O1VA 1WCSA 5CYYA 2XXZA 3F2ZA 4Z8BA 4GAZA 2QKDA 3JBG2 1ZVFA 3QCWA 2I74A 4RFT0 1OLRA 1OH4A 4CVUA 3WOGA 2PAKA 4TTGA 2HWD2 1L7RA 2EIBA 4K7JA 3A7QA 5D21A 2GMPA 2P3KA 3TNPB 3M3OA 3ZYBA 2QZ3A 5FXZA 1SFPA 4AAPA 5IK7A 1O8PA 4ZZ5A 3ZOIA 1GWMA 1N3QA 3B9CA 1CJPA 4Y5Z0 4A42A 4P9XA 2WIIB 4QQPA 4KG0A 2RJ2A 5JVVA 4Q4X1 2PHXA 4CCMA 4E8DA 4LKEA 3LGRA 1VBA2 4FVVA 1BEV1 4GH4C 3WV6A 2FCTA 2WN2A 1YEWA 3DGTA 3DUIA 1FX5A 4NPLA 4A44A 2GC0A 1AX0A 1AR82 1FOD1 2ZAAA 3DPRC 2CYFA 1PIV3 2GMEA 3H50A 4ORFA 1V9U2 4GWMA 1W8ZA 3BPZA 3N7JA 4OVEA 2WO1A 2Y6LA 3IB3A 1JXNA 2Q30A 2VZVA 2ZGMA 3R4UA 3IAPA 3O1RA 5C70A 5F3CA 1UZVA 4UW6A 2D97A 5A7OA 3FBMA 3KB5A 1LEDA 2JDYA 4AEDA 3U37A 3C7EA 2G19A 1OF4A 2Y38A 1FATA 2WO2A 4LA2A 3I8TA 2H0VA 1MPXA 1JW6A 1XNAA 2KM2A 1ZRIA 2VUDA 3JCIA 2VH9A 5FZ7A 3U14A 1RUF2 3ZYFA 2D6LX 4LE3A 5FP4A 1DBNA 2Y6JA 1YJKA 4DMIA 5FP9A 3LSEA 4LMFA 3V0AB 2P6HA 2P4EA 3NSTA 2W95A 1D4M1 4OI0A 3I2GA 2WT1A 3H1WA 2PLV3 2JD4A 3N3HA 4P9WA 4D94A 2G1MA 3SKJE 2YG0A 2XWBB 1GNYA 1I3HA 2AYHA 3C7HA 4W6YA 4MGYE 5A3NA 2WN3A 5FXXA 4CCJA 4P02B 4PQQA 4FFIA 4NAMA 4MSVA 5FMCA 3GHMA 5DN2A 2YPJA 2C26A 5A6XA 3H7JA 1PMHX 5CFDB 5I0SA 3VBFA 2IVJA 2C5DA 1ZA7A 2EVXA 2WNOA 4A6SA 5BNNA 4XFAA 3POBA 2VW1A 4IEVA 2HWD3 3NW4A 3WR0A 2ZKLA 3RJRA 1KEXA 3T3YA 2O14A 2RG4A 4DUVA 4EV0A 3D3AA 4QKBA 2JG9A 3OPTA 3IMNA 4KWUA 3CMGA 3T0BA 2XBO1 3RPQA 1XNKA 2YC2A 2A5ZA 3K2OA 3WDXA 1NCQC 1E5HA 3CNAA 1BBT1 4LO5B 3WUDA 3DF0A 3WQBA 1CESA 4QHBA 4XDOA 3H8RA 4QB1A 3VHOA 4R52A 2BTVC 4N8MA 1PGL2 1YIFA 3Q9OA 2WABA 5F5CA 2VBBA 4XF0A 1WCKA 4IGPA 4ZU7A 2GNBA 5LASA 4OZOA 2QQWA 2ZEYA 4GXLA 5D8AA 1OKQA 3DEMA 1DQ1A 3AKSA 1S0CA 2B39A 5FAXA 4OUEA 3I3BA 2ZMKA 1U5XA 2BGPA 5A7SA 5C3SA 1FMD2 4M00A 4CCCA 3WP6A 5C8CA 4IETA 1W3VA 5LA2A 5LRRA 1QNWA 1HRV3 3ACFA 3LDBA 4BCUA 4QPYA 4Z07A 4DPNA 4YZ3A 4GALA 4CDQB 4GH4B 3BGAA 4CDXB 1N1YA 3N9MA 4U2AA 3KWVA 5E16A 2WNVB 4AFMA 3V0BB 4D6SA 2DTWA 4I01A 4XZUG 1HB2A 3W59A 4DZGA 1REEA 1XJAA 1CAWB 3POGA 3VZOA 4BPZA 2VBPA 2V5DA 4I2OA 1JYTA 4FPLA 2C9AA 1ZA4A 2XJPA 3ZM8A 3AL6A 3ZFGA 5JXJA 2Q8OA 3HBKA 2VQUA 3POFA 1GBGA 2E31A 4JDNA 4YG3A 1HRI2 1ZBA2 3ZXGA 1JYVA 5GLTA 3BTXA 1AL23 1FMD3 4P14A 4Q1PA 4WBBA 4COWA 1QJX2 3NNJA 2GDFA 1RUI2 2AUYA 3FWEA 4QKDA 1G9FA 1RUC1 4L2NA 1OUSA 5FYBA 3AMPA 4JCKA 1RVF3 1V70A 2JG8A 3H3LA 1OMIA 1W0NA 1RUH1 3KT1A 3PVEA 3MW4A 1BMV1 3UJOA 1XE7A 1RC6A 1VRH1 2PELA 4NRPA 4YW6A 4IGQA 1GLHA 1PK6A 2Q8EA 1DGLA 4QB6A 1RHI2 1A34A 1QH6A 2LROA 4XQ4A 2DBNA 4WVMA 4CE8A 4UW5A 2EF6A 3D6EA 1W90A 2AR6A 2JIJA 3O12A 2P3JA 1MQTC 1ASJ2 4UW3A 1YQ2A 4ATEA 1B35A 4EN0A 3HVDA 3VD4A 1DFQA 5E6HA 2WZR1 3FX3A 1F5JA 1JOJA 4HBNA 4PF1A 4ES9A 5I0RA 4LBLA 2QQPA 4XFHA 1A6CA 1H4HA 1LOFC 2E26A 2BNOA 5F39A 1H9WA 3VDDA 1XYNA 1T6BX 2VVFA 4DRRA 4N9IA 4DY3A 4E4DX 1GICA 2DVGA 2BYVE 4UAPA 1REDA 2B5HA 5JLVA 3WW2A 1Q5OA 3Q8AA 2K0GA 3DYOA 4A41A 4BK5A 2VMGA 4XXAA 3P3PA 4CSWA 1FNYA 1MACA 3JZVA 1W6QA 3S6PA 4IE7A 3M2MA 2HJIA 4JRLA 4LULA 4W6XA 4JDMA 1S0FA 3P6BA 1Y9GA 1GOGA 1RINA 3ZYPA 3BU7A 3IT8A 3VUOA 1DZRA 2WR9A 3DXUA 5FOBB 2GAUA 2XQXA 5FZLA 5DQ0A 4GA9A 2UY8A 2PQQA 1WMDA 2VMDA 3HPNA 4BIFA 1DLLA 2X09A 1WZXA 4QQ2A 2DWRA 1DZTA 4S2FA 3AVSA 4YLZA 1V6IA 2BNNA 3OD0A 4JDOA 4V2VA 4AHWA 1SFNA 1M4WA 4AQSA 4YM3A 5C3QA 2YU1A 3MBWA 1B35C 3IIIA 1V9U3 2BGCA 2R061 2VNOA 3N7MA 1EAH2 1VIWB 4CU7A 4TLFA 3QH6A 3AP6A 5JOZA 1DQ6A 1NOVA 1PX3A 2WYSA 2YYOA 4NROA 4BOWA 2B4KA 4PBPA 1TMF1 2OUHA 4CP9A 5A7WB 5BPXA 5DAQA 5FZ8A 4WM8B 5T5PA 1QXRA 4D3WA 1D4M3 2XOMA 3AMNA 2XUEA 3JU9A 5FYVA 2JD9A 2CAVA 1EV13 2KA3A 4CCKA 3ZFGB 4YGEA 1EUUA 1UYXA 2H6CA 3GBWA 1J84A 2VZTA 4R8HA 5KC5A 3CZJA 4PF5A 3ZPYA 2W1SA 3B94A 2X05A 3GXUA 3OYWA 4IV1B 4FOYA 4PLOA 5C4WC 2E32A 3K51A 2L9LA 5FY8A 1LHWA 5KXBA 1AXZA 1GUIA 2I45A 3KF5A 4AWDA 2PAEA 5CBLA 3N35A 1NG0A 3UKVA 5ABJB 4QPWA 3GZUC 3WQ7A 5CISA 2OW4A 1QJY1 3DKWA 3KLSA 1HB3A 3UT0A 5L19A 4CEWC 5TSWA 2DTYA 4XF1A 2HWC2 5J98B 3LAGA 2VUCA 4DXSA 4OYUA 3J9SA 1XBFA 1UO9A 2IXIA 4GQ7A 4YM0A 3HIFA 2VD7A 5LK7B 2WZR3 4AQ2A 4ZS3A 1F31A 2OQ6A 2D5HA 1UX7A 1RYYA 2HH9A 4UFJA 4XW3A 4B8EA 4NPRA 1AL22 5A3OA 2VMCA 1RJ7A 2RS11 3PU3A 2GH8A 4IEYA 4UW4A 4NIDA 1W06A 1NCQA 3D8CA 4GB31 4H7LA 1VBE3 3I59A 4K9SA 3RZMA 2OZ6A 1H8TC 2FMDA 2VZ3A 5BNNB 2ZABA 2BVBA 5I8TA 3WNNA 2BUKA 1KS5A 3OPZA 1OOPA 1DU3D 2WT0A 4BLJA 1QJU3 1N1SA 2WNUB 1SLBA 1WD3A 4YW3A 3ZXLA 1S0EA 1EY2A 1Z7S3 5HXVA 4Z2AA 3SH5A 4FFGA 1KITA 4URTA 2VUAA 2XJSA 1EV11 4OLLA 4COUA 2XPJA 1QWRA 5FKCA 1EP0A 3USUA 1A78A 2YDEA 3BCWA 1ZZBA 2C6SA 1GMMA 3IWZA 4BE3A 3VBFC 5JOXA 3WX5A 5FKBA 1O5LA 4BDVB 3OF1A 5IVJA 4XFBA 4K6BA 1LECA 1D0HA 3B5LB 4PI0A 3AFGA 1QXPA 1HKDA 3PURA 4XACA 3OEAA 3ITQA 4I30A 3UJQA 3WXPA 4CEYB 5H9RA 2CGPA 5FYUA 3LA7A 4LIVA 4YVSA 1VRH3 3Q8EA 4AQ6A 1DLCA 2RS32 2JE8A 2ZMLA 1DYKA 2PAMA 1HW5A 3QD6A 5FPBA 3LA3A 2VC9A 1VRBA 3MF9A 1F2NA 2E6VA 3TNQA 2WJSA 4Y33A 2UWCA 4A7ZA 5HV0A 2R49A 3N9LA 1QY4A 2BW8A 2WSVA 3NAPB 2Q4SA 1AR71 4AEMA 2D6OX 5AC93 4CDWB 3BPSA 4MV2A 5CVRA 3M3EA 3CLPA 5A33A 3BOWA 3T2QA 2B8MA 5T52A 3SEPA 1AYM1 4ZU4A 3I3DA 5FXVA 1WMFA 1ZZCA 3WNLA 4RGKA 4XYXA 5LWBA 1AYN1 2CSGA 1HXS1 1LOBA 3G7DA 4K1YA 4LOSA 4RGAA 3AP9A 4CPBA 1OC1A 2J1SA 3MF6A 3WT3A 4EN9B 5LW9A 2BJSA 2E53A 1NCRC 4FPEA 1N3OA 5FZCA 2WLPA 1QQP1 2D6NA 4BH9A 3PIJA 4AOCA 2OKXA 1LHVA 4BM8A 1PO23 4ZHNA 5LA9A 2W94A 2VZOA 1JHNA 3IDCB 4AEKA 4LBQB 5GALA 1BZWA 3JD72 4OI4A 1BJQA 2R072 1K5MC 1OQ1A 3FLRA 3VBUC 4Q0UA 4ZZ8A 1Z7S1 4FP2A 4AI0A 5LCWL 1QIQA 3MIEA 2CTVA 3H3UA 4EWEA 4YW4A 5FZOB 1C57A 1DYOA 2ES3A 3CF6E 2YMZA 4IE6A 2UYBA 1X36A 2SBAA 5JWPA 4NIHA 1S0GA 1RUI3 4XBQA 4FBFA 1VB2A 4TXWA 5LBCA 1H9PA 3T2TA 1PNFA 4B4RA 2VNRA 1W2UA 4D7YA 5JI7A 1J3PA 1FYUA 3BU0A 3J8F1 1O3SA 4O9GA 4Q4X3 2JE7A 3I59B 4ZS2A 3WCRA 3E6DA 1R1A3 3O0XA 2R042 4YGCA 3VBOA 1V6KA 1UU4A 3CKHA 4XFIA 1DDLA 4MGZE 2E7QA 2Q1MA 5HPOA 5IVFA 3ALQA 3VL8A 3EXUA 3X29B 5DDJ1 5JAXA 5T5OA 1TEIA 5FK8A 1RMU3 4INDA 1AL0G 2VPVA 4XJWA 1ZZ6A 1IZ3A 1RUE2 2G9ZA 3DV8A 3O1MA 2W08A 4YPJA 3WNOA 1W6NA 4PDWA 5ACA2 2B9UA 2DVDA 3T2PA 1PGW1 4ASLA 3WQ0A 2O0OA 2R1BA 1JOBA 5C4WA 1RUG1 1UY0A 3WVJA 4LXLA 3WEZA 3ZFEB 4AGVA 1RUG3 4EYUA 1G9DA 3FLPA 1QKQA 2FHRA 1C3HA 4FXGB 1CJDA 3SCGA 4BYYA 1BQPA 3AJYA 3ZFEC 5A6YA 3PJQA 4BA6A 1OOPC 1CONA 1DQ0A 3LB9A 4NAOA 4O65A 3SH3A 4PT6A 4XF3A 2XMLA 3POJA 2UYAA 2Q0AA 1LNSA 1ZBE2 2N7GA 1CAXB 3O7OA 1JU3A 4QDRA 1BK0A 4WM7A 4W6WA 2VTXA 1PK6C 1APNA 2VOTA 1OPOA 3WNPA 3TEZA 1PNGA 2Z42A 2ZCWA 3O5SA 2GP5A 2D3SA 4I09A 2GN3A 3AVRA 3LOIA 2GALA 4QQLA 3OTFA 2Z5WA 5FMOS 1LRHA 4YW1A 2Q8DA 4IV3C 4Y22B 2QVSB 2P6CA 5CB7A 1UXZA 2Y60A 5DUXA 3ZDVA 2FDIA 1MS5A 2QQNA 3TN91 1JYCA 1DQ2A 2WA3A 4ZXEA 4X8PA 2E7TA 4IV3B 3WQ1A 2RS13 3S5QA 5I8SA 2ZEWA 3KHBA 5FZ3A 4XDQA 2D93A 4HVQA 2RS53 1J3RA 3DYPA 2W1UA 5K8SA 3J4UH 3PU8A 2ETEA 2XLFA 2EIEA 2MEV3 2QQUA 2MEV1 3KV5A 2ZXQA 3AKRA 3VKLA 3AB0A 3TYJA 4ASMB 2RS33 4XQDA 3U1XA 2B45X 1IG0A 2BPA2 3CDZB 2W52A 2R0HA 3KV6A 1R1A2 4FFFA 3WSOA 3ILNA 3MIHA 1YHFA 1PIV1 4R9DA 3SCFA 4MXVA 1JYWA 4IUGA 4LBKA 1OT5A 3ZSEA 2J1TA 1VAMA 5IFTA 1CPNA 5KC6A 4UF0A 2JDMA 1OPMA 2OA2A 4YRDA 3BODA 4TLGA 2ARBA 2X29A 4J1XA 3AMQA 1DGRN 2CWSA 2FMYA 1MZEA 3JUUA 3HN1A 1W6QB 4TN7A 3U0ZA 4YZ5A 3ETQA 3MLLA 4PLMA 2OZJA 1E5RA 5IVYA 2PA7A 1UU5A 1T2XA 3CQOA 3G6JB 1G6NA 4MXWB 1LODA 3AX4A 4RD7A 3FLTA 4XABA 4DQAA 2W68A 4SBVA 5D1IA 4M0NA 5LY2A 2A7AA 4FI9A 1IS4A 1J1LA 3B9IA 3I2KA 5FO7B 3D82A 4C0HA 4GZ9A 1GFF2 1H6YA 4YZ2A 1N47A 3AZVA 3R4DB 1FPN2 2GC3A 3IAQA 1TME2 2YC4A 4G3YC 4JGZB 5F9TA 3IDAA 4QPIC 4DFSA 1L7QA 4DIQA 2MHFA 1W2AX 2V4VA 3NNGA 4XOGA 4CDUA 1ND2B 4GKXA 4R9AA 3ZKYA 1BVVA 4D69A 5IVBA 5LA0A 2JXAA 2BERA 3H7YA 2XONA 3D4KA 2R0FA 1NLQA 3VD5A 3AL5A 1GSLA 1QJZA 1RVF1 1UIJA 2YGMA 3K48A 5IATA 2VNVA 2J1UA 5AC92 2RMU1 2TBVA 1PM4A 4CZSA 1W9TA 1QF3A 1WMEA 4OULA 4LO6B 1F35A 2ADDA 4IEXA 5BNPB 3HQXA 1VJ2A 4OFGA 2JWPA 1BBT3 2RM22 4KNCA 1LB2A 2W9XA 3FC0A 4FPJA 4C1XA 1L7LA 3RWKX 1PO11 5BXXA 1PO12 5C9AC 4QPGB 2PHDA 4F8AA 1UPIA 2AREA 2HWB2 3FN9A 4NRQA 5IK4A 1POV3 1RTVA 1IPKA 2Y64A 5A7PA 1W8UA 1NXMA 4XMIA 3RSJA 4IEPA 1ZYBA 2RMU2 1G7YA 5EJZB 5E89A 2VQAA 1SQ4A 2ZGPA 2P2KA 4QPGC 1XSQA 2GSYA 3AZXA 4YNIA 3MW2A 2QBXA 5E88A 1DYPA 3CJIA 5GKAC 5J36A 3S7IA 2EA7A 4QXKA 3THTA 4AFDA 2D7FA 4CDXC 5KXEA 1Q8SA 1UY1A 2VNGA 4Y20A 5IJRA 3HN3A 2CDOA 1ONAA 2JIGA 2NLRA 1DF0A 1GU3A 2NYYA 1LJ7A 3IIAA 3K3NA 4CUCA 3H8XA 1YC61 3PIGA 5FMOL 5FZEA 2UURA 4JC1A 5IFPA 3ORJA 1QMJA 4Y20B 2UWBA 2WS91 4LK6A 4A3ZA 3K4ZA 2V73A 5LB6A 2ZX4A 4XIOA 5C8CB 5JPMB 4CXXA 5FZIA 1DQ5A 5DZFA 3I2OA 1YLLA 3CJIB 3I49A 4FTEA 2FDHA 2X8KA 2XKOA 5H9PA 3H3ZA 3ILFA 2OX0A 3BI3A 4HPKA 1WW4A 4JZRA 5FRAA 1RUNA 1DIWA 4NHMA 2XLAA 2ZGRA 3CJIC 5FZKA 3JQWA 2ERFA 3AZZA 5JXIA 4W8JA 4QPGA 2A70A 1J3QA 1W3XA 2YHJA 1MS0A 3ZSJA 1D2QA 1S4CA 3W5NA 3PJYA 3AMHA 2ET1A 3ZFGC 5DMYA 3AYDA 1WLDA 5IUQA 4GJZA 1VBB3 5FY9A 4RYDA 5EYYA 3EB7A 4MO3M 5LEKA 2XJRA 2FZ1A 3AZYA 4JKMA 4YM1A 2E63A 4RR3B 2PHFA 3MI8A 4R9CA 1MZFA 1GKBA 1O5UA 4HXCA 4QDQA 2FDFA 3ES4A 4L8QA 1WBFA 1ND2A 4WZCA 2VAUA 2RJKA 2XJTA 2MEV2 3GDBA 2J7MA 5JR7B 3VD7A 1ND2C 3HT1A 1OURA 3QH7A 4JV4A 1VLNA 1ULFA 3TAYA 1BYHA 4AFCA 1UOFA 4BQYA 5D2AA 1CAVA 4YZ1A 1G9CA 2E33A 1WUVA 2MPFA 3V0AA 3SQOA 1WA6X 4P08A 1KD7A 2WAAA 1OF3A 1UY3A 3OBTA 4OZXA 1HRV1 1BLZA 4YM2A 1NUKA 3KVAA 5LRSA 1RUD1 2FZ2A 5FMDA 1RUD3 3DXTA 4AVVA 2OS2A 2AH2A 4RHV2 4LLFA 5FYHA 4EE2A 4HVOA 1XU1A 2DUQA 4AEDB 3W9AA 4KU7A 3NWKA 1K5JA 1UZWA 1ZRDA 3SISA 3OSDA 4NHLA 1G86A 4G4FA 3PDQA 2QQIA 5A6QA 1W9WA 1ZBE3 3JXSA 4ZKTB 5ANNA 2ZGUA 4Y1ZA 4IW3A 3RJ2X 1LOCA 2G9FA 2HYKA 4XDPA 3C7OA 4I3GA 5FUPA 4M4PA 2PHLA 3RVHA 3WG1A 4CDQC 2ORZA 3I2JA 3APBA 3O0VA 4Y1YA 1SHWB 2EIGA 4YARA 1RXGA 1WMXA 3AYEA 1S2KA 1LHUA 1W9SA 3VBSC 2VCMA 1R091 2EXIA 4JQTA 4J25A 4JRAA 4Y5SA 3ZMOA 1NCRA 1IS6A 3T4VA 5JXGA 1PMJX 3OPWA 2R063 3RYPA 3VZNA 4AEJA 4Q0QA 4AFBA 4V1PA 4DEQA 2OT7A 4OCTA 3MV11 4HN1A 2VOKA 4TYSA 3TEXA 1YXWA 4Q0SA 3J7LA 2QQOA 4CCNA 3OD4A 5BNQA 5FBJA 5GZCA 5A1LA 1O91A 3OY8B 4FQZA 5G04L 5IT6A 1UYPA 2BFUL 2PLV1 4RA0A 2EXKA 2JDNA 5K7PA 4XFGA 2DCZA 3OG2A 4QKFA 1K45A 2IZWA 2QNKA 2UU8A 3H9AA 4LO8A 4G9SB 1H30A 3W20A 2FCUA 3VDCA 4ZXKA 1GQHA 2DFCA 4Q0PA 3VDBA 4EZHA 2VZRA 4RS5B 2WQZC 1C4RA 1C8M3 1UYZA 4LO4B 2YBKA 3VD3A 2JENA 3OB8A 3VBRC 1CZVA 1NY72 4Q4V2 1UY2A 1W8WA 2XVKA 1US2A 3SEEA 4I0BA 4RR3C 1W99A 2YROA 2WWSA 2ZJCA 4H55A 2WKKA 2D6PA 5A7NA 3T0AA 5E8AA 2HWB1 5GLVA 2GC2A 4O61A 3AYCA 2CNAA 5IVVA 2WC2A 2NP0A 3T1MA 1PO21 1XNDA 5JSRA 3WW3A 3JD71 3NKGA 1O3QA 1M06G 1IGOA 3KCXA 1MS8A 4W65A 1NCRB 3B02A 1JOPA 4MHUA 3FJSA 5ABJC 3H8UA 4GIQA 2ZGTA 1W6PA 3CIHA 1VBD1 1QOSA 1RVF2 2FQPA 3J7MA 4LR4A 4Q0VA 4CEWB 2FDJA 2BZDA 4IGOA 5ANQA 5JDBA 5LZ6A 1JZ5A 3FFQA 1IPSA 4UI9L 4IXLA 4ZY9A 1IKQA 1RIRA 1X9TA 2AEYA 2W2IA 2IXKA 1AYN2 1W04A 3THCA 1SPPA 2PQSA 5FZ6A 3ZXKA 4MGTA 1H1AA 4H3WA 1SLLA 1TME1 2JX9A 1AYM2 2DURA 5FYCA 4DUWA 3HQRA 4HLTA 3ZO0B 2YFUA 4KG8A 5C5UA 1LGBA 3PUQA 1GP6A 1JZ7A 4P5HA 4AW7A 1DQ4A 2QJVA 2Y6FA 3VZKA 1Y7BA 1RITA 4BQ2A 1PMIA 2WA4A 3EMRA 3ZKUA 3VDAA 3WHTA 2ID4A 5JOWA 4ZPIA 3KVBA 3GBGA 1W6PB 3NVCA 1H2KA 3UL2A 5FREA 1RUJ1 2Z79A 4P9JA 2XJQA 5CU1A 2QZ2A 3OOXA 5FLJA 5CADA 3NL1A 4X8NA 5K9YA 3ZN4A 1WBLA 2VQ0A 2ZA9A 1ND3A 4FPKA 4XHBA 4KWJA 1RGSA 3T4HB 2RDQA 4FPOB 4ATFA 2WNEA 1TNRA 1H2NA 5EQUA 1OSGA 4DO0A 3OYWB 1VBB1 2Y0OA 3I7DA 4IV1A 4KH9A 1QGLA 3RNSA 3FHAA 5L7OA 4XMAA 1W9YA 2OVUA 1R1A1 2VVEA 1LGCA 1WA4A 3GCWA 3OEBA 5IAXA 1IG3A 4Q4W3 2LTNA 5GLWA 3URFA 1ULGA 2XHKA 4NOTA 3LEMA 4UT5A 3UYJA 1CAUB 1OLMA 1YQCA 3BIEA 1KDKA 5FK7A 1HJGA 2JG8C 2RS52 3D5OA 3FUOA 3NJYA 5CG8A 2XDVA 2VZUA 3VHNA 1YI9A 2WFF1 2ZX1A 5A7WA 4CP9B 1ZRFA 4HPKB 5FY1A 2VZSA 1AR93 3MDPA 1HXS3 1T6GC 3BKZA 5GZEA 4WZFA 1YWKA 3ACIA 4IESA 1JZ4A 4CP0A 2YB7A 3RDIA 5C3OA 1I5PA 5G05L 2P37A 4QQOA 3MW3A 2WFF2 4AI1A 2XVLA 2BNMA 1EYBA 2FBEA 2OPKA 3HNMA 4DXZA 2SLIA 2RS51 1VBE1 1CX4A 1QQP3 2D98A 3PL0A 4S2GA 3VN4A 5HBAA 3W5MA 1U5IA 2DVFA 4KWLA 4XUQA 2D43A 2ZZJA 4AAXA 4HK8A 4A7KA 5BYNA 2HLEA 1BMV2 2BVVA 1XQNA 1CZTA 1WD4A 2VMEA 1RUF3 1ENXA 1DCSA 1H6XA 1STMA 3C7GA 3LIGA 4BZ4A 5KHGA 2PN5A 3I54A 5SV8A 4QX0A 4XUPA 1DP0A 4CPBD 1VBC3 3PUSA 5KHIA 4XBLA 2YZ4A 4IDZA 1ENRA 3NNFA 4BK4A 5CA6A 1KFXL 5A32A 2TNFA 1OA2A 3BN6A 3PVOA 1PGW2 2VTFA 3U75A 2R32A 4BQXA 4LJHA 4EJRA 1ODMA 4LA3A 5ERLA 1JUHA 3BTAA 4TZDA 1RUE3 1OFNA 4RGGA 5CKNA 4MG2A 3RFRA 3DCQA 3PNAA 3OGGA 3RZZA 5C7GA 2FD8A 1V6MA 3DKQA 1RUJ2 3HR9A 3M70A 2R1DA 2LRPA 4LKFA 4M3CB 1X50A 1SLTA 4J6GA 3VKFC 2R043 3POIA 1S55A 4DRVA 3ZIWA 4BQ4A 3OGVA 4FTSA 2Z69A 2JJ6A 1RUJ3 1XYPA 3J8F2 5F3EA 4BXSV 2DDUA 1VMFA 4EWAA 1MEC3 5FYIA 3BUCA 1W6MB 1UMZA 3DN7A 3VHRA 1J58A 3M8LA 4M0HA 3AP4A 1CR7A 1EAH1 4FCAA 3ZSMA 2PFWA 4CEYC 1CIYA 4RR3A 1AR61 5BNOB 3VB9A 3OGJA 1C8M1 4HZFA 4B1MA 4O7XA 4CTEA 3LEIA 2EXHA 4JGYB 3EO6A 4C91A 3RZHA 1YNAA 1HJFA 3MICA 4KGQA 1XNBA 2XJUA 3ON7A 5F3IA 3HBZA 5JIUA 1B09A 4X6RB 3ME2A 3IZOA 1UMHA 3AZWA 4FPCA 5CFCB 1CD3G 1GWKA 1VBD2 1HB4A 3WDVA 2R071 3O14A 3L2YA 2Z4FA 2B42B 4MXWA 3WLUA 3GZAA 1LU2A 2ZGQA 5I91A 1ZNPA 5CIRA 4LIUA 2ZEXA 1NLSA 4HMZA 4EN8B 4XPVA 4FAHA 5CFCC 2D40A 4EWDA 3CHXA 3MYXA 1NAEA 2BGOA 2WAOA 3MIBA 5JZGA 1YUDA 1OFSA 1HDKA 1PO22 5T50A 1D4VB 1POV1 4C0BA 1TNFA 3K75B 1GZWB 4ISQA 3JQXA 1XC6A 3A0NA 1XNTA 3ACGA 1ZZ9A 4UF0B 3IMMA 2QDNA 1HXS2 4HT1T 4GMP3 5K4LA 1C8M2 4Z92B 3K46A 3V0BA 2Y6HA 4COVA 1AR62 1A3KA 1IS3A 4GH4A 2IXHA 3KCYA 4LT5A 5IK8A 1DGRA 3VHPA 4JKLA 3TOJA 3T1LA 1OQDA 3ES1A 2ZGKA 2QDRA 4B29A 2D3RA 4QX1A 5JOYA 3ZXFA 4QXHA 4HKWA 4FPFA 2W3JA 1POV0 1XRUA 2OIIA 4IV3A 2TUNA 1WWYA 2VCAA 3I2IA 1VPHA 1QHDA 3LDKA 3AMMA 4Q27A 3WNMA 4AVAA 2DFBA 4AGRA 1W8OA 2P3YA 1CAUA 3OGSA 4ZONA 2H6BA 1ZM1A 2EAKA 2VG9A 4MYEA 4NIGA 1W39A 3WG2A 1H8TA 3LPFA 1Y9MA 4E27A 1R092 1VMHA 3P5BA 4KMQA 3NO8A 5FZAA 1RUI1 2ZS6B 3SMHA 1D2SA 3M1HA 1HQWA 4XZPA 3UV9A 5FR3A 4Z1VA 5C8WA 2J1EA 4MGKE 4YW7A 5FY5A 5FV3A 4K8FA 3I3QA 3ZIXA 3QOPA 4MGQA 4OQ8A 1QNYA 4XJ8A 3LEGA 4WM7B 4AYUA 1S2EA 4LITA 4QWNA 4GWNA 4AI3A 1Q8OA 4CDUB 5BV6A 4IE0A 5FPAA 1IS5A 1H1IA 3VDDB 1ND3B 1GP4A 5KR7A 1R64A 1VBA3 2HBUA 3KS7A 3N36A 4Q8KA 4DB5A 4ES8A 1YQ8A 4WVVA 4QX5A 1XYOA 4GWIA 4UBGA 1VBE2 1JYIA 4JGYA 2KD7A 3VBSA 4GWJA 4RHV1 1IQAA 4LPLA 2AENA 4X6QB 2ZEZA 4JGYC 2RDNA 5A7QA 2RS12 1Y43B 3J7HA 4UFKA 4P5YA 1RUD2 4XQWA 3T2OA 4DXRA 1AL21 2B46X 4CCDA 4D0QA 5GJ6A 2YXSA 2VOXA 2DV9A 3AJZA 4KU8A 1OD5A 1AYN3 3QLQA 3IN9A 3MLJA 2BWCA 2IUWA 1Q8QA 3NV3A 4FOWA 4NHYA 4PHZA 3THDA 3O0WA 4OHZA 4OQ9A 1PK6B 4XILA 2QFEA 3I2DA 2HWC1 3BVCA 2QQMA 3FBYA 3ZXEA 4YYOA 4L11A 5C9AB 2Y34A 3MEPA 4Q26A 1SPPB 3PTYA 5ISLA 3WD5A 4MGIE 3U78A 5FLIA 3I97A 1BBT2 1VMJA 2RM23 3GNEA 3RI9A 1WLCA 1YFWA 3USSA 5FIXA 1ULEA 1LEMA 1VBB2 3ZLIA 1V0AA 3KV4A 4XCBA 4BQWA 4GMP0 3KV9A 3MFAA 4M3CE 1JHJA 5FBZA 5FZOA 4NIAA 5LA1A 2XHNA 5FZDA 3N4MA 4BQ1A 4OI2A 2HEVF 3GHNA 3T30A 1QJFA 4META 4COYA 4WV8A 1CX1A 4NPMA 1C1FA 1KJRA 1I9RA 2XL9A 5FPLA 5FPXA 3KCCA 4PIZA 2IWGB 2ZTNA 4XF4A 1GQPA 2VQTA 4AR2A 3H42B 1YYNA 3OBZA 3RQ0A 2O8OA 4DS0A 3AP7A 2GN7A 3MPPG 3NV4A 4L92A 4AGGA 2OUJA 4UFMA 3M4FA 4LHNA 4Y22A 4XC9A 1D4M2 5F32A 4A3XA 4CA9A 4RS5A 1AX2A 1TMF2 3ZPOA 5T54A 2WS92 4OMCA 1MS1A 3ZX7A 3ECQA 4BXFA 3MIGA 2W1QA 3C3VA 1ODNA 3ASIA 4MADA 2C4XA 3WDWA 3ZSKA 3VV1A 2DBIA 3FE5A 4NVPA 2CY6A 2DF7A 3ZFFC 5C8CC 1AHSA 1XE8A 4N53A 1JI6A 1GQGA 3H1MA 5HCHA 3FZ3A 1CAXA 1ZREA 3AYAA 3A23A 4BJ0A 1SFYA 4BLIA 2WSUA 3LD8A 4E4ZA 3I2FA 4CDUC 2OQ7A 2ZHLA 1O59A 3D0SA 2DUPA 2A6ZA 4YVSC 4LHLA 1LHNA 2VUJA 2C0ZA 4AI2A 2WFPA 1FV2A 3LF7A 4FP3A 2A3XA 1OXCA 3AKQA 2CU5A 4K20A 2E7AA 2PHUA 3VBRB 3LFIA 2D44A 3CZUA 5F6LB 4IV1C 5C4WB 1V6LA 2YUEA 5I0TA 4RSUA 4URAA 4PDWB 1WLTA 3WG3A 4A45A 1L3JA 3L2HA 4QXBA 5CFDA 4CEYA 5A1FA 5B4NA 3LIHA 2A3YA 2RM21 4E8CA 5FPZA 1IHMA 4IL7A 1JN2P 5FZFA 2RDRA 2CAUA 1XOYA 4QMAA 1VE0A 2VU9A 5FWEA 3RGBA 4I02A 2C1FA 4BB3A 2ORXA 5K0UB 3USUB 4HETA 4TWTA 1SLAA 3MUY1 1NY71 4Q4V1 3LA2A 2A3WA 1JYNA 1JBCA 1LESA 3O1UA 3I3MA 2V09A 3OBRA 2ET7A 3ILRA 2RHPA 3NV1A 3RZLA 2JDZA 4MVTA 1UX6A 4LBOA 4NHXA 2DYCA 3MIDA 1JU4A 4ITCA 4B1LA 5J48A 1ASJ3 2AEZA 1BK1A 1FPN1 2PLV2 2ILMA 3HMYA 4PI2A 1FPN3 1TG7A 3MO4A 2A1XA 5FZ1A 2HEWF 3NJXA 2NZ9A 4UYBA 5SV5A 4FFHA 2HYXA 3M7AA 3OGRA 3SC7X 4XEZA 4D7TA 5C33A 1RHI1 4YG6A 1RB8G 1UZYA 2HWF2 5FP8A 2OPWA 4C1WA 3N9OA 3UNPA 3UGHA 4NR1A 3SKVA 4N90A 1VRH2 2VOVA 2C24A 1DG6A 2WBKA 5K0UA 5JR2A 3IDEA 1GV9A 1O4TA 2YBSA 1ZRRA 1RUH2 4GJYA 4M01A 2YPDA 5DXDA 4AEDC 4D7SA 1SLCA 4YG0A 1WW6A 1PHMA 1JZ6A 3ZYJB 2TEPA 3ZN5A 4AVBA 4CEWA 3RRDA 1POQA 3DL3A 1KQRA 4C8DA 1N3PA 1SEFA 1NE6A 2EIDA 2HBTA 3HNYM 1EUTA 1C5IA 2XJVA 3HJRA 1ZZ8A 1CWPA 5EYXA 3RYKA 4KQ7A 3C2UA 4AZZA 2W39A 5LBBA 1GZ9A 3T0DA 1KGYA 1R083 5ACA3 4WM8C 3HNBM 1Q8VA 3OJBA 3HAGA 1H4GA 1W2TA 4XIKA 4XTPA 2RR12 4ONUA 3THPA 1PIV2 4FQ4A 4QQHA 2JDKA 2WS93 5IAVA 2VJXA 2DUOA 1AJKA 2W47A 3GF6A 1JZ2A 3I3EA 4F83A 2BOIA 3LCPA 2XVGA 3J26N 1ENSA 3NAPA 4PQ9A 5B4XA 3MUZ1 1LCLA 2XGXA 3WF1A 3TWIA 3GZTB 1HRV2 3BIWE 4IEOA 4EZ4A 2VBDA 2D3PA 3EQEA 4QB2A 1TE1B 4QHZA 3JB4C 5J7MA 3RWNA 2WZPP 3TBDA 1KRIA 4HK9A 4XAEA 3CO2A 1NZCA 4RQPC 4A4AA 1Y4WA 4AXOA 1J1TA 1OKOA 4LNVA 1OHFA 3MPBA 4F7ZA 2BOJA 2MNGA 1PZ7A 2XL7A 3FHIB 3OY8A 3ZN6B 1X82A 4WM8A 2VW0A 4PDWC 2LM3A 2HWC3 2PMWB 4Q2FA 1F4HA 2WQ4A 4RQPB 2QTWB 3GZEA 3VKMA 1W03A 3ZVXA 2EALA 1WKYA 3NNLA 4QX3A 3KHCA 4AHYA 1MR5A 1AXKA 2RE9A 4HFSA 1P8JA 2ZPXA 1S0IA 2VL4A 2ZGSA 2BFUS 5K0UC 1RHI3 5FZ9A 3A0KA 4EN6B 2XBO2 2JDPA 3WNKA 1ULOA 1FAYA 1ZBE1 4OHVA 4LE4A 4LBNA 5A70A 2ADEA 4QX2A 4PJYA 1BXHA 1YFYA 2WZEA 4QX8A 5EJ3A 1W8NA 2WFF3 5FYTA 4HL0A 1W0OA 3PTRB 2R16A 4UFHA 3S30A 2JB4A 5LBFA 1EPZA 3WDUA 4AG4A 4P9IA 2C9KA 5FLHA 3WY6A 3N7KA 1TQ5A 3RMYA 4HG6B 4E4HA 1TME3 4JQRA 1CIWA 1V6JA 3N9NA 5D8AC 4XCAA 3WINE 1WW5A 3VBHC 3AK0A 5ACA1 1UQXA 3J8F3 2AC1A 2VZ1A 2K46A 3GCXA 4GB33 2ZHKA 5J09A 2DCYA 1MZ6A 3FFZA 3LFMA 3RYRA 3AKTA 1LOGA 4ARXA 4CCEA 4K40A 4ARYA 4JHZA 1SDWA 1ULPA 1BEV3 3HWJA 1O8SA 5DDJ2 5KHJA 3WNXA 3O1SA 1NYWA 2O8QA 1RXFA 2BU9A 2KR2A 1C28A 3LKJA 3VL9A 4FAGA 2BV4A 2LUWA 5BNNC 5C71A 3LQCA 1HIXA 1I5ZA 4FOQA 4RL7A 1C5HA 5JXHA 3O1TA 1OA3A 2J1RA 4GKYA 3VBSB 4CRQA 1ZRCA 1GOFA 2WNUC 1IPJA 1B35B 4IEUA 4Y5TA 2ZHMA 1ENQA 4FPGA 4C90A 1NQJA 2YY1A 1CZSA 1WCDJ 2VMIA 5L9BA 4CUBA 5C5TA 1GWLA 4LBMA 5FZ4A 1NZIA 1F5FA 4NN0A 4CU6A 2F17A 4NIIA 4NO4A 2GP3A 1TVGA 2QQKA 1NKGA 3ATGA 3QBQA 2VMFA 3GJBA 4YGDA 3B00A 1V9U1 2NMNA 5HCBA 1NA1B 4YVWA 3E97A 4YGBA 5FP7A 3VLBB 2BEOA 4Y1XA 5F5QA 3S0MA 2PHRA 1HB1A 1MS9A 1U0AA 2ARCA 5C3PA 3U11A 4L9BA 4Q29A 1VBA1 1G9BA 4RS5C 2EICA 1KFUL 3AXEA 4JKKA 2H0BA 5EHDA 1S0DA 1H2MA 1AZDA 4FO9A 4XHXA 5AC91 3AKPA 2LS6A 4E2SA 5EIYB 1FT9A 5KXDA 3MIFA 3VZJA 1H8VA 2ARAA 4O9EA 2W91A 1MVEA 3TRSB 1MS3A 2BRTA 3E5QA 3NAPC 2BBVA 3A21A 4UWDA 2DU1A 1LAJA 2A71A 1NT0A 4E4SA 2ZGNA 5FUIA 3BB6A 5CNAA 1COV3 3JBG1 3K3OA 1YIPA 2JE9A 4JX0A 1QJEA 1KXGA 3ZSLA 5L9RA 2W46A 3HD8B 4L99A 2V72A 2VZPA 1GZCA 2NM1A 2BP6A 4LUKA 1AR72 1S2BA 3WW4A 1AF9A 1JZ8A 1QJY3 3VZLA 4CDQA 2GZWA 3HEIA 2X53S 4Q4W2 4PCRA 2WDBA 3O1PA 4FSJA 2Q1FA 1R1ZA 1GZWA 1A8MA 4HONA 1O3RA 5E1RA 5FYMA 5JZGB 1YO8A 4IE4A 5D8AB 4CU8A 3AFKA 1VBC1 4XUTA 3VBHB 4CYDA 2YC0A 4QT6A 4ZU5A 4BQ5A 1Y9QA 1NLRA 1UU6A 1YI7A 4KI5M 5J1XA 3POSA 2QQVA 3QACA 4FT8A 4OHYA 2XLGA 4XJUA 5CFCA 2AACA 5IW0A 1US3A 2XUMA 5DAWA 1MEC2 1Q56A 3OCPA 4HSJA 4NE9A 4N7UA 4A6OA 5BNPA 1XXNA 4QD2A 5FO8B 4BQ3A 4QDSA 2ZX2A 5F6KA 1RJ8A 3LWCA 2JG9B 1N1VA 3NRUA 4UXAA 1UYYA 2YV8A 3BYWA 3M3CA 2VW2A 4V2WA 2V5YA 3W58A 5T55A 2WO7A 5H9QA 5J37A 2ZACA 2P5BA 2GNMA 1W6NB 4BISA 3VBFB 2CL2A 2K2SA 3HT2A 5EV7A 1VALA 5F5IA 1UF2C 3WDYA 1OLQA 2RR13 5AVAA 1S0BA 3VDDC 2E9QA 3SHRA 4GB32 3VBOC 1EAH3 1QXJA 1Y3TA 1CVNA 4YFWA 1NXD1 4JGZA 4UFLA 4OUMA 1SBFA 3TN92 2LW8A 4AFAA 2FDKA 3SITA 5FP3A 1PZ9A 2YGLA 3LPGA 4M3CA 4BMBA 1HV0A 2VGDA 3VBOB 4FXKB 3ZYRA 3UK9A 1ULDA 5FYYA 2F4LA 3RZJA 1UD1A 3NNMA 1X8EA 4HVRA 5BUVA 1GP5A 2O1QA 2R073 4DXTA 5JSPA 4ET7A 1OBNA 5A80A 5FY0A 1H1MA 1XNCA 2HWF3 2E51A 4LK7A 1DGWA 1UL9A 5F1RA 3IBMA 3ST7A 1ULCA 1UOBA 4XURA 4BMEA 1SDDB 3NKTA 4Y4YA 1AR73 1GNHA 1U5YA 1UKGA 4MOAA 2YFZA 2DCJA 3GJAA 3K77A 4LBQA 2A6YA 2GU9A 2R30A 2VXRA 1G8WA 5FJHA 2EAAA 1OI6A 4GMP1 1UZZA 2XG3A 1RUG2 4MUVA 1UY4A 3N7LA 3ZFFA 4IQPA 5IVEA 5JUVA 1COV1 3WG4A 1UN1A 4CU9A 3S5AA 3M3QA 2D6KA 1PVC3 2XB6C 1RUE1 3KGZA 1UWWA 3DECA 3H1YA 2A75A 3F95A 2JDHA 1QH7A 3PUIA 1K12A 4K21A 2VCBA 4IE5A 3LZZA 5DG2A 4W50A 5JPNB 1RUOA 2R041 3OUIA 4LKSA 2ZX0A 3VKOA 3ZYHA 5A33B 3FMGA 2ZGLA 3NV2A 4CDWA 5DUWA 2DU0A 2HEYF 4Q4Y2 2Q1ZB 1UAIA 2GNDA 1W8TA 1Q8PA 1UIKA 2A6XA 4Q1RA 1MVQA 1RL3A 3E5UA 1BHGA 3L9JT 1AX1A 3PHMA 2ZX3A 1CN1A 2X5IB 4KBZA 1JTZX 4WVWA 1CGPA 1W05A 1R093 3NJZA 1SACA 1SBEA 1YFXA 4NHKA 5DAPA 5FY7A 3AP5A 4FOVA 4LTAA 1AJOA 2BQPA 5T5LA 1Z7S2 1O4YA 1N1TA 3WP3A 5FFOC 5GZFA 5I8YA 5DUUA 3TB0A 1OH3A 1UOGA 3PVBB 1LHOA 1V00A 4KBBA 4RFRB 3BOPA 1C8NA 1QU0A 4XFCA 4HKLA 5F2SA 2Q8CA 4WM7C 4BHPA 2JDUA 3MLKA 3POYA 3WCSA 1JS9A 1DHKB 2EXJA 5L9VA 3LOBA 1UCXA 4N43A 1QQP2 3SXWA 1ND3C 4LKDA 1LR5A 5T3NA 4AI8A 4B4QA 5FPUA 5CFDC 4JTOA 5DPNA 2P3IA 1KJLA 2Y33A 5JMOA 1YFUA 1OOPB 5DAVA 5IHRA 1UZ0A 2WUHA 4JHTA 4SLIA 2OYZA 4AL9A 4P9YA 4JGZC 3PMSA 5A3MA 3GBFA 5AFEA 3RZKA 3JBG3 3MZHA 1LKNA 1NCQB 4AE2A 3ETPA 1LTEA 3CEWA 2FDGA 4KL1A 5FUNA 1ASJ1 1W2OA 2VOWA 2AZ5A 2XWJB 3ACLA 4GULA 1JODA 4KGGA 3ZXAC 1SMVA 4AF9A 1YCIA 2AGSA 4QXCA 3VZMA 4CXWA 3SNMA 1MZ5A 1QOOA 5DAXA 4N53C 3AC0A 4DY5A 1W9FA 1SCRA 2VE1A 3U4SA 1C1LA 1IOAA 2RS31 2IFWA 1H0BA 2A6VA 4TSVA 3UGFA 3OUJA 4N53B 4QAWA 3H0OA 2W5FA 2HWE1 1OUXA 3GALA 1LOAA 3OBAA 2YU2A 1VR3A 2WZ8A 1X9PA 1DZQA 1U12A 2ZAHA 2W92A 3LEKA 1JZ3A 1X33A 3WUCA 4I0WB 5ABJA 3EYPA 3N9PA 1X8MA 2ATFA 4PLNA 4CUAA 5M0TA 5I93A 1Z78A 2WRAA 1EV12 3DPRA
chains in the Genus database with same CATH topology
4LMFA 1SPPB 1SPPA 2QQOA 4GZ9A 1NZIA 1SFPA 3KQ4B 5CISA 3POJA 3POIA 2QQKA 3POGA 1SZBA 4LORA 4LOSA 1NT0A 2QQLA 3DEMA 2WNOA 3POBA 3POFA 5CKMA 3POEA 2QQMA 4LOTA 5CKQA 5CKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMF A;  1SPP B;  1SPP A;  2QQO A;  4GZ9 A;  1NZI A;  1SFP A;  3KQ4 B;  5CIS A;  3POJ A;  3POI A;  2QQK A;  3POG A;  1SZB A;  4LOR A;  4LOS A;  1NT0 A;  2QQL A;  3DEM A;  2WNO A;  3POB A;  3POF A;  5CKM A;  3POE A;  2QQM A;  4LOT A;  5CKQ A;  5CKN A; 
#chains in the Genus database with same CATH topology
 4CCL A;  1W8H A;  1I1E A;  3P1I A;  5LAT A;  3FL7 A;  1HRI 1;  1JUI A;  1UMI A;  1ZBA 1;  1F15 A;  4PIX A;  2Y6G A;  4GD4 A;  4K3U A;  4YZ4 A;  3ZYI B;  2FCV A;  3ZXJ A;  1RMU 2;  3ELN A;  1J83 A;  1JH5 A;  3AXD A;  4K8R B;  1W8F A;  3RI8 A;  1EPW A;  5JCT A;  3DPR B;  1O7F A;  3KZ4 C;  1AVB A;  3ROU A;  4UOJ A;  1PX4 A;  2JDA A;  1XPW A;  4Y24 A;  1UW8 A;  2WNV C;  3B01 A;  1A8D A;  4Y26 A;  5FZG A;  2D6M A;  3T09 A;  1FOD 3;  4EN7 B;  3IM0 A;  3E1F 1;  2CWM A;  2DCK A;  5AVP A;  5KHH A;  3T08 A;  5DZG A;  2ZKN A;  2JIC A;  5FTT C;  4ERO A;  4QM9 A;  3I2H A;  4DNY A;  1V6N A;  1HLC A;  5A3L A;  3Q8F A;  3WZ1 A;  4F3J A;  4JVA A;  5GLU A;  2GC1 A;  5FZH A;  1UPS A;  3FUQ A;  4BWO A;  1S0J A;  1W0P A;  1R08 1;  5LY1 A;  1RUH 3;  5A3P A;  3SLI A;  2Y0I A;  3TEW A;  2RVA A;  4Q4Y 3;  3GGL A;  5C9A A;  4Q4Y 1;  2HWB 3;  2RMU 3;  2VCC A;  2WO3 A;  2VY0 A;  4MX3 A;  4YVS B;  4UFI A;  4QKN A;  5LEJ A;  4YVW C;  1QJY 2;  4E9K A;  4FPH A;  1Z0H A;  3I4I A;  4WVZ A;  4QPI B;  3ZDS A;  4QGM A;  2QUO A;  3IPV B;  5L73 A;  4AQT A;  4J1W A;  2VVD A;  3LDR A;  3FHQ A;  4XVH A;  3U10 A;  3WF0 A;  1UKR A;  3SH4 A;  5IVC A;  2VZQ A;  1FV3 A;  2HWE 3;  5GM0 A;  3S57 A;  3WF2 A;  3ZMN A;  4XTM A;  2V4A A;  1W6O A;  3KT4 A;  4Q4V 3;  4N43 B;  3DYM A;  4A2U A;  1AR9 2;  1AR9 1;  3N9Q A;  1E5S A;  3O1O A;  4LO7 A;  4P00 B;  4HOO A;  3LSD A;  5F8P A;  3ZYG A;  5BNP C;  2WNU A;  2WWU A;  5JI9 A;  1QDO A;  2DVA A;  1YRZ A;  5EPA A;  4N43 C;  1AXY A;  1Q3E A;  2JB8 A;  2XR4 A;  3CL1 A;  4K1Z A;  4MGS A;  4OUS A;  4Y1V A;  3ZR5 A;  3V56 A;  2JEM A;  2HKX A;  3RS6 A;  2NN8 A;  3GM8 A;  3RG0 A;  4I3P A;  1LU1 A;  1QEX A;  5A1A A;  3TEY A;  3B7M A;  5FYZ A;  1D0G A;  2VO5 A;  3VBH A;  5CKM A;  1K5M A;  3VBU A;  3PUA A;  3BAL A;  1KS4 A;  2JKX A;  5HI0 A;  1S1A A;  1CAV B;  2QQJ A;  2X5I A;  1WGP A;  5FY4 A;  4AHZ A;  4B7E A;  1F8V A;  1GR3 A;  2R7E B;  1OD3 A;  1U5Z A;  4QGL A;  3KGL A;  4IER A;  3UKN A;  5KWR A;  1H8T B;  2NQY A;  1HX6 A;  2R06 2;  2VUL A;  1R08 2;  2CGO A;  3A22 A;  4MHR A;  4KWK A;  4OI1 A;  1GOH A;  1FNZ A;  2F4P A;  2Q5T A;  3C7F A;  3KMH A;  4WVM B;  4Y4R A;  2WT2 A;  3POW A;  5T5J A;  2PHT A;  1PVX A;  2G9G A;  2IFR A;  3MV0 1;  3LE0 A;  1W28 A;  2UY9 A;  4Z2W A;  5IK5 A;  2IXJ A;  2VM9 A;  4XBN A;  3PVN A;  5FXW A;  4XJ9 A;  2J1V A;  4NUB A;  2GH2 A;  4D8M A;  1AR8 3;  1SBD A;  1ZZ7 A;  2J42 A;  1TMF 3;  3ENR A;  3KSC A;  5GZD A;  4LOT A;  4YSF A;  5J3U A;  1GAN A;  5L36 A;  5FQ0 A;  4XJA A;  1ALY A;  1YJL A;  4AVC A;  3ZFF B;  4LBJ A;  4Z82 A;  3WHU A;  4H14 A;  1YQ6 A;  4N9H A;  1RMU 1;  1E5I A;  4IEQ A;  1UOJ A;  2Y8K A;  4QM8 A;  4CUG A;  3P3N A;  1HN0 A;  1MEC 1;  5LK5 A;  1SG3 A;  4XUN A;  3BTY A;  2G4I A;  4B4P A;  3ZXD A;  5FZM A;  4XJZ A;  2WZR 2;  5JIA A;  5BY5 A;  1OLM E;  4LUM A;  4MH0 E;  4LHS A;  4M4R A;  5EFU A;  1NA1 A;  2HWD 1;  2WNV A;  4YVW B;  1FXZ A;  2HWE 2;  2LAL A;  1VBC 2;  5CAZ A;  4D6Q A;  4QU1 A;  1XB9 A;  3R0R A;  5F37 A;  2A73 B;  3J7N A;  3WP5 A;  5B2G B;  3VKN A;  1Q43 A;  5J96 B;  1BKZ A;  4COZ A;  5A3T A;  3KQ4 B;  5CG9 A;  2NMO A;  1MQT B;  1O6U A;  3KQR A;  4Q4W 1;  2WYF A;  1DGW X;  1LUL A;  3MGU A;  4H2A A;  4QU2 A;  4NRM A;  4OMD A;  4XAA A;  1ZX5 A;  2QQL A;  3MFC A;  2D5F A;  2PYT A;  1UXX X;  5BNO A;  5IYY A;  4FTB A;  2IVI B;  2KXL A;  2WQ8 A;  4NMI A;  4XE9 A;  1REF A;  2P34 A;  1YQ5 A;  1W6M A;  1RUC 2;  2P17 A;  1FI2 A;  4A7Y A;  2XKP A;  3A4U A;  1QDC A;  3R05 A;  1QJX 1;  4QHO A;  5EJ1 B;  3S7E A;  4YWA A;  4S2D A;  2VTX J;  4M3C F;  4LHK A;  4Q8L A;  3W21 A;  1OVP A;  4LBQ D;  1SCS A;  5AFB A;  5APA A;  4OHX A;  4R4X A;  4ASK A;  3EHK A;  4W4Z A;  1JYX A;  5A3U A;  2JEC A;  3MHZ A;  2WWJ A;  3R4S A;  5EXO A;  1SZB A;  3B93 A;  4LOR A;  2JKB A;  1XSR A;  1K42 A;  1K3I A;  1VAK A;  3PME A;  1X7N A;  3NJV A;  2W1W A;  5A32 B;  3C8X A;  3B69 A;  4AK3 A;  3D0J A;  3E6C C;  2DVB A;  2RJL A;  2BBA A;  2RV9 A;  1LOE A;  5A6Z A;  2W0X A;  2J22 A;  5F3G A;  4XFF A;  5I0U A;  4HAN A;  2IXC A;  5EWS A;  2ZGO A;  2B7Y A;  3UGG A;  5FWJ A;  1LGN A;  3PLQ A;  1MQT A;  2YBP A;  2XQR A;  2WL1 A;  1FMD 1;  3CBN A;  4HKO A;  1WCQ A;  2GNT A;  3Q8B A;  4RN5 A;  5DAB A;  5DZE A;  4MZU A;  5F5A A;  4RQP A;  4HN0 A;  1GZT A;  2OXB A;  2VEC A;  4QPI A;  5F2W A;  1AUY A;  3WF4 A;  3ZN6 A;  3U07 A;  1ST8 A;  2K9Z A;  3CU7 A;  4UBH A;  3UKT A;  5BNO C;  1PGL 1;  3EBR A;  3KT7 A;  2VXJ A;  2I07 B;  1J59 A;  1D7P M;  3M3I A;  2IXL A;  3E6B A;  4P9L A;  4XF9 A;  1BCX A;  1W2N A;  5EZW A;  2Y6K A;  2Z2S B;  1QJU 2;  4DEV A;  2JG8 B;  3JD7 3;  1JMU B;  3Q8C A;  3WF3 A;  2Y26 A;  3PUH A;  5IWF A;  5A3W A;  4DOU A;  1VAV A;  3R6S A;  4DUX A;  1BVP 1;  3VD9 A;  5EP9 A;  5CZK A;  4R4Z A;  1COV 2;  1PVC 2;  1SLI A;  4R9B A;  5KHK A;  1AYM 3;  4YFZ A;  1PGS A;  3NMB A;  5FQ0 B;  5FDB A;  1H2L A;  1I6X A;  4CDW C;  2ARX A;  1TZO A;  3CJX A;  5L7O C;  4N7I A;  4ISR A;  5DUV A;  4FPY A;  5HV4 A;  1UNB A;  4AHX A;  5LBE A;  3H8O A;  5I0D A;  3GYD A;  4YW5 A;  4Q5O A;  5GZG A;  1CAW A;  5FJK A;  1PVC 1;  3SCH A;  2CHH A;  5FOJ B;  5L7O B;  1MS4 A;  4NJ4 A;  2XH6 A;  1IKP A;  4CDX A;  4L97 A;  3U4X A;  1KDM A;  4CCO A;  5HCA A;  4YW2 A;  4L0P A;  5JZG C;  1VB4 A;  2QCS B;  4NWV A;  1QJU 1;  4LQR A;  1RUF 1;  1CPM A;  2BDR A;  3JB8 A;  4HSL A;  4IEZ A;  5FZB A;  3ACH A;  4E2G A;  1VP6 A;  2R6Q A;  4JAA A;  4QGN A;  4AI9 A;  2QE3 A;  5FCC A;  1HQL A;  1VBD 3;  4JTN A;  5FMB A;  2W87 A;  3OUH A;  3RMX A;  3VGI A;  1XU2 A;  3WDT A;  1K5M B;  2B9V A;  1QJX 3;  3VBU B;  2F6B A;  4B3N A;  4I0A A;  4LEJ A;  3EJK A;  3TN9 3;  2A6W A;  2I2S A;  3INA A;  4LLO A;  5FZ0 A;  3POE A;  3E5X A;  1NE4 A;  3WP4 A;  1GYK A;  3KM5 A;  3IKW A;  1AR8 1;  1FOD 2;  1HRI 3;  1O4Z A;  1ZBA 3;  3IDB B;  1LOF A;  4XET A;  5FPV A;  5JSO A;  4CXY A;  2PHW A;  2X5I C;  1GNZ A;  3NQH A;  4PIY A;  4QX7 A;  2CDP A;  1BEV 2;  1W6O B;  2PXJ A;  3K4A A;  3V64 A;  4BU2 A;  3UES A;  4CP1 A;  5C6C A;  3BTZ A;  3RZG A;  2PTM A;  1F9K A;  4S2H A;  2BWA A;  5H9S A;  3ZFE A;  2ENR A;  4Y3O A;  1URX A;  2ZMN A;  5DDJ 3;  5GLZ A;  3KD4 A;  1NQD A;  1XE0 A;  2DCT A;  1E57 A;  1WLW A;  4Q4X 2;  2WLQ A;  4XXP A;  2ZOE B;  1QOT A;  2RDS A;  3HOB A;  3UET A;  2JG9 C;  5JMC A;  1WCU A;  1PM7 A;  3IPV A;  5DG1 A;  2RR1 1;  2CGN A;  2VR4 A;  1PZ8 A;  2ZBJ A;  2ZZQ A;  4H7M A;  1F4A A;  5C3R A;  1NX9 A;  2WIN B;  2GMM A;  2CV6 A;  1CQ9 A;  1NA1 C;  4PBO A;  4Y1U A;  4AVT A;  2ZHN A;  2J1A A;  3HQU A;  1AR6 3;  1LEN A;  1OA4 A;  2P1B A;  4IEW A;  3VBR A;  3B3Q E;  1G9A A;  5KXC A;  3K4D A;  5CKQ A;  3KF3 A;  5CEH A;  4U36 A;  3V65 A;  3ABZ A;  1OQE A;  1RUC 3;  4CP2 A;  5KBF A;  1HN1 A;  3AM2 A;  2X10 A;  5HCF A;  1OVS A;  4OHW A;  3WW1 A;  2IC1 A;  4B7K A;  4EQV A;  1V6O A;  1HV1 A;  4DIN B;  2XBO 3;  3ZR6 A;  1ACC A;  5F7U A;  4D6R A;  4AVS A;  4BIO A;  1HQN A;  2UWA A;  2HWF 1;  1PO1 3;  2NPI A;  1IQD C;  4P9G A;  4MLO A;  5FYS A;  5HXM A;  4XUO A;  4NWW A;  1O3T A;  4E2Q A;  2VMH A;  1WW7 A;  4RHV 3;  5FO9 B;  3O1V A;  1WCS A;  5CYY A;  2XXZ A;  3F2Z A;  4Z8B A;  4GAZ A;  2QKD A;  3JBG 2;  1ZVF A;  3QCW A;  2I74 A;  4RFT 0;  1OLR A;  1OH4 A;  4CVU A;  3WOG A;  2PAK A;  4TTG A;  2HWD 2;  1L7R A;  2EIB A;  4K7J A;  3A7Q A;  5D21 A;  2GMP A;  2P3K A;  3TNP B;  3M3O A;  3ZYB A;  2QZ3 A;  5FXZ A;  1SFP A;  4AAP A;  5IK7 A;  1O8P A;  4ZZ5 A;  3ZOI A;  1GWM A;  1N3Q A;  3B9C A;  1CJP A;  4Y5Z 0;  4A42 A;  4P9X A;  2WII B;  4QQP A;  4KG0 A;  2RJ2 A;  5JVV A;  4Q4X 1;  2PHX A;  4CCM A;  4E8D A;  4LKE A;  3LGR A;  1VBA 2;  4FVV A;  1BEV 1;  4GH4 C;  3WV6 A;  2FCT A;  2WN2 A;  1YEW A;  3DGT A;  3DUI A;  1FX5 A;  4NPL A;  4A44 A;  2GC0 A;  1AX0 A;  1AR8 2;  1FOD 1;  2ZAA A;  3DPR C;  2CYF A;  1PIV 3;  2GME A;  3H50 A;  4ORF A;  1V9U 2;  4GWM A;  1W8Z A;  3BPZ A;  3N7J A;  4OVE A;  2WO1 A;  2Y6L A;  3IB3 A;  1JXN A;  2Q30 A;  2VZV A;  2ZGM A;  3R4U A;  3IAP A;  3O1R A;  5C70 A;  5F3C A;  1UZV A;  4UW6 A;  2D97 A;  5A7O A;  3FBM A;  3KB5 A;  1LED A;  2JDY A;  4AED A;  3U37 A;  3C7E A;  2G19 A;  1OF4 A;  2Y38 A;  1FAT A;  2WO2 A;  4LA2 A;  3I8T A;  2H0V A;  1MPX A;  1JW6 A;  1XNA A;  2KM2 A;  1ZRI A;  2VUD A;  3JCI A;  2VH9 A;  5FZ7 A;  3U14 A;  1RUF 2;  3ZYF A;  2D6L X;  4LE3 A;  5FP4 A;  1DBN A;  2Y6J A;  1YJK A;  4DMI A;  5FP9 A;  3LSE A;  4LMF A;  3V0A B;  2P6H A;  2P4E A;  3NST A;  2W95 A;  1D4M 1;  4OI0 A;  3I2G A;  2WT1 A;  3H1W A;  2PLV 3;  2JD4 A;  3N3H A;  4P9W A;  4D94 A;  2G1M A;  3SKJ E;  2YG0 A;  2XWB B;  1GNY A;  1I3H A;  2AYH A;  3C7H A;  4W6Y A;  4MGY E;  5A3N A;  2WN3 A;  5FXX A;  4CCJ A;  4P02 B;  4PQQ A;  4FFI A;  4NAM A;  4MSV A;  5FMC A;  3GHM A;  5DN2 A;  2YPJ A;  2C26 A;  5A6X A;  3H7J A;  1PMH X;  5CFD B;  5I0S A;  3VBF A;  2IVJ A;  2C5D A;  1ZA7 A;  2EVX A;  2WNO A;  4A6S A;  5BNN A;  4XFA A;  3POB A;  2VW1 A;  4IEV A;  2HWD 3;  3NW4 A;  3WR0 A;  2ZKL A;  3RJR A;  1KEX A;  3T3Y A;  2O14 A;  2RG4 A;  4DUV A;  4EV0 A;  3D3A A;  4QKB A;  2JG9 A;  3OPT A;  3IMN A;  4KWU A;  3CMG A;  3T0B A;  2XBO 1;  3RPQ A;  1XNK A;  2YC2 A;  2A5Z A;  3K2O A;  3WDX A;  1NCQ C;  1E5H A;  3CNA A;  1BBT 1;  4LO5 B;  3WUD A;  3DF0 A;  3WQB A;  1CES A;  4QHB A;  4XDO A;  3H8R A;  4QB1 A;  3VHO A;  4R52 A;  2BTV C;  4N8M A;  1PGL 2;  1YIF A;  3Q9O A;  2WAB A;  5F5C A;  2VBB A;  4XF0 A;  1WCK A;  4IGP A;  4ZU7 A;  2GNB A;  5LAS A;  4OZO A;  2QQW A;  2ZEY A;  4GXL A;  5D8A A;  1OKQ A;  3DEM A;  1DQ1 A;  3AKS A;  1S0C A;  2B39 A;  5FAX A;  4OUE A;  3I3B A;  2ZMK A;  1U5X A;  2BGP A;  5A7S A;  5C3S A;  1FMD 2;  4M00 A;  4CCC A;  3WP6 A;  5C8C A;  4IET A;  1W3V A;  5LA2 A;  5LRR A;  1QNW A;  1HRV 3;  3ACF A;  3LDB A;  4BCU A;  4QPY A;  4Z07 A;  4DPN A;  4YZ3 A;  4GAL A;  4CDQ B;  4GH4 B;  3BGA A;  4CDX B;  1N1Y A;  3N9M A;  4U2A A;  3KWV A;  5E16 A;  2WNV B;  4AFM A;  3V0B B;  4D6S A;  2DTW A;  4I01 A;  4XZU G;  1HB2 A;  3W59 A;  4DZG A;  1REE A;  1XJA A;  1CAW B;  3POG A;  3VZO A;  4BPZ A;  2VBP A;  2V5D A;  4I2O A;  1JYT A;  4FPL A;  2C9A A;  1ZA4 A;  2XJP A;  3ZM8 A;  3AL6 A;  3ZFG A;  5JXJ A;  2Q8O A;  3HBK A;  2VQU A;  3POF A;  1GBG A;  2E31 A;  4JDN A;  4YG3 A;  1HRI 2;  1ZBA 2;  3ZXG A;  1JYV A;  5GLT A;  3BTX A;  1AL2 3;  1FMD 3;  4P14 A;  4Q1P A;  4WBB A;  4COW A;  1QJX 2;  3NNJ A;  2GDF A;  1RUI 2;  2AUY A;  3FWE A;  4QKD A;  1G9F A;  1RUC 1;  4L2N A;  1OUS A;  5FYB A;  3AMP A;  4JCK A;  1RVF 3;  1V70 A;  2JG8 A;  3H3L A;  1OMI A;  1W0N A;  1RUH 1;  3KT1 A;  3PVE A;  3MW4 A;  1BMV 1;  3UJO A;  1XE7 A;  1RC6 A;  1VRH 1;  2PEL A;  4NRP A;  4YW6 A;  4IGQ A;  1GLH A;  1PK6 A;  2Q8E A;  1DGL A;  4QB6 A;  1RHI 2;  1A34 A;  1QH6 A;  2LRO A;  4XQ4 A;  2DBN A;  4WVM A;  4CE8 A;  4UW5 A;  2EF6 A;  3D6E A;  1W90 A;  2AR6 A;  2JIJ A;  3O12 A;  2P3J A;  1MQT C;  1ASJ 2;  4UW3 A;  1YQ2 A;  4ATE A;  1B35 A;  4EN0 A;  3HVD A;  3VD4 A;  1DFQ A;  5E6H A;  2WZR 1;  3FX3 A;  1F5J A;  1JOJ A;  4HBN A;  4PF1 A;  4ES9 A;  5I0R A;  4LBL A;  2QQP A;  4XFH A;  1A6C A;  1H4H A;  1LOF C;  2E26 A;  2BNO A;  5F39 A;  1H9W A;  3VDD A;  1XYN A;  1T6B X;  2VVF A;  4DRR A;  4N9I A;  4DY3 A;  4E4D X;  1GIC A;  2DVG A;  2BYV E;  4UAP A;  1RED A;  2B5H A;  5JLV A;  3WW2 A;  1Q5O A;  3Q8A A;  2K0G A;  3DYO A;  4A41 A;  4BK5 A;  2VMG A;  4XXA A;  3P3P A;  4CSW A;  1FNY A;  1MAC A;  3JZV A;  1W6Q A;  3S6P A;  4IE7 A;  3M2M A;  2HJI A;  4JRL A;  4LUL A;  4W6X A;  4JDM A;  1S0F A;  3P6B A;  1Y9G A;  1GOG A;  1RIN A;  3ZYP A;  3BU7 A;  3IT8 A;  3VUO A;  1DZR A;  2WR9 A;  3DXU A;  5FOB B;  2GAU A;  2XQX A;  5FZL A;  5DQ0 A;  4GA9 A;  2UY8 A;  2PQQ A;  1WMD A;  2VMD A;  3HPN A;  4BIF A;  1DLL A;  2X09 A;  1WZX A;  4QQ2 A;  2DWR A;  1DZT A;  4S2F A;  3AVS A;  4YLZ A;  1V6I A;  2BNN A;  3OD0 A;  4JDO A;  4V2V A;  4AHW A;  1SFN A;  1M4W A;  4AQS A;  4YM3 A;  5C3Q A;  2YU1 A;  3MBW A;  1B35 C;  3III A;  1V9U 3;  2BGC A;  2R06 1;  2VNO A;  3N7M A;  1EAH 2;  1VIW B;  4CU7 A;  4TLF A;  3QH6 A;  3AP6 A;  5JOZ A;  1DQ6 A;  1NOV A;  1PX3 A;  2WYS A;  2YYO A;  4NRO A;  4BOW A;  2B4K A;  4PBP A;  1TMF 1;  2OUH A;  4CP9 A;  5A7W B;  5BPX A;  5DAQ A;  5FZ8 A;  4WM8 B;  5T5P A;  1QXR A;  4D3W A;  1D4M 3;  2XOM A;  3AMN A;  2XUE A;  3JU9 A;  5FYV A;  2JD9 A;  2CAV A;  1EV1 3;  2KA3 A;  4CCK A;  3ZFG B;  4YGE A;  1EUU A;  1UYX A;  2H6C A;  3GBW A;  1J84 A;  2VZT A;  4R8H A;  5KC5 A;  3CZJ A;  4PF5 A;  3ZPY A;  2W1S A;  3B94 A;  2X05 A;  3GXU A;  3OYW A;  4IV1 B;  4FOY A;  4PLO A;  5C4W C;  2E32 A;  3K51 A;  2L9L A;  5FY8 A;  1LHW A;  5KXB A;  1AXZ A;  1GUI A;  2I45 A;  3KF5 A;  4AWD A;  2PAE A;  5CBL A;  3N35 A;  1NG0 A;  3UKV A;  5ABJ B;  4QPW A;  3GZU C;  3WQ7 A;  5CIS A;  2OW4 A;  1QJY 1;  3DKW A;  3KLS A;  1HB3 A;  3UT0 A;  5L19 A;  4CEW C;  5TSW A;  2DTY A;  4XF1 A;  2HWC 2;  5J98 B;  3LAG A;  2VUC A;  4DXS A;  4OYU A;  3J9S A;  1XBF A;  1UO9 A;  2IXI A;  4GQ7 A;  4YM0 A;  3HIF A;  2VD7 A;  5LK7 B;  2WZR 3;  4AQ2 A;  4ZS3 A;  1F31 A;  2OQ6 A;  2D5H A;  1UX7 A;  1RYY A;  2HH9 A;  4UFJ A;  4XW3 A;  4B8E A;  4NPR A;  1AL2 2;  5A3O A;  2VMC A;  1RJ7 A;  2RS1 1;  3PU3 A;  2GH8 A;  4IEY A;  4UW4 A;  4NID A;  1W06 A;  1NCQ A;  3D8C A;  4GB3 1;  4H7L A;  1VBE 3;  3I59 A;  4K9S A;  3RZM A;  2OZ6 A;  1H8T C;  2FMD A;  2VZ3 A;  5BNN B;  2ZAB A;  2BVB A;  5I8T A;  3WNN A;  2BUK A;  1KS5 A;  3OPZ A;  1OOP A;  1DU3 D;  2WT0 A;  4BLJ A;  1QJU 3;  1N1S A;  2WNU B;  1SLB A;  1WD3 A;  4YW3 A;  3ZXL A;  1S0E A;  1EY2 A;  1Z7S 3;  5HXV A;  4Z2A A;  3SH5 A;  4FFG A;  1KIT A;  4URT A;  2VUA A;  2XJS A;  1EV1 1;  4OLL A;  4COU A;  2XPJ A;  1QWR A;  5FKC A;  1EP0 A;  3USU A;  1A78 A;  2YDE A;  3BCW A;  1ZZB A;  2C6S A;  1GMM A;  3IWZ A;  4BE3 A;  3VBF C;  5JOX A;  3WX5 A;  5FKB A;  1O5L A;  4BDV B;  3OF1 A;  5IVJ A;  4XFB A;  4K6B A;  1LEC A;  1D0H A;  3B5L B;  4PI0 A;  3AFG A;  1QXP A;  1HKD A;  3PUR A;  4XAC A;  3OEA A;  3ITQ A;  4I30 A;  3UJQ A;  3WXP A;  4CEY B;  5H9R A;  2CGP A;  5FYU A;  3LA7 A;  4LIV A;  4YVS A;  1VRH 3;  3Q8E A;  4AQ6 A;  1DLC A;  2RS3 2;  2JE8 A;  2ZML A;  1DYK A;  2PAM A;  1HW5 A;  3QD6 A;  5FPB A;  3LA3 A;  2VC9 A;  1VRB A;  3MF9 A;  1F2N A;  2E6V A;  3TNQ A;  2WJS A;  4Y33 A;  2UWC A;  4A7Z A;  5HV0 A;  2R49 A;  3N9L A;  1QY4 A;  2BW8 A;  2WSV A;  3NAP B;  2Q4S A;  1AR7 1;  4AEM A;  2D6O X;  5AC9 3;  4CDW B;  3BPS A;  4MV2 A;  5CVR A;  3M3E A;  3CLP A;  5A33 A;  3BOW A;  3T2Q A;  2B8M A;  5T52 A;  3SEP A;  1AYM 1;  4ZU4 A;  3I3D A;  5FXV A;  1WMF A;  1ZZC A;  3WNL A;  4RGK A;  4XYX A;  5LWB A;  1AYN 1;  2CSG A;  1HXS 1;  1LOB A;  3G7D A;  4K1Y A;  4LOS A;  4RGA A;  3AP9 A;  4CPB A;  1OC1 A;  2J1S A;  3MF6 A;  3WT3 A;  4EN9 B;  5LW9 A;  2BJS A;  2E53 A;  1NCR C;  4FPE A;  1N3O A;  5FZC A;  2WLP A;  1QQP 1;  2D6N A;  4BH9 A;  3PIJ A;  4AOC A;  2OKX A;  1LHV A;  4BM8 A;  1PO2 3;  4ZHN A;  5LA9 A;  2W94 A;  2VZO A;  1JHN A;  3IDC B;  4AEK A;  4LBQ B;  5GAL A;  1BZW A;  3JD7 2;  4OI4 A;  1BJQ A;  2R07 2;  1K5M C;  1OQ1 A;  3FLR A;  3VBU C;  4Q0U A;  4ZZ8 A;  1Z7S 1;  4FP2 A;  4AI0 A;  5LCW L;  1QIQ A;  3MIE A;  2CTV A;  3H3U A;  4EWE A;  4YW4 A;  5FZO B;  1C57 A;  1DYO A;  2ES3 A;  3CF6 E;  2YMZ A;  4IE6 A;  2UYB A;  1X36 A;  2SBA A;  5JWP A;  4NIH A;  1S0G A;  1RUI 3;  4XBQ A;  4FBF A;  1VB2 A;  4TXW A;  5LBC A;  1H9P A;  3T2T A;  1PNF A;  4B4R A;  2VNR A;  1W2U A;  4D7Y A;  5JI7 A;  1J3P A;  1FYU A;  3BU0 A;  3J8F 1;  1O3S A;  4O9G A;  4Q4X 3;  2JE7 A;  3I59 B;  4ZS2 A;  3WCR A;  3E6D A;  1R1A 3;  3O0X A;  2R04 2;  4YGC A;  3VBO A;  1V6K A;  1UU4 A;  3CKH A;  4XFI A;  1DDL A;  4MGZ E;  2E7Q A;  2Q1M A;  5HPO A;  5IVF A;  3ALQ A;  3VL8 A;  3EXU A;  3X29 B;  5DDJ 1;  5JAX A;  5T5O A;  1TEI A;  5FK8 A;  1RMU 3;  4IND A;  1AL0 G;  2VPV A;  4XJW A;  1ZZ6 A;  1IZ3 A;  1RUE 2;  2G9Z A;  3DV8 A;  3O1M A;  2W08 A;  4YPJ A;  3WNO A;  1W6N A;  4PDW A;  5ACA 2;  2B9U A;  2DVD A;  3T2P A;  1PGW 1;  4ASL A;  3WQ0 A;  2O0O A;  2R1B A;  1JOB A;  5C4W A;  1RUG 1;  1UY0 A;  3WVJ A;  4LXL A;  3WEZ A;  3ZFE B;  4AGV A;  1RUG 3;  4EYU A;  1G9D A;  3FLP A;  1QKQ A;  2FHR A;  1C3H A;  4FXG B;  1CJD A;  3SCG A;  4BYY A;  1BQP A;  3AJY A;  3ZFE C;  5A6Y A;  3PJQ A;  4BA6 A;  1OOP C;  1CON A;  1DQ0 A;  3LB9 A;  4NAO A;  4O65 A;  3SH3 A;  4PT6 A;  4XF3 A;  2XML A;  3POJ A;  2UYA A;  2Q0A A;  1LNS A;  1ZBE 2;  2N7G A;  1CAX B;  3O7O A;  1JU3 A;  4QDR A;  1BK0 A;  4WM7 A;  4W6W A;  2VTX A;  1PK6 C;  1APN A;  2VOT A;  1OPO A;  3WNP A;  3TEZ A;  1PNG A;  2Z42 A;  2ZCW A;  3O5S A;  2GP5 A;  2D3S A;  4I09 A;  2GN3 A;  3AVR A;  3LOI A;  2GAL A;  4QQL A;  3OTF A;  2Z5W A;  5FMO S;  1LRH A;  4YW1 A;  2Q8D A;  4IV3 C;  4Y22 B;  2QVS B;  2P6C A;  5CB7 A;  1UXZ A;  2Y60 A;  5DUX A;  3ZDV A;  2FDI A;  1MS5 A;  2QQN A;  3TN9 1;  1JYC A;  1DQ2 A;  2WA3 A;  4ZXE A;  4X8P A;  2E7T A;  4IV3 B;  3WQ1 A;  2RS1 3;  3S5Q A;  5I8S A;  2ZEW A;  3KHB A;  5FZ3 A;  4XDQ A;  2D93 A;  4HVQ A;  2RS5 3;  1J3R A;  3DYP A;  2W1U A;  5K8S A;  3J4U H;  3PU8 A;  2ETE A;  2XLF A;  2EIE A;  2MEV 3;  2QQU A;  2MEV 1;  3KV5 A;  2ZXQ A;  3AKR A;  3VKL A;  3AB0 A;  3TYJ A;  4ASM B;  2RS3 3;  4XQD A;  3U1X A;  2B45 X;  1IG0 A;  2BPA 2;  3CDZ B;  2W52 A;  2R0H A;  3KV6 A;  1R1A 2;  4FFF A;  3WSO A;  3ILN A;  3MIH A;  1YHF A;  1PIV 1;  4R9D A;  3SCF A;  4MXV A;  1JYW A;  4IUG A;  4LBK A;  1OT5 A;  3ZSE A;  2J1T A;  1VAM A;  5IFT A;  1CPN A;  5KC6 A;  4UF0 A;  2JDM A;  1OPM A;  2OA2 A;  4YRD A;  3BOD A;  4TLG A;  2ARB A;  2X29 A;  4J1X A;  3AMQ A;  1DGR N;  2CWS A;  2FMY A;  1MZE A;  3JUU A;  3HN1 A;  1W6Q B;  4TN7 A;  3U0Z A;  4YZ5 A;  3ETQ A;  3MLL A;  4PLM A;  2OZJ A;  1E5R A;  5IVY A;  2PA7 A;  1UU5 A;  1T2X A;  3CQO A;  3G6J B;  1G6N A;  4MXW B;  1LOD A;  3AX4 A;  4RD7 A;  3FLT A;  4XAB A;  4DQA A;  2W68 A;  4SBV A;  5D1I A;  4M0N A;  5LY2 A;  2A7A A;  4FI9 A;  1IS4 A;  1J1L A;  3B9I A;  3I2K A;  5FO7 B;  3D82 A;  4C0H A;  4GZ9 A;  1GFF 2;  1H6Y A;  4YZ2 A;  1N47 A;  3AZV A;  3R4D B;  1FPN 2;  2GC3 A;  3IAQ A;  1TME 2;  2YC4 A;  4G3Y C;  4JGZ B;  5F9T A;  3IDA A;  4QPI C;  4DFS A;  1L7Q A;  4DIQ A;  2MHF A;  1W2A X;  2V4V A;  3NNG A;  4XOG A;  4CDU A;  1ND2 B;  4GKX A;  4R9A A;  3ZKY A;  1BVV A;  4D69 A;  5IVB A;  5LA0 A;  2JXA A;  2BER A;  3H7Y A;  2XON A;  3D4K A;  2R0F A;  1NLQ A;  3VD5 A;  3AL5 A;  1GSL A;  1QJZ A;  1RVF 1;  1UIJ A;  2YGM A;  3K48 A;  5IAT A;  2VNV A;  2J1U A;  5AC9 2;  2RMU 1;  2TBV A;  1PM4 A;  4CZS A;  1W9T A;  1QF3 A;  1WME A;  4OUL A;  4LO6 B;  1F35 A;  2ADD A;  4IEX A;  5BNP B;  3HQX A;  1VJ2 A;  4OFG A;  2JWP A;  1BBT 3;  2RM2 2;  4KNC A;  1LB2 A;  2W9X A;  3FC0 A;  4FPJ A;  4C1X A;  1L7L A;  3RWK X;  1PO1 1;  5BXX A;  1PO1 2;  5C9A C;  4QPG B;  2PHD A;  4F8A A;  1UPI A;  2ARE A;  2HWB 2;  3FN9 A;  4NRQ A;  5IK4 A;  1POV 3;  1RTV A;  1IPK A;  2Y64 A;  5A7P A;  1W8U A;  1NXM A;  4XMI A;  3RSJ A;  4IEP A;  1ZYB A;  2RMU 2;  1G7Y A;  5EJZ B;  5E89 A;  2VQA A;  1SQ4 A;  2ZGP A;  2P2K A;  4QPG C;  1XSQ A;  2GSY A;  3AZX A;  4YNI A;  3MW2 A;  2QBX A;  5E88 A;  1DYP A;  3CJI A;  5GKA C;  5J36 A;  3S7I A;  2EA7 A;  4QXK A;  3THT A;  4AFD A;  2D7F A;  4CDX C;  5KXE A;  1Q8S A;  1UY1 A;  2VNG A;  4Y20 A;  5IJR A;  3HN3 A;  2CDO A;  1ONA A;  2JIG A;  2NLR A;  1DF0 A;  1GU3 A;  2NYY A;  1LJ7 A;  3IIA A;  3K3N A;  4CUC A;  3H8X A;  1YC6 1;  3PIG A;  5FMO L;  5FZE A;  2UUR A;  4JC1 A;  5IFP A;  3ORJ A;  1QMJ A;  4Y20 B;  2UWB A;  2WS9 1;  4LK6 A;  4A3Z A;  3K4Z A;  2V73 A;  5LB6 A;  2ZX4 A;  4XIO A;  5C8C B;  5JPM B;  4CXX A;  5FZI A;  1DQ5 A;  5DZF A;  3I2O A;  1YLL A;  3CJI B;  3I49 A;  4FTE A;  2FDH A;  2X8K A;  2XKO A;  5H9P A;  3H3Z A;  3ILF A;  2OX0 A;  3BI3 A;  4HPK A;  1WW4 A;  4JZR A;  5FRA A;  1RUN A;  1DIW A;  4NHM A;  2XLA A;  2ZGR A;  3CJI C;  5FZK A;  3JQW A;  2ERF A;  3AZZ A;  5JXI A;  4W8J A;  4QPG A;  2A70 A;  1J3Q A;  1W3X A;  2YHJ A;  1MS0 A;  3ZSJ A;  1D2Q A;  1S4C A;  3W5N A;  3PJY A;  3AMH A;  2ET1 A;  3ZFG C;  5DMY A;  3AYD A;  1WLD A;  5IUQ A;  4GJZ A;  1VBB 3;  5FY9 A;  4RYD A;  5EYY A;  3EB7 A;  4MO3 M;  5LEK A;  2XJR A;  2FZ1 A;  3AZY A;  4JKM A;  4YM1 A;  2E63 A;  4RR3 B;  2PHF A;  3MI8 A;  4R9C A;  1MZF A;  1GKB A;  1O5U A;  4HXC A;  4QDQ A;  2FDF A;  3ES4 A;  4L8Q A;  1WBF A;  1ND2 A;  4WZC A;  2VAU A;  2RJK A;  2XJT A;  2MEV 2;  3GDB A;  2J7M A;  5JR7 B;  3VD7 A;  1ND2 C;  3HT1 A;  1OUR A;  3QH7 A;  4JV4 A;  1VLN A;  1ULF A;  3TAY A;  1BYH A;  4AFC A;  1UOF A;  4BQY A;  5D2A A;  1CAV A;  4YZ1 A;  1G9C A;  2E33 A;  1WUV A;  2MPF A;  3V0A A;  3SQO A;  1WA6 X;  4P08 A;  1KD7 A;  2WAA A;  1OF3 A;  1UY3 A;  3OBT A;  4OZX A;  1HRV 1;  1BLZ A;  4YM2 A;  1NUK A;  3KVA A;  5LRS A;  1RUD 1;  2FZ2 A;  5FMD A;  1RUD 3;  3DXT A;  4AVV A;  2OS2 A;  2AH2 A;  4RHV 2;  4LLF A;  5FYH A;  4EE2 A;  4HVO A;  1XU1 A;  2DUQ A;  4AED B;  3W9A A;  4KU7 A;  3NWK A;  1K5J A;  1UZW A;  1ZRD A;  3SIS A;  3OSD A;  4NHL A;  1G86 A;  4G4F A;  3PDQ A;  2QQI A;  5A6Q A;  1W9W A;  1ZBE 3;  3JXS A;  4ZKT B;  5ANN A;  2ZGU A;  4Y1Z A;  4IW3 A;  3RJ2 X;  1LOC A;  2G9F A;  2HYK A;  4XDP A;  3C7O A;  4I3G A;  5FUP A;  4M4P A;  2PHL A;  3RVH A;  3WG1 A;  4CDQ C;  2ORZ A;  3I2J A;  3APB A;  3O0V A;  4Y1Y A;  1SHW B;  2EIG A;  4YAR A;  1RXG A;  1WMX A;  3AYE A;  1S2K A;  1LHU A;  1W9S A;  3VBS C;  2VCM A;  1R09 1;  2EXI A;  4JQT A;  4J25 A;  4JRA A;  4Y5S A;  3ZMO A;  1NCR A;  1IS6 A;  3T4V A;  5JXG A;  1PMJ X;  3OPW A;  2R06 3;  3RYP A;  3VZN A;  4AEJ A;  4Q0Q A;  4AFB A;  4V1P A;  4DEQ A;  2OT7 A;  4OCT A;  3MV1 1;  4HN1 A;  2VOK A;  4TYS A;  3TEX A;  1YXW A;  4Q0S A;  3J7L A;  2QQO A;  4CCN A;  3OD4 A;  5BNQ A;  5FBJ A;  5GZC A;  5A1L A;  1O91 A;  3OY8 B;  4FQZ A;  5G04 L;  5IT6 A;  1UYP A;  2BFU L;  2PLV 1;  4RA0 A;  2EXK A;  2JDN A;  5K7P A;  4XFG A;  2DCZ A;  3OG2 A;  4QKF A;  1K45 A;  2IZW A;  2QNK A;  2UU8 A;  3H9A A;  4LO8 A;  4G9S B;  1H30 A;  3W20 A;  2FCU A;  3VDC A;  4ZXK A;  1GQH A;  2DFC A;  4Q0P A;  3VDB A;  4EZH A;  2VZR A;  4RS5 B;  2WQZ C;  1C4R A;  1C8M 3;  1UYZ A;  4LO4 B;  2YBK A;  3VD3 A;  2JEN A;  3OB8 A;  3VBR C;  1CZV A;  1NY7 2;  4Q4V 2;  1UY2 A;  1W8W A;  2XVK A;  1US2 A;  3SEE A;  4I0B A;  4RR3 C;  1W99 A;  2YRO A;  2WWS A;  2ZJC A;  4H55 A;  2WKK A;  2D6P A;  5A7N A;  3T0A A;  5E8A A;  2HWB 1;  5GLV A;  2GC2 A;  4O61 A;  3AYC A;  2CNA A;  5IVV A;  2WC2 A;  2NP0 A;  3T1M A;  1PO2 1;  1XND A;  5JSR A;  3WW3 A;  3JD7 1;  3NKG A;  1O3Q A;  1M06 G;  1IGO A;  3KCX A;  1MS8 A;  4W65 A;  1NCR B;  3B02 A;  1JOP A;  4MHU A;  3FJS A;  5ABJ C;  3H8U A;  4GIQ A;  2ZGT A;  1W6P A;  3CIH A;  1VBD 1;  1QOS A;  1RVF 2;  2FQP A;  3J7M A;  4LR4 A;  4Q0V A;  4CEW B;  2FDJ A;  2BZD A;  4IGO A;  5ANQ A;  5JDB A;  5LZ6 A;  1JZ5 A;  3FFQ A;  1IPS A;  4UI9 L;  4IXL A;  4ZY9 A;  1IKQ A;  1RIR A;  1X9T A;  2AEY A;  2W2I A;  2IXK A;  1AYN 2;  1W04 A;  3THC A;  1SPP A;  2PQS A;  5FZ6 A;  3ZXK A;  4MGT A;  1H1A A;  4H3W A;  1SLL A;  1TME 1;  2JX9 A;  1AYM 2;  2DUR A;  5FYC A;  4DUW A;  3HQR A;  4HLT A;  3ZO0 B;  2YFU A;  4KG8 A;  5C5U A;  1LGB A;  3PUQ A;  1GP6 A;  1JZ7 A;  4P5H A;  4AW7 A;  1DQ4 A;  2QJV A;  2Y6F A;  3VZK A;  1Y7B A;  1RIT A;  4BQ2 A;  1PMI A;  2WA4 A;  3EMR A;  3ZKU A;  3VDA A;  3WHT A;  2ID4 A;  5JOW A;  4ZPI A;  3KVB A;  3GBG A;  1W6P B;  3NVC A;  1H2K A;  3UL2 A;  5FRE A;  1RUJ 1;  2Z79 A;  4P9J A;  2XJQ A;  5CU1 A;  2QZ2 A;  3OOX A;  5FLJ A;  5CAD A;  3NL1 A;  4X8N A;  5K9Y A;  3ZN4 A;  1WBL A;  2VQ0 A;  2ZA9 A;  1ND3 A;  4FPK A;  4XHB A;  4KWJ A;  1RGS A;  3T4H B;  2RDQ A;  4FPO B;  4ATF A;  2WNE A;  1TNR A;  1H2N A;  5EQU A;  1OSG A;  4DO0 A;  3OYW B;  1VBB 1;  2Y0O A;  3I7D A;  4IV1 A;  4KH9 A;  1QGL A;  3RNS A;  3FHA A;  5L7O A;  4XMA A;  1W9Y A;  2OVU A;  1R1A 1;  2VVE A;  1LGC A;  1WA4 A;  3GCW A;  3OEB A;  5IAX A;  1IG3 A;  4Q4W 3;  2LTN A;  5GLW A;  3URF A;  1ULG A;  2XHK A;  4NOT A;  3LEM A;  4UT5 A;  3UYJ A;  1CAU B;  1OLM A;  1YQC A;  3BIE A;  1KDK A;  5FK7 A;  1HJG A;  2JG8 C;  2RS5 2;  3D5O A;  3FUO A;  3NJY A;  5CG8 A;  2XDV A;  2VZU A;  3VHN A;  1YI9 A;  2WFF 1;  2ZX1 A;  5A7W A;  4CP9 B;  1ZRF A;  4HPK B;  5FY1 A;  2VZS A;  1AR9 3;  3MDP A;  1HXS 3;  1T6G C;  3BKZ A;  5GZE A;  4WZF A;  1YWK A;  3ACI A;  4IES A;  1JZ4 A;  4CP0 A;  2YB7 A;  3RDI A;  5C3O A;  1I5P A;  5G05 L;  2P37 A;  4QQO A;  3MW3 A;  2WFF 2;  4AI1 A;  2XVL A;  2BNM A;  1EYB A;  2FBE A;  2OPK A;  3HNM A;  4DXZ A;  2SLI A;  2RS5 1;  1VBE 1;  1CX4 A;  1QQP 3;  2D98 A;  3PL0 A;  4S2G A;  3VN4 A;  5HBA A;  3W5M A;  1U5I A;  2DVF A;  4KWL A;  4XUQ A;  2D43 A;  2ZZJ A;  4AAX A;  4HK8 A;  4A7K A;  5BYN A;  2HLE A;  1BMV 2;  2BVV A;  1XQN A;  1CZT A;  1WD4 A;  2VME A;  1RUF 3;  1ENX A;  1DCS A;  1H6X A;  1STM A;  3C7G A;  3LIG A;  4BZ4 A;  5KHG A;  2PN5 A;  3I54 A;  5SV8 A;  4QX0 A;  4XUP A;  1DP0 A;  4CPB D;  1VBC 3;  3PUS A;  5KHI A;  4XBL A;  2YZ4 A;  4IDZ A;  1ENR A;  3NNF A;  4BK4 A;  5CA6 A;  1KFX L;  5A32 A;  2TNF A;  1OA2 A;  3BN6 A;  3PVO A;  1PGW 2;  2VTF A;  3U75 A;  2R32 A;  4BQX A;  4LJH A;  4EJR A;  1ODM A;  4LA3 A;  5ERL A;  1JUH A;  3BTA A;  4TZD A;  1RUE 3;  1OFN A;  4RGG A;  5CKN A;  4MG2 A;  3RFR A;  3DCQ A;  3PNA A;  3OGG A;  3RZZ A;  5C7G A;  2FD8 A;  1V6M A;  3DKQ A;  1RUJ 2;  3HR9 A;  3M70 A;  2R1D A;  2LRP A;  4LKF A;  4M3C B;  1X50 A;  1SLT A;  4J6G A;  3VKF C;  2R04 3;  3POI A;  1S55 A;  4DRV A;  3ZIW A;  4BQ4 A;  3OGV A;  4FTS A;  2Z69 A;  2JJ6 A;  1RUJ 3;  1XYP A;  3J8F 2;  5F3E A;  4BXS V;  2DDU A;  1VMF A;  4EWA A;  1MEC 3;  5FYI A;  3BUC A;  1W6M B;  1UMZ A;  3DN7 A;  3VHR A;  1J58 A;  3M8L A;  4M0H A;  3AP4 A;  1CR7 A;  1EAH 1;  4FCA A;  3ZSM A;  2PFW A;  4CEY C;  1CIY A;  4RR3 A;  1AR6 1;  5BNO B;  3VB9 A;  3OGJ A;  1C8M 1;  4HZF A;  4B1M A;  4O7X A;  4CTE A;  3LEI A;  2EXH A;  4JGY B;  3EO6 A;  4C91 A;  3RZH A;  1YNA A;  1HJF A;  3MIC A;  4KGQ A;  1XNB A;  2XJU A;  3ON7 A;  5F3I A;  3HBZ A;  5JIU A;  1B09 A;  4X6R B;  3ME2 A;  3IZO A;  1UMH A;  3AZW A;  4FPC A;  5CFC B;  1CD3 G;  1GWK A;  1VBD 2;  1HB4 A;  3WDV A;  2R07 1;  3O14 A;  3L2Y A;  2Z4F A;  2B42 B;  4MXW A;  3WLU A;  3GZA A;  1LU2 A;  2ZGQ A;  5I91 A;  1ZNP A;  5CIR A;  4LIU A;  2ZEX A;  1NLS A;  4HMZ A;  4EN8 B;  4XPV A;  4FAH A;  5CFC C;  2D40 A;  4EWD A;  3CHX A;  3MYX A;  1NAE A;  2BGO A;  2WAO A;  3MIB A;  5JZG A;  1YUD A;  1OFS A;  1HDK A;  1PO2 2;  5T50 A;  1D4V B;  1POV 1;  4C0B A;  1TNF A;  3K75 B;  1GZW B;  4ISQ A;  3JQX A;  1XC6 A;  3A0N A;  1XNT A;  3ACG A;  1ZZ9 A;  4UF0 B;  3IMM A;  2QDN A;  1HXS 2;  4HT1 T;  4GMP 3;  5K4L A;  1C8M 2;  4Z92 B;  3K46 A;  3V0B A;  2Y6H A;  4COV A;  1AR6 2;  1A3K A;  1IS3 A;  4GH4 A;  2IXH A;  3KCY A;  4LT5 A;  5IK8 A;  1DGR A;  3VHP A;  4JKL A;  3TOJ A;  3T1L A;  1OQD A;  3ES1 A;  2ZGK A;  2QDR A;  4B29 A;  2D3R A;  4QX1 A;  5JOY A;  3ZXF A;  4QXH A;  4HKW A;  4FPF A;  2W3J A;  1POV 0;  1XRU A;  2OII A;  4IV3 A;  2TUN A;  1WWY A;  2VCA A;  3I2I A;  1VPH A;  1QHD A;  3LDK A;  3AMM A;  4Q27 A;  3WNM A;  4AVA A;  2DFB A;  4AGR A;  1W8O A;  2P3Y A;  1CAU A;  3OGS A;  4ZON A;  2H6B A;  1ZM1 A;  2EAK A;  2VG9 A;  4MYE A;  4NIG A;  1W39 A;  3WG2 A;  1H8T A;  3LPF A;  1Y9M A;  4E27 A;  1R09 2;  1VMH A;  3P5B A;  4KMQ A;  3NO8 A;  5FZA A;  1RUI 1;  2ZS6 B;  3SMH A;  1D2S A;  3M1H A;  1HQW A;  4XZP A;  3UV9 A;  5FR3 A;  4Z1V A;  5C8W A;  2J1E A;  4MGK E;  4YW7 A;  5FY5 A;  5FV3 A;  4K8F A;  3I3Q A;  3ZIX A;  3QOP A;  4MGQ A;  4OQ8 A;  1QNY A;  4XJ8 A;  3LEG A;  4WM7 B;  4AYU A;  1S2E A;  4LIT A;  4QWN A;  4GWN A;  4AI3 A;  1Q8O A;  4CDU B;  5BV6 A;  4IE0 A;  5FPA A;  1IS5 A;  1H1I A;  3VDD B;  1ND3 B;  1GP4 A;  5KR7 A;  1R64 A;  1VBA 3;  2HBU A;  3KS7 A;  3N36 A;  4Q8K A;  4DB5 A;  4ES8 A;  1YQ8 A;  4WVV A;  4QX5 A;  1XYO A;  4GWI A;  4UBG A;  1VBE 2;  1JYI A;  4JGY A;  2KD7 A;  3VBS A;  4GWJ A;  4RHV 1;  1IQA A;  4LPL A;  2AEN A;  4X6Q B;  2ZEZ A;  4JGY C;  2RDN A;  5A7Q A;  2RS1 2;  1Y43 B;  3J7H A;  4UFK A;  4P5Y A;  1RUD 2;  4XQW A;  3T2O A;  4DXR A;  1AL2 1;  2B46 X;  4CCD A;  4D0Q A;  5GJ6 A;  2YXS A;  2VOX A;  2DV9 A;  3AJZ A;  4KU8 A;  1OD5 A;  1AYN 3;  3QLQ A;  3IN9 A;  3MLJ A;  2BWC A;  2IUW A;  1Q8Q A;  3NV3 A;  4FOW A;  4NHY A;  4PHZ A;  3THD A;  3O0W A;  4OHZ A;  4OQ9 A;  1PK6 B;  4XIL A;  2QFE A;  3I2D A;  2HWC 1;  3BVC A;  2QQM A;  3FBY A;  3ZXE A;  4YYO A;  4L11 A;  5C9A B;  2Y34 A;  3MEP A;  4Q26 A;  1SPP B;  3PTY A;  5ISL A;  3WD5 A;  4MGI E;  3U78 A;  5FLI A;  3I97 A;  1BBT 2;  1VMJ A;  2RM2 3;  3GNE A;  3RI9 A;  1WLC A;  1YFW A;  3USS A;  5FIX A;  1ULE A;  1LEM A;  1VBB 2;  3ZLI A;  1V0A A;  3KV4 A;  4XCB A;  4BQW A;  4GMP 0;  3KV9 A;  3MFA A;  4M3C E;  1JHJ A;  5FBZ A;  5FZO A;  4NIA A;  5LA1 A;  2XHN A;  5FZD A;  3N4M A;  4BQ1 A;  4OI2 A;  2HEV F;  3GHN A;  3T30 A;  1QJF A;  4MET A;  4COY A;  4WV8 A;  1CX1 A;  4NPM A;  1C1F A;  1KJR A;  1I9R A;  2XL9 A;  5FPL A;  5FPX A;  3KCC A;  4PIZ A;  2IWG B;  2ZTN A;  4XF4 A;  1GQP A;  2VQT A;  4AR2 A;  3H42 B;  1YYN A;  3OBZ A;  3RQ0 A;  2O8O A;  4DS0 A;  3AP7 A;  2GN7 A;  3MPP G;  3NV4 A;  4L92 A;  4AGG A;  2OUJ A;  4UFM A;  3M4F A;  4LHN A;  4Y22 A;  4XC9 A;  1D4M 2;  5F32 A;  4A3X A;  4CA9 A;  4RS5 A;  1AX2 A;  1TMF 2;  3ZPO A;  5T54 A;  2WS9 2;  4OMC A;  1MS1 A;  3ZX7 A;  3ECQ A;  4BXF A;  3MIG A;  2W1Q A;  3C3V A;  1ODN A;  3ASI A;  4MAD A;  2C4X A;  3WDW A;  3ZSK A;  3VV1 A;  2DBI A;  3FE5 A;  4NVP A;  2CY6 A;  2DF7 A;  3ZFF C;  5C8C C;  1AHS A;  1XE8 A;  4N53 A;  1JI6 A;  1GQG A;  3H1M A;  5HCH A;  3FZ3 A;  1CAX A;  1ZRE A;  3AYA A;  3A23 A;  4BJ0 A;  1SFY A;  4BLI A;  2WSU A;  3LD8 A;  4E4Z A;  3I2F A;  4CDU C;  2OQ7 A;  2ZHL A;  1O59 A;  3D0S A;  2DUP A;  2A6Z A;  4YVS C;  4LHL A;  1LHN A;  2VUJ A;  2C0Z A;  4AI2 A;  2WFP A;  1FV2 A;  3LF7 A;  4FP3 A;  2A3X A;  1OXC A;  3AKQ A;  2CU5 A;  4K20 A;  2E7A A;  2PHU A;  3VBR B;  3LFI A;  2D44 A;  3CZU A;  5F6L B;  4IV1 C;  5C4W B;  1V6L A;  2YUE A;  5I0T A;  4RSU A;  4URA A;  4PDW B;  1WLT A;  3WG3 A;  4A45 A;  1L3J A;  3L2H A;  4QXB A;  5CFD A;  4CEY A;  5A1F A;  5B4N A;  3LIH A;  2A3Y A;  2RM2 1;  4E8C A;  5FPZ A;  1IHM A;  4IL7 A;  1JN2 P;  5FZF A;  2RDR A;  2CAU A;  1XOY A;  4QMA A;  1VE0 A;  2VU9 A;  5FWE A;  3RGB A;  4I02 A;  2C1F A;  4BB3 A;  2ORX A;  5K0U B;  3USU B;  4HET A;  4TWT A;  1SLA A;  3MUY 1;  1NY7 1;  4Q4V 1;  3LA2 A;  2A3W A;  1JYN A;  1JBC A;  1LES A;  3O1U A;  3I3M A;  2V09 A;  3OBR A;  2ET7 A;  3ILR A;  2RHP A;  3NV1 A;  3RZL A;  2JDZ A;  4MVT A;  1UX6 A;  4LBO A;  4NHX A;  2DYC A;  3MID A;  1JU4 A;  4ITC A;  4B1L A;  5J48 A;  1ASJ 3;  2AEZ A;  1BK1 A;  1FPN 1;  2PLV 2;  2ILM A;  3HMY A;  4PI2 A;  1FPN 3;  1TG7 A;  3MO4 A;  2A1X A;  5FZ1 A;  2HEW F;  3NJX A;  2NZ9 A;  4UYB A;  5SV5 A;  4FFH A;  2HYX A;  3M7A A;  3OGR A;  3SC7 X;  4XEZ A;  4D7T A;  5C33 A;  1RHI 1;  4YG6 A;  1RB8 G;  1UZY A;  2HWF 2;  5FP8 A;  2OPW A;  4C1W A;  3N9O A;  3UNP A;  3UGH A;  4NR1 A;  3SKV A;  4N90 A;  1VRH 2;  2VOV A;  2C24 A;  1DG6 A;  2WBK A;  5K0U A;  5JR2 A;  3IDE A;  1GV9 A;  1O4T A;  2YBS A;  1ZRR A;  1RUH 2;  4GJY A;  4M01 A;  2YPD A;  5DXD A;  4AED C;  4D7S A;  1SLC A;  4YG0 A;  1WW6 A;  1PHM A;  1JZ6 A;  3ZYJ B;  2TEP A;  3ZN5 A;  4AVB A;  4CEW A;  3RRD A;  1POQ A;  3DL3 A;  1KQR A;  4C8D A;  1N3P A;  1SEF A;  1NE6 A;  2EID A;  2HBT A;  3HNY M;  1EUT A;  1C5I A;  2XJV A;  3HJR A;  1ZZ8 A;  1CWP A;  5EYX A;  3RYK A;  4KQ7 A;  3C2U A;  4AZZ A;  2W39 A;  5LBB A;  1GZ9 A;  3T0D A;  1KGY A;  1R08 3;  5ACA 3;  4WM8 C;  3HNB M;  1Q8V A;  3OJB A;  3HAG A;  1H4G A;  1W2T A;  4XIK A;  4XTP A;  2RR1 2;  4ONU A;  3THP A;  1PIV 2;  4FQ4 A;  4QQH A;  2JDK A;  2WS9 3;  5IAV A;  2VJX A;  2DUO A;  1AJK A;  2W47 A;  3GF6 A;  1JZ2 A;  3I3E A;  4F83 A;  2BOI A;  3LCP A;  2XVG A;  3J26 N;  1ENS A;  3NAP A;  4PQ9 A;  5B4X A;  3MUZ 1;  1LCL A;  2XGX A;  3WF1 A;  3TWI A;  3GZT B;  1HRV 2;  3BIW E;  4IEO A;  4EZ4 A;  2VBD A;  2D3P A;  3EQE A;  4QB2 A;  1TE1 B;  4QHZ A;  3JB4 C;  5J7M A;  3RWN A;  2WZP P;  3TBD A;  1KRI A;  4HK9 A;  4XAE A;  3CO2 A;  1NZC A;  4RQP C;  4A4A A;  1Y4W A;  4AXO A;  1J1T A;  1OKO A;  4LNV A;  1OHF A;  3MPB A;  4F7Z A;  2BOJ A;  2MNG A;  1PZ7 A;  2XL7 A;  3FHI B;  3OY8 A;  3ZN6 B;  1X82 A;  4WM8 A;  2VW0 A;  4PDW C;  2LM3 A;  2HWC 3;  2PMW B;  4Q2F A;  1F4H A;  2WQ4 A;  4RQP B;  2QTW B;  3GZE A;  3VKM A;  1W03 A;  3ZVX A;  2EAL A;  1WKY A;  3NNL A;  4QX3 A;  3KHC A;  4AHY A;  1MR5 A;  1AXK A;  2RE9 A;  4HFS A;  1P8J A;  2ZPX A;  1S0I A;  2VL4 A;  2ZGS A;  2BFU S;  5K0U C;  1RHI 3;  5FZ9 A;  3A0K A;  4EN6 B;  2XBO 2;  2JDP A;  3WNK A;  1ULO A;  1FAY A;  1ZBE 1;  4OHV A;  4LE4 A;  4LBN A;  5A70 A;  2ADE A;  4QX2 A;  4PJY A;  1BXH A;  1YFY A;  2WZE A;  4QX8 A;  5EJ3 A;  1W8N A;  2WFF 3;  5FYT A;  4HL0 A;  1W0O A;  3PTR B;  2R16 A;  4UFH A;  3S30 A;  2JB4 A;  5LBF A;  1EPZ A;  3WDU A;  4AG4 A;  4P9I A;  2C9K A;  5FLH A;  3WY6 A;  3N7K A;  1TQ5 A;  3RMY A;  4HG6 B;  4E4H A;  1TME 3;  4JQR A;  1CIW A;  1V6J A;  3N9N A;  5D8A C;  4XCA A;  3WIN E;  1WW5 A;  3VBH C;  3AK0 A;  5ACA 1;  1UQX A;  3J8F 3;  2AC1 A;  2VZ1 A;  2K46 A;  3GCX A;  4GB3 3;  2ZHK A;  5J09 A;  2DCY A;  1MZ6 A;  3FFZ A;  3LFM A;  3RYR A;  3AKT A;  1LOG A;  4ARX A;  4CCE A;  4K40 A;  4ARY A;  4JHZ A;  1SDW A;  1ULP A;  1BEV 3;  3HWJ A;  1O8S A;  5DDJ 2;  5KHJ A;  3WNX A;  3O1S A;  1NYW A;  2O8Q A;  1RXF A;  2BU9 A;  2KR2 A;  1C28 A;  3LKJ A;  3VL9 A;  4FAG A;  2BV4 A;  2LUW A;  5BNN C;  5C71 A;  3LQC A;  1HIX A;  1I5Z A;  4FOQ A;  4RL7 A;  1C5H A;  5JXH A;  3O1T A;  1OA3 A;  2J1R A;  4GKY A;  3VBS B;  4CRQ A;  1ZRC A;  1GOF A;  2WNU C;  1IPJ A;  1B35 B;  4IEU A;  4Y5T A;  2ZHM A;  1ENQ A;  4FPG A;  4C90 A;  1NQJ A;  2YY1 A;  1CZS A;  1WCD J;  2VMI A;  5L9B A;  4CUB A;  5C5T A;  1GWL A;  4LBM A;  5FZ4 A;  1NZI A;  1F5F A;  4NN0 A;  4CU6 A;  2F17 A;  4NII A;  4NO4 A;  2GP3 A;  1TVG A;  2QQK A;  1NKG A;  3ATG A;  3QBQ A;  2VMF A;  3GJB A;  4YGD A;  3B00 A;  1V9U 1;  2NMN A;  5HCB A;  1NA1 B;  4YVW A;  3E97 A;  4YGB A;  5FP7 A;  3VLB B;  2BEO A;  4Y1X A;  5F5Q A;  3S0M A;  2PHR A;  1HB1 A;  1MS9 A;  1U0A A;  2ARC A;  5C3P A;  3U11 A;  4L9B A;  4Q29 A;  1VBA 1;  1G9B A;  4RS5 C;  2EIC A;  1KFU L;  3AXE A;  4JKK A;  2H0B A;  5EHD A;  1S0D A;  1H2M A;  1AZD A;  4FO9 A;  4XHX A;  5AC9 1;  3AKP A;  2LS6 A;  4E2S A;  5EIY B;  1FT9 A;  5KXD A;  3MIF A;  3VZJ A;  1H8V A;  2ARA A;  4O9E A;  2W91 A;  1MVE A;  3TRS B;  1MS3 A;  2BRT A;  3E5Q A;  3NAP C;  2BBV A;  3A21 A;  4UWD A;  2DU1 A;  1LAJ A;  2A71 A;  1NT0 A;  4E4S A;  2ZGN A;  5FUI A;  3BB6 A;  5CNA A;  1COV 3;  3JBG 1;  3K3O A;  1YIP A;  2JE9 A;  4JX0 A;  1QJE A;  1KXG A;  3ZSL A;  5L9R A;  2W46 A;  3HD8 B;  4L99 A;  2V72 A;  2VZP A;  1GZC A;  2NM1 A;  2BP6 A;  4LUK A;  1AR7 2;  1S2B A;  3WW4 A;  1AF9 A;  1JZ8 A;  1QJY 3;  3VZL A;  4CDQ A;  2GZW A;  3HEI A;  2X53 S;  4Q4W 2;  4PCR A;  2WDB A;  3O1P A;  4FSJ A;  2Q1F A;  1R1Z A;  1GZW A;  1A8M A;  4HON A;  1O3R A;  5E1R A;  5FYM A;  5JZG B;  1YO8 A;  4IE4 A;  5D8A B;  4CU8 A;  3AFK A;  1VBC 1;  4XUT A;  3VBH B;  4CYD A;  2YC0 A;  4QT6 A;  4ZU5 A;  4BQ5 A;  1Y9Q A;  1NLR A;  1UU6 A;  1YI7 A;  4KI5 M;  5J1X A;  3POS A;  2QQV A;  3QAC A;  4FT8 A;  4OHY A;  2XLG A;  4XJU A;  5CFC A;  2AAC A;  5IW0 A;  1US3 A;  2XUM A;  5DAW A;  1MEC 2;  1Q56 A;  3OCP A;  4HSJ A;  4NE9 A;  4N7U A;  4A6O A;  5BNP A;  1XXN A;  4QD2 A;  5FO8 B;  4BQ3 A;  4QDS A;  2ZX2 A;  5F6K A;  1RJ8 A;  3LWC A;  2JG9 B;  1N1V A;  3NRU A;  4UXA A;  1UYY A;  2YV8 A;  3BYW A;  3M3C A;  2VW2 A;  4V2W A;  2V5Y A;  3W58 A;  5T55 A;  2WO7 A;  5H9Q A;  5J37 A;  2ZAC A;  2P5B A;  2GNM A;  1W6N B;  4BIS A;  3VBF B;  2CL2 A;  2K2S A;  3HT2 A;  5EV7 A;  1VAL A;  5F5I A;  1UF2 C;  3WDY A;  1OLQ A;  2RR1 3;  5AVA A;  1S0B A;  3VDD C;  2E9Q A;  3SHR A;  4GB3 2;  3VBO C;  1EAH 3;  1QXJ A;  1Y3T A;  1CVN A;  4YFW A;  1NXD 1;  4JGZ A;  4UFL A;  4OUM A;  1SBF A;  3TN9 2;  2LW8 A;  4AFA A;  2FDK A;  3SIT A;  5FP3 A;  1PZ9 A;  2YGL A;  3LPG A;  4M3C A;  4BMB A;  1HV0 A;  2VGD A;  3VBO B;  4FXK B;  3ZYR A;  3UK9 A;  1ULD A;  5FYY A;  2F4L A;  3RZJ A;  1UD1 A;  3NNM A;  1X8E A;  4HVR A;  5BUV A;  1GP5 A;  2O1Q A;  2R07 3;  4DXT A;  5JSP A;  4ET7 A;  1OBN A;  5A80 A;  5FY0 A;  1H1M A;  1XNC A;  2HWF 3;  2E51 A;  4LK7 A;  1DGW A;  1UL9 A;  5F1R A;  3IBM A;  3ST7 A;  1ULC A;  1UOB A;  4XUR A;  4BME A;  1SDD B;  3NKT A;  4Y4Y A;  1AR7 3;  1GNH A;  1U5Y A;  1UKG A;  4MOA A;  2YFZ A;  2DCJ A;  3GJA A;  3K77 A;  4LBQ A;  2A6Y A;  2GU9 A;  2R30 A;  2VXR A;  1G8W A;  5FJH A;  2EAA A;  1OI6 A;  4GMP 1;  1UZZ A;  2XG3 A;  1RUG 2;  4MUV A;  1UY4 A;  3N7L A;  3ZFF A;  4IQP A;  5IVE A;  5JUV A;  1COV 1;  3WG4 A;  1UN1 A;  4CU9 A;  3S5A A;  3M3Q A;  2D6K A;  1PVC 3;  2XB6 C;  1RUE 1;  3KGZ A;  1UWW A;  3DEC A;  3H1Y A;  2A75 A;  3F95 A;  2JDH A;  1QH7 A;  3PUI A;  1K12 A;  4K21 A;  2VCB A;  4IE5 A;  3LZZ A;  5DG2 A;  4W50 A;  5JPN B;  1RUO A;  2R04 1;  3OUI A;  4LKS A;  2ZX0 A;  3VKO A;  3ZYH A;  5A33 B;  3FMG A;  2ZGL A;  3NV2 A;  4CDW A;  5DUW A;  2DU0 A;  2HEY F;  4Q4Y 2;  2Q1Z B;  1UAI A;  2GND A;  1W8T A;  1Q8P A;  1UIK A;  2A6X A;  4Q1R A;  1MVQ A;  1RL3 A;  3E5U A;  1BHG A;  3L9J T;  1AX1 A;  3PHM A;  2ZX3 A;  1CN1 A;  2X5I B;  4KBZ A;  1JTZ X;  4WVW A;  1CGP A;  1W05 A;  1R09 3;  3NJZ A;  1SAC A;  1SBE A;  1YFX A;  4NHK A;  5DAP A;  5FY7 A;  3AP5 A;  4FOV A;  4LTA A;  1AJO A;  2BQP A;  5T5L A;  1Z7S 2;  1O4Y A;  1N1T A;  3WP3 A;  5FFO C;  5GZF A;  5I8Y A;  5DUU A;  3TB0 A;  1OH3 A;  1UOG A;  3PVB B;  1LHO A;  1V00 A;  4KBB A;  4RFR B;  3BOP A;  1C8N A;  1QU0 A;  4XFC A;  4HKL A;  5F2S A;  2Q8C A;  4WM7 C;  4BHP A;  2JDU A;  3MLK A;  3POY A;  3WCS A;  1JS9 A;  1DHK B;  2EXJ A;  5L9V A;  3LOB A;  1UCX A;  4N43 A;  1QQP 2;  3SXW A;  1ND3 C;  4LKD A;  1LR5 A;  5T3N A;  4AI8 A;  4B4Q A;  5FPU A;  5CFD C;  4JTO A;  5DPN A;  2P3I A;  1KJL A;  2Y33 A;  5JMO A;  1YFU A;  1OOP B;  5DAV A;  5IHR A;  1UZ0 A;  2WUH A;  4JHT A;  4SLI A;  2OYZ A;  4AL9 A;  4P9Y A;  4JGZ C;  3PMS A;  5A3M A;  3GBF A;  5AFE A;  3RZK A;  3JBG 3;  3MZH A;  1LKN A;  1NCQ B;  4AE2 A;  3ETP A;  1LTE A;  3CEW A;  2FDG A;  4KL1 A;  5FUN A;  1ASJ 1;  1W2O A;  2VOW A;  2AZ5 A;  2XWJ B;  3ACL A;  4GUL A;  1JOD A;  4KGG A;  3ZXA C;  1SMV A;  4AF9 A;  1YCI A;  2AGS A;  4QXC A;  3VZM A;  4CXW A;  3SNM A;  1MZ5 A;  1QOO A;  5DAX A;  4N53 C;  3AC0 A;  4DY5 A;  1W9F A;  1SCR A;  2VE1 A;  3U4S A;  1C1L A;  1IOA A;  2RS3 1;  2IFW A;  1H0B A;  2A6V A;  4TSV A;  3UGF A;  3OUJ A;  4N53 B;  4QAW A;  3H0O A;  2W5F A;  2HWE 1;  1OUX A;  3GAL A;  1LOA A;  3OBA A;  2YU2 A;  1VR3 A;  2WZ8 A;  1X9P A;  1DZQ A;  1U12 A;  2ZAH A;  2W92 A;  3LEK A;  1JZ3 A;  1X33 A;  3WUC A;  4I0W B;  5ABJ A;  3EYP A;  3N9P A;  1X8M A;  2ATF A;  4PLN A;  4CUA A;  5M0T A;  5I93 A;  1Z78 A;  2WRA A;  1EV1 2;  3DPR A; 
#chains in the Genus database with same CATH homology
 4LMF A;  1SPP B;  1SPP A;  2QQO A;  4GZ9 A;  1NZI A;  1SFP A;  3KQ4 B;  5CIS A;  3POJ A;  3POI A;  2QQK A;  3POG A;  1SZB A;  4LOR A;  4LOS A;  1NT0 A;  2QQL A;  3DEM A;  2WNO A;  3POB A;  3POF A;  5CKM A;  3POE A;  2QQM A;  4LOT A;  5CKQ A;  5CKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...