3POJA

Crystal structure of masp-1 cub2 domain bound to ethylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pojA00
2QQOA 5CISA 2WNOA 1SPPB 3POGA 4LMFA 4LOTA 4LOSA 1SPPA 3POJA 3KQ4B 1SFPA 3POFA 3POEA 4LORA 5CKNA 3DEMA 3POBA 4GZ9A 2QQMA 1NT0A 2QQLA 3POIA 5CKMA 1NZIA 2QQKA 5CKQA 1SZBA
chains in the Genus database with same CATH superfamily
3UV9A 4DY5A 2AACA 2BRTA 1UU4A 3KLSA 1GYKA 4XFGA 1PO22 1NOVA 3IDCB 5DN2A 2FDKA 5FP9A 2VR4A 3ZYPA 2BUKA 4QGMA 4XF4A 1JBCA 2NLRA 1NE4A 1PIV3 2PFWA 2VW2A 3WF1A 4RR3A 3ORJA 4AEDB 4AXOA 4LOSA 5AVAA 4AFDA 1YXWA 5ISLA 2A6WA 2W47A 5K9YA 3U4SA 3ZFEB 1OXCA 1VBC3 4CA9A 4HVQA 1IZ3A 1GUIA 3ZXDA 3ZXLA 3ZR5A 4R9BA 3EBRA 3AXDA 2A73B 4QMAA 5H9QA 2EIEA 1EUTA 1HKDA 1PMHX 3ELNA 4IDZA 5DZFA 3WW1A 1JZ8A 3OPZA 1PIV2 5JR7B 5JMOA 1PMIA 3S7EA 3SCHA 3HQUA 3CJIA 4CCEA 2BYVE 2JWPA 5IAXA 1UOJA 4LKEA 3TB0A 3IBMA 5IVCA 3VBOA 1VBC2 5KR7A 1WMXA 5IWFA 4RR3B 1SFYA 2Q8EA 4XIKA 2ZMKA 5KXCA 2YY1A 5FMBA 2EIDA 1ULGA 4AOCA 2ID4A 1Y7BA 1ULFA 1X8EA 2VUCA 4LKSA 1U5YA 1FATA 2P2KA 2HWE1 3MPBA 1V9U3 5D8AB 2WT2A 2Q8OA 4EE2A 1UYPA 1XNTA 3ON7A 2YC2A 4XQDA 2C26A 4B4QA 2D5FA 4OFGA 5JOZA 1ASJ1 2WYFA 2PHDA 2YMZA 2Z5WA 4OZOA 5FO9B 4FVVA 2VNOA 1C8NA 2CYFA 5KXEA 4JGYC 2PHLA 1BJQA 1JZ4A 1NX9A 1RUF1 2P6CA 1HW5A 3I2IA 1V9U2 2D6NA 1GQHA 1WW7A 3T2QA 3R4SA 2ZEZA 1PNFA 2WQ8A 1RJ8A 5A3MA 3BIWE 1OH4A 5C4WA 4AEKA 5IVYA 2D98A 3B69A 4TWTA 1GU3A 4XUNA 1ND2B 4YW4A 3RG0A 2W3JA 1YFXA 4K20A 4Q0SA 1UMIA 4Y26A 1W6PB 3AMHA 2YDEA 5FMDA 2EALA 2XKOA 2VPVA 4PDWA 1HB2A 3ZDVA 3ZIWA 4ZU7A 3OBRA 4KBZA 4XJ9A 3VBFA 4MX3A 1LCLA 2OQ7A 5C9AA 4DUXA 1AL23 1SBEA 3D0JA 3ZOIA 4COYA 4MSVA 4XJ8A 4WM7B 2ZZQA 2RVAA 2W92A 2Q0AA 1NXMA 1U0AA 3FBMA 3MLLA 4K7JA 1UYXA 3I2FA 1TVGA 5IATA 5F2SA 2WINB 3DF0A 3V56A 4R8HA 3SKVA 2RJLA 4CEYA 4CCNA 4DRRA 2ZHKA 4M4PA 1R64A 5J36A 2A70A 5HCFA 5KBFA 4PBOA 1AL22 2OXBA 4RFT0 2ZCWA 3MYXA 3D4KA 5LBBA 1B09A 4IETA 4PDWB 5APAA 1OQEA 5BYNA 3RDIA 5CFCB 5HV0A 1APNA 1E5IA 1IOAA 3SKJE 1CZSA 5F6LB 3VKMA 3AVRA 3DCQA 2WNVB 3WV6A 4LO4B 5A3TA 3OGGA 3WOGA 4QQLA 4IE6A 3AC0A 2R32A 4QX3A 5F2WA 3UGFA 4CXYA 5T5OA 1HN0A 1NCRC 3ZFGB 3OB8A 2QKDA 2VZTA 4LHLA 3SC7X 2RM23 3AL5A 4GB31 5J37A 1JUHA 4FPLA 4IEZA 1NLQA 4PIXA 3Q8AA 1ND3C 2WFPA 5DUWA 4NJ4A 1WD3A 4FPCA 1H8TA 3MIGA 3B5LB 3LPGA 3GBGA 3THDA 5HXMA 3MIBA 2DCJA 1UL9A 4Y1YA 4LPLA 5JZGA 1SDWA 2A75A 3PL0A 2RM22 1QNWA 2W0XA 3INAA 4Z8BA 1JOPA 2XG3A 4NPRA 4NWVA 1GWMA 4YGBA 5ABJB 2QDRA 2VVFA 1JW6A 2J1RA 4AHYA 5JCTA 3S5QA 4OUEA 3Q8BA 3WXPA 4X6RB 3UL2A 1W2TA 1V6KA 3SNMA 2C24A 2BFUS 2R071 1EAH3 3UNPA 1LKNA 5CG8A 2RDSA 2DCYA 4IEUA 1AR71 1V00A 4BHPA 2EXKA 3B7MA 4YSFA 5F3CA 2BBVA 2YYOA 1Y3TA 4XURA 3U11A 2XJRA 2VXJA 2NN8A 3ILFA 3SISA 1UMHA 4IV3B 2J1SA 3CU7A 4CUGA 4D7YA 3U0ZA 3V0AA 1ZX5A 1W8NA 1EAH2 3AMNA 3IAQA 4Y4RA 4DXSA 2XVLA 3MF6A 3VDDB 3IIAA 5T50A 4CDWB 4N53B 1C4RA 3LZZA 4COWA 1MR5A 5LY1A 3Q8EA 2RR13 1MS5A 4GWNA 1MQTC 3RZZA 4WVWA 1IS4A 1WLWA 2RHPA 2P3YA 2PAMA 4UF0A 4YG3A 3JQWA 1GZ9A 1ST8A 4CDQC 4MOAA 1G6NA 4EWEA 4C0BA 3UJOA 2FDGA 1RUI2 2R0FA 1LRHA 3ILNA 4AE2A 1WBLA 3AKRA 4I0BA 4HSLA 1CIWA 3ZSJA 2AEYA 3OPWA 2D44A 2RR12 3IAPA 3NO8A 1LAJA 1W0NA 1S0EA 3T3YA 5GLUA 3WDUA 1TMF1 3EO6A 3K51A 1GBGA 4QX7A 2JG8A 3VL9A 3HN3A 3IDEA 4FXKB 1XYNA 5SV8A 1Q8PA 1W0OA 2IZWA 4UF0B 4PLMA 3RMXA 5C3PA 3AMQA 2DBIA 2J1TA 4Q4X3 5FZHA 3PIJA 3T0AA 4CDUC 1LTEA 3OF1A 3BTXA 1WD4A 3J7MA 1K42A 1RVF3 4KL1A 5A3OA 3VD3A 4UAPA 3PU8A 3O1SA 2BNNA 3TEZA 4BH9A 2VMDA 3FZ3A 3DPRC 1WKYA 4LIVA 3BOPA 3K48A 1GOFA 2BOJA 1ENXA 1MS4A 4QXKA 4JGZC 1RGSA 3H3UA 2KR2A 1RVF2 3ZXJA 5KHGA 2ZEYA 2RMU1 4MGIE 3BI3A 2QVSB 3PMSA 5FPBA 5H9PA 1BLZA 4OUSA 4YG6A 2YFZA 1MVEA 4L11A 3U07A 2FHRA 2OKXA 2A6XA 2PHUA 1S0JA 3ACFA 5KXBA 1RC6A 1ASJ3 2VZRA 2Y6FA 3FFQA 5L36A 4R52A 5EYXA 2P4EA 1UD1A 3GM8A 4ATFA 3N9MA 4B7KA 3S57A 4L92A 2XL7A 4ITCA 3Q8FA 3M3EA 1LESA 3OY8A 3GNEA 1AJOA 1ZRDA 4GWMA 4E9KA 4LULA 3LEMA 4N8MA 1JH5A 3VD5A 3NV2A 1N1SA 1ODMA 3NKTA 4Q0VA 4AVSA 1OHFA 2G9FA 1ASJ2 3ZYRA 5LEJA 1PVC1 1P8JA 1RUOA 5FMOL 3VDAA 1JU3A 3FUOA 3FLRA 4CPBA 5CADA 3ACHA 2AR6A 3PVEA 4HK8A 4XDQA 4AHZA 5J7MA 2WO1A 4OZXA 1O5UA 4XAEA 1GV9A 4Q0PA 4UXAA 5FZ9A 1L3JA 1K3IA 3W21A 3OY8B 2WIIB 4E27A 4O7XA 2YUEA 1GP6A 4QQPA 3MIDA 1H30A 4BDVB 3K77A 4CXWA 2F4LA 4QPYA 5FP4A 4JCKA 1XNDA 3CBNA 3RQ0A 2HWD3 2ET7A 2QQWA 1SHWB 1X36A 3LGRA 4PLNA 1OLQA 4CYDA 1GICA 1KXGA 5FY9A 1COV1 1SLAA 5I8SA 3KF3A 1HB1A 1C1FA 2P34A 2O0OA 2VU9A 1BQPA 4PI2A 4LLFA 4LOTA 3ACGA 3EHKA 2ZGQA 2X53S 2HWD2 3HBZA 4P08A 4Y24A 3OGVA 3AYDA 4OHYA 1EPZA 4DY3A 4QM9A 2FBEA 2OIIA 1ZZ8A 5LEKA 2VBDA 2TBVA 4D8MA 3P3PA 3T2OA 4PIZA 3A0KA 2RS33 4Q4V3 1H6YA 2BFUL 2Z69A 4CE8A 3IDBB 1GNYA 1PM7A 2VZOA 3AMMA 3B02A 1MEC1 4XZPA 5CB7A 4HXCA 4PHZA 5A70A 5L73A 1DLLA 1SACA 1DQ1A 1HQWA 2C5DA 1QH6A 1VAVA 1VBA1 3AKTA 4I01A 4A42A 3THTA 1RUG3 4DPNA 3MFAA 1UIKA 1F8VA 4CEWA 4WVMB 1UY2A 5FMOS 1XJAA 3RFRA 4Q4V2 5F37A 2D7FA 1QXPA 1S2KA 2BNMA 4ZKTB 1AYM3 2YC4A 2ZX3A 4E2QA 5C7GA 3WCRA 2IXHA 2ETEA 4FT8A 5H9SA 1NLRA 4AVVA 1Q43A 3WDWA 2K0GA 1WBFA 1O4YA 1CN1A 4XMAA 1OC1A 1RUD1 2PQQA 3PURA 5FXWA 5I0TA 1S4CA 1S0GA 2IFRA 1IKPA 3POYA 4GWIA 4NVPA 3IM0A 4XMIA 5GZEA 3TNQA 2W1QA 2ZGTA 2D6KA 2DFBA 4QX8A 4CVUA 3GBFA 1ZZ7A 3RVHA 1UPIA 2IVIB 1JODA 1SFNA 2R0HA 4PIYA 2VG9A 1UU5A 4KH9A 1PMJX 4FPOB 1PM4A 5ACA3 2B9VA 1LHNA 1Q8QA 4E4SA 1S0CA 3GZUC 4ATEA 4U2AA 1PHMA 2R072 3WD5A 1LU2A 4HBNA 5GLTA 4B4RA 4KWLA 1TNFA 1OPOA 2HEYF 4NO4A 2ZGKA 3VBUC 3O1OA 1PGL1 3HWJA 2V5YA 4H14A 4IL7A 2AYHA 4PF1A 4JDOA 1YHFA 3MEPA 1PO13 5GALA 4CDUB 3S6PA 3K2OA 1W8OA 3MBWA 1BBT1 3PTYA 1W6QA 3ZN6A 2BGCA 4A41A 4C0HA 5ACA2 1JOJA 2ZGLA 1J59A 1URXA 2KD7A 1VPHA 1W3XA 3KV4A 4BMBA 3D3AA 1D4M3 3E6CC 1JOBA 1R091 4NWWA 5FPAA 5IT6A 1DGWA 1V6LA 2B8MA 3H1WA 1C1LA 1PO12 3APBA 1QNYA 2VUDA 4META 2RS53 1VMHA 2VQTA 2XHNA 4LXLA 4O65A 1RMU3 4Y22A 4YW7A 1AR61 2PHTA 4IE5A 1NA1C 1D4M2 5FYSA 1UX7A 2IUWA 2P37A 4LUKA 2C0ZA 3O5SA 2JD4A 2W1UA 3I8TA 5A7QA 5BNOA 4BQ3A 1FMD3 4OMDA 3ENRA 3MW3A 2WLPA 1PO21 1Q8SA 2RS52 1RMU2 1NAEA 4QPIC 1B35A 4H3WA 5FYYA 3KSCA 2JB4A 5D21A 2CL2A 3NJXA 1N3PA 3PVOA 3T4HB 5BNQA 2A5ZA 1S0DA 3MF9A 1OI6A 5LBCA 3NJYA 5F3IA 1FMD2 2GN3A 1UZVA 4FBFA 4YRDA 1K45A 4V1PA 1MZ5A 1DQ6A 3VV1A 4GQ7A 4DS0A 3K3OA 1LEDA 4FI9A 3LF7A 4XIOA 2W52A 1QOSA 1W8UA 5FYVA 5BNOB 3WCSA 3T1MA 3RYRA 1PIV1 2QNKA 3OSDA 2YV8A 2BQPA 3Q8CA 1NZIA 2DU1A 4XILA 1YQCA 1XPWA 3I97A 4LBQD 4M00A 1CGPA 4QKBA 1O5LA 1VBC1 4UFJA 5A6ZA 5FPXA 4TLGA 1XSRA 2PN5A 4LBKA 3WNLA 4TSVA 4DOUA 4G4FA 2WO3A 5A7WA 2P1BA 1TME3 1YRZA 1L7QA 4W65A 4KU8A 3POGA 4M3CA 1MS3A 5FRAA 1GP4A 4AF9A 3O1UA 5FYBA 2C4XA 2W95A 5BXXA 1J3RA 4GJZA 5IW0A 1CJDA 4Q5OA 5C3OA 4AVCA 4D7TA 1O4TA 1HXS3 2WZ8A 3OOXA 3ZSEA 3NL1A 1V0AA 1C5HA 2VOXA 4EWAA 1U5XA 2E7AA 2E32A 2VTXJ 4ZU5A 1N1YA 4KQ7A 4Q0UA 4RS5A 2X05A 3OBZA 3FLPA 4FOYA 1KD7A 4LBMA 1V9U1 4PT6A 3ZKUA 1XU1A 3CLPA 2WNUC 2ILMA 4PBPA 2VJXA 2X5IA 4QX2A 4M3CB 1RHI3 5LW9A 3JZVA 4J25A 3VBHC 1I6XA 1W8WA 1HXS2 1WLDA 4WZCA 4UOJA 4BYYA 4IEXA 3PUHA 3LAGA 2QCSB 1W28A 1E5RA 5LA2A 4QGLA 3E97A 1HRI3 3HBKA 4IEQA 5L7OA 1UX6A 1VR3A 5BNPB 3UGHA 3GZAA 5FZGA 5CFDA 2IWGB 1W6MA 1AL0G 3RWNA 4C90A 1RHI2 3OG2A 3RRDA 2QQVA 3FFZA 1COV3 4O9GA 1GANA 4CDXA 5A6QA 5HCBA 1HRI2 1CAWB 1YNAA 3KCYA 4LO6B 3ZN4A 1VMFA 4RQPC 3PVBB 4CTEA 1O3SA 3VHNA 3ZFFB 1PGW2 2EIBA 3LA3A 3M1HA 4NHYA 2WNOA 1AL21 1S2EA 1EYBA 1COV2 1POV0 4RGGA 1LGNA 4LE4A 3WT3A 1W6NA 3I3QA 1X50A 3BVCA 1MPXA 1J84A 3DXTA 1GMMA 1GFF2 2R1BA 3USSA 2BPA2 4AR2A 4AAPA 1JZ3A 4CDXB 2F4PA 2YXSA 5HXVA 1GZWA 4CUCA 4Z2AA 4QXBA 5FXVA 4YVWA 2J1VA 2Y38A 2Y6GA 2O14A 4YPJA 3ATGA 3WUCA 2A7AA 4EQVA 5FZ3A 4V2WA 5E6HA 2P17A 2QTWB 2CSGA 1OOPA 2XUEA 3E5XA 4QGNA 4FAHA 4OI2A 3AP4A 5EJ1B 2WZPP 3BALA 1XBFA 4LBNA 2ORZA 3CJIC 1AX0A 1NCQB 2VZ3A 4JRLA 3VBOC 4CUBA 1BYHA 2RM21 2WO2A 5LA9A 1AR83 2RDRA 4B1MA 3N35A 3N7LA 1FNZA 4WM8B 3U10A 4YM1A 4BQ5A 1RUNA 1PK6C 1GZTA 2J7MA 4E2SA 5IFPA 1D7PM 3CO2A 4YVWB 4AL9A 2WQZC 3VD4A 3GF6A 1DIWA 3T0BA 4XFHA 4MXWB 5IVFA 4R4ZA 5I0UA 1Y43B 1YI7A 2B4KA 1JHNA 2W91A 1ONAA 3OBTA 3MI8A 3VZOA 1UCXA 3ZLIA 1JYNA 1AX2A 1G86A 3LE0A 4N43B 1AR82 1EY2A 4M0HA 1DZQA 4RGAA 2XQXA 3MFCA 1H4GA 3WNOA 1A3KA 5FP3A 5IK5A 5F5QA 1NQDA 4KU7A 2W94A 4YZ4A 1XSQA 4E4HA 3IDAA 3OGRA 5K0UC 5FTTC 3O7OA 2VMCA 3VBSA 1VALA 2B9UA 4QB2A 2CWSA 2ZOEB 4XHBA 4AI8A 4AGRA 1EAH1 5C4WC 1UOFA 3MZHA 2CNAA 4KWJA 2PLV3 4N7UA 1R093 2BV4A 2EF6A 3VBRB 3HQRA 3TAYA 1A8DA 4YM0A 2HWC3 4RYDA 4UW4A 3ROUA 4Q27A 1C5IA 1YC61 4YW2A 1A8MA 4AI0A 4JDNA 4MHRA 5JXIA 3DYPA 5C9AC 1FNYA 2A3XA 1WA4A 1IQDC 3E1F1 3HMYA 1HN1A 2PLV2 4FCAA 4QQOA 2D3PA 1R092 1AX1A 3LDRA 4NIHA 4IV1C 2V09A 1OLMA 4JVAA 1V6JA 2HWC2 3RS6A 1SLBA 2PELA 1K5MB 2ZABA 2ZHMA 3WF4A 3HQXA 5GLVA 4AFMA 4CEYC 1SDDB 3DUIA 2D6OX 2RR11 4KBBA 3VZKA 4AEDA 1VJ2A 2ZGUA 5FJKA 4F83A 1JZ2A 2R043 5M0TA 3LWCA 3JB8A 3ZFEA 3HVDA 2QQJA 4PJYA 5A7PA 5K8SA 1MZ6A 5FLIA 1JZ7A 5EHDA 4R4XA 5FZAA 4AK3A 1KRIA 2UYBA 4LTAA 4FP3A 2VNVA 5A3PA 2ZGSA 5HPOA 4C1WA 1R1ZA 1ULCA 1G9AA 4XABA 3S5AA 4CZSA 4XTPA 3W5MA 2P3IA 1K5JA 5AFBA 2JDMA 4ISRA 2R042 2VCMA 4ASKA 2G9GA 4HMZA 3WDVA 1SG3A 3IMNA 5JXGA 1SBDA 2XXZA 4MGQA 1DYKA 4N7IA 3RZLA 5FUPA 1HJGA 4BK4A 4Q4X1 1XYOA 5T5PA 1ZA4A 1H8TC 1AZDA 1Y9GA 1GR3A 1RVF1 1ZA7A 5D8AA 3WNKA 2Y6LA 4A7ZA 4BJ0A 5C3RA 5JZGC 1DYPA 1NY72 1IPJA 4LBLA 2VNGA 1RITA 3UKNA 5I0DA 4HVOA 5JSRA 2V4AA 2VMGA 2ZA9A 2VCCA 1QDCA 3KVBA 1JHJA 1YUDA 3DN7A 4HPKB 5FK7A 5GJ6A 1JYCA 1Z78A 2IVJA 1QHDA 3ACIA 3KCXA 4PF5A 5BUVA 4GALA 5I0RA 3HR9A 4CU9A 1AYN3 4XYXA 3RI8A 1W2AX 2VMEA 3WVJA 2YU1A 4K6BA 1ND2A 2JECA 4L8QA 1S2BA 3HAGA 4XTMA 1W6PA 5A6YA 2UY8A 4QHOA 2Y6HA 5FZMA 3HJRA 1Q8VA 5FPUA 3H7JA 5LK5A 2DFCA 4Y1VA 1LOFC 1UXXX 3H8UA 4QHZA 2A1XA 2VQUA 2Z42A 3IN9A 3W58A 5JIUA 5JOWA 3TEYA 3LIGA 3WEZA 5IVBA 4TTGA 3SEEA 2FD8A 1SLLA 4CU6A 1ZBA3 3AZYA 1G7YA 4WM7A 1W8FA 4HFSA 4Q8LA 5SV5A 2JX9A 3OUIA 4B1LA 5BY5A 3WNNA 4RHV3 1GP5A 4FFFA 3NWKA 4YWAA 4QXCA 5A3NA 3AYEA 5ANQA 3FHAA 2RS13 2JE8A 4ET7A 5IK7A 1RB8G 3AMPA 1QF3A 4QHBA 2IXKA 1UZ0A 3GDBA 1ZBA2 1US3A 5CFCA 4Y33A 5IYYA 2QQKA 2JD9A 3RSJA 1DCSA 4Z2WA 1QJFA 4JQTA 4QU2A 5CU1A 5T5LA 4RHV2 4CUAA 4J1XA 5C8CB 2JG9B 2WNVA 2BTVC 4OHZA 1HB4A 3S7IA 4NRPA 1OD3A 1XB9A 2RS12 4B8EA 2Y8KA 4LBQB 3HNBM 4AEJA 3ZFGA 2W87A 4GMP0 1DQ0A 2HWD1 3WY6A 1H2LA 2JG8C 4FFIA 1OVPA 2G19A 3EB7A 3J9SA 4IE0A 4I3GA 4XAAA 3ZO0B 1AXKA 1UAIA 4LA2A 4W4ZA 2LALA 1D2QA 1QU0A 1KQRA 2D6MA 2WS93 4LORA 4R9CA 4GZ9A 3VUOA 3BPZA 4P9WA 4QDRA 3BPSA 4CCLA 1DP0A 4HN0A 3FHQA 4LK6A 4I02A 1KFUL 5FWEA 1I1EA 2D3RA 2VNRA 2BW8A 2JE9A 3LEGA 4OHVA 5K0UB 2VZQA 1UYYA 2ET1A 5GZFA 2MEV3 3BIEA 1G9CA 3WF2A 2RDQA 4GA9A 2WS92 2NP0A 2IC1A 2FDJA 2PHWA 5ABJA 1AUYA 3ZSLA 1NQJA 2YC0A 2RS31 3R05A 4HK9A 4Q4V1 3QOPA 4Y20B 3KM5A 4DXTA 4CXXA 3KT7A 3ZXAC 3C7OA 2OUHA 5J3UA 4UW3A 3KV5A 3WP3A 2UWCA 2DYCA 1W0PA 1Q8OA 1CONA 2MEV2 4XCBA 4DB5A 2I07B 4YW5A 1RUG1 1UZYA 5EZWA 3QLQA 4SLIA 4XE9A 1HLCA 2Y33A 2WZR3 5GKAC 3H8XA 4E8CA 1AYM1 2VZPA 3VDCA 1HQLA 4IV3A 4LBOA 1O7FA 1A78A 1W6OB 3AK0A 2VM9A 1POQA 1XNAA 3JXSA 4CP1A 4FOQA 2A6ZA 2QQOA 2E7QA 2R063 2QZ3A 3AM2A 4Q2FA 1GWKA 4TXWA 4NRQA 5AC93 3VDDA 3NAPB 1MS8A 5KHKA 4CDWA 2HWB3 1CJPA 4N53A 2EA7A 1F5JA 1UN1A 4YVSB 2WA4A 2WZR2 3O1PA 1PZ7A 3A21A 4ARXA 4UBGA 1DU3D 2K2SA 3LA2A 3MLKA 5FV3A 2ORXA 3LD8A 4Z1VA 1QJZA 2P3JA 5J48A 1RUH3 1UYZA 2B46X 2OQ6A 3X29B 3RZHA 5AVPA 4Q26A 1JU4A 2R062 4Y5TA 3SH3A 3UESA 3U75A 5ACA1 2JKBA 2TEPA 3N9PA 3HT1A 5T54A 5JPMB 4DFSA 5AC92 1OUXA 2SBAA 1ZZCA 2HWB2 3EYPA 5FYHA 3T1LA 2O8QA 2UYAA 2WAOA 3O0XA 1XXNA 3IB3A 4EV0A 2VL4A 2DVFA 2YBPA 3B3QE 4MGYE 3NJZA 4QAWA 2CV6A 4LA3A 1PO11 1ENQA 4QX1A 1J1LA 2B7YA 1H0BA 5FY8A 5FZIA 4PQ9A 3OGSA 4LK7A 1D4M1 3NW4A 2RDNA 1TEIA 3A22A 5L9VA 4XUTA 1MS1A 3VHPA 3BTAA 1AXZA 4BB3A 2E63A 5T3NA 3NQHA 1G9FA 3D82A 4YGCA 5FZOA 2VMIA 3K4ZA 2D97A 4R9DA 5EPAA 5BNNC 2RS51 4QD2A 4XF0A 1RMU1 3FX3A 3TEWA 2I2SA 4COUA 2WUHA 2ZJCA 1VRH3 3ZPOA 1X8MA 4QQHA 5E88A 5A33B 2BBAA 3AP6A 1AXYA 1FMD1 1IG3A 2BEOA 3HD8B 3PIGA 4XUOA 5F8PA 2W68A 3OPTA 4UI9L 4WVVA 5KHHA 3I3BA 2IXCA 1LB2A 2ZPXA 2OS2A 2AGSA 1BCXA 2WSUA 5F39A 1UWWA 1UKRA 2SLIA 4JGYB 5FZOB 1VRH2 5FIXA 4CEWC 4XJAA 1CVNA 3WR0A 3RZGA 1XE0A 3LB9A 3N3HA 5CYYA 1W03A 4MLOA 3H8OA 2E26A 1MVQA 1WCDJ 4AHWA 2JDPA 4M0NA 2HEWF 2ZHNA 3WDTA 3FN9A 2GC3A 1CPMA 3GZTB 3J7HA 4MUVA 4Q4X2 4UFIA 1F15A 4XQ4A 3URFA 1DGRN 2VTFA 2Z4FA 4LKDA 4B4PA 2LM3A 4HN1A 3NNLA 4MXVA 3MW2A 5CISA 2Y6KA 4UFHA 2PQSA 3VB9A 1CX4A 3KHCA 1ULDA 3IMMA 5DDJ3 4OQ8A 1D0HA 1JYIA 1ZZ6A 1REEA 3ZDSA 4FTBA 4NPMA 1OA2A 2ZMLA 1YJKA 1STMA 1KJLA 4EN7B 4QM8A 1TME1 1W3VA 2A71A 3I59B 5FZ8A 5KHIA 1EPWA 2BZDA 4IEOA 5DG2A 3SH4A 4XFCA 3SMHA 3QACA 4K3UA 2DVDA 2VULA 2W9XA 3RYPA 1KS5A 3NNJA 4HOOA 3WNMA 2YBKA 3PLQA 3DYMA 5DDJ2 1JXNA 1RUJ3 2JDZA 2ARAA 3HNMA 4LR4A 4P9GA 4UW5A 5L9RA 1C8M3 5I0SA 5JLVA 1HRV3 1WW4A 3T09A 1I5PA 1HXS1 2LTNA 3PJYA 1PNGA 1DGLA 3I54A 1SCRA 5DAQA 1YQ5A 4NR1A 1LHOA 1V6MA 2QQIA 3AKSA 1QJEA 4RL7A 4XBQA 4W6WA 1QJY3 4D6RA 4TZDA 1F4HA 1BEV3 1TNRA 5CNAA 4PI0A 3AX4A 3DGTA 1RUJ2 3HT2A 3S0MA 5JOYA 1BZWA 1C8M2 1NCRB 1PZ9A 2ADDA 1HRV2 1OSGA 1RHI1 2Y64A 3NVCA 4XW3A 1UZZA 2GP5A 3T08A 5FO8B 2W1WA 1W2OA 3LEKA 5GLWA 5HI0A 2NMOA 4JRAA 3U37A 3MUZ1 2QQLA 5JSPA 3J4UH 3HPNA 1CQ9A 3TN93 2ZBJA 1H2MA 4ZS2A 3GZEA 1ND3B 1HRI1 3ZXGA 4AHXA 1OMIA 2CGPA 1QJY2 1BEV2 3NSTA 1PGW1 4DNYA 3O1RA 2YU2A 4COVA 3H8RA 4IEPA 5IHRA 3SHRA 1T6BX 1J83A 1GSLA 3W5NA 3LSDA 3SEPA 1GLHA 2JB8A 3N7MA 5FY0A 3TN92 4AI2A 1SMVA 4ASMB 4OMCA 4A7KA 1B35C 2E9QA 4LHSA 3AJZA 4YNIA 3J7LA 4WVMA 1ENRA 2JKXA 3DEMA 3WINE 5DAXA 2XWJB 1NT0A 2CY6A 4I30A 1UNBA 1ZYBA 2J22A 2JDUA 1QJX3 1V6OA 3H7YA 2HLEA 4LEJA 4FPKA 4Q0QA 5I8TA 2NMNA 5LK7B 3PJQA 4AVAA 3H3LA 4NAMA 5FQ0B 4KG8A 2B42B 1DQ5A 3N9LA 5JAXA 1SPPB 2VOKA 3THPA 1JTZX 4P14A 1WW6A 1QJX2 1ULOA 1HIXA 2KM2A 2NM1A 4MGKE 4TLFA 3AZWA 4QPGC 4BQWA 2RS32 1OQ1A 4MHUA 3SLIA 3KZ4C 2GMEA 3ZN5A 2WFF3 1W2UA 2K46A 4JHZA 4AAXA 2GAUA 2RV9A 1YYNA 2XKPA 2XH6A 1VBB3 2GC2A 1MQTB 2DUOA 3NNGA 1RUG2 2CHHA 3EJKA 4HVRA 4IUGA 3CMGA 4Q29A 1YWKA 4DXRA 1AR81 1RUC3 4CDQB 4CDUA 3GJAA 4RSUA 5BV6A 1HDKA 2AREA 2EAKA 1AYM2 4URTA 5FY4A 1W9FA 3FBYA 2WFF2 4RS5C 5B2GB 5C3SA 2E31A 3R4UA 1IPKA 1VBB2 1WZXA 1F2NA 4UFKA 2JIGA 1LNSA 1C3HA 2DUQA 2X5IC 4HSJA 2CGNA 1DLCA 1UY1A 4F7ZA 2V5DA 2VOTA 3MO4A 3B00A 1O6UA 4BQYA 2CU5A 4Y1ZA 2HWF3 3ZXFA 2GNMA 5FCCA 2Q1ZB 1X82A 5L7OC 2XJUA 5FPLA 3VKNA 5KWRA 4AVBA 4MG2A 5CFDC 4GD4A 1UKGA 2VECA 3J7NA 3H1YA 4A44A 3SCFA 2FCUA 1RTVA 4FPJA 1W9SA 4A6OA 4BQ4A 5I8YA 5LCWL 1XYPA 2PLV1 2VUAA 2ZX4A 3WUDA 2XR4A 2W46A 2HWF2 1OF3A 3DPRB 2HWC1 5FAXA 2WZEA 2Q8DA 1W99A 5CA6A 3L9JT 1QIQA 3OBAA 3USUA 4GIQA 4JGZB 1H1AA 1SLTA 3POFA 2GZWA 1MS9A 2XLGA 4QB6A 5EJ3A 4Y4YA 2VTXA 2OT7A 2EAAA 5A32B 3DECA 5EJZB 4BOWA 3OEAA 1D4VB 2B5HA 5CEHA 4V2VA 3M3IA 4QQ2A 3TYJA 3IIIA 4JQRA 2O8OA 3K46A 3OEBA 1F4AA 5F1RA 3OD4A 3UKTA 4EN0A 2R041 5FZ1A 2RE9A 4GXLA 3TOJA 5L19A 1CAVB 2R7EB 2JIJA 3USUB 4EYUA 2CDPA 1RINA 2FCTA 2WR9A 2FMYA 1ZBE1 5DAWA 5FYTA 4XVHA 4DIQA 1KJRA 1OKOA 1OOPC 1YI9A 4P9YA 1S55A 1QY4A 4C91A 5DQ0A 4M01A 5HBAA 1VB2A 1YIPA 1Y4WA 3CZJA 4Z07A 3POIA 2DVAA 4K9SA 5FKCA 4CP9B 2MPFA 1NY71 3I4IA 2JDHA 4OI4A 1JYTA 1X9PA 4E4ZA 3LPFA 4XJWA 4JKKA 5IJRA 1FOD3 2OX0A 5FZ4A 5HCAA 3I2OA 3AL6A 2UU8A 3B01A 3MIEA 2FMDA 5C70A 4D3WA 2HBUA 4FTEA 4AG4A 4IW3A 5A1LA 3OTFA 4Z82A 3NJVA 4DEQA 3AXEA 4GH4C 4MV2A 1WMEA 2HJIA 5D1IA 2XJTA 3WQBA 3QCWA 3OGJA 2FZ1A 5F5AA 4FOWA 4BMEA 4DO0A 1FOD2 3CKHA 3D6EA 3RJRA 4F8AA 2F17A 2VCBA 3LA7A 4XPVA 1FAYA 4I2OA 1UW8A 3AP7A 2JDKA 5BNPA 4A4AA 3EXUA 2DCZA 5C5TA 1TME2 1M06G 1IPSA 4FQZA 4YW3A 2X8KA 1AYN1 3VBSC 4A6SA 2D43A 2HYXA 4BQXA 4NIGA 1QWRA 3MPPG 2J1EA 5IK8A 4OI1A 1CAXB 4AGVA 2ZEXA 2V73A 2ZX2A 3IWZA 4P9IA 3WG2A 2GC0A 1AR93 1YFYA 4BA6A 4YW1A 1CAWA 3KT4A 4I09A 3ZFFA 4DMIA 3C7HA 2MHFA 3ASIA 2VZSA 4HZFA 5K4LA 4QKFA 2QFEA 1VP6A 3MV11 1I3HA 3KQ4B 1PGSA 3ACLA 5A3WA 1SFPA 2AC1A 4DRVA 1ZBA1 1LOGA 4IERA 4AYUA 3T4VA 2WWJA 1XE8A 1AR92 4MVTA 2H0BA 1U5IA 4JKMA 5FFOC 3V64A 4RHV1 4QPGB 3THCA 2I74A 3BYWA 3LFMA 5CKQA 5ANNA 1O8SA 3RJ2X 1UO9A 5FJHA 3P5BA 2RS11 4BZ4A 5FWJA 1OLRA 2IFWA 3GYDA 4JTOA 5JDBA 5LZ6A 3OD0A 1J1TA 2V4VA 1QGLA 4QPWA 3ZFEC 3RNSA 3KQRA 4DXZA 1YQ6A 4EZHA 1Q56A 2VBPA 3FHIB 1ODNA 4OLLA 1XOYA 3M3QA 4M4RA 1RXFA 2GC1A 3K4DA 3B9IA 3WHTA 3U4XA 4EN8B 3V65A 1XNBA 1NCQA 2WRAA 3UETA 3O1TA 3ZYBA 4XUPA 3SH5A 4RR3C 4MO3M 1O3QA 3PUIA 1OPMA 3DL3A 1ENSA 5DABA 3ZYFA 1IHMA 4WM8A 2WS91 3WW2A 3POSA 5JSOA 3AZVA 3VBUB 4MXWA 4P9XA 3RYKA 2BNOA 2WWSA 4MADA 5D8AC 4B3NA 3CF6E 3FWEA 2BGOA 3QH7A 2MEV1 2ZACA 2PMWB 3W20A 4N43A 4IGPA 4JTNA 1ZREA 4CCJA 4IXLA 4MGZE 1J58A 1NG0A 1V6IA 3BODA 2EVXA 3PHMA 5LATA 3G7DA 2ZAHA 1Z0HA 2GNDA 1REDA 1QKQA 4QPIA 2XHKA 4XFFA 4FPGA 1H2KA 4P9JA 3CDZB 5CIRA 2GH8A 1F5FA 2VCAA 5A3UA 2JJ6A 1V6NA 2J1UA 2H6CA 1BHGA 3IPVB 1UXZA 2W5FA 3VBRA 5FYIA 2E6VA 1R1A3 2VOWA 1NA1B 4EJRA 3GCXA 2WZR1 4COZA 4OULA 2ERFA 3ZYHA 1C28A 3AP5A 3OYWB 4XCAA 1XC6A 2VE1A 2YGMA 3U78A 5FXXA 2R30A 1QOOA 1R083 3H0OA 2QJVA 3C7GA 3AYCA 2ARBA 2R061 4QPIB 3POEA 4WM7C 4K1YA 4JZRA 4CU7A 2WA3A 2EXJA 4XFAA 4YM3A 5AC91 1BXHA 1R1A2 2HWB1 3OJBA 2PTMA 3H50A 3WHUA 2UURA 4BE3A 4XQWA 5DXDA 1QOTA 3AVSA 1WMDA 1K5MA 1T6GC 1PVXA 2OPKA 4QU1A 2QBXA 2CWMA 1UU6A 1GWLA 1RUH1 1R082 2W1SA 4LLOA 4FPHA 4Q4Y3 5E89A 5EP9A 5D2AA 4A3ZA 2Y26A 5JWPA 1PX3A 4PDWC 1VBD3 5LA1A 5CFCC 4NAOA 4LUMA 4P9LA 1NZCA 3VBFC 1F35A 5IVJA 2GP3A 4K1ZA 1GKBA 1FV2A 2XOMA 4C1XA 1WGPA 1Z7S3 2WNVC 3MGUA 3S30A 3W9AA 1LGBA 1RUE3 4Q4Y2 3I49A 3JQXA 3POJA 3RMYA 3UKVA 2TNFA 3TWIA 2OZ6A 3ZFGC 3H9AA 3M3CA 4XACA 5CBLA 2BP6A 1GQGA 1BVP1 1LR5A 1VBD2 3MLJA 5T5JA 2LRPA 4W8JA 5FYMA 4LBJA 2WN3A 3H42B 3JD73 4JX0A 1JUIA 4URAA 3P3NA 5FP8A 3T2TA 1FPN3 1Y9MA 4D69A 1Z7S2 3JUUA 2Z2SB 3I2KA 3KF5A 5DPNA 4YZ5A 3KMHA 1RUE2 1BMV2 3MIHA 1JYXA 4ZY9A 1ZBE3 3FJSA 3ZYGA 4K40A 3ZX7A 2XL9A 2XQRA 1LU1A 2XJSA 2DTYA 1TQ5A 2YBSA 3I2JA 3JD72 3VZLA 5J98B 5FREA 4D0QA 4ZPIA 1VRH1 5F5IA 2OW4A 2VMHA 1FPN2 4HPKA 5ABJC 2P3KA 4FPEA 3ZVXA 2WNUB 3AP9A 5CKNA 5J1XA 1POV3 5F6KA 4Q4W3 3VBHB 1ZBE2 2B39A 1CR7A 1X7NA 5A7OA 2ENRA 4GKYA 2D3SA 4RQPA 4Y1UA 1ZRFA 3AYAA 2XVKA 4Y1XA 5DZGA 5F3EA 3VKOA 2WNEA 3O1VA 4P5HA 1JS9A 3T2PA 1H2NA 2QDNA 4FFHA 4EROA 1NYWA 3I2HA 4Q4W2 1PZ8A 4KG0A 3UYJA 1CAUB 1F9KA 2CGOA 4IV3C 5C3QA 3WW4A 2E53A 2ZXQA 1JZ6A 2XVGA 2VZ1A 3BOWA 3BCWA 3VDDC 4RQPB 3ETPA 4CDWC 4LO8A 4N53C 5EQUA 3POBA 2VOVA 5FYZA 5A7NA 1QEXA 4F3JA 3VD9A 5FY5A 5DDJ1 2VZVA 3DXUA 1JYWA 3DV8A 1FV3A 2XMLA 2AEZA 2WYSA 4CPBD 2WL1A 4CCKA 4S2FA 2PAKA 4QDSA 3ALQA 3CJXA 2OA2A 4N9IA 5B4XA 1DQ4A 3VKLA 5T55A 3M70A 3BTZA 1OUSA 3KHBA 1YEWA 2Z79A 3O0VA 1SQ4A 1AYN2 1ZRIA 2Y0OA 2CAUA 1VIWB 5LA0A 1LEMA 4HL0A 1KITA 4RGKA 1RUJ1 3BN6A 4RFRB 3ZYIB 5C8CA 2JG9A 2QQPA 3RZMA 4C8DA 1C8M1 1HRV1 2JEMA 3CL1A 4BWOA 1PK6A 3N9OA 4LE3A 3KGZA 4LBQA 2PA7A 1LOCA 1AJKA 4ARYA 3UJQA 3GXUA 2JENA 1W04A 4LITA 3E5UA 2QUOA 1YQ2A 1QQP3 4BCUA 3JCIA 3JB4C 1QJY1 4XFIA 2RJKA 2UWBA 1BEV1 2EXHA 5A1AA 1DZRA 4LQRA 2ZS6B 2PHFA 3CJIB 4I0WB 1UQXA 3AKPA 4S2GA 5FZFA 3VBOB 4IE7A 2JDAA 1EUUA 5K0UA 5FK8A 3TN91 1QQP2 5JXJA 1MACA 4U36A 5FBJA 1PK6B 1EV11 2D6LX 5F32A 2J1AA 1CD3G 4N9HA 3KS7A 1JI6A 4LMFA 2XBO3 5FZEA 4Y20A 2ZX0A 2G1MA 5JVVA 3WX5A 5GLZA 4YGEA 2ZKNA 2YPDA 2Y0IA 5FPZA 5LBEA 2HKXA 2Y60A 3LKJA 1ACCA 4YFWA 2XB6C 3EMRA 4AQTA 3QD6A 1VAKA 5C6CA 2WABA 3JBG3 4EWDA 3B93A 1TZOA 4I0AA 4X8NA 3ZMOA 1FI2A 3LSEA 2YROA 2XBO2 2ARXA 2DCKA 4IV1A 4QDQA 4UFLA 5C4WB 1QJX1 2ZEWA 1W6OA 3D0SA 3LFIA 3R4DB 4L2NA 5EFUA 4BLIA 4B29A 5GZCA 1DG6A 1E5SA 1LULA 1D2SA 1RIRA 2XGXA 4H2AA 4RA0A 4XJZA 4BQ1A 3JBG2 3PTRB 1QMJA 3NAPA 3T0DA 4E2GA 1CX1A 1VB4A 4YVSA 3WP5A 3BU7A 4BLJA 1UOGA 3VBFB 5C9AB 1UZWA 2X29A 1BVVA 5DG1A 4MGTA 3EQEA 2OZJA 3DYOA 4L97A 3J8F3 3LEIA 3N9QA 3C7FA 4NHXA 4DINB 4XUQA 4IV1B 3A23A 4XBLA 5JI7A 4YG0A 1DFQA 5JMCA 2WFF1 2CDOA 1KDKA 3L2YA 1VBB1 3Q9OA 4NPLA 2WDBA 4CEYB 5C8WA 4YW6A 1REFA 4IGOA 1HJFA 2Q4SA 3J8F2 4XF3A 2Q1FA 1RUC1 1UF2C 5FUIA 1YCIA 3FE5A 4QX0A 1RL3A 1BKZA 4KMQA 4NIDA 4FFGA 1YIFA 1IS3A 5LWBA 1TE1B 1O91A 1EP0A 3WP6A 3V0BA 3FMGA 2WWUA 5CKMA 5F7UA 2FDIA 4NOTA 1VBE3 3U1XA 4CP2A 1CWPA 3D5OA 3W59A 3KCCA 5JXHA 4UT5A 1X9TA 1S1AA 1IG0A 1H4HA 3CIHA 2LW8A 2HWF1 2DF7A 2YFUA 2BU9A 4FQ4A 4JDMA 3ZM8A 1CIYA 5FDBA 1GOGA 1RUH2 1E57A 2BJSA 4HKOA 4W50A 2N7GA 1H8TB 3G6JB 3I3EA 4Q1PA 1VBE2 2WQ4A 5A33A 2YB7A 5JZGB 1ZZBA 2DDUA 3RGBA 1S0IA 2FZ2A 1O4ZA 3NV4A 5EWSA 2JICA 1W06A 1IKQA 3ABZA 4AVTA 1LOFA 2VQAA 3RZKA 4OI0A 2FDFA 5E8AA 5FZ6A 2HEVF 3ITQA 2UWAA 4JGYA 4ZU4A 4DQAA 3NRUA 1QJU3 3L2HA 4FAGA 4ES9A 2PXJA 2HYKA 2BVBA 1L7LA 1RUI3 2Q30A 1H1MA 1T2XA 5E16A 3VHRA 3WSOA 1WUVA 5L9BA 1DF0A 2WN2A 3HOBA 3QBQA 3VKFC 1ZRRA 1BK1A 2P5BA 1CESA 3OCPA 4HETA 5IK4A 2LROA 2XLAA 4NUBA 3RPQA 1QJU2 5FZLA 2GN7A 4GMP3 5I93A 3V0AB 1WWYA 1V70A 1MS0A 4X6QB 1S0BA 1VMJA 1QXRA 4OHWA 2Q5TA 3I59A 2Q8CA 4HT1T 4BPZA 3P6BA 2VGDA 1SZBA 4BM8A 4XDPA 2GMMA 5IAVA 3VLBB 4L99A 4AWDA 2C6SA 4LJHA 1WA6X 3GCWA 4LNVA 5FUNA 4KWUA 2KXLA 1WCUA 1N47A 2BGPA 5ERLA 3LCPA 1FOD1 2XLFA 5CG9A 3KV9A 1W8TA 2R16A 5A7SA 4DUVA 4LHNA 1MZFA 3A0NA 1G9DA 4XXPA 4OCTA 5KXDA 2RG4A 2Y34A 5AFEA 4RD7A 5FOJB 5J96B 2VAUA 3VZMA 4QT6A 4TYSA 4W6YA 2YGLA 1NCRA 4AGGA 3BGAA 4J6GA 5G05L 5FYUA 2C9AA 2JG8B 1CZTA 5EXOA 2DVBA 2X09A 3ES4A 2OYZA 3ST7A 4QKNA 2VW0A 2ZKLA 1ND3A 2ZGRA 1DQ2A 3OUHA 2CAVA 2E51A 4YLZA 5H9RA 2XWBB 4YARA 4QX5A 3MHZA 4YGDA 4EZ4A 4AFBA 2HWE3 3PU3A 1LJ7A 3KWVA 5HV4A 4AI3A 4CSWA 5HCHA 5DUXA 2ZGPA 4O61A 4YYOA 5BPXA 1WLTA 1LHVA 1AR91 3KB5A 3M2MA 3O12A 1U12A 4OQ9A 1LECA 1OF4A 2OVUA 2VMFA 4YFZA 2G4IA 2EXIA 1M4WA 1O8PA 1RUF3 3NMBA 1DDLA 2HWE2 3T30A 1YQ8A 1W8HA 3AZZA 2NQYA 4BIOA 4PCRA 5TSWA 1EV13 1BK0A 3DKQA 3R0RA 3BTYA 3UGGA 3LDBA 3CNAA 4UWDA 1ZVFA 1KS4A 5A1FA 5LBFA 3VZNA 2VUJA 3VDBA 2PHRA 3ZYJB 5BNOC 2DWRA 3NV3A 1US2A 2WC2A 3ZSMA 4AEMA 3K4AA 4MZUA 3ZPYA 4CU8A 5FZCA 5GZGA 3CZUA 2A3WA 5F3GA 5KC6A 1RUF2 3BKZA 3RI9A 5FZBA 2BWAA 4HKLA 2WBKA 5FYCA 5FQ0A 1EV12 1SPPA 4WBBA 3WP4A 2R6QA 2WT1A 2L9LA 5GZDA 5KHJA 2YPJA 4P02B 1IGOA 4KWKA 1AHSA 3H3ZA 4YZ3A 4BXFA 4YZ2A 3KGLA 1W9TA 4EN6B 4ZXEA 2JXAA 4GWJA 4NIIA 1FYUA 3WG3A 3AB0A 3ES1A 3SQOA 3N7KA 4ORFA 1MQTA 2BVVA 2ES3A 2E33A 3AKQA 2C9KA 4TN7A 4XC9A 4A45A 3GBWA 4D94A 3K75B 4CDQA 1VAMA 2F6BA 4J1WA 1LHUA 5FO7B 3ZR6A 1E5HA 2UY9A 5JR2A 2XUMA 2ZZJA 2ZGOA 1ZM1A 5BNNA 3C8XA 1WLCA 1UPSA 2GSYA 3CEWA 5FLHA 1FT9A 4MH0E 4YZ1A 2VBBA 4H7MA 4FPFA 1H9WA 1PX4A 5DAVA 2ZTNA 3TRSB 5JUVA 5JOXA 4NN0A 2EIGA 4HANA 5DAPA 1DGRA 4GB33 2AH2A 2VZUA 1H6XA 1K12A 3GHMA 4LT5A 3KVAA 2WO7A 4CCOA 4XF9A 2I45A 2W39A 1O59A 3GALA 4M3CE 4JAAA 4UFMA 5BNPC 2R49A 2D93A 3QH6A 2FQPA 1DHKB 1ULPA 1VE0A 4FXGB 4BU2A 1GOHA 1AVBA 4XOGA 3DKWA 1Q3EA 5JI9A 5BNNB 4M3CF 4GJYA 2TUNA 4I3PA 1OKQA 4GB32 1OA4A 1N3QA 1NXD1 2ZHLA 4IE4A 2VO5A 3HN1A 3PMEA 2OPWA 1R1A1 5FZKA 5KC5A 3DPRA 3A4UA 3POWA 1A34A 2DCTA 2ZGNA 1VRBA 1N1VA 2J42A 2JDYA 2VD7A 1RUC2 3E6DA 1ULEA 5FPVA 3ZFFC 2YZ4A 4JGZA 1NUKA 1R081 2RJ2A 3MICA 3MDPA 2BERA 4H7LA 5EIYB 2GNTA 2R073 2A6YA 3ZXKA 3ZMNA 1DYOA 1YFUA 2HH9A 4HKWA 1LGCA 3E6BA 3N36A 3R6SA 5A32A 5LRSA 3ZIXA 3WNPA 1AR73 5C33A 2QE3A 2BWCA 3WQ0A 4RN5A 1WMFA 4KI5M 4H55A 2GU9A 2YHJA 4CEWB 1LENA 3AFGA 1DGWX 4QXHA 4E8DA 2D40A 3WDXA 3WDYA 4NE9A 2GALA 5FY7A 3ZXEA 2XJPA 4DZGA 4HG6B 4Q4Y1 5EV7A 4CDXC 5IVVA 3O1MA 2ARCA 2WAAA 4WVZA 2ZMNA 1CAVA 3N4MA 4AFCA 1VBD1 2B45X 5A6XA 1C57A 5FZ0A 1AR72 1F31A 1NE6A 2VXRA 4LKFA 5DZEA 1H8VA 1Z7S1 2QQNA 1OH3A 4XETA 1GNZA 1RUE1 2H6BA 4FSJA 1BMV1 3AJYA 4AQSA 2DV9A 4A2UA 4AQ2A 4CP9A 1NCQC 1TG7A 5IVEA 4DUWA 1LODA 1UMZA 3WG4A 1RYYA 3MV01 2FDHA 1HV1A 3FUQA 3JD71 5CAZA 4WM8C 1H9PA 3C7EA 3MW4A 4LIUA 1FPN1 2KA3A 2D6PA 4XBNA 4XEZA 4YVWC 4AQ6A 4XJUA 4SBVA 4O9EA 1J3PA 1QXJA 4KGGA 4XXAA 3VN4A 5K7PA 5FY1A 4QWNA 1ZNPA 4CCDA 3ZN6B 4BIFA 3I3MA 1TMF3 1W6QB 3CQOA 3MIFA 4N43C 4JC1A 3BB6A 3N9NA 3GJBA 1S0FA 4L0PA 2AENA 4BISA 2DUPA 1XU2A 3U14A 2VY0A 1J3QA 1OA3A 3M4FA 5F9TA 1Q5OA 1POV1 3LOBA 2D5HA 3KT1A 4Q4W1 1OFSA 1OFNA 2PAEA 2JDNA 4Q1RA 4ES8A 1TMF2 4K8FA 4Y22B 1W9YA 4N90A 2DTWA 3I7DA 1CAXA 2BOIA 5FLJA 2ZX1A 5LY2A 3VBRC 4AI1A 3WG1A 1HV0A 1GZCA 3WF0A 3C2UA 4JHTA 2P6HA 4YM2A 2NPIA 1N3OA 1JYVA 1DBNA 1KFXL 4MYEA 1RJ7A 4MGSA 1CZVA 3M8LA 4WV8A 4XFBA 4ASLA 5FMCA 2W08A 3LOIA 3SXWA 2RMU3 4XDOA 1B35B 3B94A 4NRMA 2PHXA 5FBZA 3VL8A 2VH9A 5LASA 4EN9B 3LQCA 5DUUA 4ISQA 2CTVA 2XONA 4HONA 1JN2P 2A6VA 3HEIA 1K5MC 4JV4A 4KNCA 4QPGA 4R9AA 4D7SA 4HLTA 3TBDA 1UY3A 1HQNA 2GDFA 2RMU2 3JU9A 1OT5A 5C5UA 2GNBA 5FOBB 3BUCA 3SITA 3WNXA 1GNHA 4AFAA 1LOAA 1KDMA 3N7JA 2VC9A 1PVC3 3PUSA 4CCCA 2FCVA 4PLOA 3VZJA 1YLLA 2VQ0A 5I91A 4FO9A 1OVSA 5A7WB 4A7YA 1SLIA 1QQP1 3H1MA 1OD5A 2WJSA 4AEDC 4S2HA 4B7EA 1HX6A 1UOBA 1OURA 5A3LA 1OLME 2WSVA 3ZKYA 4IGQA 3B9CA 4LO7A 1D0GA 2ADEA 1PVC2 2QQUA 3E5QA 4K8RB 4NHLA 2XJVA 3VBUA 2C1FA 4ZONA 2IXJA 4IQPA 4WZFA 3FC0A 3F95A 4X8PA 1LOBA 1G8WA 1SCSA 2XDVA 4RS5B 4UW6A 4IEWA 4P5YA 2VW1A 3ME2A 1XNKA 4OYUA 5FZDA 1NKGA 2XBO1 1QDOA 5DUVA 3TEXA 5LB6A 1OQDA 2X5IB 3O0WA 4OHXA 4ZS3A 2BDRA 3RZJA 4BXSV 4BQ2A 3PUAA 2AZ5A 4PQQA 2W2IA 2WLQA 3KV6A 5E1RA 1HB3A 1W8ZA 1UY0A 3GGLA 2YG0A 3JBG1 2X10A 1IQAA 2Q1MA 3C3VA 1KEXA 3IPVA 4FPYA 4NROA 5L7OB 1NA1A 1U5ZA 2XJQA 1O3RA 5CFDB 1ALYA 1W90A 1WCQA 1W6MB 3HNYM 3NKGA 5JIAA 3GHNA 1UIJA 5CVRA 5LRRA 3TNPB 3OYWA 3PNAA 2GMPA 2QZ2A 3WLUA 1MEC3 3M3OA 1NLSA 4UBHA 3CHXA 4Y5Z0 2VVDA 1MZEA 2ATFA 3FL7A 3J26N 3PDQA 3A7QA 1VBA3 2H0VA 3PUQA 1XNCA 3FLTA 1ZZ9A 1WW5A 4GAZA 2IXLA 4S2DA 3P1IA 1W2NA 1XRUA 2ZGMA 3VD7A 1JZ5A 4A3XA 1ND2C 1RXGA 2DVGA 4P00B 5C71A 4W6XA 4OVEA 3J8F1 4ZZ5A 5FP7A 1MEC2 2AUYA 2Y6JA 1N1TA 1W6NB 4CRQA 5T52A 3IZOA 4IESA 5A80A 1YO8A 4AI9A 4FOVA 1GQPA 1VBA2 3IT8A 1RUD3 4Y5SA 4Z92B 3NNMA 4GKXA 4LHKA 1IS6A 1W05A 1A6CA 3ILRA 5C8CC 2JG9C 1YFWA 2WT0A 5JPNB 1GZWB 4XZUG 3F2ZA 2QQMA 3RWKX 5FZ7A 1KGYA 2DU0A 3D8CA 4IEYA 3WF3A 1IS5A 3M7AA 5FXZA 4ZXKA 1G9BA 2EICA 2GH2A 3HIFA 1OOPB 1RUD2 3KD4A 4L9BA 2NYYA 4ONUA 5IFTA 2XPJA 1FXZA 4NMIA 4GH4A 2OUJA 1AF9A 1XQNA 1I5ZA 3K3NA 3UT0A 5FR3A 3WZ1A 1CPNA 1VBE1 2O1QA 4K21A 2NZ9A 2MNGA 4QB1A 4XHXA 5G04L 3MUY1 3O14A 5EYYA 3I3DA 3VGIA 3LDKA 3V0BB 3VHOA 4JKLA 1BBT3 3NV1A 4FTSA 1OBNA 4Y3OA 1W9WA 2ZAAA 4D6QA 5CZKA 2HBTA 4CP0A 1L7RA 4AW7A 5F5CA 4IEVA 1QH7A 2G9ZA 2R1DA 1XE7A 1H1IA 2E7TA 1UY4A 2LS6A 2WNUA 5J09A 4FP2A 1PGL2 1DZTA 4GH4B 1VLNA 3VBHA 4ZZ8A 3BU0A 4XF1A 1FX5A 4BK5A 4ZHNA 1WCSA 1BBT2 2JE7A 4INDA 4QKDA 5FKBA 1SEFA 1SBFA 3ECQA 2K9ZA 3UK9A 1AR63 5IUQA 1QJU1 2V72A 4AZZA 1W39A 3VBSB 5GM0A 2DBNA 4LO5B 3PVNA 4GULA 4NHKA 3ETQA 3WQ1A 3WW3A 1RUI1 3ZSKA 4Q8KA 1I9RA 1CAUA 4G9SB 4DEVA 3OUJA 3NNFA 4UYBA 4E4DX 2IXIA 1O3TA 1X33A 1Y9QA 3I2GA 4CCMA 1PO23 1WCKA 4NIAA 4KGQA 5B4NA 3WQ7A 3AFKA 4NHMA 4D6SA 2A3YA 3IKWA 5DMYA 1LHWA 3NAPC 3AZXA 4OUMA 1AR62 2VVEA 2PYTA 1LOEA 1JMUB 1SLCA 2DURA 3I2DA 4GMP1 4YVSC 1YJLA 2LUWA 1ZRCA 4G3YC 3LIHA 3SCGA 2WKKA
chains in the Genus database with same CATH topology
2QQOA 5CISA 2WNOA 1SPPB 3POGA 4LMFA 4LOTA 4LOSA 1SPPA 3POJA 3KQ4B 1SFPA 3POFA 3POEA 4LORA 5CKNA 3DEMA 3POBA 4GZ9A 2QQMA 1NT0A 2QQLA 3POIA 5CKMA 1NZIA 2QQKA 5CKQA 1SZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQO A;  5CIS A;  2WNO A;  1SPP B;  3POG A;  4LMF A;  4LOT A;  4LOS A;  1SPP A;  3POJ A;  3KQ4 B;  1SFP A;  3POF A;  3POE A;  4LOR A;  5CKN A;  3DEM A;  3POB A;  4GZ9 A;  2QQM A;  1NT0 A;  2QQL A;  3POI A;  5CKM A;  1NZI A;  2QQK A;  5CKQ A;  1SZB A; 
#chains in the Genus database with same CATH topology
 3UV9 A;  4DY5 A;  2AAC A;  2BRT A;  1UU4 A;  3KLS A;  1GYK A;  4XFG A;  1PO2 2;  1NOV A;  3IDC B;  5DN2 A;  2FDK A;  5FP9 A;  2VR4 A;  3ZYP A;  2BUK A;  4QGM A;  4XF4 A;  1JBC A;  2NLR A;  1NE4 A;  1PIV 3;  2PFW A;  2VW2 A;  3WF1 A;  4RR3 A;  3ORJ A;  4AED B;  4AXO A;  4LOS A;  5AVA A;  4AFD A;  1YXW A;  5ISL A;  2A6W A;  2W47 A;  5K9Y A;  3U4S A;  3ZFE B;  1OXC A;  1VBC 3;  4CA9 A;  4HVQ A;  1IZ3 A;  1GUI A;  3ZXD A;  3ZXL A;  3ZR5 A;  4R9B A;  3EBR A;  3AXD A;  2A73 B;  4QMA A;  5H9Q A;  2EIE A;  1EUT A;  1HKD A;  1PMH X;  3ELN A;  4IDZ A;  5DZF A;  3WW1 A;  1JZ8 A;  3OPZ A;  1PIV 2;  5JR7 B;  5JMO A;  1PMI A;  3S7E A;  3SCH A;  3HQU A;  3CJI A;  4CCE A;  2BYV E;  2JWP A;  5IAX A;  1UOJ A;  4LKE A;  3TB0 A;  3IBM A;  5IVC A;  3VBO A;  1VBC 2;  5KR7 A;  1WMX A;  5IWF A;  4RR3 B;  1SFY A;  2Q8E A;  4XIK A;  2ZMK A;  5KXC A;  2YY1 A;  5FMB A;  2EID A;  1ULG A;  4AOC A;  2ID4 A;  1Y7B A;  1ULF A;  1X8E A;  2VUC A;  4LKS A;  1U5Y A;  1FAT A;  2P2K A;  2HWE 1;  3MPB A;  1V9U 3;  5D8A B;  2WT2 A;  2Q8O A;  4EE2 A;  1UYP A;  1XNT A;  3ON7 A;  2YC2 A;  4XQD A;  2C26 A;  4B4Q A;  2D5F A;  4OFG A;  5JOZ A;  1ASJ 1;  2WYF A;  2PHD A;  2YMZ A;  2Z5W A;  4OZO A;  5FO9 B;  4FVV A;  2VNO A;  1C8N A;  2CYF A;  5KXE A;  4JGY C;  2PHL A;  1BJQ A;  1JZ4 A;  1NX9 A;  1RUF 1;  2P6C A;  1HW5 A;  3I2I A;  1V9U 2;  2D6N A;  1GQH A;  1WW7 A;  3T2Q A;  3R4S A;  2ZEZ A;  1PNF A;  2WQ8 A;  1RJ8 A;  5A3M A;  3BIW E;  1OH4 A;  5C4W A;  4AEK A;  5IVY A;  2D98 A;  3B69 A;  4TWT A;  1GU3 A;  4XUN A;  1ND2 B;  4YW4 A;  3RG0 A;  2W3J A;  1YFX A;  4K20 A;  4Q0S A;  1UMI A;  4Y26 A;  1W6P B;  3AMH A;  2YDE A;  5FMD A;  2EAL A;  2XKO A;  2VPV A;  4PDW A;  1HB2 A;  3ZDV A;  3ZIW A;  4ZU7 A;  3OBR A;  4KBZ A;  4XJ9 A;  3VBF A;  4MX3 A;  1LCL A;  2OQ7 A;  5C9A A;  4DUX A;  1AL2 3;  1SBE A;  3D0J A;  3ZOI A;  4COY A;  4MSV A;  4XJ8 A;  4WM7 B;  2ZZQ A;  2RVA A;  2W92 A;  2Q0A A;  1NXM A;  1U0A A;  3FBM A;  3MLL A;  4K7J A;  1UYX A;  3I2F A;  1TVG A;  5IAT A;  5F2S A;  2WIN B;  3DF0 A;  3V56 A;  4R8H A;  3SKV A;  2RJL A;  4CEY A;  4CCN A;  4DRR A;  2ZHK A;  4M4P A;  1R64 A;  5J36 A;  2A70 A;  5HCF A;  5KBF A;  4PBO A;  1AL2 2;  2OXB A;  4RFT 0;  2ZCW A;  3MYX A;  3D4K A;  5LBB A;  1B09 A;  4IET A;  4PDW B;  5APA A;  1OQE A;  5BYN A;  3RDI A;  5CFC B;  5HV0 A;  1APN A;  1E5I A;  1IOA A;  3SKJ E;  1CZS A;  5F6L B;  3VKM A;  3AVR A;  3DCQ A;  2WNV B;  3WV6 A;  4LO4 B;  5A3T A;  3OGG A;  3WOG A;  4QQL A;  4IE6 A;  3AC0 A;  2R32 A;  4QX3 A;  5F2W A;  3UGF A;  4CXY A;  5T5O A;  1HN0 A;  1NCR C;  3ZFG B;  3OB8 A;  2QKD A;  2VZT A;  4LHL A;  3SC7 X;  2RM2 3;  3AL5 A;  4GB3 1;  5J37 A;  1JUH A;  4FPL A;  4IEZ A;  1NLQ A;  4PIX A;  3Q8A A;  1ND3 C;  2WFP A;  5DUW A;  4NJ4 A;  1WD3 A;  4FPC A;  1H8T A;  3MIG A;  3B5L B;  3LPG A;  3GBG A;  3THD A;  5HXM A;  3MIB A;  2DCJ A;  1UL9 A;  4Y1Y A;  4LPL A;  5JZG A;  1SDW A;  2A75 A;  3PL0 A;  2RM2 2;  1QNW A;  2W0X A;  3INA A;  4Z8B A;  1JOP A;  2XG3 A;  4NPR A;  4NWV A;  1GWM A;  4YGB A;  5ABJ B;  2QDR A;  2VVF A;  1JW6 A;  2J1R A;  4AHY A;  5JCT A;  3S5Q A;  4OUE A;  3Q8B A;  3WXP A;  4X6R B;  3UL2 A;  1W2T A;  1V6K A;  3SNM A;  2C24 A;  2BFU S;  2R07 1;  1EAH 3;  3UNP A;  1LKN A;  5CG8 A;  2RDS A;  2DCY A;  4IEU A;  1AR7 1;  1V00 A;  4BHP A;  2EXK A;  3B7M A;  4YSF A;  5F3C A;  2BBV A;  2YYO A;  1Y3T A;  4XUR A;  3U11 A;  2XJR A;  2VXJ A;  2NN8 A;  3ILF A;  3SIS A;  1UMH A;  4IV3 B;  2J1S A;  3CU7 A;  4CUG A;  4D7Y A;  3U0Z A;  3V0A A;  1ZX5 A;  1W8N A;  1EAH 2;  3AMN A;  3IAQ A;  4Y4R A;  4DXS A;  2XVL A;  3MF6 A;  3VDD B;  3IIA A;  5T50 A;  4CDW B;  4N53 B;  1C4R A;  3LZZ A;  4COW A;  1MR5 A;  5LY1 A;  3Q8E A;  2RR1 3;  1MS5 A;  4GWN A;  1MQT C;  3RZZ A;  4WVW A;  1IS4 A;  1WLW A;  2RHP A;  2P3Y A;  2PAM A;  4UF0 A;  4YG3 A;  3JQW A;  1GZ9 A;  1ST8 A;  4CDQ C;  4MOA A;  1G6N A;  4EWE A;  4C0B A;  3UJO A;  2FDG A;  1RUI 2;  2R0F A;  1LRH A;  3ILN A;  4AE2 A;  1WBL A;  3AKR A;  4I0B A;  4HSL A;  1CIW A;  3ZSJ A;  2AEY A;  3OPW A;  2D44 A;  2RR1 2;  3IAP A;  3NO8 A;  1LAJ A;  1W0N A;  1S0E A;  3T3Y A;  5GLU A;  3WDU A;  1TMF 1;  3EO6 A;  3K51 A;  1GBG A;  4QX7 A;  2JG8 A;  3VL9 A;  3HN3 A;  3IDE A;  4FXK B;  1XYN A;  5SV8 A;  1Q8P A;  1W0O A;  2IZW A;  4UF0 B;  4PLM A;  3RMX A;  5C3P A;  3AMQ A;  2DBI A;  2J1T A;  4Q4X 3;  5FZH A;  3PIJ A;  3T0A A;  4CDU C;  1LTE A;  3OF1 A;  3BTX A;  1WD4 A;  3J7M A;  1K42 A;  1RVF 3;  4KL1 A;  5A3O A;  3VD3 A;  4UAP A;  3PU8 A;  3O1S A;  2BNN A;  3TEZ A;  4BH9 A;  2VMD A;  3FZ3 A;  3DPR C;  1WKY A;  4LIV A;  3BOP A;  3K48 A;  1GOF A;  2BOJ A;  1ENX A;  1MS4 A;  4QXK A;  4JGZ C;  1RGS A;  3H3U A;  2KR2 A;  1RVF 2;  3ZXJ A;  5KHG A;  2ZEY A;  2RMU 1;  4MGI E;  3BI3 A;  2QVS B;  3PMS A;  5FPB A;  5H9P A;  1BLZ A;  4OUS A;  4YG6 A;  2YFZ A;  1MVE A;  4L11 A;  3U07 A;  2FHR A;  2OKX A;  2A6X A;  2PHU A;  1S0J A;  3ACF A;  5KXB A;  1RC6 A;  1ASJ 3;  2VZR A;  2Y6F A;  3FFQ A;  5L36 A;  4R52 A;  5EYX A;  2P4E A;  1UD1 A;  3GM8 A;  4ATF A;  3N9M A;  4B7K A;  3S57 A;  4L92 A;  2XL7 A;  4ITC A;  3Q8F A;  3M3E A;  1LES A;  3OY8 A;  3GNE A;  1AJO A;  1ZRD A;  4GWM A;  4E9K A;  4LUL A;  3LEM A;  4N8M A;  1JH5 A;  3VD5 A;  3NV2 A;  1N1S A;  1ODM A;  3NKT A;  4Q0V A;  4AVS A;  1OHF A;  2G9F A;  1ASJ 2;  3ZYR A;  5LEJ A;  1PVC 1;  1P8J A;  1RUO A;  5FMO L;  3VDA A;  1JU3 A;  3FUO A;  3FLR A;  4CPB A;  5CAD A;  3ACH A;  2AR6 A;  3PVE A;  4HK8 A;  4XDQ A;  4AHZ A;  5J7M A;  2WO1 A;  4OZX A;  1O5U A;  4XAE A;  1GV9 A;  4Q0P A;  4UXA A;  5FZ9 A;  1L3J A;  1K3I A;  3W21 A;  3OY8 B;  2WII B;  4E27 A;  4O7X A;  2YUE A;  1GP6 A;  4QQP A;  3MID A;  1H30 A;  4BDV B;  3K77 A;  4CXW A;  2F4L A;  4QPY A;  5FP4 A;  4JCK A;  1XND A;  3CBN A;  3RQ0 A;  2HWD 3;  2ET7 A;  2QQW A;  1SHW B;  1X36 A;  3LGR A;  4PLN A;  1OLQ A;  4CYD A;  1GIC A;  1KXG A;  5FY9 A;  1COV 1;  1SLA A;  5I8S A;  3KF3 A;  1HB1 A;  1C1F A;  2P34 A;  2O0O A;  2VU9 A;  1BQP A;  4PI2 A;  4LLF A;  4LOT A;  3ACG A;  3EHK A;  2ZGQ A;  2X53 S;  2HWD 2;  3HBZ A;  4P08 A;  4Y24 A;  3OGV A;  3AYD A;  4OHY A;  1EPZ A;  4DY3 A;  4QM9 A;  2FBE A;  2OII A;  1ZZ8 A;  5LEK A;  2VBD A;  2TBV A;  4D8M A;  3P3P A;  3T2O A;  4PIZ A;  3A0K A;  2RS3 3;  4Q4V 3;  1H6Y A;  2BFU L;  2Z69 A;  4CE8 A;  3IDB B;  1GNY A;  1PM7 A;  2VZO A;  3AMM A;  3B02 A;  1MEC 1;  4XZP A;  5CB7 A;  4HXC A;  4PHZ A;  5A70 A;  5L73 A;  1DLL A;  1SAC A;  1DQ1 A;  1HQW A;  2C5D A;  1QH6 A;  1VAV A;  1VBA 1;  3AKT A;  4I01 A;  4A42 A;  3THT A;  1RUG 3;  4DPN A;  3MFA A;  1UIK A;  1F8V A;  4CEW A;  4WVM B;  1UY2 A;  5FMO S;  1XJA A;  3RFR A;  4Q4V 2;  5F37 A;  2D7F A;  1QXP A;  1S2K A;  2BNM A;  4ZKT B;  1AYM 3;  2YC4 A;  2ZX3 A;  4E2Q A;  5C7G A;  3WCR A;  2IXH A;  2ETE A;  4FT8 A;  5H9S A;  1NLR A;  4AVV A;  1Q43 A;  3WDW A;  2K0G A;  1WBF A;  1O4Y A;  1CN1 A;  4XMA A;  1OC1 A;  1RUD 1;  2PQQ A;  3PUR A;  5FXW A;  5I0T A;  1S4C A;  1S0G A;  2IFR A;  1IKP A;  3POY A;  4GWI A;  4NVP A;  3IM0 A;  4XMI A;  5GZE A;  3TNQ A;  2W1Q A;  2ZGT A;  2D6K A;  2DFB A;  4QX8 A;  4CVU A;  3GBF A;  1ZZ7 A;  3RVH A;  1UPI A;  2IVI B;  1JOD A;  1SFN A;  2R0H A;  4PIY A;  2VG9 A;  1UU5 A;  4KH9 A;  1PMJ X;  4FPO B;  1PM4 A;  5ACA 3;  2B9V A;  1LHN A;  1Q8Q A;  4E4S A;  1S0C A;  3GZU C;  4ATE A;  4U2A A;  1PHM A;  2R07 2;  3WD5 A;  1LU2 A;  4HBN A;  5GLT A;  4B4R A;  4KWL A;  1TNF A;  1OPO A;  2HEY F;  4NO4 A;  2ZGK A;  3VBU C;  3O1O A;  1PGL 1;  3HWJ A;  2V5Y A;  4H14 A;  4IL7 A;  2AYH A;  4PF1 A;  4JDO A;  1YHF A;  3MEP A;  1PO1 3;  5GAL A;  4CDU B;  3S6P A;  3K2O A;  1W8O A;  3MBW A;  1BBT 1;  3PTY A;  1W6Q A;  3ZN6 A;  2BGC A;  4A41 A;  4C0H A;  5ACA 2;  1JOJ A;  2ZGL A;  1J59 A;  1URX A;  2KD7 A;  1VPH A;  1W3X A;  3KV4 A;  4BMB A;  3D3A A;  1D4M 3;  3E6C C;  1JOB A;  1R09 1;  4NWW A;  5FPA A;  5IT6 A;  1DGW A;  1V6L A;  2B8M A;  3H1W A;  1C1L A;  1PO1 2;  3APB A;  1QNY A;  2VUD A;  4MET A;  2RS5 3;  1VMH A;  2VQT A;  2XHN A;  4LXL A;  4O65 A;  1RMU 3;  4Y22 A;  4YW7 A;  1AR6 1;  2PHT A;  4IE5 A;  1NA1 C;  1D4M 2;  5FYS A;  1UX7 A;  2IUW A;  2P37 A;  4LUK A;  2C0Z A;  3O5S A;  2JD4 A;  2W1U A;  3I8T A;  5A7Q A;  5BNO A;  4BQ3 A;  1FMD 3;  4OMD A;  3ENR A;  3MW3 A;  2WLP A;  1PO2 1;  1Q8S A;  2RS5 2;  1RMU 2;  1NAE A;  4QPI C;  1B35 A;  4H3W A;  5FYY A;  3KSC A;  2JB4 A;  5D21 A;  2CL2 A;  3NJX A;  1N3P A;  3PVO A;  3T4H B;  5BNQ A;  2A5Z A;  1S0D A;  3MF9 A;  1OI6 A;  5LBC A;  3NJY A;  5F3I A;  1FMD 2;  2GN3 A;  1UZV A;  4FBF A;  4YRD A;  1K45 A;  4V1P A;  1MZ5 A;  1DQ6 A;  3VV1 A;  4GQ7 A;  4DS0 A;  3K3O A;  1LED A;  4FI9 A;  3LF7 A;  4XIO A;  2W52 A;  1QOS A;  1W8U A;  5FYV A;  5BNO B;  3WCS A;  3T1M A;  3RYR A;  1PIV 1;  2QNK A;  3OSD A;  2YV8 A;  2BQP A;  3Q8C A;  1NZI A;  2DU1 A;  4XIL A;  1YQC A;  1XPW A;  3I97 A;  4LBQ D;  4M00 A;  1CGP A;  4QKB A;  1O5L A;  1VBC 1;  4UFJ A;  5A6Z A;  5FPX A;  4TLG A;  1XSR A;  2PN5 A;  4LBK A;  3WNL A;  4TSV A;  4DOU A;  4G4F A;  2WO3 A;  5A7W A;  2P1B A;  1TME 3;  1YRZ A;  1L7Q A;  4W65 A;  4KU8 A;  3POG A;  4M3C A;  1MS3 A;  5FRA A;  1GP4 A;  4AF9 A;  3O1U A;  5FYB A;  2C4X A;  2W95 A;  5BXX A;  1J3R A;  4GJZ A;  5IW0 A;  1CJD A;  4Q5O A;  5C3O A;  4AVC A;  4D7T A;  1O4T A;  1HXS 3;  2WZ8 A;  3OOX A;  3ZSE A;  3NL1 A;  1V0A A;  1C5H A;  2VOX A;  4EWA A;  1U5X A;  2E7A A;  2E32 A;  2VTX J;  4ZU5 A;  1N1Y A;  4KQ7 A;  4Q0U A;  4RS5 A;  2X05 A;  3OBZ A;  3FLP A;  4FOY A;  1KD7 A;  4LBM A;  1V9U 1;  4PT6 A;  3ZKU A;  1XU1 A;  3CLP A;  2WNU C;  2ILM A;  4PBP A;  2VJX A;  2X5I A;  4QX2 A;  4M3C B;  1RHI 3;  5LW9 A;  3JZV A;  4J25 A;  3VBH C;  1I6X A;  1W8W A;  1HXS 2;  1WLD A;  4WZC A;  4UOJ A;  4BYY A;  4IEX A;  3PUH A;  3LAG A;  2QCS B;  1W28 A;  1E5R A;  5LA2 A;  4QGL A;  3E97 A;  1HRI 3;  3HBK A;  4IEQ A;  5L7O A;  1UX6 A;  1VR3 A;  5BNP B;  3UGH A;  3GZA A;  5FZG A;  5CFD A;  2IWG B;  1W6M A;  1AL0 G;  3RWN A;  4C90 A;  1RHI 2;  3OG2 A;  3RRD A;  2QQV A;  3FFZ A;  1COV 3;  4O9G A;  1GAN A;  4CDX A;  5A6Q A;  5HCB A;  1HRI 2;  1CAW B;  1YNA A;  3KCY A;  4LO6 B;  3ZN4 A;  1VMF A;  4RQP C;  3PVB B;  4CTE A;  1O3S A;  3VHN A;  3ZFF B;  1PGW 2;  2EIB A;  3LA3 A;  3M1H A;  4NHY A;  2WNO A;  1AL2 1;  1S2E A;  1EYB A;  1COV 2;  1POV 0;  4RGG A;  1LGN A;  4LE4 A;  3WT3 A;  1W6N A;  3I3Q A;  1X50 A;  3BVC A;  1MPX A;  1J84 A;  3DXT A;  1GMM A;  1GFF 2;  2R1B A;  3USS A;  2BPA 2;  4AR2 A;  4AAP A;  1JZ3 A;  4CDX B;  2F4P A;  2YXS A;  5HXV A;  1GZW A;  4CUC A;  4Z2A A;  4QXB A;  5FXV A;  4YVW A;  2J1V A;  2Y38 A;  2Y6G A;  2O14 A;  4YPJ A;  3ATG A;  3WUC A;  2A7A A;  4EQV A;  5FZ3 A;  4V2W A;  5E6H A;  2P17 A;  2QTW B;  2CSG A;  1OOP A;  2XUE A;  3E5X A;  4QGN A;  4FAH A;  4OI2 A;  3AP4 A;  5EJ1 B;  2WZP P;  3BAL A;  1XBF A;  4LBN A;  2ORZ A;  3CJI C;  1AX0 A;  1NCQ B;  2VZ3 A;  4JRL A;  3VBO C;  4CUB A;  1BYH A;  2RM2 1;  2WO2 A;  5LA9 A;  1AR8 3;  2RDR A;  4B1M A;  3N35 A;  3N7L A;  1FNZ A;  4WM8 B;  3U10 A;  4YM1 A;  4BQ5 A;  1RUN A;  1PK6 C;  1GZT A;  2J7M A;  4E2S A;  5IFP A;  1D7P M;  3CO2 A;  4YVW B;  4AL9 A;  2WQZ C;  3VD4 A;  3GF6 A;  1DIW A;  3T0B A;  4XFH A;  4MXW B;  5IVF A;  4R4Z A;  5I0U A;  1Y43 B;  1YI7 A;  2B4K A;  1JHN A;  2W91 A;  1ONA A;  3OBT A;  3MI8 A;  3VZO A;  1UCX A;  3ZLI A;  1JYN A;  1AX2 A;  1G86 A;  3LE0 A;  4N43 B;  1AR8 2;  1EY2 A;  4M0H A;  1DZQ A;  4RGA A;  2XQX A;  3MFC A;  1H4G A;  3WNO A;  1A3K A;  5FP3 A;  5IK5 A;  5F5Q A;  1NQD A;  4KU7 A;  2W94 A;  4YZ4 A;  1XSQ A;  4E4H A;  3IDA A;  3OGR A;  5K0U C;  5FTT C;  3O7O A;  2VMC A;  3VBS A;  1VAL A;  2B9U A;  4QB2 A;  2CWS A;  2ZOE B;  4XHB A;  4AI8 A;  4AGR A;  1EAH 1;  5C4W C;  1UOF A;  3MZH A;  2CNA A;  4KWJ A;  2PLV 3;  4N7U A;  1R09 3;  2BV4 A;  2EF6 A;  3VBR B;  3HQR A;  3TAY A;  1A8D A;  4YM0 A;  2HWC 3;  4RYD A;  4UW4 A;  3ROU A;  4Q27 A;  1C5I A;  1YC6 1;  4YW2 A;  1A8M A;  4AI0 A;  4JDN A;  4MHR A;  5JXI A;  3DYP A;  5C9A C;  1FNY A;  2A3X A;  1WA4 A;  1IQD C;  3E1F 1;  3HMY A;  1HN1 A;  2PLV 2;  4FCA A;  4QQO A;  2D3P A;  1R09 2;  1AX1 A;  3LDR A;  4NIH A;  4IV1 C;  2V09 A;  1OLM A;  4JVA A;  1V6J A;  2HWC 2;  3RS6 A;  1SLB A;  2PEL A;  1K5M B;  2ZAB A;  2ZHM A;  3WF4 A;  3HQX A;  5GLV A;  4AFM A;  4CEY C;  1SDD B;  3DUI A;  2D6O X;  2RR1 1;  4KBB A;  3VZK A;  4AED A;  1VJ2 A;  2ZGU A;  5FJK A;  4F83 A;  1JZ2 A;  2R04 3;  5M0T A;  3LWC A;  3JB8 A;  3ZFE A;  3HVD A;  2QQJ A;  4PJY A;  5A7P A;  5K8S A;  1MZ6 A;  5FLI A;  1JZ7 A;  5EHD A;  4R4X A;  5FZA A;  4AK3 A;  1KRI A;  2UYB A;  4LTA A;  4FP3 A;  2VNV A;  5A3P A;  2ZGS A;  5HPO A;  4C1W A;  1R1Z A;  1ULC A;  1G9A A;  4XAB A;  3S5A A;  4CZS A;  4XTP A;  3W5M A;  2P3I A;  1K5J A;  5AFB A;  2JDM A;  4ISR A;  2R04 2;  2VCM A;  4ASK A;  2G9G A;  4HMZ A;  3WDV A;  1SG3 A;  3IMN A;  5JXG A;  1SBD A;  2XXZ A;  4MGQ A;  1DYK A;  4N7I A;  3RZL A;  5FUP A;  1HJG A;  4BK4 A;  4Q4X 1;  1XYO A;  5T5P A;  1ZA4 A;  1H8T C;  1AZD A;  1Y9G A;  1GR3 A;  1RVF 1;  1ZA7 A;  5D8A A;  3WNK A;  2Y6L A;  4A7Z A;  4BJ0 A;  5C3R A;  5JZG C;  1DYP A;  1NY7 2;  1IPJ A;  4LBL A;  2VNG A;  1RIT A;  3UKN A;  5I0D A;  4HVO A;  5JSR A;  2V4A A;  2VMG A;  2ZA9 A;  2VCC A;  1QDC A;  3KVB A;  1JHJ A;  1YUD A;  3DN7 A;  4HPK B;  5FK7 A;  5GJ6 A;  1JYC A;  1Z78 A;  2IVJ A;  1QHD A;  3ACI A;  3KCX A;  4PF5 A;  5BUV A;  4GAL A;  5I0R A;  3HR9 A;  4CU9 A;  1AYN 3;  4XYX A;  3RI8 A;  1W2A X;  2VME A;  3WVJ A;  2YU1 A;  4K6B A;  1ND2 A;  2JEC A;  4L8Q A;  1S2B A;  3HAG A;  4XTM A;  1W6P A;  5A6Y A;  2UY8 A;  4QHO A;  2Y6H A;  5FZM A;  3HJR A;  1Q8V A;  5FPU A;  3H7J A;  5LK5 A;  2DFC A;  4Y1V A;  1LOF C;  1UXX X;  3H8U A;  4QHZ A;  2A1X A;  2VQU A;  2Z42 A;  3IN9 A;  3W58 A;  5JIU A;  5JOW A;  3TEY A;  3LIG A;  3WEZ A;  5IVB A;  4TTG A;  3SEE A;  2FD8 A;  1SLL A;  4CU6 A;  1ZBA 3;  3AZY A;  1G7Y A;  4WM7 A;  1W8F A;  4HFS A;  4Q8L A;  5SV5 A;  2JX9 A;  3OUI A;  4B1L A;  5BY5 A;  3WNN A;  4RHV 3;  1GP5 A;  4FFF A;  3NWK A;  4YWA A;  4QXC A;  5A3N A;  3AYE A;  5ANQ A;  3FHA A;  2RS1 3;  2JE8 A;  4ET7 A;  5IK7 A;  1RB8 G;  3AMP A;  1QF3 A;  4QHB A;  2IXK A;  1UZ0 A;  3GDB A;  1ZBA 2;  1US3 A;  5CFC A;  4Y33 A;  5IYY A;  2QQK A;  2JD9 A;  3RSJ A;  1DCS A;  4Z2W A;  1QJF A;  4JQT A;  4QU2 A;  5CU1 A;  5T5L A;  4RHV 2;  4CUA A;  4J1X A;  5C8C B;  2JG9 B;  2WNV A;  2BTV C;  4OHZ A;  1HB4 A;  3S7I A;  4NRP A;  1OD3 A;  1XB9 A;  2RS1 2;  4B8E A;  2Y8K A;  4LBQ B;  3HNB M;  4AEJ A;  3ZFG A;  2W87 A;  4GMP 0;  1DQ0 A;  2HWD 1;  3WY6 A;  1H2L A;  2JG8 C;  4FFI A;  1OVP A;  2G19 A;  3EB7 A;  3J9S A;  4IE0 A;  4I3G A;  4XAA A;  3ZO0 B;  1AXK A;  1UAI A;  4LA2 A;  4W4Z A;  2LAL A;  1D2Q A;  1QU0 A;  1KQR A;  2D6M A;  2WS9 3;  4LOR A;  4R9C A;  4GZ9 A;  3VUO A;  3BPZ A;  4P9W A;  4QDR A;  3BPS A;  4CCL A;  1DP0 A;  4HN0 A;  3FHQ A;  4LK6 A;  4I02 A;  1KFU L;  5FWE A;  1I1E A;  2D3R A;  2VNR A;  2BW8 A;  2JE9 A;  3LEG A;  4OHV A;  5K0U B;  2VZQ A;  1UYY A;  2ET1 A;  5GZF A;  2MEV 3;  3BIE A;  1G9C A;  3WF2 A;  2RDQ A;  4GA9 A;  2WS9 2;  2NP0 A;  2IC1 A;  2FDJ A;  2PHW A;  5ABJ A;  1AUY A;  3ZSL A;  1NQJ A;  2YC0 A;  2RS3 1;  3R05 A;  4HK9 A;  4Q4V 1;  3QOP A;  4Y20 B;  3KM5 A;  4DXT A;  4CXX A;  3KT7 A;  3ZXA C;  3C7O A;  2OUH A;  5J3U A;  4UW3 A;  3KV5 A;  3WP3 A;  2UWC A;  2DYC A;  1W0P A;  1Q8O A;  1CON A;  2MEV 2;  4XCB A;  4DB5 A;  2I07 B;  4YW5 A;  1RUG 1;  1UZY A;  5EZW A;  3QLQ A;  4SLI A;  4XE9 A;  1HLC A;  2Y33 A;  2WZR 3;  5GKA C;  3H8X A;  4E8C A;  1AYM 1;  2VZP A;  3VDC A;  1HQL A;  4IV3 A;  4LBO A;  1O7F A;  1A78 A;  1W6O B;  3AK0 A;  2VM9 A;  1POQ A;  1XNA A;  3JXS A;  4CP1 A;  4FOQ A;  2A6Z A;  2QQO A;  2E7Q A;  2R06 3;  2QZ3 A;  3AM2 A;  4Q2F A;  1GWK A;  4TXW A;  4NRQ A;  5AC9 3;  3VDD A;  3NAP B;  1MS8 A;  5KHK A;  4CDW A;  2HWB 3;  1CJP A;  4N53 A;  2EA7 A;  1F5J A;  1UN1 A;  4YVS B;  2WA4 A;  2WZR 2;  3O1P A;  1PZ7 A;  3A21 A;  4ARX A;  4UBG A;  1DU3 D;  2K2S A;  3LA2 A;  3MLK A;  5FV3 A;  2ORX A;  3LD8 A;  4Z1V A;  1QJZ A;  2P3J A;  5J48 A;  1RUH 3;  1UYZ A;  2B46 X;  2OQ6 A;  3X29 B;  3RZH A;  5AVP A;  4Q26 A;  1JU4 A;  2R06 2;  4Y5T A;  3SH3 A;  3UES A;  3U75 A;  5ACA 1;  2JKB A;  2TEP A;  3N9P A;  3HT1 A;  5T54 A;  5JPM B;  4DFS A;  5AC9 2;  1OUX A;  2SBA A;  1ZZC A;  2HWB 2;  3EYP A;  5FYH A;  3T1L A;  2O8Q A;  2UYA A;  2WAO A;  3O0X A;  1XXN A;  3IB3 A;  4EV0 A;  2VL4 A;  2DVF A;  2YBP A;  3B3Q E;  4MGY E;  3NJZ A;  4QAW A;  2CV6 A;  4LA3 A;  1PO1 1;  1ENQ A;  4QX1 A;  1J1L A;  2B7Y A;  1H0B A;  5FY8 A;  5FZI A;  4PQ9 A;  3OGS A;  4LK7 A;  1D4M 1;  3NW4 A;  2RDN A;  1TEI A;  3A22 A;  5L9V A;  4XUT A;  1MS1 A;  3VHP A;  3BTA A;  1AXZ A;  4BB3 A;  2E63 A;  5T3N A;  3NQH A;  1G9F A;  3D82 A;  4YGC A;  5FZO A;  2VMI A;  3K4Z A;  2D97 A;  4R9D A;  5EPA A;  5BNN C;  2RS5 1;  4QD2 A;  4XF0 A;  1RMU 1;  3FX3 A;  3TEW A;  2I2S A;  4COU A;  2WUH A;  2ZJC A;  1VRH 3;  3ZPO A;  1X8M A;  4QQH A;  5E88 A;  5A33 B;  2BBA A;  3AP6 A;  1AXY A;  1FMD 1;  1IG3 A;  2BEO A;  3HD8 B;  3PIG A;  4XUO A;  5F8P A;  2W68 A;  3OPT A;  4UI9 L;  4WVV A;  5KHH A;  3I3B A;  2IXC A;  1LB2 A;  2ZPX A;  2OS2 A;  2AGS A;  1BCX A;  2WSU A;  5F39 A;  1UWW A;  1UKR A;  2SLI A;  4JGY B;  5FZO B;  1VRH 2;  5FIX A;  4CEW C;  4XJA A;  1CVN A;  3WR0 A;  3RZG A;  1XE0 A;  3LB9 A;  3N3H A;  5CYY A;  1W03 A;  4MLO A;  3H8O A;  2E26 A;  1MVQ A;  1WCD J;  4AHW A;  2JDP A;  4M0N A;  2HEW F;  2ZHN A;  3WDT A;  3FN9 A;  2GC3 A;  1CPM A;  3GZT B;  3J7H A;  4MUV A;  4Q4X 2;  4UFI A;  1F15 A;  4XQ4 A;  3URF A;  1DGR N;  2VTF A;  2Z4F A;  4LKD A;  4B4P A;  2LM3 A;  4HN1 A;  3NNL A;  4MXV A;  3MW2 A;  5CIS A;  2Y6K A;  4UFH A;  2PQS A;  3VB9 A;  1CX4 A;  3KHC A;  1ULD A;  3IMM A;  5DDJ 3;  4OQ8 A;  1D0H A;  1JYI A;  1ZZ6 A;  1REE A;  3ZDS A;  4FTB A;  4NPM A;  1OA2 A;  2ZML A;  1YJK A;  1STM A;  1KJL A;  4EN7 B;  4QM8 A;  1TME 1;  1W3V A;  2A71 A;  3I59 B;  5FZ8 A;  5KHI A;  1EPW A;  2BZD A;  4IEO A;  5DG2 A;  3SH4 A;  4XFC A;  3SMH A;  3QAC A;  4K3U A;  2DVD A;  2VUL A;  2W9X A;  3RYP A;  1KS5 A;  3NNJ A;  4HOO A;  3WNM A;  2YBK A;  3PLQ A;  3DYM A;  5DDJ 2;  1JXN A;  1RUJ 3;  2JDZ A;  2ARA A;  3HNM A;  4LR4 A;  4P9G A;  4UW5 A;  5L9R A;  1C8M 3;  5I0S A;  5JLV A;  1HRV 3;  1WW4 A;  3T09 A;  1I5P A;  1HXS 1;  2LTN A;  3PJY A;  1PNG A;  1DGL A;  3I54 A;  1SCR A;  5DAQ A;  1YQ5 A;  4NR1 A;  1LHO A;  1V6M A;  2QQI A;  3AKS A;  1QJE A;  4RL7 A;  4XBQ A;  4W6W A;  1QJY 3;  4D6R A;  4TZD A;  1F4H A;  1BEV 3;  1TNR A;  5CNA A;  4PI0 A;  3AX4 A;  3DGT A;  1RUJ 2;  3HT2 A;  3S0M A;  5JOY A;  1BZW A;  1C8M 2;  1NCR B;  1PZ9 A;  2ADD A;  1HRV 2;  1OSG A;  1RHI 1;  2Y64 A;  3NVC A;  4XW3 A;  1UZZ A;  2GP5 A;  3T08 A;  5FO8 B;  2W1W A;  1W2O A;  3LEK A;  5GLW A;  5HI0 A;  2NMO A;  4JRA A;  3U37 A;  3MUZ 1;  2QQL A;  5JSP A;  3J4U H;  3HPN A;  1CQ9 A;  3TN9 3;  2ZBJ A;  1H2M A;  4ZS2 A;  3GZE A;  1ND3 B;  1HRI 1;  3ZXG A;  4AHX A;  1OMI A;  2CGP A;  1QJY 2;  1BEV 2;  3NST A;  1PGW 1;  4DNY A;  3O1R A;  2YU2 A;  4COV A;  3H8R A;  4IEP A;  5IHR A;  3SHR A;  1T6B X;  1J83 A;  1GSL A;  3W5N A;  3LSD A;  3SEP A;  1GLH A;  2JB8 A;  3N7M A;  5FY0 A;  3TN9 2;  4AI2 A;  1SMV A;  4ASM B;  4OMC A;  4A7K A;  1B35 C;  2E9Q A;  4LHS A;  3AJZ A;  4YNI A;  3J7L A;  4WVM A;  1ENR A;  2JKX A;  3DEM A;  3WIN E;  5DAX A;  2XWJ B;  1NT0 A;  2CY6 A;  4I30 A;  1UNB A;  1ZYB A;  2J22 A;  2JDU A;  1QJX 3;  1V6O A;  3H7Y A;  2HLE A;  4LEJ A;  4FPK A;  4Q0Q A;  5I8T A;  2NMN A;  5LK7 B;  3PJQ A;  4AVA A;  3H3L A;  4NAM A;  5FQ0 B;  4KG8 A;  2B42 B;  1DQ5 A;  3N9L A;  5JAX A;  1SPP B;  2VOK A;  3THP A;  1JTZ X;  4P14 A;  1WW6 A;  1QJX 2;  1ULO A;  1HIX A;  2KM2 A;  2NM1 A;  4MGK E;  4TLF A;  3AZW A;  4QPG C;  4BQW A;  2RS3 2;  1OQ1 A;  4MHU A;  3SLI A;  3KZ4 C;  2GME A;  3ZN5 A;  2WFF 3;  1W2U A;  2K46 A;  4JHZ A;  4AAX A;  2GAU A;  2RV9 A;  1YYN A;  2XKP A;  2XH6 A;  1VBB 3;  2GC2 A;  1MQT B;  2DUO A;  3NNG A;  1RUG 2;  2CHH A;  3EJK A;  4HVR A;  4IUG A;  3CMG A;  4Q29 A;  1YWK A;  4DXR A;  1AR8 1;  1RUC 3;  4CDQ B;  4CDU A;  3GJA A;  4RSU A;  5BV6 A;  1HDK A;  2ARE A;  2EAK A;  1AYM 2;  4URT A;  5FY4 A;  1W9F A;  3FBY A;  2WFF 2;  4RS5 C;  5B2G B;  5C3S A;  2E31 A;  3R4U A;  1IPK A;  1VBB 2;  1WZX A;  1F2N A;  4UFK A;  2JIG A;  1LNS A;  1C3H A;  2DUQ A;  2X5I C;  4HSJ A;  2CGN A;  1DLC A;  1UY1 A;  4F7Z A;  2V5D A;  2VOT A;  3MO4 A;  3B00 A;  1O6U A;  4BQY A;  2CU5 A;  4Y1Z A;  2HWF 3;  3ZXF A;  2GNM A;  5FCC A;  2Q1Z B;  1X82 A;  5L7O C;  2XJU A;  5FPL A;  3VKN A;  5KWR A;  4AVB A;  4MG2 A;  5CFD C;  4GD4 A;  1UKG A;  2VEC A;  3J7N A;  3H1Y A;  4A44 A;  3SCF A;  2FCU A;  1RTV A;  4FPJ A;  1W9S A;  4A6O A;  4BQ4 A;  5I8Y A;  5LCW L;  1XYP A;  2PLV 1;  2VUA A;  2ZX4 A;  3WUD A;  2XR4 A;  2W46 A;  2HWF 2;  1OF3 A;  3DPR B;  2HWC 1;  5FAX A;  2WZE A;  2Q8D A;  1W99 A;  5CA6 A;  3L9J T;  1QIQ A;  3OBA A;  3USU A;  4GIQ A;  4JGZ B;  1H1A A;  1SLT A;  3POF A;  2GZW A;  1MS9 A;  2XLG A;  4QB6 A;  5EJ3 A;  4Y4Y A;  2VTX A;  2OT7 A;  2EAA A;  5A32 B;  3DEC A;  5EJZ B;  4BOW A;  3OEA A;  1D4V B;  2B5H A;  5CEH A;  4V2V A;  3M3I A;  4QQ2 A;  3TYJ A;  3III A;  4JQR A;  2O8O A;  3K46 A;  3OEB A;  1F4A A;  5F1R A;  3OD4 A;  3UKT A;  4EN0 A;  2R04 1;  5FZ1 A;  2RE9 A;  4GXL A;  3TOJ A;  5L19 A;  1CAV B;  2R7E B;  2JIJ A;  3USU B;  4EYU A;  2CDP A;  1RIN A;  2FCT A;  2WR9 A;  2FMY A;  1ZBE 1;  5DAW A;  5FYT A;  4XVH A;  4DIQ A;  1KJR A;  1OKO A;  1OOP C;  1YI9 A;  4P9Y A;  1S55 A;  1QY4 A;  4C91 A;  5DQ0 A;  4M01 A;  5HBA A;  1VB2 A;  1YIP A;  1Y4W A;  3CZJ A;  4Z07 A;  3POI A;  2DVA A;  4K9S A;  5FKC A;  4CP9 B;  2MPF A;  1NY7 1;  3I4I A;  2JDH A;  4OI4 A;  1JYT A;  1X9P A;  4E4Z A;  3LPF A;  4XJW A;  4JKK A;  5IJR A;  1FOD 3;  2OX0 A;  5FZ4 A;  5HCA A;  3I2O A;  3AL6 A;  2UU8 A;  3B01 A;  3MIE A;  2FMD A;  5C70 A;  4D3W A;  2HBU A;  4FTE A;  4AG4 A;  4IW3 A;  5A1L A;  3OTF A;  4Z82 A;  3NJV A;  4DEQ A;  3AXE A;  4GH4 C;  4MV2 A;  1WME A;  2HJI A;  5D1I A;  2XJT A;  3WQB A;  3QCW A;  3OGJ A;  2FZ1 A;  5F5A A;  4FOW A;  4BME A;  4DO0 A;  1FOD 2;  3CKH A;  3D6E A;  3RJR A;  4F8A A;  2F17 A;  2VCB A;  3LA7 A;  4XPV A;  1FAY A;  4I2O A;  1UW8 A;  3AP7 A;  2JDK A;  5BNP A;  4A4A A;  3EXU A;  2DCZ A;  5C5T A;  1TME 2;  1M06 G;  1IPS A;  4FQZ A;  4YW3 A;  2X8K A;  1AYN 1;  3VBS C;  4A6S A;  2D43 A;  2HYX A;  4BQX A;  4NIG A;  1QWR A;  3MPP G;  2J1E A;  5IK8 A;  4OI1 A;  1CAX B;  4AGV A;  2ZEX A;  2V73 A;  2ZX2 A;  3IWZ A;  4P9I A;  3WG2 A;  2GC0 A;  1AR9 3;  1YFY A;  4BA6 A;  4YW1 A;  1CAW A;  3KT4 A;  4I09 A;  3ZFF A;  4DMI A;  3C7H A;  2MHF A;  3ASI A;  2VZS A;  4HZF A;  5K4L A;  4QKF A;  2QFE A;  1VP6 A;  3MV1 1;  1I3H A;  3KQ4 B;  1PGS A;  3ACL A;  5A3W A;  1SFP A;  2AC1 A;  4DRV A;  1ZBA 1;  1LOG A;  4IER A;  4AYU A;  3T4V A;  2WWJ A;  1XE8 A;  1AR9 2;  4MVT A;  2H0B A;  1U5I A;  4JKM A;  5FFO C;  3V64 A;  4RHV 1;  4QPG B;  3THC A;  2I74 A;  3BYW A;  3LFM A;  5CKQ A;  5ANN A;  1O8S A;  3RJ2 X;  1UO9 A;  5FJH A;  3P5B A;  2RS1 1;  4BZ4 A;  5FWJ A;  1OLR A;  2IFW A;  3GYD A;  4JTO A;  5JDB A;  5LZ6 A;  3OD0 A;  1J1T A;  2V4V A;  1QGL A;  4QPW A;  3ZFE C;  3RNS A;  3KQR A;  4DXZ A;  1YQ6 A;  4EZH A;  1Q56 A;  2VBP A;  3FHI B;  1ODN A;  4OLL A;  1XOY A;  3M3Q A;  4M4R A;  1RXF A;  2GC1 A;  3K4D A;  3B9I A;  3WHT A;  3U4X A;  4EN8 B;  3V65 A;  1XNB A;  1NCQ A;  2WRA A;  3UET A;  3O1T A;  3ZYB A;  4XUP A;  3SH5 A;  4RR3 C;  4MO3 M;  1O3Q A;  3PUI A;  1OPM A;  3DL3 A;  1ENS A;  5DAB A;  3ZYF A;  1IHM A;  4WM8 A;  2WS9 1;  3WW2 A;  3POS A;  5JSO A;  3AZV A;  3VBU B;  4MXW A;  4P9X A;  3RYK A;  2BNO A;  2WWS A;  4MAD A;  5D8A C;  4B3N A;  3CF6 E;  3FWE A;  2BGO A;  3QH7 A;  2MEV 1;  2ZAC A;  2PMW B;  3W20 A;  4N43 A;  4IGP A;  4JTN A;  1ZRE A;  4CCJ A;  4IXL A;  4MGZ E;  1J58 A;  1NG0 A;  1V6I A;  3BOD A;  2EVX A;  3PHM A;  5LAT A;  3G7D A;  2ZAH A;  1Z0H A;  2GND A;  1RED A;  1QKQ A;  4QPI A;  2XHK A;  4XFF A;  4FPG A;  1H2K A;  4P9J A;  3CDZ B;  5CIR A;  2GH8 A;  1F5F A;  2VCA A;  5A3U A;  2JJ6 A;  1V6N A;  2J1U A;  2H6C A;  1BHG A;  3IPV B;  1UXZ A;  2W5F A;  3VBR A;  5FYI A;  2E6V A;  1R1A 3;  2VOW A;  1NA1 B;  4EJR A;  3GCX A;  2WZR 1;  4COZ A;  4OUL A;  2ERF A;  3ZYH A;  1C28 A;  3AP5 A;  3OYW B;  4XCA A;  1XC6 A;  2VE1 A;  2YGM A;  3U78 A;  5FXX A;  2R30 A;  1QOO A;  1R08 3;  3H0O A;  2QJV A;  3C7G A;  3AYC A;  2ARB A;  2R06 1;  4QPI B;  3POE A;  4WM7 C;  4K1Y A;  4JZR A;  4CU7 A;  2WA3 A;  2EXJ A;  4XFA A;  4YM3 A;  5AC9 1;  1BXH A;  1R1A 2;  2HWB 1;  3OJB A;  2PTM A;  3H50 A;  3WHU A;  2UUR A;  4BE3 A;  4XQW A;  5DXD A;  1QOT A;  3AVS A;  1WMD A;  1K5M A;  1T6G C;  1PVX A;  2OPK A;  4QU1 A;  2QBX A;  2CWM A;  1UU6 A;  1GWL A;  1RUH 1;  1R08 2;  2W1S A;  4LLO A;  4FPH A;  4Q4Y 3;  5E89 A;  5EP9 A;  5D2A A;  4A3Z A;  2Y26 A;  5JWP A;  1PX3 A;  4PDW C;  1VBD 3;  5LA1 A;  5CFC C;  4NAO A;  4LUM A;  4P9L A;  1NZC A;  3VBF C;  1F35 A;  5IVJ A;  2GP3 A;  4K1Z A;  1GKB A;  1FV2 A;  2XOM A;  4C1X A;  1WGP A;  1Z7S 3;  2WNV C;  3MGU A;  3S30 A;  3W9A A;  1LGB A;  1RUE 3;  4Q4Y 2;  3I49 A;  3JQX A;  3POJ A;  3RMY A;  3UKV A;  2TNF A;  3TWI A;  2OZ6 A;  3ZFG C;  3H9A A;  3M3C A;  4XAC A;  5CBL A;  2BP6 A;  1GQG A;  1BVP 1;  1LR5 A;  1VBD 2;  3MLJ A;  5T5J A;  2LRP A;  4W8J A;  5FYM A;  4LBJ A;  2WN3 A;  3H42 B;  3JD7 3;  4JX0 A;  1JUI A;  4URA A;  3P3N A;  5FP8 A;  3T2T A;  1FPN 3;  1Y9M A;  4D69 A;  1Z7S 2;  3JUU A;  2Z2S B;  3I2K A;  3KF5 A;  5DPN A;  4YZ5 A;  3KMH A;  1RUE 2;  1BMV 2;  3MIH A;  1JYX A;  4ZY9 A;  1ZBE 3;  3FJS A;  3ZYG A;  4K40 A;  3ZX7 A;  2XL9 A;  2XQR A;  1LU1 A;  2XJS A;  2DTY A;  1TQ5 A;  2YBS A;  3I2J A;  3JD7 2;  3VZL A;  5J98 B;  5FRE A;  4D0Q A;  4ZPI A;  1VRH 1;  5F5I A;  2OW4 A;  2VMH A;  1FPN 2;  4HPK A;  5ABJ C;  2P3K A;  4FPE A;  3ZVX A;  2WNU B;  3AP9 A;  5CKN A;  5J1X A;  1POV 3;  5F6K A;  4Q4W 3;  3VBH B;  1ZBE 2;  2B39 A;  1CR7 A;  1X7N A;  5A7O A;  2ENR A;  4GKY A;  2D3S A;  4RQP A;  4Y1U A;  1ZRF A;  3AYA A;  2XVK A;  4Y1X A;  5DZG A;  5F3E A;  3VKO A;  2WNE A;  3O1V A;  4P5H A;  1JS9 A;  3T2P A;  1H2N A;  2QDN A;  4FFH A;  4ERO A;  1NYW A;  3I2H A;  4Q4W 2;  1PZ8 A;  4KG0 A;  3UYJ A;  1CAU B;  1F9K A;  2CGO A;  4IV3 C;  5C3Q A;  3WW4 A;  2E53 A;  2ZXQ A;  1JZ6 A;  2XVG A;  2VZ1 A;  3BOW A;  3BCW A;  3VDD C;  4RQP B;  3ETP A;  4CDW C;  4LO8 A;  4N53 C;  5EQU A;  3POB A;  2VOV A;  5FYZ A;  5A7N A;  1QEX A;  4F3J A;  3VD9 A;  5FY5 A;  5DDJ 1;  2VZV A;  3DXU A;  1JYW A;  3DV8 A;  1FV3 A;  2XML A;  2AEZ A;  2WYS A;  4CPB D;  2WL1 A;  4CCK A;  4S2F A;  2PAK A;  4QDS A;  3ALQ A;  3CJX A;  2OA2 A;  4N9I A;  5B4X A;  1DQ4 A;  3VKL A;  5T55 A;  3M70 A;  3BTZ A;  1OUS A;  3KHB A;  1YEW A;  2Z79 A;  3O0V A;  1SQ4 A;  1AYN 2;  1ZRI A;  2Y0O A;  2CAU A;  1VIW B;  5LA0 A;  1LEM A;  4HL0 A;  1KIT A;  4RGK A;  1RUJ 1;  3BN6 A;  4RFR B;  3ZYI B;  5C8C A;  2JG9 A;  2QQP A;  3RZM A;  4C8D A;  1C8M 1;  1HRV 1;  2JEM A;  3CL1 A;  4BWO A;  1PK6 A;  3N9O A;  4LE3 A;  3KGZ A;  4LBQ A;  2PA7 A;  1LOC A;  1AJK A;  4ARY A;  3UJQ A;  3GXU A;  2JEN A;  1W04 A;  4LIT A;  3E5U A;  2QUO A;  1YQ2 A;  1QQP 3;  4BCU A;  3JCI A;  3JB4 C;  1QJY 1;  4XFI A;  2RJK A;  2UWB A;  1BEV 1;  2EXH A;  5A1A A;  1DZR A;  4LQR A;  2ZS6 B;  2PHF A;  3CJI B;  4I0W B;  1UQX A;  3AKP A;  4S2G A;  5FZF A;  3VBO B;  4IE7 A;  2JDA A;  1EUU A;  5K0U A;  5FK8 A;  3TN9 1;  1QQP 2;  5JXJ A;  1MAC A;  4U36 A;  5FBJ A;  1PK6 B;  1EV1 1;  2D6L X;  5F32 A;  2J1A A;  1CD3 G;  4N9H A;  3KS7 A;  1JI6 A;  4LMF A;  2XBO 3;  5FZE A;  4Y20 A;  2ZX0 A;  2G1M A;  5JVV A;  3WX5 A;  5GLZ A;  4YGE A;  2ZKN A;  2YPD A;  2Y0I A;  5FPZ A;  5LBE A;  2HKX A;  2Y60 A;  3LKJ A;  1ACC A;  4YFW A;  2XB6 C;  3EMR A;  4AQT A;  3QD6 A;  1VAK A;  5C6C A;  2WAB A;  3JBG 3;  4EWD A;  3B93 A;  1TZO A;  4I0A A;  4X8N A;  3ZMO A;  1FI2 A;  3LSE A;  2YRO A;  2XBO 2;  2ARX A;  2DCK A;  4IV1 A;  4QDQ A;  4UFL A;  5C4W B;  1QJX 1;  2ZEW A;  1W6O A;  3D0S A;  3LFI A;  3R4D B;  4L2N A;  5EFU A;  4BLI A;  4B29 A;  5GZC A;  1DG6 A;  1E5S A;  1LUL A;  1D2S A;  1RIR A;  2XGX A;  4H2A A;  4RA0 A;  4XJZ A;  4BQ1 A;  3JBG 2;  3PTR B;  1QMJ A;  3NAP A;  3T0D A;  4E2G A;  1CX1 A;  1VB4 A;  4YVS A;  3WP5 A;  3BU7 A;  4BLJ A;  1UOG A;  3VBF B;  5C9A B;  1UZW A;  2X29 A;  1BVV A;  5DG1 A;  4MGT A;  3EQE A;  2OZJ A;  3DYO A;  4L97 A;  3J8F 3;  3LEI A;  3N9Q A;  3C7F A;  4NHX A;  4DIN B;  4XUQ A;  4IV1 B;  3A23 A;  4XBL A;  5JI7 A;  4YG0 A;  1DFQ A;  5JMC A;  2WFF 1;  2CDO A;  1KDK A;  3L2Y A;  1VBB 1;  3Q9O A;  4NPL A;  2WDB A;  4CEY B;  5C8W A;  4YW6 A;  1REF A;  4IGO A;  1HJF A;  2Q4S A;  3J8F 2;  4XF3 A;  2Q1F A;  1RUC 1;  1UF2 C;  5FUI A;  1YCI A;  3FE5 A;  4QX0 A;  1RL3 A;  1BKZ A;  4KMQ A;  4NID A;  4FFG A;  1YIF A;  1IS3 A;  5LWB A;  1TE1 B;  1O91 A;  1EP0 A;  3WP6 A;  3V0B A;  3FMG A;  2WWU A;  5CKM A;  5F7U A;  2FDI A;  4NOT A;  1VBE 3;  3U1X A;  4CP2 A;  1CWP A;  3D5O A;  3W59 A;  3KCC A;  5JXH A;  4UT5 A;  1X9T A;  1S1A A;  1IG0 A;  1H4H A;  3CIH A;  2LW8 A;  2HWF 1;  2DF7 A;  2YFU A;  2BU9 A;  4FQ4 A;  4JDM A;  3ZM8 A;  1CIY A;  5FDB A;  1GOG A;  1RUH 2;  1E57 A;  2BJS A;  4HKO A;  4W50 A;  2N7G A;  1H8T B;  3G6J B;  3I3E A;  4Q1P A;  1VBE 2;  2WQ4 A;  5A33 A;  2YB7 A;  5JZG B;  1ZZB A;  2DDU A;  3RGB A;  1S0I A;  2FZ2 A;  1O4Z A;  3NV4 A;  5EWS A;  2JIC A;  1W06 A;  1IKQ A;  3ABZ A;  4AVT A;  1LOF A;  2VQA A;  3RZK A;  4OI0 A;  2FDF A;  5E8A A;  5FZ6 A;  2HEV F;  3ITQ A;  2UWA A;  4JGY A;  4ZU4 A;  4DQA A;  3NRU A;  1QJU 3;  3L2H A;  4FAG A;  4ES9 A;  2PXJ A;  2HYK A;  2BVB A;  1L7L A;  1RUI 3;  2Q30 A;  1H1M A;  1T2X A;  5E16 A;  3VHR A;  3WSO A;  1WUV A;  5L9B A;  1DF0 A;  2WN2 A;  3HOB A;  3QBQ A;  3VKF C;  1ZRR A;  1BK1 A;  2P5B A;  1CES A;  3OCP A;  4HET A;  5IK4 A;  2LRO A;  2XLA A;  4NUB A;  3RPQ A;  1QJU 2;  5FZL A;  2GN7 A;  4GMP 3;  5I93 A;  3V0A B;  1WWY A;  1V70 A;  1MS0 A;  4X6Q B;  1S0B A;  1VMJ A;  1QXR A;  4OHW A;  2Q5T A;  3I59 A;  2Q8C A;  4HT1 T;  4BPZ A;  3P6B A;  2VGD A;  1SZB A;  4BM8 A;  4XDP A;  2GMM A;  5IAV A;  3VLB B;  4L99 A;  4AWD A;  2C6S A;  4LJH A;  1WA6 X;  3GCW A;  4LNV A;  5FUN A;  4KWU A;  2KXL A;  1WCU A;  1N47 A;  2BGP A;  5ERL A;  3LCP A;  1FOD 1;  2XLF A;  5CG9 A;  3KV9 A;  1W8T A;  2R16 A;  5A7S A;  4DUV A;  4LHN A;  1MZF A;  3A0N A;  1G9D A;  4XXP A;  4OCT A;  5KXD A;  2RG4 A;  2Y34 A;  5AFE A;  4RD7 A;  5FOJ B;  5J96 B;  2VAU A;  3VZM A;  4QT6 A;  4TYS A;  4W6Y A;  2YGL A;  1NCR A;  4AGG A;  3BGA A;  4J6G A;  5G05 L;  5FYU A;  2C9A A;  2JG8 B;  1CZT A;  5EXO A;  2DVB A;  2X09 A;  3ES4 A;  2OYZ A;  3ST7 A;  4QKN A;  2VW0 A;  2ZKL A;  1ND3 A;  2ZGR A;  1DQ2 A;  3OUH A;  2CAV A;  2E51 A;  4YLZ A;  5H9R A;  2XWB B;  4YAR A;  4QX5 A;  3MHZ A;  4YGD A;  4EZ4 A;  4AFB A;  2HWE 3;  3PU3 A;  1LJ7 A;  3KWV A;  5HV4 A;  4AI3 A;  4CSW A;  5HCH A;  5DUX A;  2ZGP A;  4O61 A;  4YYO A;  5BPX A;  1WLT A;  1LHV A;  1AR9 1;  3KB5 A;  3M2M A;  3O12 A;  1U12 A;  4OQ9 A;  1LEC A;  1OF4 A;  2OVU A;  2VMF A;  4YFZ A;  2G4I A;  2EXI A;  1M4W A;  1O8P A;  1RUF 3;  3NMB A;  1DDL A;  2HWE 2;  3T30 A;  1YQ8 A;  1W8H A;  3AZZ A;  2NQY A;  4BIO A;  4PCR A;  5TSW A;  1EV1 3;  1BK0 A;  3DKQ A;  3R0R A;  3BTY A;  3UGG A;  3LDB A;  3CNA A;  4UWD A;  1ZVF A;  1KS4 A;  5A1F A;  5LBF A;  3VZN A;  2VUJ A;  3VDB A;  2PHR A;  3ZYJ B;  5BNO C;  2DWR A;  3NV3 A;  1US2 A;  2WC2 A;  3ZSM A;  4AEM A;  3K4A A;  4MZU A;  3ZPY A;  4CU8 A;  5FZC A;  5GZG A;  3CZU A;  2A3W A;  5F3G A;  5KC6 A;  1RUF 2;  3BKZ A;  3RI9 A;  5FZB A;  2BWA A;  4HKL A;  2WBK A;  5FYC A;  5FQ0 A;  1EV1 2;  1SPP A;  4WBB A;  3WP4 A;  2R6Q A;  2WT1 A;  2L9L A;  5GZD A;  5KHJ A;  2YPJ A;  4P02 B;  1IGO A;  4KWK A;  1AHS A;  3H3Z A;  4YZ3 A;  4BXF A;  4YZ2 A;  3KGL A;  1W9T A;  4EN6 B;  4ZXE A;  2JXA A;  4GWJ A;  4NII A;  1FYU A;  3WG3 A;  3AB0 A;  3ES1 A;  3SQO A;  3N7K A;  4ORF A;  1MQT A;  2BVV A;  2ES3 A;  2E33 A;  3AKQ A;  2C9K A;  4TN7 A;  4XC9 A;  4A45 A;  3GBW A;  4D94 A;  3K75 B;  4CDQ A;  1VAM A;  2F6B A;  4J1W A;  1LHU A;  5FO7 B;  3ZR6 A;  1E5H A;  2UY9 A;  5JR2 A;  2XUM A;  2ZZJ A;  2ZGO A;  1ZM1 A;  5BNN A;  3C8X A;  1WLC A;  1UPS A;  2GSY A;  3CEW A;  5FLH A;  1FT9 A;  4MH0 E;  4YZ1 A;  2VBB A;  4H7M A;  4FPF A;  1H9W A;  1PX4 A;  5DAV A;  2ZTN A;  3TRS B;  5JUV A;  5JOX A;  4NN0 A;  2EIG A;  4HAN A;  5DAP A;  1DGR A;  4GB3 3;  2AH2 A;  2VZU A;  1H6X A;  1K12 A;  3GHM A;  4LT5 A;  3KVA A;  2WO7 A;  4CCO A;  4XF9 A;  2I45 A;  2W39 A;  1O59 A;  3GAL A;  4M3C E;  4JAA A;  4UFM A;  5BNP C;  2R49 A;  2D93 A;  3QH6 A;  2FQP A;  1DHK B;  1ULP A;  1VE0 A;  4FXG B;  4BU2 A;  1GOH A;  1AVB A;  4XOG A;  3DKW A;  1Q3E A;  5JI9 A;  5BNN B;  4M3C F;  4GJY A;  2TUN A;  4I3P A;  1OKQ A;  4GB3 2;  1OA4 A;  1N3Q A;  1NXD 1;  2ZHL A;  4IE4 A;  2VO5 A;  3HN1 A;  3PME A;  2OPW A;  1R1A 1;  5FZK A;  5KC5 A;  3DPR A;  3A4U A;  3POW A;  1A34 A;  2DCT A;  2ZGN A;  1VRB A;  1N1V A;  2J42 A;  2JDY A;  2VD7 A;  1RUC 2;  3E6D A;  1ULE A;  5FPV A;  3ZFF C;  2YZ4 A;  4JGZ A;  1NUK A;  1R08 1;  2RJ2 A;  3MIC A;  3MDP A;  2BER A;  4H7L A;  5EIY B;  2GNT A;  2R07 3;  2A6Y A;  3ZXK A;  3ZMN A;  1DYO A;  1YFU A;  2HH9 A;  4HKW A;  1LGC A;  3E6B A;  3N36 A;  3R6S A;  5A32 A;  5LRS A;  3ZIX A;  3WNP A;  1AR7 3;  5C33 A;  2QE3 A;  2BWC A;  3WQ0 A;  4RN5 A;  1WMF A;  4KI5 M;  4H55 A;  2GU9 A;  2YHJ A;  4CEW B;  1LEN A;  3AFG A;  1DGW X;  4QXH A;  4E8D A;  2D40 A;  3WDX A;  3WDY A;  4NE9 A;  2GAL A;  5FY7 A;  3ZXE A;  2XJP A;  4DZG A;  4HG6 B;  4Q4Y 1;  5EV7 A;  4CDX C;  5IVV A;  3O1M A;  2ARC A;  2WAA A;  4WVZ A;  2ZMN A;  1CAV A;  3N4M A;  4AFC A;  1VBD 1;  2B45 X;  5A6X A;  1C57 A;  5FZ0 A;  1AR7 2;  1F31 A;  1NE6 A;  2VXR A;  4LKF A;  5DZE A;  1H8V A;  1Z7S 1;  2QQN A;  1OH3 A;  4XET A;  1GNZ A;  1RUE 1;  2H6B A;  4FSJ A;  1BMV 1;  3AJY A;  4AQS A;  2DV9 A;  4A2U A;  4AQ2 A;  4CP9 A;  1NCQ C;  1TG7 A;  5IVE A;  4DUW A;  1LOD A;  1UMZ A;  3WG4 A;  1RYY A;  3MV0 1;  2FDH A;  1HV1 A;  3FUQ A;  3JD7 1;  5CAZ A;  4WM8 C;  1H9P A;  3C7E A;  3MW4 A;  4LIU A;  1FPN 1;  2KA3 A;  2D6P A;  4XBN A;  4XEZ A;  4YVW C;  4AQ6 A;  4XJU A;  4SBV A;  4O9E A;  1J3P A;  1QXJ A;  4KGG A;  4XXA A;  3VN4 A;  5K7P A;  5FY1 A;  4QWN A;  1ZNP A;  4CCD A;  3ZN6 B;  4BIF A;  3I3M A;  1TMF 3;  1W6Q B;  3CQO A;  3MIF A;  4N43 C;  4JC1 A;  3BB6 A;  3N9N A;  3GJB A;  1S0F A;  4L0P A;  2AEN A;  4BIS A;  2DUP A;  1XU2 A;  3U14 A;  2VY0 A;  1J3Q A;  1OA3 A;  3M4F A;  5F9T A;  1Q5O A;  1POV 1;  3LOB A;  2D5H A;  3KT1 A;  4Q4W 1;  1OFS A;  1OFN A;  2PAE A;  2JDN A;  4Q1R A;  4ES8 A;  1TMF 2;  4K8F A;  4Y22 B;  1W9Y A;  4N90 A;  2DTW A;  3I7D A;  1CAX A;  2BOI A;  5FLJ A;  2ZX1 A;  5LY2 A;  3VBR C;  4AI1 A;  3WG1 A;  1HV0 A;  1GZC A;  3WF0 A;  3C2U A;  4JHT A;  2P6H A;  4YM2 A;  2NPI A;  1N3O A;  1JYV A;  1DBN A;  1KFX L;  4MYE A;  1RJ7 A;  4MGS A;  1CZV A;  3M8L A;  4WV8 A;  4XFB A;  4ASL A;  5FMC A;  2W08 A;  3LOI A;  3SXW A;  2RMU 3;  4XDO A;  1B35 B;  3B94 A;  4NRM A;  2PHX A;  5FBZ A;  3VL8 A;  2VH9 A;  5LAS A;  4EN9 B;  3LQC A;  5DUU A;  4ISQ A;  2CTV A;  2XON A;  4HON A;  1JN2 P;  2A6V A;  3HEI A;  1K5M C;  4JV4 A;  4KNC A;  4QPG A;  4R9A A;  4D7S A;  4HLT A;  3TBD A;  1UY3 A;  1HQN A;  2GDF A;  2RMU 2;  3JU9 A;  1OT5 A;  5C5U A;  2GNB A;  5FOB B;  3BUC A;  3SIT A;  3WNX A;  1GNH A;  4AFA A;  1LOA A;  1KDM A;  3N7J A;  2VC9 A;  1PVC 3;  3PUS A;  4CCC A;  2FCV A;  4PLO A;  3VZJ A;  1YLL A;  2VQ0 A;  5I91 A;  4FO9 A;  1OVS A;  5A7W B;  4A7Y A;  1SLI A;  1QQP 1;  3H1M A;  1OD5 A;  2WJS A;  4AED C;  4S2H A;  4B7E A;  1HX6 A;  1UOB A;  1OUR A;  5A3L A;  1OLM E;  2WSV A;  3ZKY A;  4IGQ A;  3B9C A;  4LO7 A;  1D0G A;  2ADE A;  1PVC 2;  2QQU A;  3E5Q A;  4K8R B;  4NHL A;  2XJV A;  3VBU A;  2C1F A;  4ZON A;  2IXJ A;  4IQP A;  4WZF A;  3FC0 A;  3F95 A;  4X8P A;  1LOB A;  1G8W A;  1SCS A;  2XDV A;  4RS5 B;  4UW6 A;  4IEW A;  4P5Y A;  2VW1 A;  3ME2 A;  1XNK A;  4OYU A;  5FZD A;  1NKG A;  2XBO 1;  1QDO A;  5DUV A;  3TEX A;  5LB6 A;  1OQD A;  2X5I B;  3O0W A;  4OHX A;  4ZS3 A;  2BDR A;  3RZJ A;  4BXS V;  4BQ2 A;  3PUA A;  2AZ5 A;  4PQQ A;  2W2I A;  2WLQ A;  3KV6 A;  5E1R A;  1HB3 A;  1W8Z A;  1UY0 A;  3GGL A;  2YG0 A;  3JBG 1;  2X10 A;  1IQA A;  2Q1M A;  3C3V A;  1KEX A;  3IPV A;  4FPY A;  4NRO A;  5L7O B;  1NA1 A;  1U5Z A;  2XJQ A;  1O3R A;  5CFD B;  1ALY A;  1W90 A;  1WCQ A;  1W6M B;  3HNY M;  3NKG A;  5JIA A;  3GHN A;  1UIJ A;  5CVR A;  5LRR A;  3TNP B;  3OYW A;  3PNA A;  2GMP A;  2QZ2 A;  3WLU A;  1MEC 3;  3M3O A;  1NLS A;  4UBH A;  3CHX A;  4Y5Z 0;  2VVD A;  1MZE A;  2ATF A;  3FL7 A;  3J26 N;  3PDQ A;  3A7Q A;  1VBA 3;  2H0V A;  3PUQ A;  1XNC A;  3FLT A;  1ZZ9 A;  1WW5 A;  4GAZ A;  2IXL A;  4S2D A;  3P1I A;  1W2N A;  1XRU A;  2ZGM A;  3VD7 A;  1JZ5 A;  4A3X A;  1ND2 C;  1RXG A;  2DVG A;  4P00 B;  5C71 A;  4W6X A;  4OVE A;  3J8F 1;  4ZZ5 A;  5FP7 A;  1MEC 2;  2AUY A;  2Y6J A;  1N1T A;  1W6N B;  4CRQ A;  5T52 A;  3IZO A;  4IES A;  5A80 A;  1YO8 A;  4AI9 A;  4FOV A;  1GQP A;  1VBA 2;  3IT8 A;  1RUD 3;  4Y5S A;  4Z92 B;  3NNM A;  4GKX A;  4LHK A;  1IS6 A;  1W05 A;  1A6C A;  3ILR A;  5C8C C;  2JG9 C;  1YFW A;  2WT0 A;  5JPN B;  1GZW B;  4XZU G;  3F2Z A;  2QQM A;  3RWK X;  5FZ7 A;  1KGY A;  2DU0 A;  3D8C A;  4IEY A;  3WF3 A;  1IS5 A;  3M7A A;  5FXZ A;  4ZXK A;  1G9B A;  2EIC A;  2GH2 A;  3HIF A;  1OOP B;  1RUD 2;  3KD4 A;  4L9B A;  2NYY A;  4ONU A;  5IFT A;  2XPJ A;  1FXZ A;  4NMI A;  4GH4 A;  2OUJ A;  1AF9 A;  1XQN A;  1I5Z A;  3K3N A;  3UT0 A;  5FR3 A;  3WZ1 A;  1CPN A;  1VBE 1;  2O1Q A;  4K21 A;  2NZ9 A;  2MNG A;  4QB1 A;  4XHX A;  5G04 L;  3MUY 1;  3O14 A;  5EYY A;  3I3D A;  3VGI A;  3LDK A;  3V0B B;  3VHO A;  4JKL A;  1BBT 3;  3NV1 A;  4FTS A;  1OBN A;  4Y3O A;  1W9W A;  2ZAA A;  4D6Q A;  5CZK A;  2HBT A;  4CP0 A;  1L7R A;  4AW7 A;  5F5C A;  4IEV A;  1QH7 A;  2G9Z A;  2R1D A;  1XE7 A;  1H1I A;  2E7T A;  1UY4 A;  2LS6 A;  2WNU A;  5J09 A;  4FP2 A;  1PGL 2;  1DZT A;  4GH4 B;  1VLN A;  3VBH A;  4ZZ8 A;  3BU0 A;  4XF1 A;  1FX5 A;  4BK5 A;  4ZHN A;  1WCS A;  1BBT 2;  2JE7 A;  4IND A;  4QKD A;  5FKB A;  1SEF A;  1SBF A;  3ECQ A;  2K9Z A;  3UK9 A;  1AR6 3;  5IUQ A;  1QJU 1;  2V72 A;  4AZZ A;  1W39 A;  3VBS B;  5GM0 A;  2DBN A;  4LO5 B;  3PVN A;  4GUL A;  4NHK A;  3ETQ A;  3WQ1 A;  3WW3 A;  1RUI 1;  3ZSK A;  4Q8K A;  1I9R A;  1CAU A;  4G9S B;  4DEV A;  3OUJ A;  3NNF A;  4UYB A;  4E4D X;  2IXI A;  1O3T A;  1X33 A;  1Y9Q A;  3I2G A;  4CCM A;  1PO2 3;  1WCK A;  4NIA A;  4KGQ A;  5B4N A;  3WQ7 A;  3AFK A;  4NHM A;  4D6S A;  2A3Y A;  3IKW A;  5DMY A;  1LHW A;  3NAP C;  3AZX A;  4OUM A;  1AR6 2;  2VVE A;  2PYT A;  1LOE A;  1JMU B;  1SLC A;  2DUR A;  3I2D A;  4GMP 1;  4YVS C;  1YJL A;  2LUW A;  1ZRC A;  4G3Y C;  3LIH A;  3SCG A;  2WKK A; 
#chains in the Genus database with same CATH homology
 2QQO A;  5CIS A;  2WNO A;  1SPP B;  3POG A;  4LMF A;  4LOT A;  4LOS A;  1SPP A;  3POJ A;  3KQ4 B;  1SFP A;  3POF A;  3POE A;  4LOR A;  5CKN A;  3DEM A;  3POB A;  4GZ9 A;  2QQM A;  1NT0 A;  2QQL A;  3POI A;  5CKM A;  1NZI A;  2QQK A;  5CKQ A;  1SZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...