3POJA

Crystal structure of masp-1 cub2 domain bound to ethylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannan-binding lectin serine protease 1
publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pojA00
1NT0A 1NZIA 3KQ4B 4LOSA 5CISA 1SPPA 3POBA 4LOTA 3POEA 2QQMA 4LORA 3DEMA 1SFPA 3POJA 5CKNA 2WNOA 2QQOA 3POIA 3POGA 2QQKA 1SPPB 5CKQA 4LMFA 2QQLA 1SZBA 5CKMA 3POFA 4GZ9A
chains in the Genus database with same CATH superfamily
3I3MA 3WNXA 1DFQA 4Y33A 3O1RA 5FZ0A 3F95A 3JBG2 5C8WA 2VO5A 2XONA 5CVRA 2XOMA 1YEWA 1SFNA 5T3NA 1BKZA 3E97A 3MEPA 2C26A 3NQHA 5T5OA 5BNPA 2ORZA 1WW6A 3LCPA 3WQ7A 3RNSA 3TEXA 3A4UA 5FMDA 3HAGA 3OPWA 1CR7A 2RV9A 1BBT2 3RRDA 4CEWC 2VZOA 4P9WA 3GJAA 4SLIA 5GZFA 5EP9A 2D97A 3WF1A 1Z7S1 3SH5A 4MGIE 3AKPA 4DRRA 4GA9A 1UY0A 3NRUA 1W6MA 4OHXA 4GMP0 1Y9MA 4H3WA 2CNAA 3MI8A 4UI9L 1S1AA 3A21A 3P3PA 4GH4A 2QQWA 4HKWA 2GN3A 4LO4B 2BERA 2ZMLA 1PX4A 1PGSA 2JENA 4LQRA 2GNMA 1S4CA 3J9SA 2ARAA 4PCRA 4XHBA 3J7LA 2Q1MA 1EP0A 2WA3A 3K2OA 4IESA 4Q8LA 3KV4A 2AR6A 4XYXA 3LB9A 1JUIA 1SQ4A 2H0BA 1LGCA 1H8TB 4GKYA 1F5FA 2XL7A 5KC5A 5D8AA 1IKQA 4DNYA 3RS6A 1ULGA 3POFA 3VBHB 4GJYA 2QZ3A 4AWDA 2WLQA 2ZA9A 3O14A 4QHZA 4TXWA 4X6QB 3C7OA 1YQ6A 4WZFA 1GYKA 3OD4A 1C57A 4RA0A 3U1XA 4EN9B 1CJDA 3NWKA 1RYYA 4MGQA 3M3IA 1VBA2 5I8SA 3M4FA 3N9QA 2V09A 3CZJA 3T0AA 4OVEA 1ND3A 1RGSA 2OVUA 2VVEA 2XKPA 2BWAA 3NVCA 4LE4A 5K0UC 4QD2A 5K9YA 5LCWL 1CVNA 4XCAA 4LPLA 1OUXA 2OYZA 1HQLA 1OI6A 1GSLA 4Q4V3 3WP5A 3N9MA 3N7MA 4AEKA 2YY1A 4MGKE 5FDBA 1UZYA 2BOJA 2LRPA 5SV5A 2ZKLA 4OUSA 2E51A 2DVAA 2ET7A 3OGRA 4LO6B 3ZLIA 5F6LB 5LA0A 2BQPA 3OSDA 3I49A 3CJIC 4E4DX 1A34A 2I2SA 2JDZA 2O14A 1LJ7A 3NJXA 4PQ9A 4OULA 4A6OA 4Z2AA 3ST7A 4IDZA 4CDUB 5JSPA 3BOPA 2VL4A 4RQPB 4LBKA 1JYWA 1X8EA 3RGBA 1AX2A 1PMJX 2KXLA 2R16A 3WF3A 4CTEA 3W9AA 4FSJA 4WVVA 1NCQA 3JB4C 2WZR2 4CCOA 2P3KA 4A45A 4BK5A 1U5XA 2ZMKA 3DPRA 2BFUL 4Y1YA 4CDWB 2XJQA 1OD3A 1IZ3A 3GBGA 1JHJA 4RHV2 1SBDA 4TTGA 1CX4A 1QJX1 1YXWA 3BTXA 3SMHA 2JD9A 3IMNA 2Q8OA 1ASJ3 3GCWA 2P17A 4YFZA 3GYDA 1FT9A 3AKSA 3UT0A 3HD8B 1ODMA 1BEV3 1LHVA 2LTNA 3HBZA 1YQ5A 3TWIA 5FRAA 1V9U2 1O8PA 2WWJA 5C3OA 4F3JA 1TG7A 4Q4X3 2UYBA 2VCBA 2FDHA 4HETA 1YYNA 2AC1A 3N9PA 4EN0A 5L36A 3WNOA 2MNGA 3ON7A 4L11A 3U37A 4ZONA 2CTVA 3I2DA 2R1DA 4S2FA 4WM7B 5F5QA 3ZYJB 3WUDA 4YW1A 4Z1VA 4PLMA 1OF4A 1WCDJ 2VCCA 3X29B 5ACA3 4XDPA 3D8CA 5FO9B 3ES1A 2EIEA 3EBRA 4XFFA 4XACA 5I8TA 2PHWA 2WZ8A 3AYEA 1HIXA 1V70A 3ES4A 5IUQA 1EV12 1COV3 2BUKA 4W50A 3WX5A 1C8M3 1FMD2 2CY6A 5IAXA 3J7MA 1UO9A 2QKDA 4M4PA 1V6LA 2RM23 5FIXA 2XMLA 1CPNA 4CCEA 3KVAA 2FZ2A 1RUD1 2FDKA 1V0AA 1AR82 2F4PA 4Y20A 5F3IA 1D2QA 4BMEA 4ZPIA 4DUVA 3L9JT 1JYVA 1RVF1 1XNCA 4UYBA 5A6XA 1AR73 1CIWA 1PK6B 1AXZA 2QNKA 4L9BA 4WVZA 5FY7A 3UGHA 2PXJA 1LOGA 1RUF2 2EXIA 4I3PA 5FYMA 2P3JA 1HQWA 5BNPB 4M3CF 3H42B 4IE6A 3CHXA 5F5CA 1S2EA 1KFXL 3HEIA 2JB8A 1HQNA 1PVXA 2Q8CA 2HWC1 4J6GA 2EAKA 1H6XA 2HWF2 2YZ4A 3NNJA 3RFRA 4A2UA 4N53C 3W59A 1RUG2 3GZUC 1WD4A 2ZEXA 4DS0A 1EAH3 3VB9A 4RFT0 4ZHNA 3R4SA 2DWRA 2HWE2 2PHDA 2XWBB 4RYDA 1C1LA 3POJA 3DF0A 4A41A 3AMNA 5FPAA 4LLFA 1BXHA 2QVSB 3NO8A 1UY2A 2JX9A 1YWKA 1DP0A 4HONA 1ZRIA 5BNNC 3O1VA 3ETPA 1RHI2 4GH4B 3SQOA 3H1YA 4YLZA 4ZU4A 4Q8KA 1YQ8A 2A6WA 3DYOA 2RDQA 3OBZA 4EWAA 4FXKB 4HSJA 4EZ4A 3MO4A 5FZIA 2VMHA 4XBLA 3ZOIA 5ISLA 2EF6A 4ZU7A 1D4M1 1PGW2 1CWPA 1W3VA 3JUUA 2BNNA 3I54A 1NUKA 1UN1A 4ASMB 3LWCA 1NG0A 2RS13 2I74A 3AP4A 1OLME 3U78A 4XJ9A 1YRZA 1UXXX 2WL1A 4Y5TA 1GR3A 4O7XA 3PHMA 2GNBA 4NPLA 4D6SA 1I6XA 4LHKA 2ZS6B 4Q2FA 3B3QE 4QXKA 3MV01 2VH9A 4BQ5A 5ERLA 4INDA 5T5LA 1QWRA 2YGMA 2WNVC 4UW5A 5FJHA 4AEDC 1ND3B 4K21A 2YYOA 3H7YA 4OI1A 1FPN2 1AR61 5C3RA 1CIYA 1FNYA 4CPBD 5BXXA 3VBFC 1VBC3 4U2AA 3VL9A 3WW1A 1JYTA 4IGQA 4XTPA 1WLDA 5IK7A 5T5JA 3S5QA 2E31A 4CCMA 1ST8A 2DCKA 4IEXA 4AXOA 5L7OC 4LULA 5F3GA 4JX0A 1E57A 3V65A 4AQTA 2YUEA 1XNKA 1Q8VA 5LK7B 4PIZA 2QBXA 3GHNA 4C0BA 1ULFA 5DAQA 5T55A 1RUH1 1W9TA 3INAA 3VL8A 2VNVA 4IEZA 3ACHA 2JDUA 3LFMA 2YBSA 3I7DA 4BQ4A 5GJ6A 3ATGA 5J36A 1VIWB 3CO2A 3RZMA 3PUIA 5FREA 1VBB1 3KF3A 4RS5B 1XU2A 4AOCA 4JCKA 1AXKA 1RC6A 2VBDA 3ZDVA 4BQWA 5J7MA 3PVNA 2WNUC 5FZ1A 4GXLA 4AEJA 2G4IA 2Z42A 5A7OA 2EXKA 3IDCB 4Q0UA 1CAVA 5LB6A 4YZ3A 2DVDA 3DUIA 4FOVA 1WW5A 4Q4V2 2JG8C 2R30A 4PDWA 3GJBA 3WR0A 3VBOB 1SLLA 1QJX3 1WBFA 3NKGA 2E26A 2V72A 1XOYA 4R9BA 1ZRFA 4G3YC 5FZLA 2WRAA 3JCIA 4DXRA 2DU0A 3QOPA 1S0FA 2W91A 1GUIA 2YC2A 3LFIA 1HB3A 2Y33A 3VKMA 1HN0A 1JH5A 2WC2A 4QT6A 4LUKA 5D2AA 2VNRA 5IAVA 2O8QA 3B69A 1GZWA 4XIOA 3K77A 3MIGA 3ZXDA 2RS51 4AVVA 5LBEA 4DY3A 1DDLA 1OT5A 3WP6A 5CAZA 5HCBA 4YZ1A 4OQ8A 4DEVA 5IW0A 2QUOA 5GKAC 1BBT1 2P4EA 2VVFA 5AVPA 2TUNA 4CCLA 2HYKA 3IIAA 1ZBE2 2VC9A 3CMGA 1PO13 1S55A 4YW2A 4PI2A 2UWCA 4QHBA 4QXBA 1AYN1 5EHDA 4IV3B 3VBSA 4B1LA 5F1RA 1JYXA 2W92A 3RJRA 5FYZA 1TMF2 3VGIA 3VHPA 1ZRRA 1RINA 1A8MA 4GWNA 1UU5A 3M7AA 5GZEA 1LU1A 2W1WA 5JIUA 1REEA 4DUXA 3ZIWA 1QJY1 3E6BA 1BEV2 1J84A 2XGXA 1POV3 4MX3A 3FLPA 2V73A 2CU5A 3ILRA 1TNRA 4Y20B 1C5IA 4Q4X2 1H1AA 1QXJA 1W9WA 4E4ZA 1O3SA 3TN91 4CE8A 2WO2A 2AEYA 5FPLA 5JCTA 1MEC1 3B9IA 4FTSA 1G9DA 1SPPA 4QPIB 1X82A 2ENRA 5EJ1B 4AVTA 1OOPC 1LENA 2XVLA 1H6YA 1MS3A 1RUI3 1UY1A 2PHLA 3ECQA 4GALA 4EWEA 3N7LA 5ACA2 1AL0G 3EQEA 1IS6A 2AUYA 2Q30A 2NMNA 3NAPC 1MR5A 3IM0A 1L7RA 3HNMA 4AGGA 3BI3A 3WEZA 3C7FA 2CHHA 5F32A 1COV2 1ZBA1 2F4LA 3WDWA 2JD4A 2D6KA 5E89A 4XFIA 3AL6A 2HWC3 1DQ1A 2Y6KA 4B7KA 3THDA 2XVGA 1NCRA 1EPZA 4KWLA 3VBUC 3L2YA 1K3IA 2EXHA 4N43C 1DQ0A 5A3UA 5K7PA 1CESA 1UY4A 1SLTA 4AI0A 2AREA 2VOKA 1ZREA 1YIPA 2P1BA 3LEGA 3OY8A 3VZJA 5B2GB 2PAKA 2VTXA 1AUYA 2G19A 1KS4A 1AYM1 2OZ6A 2R072 2UY8A 4M3CE 3NJZA 2W1SA 5B4NA 3WW4A 1EPWA 3GCXA 2SBAA 3U07A 5JXJA 1I3HA 1BMV1 5IJRA 1O6UA 2XDVA 1D4M3 2LW8A 3TOJA 5BV6A 3ZYRA 1JMUB 1W2NA 3KGLA 3POWA 4L8QA 3ZYGA 1XU1A 3N7JA 3GDBA 4LIUA 1EAH2 4PT6A 3LA7A 5FYIA 4JDMA 3R4DB 4QAWA 4CP0A 3E5XA 3NNFA 3ZFEA 5GLWA 3I3QA 5FWEA 2WLPA 1QIQA 1YC61 3VLBB 3Q8BA 1HB2A 3QLQA 4RGKA 2HJIA 1W8OA 2ZX1A 1Q3EA 2W47A 2PN5A 1QOTA 2XJSA 1AR63 4FP2A 2JE7A 4WV8A 1KS5A 2JG9A 5FWJA 1WLCA 3E6DA 1R1A1 1STMA 4BXFA 5C3QA 1VRH1 1DF0A 3CL1A 3T09A 1CAWB 5BY5A 2IFRA 1V6MA 5FCCA 3GBWA 1GQGA 1V6NA 2WT2A 3VZKA 1AZDA 1H2LA 1PMHX 4H14A 3T1LA 4ASKA 1FNZA 1QH6A 2RS12 2W08A 3FHAA 3I2GA 3WDXA 3O1MA 1AF9A 1RTVA 3O0XA 2ADDA 2XLFA 3KV5A 1JTZX 3POBA 4FOWA 1LTEA 1ACCA 5HBAA 2R1BA 2GMPA 4I02A 4M0HA 5ANNA 1AL21 2X05A 4MYEA 3SNMA 4BQ3A 1O3QA 3PVBB 1YFWA 2IUWA 2UU8A 5A32A 2X10A 4JAAA 3UJOA 2VG9A 2Y0OA 4CDQC 1OH4A 2BGCA 4FTEA 3LD8A 2PA7A 3BIWE 1S0JA 1GZTA 4FPCA 4WM8A 2J1VA 2YROA 5FZFA 3MF9A 1S2KA 5HCFA 1CAVB 3POGA 5FUPA 1UYYA 3ZN4A 2BFUS 3ZXKA 4A7YA 1Y7BA 2BBAA 2CGOA 3IAQA 2E7QA 1QMJA 1UU6A 3UYJA 3VDBA 1LAJA 3WNNA 1NXMA 3ENRA 1XBFA 5A1LA 3KCYA 4TN7A 4XBNA 3VBRA 3ZXEA 2RS33 3J7HA 1WD3A 5BPXA 5DG2A 4LXLA 4X8PA 3LF7A 4UFHA 4E2SA 2R041 2ZGLA 4UF0A 4DINB 3NL1A 5CYYA 3ITQA 2XJPA 2XQXA 2ZACA 4YVWC 2ETEA 1DZRA 2YV8A 3N9NA 3OBTA 4QQOA 3I2JA 4QXCA 3T4VA 3WT3A 1CX1A 1GZWB 2W1UA 4J1XA 3WF0A 4FI9A 4XVHA 3I2FA 4F8AA 1V6IA 2UURA 4Q4W3 4XDQA 3Q8FA 5L19A 1TQ5A 5DMYA 3RSJA 2XL9A 4YWAA 2DU1A 4NIGA 2HWF1 1LHNA 3ZDSA 1PM7A 1W8UA 4BOWA 4COUA 4BCUA 3ZSMA 4BK4A 4D0QA 2R0HA 2WFF2 5LBBA 2D6NA 4AVAA 4NHMA 5JWPA 3O1PA 3WNKA 2UYAA 1W8HA 3MUZ1 4LBQD 3ALQA 5JVVA 2L9LA 2WWSA 4QGLA 3A23A 1EY2A 1WCKA 5F2WA 5ABJA 5C9AC 2P5BA 3RZZA 3OYWB 1X50A 1QJY3 3POYA 2HEYF 5LK5A 1UOFA 3BN6A 4QKFA 4M0NA 4IV1C 2X5IB 1Y43B 3IKWA 4UBHA 1XYOA 3A0KA 2ARCA 4HKOA 3AYCA 2B5HA 3MHZA 4W65A 3TN93 1C4RA 2D3SA 3LSEA 3WW3A 4QPGC 1O8SA 3RYRA 1SZBA 4P02B 4NR1A 3WG3A 2J42A 4JKLA 3CBNA 1AXYA 4KU7A 4IETA 4ZZ5A 3H0OA 4Q4Y1 3J8F1 4QX5A 3U75A 2TEPA 3O5SA 5LW9A 1GQHA 5IK5A 2RJ2A 4HBNA 4WVMB 1ZZCA 2VU9A 3LE0A 1MS4A 1FPN1 1E5SA 4TZDA 1ALYA 4A44A 1YLLA 2C4XA 5FTTC 1NCRB 4I01A 1GICA 1Y4WA 1E5IA 4QQ2A 1WA4A 2DBIA 3H1WA 1NA1C 1VALA 1ND2C 4XXPA 5F9TA 4NOTA 4AVBA 2W3JA 1C28A 4ITCA 2VUCA 3OCPA 1PX3A 3OY8B 5I0TA 1JZ5A 3C7GA 2FMYA 3MIDA 4YW7A 5A7SA 2RMU3 4GWMA 4E27A 1ZZ8A 2OPKA 1P8JA 5DAVA 2VOXA 4KL1A 1GNZA 4D6QA 1CAUA 2WO1A 2WS91 4YGBA 1DGRA 1SLBA 2FCTA 3JQXA 1J3RA 4XDOA 3LZZA 2QDRA 4I0AA 2BYVE 1CZTA 1VP6A 1WMDA 2VAUA 3V64A 3H8XA 4CEWA 4GAZA 4K9SA 2KD7A 4NE9A 4CUAA 1H4GA 1X33A 1F4HA 3HT2A 5F3EA 2KA3A 1SEFA 5M0TA 1KJRA 5FOBB 2P6HA 1DZTA 3FFQA 2WYFA 5JIAA 4KWJA 3NKTA 4XILA 1LHOA 1OH3A 3PDQA 1DHKB 3ZFEB 4OLLA 4BQ1A 2D5HA 3BVCA 3WLUA 3HMYA 2VY0A 3NV2A 4XZPA 5JSRA 3P5BA 1S0DA 2JE8A 2ZEZA 4FFIA 2DV9A 4DRVA 3ZSEA 2JXAA 2NLRA 1B35C 2D7FA 1EYBA 2VVDA 4OFGA 1VBD3 2A70A 5KHJA 1BCXA 4FPJA 2OZJA 5FAXA 3MV11 2DCJA 3U4SA 2XJTA 4D8MA 1ZZBA 5CBLA 1SMVA 5H9QA 2BVVA 4TLGA 1W6OA 1R1A3 2GNTA 2PELA 2Y6LA 1HXS3 1JYCA 4QX8A 5DDJ3 5F5AA 3A22A 4L92A 5A7PA 4P9LA 3AMHA 4ZZ8A 1HLCA 3TEYA 1ZBE1 2HYXA 3JD71 3PVOA 5A3OA 4NAOA 2QQPA 4XUOA 4Y1XA 1OFSA 1R082 4YG3A 3CNAA 5E8AA 1TMF1 1AL23 1SCSA 5K0UA 1N3PA 1GOHA 2MEV3 4WM8B 4CRQA 4IXLA 4R8HA 1RUC1 1CZSA 3G7DA 4XUTA 1MZEA 2WIIB 4YZ2A 1C8NA 1DCSA 4LBQA 3K4AA 5BNOC 2HWD1 4I3GA 2Q8EA 3SCFA 4M01A 1AR93 1UPIA 4Q0SA 1GP5A 3CIHA 4DFSA 3M1HA 4AFCA 4MLOA 2ATFA 5FYCA 4GWIA 2C24A 5C8CC 3CJIA 3OPTA 3KCXA 4XJZA 5A33A 1V6OA 4KGGA 5CNAA 5LWBA 2J1UA 3J4UH 3WP3A 3B01A 3U0ZA 3OBRA 4NJ4A 1XC6A 4BB3A 1F8VA 4EYUA 1POV0 4MSVA 1GNYA 3T2QA 3WW2A 4YW3A 4OHWA 4B8EA 2DUOA 3BALA 3B02A 5FYUA 4GB33 3OPZA 4TLFA 3RG0A 4JGYC 4NIIA 2VZSA 4XW3A 2OQ6A 3GF6A 2P34A 1JU3A 2BJSA 3AKRA 4AI1A 2QQUA 4COYA 1VAVA 1ONAA 1J1LA 1H1IA 1QEXA 2ES3A 3U10A 4UFJA 4B4QA 3GZAA 2GP3A 3K48A 3N35A 2DUPA 1QGLA 4LEJA 4KWKA 3VD9A 5DUWA 3P1IA 1Q8PA 5E1RA 5EZWA 3VHRA 1R091 5ABJB 1RMU1 1LGNA 3FX3A 4I09A 5KBFA 3T30A 1UCXA 5FP4A 2P6CA 4XAEA 2R071 1HRI1 4I0BA 2AENA 5EFUA 3WY6A 5IYYA 3OEBA 2ERFA 2HWB3 4ZXEA 1EUUA 3DKQA 1NY71 1BK0A 4PBPA 3W20A 1IGOA 2J1RA 5FKBA 3WDTA 1XRUA 2WO7A 4LLOA 4ES9A 3WV6A 4Q4W2 1WCQA 5D1IA 1OMIA 3PUAA 4HXCA 3U11A 4YSFA 1D0HA 1FXZA 3RQ0A 3AZYA 1E5RA 4C0HA 2MPFA 4XUPA 5F6KA 4N7IA 4CDXC 2A6VA 1ZRCA 3P6BA 4F83A 4U36A 4QMAA 2WABA 2ZHNA 2K2SA 3KV9A 4LA3A 2RR13 3I2KA 4OCTA 5T50A 4AHWA 4W6WA 3MUY1 5GZCA 3MYXA 3ZYFA 3SH4A 1DG6A 2B42B 1QJZA 3P3NA 4RQPC 4JDOA 4HPKA 1JW6A 2B39A 2O0OA 5A3MA 5IK4A 2Q1ZB 4NROA 3WG1A 4XJUA 4HANA 2ZOEB 2BV4A 1I1EA 1H2NA 5LY1A 1IOAA 2W52A 1GFF2 4NHLA 3ASIA 1US3A 4CDWC 2WBKA 4F7ZA 4XF1A 4IE0A 5C6CA 2Y6FA 4C90A 1DLCA 3NNLA 1QJU2 2GZWA 5FUIA 3VUOA 4MOAA 1CAUB 4DUWA 3ELNA 2OW4A 1ULCA 3S30A 5J96B 2ZX0A 5FZBA 4FPOB 4YGEA 1PZ9A 3T3YA 3TRSB 1A78A 1GNHA 4CEWB 2RVAA 2WS93 4PQQA 3GGLA 4N53A 3A0NA 3FJSA 4LKDA 3I2HA 4CSWA 1ULOA 3Q8AA 2ID4A 4XUNA 2UWAA 2J1SA 4NVPA 1MS1A 1LODA 2YC4A 3T2OA 4QX3A 5CFDC 2XR4A 1WCSA 2IXHA 2R062 3VZOA 1FAYA 3L2HA 5FYVA 4DY5A 5BNNA 2SLIA 2XBO3 5CEHA 3OUJA 4HL0A 1NLSA 1JU4A 4GKXA 2JECA 1F35A 4YNIA 1JS9A 1I5PA 5FZ4A 3HNYM 3PJQA 1W9FA 1FOD2 3GBFA 5DG1A 2RMU2 4ATEA 1LOFC 3MIHA 4P9YA 4BQYA 5IK8A 1QOSA 4BZ4A 3AJZA 3OOXA 4IEPA 4O9GA 2JDNA 1W6OB 3WHUA 3B94A 1RUE2 1VBE1 4NWWA 1G8WA 1PVC1 2WQZC 4XTMA 3W21A 2BPA2 1W9SA 1SLCA 2AGSA 2JDKA 4HT1T 3SLIA 2G9FA 2EIGA 3FZ3A 3Q8EA 5GALA 2GH8A 4O9EA 3ZMOA 4XJAA 4CCJA 2D6OX 5JMOA 4JGZC 1W90A 3W5MA 3ACFA 2WFF1 2WNVA 2ZTNA 1RUJ1 3JD73 4LORA 1PK6C 1SFPA 5F2SA 5K0UB 1O4TA 1YI7A 4AG4A 4BXSV 4YM3A 2DTYA 2ZGOA 3VBFA 4I0WB 4CVUA 5FZDA 3AX4A 4D3WA 4RFRB 2LROA 1JXNA 1VBD2 1RJ7A 5L7OA 2HWD3 1HRV3 2ARXA 2DCZA 3M70A 4FFHA 4S2GA 2X29A 4XF9A 4BH9A 3O0WA 3LDKA 3CJIB 4XXAA 3LIGA 1T2XA 5A33B 2OA2A 3CLPA 3ZYIB 5I0SA 5GLTA 5FY9A 2YXSA 1HXS2 4N9HA 5FQ0A 1KD7A 3KV6A 1IS3A 1MZFA 3D3AA 5DDJ2 4EJRA 1JOJA 1D4VB 1OLMA 1Y3TA 4DZGA 5JZGC 4RD7A 1UIJA 3S7IA 3UGGA 5EJZB 1QQP3 2PLV1 2QQNA 2VQAA 2GC3A 3HIFA 4W6YA 1YIFA 2WNUA 1LCLA 1TME2 3AKQA 2VQTA 5E16A 2GMMA 2Y6HA 5FK8A 2MEV2 2XLAA 3BODA 1N3QA 4PF5A 2DVBA 4DOUA 5EYYA 1N3OA 2CGPA 1PO22 2JG8A 4QWNA 4ZY9A 3LKJA 4CCCA 4J1WA 1W8FA 1AR92 5JSOA 1Y9GA 4PLNA 2PMWB 1RXGA 2VXRA 5LA2A 2VZUA 3AXEA 1V6JA 1W03A 4ASLA 1REFA 1DGWX 1VR3A 1VAKA 1LB2A 1RUOA 1R093 3HQUA 3OB8A 3KS7A 4YM2A 1MS9A 4BIFA 3KHCA 1LNSA 1W6MB 3WF2A 2EIDA 4UXAA 1Z7S3 5AC91 5JXGA 5IVFA 3AVSA 4LR4A 3DECA 2A6ZA 3USSA 3U14A 2E6VA 3PL0A 2GC0A 1H2MA 2DUQA 2PHUA 1NYWA 2E7AA 1K5MA 1W0OA 3C2UA 1ZVFA 3LOIA 3UJQA 3UKVA 1OSGA 3ZXFA 4W4ZA 1NT0A 1FV3A 1O59A 2XPJA 3LDRA 1UX7A 2E32A 2VD7A 4DPNA 4JTNA 3HPNA 4GMP1 4BE3A 5A1AA 1F31A 2D6MA 5G05L 4I2OA 2GU9A 3WQ0A 3K3OA 5D8AB 4XHXA 3RDIA 3FHQA 4IEYA 2ORXA 1MACA 3RWKX 1XNTA 5JOWA 4UT5A 3HT1A 1DYOA 5DZEA 1WGPA 4HPKB 4IEOA 5CADA 2VZTA 1IQDC 1FX5A 2YU1A 3ACGA 4RS5C 4MO3M 2XLGA 1N1YA 2CSGA 4HOOA 2VZRA 2HWB2 5FXZA 1MVQA 1OOPA 1PZ8A 2AH2A 4KQ7A 3AFGA 3K46A 5LA1A 1Y9QA 2QDNA 4XMAA 4LHSA 1JBCA 2N7GA 4B29A 3E1F1 3NAPA 1UKGA 2VZVA 4IEQA 4DXSA 3VBOC 1PIV1 3M3CA 2OUHA 1R081 1H2KA 4X6RB 5C71A 4IW3A 4JDNA 4JKMA 1JZ2A 1VPHA 2RR12 4FT8A 4Q1RA 5K4LA 3PUHA 5JAXA 1DBNA 5T54A 4A3ZA 3ZX7A 3JQWA 1OA4A 4TYSA 3VBUA 4Q5OA 4BU2A 2V5YA 4N43A 2PTMA 3J26N 3W58A 3MDPA 2LS6A 1VB4A 5BNNB 4Y1VA 3O1OA 2WQ4A 3MBWA 1YNAA 1O5LA 1NCQB 1SBEA 3RYKA 2PHRA 3O7OA 5A70A 1Q8OA 2R32A 3OEAA 1PGL2 3AP5A 4CEYC 3DPRB 3O0VA 1MZ5A 2JWPA 3I3DA 4IV3C 1WMFA 5DN2A 2Y8KA 4NN0A 3C7HA 3CDZB 3EYPA 5I0RA 1LRHA 1VMJA 3ACIA 3RPQA 3T0DA 4RR3C 4Y22A 3J7NA 2YFUA 4KMQA 4PF1A 5GZDA 2RG4A 2E9QA 1VBE3 3SITA 1NXD1 4FQZA 2ZGPA 1X8MA 2DF7A 3BB6A 1WLTA 3JBG1 2YB7A 2ZPXA 1BJQA 3HVDA 1H1MA 2WNVB 4IE5A 4Y4YA 5F5IA 3IMMA 3V0AA 2VCAA 5H9RA 3JZVA 4JKKA 2WAOA 1AX1A 2GSYA 1VMFA 4QPIC 5FY5A 5C4WA 3VBFB 5CA6A 5HXMA 2JEMA 2E7TA 1NZIA 2H6CA 2XBO2 1UZZA 2R7EB 1PM4A 1WLWA 3I59A 4G9SB 4QDRA 1L7QA 4E9KA 3JU9A 4HMZA 3U4XA 5FPUA 1JZ4A 1T6BX 1REDA 3VDDC 2QFEA 4M3CA 4Q27A 5I0DA 5FZ8A 1CD3G 2GC1A 4C91A 2W0XA 3RI9A 4AF9A 5LEJA 3HQXA 1ASJ2 1DLLA 3HOBA 1C5HA 2ZZJA 5FQ0B 3VKLA 2O1QA 4K8RB 2OX0A 5EJ3A 3NNGA 3RZJA 2UWBA 1NOVA 4EN6B 3FE5A 1X36A 1UW8A 1T6GC 3H50A 3MICA 3ZN6A 3ZIXA 5EQUA 1OPOA 2BRTA 4L0PA 5IVVA 1UMZA 4CDQA 1RUD3 1SDDB 4AL9A 4AGRA 2WNUB 2A6XA 4ISRA 5KXCA 3DGTA 3ZO0B 4GJZA 4CU6A 1PHMA 1S0IA 2XXZA 4JHTA 2B4KA 1RVF3 4PLOA 4XPVA 1A6CA 1XYNA 3FL7A 1KITA 1WW7A 2JG8B 2XJVA 3LQCA 2DTWA 5FJKA 4XFAA 4QHOA 1YHFA 3NV4A 1UQXA 1YCIA 1J83A 3I2IA 3VHNA 4E4SA 3I2OA 3IB3A 2MHFA 4IGOA 1O5UA 2EVXA 2AYHA 1YUDA 1VBA1 1H9WA 3WD5A 2IXIA 4K1ZA 4LHNA 5I93A 1CPMA 1C8M2 5C7GA 4YVWA 1W0NA 4CPBA 2TBVA 2RJLA 1X9TA 3JB8A 3WDYA 1IKPA 1N1SA 2RM22 5K8SA 4PIXA 1AJKA 4QGNA 2QTWB 2HLEA 2WN3A 2D6PA 2HKXA 2BDRA 4XJWA 1W2UA 1JOPA 1XYPA 1WCUA 3I3BA 1QQP2 4JQTA 4MVTA 4CU8A 2QCSB 4AEMA 2ZZQA 2BBVA 1AR72 4LA2A 5JOZA 4PHZA 1K5MB 1QNWA 4P9GA 1URXA 3GHMA 3OUIA 3KT4A 2Q8DA 3USUA 3QBQA 2ZGKA 5LZ6A 4EE2A 1UKRA 5DXDA 5CFCC 1LULA 4KNCA 3SEEA 3C8XA 2BNMA 2D93A 2GALA 4P5HA 1OKQA 5A1FA 5C9AA 1H0BA 1XPWA 3AP7A 3ZFGC 1G6NA 2WZR1 5J37A 2VW0A 1WBLA 5FY4A 1AJOA 1FOD1 4CUGA 1BLZA 3BYWA 4IV1A 3D0JA 1QNYA 4RHV1 5A3TA 3ME2A 4NMIA 4P5YA 2C1FA 5FP7A 2EICA 4LO8A 4ES8A 2YC0A 1RUE1 3EJKA 1OOPB 1R64A 1Z7S2 4QPGA 3WDVA 1RJ8A 5FFOC 1V9U1 2HEVF 1F5JA 3I97A 3NAPB 3ZSKA 2C6SA 1W6NA 4HG6B 3N9OA 3SH3A 4O65A 1MVEA 1ZRDA 1DU3D 4OHZA 4YW5A 4AYUA 1W6PA 1S0BA 1AHSA 1XNBA 4UFLA 5C5UA 1UPSA 1LGBA 1UYXA 4GZ9A 4OYUA 1KFUL 3ZSLA 1A8DA 3WXPA 4YZ5A 2Z4FA 1IG3A 2BNOA 3IDBB 1MQTC 5A7NA 2AZ5A 4HKLA 4K40A 1MS8A 3MLKA 4N43B 2P3IA 1NA1A 1RUH3 1O4YA 5GM0A 1K5JA 3DL3A 5FUNA 1EV11 1J59A 4Q0VA 1V00A 3H7JA 3THCA 1APNA 1FMD1 1VBB3 2HBTA 3PU3A 2QQKA 3GZTB 4YW4A 3HBKA 3FFZA 3WZ1A 5A6YA 1GV9A 4D6RA 1VBC2 4AI2A 3BTYA 3S5AA 4PDWB 1AR81 1W8TA 1YQ2A 3ZXLA 3BIEA 4Y22B 5ANQA 1W2TA 4JVAA 4Q26A 4TSVA 4AW7A 2BOIA 1HV1A 3FBYA 2IC1A 4XFGA 5KC6A 1IPJA 2BW8A 1DGLA 1LESA 4QB6A 3FWEA 4R4XA 3M8LA 1RUF1 4XJ8A 5FYHA 2BVBA 2CV6A 2YBPA 1XJAA 2WR9A 2X5IC 3JBG3 3V0AB 3QH6A 4R9CA 2JDHA 5C4WB 4IUGA 3K51A 4QPYA 1B35A 5LY2A 4QB2A 2FQPA 2ZHKA 2IVIB 4URTA 3ZXGA 2YFZA 3N9LA 3I59B 4CP9A 2RS53 4G4FA 3AYAA 4HK9A 1RUG1 4QX1A 2CAUA 5C3PA 4BMBA 1X7NA 3THPA 2HWE1 1BBT3 4KG0A 3VBSB 4M3CB 3LEMA 2FZ1A 5KWRA 2VNOA 1NE6A 4BIOA 1AYN3 1UXZA 3OGJA 1V6KA 4FVVA 5DZFA 1YI9A 1JZ7A 1QJX2 3K75B 3UV9A 1RHI1 3APBA 1TE1B 1QDCA 4YVSC 1XE0A 1H30A 3SCHA 4YG6A 3MLLA 3LEIA 1FI2A 4E2GA 4C1XA 3LSDA 4YW6A 3AMMA 4X8NA 5FP3A 4Y24A 3ZN6B 4CXYA 1OQEA 2ZEYA 4CDQB 4EQVA 1Q5OA 1PGW1 2XUEA 1HB4A 5DUUA 3OGVA 4FTBA 4S2HA 2G9ZA 1E5HA 1O7FA 1SPPB 2ZGMA 3A7QA 2JKXA 2VJXA 3PUQA 3UKNA 5BNOA 2FDJA 1MEC3 1Q8QA 1GWMA 1UOGA 2IXJA 3ILFA 3MLJA 4QDSA 2D5FA 3SHRA 4HVOA 1C1FA 4B7EA 5FZOA 2D44A 2BGPA 4UFMA 3V0BA 4QM9A 5C8CA 1PO12 4DQAA 1DQ4A 4HSLA 2VMIA 4BISA 5F7UA 1UF2C 5I91A 1W8WA 3AKTA 4FPLA 1O3RA 1JYIA 3ZKYA 2OS2A 2KM2A 2CDPA 5FZ3A 2VGDA 1Z0HA 4YVWB 5LASA 4A4AA 1ZBA3 3OJBA 1JZ8A 4GULA 1VRBA 2V4VA 4JTOA 5IATA 3POIA 5C3SA 2J7MA 3WF4A 4DMIA 1RXFA 3H3LA 1UOJA 4GD4A 2J1AA 2WJSA 4J25A 4RSUA 3ZXJA 5L9VA 1XNAA 4JGYA 4Y5SA 3TAYA 1KDMA 2P3YA 1Q43A 1GMMA 4FPEA 4Y5Z0 5CKQA 1RUD2 2VMEA 4DEQA 5JOYA 1W39A 3MW2A 4I30A 1D2SA 2GAUA 4D69A 1RVF2 2CWSA 3WNPA 1RUI2 1F4AA 1AYM3 3DYPA 3WSOA 2VTFA 2VMFA 1GP4A 2P37A 1J58A 1NAEA 1U5IA 3VDAA 5C9AB 4K7JA 2XG3A 4WBBA 5FZMA 4K20A 4BHPA 1F9KA 4O61A 3SCGA 5LRSA 4BA6A 4FAHA 4IV1B 2HWC2 2WZR3 5EV7A 3V0BB 1SLAA 2R49A 2VBBA 2QJVA 1I9RA 1BVVA 1OVSA 4Q4V1 3VV1A 4AE2A 3UETA 4AK3A 4RHV3 1HX6A 3NSTA 3ZFFC 3ILNA 4QPGB 2FBEA 5HCHA 1OLRA 3EMRA 1UOBA 2PAEA 1HKDA 3BGAA 4UFKA 2JKBA 1NLQA 2FHRA 3DKWA 5A80A 2JG9B 4LKSA 1W6NB 4CDXA 3N36A 2IZWA 1S2BA 3ETQA 2DURA 2OIIA 2K9ZA 4QKDA 1OFNA 1JHNA 4JC1A 4LJHA 4LKEA 5D21A 2H0VA 1CONA 1VRH3 5B4XA 4NIAA 1IPSA 1D4M2 3PIGA 2X8KA 2WO3A 1KEXA 3ACLA 4HZFA 4P9IA 4XUQA 4B4RA 4GQ7A 2D40A 2QE3A 4CCKA 1I5ZA 1QXRA 1QXPA 1KQRA 3RMYA 1NZCA 4FCAA 4UWDA 3N7KA 2F17A 3GALA 2Y38A 3GNEA 4LMFA 4NRPA 3LIHA 4QKBA 5EXOA 2ARBA 5FZKA 1W05A 5A32B 4UW3A 4A42A 1G9CA 3OTFA 5JR7B 5FP8A 1DYPA 5J98B 4CDWA 4AAPA 2WKKA 4DIQA 1DGRN 2CDOA 2EIBA 2Y64A 5L9RA 3BU0A 1BEV1 1FMD3 3IDEA 4YFWA 2WSVA 5A7WA 2XH6A 3CJXA 3E5QA 4IEWA 5L9BA 2ZGQA 4COWA 1AR62 3TEZA 3WHTA 1FATA 2Y60A 1KDKA 4Q4X1 3VKFC 5JXHA 2VUDA 3AC0A 3VBRB 1XSRA 2VZ3A 2WZEA 4ZS2A 5JI7A 5A6ZA 2JIGA 1GANA 4FOQA 4UF0B 3SC7X 5CFDA 3UESA 2FDGA 1NE4A 5GLUA 4XCBA 2ZXQA 2R043 3NJVA 5ACA1 5DUVA 2W1QA 1POQA 4Y1ZA 3T0BA 1SLIA 2EA7A 2W46A 3LOBA 3KSCA 4CP9B 3CQOA 1GZ9A 1MPXA 1COV1 2BP6A 1LOFA 1VBB2 4DB5A 4H7LA 4BM8A 5IT6A 5EPAA 2HWF3 2Q1FA 2YG0A 4BJ0A 3H8UA 1DQ5A 1RUG3 2HBUA 2YGLA 3DEMA 3KB5A 4XQWA 3VHOA 1BK1A 1K12A 1KRIA 4D7YA 1H8TC 1WA6X 3KT7A 5CG8A 1DQ6A 4FXGB 4C8DA 2NYYA 1Q8SA 4XZUG 4AGVA 2W5FA 4K1YA 1ENXA 5FR3A 4XURA 4Z92B 3VBHC 1RB8G 2C0ZA 1ZM1A 2RS32 2PHXA 4QGMA 4JGZA 2A75A 1PK6A 5LRRA 4YPJA 4JRLA 4QXHA 5FMCA 4OMDA 5T52A 1KXGA 5BNOB 1PZ7A 2Z69A 2WINB 4R9AA 3S7EA 2RS52 1ZZ7A 5FZOB 2ZCWA 3R0RA 1ZZ9A 4XEZA 1PMIA 1EAH1 5C8CB 3VN4A 3EO6A 3T2TA 1OVPA 4CXXA 2VZPA 5JUVA 2ZGUA 2O8OA 3FMGA 4Q4Y3 1CGPA 1CJPA 3J8F3 3WCRA 1XXNA 3V56A 1KJLA 4YGCA 3IIIA 3MFCA 1AYN2 4S2DA 3PJYA 3IZOA 4CDUC 5FK7A 4BLJA 5J48A 3MPPG 5HPOA 4AFMA 1FPN3 1L3JA 2A71A 5JZGA 1QDOA 3CU7A 4LUMA 4RN5A 4XETA 2J1TA 5HV0A 2DVGA 1QJY2 2VUAA 2XQRA 1QOOA 4JGYB 4YZ4A 4JHZA 1W0PA 3KM5A 3KCCA 4D7TA 2IXKA 5JR2A 2GN7A 4LITA 2Q5TA 5FPVA 3TN92 4FFGA 2RS11 1MZ6A 1MEC2 2EXJA 3OG2A 1G9AA 1LHWA 1B09A 4XOGA 4IGPA 1IPKA 2D43A 1UY3A 1D0GA 1CAXA 2W95A 3AYDA 3RI8A 3WNLA 2LM3A 2W9XA 1UZ0A 2EALA 5A7QA 1LU2A 2W87A 2RHPA 1OLQA 2VQUA 3KT1A 2WQ8A 2DYCA 3B9CA 4ZXKA 3VZLA 4QU2A 1M06G 1ZBA2 5BYNA 3TEWA 4IEVA 1VBC1 1LHUA 3MFAA 1OQDA 2D98A 5DQ0A 4WM7C 3RZGA 2VBPA 5KXEA 2TNFA 3AM2A 4NRMA 2X53S 3VD7A 2FMDA 2GDFA 2QQOA 2B9VA 4MZUA 2B8MA 2ZGNA 3AZVA 4CDXB 3HQRA 5G04L 4CUCA 3ZSJA 3DN7A 3LGRA 2WT0A 4AI9A 3WQBA 3NNMA 4AFDA 1AYM2 2W2IA 3O1SA 4LHLA 1D7PM 1PNGA 2OQ7A 2OT7A 1QHDA 2VR4A 3OF1A 3Q9OA 4FPHA 2C5DA 3ZM8A 4A7KA 4B4PA 3AK0A 4OUEA 1OKOA 1BMV2 5CISA 3M3EA 3PUSA 2OUJA 4CP2A 4DXTA 3ZMNA 4RS5A 4URAA 2E53A 1IG0A 2NPIA 1VMHA 2Q4SA 4AI3A 4AEDA 2JJ6A 2FCVA 3OUHA 1ZBE3 4L97A 5KR7A 3MZHA 1LOAA 4E4HA 3WUCA 4A6SA 4CA9A 3KHBA 4LBQB 4FP3A 1TMF3 3WOGA 2XJUA 5A7WB 1RUC3 4FPGA 5BNPC 3VBOA 2V5DA 2A3WA 2W94A 4QX0A 1O91A 1WKYA 2ADEA 4EROA 1JZ6A 1LR5A 5C5TA 3THTA 5FMOS 5BUVA 4HVQA 2IVJA 4COZA 3H3ZA 3K3NA 1R1A2 5H9PA 3URFA 1VRH2 1W04A 5CFDB 4AFBA 2DVFA 4OHVA 3QCWA 4PJYA 3WDUA 2A3XA 2VULA 5CB7A 4Y4RA 1QH7A 2RDSA 1TEIA 1DGWA 2Q0AA 5C33A 4YM0A 3CZUA 3BUCA 3EXUA 3PURA 1PO11 4GH4C 4AAXA 1JYNA 1SG3A 1QJEA 2JB4A 4FAGA 4N8MA 4CEYA 1AL22 1S0EA 1GU3A 2G1MA 2K0GA 5FYSA 5C70A 3D4KA 1OBNA 4IV3A 2C9AA 3KWVA 4MXVA 1UMIA 4XAAA 5H9SA 4BWOA 4BDVB 1POV1 4LBMA 1UIKA 3S0MA 4K3UA 1OD5A 4RR3A 1WMEA 2QQIA 5AFBA 3PLQA 2BGOA 3POSA 5D8AC 3Q8CA 4OZOA 3BTZA 3VKOA 4AVSA 3PTRB 1SDWA 4RGAA 4DXZA 1GP6A 4FPKA 3AMPA 3O1UA 2PHTA 3KGZA 2IWGB 4HLTA 2A3YA 2FD8A 4JGZB 2A73B 4NUBA 3HR9A 4PIYA 1RMU3 4QPWA 4LBJA 2H6BA 1ZX5A 2Z79A 3ZYBA 1RUI1 5CIRA 2R073 4QPIA 3T2PA 2R042 3AJYA 1HRI3 1LOCA 1ND3C 4XFBA 4CP1A 2JE9A 4MV2A 4NHXA 4GB32 4AQ2A 2UY9A 5CKMA 3BOWA 1W8ZA 3IT8A 3VDDA 2WA4A 4XE9A 5FZ7A 5KHKA 2LUWA 3IAPA 4MG2A 1QJFA 4N9IA 1IS4A 1RITA 3MGUA 5DAXA 2Y6GA 1SHWB 4YM1A 5IWFA 3T4HB 3ZVXA 2VOWA 1VJ2A 4BPZA 5FLJA 3H3UA 3MW3A 2V4AA 4MHRA 4PI0A 2Z2SB 3O12A 3M3OA 1OXCA 3T1MA 4AHZA 3O1TA 1UZVA 1NQDA 3BTAA 3WG2A 3AZWA 3AB0A 3AP9A 3FLTA 5JZGB 3ZN5A 1UYPA 4XF0A 1ENQA 1MS0A 4XQDA 1XSQA 1U0AA 4YRDA 3H8OA 4JQRA 1NCQC 3SKVA 2XB6C 5F3CA 2BU9A 1G7YA 2XHNA 4CU7A 4M00A 4ATFA 2D6LX 3DPRC 3IWZA 3RZLA 1VAMA 4KBZA 4LO7A 4UBGA 3AZZA 2XVKA 1KGYA 2ILMA 1CAXB 4FOYA 1AVBA 1FYUA 4MGYE 5IVCA 4JV4A 1X9PA 1GWLA 1L7LA 4N53B 2DBNA 1R1ZA 1O3TA 3WNMA 4Q29A 4Q4Y2 2XUMA 3J8F2 4JZRA 5IVEA 5GZGA 2XJRA 1UNBA 2NN8A 2GNDA 1WMXA 4P9JA 2R6QA 3C7EA 2VNGA 4MXWA 1WWYA 2ZX3A 1HN1A 3PU8A 4LBOA 1VE0A 3ZPOA 2W68A 5TSWA 3M2MA 4TWTA 5APAA 3AXDA 1YFUA 3MF6A 1O4ZA 3E6CC 1HDKA 3RWNA 4CXWA 4AI8A 5FZ6A 3PNAA 1CAWA 1JN2P 3B00A 1SBFA 2XHKA 5A3WA 4EN8B 3DXTA 5CFCA 3RZHA 1N1VA 2JIJA 4KGQA 2VOTA 4KI5M 2WT1A 2ET1A 4LBNA 2WNOA 4GIQA 5L73A 3ZFGA 2OPWA 2WS92 3AFKA 4B3NA 1PVC3 2DCYA 2OXBA 2YBKA 3AZXA 1HJGA 4CCNA 2IFWA 4PBOA 5LBCA 2QQLA 1EUTA 1TNFA 1SCRA 4AEDB 4RGGA 5KHHA 2PHFA 1JOBA 1C3HA 2GP5A 2B46X 1OA3A 1UL9A 3NV1A 4UW6A 3AVRA 2WFF3 3JXSA 2GH2A 1RUJ3 3OGSA 5KXDA 1LEDA 3R05A 3VZMA 1JODA 4HK8A 4NPRA 2DDUA 2AEZA 1U5YA 2RS31 5L7OB 1W99A 2Y0IA 1W3XA 3NV3A 2CL2A 1RUNA 5AVAA 4OI4A 5BNQA 3RMXA 1ZA7A 5FZ9A 2FDFA 4IL7A 4QKNA 1NX9A 2VQ0A 3ZYPA 2VMCA 5IVYA 1S0GA 4XQ4A 3MIEA 3UKTA 1MQTA 4A7ZA 2NQYA 5LA9A 1YJKA 2VECA 5FZHA 2JDMA 4Q4W1 4C1WA 1DZQA 2DFBA 3FHIB 2NZ9A 3I3EA 3VD5A 2PQQA 5LATA 2JICA 2VZ1A 2LALA 4P14A 3UNPA 3R6SA 2OKXA 1G86A 1GQPA 1DQ2A 3RJ2X 4LOSA 2A6YA 2CWMA 4XC9A 5JOXA 3JD72 2WZPP 2PLV3 2K46A 4CEYB 3NJYA 3KVBA 3ZR6A 1K5MC 1NQJA 2HEWF 1UMHA 4LTAA 2YMZA 4H7MA 1F2NA 2GC2A 5LEKA 4Q0PA 1W2OA 2NM1A 1BZWA 4E8DA 1RUC2 4FBFA 4QQLA 3KMHA 4RR3B 3T08A 3WVJA 3N4MA 2HWD2 3LAGA 5KHGA 1HRV2 4XABA 2JDPA 1UD1A 3LDBA 5JXIA 3BPZA 3OYWA 5CZKA 4EWDA 2CYFA 3M3QA 1YJLA 3FN9A 1CZVA 4UFIA 2ZJCA 2ZBJA 2X5IA 1GWKA 4HN0A 1QJU1 1J3QA 1GOFA 3KQ4B 4UW4A 5J3UA 4KH9A 2CAVA 5HI0A 4AVCA 3OD0A 5EIYB 2YDEA 4GWJA 4OQ9A 5FOJB 1WZXA 4XF3A 4LO5B 5GLZA 5CKNA 4RL7A 3VDDB 4ORFA 5AC93 3RZKA 2W39A 3DYMA 1H4HA 5JPMB 1LEMA 1BHGA 2VOVA 4FQ4A 4P00B 4WVMA 4WZCA 5I0UA 3K4DA 4IEUA 1ENSA 2R061 1ULDA 4LBLA 1N1TA 2BWCA 1JZ3A 1UZWA 3DCQA 5T5PA 4P9XA 4YVSA 5HCAA 5E88A 5IHRA 4GMP3 3ZYHA 4V2WA 3FUQA 2WSUA 1ULPA 3EB7A 3LEKA 4XIKA 4Y1UA 2RMU1 5FV3A 1ZNPA 4AR2A 1R092 1XNDA 1RMU2 3TYJA 1BVP1 4Z2WA 4LOTA 1TZOA 5AFEA 1IQAA 1BQPA 2A7AA 2WDBA 1W6QA 4FPYA 2ZGSA 5FY8A 5LBFA 1HRI2 1IHMA 2DCTA 3MIBA 4ARYA 1ZZ6A 5EWSA 4LE3A 4NAMA 1NY72 4IERA 4K8FA 1W28A 2Y34A 5DZGA 1YQCA 2J22A 1QU0A 3H9AA 4PDWC 4UAPA 4OMCA 3R4UA 3KZ4C 4FFFA 5JMCA 5DAWA 3AMQA 3KQRA 4META 4OUMA 1PIV3 3VZNA 1R083 2XWJB 3C3VA 4IE4A 5FYYA 5CU1A 4MHUA 3MPBA 4MXWB 3B5LB 5HV4A 3VBUB 3NMBA 5IVBA 3TB0A 4OI0A 1ODNA 1VBD1 2J1EA 1ND2A 4QX2A 5C4WC 1XE7A 3F2ZA 3UL2A 4QU1A 3AP6A 5F39A 3CEWA 3OBAA 4MGZE 1LECA 1F15A 3I4IA 5J1XA 5SV8A 4NWVA 4FO9A 1HW5A 1HXS1 3D6EA 3VBSC 5DDJ1 3ZKUA 1ZA4A 1XB9A 2XKOA 1G9FA 1N47A 5FP9A 5CFCB 1OQ1A 3HJRA 3IPVA 2ZHMA 1W9YA 3WQ1A 3GM8A 1HJFA 3GZEA 1AX0A 2VMDA 2ZABA 1YFYA 4QX7A 4MADA 3FLRA 1J3PA 2Y6JA 4KWUA 5FY0A 5FMOL 1OC1A 5FZCA 3TBDA 3ZFGB 1TME1 2ZAAA 3LA3A 4Z07A 5FPZA 3GXUA 2MEV1 1W2AX 2AACA 2YHJA 4AFAA 3ABZA 5I8YA 5HXVA 4CU9A 4N7UA 3POEA 5GLVA 3ORJA 2VZQA 4E2QA 4Y3OA 1PO21 2NP0A 3H1MA 2VXJA 5KXBA 4DO0A 1AR91 1GZCA 2BEOA 3ZFFA 2VCMA 4K6BA 5FKCA 5FPXA 5FMBA 3QD6A 4E8CA 1XE8A 2VE1A 3NW4A 3WINE 2F6BA 4NRQA 3N3HA 4L2NA 4XF4A 3QACA 2B45X 2RJKA 2YU2A 4KG8A 5FXVA 2FCUA 3ZPYA 5JPNB 2R0FA 1DYKA 1QF3A 1K42A 2WNEA 1MQTB 4M4RA 4MUVA 5FPBA 4GB31 5DUXA 1NCRC 3PMEA 1Q56A 1VB2A 1VBE2 5IVJA 1UU4A 1PVC2 2QZ2A 1LOEA 3ZR5A 4EZHA 1UYZA 2EAAA 3PVEA 4WVWA 2ZHLA 2RDNA 2Y26A 3MIFA 4NIDA 5A3NA 5JDBA 2FDIA 3KLSA 3LA2A 4NHKA 4R9DA 3KD4A 4QM8A 3D0SA 3VD4A 4FPFA 2ZEWA 3SISA 1JUHA 1ENRA 1RUJ2 2IXLA 5DABA 2WAAA 5EYXA 4P08A 4XBQA 4D7SA 4XMIA 2X09A 3S57A 3WP4A 4IQPA 1OUSA 4R4ZA 2NMOA 4YYOA 3I8TA 3PMSA 3DV8A 5JI9A 2ZGTA 2DFCA 1UX6A 2HWB1 4HN1A 5FZAA 5DAPA 4COVA 4CZSA 5IFTA 1G9BA 4L99A 3TNPB 1U5ZA 1VBA3 4LKFA 4BQXA 4LIVA 3VKNA 4MGSA 3ZFEC 4N90A 4ISQA 2HH9A 2A1XA 2ZGRA 3LPFA 2ZAHA 4Z8BA 1W8NA 4BLIA 1IS5A 1QJU3 4AHXA 4BQ2A 5A3LA 3RVHA 2D3PA 4ONUA 1CQ9A 4QQPA 3HN3A 3KF5A 4AQ6A 4AZZA 5FO8B 2JG9C 2VM9A 2RR11 2PLV2 3MW4A 3UK9A 4AQSA 1HV0A 2KR2A 3HWJA 3UGFA 5FXXA 3USUB 1H8TA 4YGDA 1A3KA 2JDAA 2WFPA 4HVRA 5E6HA 4D94A 1LKNA 4Z82A 2Z5WA 2ZKNA 3TNQA 1GKBA 2QQMA 3VBHA 2ZMNA 3BU7A 2PFWA 4YVSB 1YFXA 2BZDA 2E63A 2R063 3CF6E 1OA2A 1RIRA 4QDQA 4OHYA 3DXUA 2BTVC 3D5OA 5F8PA 1SACA 1PGL1 1OURA 1ZYBA 3E5UA 4UOJA 2I45A 4HFSA 3D82A 1GLHA 3HNBM 4V1PA 5A3PA 1FOD3 4W8JA 5J09A 1W6QB 2E33A 4OZXA 4WM8C 1DIWA 2C9KA 2B7YA 1JI6A 4YARA 1QY4A 4ARXA 5JLVA 3FBMA 5DPNA 3IDAA 4NHYA 2VW1A 3B93A 4LK6A 1RUE3 2VMGA 5FZGA 5FYTA 5FLIA 4B1MA 5AC92 4KBBA 5F37A 1XQNA 1V9U3 1W06A 4V2VA 4JRAA 2WWUA 3VDCA 3VBRC 1NLRA 4CYDA 1W6PB 2YPJA 3B7MA 3OGGA 1Z78A 4CDUA 5FY1A 5CG9A 3FC0A 2XBO1 3SXWA 4RQPA 2PQSA 5FXWA 4XFHA 4EN7B 1U12A 4ZKTB 2G9GA 1NA1B 1ND2B 4AHYA 4EV0A 1FV2A 3FUOA 4OI2A 1OF3A 4NIHA 3ZXAC 3LPGA 1MS5A 2A5ZA 1SFYA 4LT5A 2CGNA 2VW2A 2QQVA 3PTYA 4XFCA 5FBZA 4KU8A 4CCDA 1LOBA 4LK7A 4QQHA 1ASJ1 1ULEA 1EV13 3AL5A 5FO7B 2WYSA 3S6PA 4ET7A 1BYHA 2PYTA 3VD3A 1J1TA 4IE7A 2GMEA 3W5NA 1VLNA 1H8VA 3IPVB 3EHKA 1QKQA 3PIJA 1PNFA 4W6XA 5KHIA 1CN1A 4Q0QA 4H55A 4LNVA 1US2A 2VUJA 1GOGA 3SEPA 1AR83 5FBJA 3WG4A 2PAMA 2JDYA 2QQJA 2I07B 4Q1PA 5ABJC 1PIV2 5IFPA 2VTXJ 1HB1A 3ROUA 1TME3 1UWWA 1GBGA 2IXCA 2ZX4A 1YO8A 4ZS3A 5FYBA 2ZX2A 4WM7A 1RUF3 1RUH2 3ZFFB 3QH7A 3H8RA 3BKZA 5FLHA 1H9PA 1PO23 1S0CA 1B35B 1HRV1 2B9UA 3RYPA 2RE9A 4CUBA 3G6JB 4NPMA 1OHFA 4YG0A 3K4ZA 3BPSA 1WUVA 4A3XA 1C8M1 1NKGA 2WN2A 3WCSA 1RL3A 4NO4A 1OPMA 3CKHA 4H2AA 1UAIA 4QB1A 3BCWA 5FZEA 1TVGA 2RM21 4MH0E 4SBVA 3SKJE 2HWE3 3HN1A 4ZU5A 4MGTA 4R52A 2YPDA 3IN9A 5A6QA 1QQP1 1M4WA 2D3RA 4Y26A 2WUHA 1WW4A 3IBMA 2VPVA 1AR71 2RDRA 4BYYA 2P2KA 1K45A 1RHI3
chains in the Genus database with same CATH topology
1NT0A 1NZIA 3KQ4B 4LOSA 5CISA 1SPPA 3POBA 4LOTA 3POEA 2QQMA 4LORA 3DEMA 1SFPA 3POJA 5CKNA 2WNOA 2QQOA 3POIA 3POGA 2QQKA 1SPPB 5CKQA 4LMFA 2QQLA 1SZBA 5CKMA 3POFA 4GZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NT0 A;  1NZI A;  3KQ4 B;  4LOS A;  5CIS A;  1SPP A;  3POB A;  4LOT A;  3POE A;  2QQM A;  4LOR A;  3DEM A;  1SFP A;  3POJ A;  5CKN A;  2WNO A;  2QQO A;  3POI A;  3POG A;  2QQK A;  1SPP B;  5CKQ A;  4LMF A;  2QQL A;  1SZB A;  5CKM A;  3POF A;  4GZ9 A; 
#chains in the Genus database with same CATH topology
 3I3M A;  3WNX A;  1DFQ A;  4Y33 A;  3O1R A;  5FZ0 A;  3F95 A;  3JBG 2;  5C8W A;  2VO5 A;  2XON A;  5CVR A;  2XOM A;  1YEW A;  1SFN A;  5T3N A;  1BKZ A;  3E97 A;  3MEP A;  2C26 A;  3NQH A;  5T5O A;  5BNP A;  2ORZ A;  1WW6 A;  3LCP A;  3WQ7 A;  3RNS A;  3TEX A;  3A4U A;  5FMD A;  3HAG A;  3OPW A;  1CR7 A;  2RV9 A;  1BBT 2;  3RRD A;  4CEW C;  2VZO A;  4P9W A;  3GJA A;  4SLI A;  5GZF A;  5EP9 A;  2D97 A;  3WF1 A;  1Z7S 1;  3SH5 A;  4MGI E;  3AKP A;  4DRR A;  4GA9 A;  1UY0 A;  3NRU A;  1W6M A;  4OHX A;  4GMP 0;  1Y9M A;  4H3W A;  2CNA A;  3MI8 A;  4UI9 L;  1S1A A;  3A21 A;  3P3P A;  4GH4 A;  2QQW A;  4HKW A;  2GN3 A;  4LO4 B;  2BER A;  2ZML A;  1PX4 A;  1PGS A;  2JEN A;  4LQR A;  2GNM A;  1S4C A;  3J9S A;  2ARA A;  4PCR A;  4XHB A;  3J7L A;  2Q1M A;  1EP0 A;  2WA3 A;  3K2O A;  4IES A;  4Q8L A;  3KV4 A;  2AR6 A;  4XYX A;  3LB9 A;  1JUI A;  1SQ4 A;  2H0B A;  1LGC A;  1H8T B;  4GKY A;  1F5F A;  2XL7 A;  5KC5 A;  5D8A A;  1IKQ A;  4DNY A;  3RS6 A;  1ULG A;  3POF A;  3VBH B;  4GJY A;  2QZ3 A;  4AWD A;  2WLQ A;  2ZA9 A;  3O14 A;  4QHZ A;  4TXW A;  4X6Q B;  3C7O A;  1YQ6 A;  4WZF A;  1GYK A;  3OD4 A;  1C57 A;  4RA0 A;  3U1X A;  4EN9 B;  1CJD A;  3NWK A;  1RYY A;  4MGQ A;  3M3I A;  1VBA 2;  5I8S A;  3M4F A;  3N9Q A;  2V09 A;  3CZJ A;  3T0A A;  4OVE A;  1ND3 A;  1RGS A;  2OVU A;  2VVE A;  2XKP A;  2BWA A;  3NVC A;  4LE4 A;  5K0U C;  4QD2 A;  5K9Y A;  5LCW L;  1CVN A;  4XCA A;  4LPL A;  1OUX A;  2OYZ A;  1HQL A;  1OI6 A;  1GSL A;  4Q4V 3;  3WP5 A;  3N9M A;  3N7M A;  4AEK A;  2YY1 A;  4MGK E;  5FDB A;  1UZY A;  2BOJ A;  2LRP A;  5SV5 A;  2ZKL A;  4OUS A;  2E51 A;  2DVA A;  2ET7 A;  3OGR A;  4LO6 B;  3ZLI A;  5F6L B;  5LA0 A;  2BQP A;  3OSD A;  3I49 A;  3CJI C;  4E4D X;  1A34 A;  2I2S A;  2JDZ A;  2O14 A;  1LJ7 A;  3NJX A;  4PQ9 A;  4OUL A;  4A6O A;  4Z2A A;  3ST7 A;  4IDZ A;  4CDU B;  5JSP A;  3BOP A;  2VL4 A;  4RQP B;  4LBK A;  1JYW A;  1X8E A;  3RGB A;  1AX2 A;  1PMJ X;  2KXL A;  2R16 A;  3WF3 A;  4CTE A;  3W9A A;  4FSJ A;  4WVV A;  1NCQ A;  3JB4 C;  2WZR 2;  4CCO A;  2P3K A;  4A45 A;  4BK5 A;  1U5X A;  2ZMK A;  3DPR A;  2BFU L;  4Y1Y A;  4CDW B;  2XJQ A;  1OD3 A;  1IZ3 A;  3GBG A;  1JHJ A;  4RHV 2;  1SBD A;  4TTG A;  1CX4 A;  1QJX 1;  1YXW A;  3BTX A;  3SMH A;  2JD9 A;  3IMN A;  2Q8O A;  1ASJ 3;  3GCW A;  2P17 A;  4YFZ A;  3GYD A;  1FT9 A;  3AKS A;  3UT0 A;  3HD8 B;  1ODM A;  1BEV 3;  1LHV A;  2LTN A;  3HBZ A;  1YQ5 A;  3TWI A;  5FRA A;  1V9U 2;  1O8P A;  2WWJ A;  5C3O A;  4F3J A;  1TG7 A;  4Q4X 3;  2UYB A;  2VCB A;  2FDH A;  4HET A;  1YYN A;  2AC1 A;  3N9P A;  4EN0 A;  5L36 A;  3WNO A;  2MNG A;  3ON7 A;  4L11 A;  3U37 A;  4ZON A;  2CTV A;  3I2D A;  2R1D A;  4S2F A;  4WM7 B;  5F5Q A;  3ZYJ B;  3WUD A;  4YW1 A;  4Z1V A;  4PLM A;  1OF4 A;  1WCD J;  2VCC A;  3X29 B;  5ACA 3;  4XDP A;  3D8C A;  5FO9 B;  3ES1 A;  2EIE A;  3EBR A;  4XFF A;  4XAC A;  5I8T A;  2PHW A;  2WZ8 A;  3AYE A;  1HIX A;  1V70 A;  3ES4 A;  5IUQ A;  1EV1 2;  1COV 3;  2BUK A;  4W50 A;  3WX5 A;  1C8M 3;  1FMD 2;  2CY6 A;  5IAX A;  3J7M A;  1UO9 A;  2QKD A;  4M4P A;  1V6L A;  2RM2 3;  5FIX A;  2XML A;  1CPN A;  4CCE A;  3KVA A;  2FZ2 A;  1RUD 1;  2FDK A;  1V0A A;  1AR8 2;  2F4P A;  4Y20 A;  5F3I A;  1D2Q A;  4BME A;  4ZPI A;  4DUV A;  3L9J T;  1JYV A;  1RVF 1;  1XNC A;  4UYB A;  5A6X A;  1AR7 3;  1CIW A;  1PK6 B;  1AXZ A;  2QNK A;  4L9B A;  4WVZ A;  5FY7 A;  3UGH A;  2PXJ A;  1LOG A;  1RUF 2;  2EXI A;  4I3P A;  5FYM A;  2P3J A;  1HQW A;  5BNP B;  4M3C F;  3H42 B;  4IE6 A;  3CHX A;  5F5C A;  1S2E A;  1KFX L;  3HEI A;  2JB8 A;  1HQN A;  1PVX A;  2Q8C A;  2HWC 1;  4J6G A;  2EAK A;  1H6X A;  2HWF 2;  2YZ4 A;  3NNJ A;  3RFR A;  4A2U A;  4N53 C;  3W59 A;  1RUG 2;  3GZU C;  1WD4 A;  2ZEX A;  4DS0 A;  1EAH 3;  3VB9 A;  4RFT 0;  4ZHN A;  3R4S A;  2DWR A;  2HWE 2;  2PHD A;  2XWB B;  4RYD A;  1C1L A;  3POJ A;  3DF0 A;  4A41 A;  3AMN A;  5FPA A;  4LLF A;  1BXH A;  2QVS B;  3NO8 A;  1UY2 A;  2JX9 A;  1YWK A;  1DP0 A;  4HON A;  1ZRI A;  5BNN C;  3O1V A;  3ETP A;  1RHI 2;  4GH4 B;  3SQO A;  3H1Y A;  4YLZ A;  4ZU4 A;  4Q8K A;  1YQ8 A;  2A6W A;  3DYO A;  2RDQ A;  3OBZ A;  4EWA A;  4FXK B;  4HSJ A;  4EZ4 A;  3MO4 A;  5FZI A;  2VMH A;  4XBL A;  3ZOI A;  5ISL A;  2EF6 A;  4ZU7 A;  1D4M 1;  1PGW 2;  1CWP A;  1W3V A;  3JUU A;  2BNN A;  3I54 A;  1NUK A;  1UN1 A;  4ASM B;  3LWC A;  1NG0 A;  2RS1 3;  2I74 A;  3AP4 A;  1OLM E;  3U78 A;  4XJ9 A;  1YRZ A;  1UXX X;  2WL1 A;  4Y5T A;  1GR3 A;  4O7X A;  3PHM A;  2GNB A;  4NPL A;  4D6S A;  1I6X A;  4LHK A;  2ZS6 B;  4Q2F A;  3B3Q E;  4QXK A;  3MV0 1;  2VH9 A;  4BQ5 A;  5ERL A;  4IND A;  5T5L A;  1QWR A;  2YGM A;  2WNV C;  4UW5 A;  5FJH A;  4AED C;  1ND3 B;  4K21 A;  2YYO A;  3H7Y A;  4OI1 A;  1FPN 2;  1AR6 1;  5C3R A;  1CIY A;  1FNY A;  4CPB D;  5BXX A;  3VBF C;  1VBC 3;  4U2A A;  3VL9 A;  3WW1 A;  1JYT A;  4IGQ A;  4XTP A;  1WLD A;  5IK7 A;  5T5J A;  3S5Q A;  2E31 A;  4CCM A;  1ST8 A;  2DCK A;  4IEX A;  4AXO A;  5L7O C;  4LUL A;  5F3G A;  4JX0 A;  1E57 A;  3V65 A;  4AQT A;  2YUE A;  1XNK A;  1Q8V A;  5LK7 B;  4PIZ A;  2QBX A;  3GHN A;  4C0B A;  1ULF A;  5DAQ A;  5T55 A;  1RUH 1;  1W9T A;  3INA A;  3VL8 A;  2VNV A;  4IEZ A;  3ACH A;  2JDU A;  3LFM A;  2YBS A;  3I7D A;  4BQ4 A;  5GJ6 A;  3ATG A;  5J36 A;  1VIW B;  3CO2 A;  3RZM A;  3PUI A;  5FRE A;  1VBB 1;  3KF3 A;  4RS5 B;  1XU2 A;  4AOC A;  4JCK A;  1AXK A;  1RC6 A;  2VBD A;  3ZDV A;  4BQW A;  5J7M A;  3PVN A;  2WNU C;  5FZ1 A;  4GXL A;  4AEJ A;  2G4I A;  2Z42 A;  5A7O A;  2EXK A;  3IDC B;  4Q0U A;  1CAV A;  5LB6 A;  4YZ3 A;  2DVD A;  3DUI A;  4FOV A;  1WW5 A;  4Q4V 2;  2JG8 C;  2R30 A;  4PDW A;  3GJB A;  3WR0 A;  3VBO B;  1SLL A;  1QJX 3;  1WBF A;  3NKG A;  2E26 A;  2V72 A;  1XOY A;  4R9B A;  1ZRF A;  4G3Y C;  5FZL A;  2WRA A;  3JCI A;  4DXR A;  2DU0 A;  3QOP A;  1S0F A;  2W91 A;  1GUI A;  2YC2 A;  3LFI A;  1HB3 A;  2Y33 A;  3VKM A;  1HN0 A;  1JH5 A;  2WC2 A;  4QT6 A;  4LUK A;  5D2A A;  2VNR A;  5IAV A;  2O8Q A;  3B69 A;  1GZW A;  4XIO A;  3K77 A;  3MIG A;  3ZXD A;  2RS5 1;  4AVV A;  5LBE A;  4DY3 A;  1DDL A;  1OT5 A;  3WP6 A;  5CAZ A;  5HCB A;  4YZ1 A;  4OQ8 A;  4DEV A;  5IW0 A;  2QUO A;  5GKA C;  1BBT 1;  2P4E A;  2VVF A;  5AVP A;  2TUN A;  4CCL A;  2HYK A;  3IIA A;  1ZBE 2;  2VC9 A;  3CMG A;  1PO1 3;  1S55 A;  4YW2 A;  4PI2 A;  2UWC A;  4QHB A;  4QXB A;  1AYN 1;  5EHD A;  4IV3 B;  3VBS A;  4B1L A;  5F1R A;  1JYX A;  2W92 A;  3RJR A;  5FYZ A;  1TMF 2;  3VGI A;  3VHP A;  1ZRR A;  1RIN A;  1A8M A;  4GWN A;  1UU5 A;  3M7A A;  5GZE A;  1LU1 A;  2W1W A;  5JIU A;  1REE A;  4DUX A;  3ZIW A;  1QJY 1;  3E6B A;  1BEV 2;  1J84 A;  2XGX A;  1POV 3;  4MX3 A;  3FLP A;  2V73 A;  2CU5 A;  3ILR A;  1TNR A;  4Y20 B;  1C5I A;  4Q4X 2;  1H1A A;  1QXJ A;  1W9W A;  4E4Z A;  1O3S A;  3TN9 1;  4CE8 A;  2WO2 A;  2AEY A;  5FPL A;  5JCT A;  1MEC 1;  3B9I A;  4FTS A;  1G9D A;  1SPP A;  4QPI B;  1X82 A;  2ENR A;  5EJ1 B;  4AVT A;  1OOP C;  1LEN A;  2XVL A;  1H6Y A;  1MS3 A;  1RUI 3;  1UY1 A;  2PHL A;  3ECQ A;  4GAL A;  4EWE A;  3N7L A;  5ACA 2;  1AL0 G;  3EQE A;  1IS6 A;  2AUY A;  2Q30 A;  2NMN A;  3NAP C;  1MR5 A;  3IM0 A;  1L7R A;  3HNM A;  4AGG A;  3BI3 A;  3WEZ A;  3C7F A;  2CHH A;  5F32 A;  1COV 2;  1ZBA 1;  2F4L A;  3WDW A;  2JD4 A;  2D6K A;  5E89 A;  4XFI A;  3AL6 A;  2HWC 3;  1DQ1 A;  2Y6K A;  4B7K A;  3THD A;  2XVG A;  1NCR A;  1EPZ A;  4KWL A;  3VBU C;  3L2Y A;  1K3I A;  2EXH A;  4N43 C;  1DQ0 A;  5A3U A;  5K7P A;  1CES A;  1UY4 A;  1SLT A;  4AI0 A;  2ARE A;  2VOK A;  1ZRE A;  1YIP A;  2P1B A;  3LEG A;  3OY8 A;  3VZJ A;  5B2G B;  2PAK A;  2VTX A;  1AUY A;  2G19 A;  1KS4 A;  1AYM 1;  2OZ6 A;  2R07 2;  2UY8 A;  4M3C E;  3NJZ A;  2W1S A;  5B4N A;  3WW4 A;  1EPW A;  3GCX A;  2SBA A;  3U07 A;  5JXJ A;  1I3H A;  1BMV 1;  5IJR A;  1O6U A;  2XDV A;  1D4M 3;  2LW8 A;  3TOJ A;  5BV6 A;  3ZYR A;  1JMU B;  1W2N A;  3KGL A;  3POW A;  4L8Q A;  3ZYG A;  1XU1 A;  3N7J A;  3GDB A;  4LIU A;  1EAH 2;  4PT6 A;  3LA7 A;  5FYI A;  4JDM A;  3R4D B;  4QAW A;  4CP0 A;  3E5X A;  3NNF A;  3ZFE A;  5GLW A;  3I3Q A;  5FWE A;  2WLP A;  1QIQ A;  1YC6 1;  3VLB B;  3Q8B A;  1HB2 A;  3QLQ A;  4RGK A;  2HJI A;  1W8O A;  2ZX1 A;  1Q3E A;  2W47 A;  2PN5 A;  1QOT A;  2XJS A;  1AR6 3;  4FP2 A;  2JE7 A;  4WV8 A;  1KS5 A;  2JG9 A;  5FWJ A;  1WLC A;  3E6D A;  1R1A 1;  1STM A;  4BXF A;  5C3Q A;  1VRH 1;  1DF0 A;  3CL1 A;  3T09 A;  1CAW B;  5BY5 A;  2IFR A;  1V6M A;  5FCC A;  3GBW A;  1GQG A;  1V6N A;  2WT2 A;  3VZK A;  1AZD A;  1H2L A;  1PMH X;  4H14 A;  3T1L A;  4ASK A;  1FNZ A;  1QH6 A;  2RS1 2;  2W08 A;  3FHA A;  3I2G A;  3WDX A;  3O1M A;  1AF9 A;  1RTV A;  3O0X A;  2ADD A;  2XLF A;  3KV5 A;  1JTZ X;  3POB A;  4FOW A;  1LTE A;  1ACC A;  5HBA A;  2R1B A;  2GMP A;  4I02 A;  4M0H A;  5ANN A;  1AL2 1;  2X05 A;  4MYE A;  3SNM A;  4BQ3 A;  1O3Q A;  3PVB B;  1YFW A;  2IUW A;  2UU8 A;  5A32 A;  2X10 A;  4JAA A;  3UJO A;  2VG9 A;  2Y0O A;  4CDQ C;  1OH4 A;  2BGC A;  4FTE A;  3LD8 A;  2PA7 A;  3BIW E;  1S0J A;  1GZT A;  4FPC A;  4WM8 A;  2J1V A;  2YRO A;  5FZF A;  3MF9 A;  1S2K A;  5HCF A;  1CAV B;  3POG A;  5FUP A;  1UYY A;  3ZN4 A;  2BFU S;  3ZXK A;  4A7Y A;  1Y7B A;  2BBA A;  2CGO A;  3IAQ A;  2E7Q A;  1QMJ A;  1UU6 A;  3UYJ A;  3VDB A;  1LAJ A;  3WNN A;  1NXM A;  3ENR A;  1XBF A;  5A1L A;  3KCY A;  4TN7 A;  4XBN A;  3VBR A;  3ZXE A;  2RS3 3;  3J7H A;  1WD3 A;  5BPX A;  5DG2 A;  4LXL A;  4X8P A;  3LF7 A;  4UFH A;  4E2S A;  2R04 1;  2ZGL A;  4UF0 A;  4DIN B;  3NL1 A;  5CYY A;  3ITQ A;  2XJP A;  2XQX A;  2ZAC A;  4YVW C;  2ETE A;  1DZR A;  2YV8 A;  3N9N A;  3OBT A;  4QQO A;  3I2J A;  4QXC A;  3T4V A;  3WT3 A;  1CX1 A;  1GZW B;  2W1U A;  4J1X A;  3WF0 A;  4FI9 A;  4XVH A;  3I2F A;  4F8A A;  1V6I A;  2UUR A;  4Q4W 3;  4XDQ A;  3Q8F A;  5L19 A;  1TQ5 A;  5DMY A;  3RSJ A;  2XL9 A;  4YWA A;  2DU1 A;  4NIG A;  2HWF 1;  1LHN A;  3ZDS A;  1PM7 A;  1W8U A;  4BOW A;  4COU A;  4BCU A;  3ZSM A;  4BK4 A;  4D0Q A;  2R0H A;  2WFF 2;  5LBB A;  2D6N A;  4AVA A;  4NHM A;  5JWP A;  3O1P A;  3WNK A;  2UYA A;  1W8H A;  3MUZ 1;  4LBQ D;  3ALQ A;  5JVV A;  2L9L A;  2WWS A;  4QGL A;  3A23 A;  1EY2 A;  1WCK A;  5F2W A;  5ABJ A;  5C9A C;  2P5B A;  3RZZ A;  3OYW B;  1X50 A;  1QJY 3;  3POY A;  2HEY F;  5LK5 A;  1UOF A;  3BN6 A;  4QKF A;  4M0N A;  4IV1 C;  2X5I B;  1Y43 B;  3IKW A;  4UBH A;  1XYO A;  3A0K A;  2ARC A;  4HKO A;  3AYC A;  2B5H A;  3MHZ A;  4W65 A;  3TN9 3;  1C4R A;  2D3S A;  3LSE A;  3WW3 A;  4QPG C;  1O8S A;  3RYR A;  1SZB A;  4P02 B;  4NR1 A;  3WG3 A;  2J42 A;  4JKL A;  3CBN A;  1AXY A;  4KU7 A;  4IET A;  4ZZ5 A;  3H0O A;  4Q4Y 1;  3J8F 1;  4QX5 A;  3U75 A;  2TEP A;  3O5S A;  5LW9 A;  1GQH A;  5IK5 A;  2RJ2 A;  4HBN A;  4WVM B;  1ZZC A;  2VU9 A;  3LE0 A;  1MS4 A;  1FPN 1;  1E5S A;  4TZD A;  1ALY A;  4A44 A;  1YLL A;  2C4X A;  5FTT C;  1NCR B;  4I01 A;  1GIC A;  1Y4W A;  1E5I A;  4QQ2 A;  1WA4 A;  2DBI A;  3H1W A;  1NA1 C;  1VAL A;  1ND2 C;  4XXP A;  5F9T A;  4NOT A;  4AVB A;  2W3J A;  1C28 A;  4ITC A;  2VUC A;  3OCP A;  1PX3 A;  3OY8 B;  5I0T A;  1JZ5 A;  3C7G A;  2FMY A;  3MID A;  4YW7 A;  5A7S A;  2RMU 3;  4GWM A;  4E27 A;  1ZZ8 A;  2OPK A;  1P8J A;  5DAV A;  2VOX A;  4KL1 A;  1GNZ A;  4D6Q A;  1CAU A;  2WO1 A;  2WS9 1;  4YGB A;  1DGR A;  1SLB A;  2FCT A;  3JQX A;  1J3R A;  4XDO A;  3LZZ A;  2QDR A;  4I0A A;  2BYV E;  1CZT A;  1VP6 A;  1WMD A;  2VAU A;  3V64 A;  3H8X A;  4CEW A;  4GAZ A;  4K9S A;  2KD7 A;  4NE9 A;  4CUA A;  1H4G A;  1X33 A;  1F4H A;  3HT2 A;  5F3E A;  2KA3 A;  1SEF A;  5M0T A;  1KJR A;  5FOB B;  2P6H A;  1DZT A;  3FFQ A;  2WYF A;  5JIA A;  4KWJ A;  3NKT A;  4XIL A;  1LHO A;  1OH3 A;  3PDQ A;  1DHK B;  3ZFE B;  4OLL A;  4BQ1 A;  2D5H A;  3BVC A;  3WLU A;  3HMY A;  2VY0 A;  3NV2 A;  4XZP A;  5JSR A;  3P5B A;  1S0D A;  2JE8 A;  2ZEZ A;  4FFI A;  2DV9 A;  4DRV A;  3ZSE A;  2JXA A;  2NLR A;  1B35 C;  2D7F A;  1EYB A;  2VVD A;  4OFG A;  1VBD 3;  2A70 A;  5KHJ A;  1BCX A;  4FPJ A;  2OZJ A;  5FAX A;  3MV1 1;  2DCJ A;  3U4S A;  2XJT A;  4D8M A;  1ZZB A;  5CBL A;  1SMV A;  5H9Q A;  2BVV A;  4TLG A;  1W6O A;  1R1A 3;  2GNT A;  2PEL A;  2Y6L A;  1HXS 3;  1JYC A;  4QX8 A;  5DDJ 3;  5F5A A;  3A22 A;  4L92 A;  5A7P A;  4P9L A;  3AMH A;  4ZZ8 A;  1HLC A;  3TEY A;  1ZBE 1;  2HYX A;  3JD7 1;  3PVO A;  5A3O A;  4NAO A;  2QQP A;  4XUO A;  4Y1X A;  1OFS A;  1R08 2;  4YG3 A;  3CNA A;  5E8A A;  1TMF 1;  1AL2 3;  1SCS A;  5K0U A;  1N3P A;  1GOH A;  2MEV 3;  4WM8 B;  4CRQ A;  4IXL A;  4R8H A;  1RUC 1;  1CZS A;  3G7D A;  4XUT A;  1MZE A;  2WII B;  4YZ2 A;  1C8N A;  1DCS A;  4LBQ A;  3K4A A;  5BNO C;  2HWD 1;  4I3G A;  2Q8E A;  3SCF A;  4M01 A;  1AR9 3;  1UPI A;  4Q0S A;  1GP5 A;  3CIH A;  4DFS A;  3M1H A;  4AFC A;  4MLO A;  2ATF A;  5FYC A;  4GWI A;  2C24 A;  5C8C C;  3CJI A;  3OPT A;  3KCX A;  4XJZ A;  5A33 A;  1V6O A;  4KGG A;  5CNA A;  5LWB A;  2J1U A;  3J4U H;  3WP3 A;  3B01 A;  3U0Z A;  3OBR A;  4NJ4 A;  1XC6 A;  4BB3 A;  1F8V A;  4EYU A;  1POV 0;  4MSV A;  1GNY A;  3T2Q A;  3WW2 A;  4YW3 A;  4OHW A;  4B8E A;  2DUO A;  3BAL A;  3B02 A;  5FYU A;  4GB3 3;  3OPZ A;  4TLF A;  3RG0 A;  4JGY C;  4NII A;  2VZS A;  4XW3 A;  2OQ6 A;  3GF6 A;  2P34 A;  1JU3 A;  2BJS A;  3AKR A;  4AI1 A;  2QQU A;  4COY A;  1VAV A;  1ONA A;  1J1L A;  1H1I A;  1QEX A;  2ES3 A;  3U10 A;  4UFJ A;  4B4Q A;  3GZA A;  2GP3 A;  3K48 A;  3N35 A;  2DUP A;  1QGL A;  4LEJ A;  4KWK A;  3VD9 A;  5DUW A;  3P1I A;  1Q8P A;  5E1R A;  5EZW A;  3VHR A;  1R09 1;  5ABJ B;  1RMU 1;  1LGN A;  3FX3 A;  4I09 A;  5KBF A;  3T30 A;  1UCX A;  5FP4 A;  2P6C A;  4XAE A;  2R07 1;  1HRI 1;  4I0B A;  2AEN A;  5EFU A;  3WY6 A;  5IYY A;  3OEB A;  2ERF A;  2HWB 3;  4ZXE A;  1EUU A;  3DKQ A;  1NY7 1;  1BK0 A;  4PBP A;  3W20 A;  1IGO A;  2J1R A;  5FKB A;  3WDT A;  1XRU A;  2WO7 A;  4LLO A;  4ES9 A;  3WV6 A;  4Q4W 2;  1WCQ A;  5D1I A;  1OMI A;  3PUA A;  4HXC A;  3U11 A;  4YSF A;  1D0H A;  1FXZ A;  3RQ0 A;  3AZY A;  1E5R A;  4C0H A;  2MPF A;  4XUP A;  5F6K A;  4N7I A;  4CDX C;  2A6V A;  1ZRC A;  3P6B A;  4F83 A;  4U36 A;  4QMA A;  2WAB A;  2ZHN A;  2K2S A;  3KV9 A;  4LA3 A;  2RR1 3;  3I2K A;  4OCT A;  5T50 A;  4AHW A;  4W6W A;  3MUY 1;  5GZC A;  3MYX A;  3ZYF A;  3SH4 A;  1DG6 A;  2B42 B;  1QJZ A;  3P3N A;  4RQP C;  4JDO A;  4HPK A;  1JW6 A;  2B39 A;  2O0O A;  5A3M A;  5IK4 A;  2Q1Z B;  4NRO A;  3WG1 A;  4XJU A;  4HAN A;  2ZOE B;  2BV4 A;  1I1E A;  1H2N A;  5LY1 A;  1IOA A;  2W52 A;  1GFF 2;  4NHL A;  3ASI A;  1US3 A;  4CDW C;  2WBK A;  4F7Z A;  4XF1 A;  4IE0 A;  5C6C A;  2Y6F A;  4C90 A;  1DLC A;  3NNL A;  1QJU 2;  2GZW A;  5FUI A;  3VUO A;  4MOA A;  1CAU B;  4DUW A;  3ELN A;  2OW4 A;  1ULC A;  3S30 A;  5J96 B;  2ZX0 A;  5FZB A;  4FPO B;  4YGE A;  1PZ9 A;  3T3Y A;  3TRS B;  1A78 A;  1GNH A;  4CEW B;  2RVA A;  2WS9 3;  4PQQ A;  3GGL A;  4N53 A;  3A0N A;  3FJS A;  4LKD A;  3I2H A;  4CSW A;  1ULO A;  3Q8A A;  2ID4 A;  4XUN A;  2UWA A;  2J1S A;  4NVP A;  1MS1 A;  1LOD A;  2YC4 A;  3T2O A;  4QX3 A;  5CFD C;  2XR4 A;  1WCS A;  2IXH A;  2R06 2;  3VZO A;  1FAY A;  3L2H A;  5FYV A;  4DY5 A;  5BNN A;  2SLI A;  2XBO 3;  5CEH A;  3OUJ A;  4HL0 A;  1NLS A;  1JU4 A;  4GKX A;  2JEC A;  1F35 A;  4YNI A;  1JS9 A;  1I5P A;  5FZ4 A;  3HNY M;  3PJQ A;  1W9F A;  1FOD 2;  3GBF A;  5DG1 A;  2RMU 2;  4ATE A;  1LOF C;  3MIH A;  4P9Y A;  4BQY A;  5IK8 A;  1QOS A;  4BZ4 A;  3AJZ A;  3OOX A;  4IEP A;  4O9G A;  2JDN A;  1W6O B;  3WHU A;  3B94 A;  1RUE 2;  1VBE 1;  4NWW A;  1G8W A;  1PVC 1;  2WQZ C;  4XTM A;  3W21 A;  2BPA 2;  1W9S A;  1SLC A;  2AGS A;  2JDK A;  4HT1 T;  3SLI A;  2G9F A;  2EIG A;  3FZ3 A;  3Q8E A;  5GAL A;  2GH8 A;  4O9E A;  3ZMO A;  4XJA A;  4CCJ A;  2D6O X;  5JMO A;  4JGZ C;  1W90 A;  3W5M A;  3ACF A;  2WFF 1;  2WNV A;  2ZTN A;  1RUJ 1;  3JD7 3;  4LOR A;  1PK6 C;  1SFP A;  5F2S A;  5K0U B;  1O4T A;  1YI7 A;  4AG4 A;  4BXS V;  4YM3 A;  2DTY A;  2ZGO A;  3VBF A;  4I0W B;  4CVU A;  5FZD A;  3AX4 A;  4D3W A;  4RFR B;  2LRO A;  1JXN A;  1VBD 2;  1RJ7 A;  5L7O A;  2HWD 3;  1HRV 3;  2ARX A;  2DCZ A;  3M70 A;  4FFH A;  4S2G A;  2X29 A;  4XF9 A;  4BH9 A;  3O0W A;  3LDK A;  3CJI B;  4XXA A;  3LIG A;  1T2X A;  5A33 B;  2OA2 A;  3CLP A;  3ZYI B;  5I0S A;  5GLT A;  5FY9 A;  2YXS A;  1HXS 2;  4N9H A;  5FQ0 A;  1KD7 A;  3KV6 A;  1IS3 A;  1MZF A;  3D3A A;  5DDJ 2;  4EJR A;  1JOJ A;  1D4V B;  1OLM A;  1Y3T A;  4DZG A;  5JZG C;  4RD7 A;  1UIJ A;  3S7I A;  3UGG A;  5EJZ B;  1QQP 3;  2PLV 1;  2QQN A;  2VQA A;  2GC3 A;  3HIF A;  4W6Y A;  1YIF A;  2WNU A;  1LCL A;  1TME 2;  3AKQ A;  2VQT A;  5E16 A;  2GMM A;  2Y6H A;  5FK8 A;  2MEV 2;  2XLA A;  3BOD A;  1N3Q A;  4PF5 A;  2DVB A;  4DOU A;  5EYY A;  1N3O A;  2CGP A;  1PO2 2;  2JG8 A;  4QWN A;  4ZY9 A;  3LKJ A;  4CCC A;  4J1W A;  1W8F A;  1AR9 2;  5JSO A;  1Y9G A;  4PLN A;  2PMW B;  1RXG A;  2VXR A;  5LA2 A;  2VZU A;  3AXE A;  1V6J A;  1W03 A;  4ASL A;  1REF A;  1DGW X;  1VR3 A;  1VAK A;  1LB2 A;  1RUO A;  1R09 3;  3HQU A;  3OB8 A;  3KS7 A;  4YM2 A;  1MS9 A;  4BIF A;  3KHC A;  1LNS A;  1W6M B;  3WF2 A;  2EID A;  4UXA A;  1Z7S 3;  5AC9 1;  5JXG A;  5IVF A;  3AVS A;  4LR4 A;  3DEC A;  2A6Z A;  3USS A;  3U14 A;  2E6V A;  3PL0 A;  2GC0 A;  1H2M A;  2DUQ A;  2PHU A;  1NYW A;  2E7A A;  1K5M A;  1W0O A;  3C2U A;  1ZVF A;  3LOI A;  3UJQ A;  3UKV A;  1OSG A;  3ZXF A;  4W4Z A;  1NT0 A;  1FV3 A;  1O59 A;  2XPJ A;  3LDR A;  1UX7 A;  2E32 A;  2VD7 A;  4DPN A;  4JTN A;  3HPN A;  4GMP 1;  4BE3 A;  5A1A A;  1F31 A;  2D6M A;  5G05 L;  4I2O A;  2GU9 A;  3WQ0 A;  3K3O A;  5D8A B;  4XHX A;  3RDI A;  3FHQ A;  4IEY A;  2ORX A;  1MAC A;  3RWK X;  1XNT A;  5JOW A;  4UT5 A;  3HT1 A;  1DYO A;  5DZE A;  1WGP A;  4HPK B;  4IEO A;  5CAD A;  2VZT A;  1IQD C;  1FX5 A;  2YU1 A;  3ACG A;  4RS5 C;  4MO3 M;  2XLG A;  1N1Y A;  2CSG A;  4HOO A;  2VZR A;  2HWB 2;  5FXZ A;  1MVQ A;  1OOP A;  1PZ8 A;  2AH2 A;  4KQ7 A;  3AFG A;  3K46 A;  5LA1 A;  1Y9Q A;  2QDN A;  4XMA A;  4LHS A;  1JBC A;  2N7G A;  4B29 A;  3E1F 1;  3NAP A;  1UKG A;  2VZV A;  4IEQ A;  4DXS A;  3VBO C;  1PIV 1;  3M3C A;  2OUH A;  1R08 1;  1H2K A;  4X6R B;  5C71 A;  4IW3 A;  4JDN A;  4JKM A;  1JZ2 A;  1VPH A;  2RR1 2;  4FT8 A;  4Q1R A;  5K4L A;  3PUH A;  5JAX A;  1DBN A;  5T54 A;  4A3Z A;  3ZX7 A;  3JQW A;  1OA4 A;  4TYS A;  3VBU A;  4Q5O A;  4BU2 A;  2V5Y A;  4N43 A;  2PTM A;  3J26 N;  3W58 A;  3MDP A;  2LS6 A;  1VB4 A;  5BNN B;  4Y1V A;  3O1O A;  2WQ4 A;  3MBW A;  1YNA A;  1O5L A;  1NCQ B;  1SBE A;  3RYK A;  2PHR A;  3O7O A;  5A70 A;  1Q8O A;  2R32 A;  3OEA A;  1PGL 2;  3AP5 A;  4CEY C;  3DPR B;  3O0V A;  1MZ5 A;  2JWP A;  3I3D A;  4IV3 C;  1WMF A;  5DN2 A;  2Y8K A;  4NN0 A;  3C7H A;  3CDZ B;  3EYP A;  5I0R A;  1LRH A;  1VMJ A;  3ACI A;  3RPQ A;  3T0D A;  4RR3 C;  4Y22 A;  3J7N A;  2YFU A;  4KMQ A;  4PF1 A;  5GZD A;  2RG4 A;  2E9Q A;  1VBE 3;  3SIT A;  1NXD 1;  4FQZ A;  2ZGP A;  1X8M A;  2DF7 A;  3BB6 A;  1WLT A;  3JBG 1;  2YB7 A;  2ZPX A;  1BJQ A;  3HVD A;  1H1M A;  2WNV B;  4IE5 A;  4Y4Y A;  5F5I A;  3IMM A;  3V0A A;  2VCA A;  5H9R A;  3JZV A;  4JKK A;  2WAO A;  1AX1 A;  2GSY A;  1VMF A;  4QPI C;  5FY5 A;  5C4W A;  3VBF B;  5CA6 A;  5HXM A;  2JEM A;  2E7T A;  1NZI A;  2H6C A;  2XBO 2;  1UZZ A;  2R7E B;  1PM4 A;  1WLW A;  3I59 A;  4G9S B;  4QDR A;  1L7Q A;  4E9K A;  3JU9 A;  4HMZ A;  3U4X A;  5FPU A;  1JZ4 A;  1T6B X;  1RED A;  3VDD C;  2QFE A;  4M3C A;  4Q27 A;  5I0D A;  5FZ8 A;  1CD3 G;  2GC1 A;  4C91 A;  2W0X A;  3RI9 A;  4AF9 A;  5LEJ A;  3HQX A;  1ASJ 2;  1DLL A;  3HOB A;  1C5H A;  2ZZJ A;  5FQ0 B;  3VKL A;  2O1Q A;  4K8R B;  2OX0 A;  5EJ3 A;  3NNG A;  3RZJ A;  2UWB A;  1NOV A;  4EN6 B;  3FE5 A;  1X36 A;  1UW8 A;  1T6G C;  3H50 A;  3MIC A;  3ZN6 A;  3ZIX A;  5EQU A;  1OPO A;  2BRT A;  4L0P A;  5IVV A;  1UMZ A;  4CDQ A;  1RUD 3;  1SDD B;  4AL9 A;  4AGR A;  2WNU B;  2A6X A;  4ISR A;  5KXC A;  3DGT A;  3ZO0 B;  4GJZ A;  4CU6 A;  1PHM A;  1S0I A;  2XXZ A;  4JHT A;  2B4K A;  1RVF 3;  4PLO A;  4XPV A;  1A6C A;  1XYN A;  3FL7 A;  1KIT A;  1WW7 A;  2JG8 B;  2XJV A;  3LQC A;  2DTW A;  5FJK A;  4XFA A;  4QHO A;  1YHF A;  3NV4 A;  1UQX A;  1YCI A;  1J83 A;  3I2I A;  3VHN A;  4E4S A;  3I2O A;  3IB3 A;  2MHF A;  4IGO A;  1O5U A;  2EVX A;  2AYH A;  1YUD A;  1VBA 1;  1H9W A;  3WD5 A;  2IXI A;  4K1Z A;  4LHN A;  5I93 A;  1CPM A;  1C8M 2;  5C7G A;  4YVW A;  1W0N A;  4CPB A;  2TBV A;  2RJL A;  1X9T A;  3JB8 A;  3WDY A;  1IKP A;  1N1S A;  2RM2 2;  5K8S A;  4PIX A;  1AJK A;  4QGN A;  2QTW B;  2HLE A;  2WN3 A;  2D6P A;  2HKX A;  2BDR A;  4XJW A;  1W2U A;  1JOP A;  1XYP A;  1WCU A;  3I3B A;  1QQP 2;  4JQT A;  4MVT A;  4CU8 A;  2QCS B;  4AEM A;  2ZZQ A;  2BBV A;  1AR7 2;  4LA2 A;  5JOZ A;  4PHZ A;  1K5M B;  1QNW A;  4P9G A;  1URX A;  3GHM A;  3OUI A;  3KT4 A;  2Q8D A;  3USU A;  3QBQ A;  2ZGK A;  5LZ6 A;  4EE2 A;  1UKR A;  5DXD A;  5CFC C;  1LUL A;  4KNC A;  3SEE A;  3C8X A;  2BNM A;  2D93 A;  2GAL A;  4P5H A;  1OKQ A;  5A1F A;  5C9A A;  1H0B A;  1XPW A;  3AP7 A;  3ZFG C;  1G6N A;  2WZR 1;  5J37 A;  2VW0 A;  1WBL A;  5FY4 A;  1AJO A;  1FOD 1;  4CUG A;  1BLZ A;  3BYW A;  4IV1 A;  3D0J A;  1QNY A;  4RHV 1;  5A3T A;  3ME2 A;  4NMI A;  4P5Y A;  2C1F A;  5FP7 A;  2EIC A;  4LO8 A;  4ES8 A;  2YC0 A;  1RUE 1;  3EJK A;  1OOP B;  1R64 A;  1Z7S 2;  4QPG A;  3WDV A;  1RJ8 A;  5FFO C;  1V9U 1;  2HEV F;  1F5J A;  3I97 A;  3NAP B;  3ZSK A;  2C6S A;  1W6N A;  4HG6 B;  3N9O A;  3SH3 A;  4O65 A;  1MVE A;  1ZRD A;  1DU3 D;  4OHZ A;  4YW5 A;  4AYU A;  1W6P A;  1S0B A;  1AHS A;  1XNB A;  4UFL A;  5C5U A;  1UPS A;  1LGB A;  1UYX A;  4GZ9 A;  4OYU A;  1KFU L;  3ZSL A;  1A8D A;  3WXP A;  4YZ5 A;  2Z4F A;  1IG3 A;  2BNO A;  3IDB B;  1MQT C;  5A7N A;  2AZ5 A;  4HKL A;  4K40 A;  1MS8 A;  3MLK A;  4N43 B;  2P3I A;  1NA1 A;  1RUH 3;  1O4Y A;  5GM0 A;  1K5J A;  3DL3 A;  5FUN A;  1EV1 1;  1J59 A;  4Q0V A;  1V00 A;  3H7J A;  3THC A;  1APN A;  1FMD 1;  1VBB 3;  2HBT A;  3PU3 A;  2QQK A;  3GZT B;  4YW4 A;  3HBK A;  3FFZ A;  3WZ1 A;  5A6Y A;  1GV9 A;  4D6R A;  1VBC 2;  4AI2 A;  3BTY A;  3S5A A;  4PDW B;  1AR8 1;  1W8T A;  1YQ2 A;  3ZXL A;  3BIE A;  4Y22 B;  5ANQ A;  1W2T A;  4JVA A;  4Q26 A;  4TSV A;  4AW7 A;  2BOI A;  1HV1 A;  3FBY A;  2IC1 A;  4XFG A;  5KC6 A;  1IPJ A;  2BW8 A;  1DGL A;  1LES A;  4QB6 A;  3FWE A;  4R4X A;  3M8L A;  1RUF 1;  4XJ8 A;  5FYH A;  2BVB A;  2CV6 A;  2YBP A;  1XJA A;  2WR9 A;  2X5I C;  3JBG 3;  3V0A B;  3QH6 A;  4R9C A;  2JDH A;  5C4W B;  4IUG A;  3K51 A;  4QPY A;  1B35 A;  5LY2 A;  4QB2 A;  2FQP A;  2ZHK A;  2IVI B;  4URT A;  3ZXG A;  2YFZ A;  3N9L A;  3I59 B;  4CP9 A;  2RS5 3;  4G4F A;  3AYA A;  4HK9 A;  1RUG 1;  4QX1 A;  2CAU A;  5C3P A;  4BMB A;  1X7N A;  3THP A;  2HWE 1;  1BBT 3;  4KG0 A;  3VBS B;  4M3C B;  3LEM A;  2FZ1 A;  5KWR A;  2VNO A;  1NE6 A;  4BIO A;  1AYN 3;  1UXZ A;  3OGJ A;  1V6K A;  4FVV A;  5DZF A;  1YI9 A;  1JZ7 A;  1QJX 2;  3K75 B;  3UV9 A;  1RHI 1;  3APB A;  1TE1 B;  1QDC A;  4YVS C;  1XE0 A;  1H30 A;  3SCH A;  4YG6 A;  3MLL A;  3LEI A;  1FI2 A;  4E2G A;  4C1X A;  3LSD A;  4YW6 A;  3AMM A;  4X8N A;  5FP3 A;  4Y24 A;  3ZN6 B;  4CXY A;  1OQE A;  2ZEY A;  4CDQ B;  4EQV A;  1Q5O A;  1PGW 1;  2XUE A;  1HB4 A;  5DUU A;  3OGV A;  4FTB A;  4S2H A;  2G9Z A;  1E5H A;  1O7F A;  1SPP B;  2ZGM A;  3A7Q A;  2JKX A;  2VJX A;  3PUQ A;  3UKN A;  5BNO A;  2FDJ A;  1MEC 3;  1Q8Q A;  1GWM A;  1UOG A;  2IXJ A;  3ILF A;  3MLJ A;  4QDS A;  2D5F A;  3SHR A;  4HVO A;  1C1F A;  4B7E A;  5FZO A;  2D44 A;  2BGP A;  4UFM A;  3V0B A;  4QM9 A;  5C8C A;  1PO1 2;  4DQA A;  1DQ4 A;  4HSL A;  2VMI A;  4BIS A;  5F7U A;  1UF2 C;  5I91 A;  1W8W A;  3AKT A;  4FPL A;  1O3R A;  1JYI A;  3ZKY A;  2OS2 A;  2KM2 A;  2CDP A;  5FZ3 A;  2VGD A;  1Z0H A;  4YVW B;  5LAS A;  4A4A A;  1ZBA 3;  3OJB A;  1JZ8 A;  4GUL A;  1VRB A;  2V4V A;  4JTO A;  5IAT A;  3POI A;  5C3S A;  2J7M A;  3WF4 A;  4DMI A;  1RXF A;  3H3L A;  1UOJ A;  4GD4 A;  2J1A A;  2WJS A;  4J25 A;  4RSU A;  3ZXJ A;  5L9V A;  1XNA A;  4JGY A;  4Y5S A;  3TAY A;  1KDM A;  2P3Y A;  1Q43 A;  1GMM A;  4FPE A;  4Y5Z 0;  5CKQ A;  1RUD 2;  2VME A;  4DEQ A;  5JOY A;  1W39 A;  3MW2 A;  4I30 A;  1D2S A;  2GAU A;  4D69 A;  1RVF 2;  2CWS A;  3WNP A;  1RUI 2;  1F4A A;  1AYM 3;  3DYP A;  3WSO A;  2VTF A;  2VMF A;  1GP4 A;  2P37 A;  1J58 A;  1NAE A;  1U5I A;  3VDA A;  5C9A B;  4K7J A;  2XG3 A;  4WBB A;  5FZM A;  4K20 A;  4BHP A;  1F9K A;  4O61 A;  3SCG A;  5LRS A;  4BA6 A;  4FAH A;  4IV1 B;  2HWC 2;  2WZR 3;  5EV7 A;  3V0B B;  1SLA A;  2R49 A;  2VBB A;  2QJV A;  1I9R A;  1BVV A;  1OVS A;  4Q4V 1;  3VV1 A;  4AE2 A;  3UET A;  4AK3 A;  4RHV 3;  1HX6 A;  3NST A;  3ZFF C;  3ILN A;  4QPG B;  2FBE A;  5HCH A;  1OLR A;  3EMR A;  1UOB A;  2PAE A;  1HKD A;  3BGA A;  4UFK A;  2JKB A;  1NLQ A;  2FHR A;  3DKW A;  5A80 A;  2JG9 B;  4LKS A;  1W6N B;  4CDX A;  3N36 A;  2IZW A;  1S2B A;  3ETQ A;  2DUR A;  2OII A;  2K9Z A;  4QKD A;  1OFN A;  1JHN A;  4JC1 A;  4LJH A;  4LKE A;  5D21 A;  2H0V A;  1CON A;  1VRH 3;  5B4X A;  4NIA A;  1IPS A;  1D4M 2;  3PIG A;  2X8K A;  2WO3 A;  1KEX A;  3ACL A;  4HZF A;  4P9I A;  4XUQ A;  4B4R A;  4GQ7 A;  2D40 A;  2QE3 A;  4CCK A;  1I5Z A;  1QXR A;  1QXP A;  1KQR A;  3RMY A;  1NZC A;  4FCA A;  4UWD A;  3N7K A;  2F17 A;  3GAL A;  2Y38 A;  3GNE A;  4LMF A;  4NRP A;  3LIH A;  4QKB A;  5EXO A;  2ARB A;  5FZK A;  1W05 A;  5A32 B;  4UW3 A;  4A42 A;  1G9C A;  3OTF A;  5JR7 B;  5FP8 A;  1DYP A;  5J98 B;  4CDW A;  4AAP A;  2WKK A;  4DIQ A;  1DGR N;  2CDO A;  2EIB A;  2Y64 A;  5L9R A;  3BU0 A;  1BEV 1;  1FMD 3;  3IDE A;  4YFW A;  2WSV A;  5A7W A;  2XH6 A;  3CJX A;  3E5Q A;  4IEW A;  5L9B A;  2ZGQ A;  4COW A;  1AR6 2;  3TEZ A;  3WHT A;  1FAT A;  2Y60 A;  1KDK A;  4Q4X 1;  3VKF C;  5JXH A;  2VUD A;  3AC0 A;  3VBR B;  1XSR A;  2VZ3 A;  2WZE A;  4ZS2 A;  5JI7 A;  5A6Z A;  2JIG A;  1GAN A;  4FOQ A;  4UF0 B;  3SC7 X;  5CFD A;  3UES A;  2FDG A;  1NE4 A;  5GLU A;  4XCB A;  2ZXQ A;  2R04 3;  3NJV A;  5ACA 1;  5DUV A;  2W1Q A;  1POQ A;  4Y1Z A;  3T0B A;  1SLI A;  2EA7 A;  2W46 A;  3LOB A;  3KSC A;  4CP9 B;  3CQO A;  1GZ9 A;  1MPX A;  1COV 1;  2BP6 A;  1LOF A;  1VBB 2;  4DB5 A;  4H7L A;  4BM8 A;  5IT6 A;  5EPA A;  2HWF 3;  2Q1F A;  2YG0 A;  4BJ0 A;  3H8U A;  1DQ5 A;  1RUG 3;  2HBU A;  2YGL A;  3DEM A;  3KB5 A;  4XQW A;  3VHO A;  1BK1 A;  1K12 A;  1KRI A;  4D7Y A;  1H8T C;  1WA6 X;  3KT7 A;  5CG8 A;  1DQ6 A;  4FXG B;  4C8D A;  2NYY A;  1Q8S A;  4XZU G;  4AGV A;  2W5F A;  4K1Y A;  1ENX A;  5FR3 A;  4XUR A;  4Z92 B;  3VBH C;  1RB8 G;  2C0Z A;  1ZM1 A;  2RS3 2;  2PHX A;  4QGM A;  4JGZ A;  2A75 A;  1PK6 A;  5LRR A;  4YPJ A;  4JRL A;  4QXH A;  5FMC A;  4OMD A;  5T52 A;  1KXG A;  5BNO B;  1PZ7 A;  2Z69 A;  2WIN B;  4R9A A;  3S7E A;  2RS5 2;  1ZZ7 A;  5FZO B;  2ZCW A;  3R0R A;  1ZZ9 A;  4XEZ A;  1PMI A;  1EAH 1;  5C8C B;  3VN4 A;  3EO6 A;  3T2T A;  1OVP A;  4CXX A;  2VZP A;  5JUV A;  2ZGU A;  2O8O A;  3FMG A;  4Q4Y 3;  1CGP A;  1CJP A;  3J8F 3;  3WCR A;  1XXN A;  3V56 A;  1KJL A;  4YGC A;  3III A;  3MFC A;  1AYN 2;  4S2D A;  3PJY A;  3IZO A;  4CDU C;  5FK7 A;  4BLJ A;  5J48 A;  3MPP G;  5HPO A;  4AFM A;  1FPN 3;  1L3J A;  2A71 A;  5JZG A;  1QDO A;  3CU7 A;  4LUM A;  4RN5 A;  4XET A;  2J1T A;  5HV0 A;  2DVG A;  1QJY 2;  2VUA A;  2XQR A;  1QOO A;  4JGY B;  4YZ4 A;  4JHZ A;  1W0P A;  3KM5 A;  3KCC A;  4D7T A;  2IXK A;  5JR2 A;  2GN7 A;  4LIT A;  2Q5T A;  5FPV A;  3TN9 2;  4FFG A;  2RS1 1;  1MZ6 A;  1MEC 2;  2EXJ A;  3OG2 A;  1G9A A;  1LHW A;  1B09 A;  4XOG A;  4IGP A;  1IPK A;  2D43 A;  1UY3 A;  1D0G A;  1CAX A;  2W95 A;  3AYD A;  3RI8 A;  3WNL A;  2LM3 A;  2W9X A;  1UZ0 A;  2EAL A;  5A7Q A;  1LU2 A;  2W87 A;  2RHP A;  1OLQ A;  2VQU A;  3KT1 A;  2WQ8 A;  2DYC A;  3B9C A;  4ZXK A;  3VZL A;  4QU2 A;  1M06 G;  1ZBA 2;  5BYN A;  3TEW A;  4IEV A;  1VBC 1;  1LHU A;  3MFA A;  1OQD A;  2D98 A;  5DQ0 A;  4WM7 C;  3RZG A;  2VBP A;  5KXE A;  2TNF A;  3AM2 A;  4NRM A;  2X53 S;  3VD7 A;  2FMD A;  2GDF A;  2QQO A;  2B9V A;  4MZU A;  2B8M A;  2ZGN A;  3AZV A;  4CDX B;  3HQR A;  5G04 L;  4CUC A;  3ZSJ A;  3DN7 A;  3LGR A;  2WT0 A;  4AI9 A;  3WQB A;  3NNM A;  4AFD A;  1AYM 2;  2W2I A;  3O1S A;  4LHL A;  1D7P M;  1PNG A;  2OQ7 A;  2OT7 A;  1QHD A;  2VR4 A;  3OF1 A;  3Q9O A;  4FPH A;  2C5D A;  3ZM8 A;  4A7K A;  4B4P A;  3AK0 A;  4OUE A;  1OKO A;  1BMV 2;  5CIS A;  3M3E A;  3PUS A;  2OUJ A;  4CP2 A;  4DXT A;  3ZMN A;  4RS5 A;  4URA A;  2E53 A;  1IG0 A;  2NPI A;  1VMH A;  2Q4S A;  4AI3 A;  4AED A;  2JJ6 A;  2FCV A;  3OUH A;  1ZBE 3;  4L97 A;  5KR7 A;  3MZH A;  1LOA A;  4E4H A;  3WUC A;  4A6S A;  4CA9 A;  3KHB A;  4LBQ B;  4FP3 A;  1TMF 3;  3WOG A;  2XJU A;  5A7W B;  1RUC 3;  4FPG A;  5BNP C;  3VBO A;  2V5D A;  2A3W A;  2W94 A;  4QX0 A;  1O91 A;  1WKY A;  2ADE A;  4ERO A;  1JZ6 A;  1LR5 A;  5C5T A;  3THT A;  5FMO S;  5BUV A;  4HVQ A;  2IVJ A;  4COZ A;  3H3Z A;  3K3N A;  1R1A 2;  5H9P A;  3URF A;  1VRH 2;  1W04 A;  5CFD B;  4AFB A;  2DVF A;  4OHV A;  3QCW A;  4PJY A;  3WDU A;  2A3X A;  2VUL A;  5CB7 A;  4Y4R A;  1QH7 A;  2RDS A;  1TEI A;  1DGW A;  2Q0A A;  5C33 A;  4YM0 A;  3CZU A;  3BUC A;  3EXU A;  3PUR A;  1PO1 1;  4GH4 C;  4AAX A;  1JYN A;  1SG3 A;  1QJE A;  2JB4 A;  4FAG A;  4N8M A;  4CEY A;  1AL2 2;  1S0E A;  1GU3 A;  2G1M A;  2K0G A;  5FYS A;  5C70 A;  3D4K A;  1OBN A;  4IV3 A;  2C9A A;  3KWV A;  4MXV A;  1UMI A;  4XAA A;  5H9S A;  4BWO A;  4BDV B;  1POV 1;  4LBM A;  1UIK A;  3S0M A;  4K3U A;  1OD5 A;  4RR3 A;  1WME A;  2QQI A;  5AFB A;  3PLQ A;  2BGO A;  3POS A;  5D8A C;  3Q8C A;  4OZO A;  3BTZ A;  3VKO A;  4AVS A;  3PTR B;  1SDW A;  4RGA A;  4DXZ A;  1GP6 A;  4FPK A;  3AMP A;  3O1U A;  2PHT A;  3KGZ A;  2IWG B;  4HLT A;  2A3Y A;  2FD8 A;  4JGZ B;  2A73 B;  4NUB A;  3HR9 A;  4PIY A;  1RMU 3;  4QPW A;  4LBJ A;  2H6B A;  1ZX5 A;  2Z79 A;  3ZYB A;  1RUI 1;  5CIR A;  2R07 3;  4QPI A;  3T2P A;  2R04 2;  3AJY A;  1HRI 3;  1LOC A;  1ND3 C;  4XFB A;  4CP1 A;  2JE9 A;  4MV2 A;  4NHX A;  4GB3 2;  4AQ2 A;  2UY9 A;  5CKM A;  3BOW A;  1W8Z A;  3IT8 A;  3VDD A;  2WA4 A;  4XE9 A;  5FZ7 A;  5KHK A;  2LUW A;  3IAP A;  4MG2 A;  1QJF A;  4N9I A;  1IS4 A;  1RIT A;  3MGU A;  5DAX A;  2Y6G A;  1SHW B;  4YM1 A;  5IWF A;  3T4H B;  3ZVX A;  2VOW A;  1VJ2 A;  4BPZ A;  5FLJ A;  3H3U A;  3MW3 A;  2V4A A;  4MHR A;  4PI0 A;  2Z2S B;  3O12 A;  3M3O A;  1OXC A;  3T1M A;  4AHZ A;  3O1T A;  1UZV A;  1NQD A;  3BTA A;  3WG2 A;  3AZW A;  3AB0 A;  3AP9 A;  3FLT A;  5JZG B;  3ZN5 A;  1UYP A;  4XF0 A;  1ENQ A;  1MS0 A;  4XQD A;  1XSQ A;  1U0A A;  4YRD A;  3H8O A;  4JQR A;  1NCQ C;  3SKV A;  2XB6 C;  5F3C A;  2BU9 A;  1G7Y A;  2XHN A;  4CU7 A;  4M00 A;  4ATF A;  2D6L X;  3DPR C;  3IWZ A;  3RZL A;  1VAM A;  4KBZ A;  4LO7 A;  4UBG A;  3AZZ A;  2XVK A;  1KGY A;  2ILM A;  1CAX B;  4FOY A;  1AVB A;  1FYU A;  4MGY E;  5IVC A;  4JV4 A;  1X9P A;  1GWL A;  1L7L A;  4N53 B;  2DBN A;  1R1Z A;  1O3T A;  3WNM A;  4Q29 A;  4Q4Y 2;  2XUM A;  3J8F 2;  4JZR A;  5IVE A;  5GZG A;  2XJR A;  1UNB A;  2NN8 A;  2GND A;  1WMX A;  4P9J A;  2R6Q A;  3C7E A;  2VNG A;  4MXW A;  1WWY A;  2ZX3 A;  1HN1 A;  3PU8 A;  4LBO A;  1VE0 A;  3ZPO A;  2W68 A;  5TSW A;  3M2M A;  4TWT A;  5APA A;  3AXD A;  1YFU A;  3MF6 A;  1O4Z A;  3E6C C;  1HDK A;  3RWN A;  4CXW A;  4AI8 A;  5FZ6 A;  3PNA A;  1CAW A;  1JN2 P;  3B00 A;  1SBF A;  2XHK A;  5A3W A;  4EN8 B;  3DXT A;  5CFC A;  3RZH A;  1N1V A;  2JIJ A;  4KGQ A;  2VOT A;  4KI5 M;  2WT1 A;  2ET1 A;  4LBN A;  2WNO A;  4GIQ A;  5L73 A;  3ZFG A;  2OPW A;  2WS9 2;  3AFK A;  4B3N A;  1PVC 3;  2DCY A;  2OXB A;  2YBK A;  3AZX A;  1HJG A;  4CCN A;  2IFW A;  4PBO A;  5LBC A;  2QQL A;  1EUT A;  1TNF A;  1SCR A;  4AED B;  4RGG A;  5KHH A;  2PHF A;  1JOB A;  1C3H A;  2GP5 A;  2B46 X;  1OA3 A;  1UL9 A;  3NV1 A;  4UW6 A;  3AVR A;  2WFF 3;  3JXS A;  2GH2 A;  1RUJ 3;  3OGS A;  5KXD A;  1LED A;  3R05 A;  3VZM A;  1JOD A;  4HK8 A;  4NPR A;  2DDU A;  2AEZ A;  1U5Y A;  2RS3 1;  5L7O B;  1W99 A;  2Y0I A;  1W3X A;  3NV3 A;  2CL2 A;  1RUN A;  5AVA A;  4OI4 A;  5BNQ A;  3RMX A;  1ZA7 A;  5FZ9 A;  2FDF A;  4IL7 A;  4QKN A;  1NX9 A;  2VQ0 A;  3ZYP A;  2VMC A;  5IVY A;  1S0G A;  4XQ4 A;  3MIE A;  3UKT A;  1MQT A;  4A7Z A;  2NQY A;  5LA9 A;  1YJK A;  2VEC A;  5FZH A;  2JDM A;  4Q4W 1;  4C1W A;  1DZQ A;  2DFB A;  3FHI B;  2NZ9 A;  3I3E A;  3VD5 A;  2PQQ A;  5LAT A;  2JIC A;  2VZ1 A;  2LAL A;  4P14 A;  3UNP A;  3R6S A;  2OKX A;  1G86 A;  1GQP A;  1DQ2 A;  3RJ2 X;  4LOS A;  2A6Y A;  2CWM A;  4XC9 A;  5JOX A;  3JD7 2;  2WZP P;  2PLV 3;  2K46 A;  4CEY B;  3NJY A;  3KVB A;  3ZR6 A;  1K5M C;  1NQJ A;  2HEW F;  1UMH A;  4LTA A;  2YMZ A;  4H7M A;  1F2N A;  2GC2 A;  5LEK A;  4Q0P A;  1W2O A;  2NM1 A;  1BZW A;  4E8D A;  1RUC 2;  4FBF A;  4QQL A;  3KMH A;  4RR3 B;  3T08 A;  3WVJ A;  3N4M A;  2HWD 2;  3LAG A;  5KHG A;  1HRV 2;  4XAB A;  2JDP A;  1UD1 A;  3LDB A;  5JXI A;  3BPZ A;  3OYW A;  5CZK A;  4EWD A;  2CYF A;  3M3Q A;  1YJL A;  3FN9 A;  1CZV A;  4UFI A;  2ZJC A;  2ZBJ A;  2X5I A;  1GWK A;  4HN0 A;  1QJU 1;  1J3Q A;  1GOF A;  3KQ4 B;  4UW4 A;  5J3U A;  4KH9 A;  2CAV A;  5HI0 A;  4AVC A;  3OD0 A;  5EIY B;  2YDE A;  4GWJ A;  4OQ9 A;  5FOJ B;  1WZX A;  4XF3 A;  4LO5 B;  5GLZ A;  5CKN A;  4RL7 A;  3VDD B;  4ORF A;  5AC9 3;  3RZK A;  2W39 A;  3DYM A;  1H4H A;  5JPM B;  1LEM A;  1BHG A;  2VOV A;  4FQ4 A;  4P00 B;  4WVM A;  4WZC A;  5I0U A;  3K4D A;  4IEU A;  1ENS A;  2R06 1;  1ULD A;  4LBL A;  1N1T A;  2BWC A;  1JZ3 A;  1UZW A;  3DCQ A;  5T5P A;  4P9X A;  4YVS A;  5HCA A;  5E88 A;  5IHR A;  4GMP 3;  3ZYH A;  4V2W A;  3FUQ A;  2WSU A;  1ULP A;  3EB7 A;  3LEK A;  4XIK A;  4Y1U A;  2RMU 1;  5FV3 A;  1ZNP A;  4AR2 A;  1R09 2;  1XND A;  1RMU 2;  3TYJ A;  1BVP 1;  4Z2W A;  4LOT A;  1TZO A;  5AFE A;  1IQA A;  1BQP A;  2A7A A;  2WDB A;  1W6Q A;  4FPY A;  2ZGS A;  5FY8 A;  5LBF A;  1HRI 2;  1IHM A;  2DCT A;  3MIB A;  4ARY A;  1ZZ6 A;  5EWS A;  4LE3 A;  4NAM A;  1NY7 2;  4IER A;  4K8F A;  1W28 A;  2Y34 A;  5DZG A;  1YQC A;  2J22 A;  1QU0 A;  3H9A A;  4PDW C;  4UAP A;  4OMC A;  3R4U A;  3KZ4 C;  4FFF A;  5JMC A;  5DAW A;  3AMQ A;  3KQR A;  4MET A;  4OUM A;  1PIV 3;  3VZN A;  1R08 3;  2XWJ B;  3C3V A;  4IE4 A;  5FYY A;  5CU1 A;  4MHU A;  3MPB A;  4MXW B;  3B5L B;  5HV4 A;  3VBU B;  3NMB A;  5IVB A;  3TB0 A;  4OI0 A;  1ODN A;  1VBD 1;  2J1E A;  1ND2 A;  4QX2 A;  5C4W C;  1XE7 A;  3F2Z A;  3UL2 A;  4QU1 A;  3AP6 A;  5F39 A;  3CEW A;  3OBA A;  4MGZ E;  1LEC A;  1F15 A;  3I4I A;  5J1X A;  5SV8 A;  4NWV A;  4FO9 A;  1HW5 A;  1HXS 1;  3D6E A;  3VBS C;  5DDJ 1;  3ZKU A;  1ZA4 A;  1XB9 A;  2XKO A;  1G9F A;  1N47 A;  5FP9 A;  5CFC B;  1OQ1 A;  3HJR A;  3IPV A;  2ZHM A;  1W9Y A;  3WQ1 A;  3GM8 A;  1HJF A;  3GZE A;  1AX0 A;  2VMD A;  2ZAB A;  1YFY A;  4QX7 A;  4MAD A;  3FLR A;  1J3P A;  2Y6J A;  4KWU A;  5FY0 A;  5FMO L;  1OC1 A;  5FZC A;  3TBD A;  3ZFG B;  1TME 1;  2ZAA A;  3LA3 A;  4Z07 A;  5FPZ A;  3GXU A;  2MEV 1;  1W2A X;  2AAC A;  2YHJ A;  4AFA A;  3ABZ A;  5I8Y A;  5HXV A;  4CU9 A;  4N7U A;  3POE A;  5GLV A;  3ORJ A;  2VZQ A;  4E2Q A;  4Y3O A;  1PO2 1;  2NP0 A;  3H1M A;  2VXJ A;  5KXB A;  4DO0 A;  1AR9 1;  1GZC A;  2BEO A;  3ZFF A;  2VCM A;  4K6B A;  5FKC A;  5FPX A;  5FMB A;  3QD6 A;  4E8C A;  1XE8 A;  2VE1 A;  3NW4 A;  3WIN E;  2F6B A;  4NRQ A;  3N3H A;  4L2N A;  4XF4 A;  3QAC A;  2B45 X;  2RJK A;  2YU2 A;  4KG8 A;  5FXV A;  2FCU A;  3ZPY A;  5JPN B;  2R0F A;  1DYK A;  1QF3 A;  1K42 A;  2WNE A;  1MQT B;  4M4R A;  4MUV A;  5FPB A;  4GB3 1;  5DUX A;  1NCR C;  3PME A;  1Q56 A;  1VB2 A;  1VBE 2;  5IVJ A;  1UU4 A;  1PVC 2;  2QZ2 A;  1LOE A;  3ZR5 A;  4EZH A;  1UYZ A;  2EAA A;  3PVE A;  4WVW A;  2ZHL A;  2RDN A;  2Y26 A;  3MIF A;  4NID A;  5A3N A;  5JDB A;  2FDI A;  3KLS A;  3LA2 A;  4NHK A;  4R9D A;  3KD4 A;  4QM8 A;  3D0S A;  3VD4 A;  4FPF A;  2ZEW A;  3SIS A;  1JUH A;  1ENR A;  1RUJ 2;  2IXL A;  5DAB A;  2WAA A;  5EYX A;  4P08 A;  4XBQ A;  4D7S A;  4XMI A;  2X09 A;  3S57 A;  3WP4 A;  4IQP A;  1OUS A;  4R4Z A;  2NMO A;  4YYO A;  3I8T A;  3PMS A;  3DV8 A;  5JI9 A;  2ZGT A;  2DFC A;  1UX6 A;  2HWB 1;  4HN1 A;  5FZA A;  5DAP A;  4COV A;  4CZS A;  5IFT A;  1G9B A;  4L99 A;  3TNP B;  1U5Z A;  1VBA 3;  4LKF A;  4BQX A;  4LIV A;  3VKN A;  4MGS A;  3ZFE C;  4N90 A;  4ISQ A;  2HH9 A;  2A1X A;  2ZGR A;  3LPF A;  2ZAH A;  4Z8B A;  1W8N A;  4BLI A;  1IS5 A;  1QJU 3;  4AHX A;  4BQ2 A;  5A3L A;  3RVH A;  2D3P A;  4ONU A;  1CQ9 A;  4QQP A;  3HN3 A;  3KF5 A;  4AQ6 A;  4AZZ A;  5FO8 B;  2JG9 C;  2VM9 A;  2RR1 1;  2PLV 2;  3MW4 A;  3UK9 A;  4AQS A;  1HV0 A;  2KR2 A;  3HWJ A;  3UGF A;  5FXX A;  3USU B;  1H8T A;  4YGD A;  1A3K A;  2JDA A;  2WFP A;  4HVR A;  5E6H A;  4D94 A;  1LKN A;  4Z82 A;  2Z5W A;  2ZKN A;  3TNQ A;  1GKB A;  2QQM A;  3VBH A;  2ZMN A;  3BU7 A;  2PFW A;  4YVS B;  1YFX A;  2BZD A;  2E63 A;  2R06 3;  3CF6 E;  1OA2 A;  1RIR A;  4QDQ A;  4OHY A;  3DXU A;  2BTV C;  3D5O A;  5F8P A;  1SAC A;  1PGL 1;  1OUR A;  1ZYB A;  3E5U A;  4UOJ A;  2I45 A;  4HFS A;  3D82 A;  1GLH A;  3HNB M;  4V1P A;  5A3P A;  1FOD 3;  4W8J A;  5J09 A;  1W6Q B;  2E33 A;  4OZX A;  4WM8 C;  1DIW A;  2C9K A;  2B7Y A;  1JI6 A;  4YAR A;  1QY4 A;  4ARX A;  5JLV A;  3FBM A;  5DPN A;  3IDA A;  4NHY A;  2VW1 A;  3B93 A;  4LK6 A;  1RUE 3;  2VMG A;  5FZG A;  5FYT A;  5FLI A;  4B1M A;  5AC9 2;  4KBB A;  5F37 A;  1XQN A;  1V9U 3;  1W06 A;  4V2V A;  4JRA A;  2WWU A;  3VDC A;  3VBR C;  1NLR A;  4CYD A;  1W6P B;  2YPJ A;  3B7M A;  3OGG A;  1Z78 A;  4CDU A;  5FY1 A;  5CG9 A;  3FC0 A;  2XBO 1;  3SXW A;  4RQP A;  2PQS A;  5FXW A;  4XFH A;  4EN7 B;  1U12 A;  4ZKT B;  2G9G A;  1NA1 B;  1ND2 B;  4AHY A;  4EV0 A;  1FV2 A;  3FUO A;  4OI2 A;  1OF3 A;  4NIH A;  3ZXA C;  3LPG A;  1MS5 A;  2A5Z A;  1SFY A;  4LT5 A;  2CGN A;  2VW2 A;  2QQV A;  3PTY A;  4XFC A;  5FBZ A;  4KU8 A;  4CCD A;  1LOB A;  4LK7 A;  4QQH A;  1ASJ 1;  1ULE A;  1EV1 3;  3AL5 A;  5FO7 B;  2WYS A;  3S6P A;  4ET7 A;  1BYH A;  2PYT A;  3VD3 A;  1J1T A;  4IE7 A;  2GME A;  3W5N A;  1VLN A;  1H8V A;  3IPV B;  3EHK A;  1QKQ A;  3PIJ A;  1PNF A;  4W6X A;  5KHI A;  1CN1 A;  4Q0Q A;  4H55 A;  4LNV A;  1US2 A;  2VUJ A;  1GOG A;  3SEP A;  1AR8 3;  5FBJ A;  3WG4 A;  2PAM A;  2JDY A;  2QQJ A;  2I07 B;  4Q1P A;  5ABJ C;  1PIV 2;  5IFP A;  2VTX J;  1HB1 A;  3ROU A;  1TME 3;  1UWW A;  1GBG A;  2IXC A;  2ZX4 A;  1YO8 A;  4ZS3 A;  5FYB A;  2ZX2 A;  4WM7 A;  1RUF 3;  1RUH 2;  3ZFF B;  3QH7 A;  3H8R A;  3BKZ A;  5FLH A;  1H9P A;  1PO2 3;  1S0C A;  1B35 B;  1HRV 1;  2B9U A;  3RYP A;  2RE9 A;  4CUB A;  3G6J B;  4NPM A;  1OHF A;  4YG0 A;  3K4Z A;  3BPS A;  1WUV A;  4A3X A;  1C8M 1;  1NKG A;  2WN2 A;  3WCS A;  1RL3 A;  4NO4 A;  1OPM A;  3CKH A;  4H2A A;  1UAI A;  4QB1 A;  3BCW A;  5FZE A;  1TVG A;  2RM2 1;  4MH0 E;  4SBV A;  3SKJ E;  2HWE 3;  3HN1 A;  4ZU5 A;  4MGT A;  4R52 A;  2YPD A;  3IN9 A;  5A6Q A;  1QQP 1;  1M4W A;  2D3R A;  4Y26 A;  2WUH A;  1WW4 A;  3IBM A;  2VPV A;  1AR7 1;  2RDR A;  4BYY A;  2P2K A;  1K45 A;  1RHI 3; 
#chains in the Genus database with same CATH homology
 1NT0 A;  1NZI A;  3KQ4 B;  4LOS A;  5CIS A;  1SPP A;  3POB A;  4LOT A;  3POE A;  2QQM A;  4LOR A;  3DEM A;  1SFP A;  3POJ A;  5CKN A;  2WNO A;  2QQO A;  3POI A;  3POG A;  2QQK A;  1SPP B;  5CKQ A;  4LMF A;  2QQL A;  1SZB A;  5CKM A;  3POF A;  4GZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...