3POJA

Crystal structure of masp-1 cub2 domain bound to ethylamine
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
ECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Mannan-Binding Lectin Recognition by Its Associated Serine Protease MASP-1: Implications for Complement Activation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords Mannan-binding lectin serine protease 1
total genus 21
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 3pojA00
1SZBA 3POEA 5CKQA 2WNOA 4LOSA 2QQLA 5CISA 2QQOA 1NT0A 3DEMA 2QQMA 4LORA 1NZIA 3POJA 1SPPA 4LMFA 5CKMA 4LOTA 3POBA 1SPPB 5CKNA 4GZ9A 3POGA 3POIA 3POFA 3KQ4B 1SFPA 2QQKA
chains in the Genus database with same CATH superfamily
3AMPA 4H7MA 5CFCA 2HWB2 4LHSA 1PIV3 1HLCA 1W99A 2A73B 2VUCA 1SDDB 4Q4X1 2VOWA 2OKXA 1UNBA 1ONAA 4IXLA 2DF7A 3C7EA 1UYYA 4JQRA 3RZKA 4KI5M 1YHFA 4AQ2A 2B9VA 2ENRA 2GN7A 4A2UA 1EV11 3B9IA 4YVWA 3KQRA 2RR11 3TYJA 3WNKA 1LULA 1TEIA 5A7PA 4NJ4A 4UXAA 5JOWA 3CJXA 1CAUA 4A7ZA 4A4AA 3W9AA 4GWJA 1ZRRA 2YYOA 1X33A 4HKWA 4K8FA 2DCJA 3APBA 5A7WB 3M3IA 3WW3A 1FI2A 2P17A 4CDUB 2OZJA 4NOTA 1RUJ1 1ZZ9A 2PHUA 2GH8A 4IDZA 2Z42A 3H3LA 5BXXA 5C6CA 4M4RA 2XOMA 5GZEA 1M4WA 2DDUA 3B69A 4J1WA 2JG9B 3VBRB 5KR7A 5C5UA 1G7YA 2ETEA 4ZKTB 2Q1ZB 1RUE2 2XG3A 2J1TA 4Z1VA 5GLUA 5A3PA 1NE6A 1NLRA 3HN3A 3N9NA 5HV0A 5GALA 3RYRA 5F39A 1RINA 4IEZA 3RQ0A 3U10A 2W1WA 3LGRA 4NIDA 1FXZA 4N43C 1JTZX 3BU7A 3WG1A 2UY9A 5I0UA 1UW8A 3WW2A 2GAUA 5A32B 4CUAA 4K9SA 1DQ1A 3B00A 3S5QA 4BXSV 1MZ5A 3WDXA 1LKNA 4FPYA 3VZNA 4X6QB 2K0GA 4LK7A 1G9CA 4AQTA 3UL2A 3WDYA 3LOBA 1YQ2A 2Z79A 3JQXA 4INDA 2BFUS 2VVEA 2J1AA 2X05A 4W4ZA 2CWMA 5F32A 3ELNA 3S6PA 5G05L 5I0TA 3ZMNA 4BQ5A 5A1LA 5IVFA 4RHV2 2AEYA 3ZYGA 2D6PA 4ZONA 3ZOIA 2AEZA 1RUI3 1AR81 4XEZA 2HWE1 3VDDA 4E4ZA 1O4ZA 4COVA 1UYXA 2ZPXA 2A70A 4E8DA 5FR3A 3ZSJA 1CAXB 2RMU1 1NXMA 5T3NA 4LHKA 3NKGA 2BJSA 1MPXA 1BK0A 1RUJ3 1W6MB 4XFBA 1W0OA 5DAXA 1O4TA 2AGSA 3WDVA 2WNEA 4AWDA 4URTA 2V09A 2GN3A 1PK6C 2R16A 4LXLA 5FYSA 2QUOA 3E1F1 4YFWA 1ULDA 5A7NA 1XYOA 2ZKNA 3G6JB 4D6QA 5CG8A 3ZR5A 1OD5A 3VBHB 3FBMA 4NHMA 2G1MA 2VMIA 1H1MA 1S0CA 2UYBA 2YFZA 3KSCA 4P00B 4OHVA 5FP3A 4CU8A 3AJZA 5FOJB 4FXKB 2E6VA 2VCAA 4XQDA 4A42A 4NO4A 5A6QA 1JZ7A 3RMXA 2CNAA 2RDRA 2A6WA 4IV1A 4AQ6A 4MYEA 2XWJB 2DFBA 1XRUA 1YUDA 2OT7A 4M4PA 4Y26A 1Y9GA 1XNCA 4Q4X2 5A7SA 2XJTA 2RDQA 3VBOC 3ALQA 4A44A 4ZXEA 4BK5A 4NWVA 4R4XA 4XZUG 3VL9A 3ZYPA 4CVUA 3EBRA 2IFWA 3RJ2X 5JPNB 3I49A 1CPNA 5EZWA 1L7RA 3C2UA 4CZSA 1CQ9A 3RYKA 1I6XA 3IDEA 4QB1A 4RN5A 3VKMA 1MS1A 1Q8QA 3HNYM 3OEBA 5FMBA 5GKAC 3DPRC 3H3ZA 2Y6GA 4FTSA 5ANQA 1SLTA 1S0FA 1OOPC 1IZ3A 1NXD1 2D44A 1CAUB 1MEC2 4NN0A 1LOFC 1POV1 1SBDA 2ILMA 3ZVXA 5CIRA 4BLJA 1GP6A 4CEWA 4RR3C 1YFWA 1CGPA 1LOEA 2DCTA 3AP6A 4R4ZA 3RYPA 1YO8A 5DUWA 2R32A 5E6HA 2V4VA 2AH2A 3RI9A 1WCQA 2VUDA 2RHPA 5CADA 2BTVC 2CTVA 1UO9A 1W6PA 4CEYB 4CU6A 5I8YA 3GHNA 3VBRA 5FQ0B 3ZYIB 1VMFA 4F83A 3OY8A 2DWRA 4FP2A 4CCOA 5A7WA 1HKDA 4DXZA 4EZHA 4ZU7A 2JG8B 2W87A 1FV3A 1OQEA 1GZ9A 2BV4A 3ETQA 3V56A 4Q0SA 4FTEA 3DYOA 2HEWF 2JJ6A 1TQ5A 3VDDC 5C3SA 4Z07A 2EXKA 3PURA 3AKRA 1HQNA 1ZBA1 2IFRA 3PUQA 4DY5A 5IT6A 5FJHA 1HXS2 1RXFA 5F5IA 2UYAA 1W6NA 1WMFA 4H14A 1RITA 1AYM2 3JD72 2VMCA 2YY1A 3GNEA 1AZDA 2VE1A 3TB0A 4CYDA 2R30A 5GJ6A 1K5MC 1R082 2QBXA 1POV3 3KD4A 5EV7A 4JGZB 4FFIA 4JRLA 1GBGA 1RMU1 3T4VA 1AL0G 5FWJA 3N9QA 1Z7S3 3I2IA 1CONA 5F1RA 4XFAA 5FZIA 1HJFA 4HT1T 3RI8A 2W2IA 3C3VA 1BKZA 1SHWB 3CMGA 4LKEA 3ATGA 2WN2A 3WNLA 3ZDSA 3J7HA 5D8AC 1H2LA 4Y33A 4Y22B 4CEWB 4XUOA 5EYYA 4IEXA 4P9IA 2WNOA 2W1SA 5FV3A 3SQOA 3ZSEA 2RR12 3RZJA 1JOBA 1CPMA 1KS5A 2AUYA 4WVMB 3OBAA 2B42B 3TN92 1W8TA 2CWSA 5C33A 2ZX4A 2VTXA 1E5IA 3KT1A 1YFUA 2JKXA 1QOSA 2ORZA 4NRPA 2VZTA 3WZ1A 1KFXL 3QOPA 4XFGA 4W6WA 1JU3A 3NAPA 2PHTA 3POBA 1M06G 1DBNA 2V5YA 4LNVA 3JXSA 3PVBB 1VBC1 2BVBA 3ZR6A 2WT1A 1J3RA 1MVQA 1RUG1 3TEWA 4QXCA 2P5BA 5IFTA 5LEKA 3ZFEA 1A78A 2VMEA 2A3YA 1UF2C 1YCIA 2Z69A 3LSDA 1VBB1 4MGIE 3HBZA 4N7IA 1PHMA 1MACA 3EHKA 1W6QB 1OQDA 2X5IC 4DEQA 1N1VA 3SH3A 2WNVA 1ZBA3 4AHXA 3ZXJA 4Q1RA 3WDTA 1LOCA 2GH2A 2EAKA 4QX1A 1J83A 1WW4A 3I3DA 1VBD2 3PUAA 3TNQA 4TLGA 4LMFA 4NIAA 5KXBA 2O1QA 1QJZA 1Y9MA 2XR4A 2ERFA 4ISRA 1BXHA 4P9LA 1AX1A 3HIFA 3KHCA 1AR93 1YFXA 1O5UA 2W9XA 3WUCA 3ZSMA 3VKLA 1RUF2 3JQWA 5FZDA 3J7MA 4AL9A 2RM22 3VBOA 4HSJA 4AFAA 2VMHA 2XVKA 4P5HA 4UBHA 1RC6A 3H9AA 5H9SA 2HWD3 1DLCA 5DUUA 5FY4A 2BUKA 2QQWA 1PGL2 5L73A 3O12A 4PQ9A 2D43A 1I9RA 1R1A1 4XW3A 1D2QA 4EJRA 5I0DA 5KXEA 3SCGA 2W92A 1W3XA 4ZU5A 5FPAA 5TSWA 4YZ5A 1PNGA 1YJKA 1W06A 1E5HA 1ST8A 1XE8A 2GC1A 2E63A 1W3VA 2EXIA 3O7OA 1R093 3PVEA 4IGPA 4O9GA 5HCFA 1X8MA 4RQPB 2YPJA 4ZY9A 5T50A 1AYM3 3JD73 3CJIC 3WF2A 4CXYA 1NAEA 5EWSA 2JG8A 5FZ4A 1PX3A 3BCWA 4E4SA 5A80A 1GSLA 2GU9A 4KG0A 3LEKA 4UI9L 3W5NA 1AJKA 2A3XA 3M2MA 4D8MA 4XAEA 4CU7A 3DF0A 2E53A 1O3SA 5T5JA 1RUD3 2IXKA 3T0DA 3AYEA 1Y4WA 1REEA 5AC93 4LUKA 4XBLA 4PLMA 5JWPA 3WQ7A 2VZOA 1B35B 4K1YA 3ENRA 1EV13 2ORXA 3H1YA 2VOKA 2FD8A 5IK8A 3JB4C 3WG3A 1H1IA 5HBAA 4CCDA 3VB9A 1G8WA 4DY3A 2VZQA 3U1XA 1SPPB 3FHQA 5JIUA 4JC1A 4AEDC 4AVSA 4C8DA 1S0GA 4YWAA 4CDWA 3S30A 1JZ3A 1FAYA 3IBMA 4EROA 3WG4A 5C8CB 4S2FA 5FPBA 2ZEZA 5A3UA 3H3UA 1DG6A 3AVRA 4GMP0 2XLFA 2E32A 4F7ZA 5B2GB 1H2KA 4HFSA 1N47A 2R1DA 2XQRA 1K12A 2OQ6A 4XJWA 5AC91 1LEDA 1W2UA 5JXHA 5T52A 4ZPIA 1UMHA 1UY0A 2HYKA 2P3KA 5FUNA 2NQYA 2QQMA 4BPZA 4V2VA 1ODNA 3AZXA 3D3AA 4QPIC 1FMD3 3T09A 1IPSA 1BZWA 2WO1A 1OF3A 1ENQA 3J9SA 3MPBA 4JRAA 4N9IA 4AVTA 2FDGA 3OPZA 4G3YC 5FCCA 5IK7A 1SLCA 4Y5Z0 4KGQA 2C9KA 3J8F3 1SBEA 2ES3A 3ZPOA 2YC4A 3UYJA 4IEWA 4QHOA 4WZFA 4Q1PA 4RQPA 3VBUA 4BM8A 2Z4FA 3B9CA 5JSOA 1PVC1 4A6SA 2YV8A 1XE0A 2VM9A 4FFFA 1AR71 2WIIB 2XQXA 3ES4A 3NNFA 3PMSA 4XJAA 3THDA 5FFOC 4QX7A 1G9BA 3NV2A 1JUHA 1NCRA 3OBZA 4DUXA 1JZ5A 2WRAA 2WJSA 4XIKA 1OH4A 1COV1 1TMF2 3CHXA 4J1XA 1RUF3 3VUOA 3N9OA 1QHDA 2VTXJ 3AL6A 4JGYC 1S0EA 1WW7A 1EAH1 3NJZA 1X9TA 4HKLA 5JXGA 2KA3A 3O1MA 2YBSA 4YYOA 3U37A 1W6OB 4LO7A 3ECQA 1ZA7A 1VBE2 3WX5A 4UW6A 2PHDA 4UF0B 1G6NA 2WO7A 4HETA 2VBBA 5IVEA 1OBNA 1Q3EA 1S0BA 2HH9A 5LA2A 3SH5A 4IV1C 2XONA 2Y6HA 3USUA 5IK5A 3FLTA 1OLRA 5JOXA 4ASLA 3WNNA 4GKXA 3ZSKA 3VHOA 4JGYB 1U5XA 2VG9A 4MHUA 2BEOA 2PHXA 2WN3A 4QM9A 3I3MA 1XNTA 2H6CA 4HBNA 1DFQA 5IJRA 1QXRA 1AX0A 2BNOA 2CDPA 2WAOA 4LBKA 1A6CA 1AXYA 1OSGA 4LQRA 3H7YA 5APAA 1VP6A 2WYFA 1D4M3 3U07A 1AL21 3S5AA 2GC2A 1WA4A 3O1OA 1YFYA 2R062 5LK7B 4CDWC 3GGLA 3AK0A 4CSWA 3RVHA 2EIEA 1PIV1 2E51A 3NL1A 5FBJA 2TNFA 2W94A 4GJYA 3KM5A 4IW3A 3Q9OA 2V73A 2DVFA 2DBIA 3ETPA 2D3RA 3H1WA 2WO3A 3M70A 5FYZA 5FZFA 1LHOA 1IS6A 4HANA 4OUEA 5FJKA 4OI1A 1UAIA 2VCCA 1PX4A 2JXAA 4DUVA 5I93A 2Y60A 3GXUA 5LY2A 4LHNA 1P8JA 1VBC2 1C8M1 2J1VA 2LS6A 2ARCA 1HB1A 5JSPA 1SDWA 3NJXA 3OGJA 4HXCA 3VBSC 1DP0A 2SLIA 3WF0A 4LKSA 1V9U3 1ND2C 4OUSA 1VALA 3J4UH 1VBB2 5FXZA 4IEQA 1REDA 4BE3A 2ZX2A 2E26A 3ROUA 1N1YA 4PJYA 4X8NA 1DQ0A 4XFHA 5DABA 3E6CC 2DCZA 2JG8C 1DF0A 4L11A 1E57A 4FPKA 5FUIA 5FYMA 3HT2A 1HRI2 1LHWA 5IYYA 3W21A 2JICA 2DBNA 4FFGA 1FV2A 4Q0VA 1CJDA 3RGBA 3EXUA 5K4LA 4GD4A 1QQP2 2R0HA 4BIOA 2Z2SB 4QKNA 2K9ZA 5T55A 3ZMOA 2GC0A 3O1UA 4FAGA 1UKGA 1Q5OA 4UWDA 3IPVB 4A45A 3ZN4A 3QLQA 1NCQA 3EB7A 4EWEA 3N9MA 2RM21 4K20A 1QJU3 2QNKA 4L97A 4EQVA 5ABJA 4XUNA 3BUCA 1XQNA 1RGSA 1PO23 5C8CC 4LTAA 3M3QA 1X36A 3V0BA 2RS31 4QKBA 3O0VA 1FYUA 3WXPA 1C1FA 1ZM1A 1DLLA 2QQUA 2P34A 3KGLA 4JCKA 4PI0A 4Q4V3 4QWNA 5G04L 1R1A2 1NY72 5K7PA 2QE3A 3ACGA 3I3EA 4DRRA 3H7JA 1W6MA 4ZZ8A 1CWPA 1EYBA 1YYNA 1DHKB 2VD7A 4D6SA 3H8UA 3CJIB 2QQKA 4BB3A 3IDAA 4QU1A 4E2QA 4BYYA 3E5QA 5LZ6A 1CAVB 3SISA 1ZA4A 2EF6A 1GUIA 3WR0A 1W04A 2D40A 5CG9A 2OPWA 3K48A 5FP7A 5DZEA 4CDUC 5JAXA 5JCTA 1KJRA 1UOJA 4AOCA 4XQWA 1UMZA 1L7LA 4YFZA 5JR2A 5CFCB 1PO11 1YI7A 1TNFA 4S2GA 2RS52 1FX5A 5JDBA 1W2NA 5EJ1B 5EQUA 4MOAA 4AVAA 1JUIA 4XFIA 4A7YA 1OLMA 1QXJA 4KL1A 4ASMB 3BTXA 3IAQA 2FCVA 4GZ9A 3POFA 1HXS3 3WVJA 4D6RA 1LECA 4LEJA 4YM2A 5FZ6A 2GMMA 4R9CA 2Y64A 1W8UA 3T2PA 5FQ0A 4KWLA 4ASKA 3UK9A 3AP9A 5FPLA 2VR4A 3E6DA 1GFF2 4HL0A 5A3OA 5C71A 2PAEA 5F7UA 2RJ2A 4GAZA 1UCXA 4Y1ZA 2WO2A 1OFNA 1AR92 1IKPA 3J7NA 1PM4A 1UXZA 1OOPA 3AZZA 3GHMA 2IWGB 3N7LA 1WBFA 5C9AB 3RRDA 5AC92 5BNPA 3M1HA 3B5LB 2HYXA 4Q0PA 2PMWB 2XKOA 4IGQA 1FMD2 5I91A 3ES1A 1VAVA 1NE4A 4NWWA 5DQ0A 4XJUA 5K9YA 1ULCA 4FVVA 1ZVFA 2ZMLA 3GM8A 3IT8A 4Q2FA 1SLBA 1W6PB 4CEYA 1QIQA 3E97A 3OD4A 1SEFA 3SXWA 2CAUA 3HQRA 4JTNA 3DXTA 3FJSA 3AP4A 3AXEA 2WT2A 4YVWC 3SNMA 1AYN2 1YQ8A 3HBKA 3K3OA 4LORA 2EXJA 3OF1A 4QX0A 2WFPA 2CL2A 1DZQA 3DUIA 4X8PA 1DQ6A 4BCUA 5KHJA 1B35A 4ITCA 1EAH3 1W0NA 3D8CA 4D7YA 5FYBA 2PXJA 1JYNA 3DKQA 1EUUA 1WCDJ 2FDJA 2BGOA 1QWRA 3LFMA 4AEDB 2VU9A 4NRMA 2VPVA 3K4AA 4L8QA 3WW1A 2Y33A 3NKTA 1T6GC 1W8HA 4YW2A 1MZEA 1FOD3 4UFJA 1VAKA 1H8VA 4Q4W1 5GZDA 2WS91 5FZMA 3WD5A 3WUDA 1WCKA 4YZ1A 5GZGA 3GZUC 1LENA 2DTYA 4QHZA 1WLTA 4Q0QA 4COUA 4AHYA 4LHLA 1RJ7A 3LWCA 5KHKA 2WNUB 3ZFGA 2P4EA 1CX4A 4E27A 5F3CA 3TRSB 4K3UA 4IEOA 5FUPA 1D4M1 1BCXA 1KS4A 4LULA 2RS51 3B93A 4LR4A 3AMMA 4QQLA 4OHWA 2XBO2 4MO3M 3OGSA 4XF3A 1VRH3 4ATEA 4PDWA 1VBE3 3Q8AA 1AL22 5JVVA 2VMGA 4JTOA 1LHNA 2PQSA 3P3PA 3N9PA 4XDOA 4OHYA 3DYPA 5FAXA 3B94A 3LA3A 1OC1A 4LBQA 3FFQA 1STMA 3CIHA 4MX3A 3Q8EA 4XOGA 5FZ8A 5C4WA 2R073 3EMRA 2ZGMA 3SEPA 3I54A 3T08A 2BGCA 2PHLA 2IXLA 3FZ3A 5BNPC 5L7OC 2FDFA 2VCMA 4IE4A 4QDQA 3KCYA 3PLQA 1VPHA 4GALA 1QJX2 4BU2A 5FTTC 3FMGA 5I0RA 1OHFA 4JDOA 1X8EA 4Q4X3 4TTGA 3SEEA 5C3PA 5FMCA 1I3HA 1UY3A 2R063 2ZGSA 3HN1A 1FMD1 2XGXA 1QKQA 2VECA 3VD7A 4EN9B 3H8RA 1UKRA 3POEA 4QX2A 4QU2A 5C9AA 1RJ8A 4HONA 1AR73 4UW4A 3I59B 2X5IB 2ZGOA 4UW3A 1UU6A 2VNRA 1H30A 1W9SA 1YWKA 4AG4A 3ZXLA 4ZS3A 3POJA 5JMCA 1O59A 3KZ4C 1KDKA 2FHRA 1HX6A 2B8MA 2GZWA 3CO2A 3D0SA 4Q5OA 3MW2A 3PU3A 4WVMA 3CU7A 1DU3D 3ZLIA 1OOPB 3O1VA 2DCYA 4QXBA 2CYFA 4AI1A 3GCWA 4XUPA 3VBOB 2IXCA 2W1UA 4OMDA 4AR2A 4YW1A 2YMZA 2J7MA 1CVNA 3BB6A 4P14A 4TYSA 3RFRA 3AKQA 3O0WA 3U75A 2FCUA 2I07B 4AZZA 4V1PA 1LGBA 3LSEA 4CCMA 4YNIA 1WZXA 4Y1VA 4DXRA 1SLAA 2WZR1 1X9PA 2EAAA 2WKKA 4BQ2A 4EWDA 5K8SA 3KLSA 2PLV2 3IKWA 1RYYA 4MGZE 1UOBA 4LE4A 2IVJA 2JDMA 3ACIA 4Z82A 1LOGA 3VBUC 4C0BA 1GR3A 3C7GA 2HWB3 2PA7A 5JXIA 3A22A 5L9RA 3AFKA 5BY5A 1I5ZA 1UY1A 5FP9A 4DXTA 3CZJA 1AL23 2Q4SA 3HT1A 4A3XA 4B7EA 3IB3A 3KMHA 3HNMA 4RFT0 4R9DA 4YZ2A 5ACA3 2CU5A 1PMJX 1G9AA 1NLSA 3UETA 3NJVA 4K21A 1K5MA 3DKWA 1BJQA 2H0VA 2BPA2 3NNLA 4QXHA 1DGWA 2WYSA 1E5RA 1LTEA 1ODMA 1VRH1 3LCPA 4BQ4A 5CFDB 1K42A 4AGRA 5KHGA 1VBA2 1QJY1 1TMF3 3BTYA 3RNSA 2YBKA 3WG2A 4ES9A 4QKFA 5CZKA 2JKBA 1JYWA 2X5IA 1DQ5A 4FPJA 1JYTA 3VKNA 4HVOA 2X09A 4COWA 2JG9A 4NHYA 2X8KA 3IN9A 2QQIA 1O3RA 1AR91 2DTWA 2NN8A 3PIGA 4WVVA 4EV0A 1HN0A 2WWUA 4MXWA 1R64A 3MV11 3K46A 2VJXA 4Q4Y2 3OTFA 4I0WB 1OUXA 5LCWL 1H6YA 2JECA 5KC6A 1LU2A 4EYUA 2WLQA 4HN1A 1SG3A 3VV1A 5CBLA 2AC1A 1POQA 2ADDA 3OJBA 4LO4B 4LBQB 5IVYA 2B39A 3WOGA 3FLRA 3ZN6B 4OUMA 4Y5SA 5FZ3A 4QQHA 3CF6E 2W52A 2WQ8A 1LU1A 3PMEA 1ENRA 2A5ZA 3Q8FA 5HCAA 1GICA 1UZVA 3N9LA 1DGLA 2ZGUA 2JEMA 1CZTA 2CAVA 2IVIB 3M7AA 3THPA 5FPXA 1RUH2 4KG8A 1HB3A 3NV1A 3HQUA 5FY1A 1ASJ1 2O14A 3WDWA 5DN2A 1Z7S2 3ZYRA 4HLTA 1HV1A 1GZWA 1LHUA 1U0AA 3URFA 1K5MB 1A8MA 1QF3A 1ZX5A 4Q8KA 4CEWC 3GALA 3ST7A 1CIWA 1BYHA 5FZ0A 4Q0UA 2NMNA 3MUY1 3F95A 4Q8LA 4TSVA 4GH4B 4ORFA 4OLLA 4NHLA 1C8M3 1UQXA 4RGAA 4TLFA 5JI9A 4B3NA 5ABJB 4IV3A 4CP1A 4OQ8A 3MEPA 3DPRA 1GV9A 4Z8BA 4OYUA 1BEV3 1XNAA 3HAGA 3MPPG 5FXWA 2VNGA 5DAPA 5FO9B 4U2AA 4QPIA 1SFPA 4B4RA 1APNA 2V4AA 2ZHLA 5JZGA 3BTAA 1QQP3 2VW2A 2ZEYA 3OY8B 1BQPA 5T5LA 1SFYA 4OI2A 3T0BA 4BISA 2J1SA 2XXZA 4N90A 4BLIA 1H9WA 1MVEA 1RUD1 4GWMA 3BODA 2LUWA 4IEPA 3VLBB 1GLHA 2XBO1 1HRI3 2BBVA 2AREA 5FZOA 3VHNA 3CKHA 4LBLA 4YG0A 1UZWA 3PVNA 4XFFA 1ZZ6A 4L92A 4E4DX 3R4UA 4RL7A 3WCRA 2KXLA 4XABA 4Y5TA 2Q8DA 5LY1A 2E7TA 3ZN6A 5FP4A 1AYM1 3JD71 4B4PA 1U5ZA 1PO13 1RHI1 3U78A 1C3HA 5FZAA 3UV9A 5J98B 4G9SB 4IESA 5CFDA 3PNAA 4QGNA 4GMP3 2JWPA 4CPBA 1ND3B 4IE6A 3TBDA 4EE2A 2PQQA 2BERA 1UYPA 2ZHKA 3OUHA 3WP6A 1DGRN 2JENA 2NLRA 5KC5A 4GB32 4LPLA 3VBSB 4PBPA 5C7GA 5CISA 4YW7A 1W90A 4LE3A 4JGYA 5DAWA 2WZR3 2ZX0A 4RYDA 4UF0A 4AGVA 4BMBA 3AP7A 1NCRC 2XJPA 3D82A 1XU2A 3I2GA 4QB2A 4JX0A 1KXGA 1QJU2 1YQ5A 5CU1A 1LEMA 2DVDA 3GF6A 3LDRA 4O61A 2EIGA 2PN5A 1C8NA 5ANNA 5EXOA 4B1LA 1WMXA 4GKYA 3DPRB 5D2AA 1YLLA 4UFMA 4DMIA 3ZYJB 5D21A 3OYWB 1XXNA 3VBHA 1UZ0A 4YGBA 2LW8A 4FAHA 3N7MA 1BVP1 1IKQA 2P3YA 1LGCA 3ZKYA 5F6KA 1ASJ2 4QQPA 3RJRA 1OA4A 2VULA 2G9FA 5HPOA 1NZIA 4PIYA 5IFPA 4MUVA 3IMMA 1GQHA 4KWUA 3WF3A 4K7JA 5F37A 4HMZA 5DPNA 4B8EA 5LA1A 3VD4A 1BBT3 2JD4A 2ZEWA 4PI2A 4UBGA 1ULGA 1RTVA 3RWKX 4NHKA 3AMQA 4AEMA 5A6ZA 4BOWA 5FYHA 5IAXA 5SV5A 1HIXA 2OA2A 1H4GA 1TE1B 2W1QA 1R1ZA 3I2FA 1C28A 5FLJA 1E5SA 3DXUA 4JHZA 3VBHC 4YGDA 2WNVB 3VDBA 2ZGLA 2P3IA 4NMIA 2JE8A 2BU9A 4JGZC 3LD8A 2WUHA 1HRV1 1MS3A 2D3PA 1TME2 3K77A 3VGIA 2H6BA 1N1SA 1GP4A 3MLJA 1BEV2 2DURA 3LFIA 3KWVA 1AR61 4FPOB 5IHRA 2W39A 2XH6A 3AVSA 4NR1A 4CUBA 5FZKA 3WF4A 1C1LA 4I2OA 2YROA 3ZX7A 5FDBA 2Y8KA 2VOVA 1VBD3 2ARXA 2D6LX 4JVAA 4UYBA 3UJQA 3WV6A 3ZFGB 2RS53 2HWF3 1BMV1 1PGL1 3GYDA 3IAPA 4COYA 4EZ4A 1OXCA 1RUI1 3QH6A 5I8SA 3T1MA 4E2GA 1QY4A 4DS0A 3BIEA 4W8JA 1N3QA 1W2OA 4K6BA 1GZCA 2Y6FA 1QMJA 4JAAA 2ZBJA 3KVBA 4RGKA 4CP9A 4BZ4A 1JZ8A 1R091 3AX4A 2IXHA 1SACA 3PJQA 2ATFA 5FPUA 2CGPA 5C8WA 1XC6A 2YGLA 1WD4A 5ACA1 3HQXA 2YZ4A 4AFBA 3MO4A 4XTPA 1RVF2 3ZXKA 1LHVA 1AR83 3GBFA 4J6GA 4D94A 1OKOA 5ABJC 4OHXA 2WNUC 4BIFA 4QGMA 5EJZB 3N7KA 2BOIA 4WM7B 4AHWA 5LWBA 5FY8A 2PLV3 5LBFA 1JBCA 2E9QA 4Z2WA 2R041 4FQ4A 4CU9A 1SZBA 2BWCA 1ZREA 3B01A 3LKJA 1F2NA 4NPRA 2XLAA 1DYOA 3BVCA 2VVFA 3J7LA 1QH7A 1LOBA 5JOYA 1RUH1 3VD5A 3GZTB 4IETA 4XURA 4HVQA 4XILA 4BQ1A 2HKXA 2H0BA 1W0PA 2XHKA 4BQWA 2MNGA 4RS5A 4LIUA 4XHBA 4E4HA 3DCQA 4LOTA 3NRUA 3OB8A 4IEUA 5KHIA 5FZ7A 5IAVA 1UU5A 5DDJ1 2XL9A 4XJZA 4AHZA 1NQJA 3THTA 4PQQA 1Z78A 3KVAA 3MICA 4QDSA 3V0AA 1NOVA 1OUSA 4M3CE 2O8OA 4META 3T4HB 3UJOA 2JIGA 2W3JA 4AI0A 4CTEA 1QH6A 1QU0A 1CX1A 2MEV2 4WVWA 2D6KA 1JXNA 2D7FA 2ZKLA 3MIHA 3PUIA 3NWKA 1KQRA 2ZGNA 1V6MA 1TVGA 2W46A 4YARA 3LIHA 5A3NA 3JBG1 4R8HA 2VL4A 2DU1A 4XCBA 1HRV2 2R1BA 1GNYA 4FXGB 1JOPA 2P3JA 4XXPA 2QDNA 2A6VA 2DV9A 2XL7A 1NZCA 3P6BA 1DYKA 1IQAA 1F9KA 2NM1A 3GBWA 3PTYA 2WZPP 2GP5A 2XPJA 3INAA 1XJAA 2IC1A 3BOWA 2WA3A 4WVZA 5FY7A 4OZXA 1KGYA 3TNPB 5C8CA 5L7OB 2D93A 2UU8A 3WQ0A 1AR82 5CKQA 3W5MA 5J1XA 2VH9A 4Y1UA 3OG2A 4Y4YA 4B4QA 1WLDA 2QQNA 5F2SA 1ND3C 3DGTA 1UL9A 2HEYF 4M3CA 5FKCA 3QBQA 5BNNC 3I2OA 3POYA 3HMYA 4UW5A 5L7OA 1O3QA 1TG7A 1UOFA 1CESA 3SKVA 4GJZA 4UFLA 2YB7A 1AX2A 4A6OA 1Y43B 1RL3A 4FPHA 4ZU4A 4CCNA 4C1XA 3USUB 1U12A 4LBMA 4FPCA 2PYTA 3UGHA 2HWB1 5JPMB 3B7MA 2WNUA 4AVCA 2QZ2A 1RVF1 5JLVA 1O5LA 1DCSA 2Q8OA 3AMNA 4C0HA 1UZYA 3I2DA 3KS7A 1CAXA 3LDBA 3ZFFC 1GOGA 2DUQA 1QJU1 1V6IA 2J22A 1WMDA 2XDVA 1V6LA 1WLWA 2C24A 2DUPA 4NRQA 4CRQA 1RUC3 4QHBA 2JE7A 1H4HA 2WFF3 3WP3A 1JS9A 5GLTA 2ARAA 3VHPA 2F17A 1OMIA 3VZLA 4XUQA 4YZ4A 3CDZB 4XPVA 5J7MA 2D6MA 4ONUA 3MF9A 3LE0A 3AKSA 1ULPA 4FOVA 5FPVA 3PL0A 3POIA 5EYXA 1VR3A 3B02A 1SCRA 2BDRA 5LA9A 4AVBA 1VBC3 1H8TA 1ENXA 4P9WA 3K4DA 2RS12 4WM8A 5FMOS 1MEC1 2F6BA 3N7JA 4OCTA 3SKJE 4L9BA 5FYIA 3AM2A 1IG3A 4FP3A 4XACA 1YIPA 2W91A 2BZDA 1IS5A 1FATA 2Y6JA 1MZFA 5L9VA 2VZVA 4XBQA 4O9EA 3HR9A 4ZS2A 3PDQA 1I1EA 3MZHA 1GQGA 2A6XA 4D7TA 4AI2A 2RR13 4TWTA 2CY6A 1U5IA 2ZHNA 3OBTA 1HV0A 4NIIA 4FPFA 5SV8A 1O8PA 4NPLA 5GM0A 4IV3B 1BEV1 3MW4A 3ZPYA 4AXOA 2HJIA 4YSFA 1O3TA 1OH3A 3VBRC 2YFUA 1WW6A 2UWCA 3JBG3 1YC61 1F8VA 4HG6B 4XE9A 1WBLA 3K4ZA 4OZOA 2AR6A 2LRPA 2QFEA 3ORJA 1HRV3 1V00A 2B5HA 3OGGA 3U4SA 5BNOC 1DYPA 4JKMA 4GMP1 1AF9A 3X29B 3OSDA 2HWE2 2A71A 4Y1XA 3FE5A 3RZHA 1PO21 1S55A 3LAGA 3LDKA 2XB6C 1VB4A 3LA7A 3D4KA 3NSTA 2QQJA 2EXHA 5IWFA 4QB6A 4BWOA 5FZLA 3HNBM 5C4WB 4HPKB 1RMU3 1JN2P 2CHHA 2Q8CA 1MR5A 3BKZA 1R092 4KU7A 1O7FA 2XBO3 2WZEA 4PF1A 2A7AA 1REFA 1S2EA 2Y38A 3D6EA 4AAXA 1RXGA 2Q30A 4NAMA 3WEZA 4M3CF 2QJVA 1W39A 2F4LA 4YM1A 5A7OA 3ZXAC 1HJGA 2HWC3 2WS93 2EALA 5JXJA 3I7DA 4WV8A 3KHBA 5F2WA 1COV3 2FMYA 3LEGA 4PIZA 3DEMA 3U11A 5DG2A 1ZRDA 2KM2A 3AZYA 5CA6A 2YU2A 1W05A 2OUHA 4S2DA 3SHRA 5F6LB 1ZBE3 2R042 4RR3B 4EWAA 2RG4A 5IVCA 2ET7A 3J8F2 3VHRA 4LIVA 3WNPA 5LRSA 2C9AA 1AXZA 2VZ3A 5AFBA 1OPMA 3LEIA 2ZACA 2GMEA 2RS33 5FBZA 2Z5WA 3WHTA 4P9JA 2DVAA 2R072 4B29A 3VZMA 1U5YA 3NMBA 3PHMA 4Y22A 3MI8A 1GYKA 1UWWA 4Y4RA 2W08A 4DPNA 2XJRA 4A41A 1UPSA 4LLFA 3AMHA 1LODA 2WQZC 3CEWA 5FWEA 3RDIA 4QQ2A 1OF4A 5FZHA 1OQ1A 3SCFA 1FNYA 3PU8A 3EJKA 5HXMA 2TBVA 5B4XA 4B1MA 3HOBA 4QGLA 2QQPA 1PK6B 1D2SA 3I8TA 2GDFA 2QTWB 2X29A 1JZ2A 1Y3TA 2GMPA 4GULA 4BQXA 1VIWB 1D0GA 2UWAA 4PDWB 2GNTA 4UOJA 3ZN5A 3ZIWA 1GMMA 4DINB 1W9TA 4ZZ5A 4DNYA 1AYN1 2Q8EA 3T2TA 4YRDA 4KBZA 5GLWA 2JDHA 1G86A 3ASIA 2YU1A 2FCTA 4X6RB 3O14A 2YC2A 3J26N 1H9PA 5A70A 1ZBA2 3UESA 4CDQA 3L2HA 3VBFC 1IPKA 4MHRA 2VC9A 1ZZ7A 3AJYA 4JDNA 5K0UC 2HWC2 4NAOA 3O1PA 1GOHA 4FO9A 1Q8SA 2RVAA 3ME2A 5BNPB 3BOPA 4WM8C 1JYCA 4UT5A 5FY0A 2VTFA 1CAWA 3WNMA 2FZ1A 1ZRCA 3Q8CA 3U0ZA 5T5OA 1PZ7A 2BRTA 2ZGPA 2PFWA 3BPSA 4IGOA 3W20A 4EN8B 1BBT2 1O4YA 1S2KA 3POSA 4LO8A 2HWD2 3C8XA 3TOJA 1HN1A 3FC0A 2FDHA 3IWZA 4A7KA 5FLIA 1BVVA 1DIWA 3OUIA 2OQ7A 2RMU3 4BQ3A 1JOJA 1MQTA 1WW5A 2VZ1A 1W2TA 3TEZA 1VBA3 3IZOA 1BHGA 1HQWA 2C4XA 1DZRA 1WGPA 4GXLA 4W6XA 5CKMA 1ACCA 2GC3A 2ZX3A 2O0OA 3ZFEB 5L19A 4XFCA 3UGGA 5JSRA 3MLKA 2JG9C 4R52A 3FBYA 4QT6A 5J96B 2RDNA 1US2A 4KWKA 4P02B 3J8F1 4UFIA 3TN91 4ES8A 4P9GA 3KT7A 3ZDVA 3MDPA 1YXWA 3M3OA 1ZZBA 4MZUA 1ZZ8A 1AUYA 4IQPA 5E8AA 3UGFA 2RJLA 2R071 5BPXA 3ZYHA 4NUBA 2DFCA 4QPWA 2VOTA 3FHIB 1F5FA 2VW0A 4LBJA 3WF1A 5BNOA 2CSGA 2JDYA 4LKFA 3I2KA 2XJVA 3NV4A 2XHNA 1LOFA 5T5PA 3MW3A 2OVUA 3F2ZA 5LA0A 3RWNA 3WHUA 3W59A 4XF9A 2RS11 4CCLA 3D0JA 1FPN1 3LZZA 1PNFA 2P1BA 3E6BA 3LB9A 5KHHA 3LF7A 1LR5A 1W03A 4RS5B 1MS5A 3RZZA 3TEXA 5C4WC 1J58A 5KBFA 3UT0A 1XNKA 4OVEA 3FUQA 2D6OX 2W5FA 5AFEA 4KMQA 4AFMA 2FQPA 1VE0A 1ENSA 4R9BA 2ZAHA 4Y24A 1K3IA 2A6YA 2XMLA 4WBBA 5A3WA 5JMOA 1JHJA 1C4RA 3ZSLA 1WA6X 4J25A 3W58A 4D7SA 1JZ4A 2W0XA 5DZFA 1RUF1 2XJQA 5CYYA 1V6OA 3ILFA 4Q4V2 3P1IA 1AR72 5FKBA 4P5YA 3UKTA 4UFHA 5FZOB 3NNGA 3ZFGC 1X7NA 1QNYA 2VQTA 5C3RA 1MS9A 1OT5A 5M0TA 1HQLA 2RDSA 2XVLA 2OYZA 5A1AA 5JZGC 1PO22 3BYWA 3KCXA 1CAVA 1AVBA 1B09A 3DV8A 3KV5A 5E88A 1QJY3 1TMF1 4MXWB 4QQOA 2WZ8A 3R4DB 3ZFEC 1OD3A 3IMNA 4CP0A 4EN6B 2A75A 3VZKA 1QJX3 2NP0A 2W95A 4HSLA 1VBE1 5F3IA 4MGQA 5FZBA 2QKDA 5IUQA 4E2SA 4MGTA 1JYXA 2KD7A 2VMDA 2UURA 1DQ2A 4XF0A 4ZXKA 5LK5A 1G9DA 2WNVC 1OA2A 4UAPA 1WMEA 2ZGQA 4IUGA 3L9JT 2R0FA 5FYYA 1OPOA 1UN1A 2HWD1 2PAKA 2PTMA 2D98A 2WABA 3I3BA 1VB2A 2VZRA 5B4NA 2YC0A 4RA0A 3WP4A 3ZXEA 1ULOA 2VCBA 4DB5A 3AYAA 3KV9A 2R043 2J1RA 2JDZA 2JB8A 4JKLA 4QPYA 4XTMA 4F3JA 3O5SA 3TAYA 2OPKA 1CR7A 3KB5A 1W6OA 3IM0A 1LESA 5H9RA 1QJY2 1YJLA 5LB6A 2OZ6A 1R1A3 2MPFA 1K45A 1O91A 1S0DA 5FK7A 2Y6LA 2NZ9A 3WQ1A 1UXXX 1GOFA 1RUOA 4LT5A 2BOJA 3GZAA 4PF5A 3TN93 1RUE3 2MEV3 3POWA 4KU8A 4LBQD 4RGGA 4N53B 3RSJA 3E5UA 1MQTB 4QKDA 1QJFA 5FXXA 4AQSA 4G4FA 5AVAA 1RUJ2 3FFZA 2WL1A 3BPZA 1F31A 4GIQA 3R6SA 5CNAA 4ET7A 4YG6A 3POGA 2Y6KA 5LBEA 3N4MA 3AZVA 3KV6A 5F5AA 1FPN2 4BA6A 2XKPA 2ZGKA 1MQTC 4H7LA 4RFRB 5F3EA 1QJEA 1RIRA 2PELA 2WBKA 4FTBA 4LBOA 1H8TB 3HWJA 4AFDA 3N3HA 5GZCA 3C7OA 2N7GA 2A1XA 3D5OA 4CE8A 4XJ8A 5J3UA 2QDRA 2VQAA 5A7QA 4YM3A 3A4UA 4MG2A 3BALA 3TEYA 5BNOB 5FYVA 1W6QA 1XBFA 2SBAA 4K1ZA 5FP8A 2CV6A 1GWLA 5A6YA 4QAWA 2P2KA 2VY0A 2VZUA 4FOQA 4N7UA 3H8XA 4C90A 5F9TA 4CCKA 3B3QE 1WKYA 1WWYA 1W9FA 2ZZJA 4LO5B 4M01A 3JZVA 1COV2 1GWMA 2B46X 2JIJA 1GZWB 2BNNA 1PMHX 3I2HA 1AJOA 2X53S 3A0NA 1EAH2 4NVPA 5KXCA 4YW4A 1UIKA 1W9YA 4AAPA 1T6BX 4FBFA 2RM23 3A7QA 3K3NA 2YHJA 3LQCA 3RPQA 4DXSA 5HV4A 3VDCA 4OI0A 3HJRA 1SLLA 2YGMA 4DEVA 1JODA 1MEC3 3LPFA 2WDBA 2AACA 3VZJA 1BBT1 2WWSA 3BGAA 4KNCA 4I01A 1VAMA 2B7YA 4KH9A 4M00A 1XU1A 2VNOA 3QD6A 3RZGA 3CJIA 4MGSA 2XJSA 1Y7BA 4B7KA 4XC9A 3C7FA 3A21A 1EUTA 1VLNA 1W28A 4ISQA 1NX9A 5C5TA 1ND2A 5FO8B 3DYMA 2VUJA 4HOOA 3SLIA 3OBRA 2KR2A 1OVSA 1NQDA 2OX0A 3T2QA 4GA9A 2Y0OA 2RJKA 4Z92B 5A1FA 4I30A 4AK3A 4RD7A 1PIV2 2J42A 5D8AB 2HEVF 2JB4A 1RHI2 2JDUA 1S2BA 3R05A 3CL1A 1UX6A 5F5CA 2VW1A 3C7HA 1QDCA 1ZYBA 1EPWA 3FN9A 2YPDA 3M8LA 1UU4A 4HKOA 5A3LA 5FZ1A 2UWBA 4GB31 1HW5A 4I0AA 3FWEA 1URXA 1Q8OA 3O1SA 2HBTA 5LW9A 2LROA 4FSJA 1N1TA 1YQCA 1SCSA 1H0BA 2VNVA 3I59A 3JB8A 2AENA 4Y20B 1W9WA 3GJBA 1NCQB 4IEYA 2A6ZA 1UX7A 4QPIB 5C9AC 4AEKA 2XWBB 4JQTA 4R9AA 2QVSB 1HDKA 4JGZA 1CIYA 3IIIA 3SMHA 2EA7A 4LO6B 2VGDA 3FHAA 1QXPA 1V70A 2GALA 4DRVA 4Z2AA 3BU0A 2K2SA 1HRI1 4LA3A 4YZ3A 5F3GA 3S7IA 4PLOA 2J1UA 5LBCA 4PIXA 5EPAA 1SQ4A 3LPGA 4E9KA 1YQ6A 3WT3A 2QZ3A 4MGYE 2A3WA 2YXSA 4OHZA 4YGCA 4COZA 4QD2A 1IOAA 4YVSC 2BBAA 4N43A 4Q4V1 4AF9A 3NAPC 2VZSA 3AL5A 4IE5A 4DO0A 4CUGA 4QDRA 3VBUB 2GNDA 3IDBB 2JDAA 4GWIA 3WW4A 4LLOA 2GSYA 4Q4W3 5CEHA 4XUTA 5FLHA 5H9PA 5HI0A 3PUSA 1FOD1 2C5DA 5JOZA 1HXS1 2ZAAA 4OQ9A 2E7AA 5EJ3A 2YDEA 1AYN3 5FZEA 1L7QA 1XB9A 2B45X 4MLOA 3VBSA 3RZMA 3ZO0B 4DOUA 2D5FA 3BN6A 1J84A 3MGUA 4GB33 4FT8A 4I09A 4JDMA 4DFSA 1S0IA 5EP9A 5JI7A 3T30A 1G9FA 2WS92 4YM0A 5D8AA 5F5QA 5FIXA 3CLPA 1PVXA 2BNMA 4XHXA 1ZBE2 3NV3A 2LALA 5IVJA 5DDJ3 5T54A 2JDPA 4K40A 1IPJA 4WM8B 3VN4A 4BXFA 4BH9A 1SBFA 1PO12 5LATA 3KQ4B 4W65A 1RB8G 4ZHNA 3EO6A 2LM3A 4KWJA 4I02A 3FX3A 4SLIA 2Q0AA 4YVWB 2R7EB 1H6XA 5CAZA 2WAAA 4QM8A 4OULA 1D4M2 1OKQA 2ZGRA 1JYVA 3AKTA 3ZFFB 3IDCB 3KF3A 3OYWA 1X50A 4FPEA 1O8SA 1H8TC 5IW0A 3U14A 5D1IA 1BMV2 2ARBA 3THCA 2NPIA 1J1TA 4AVVA 1RUI2 1JU4A 4BQYA 3NQHA 4MGKE 5CVRA 4L0PA 1KJLA 4YW5A 3OGRA 4WM7C 5KXDA 3H0OA 5K0UB 4I3GA 3OGVA 2BGPA 5FZGA 5JZGB 1IQDC 4P9XA 2BVVA 4QX5A 1F5JA 5H9QA 2ZXQA 3M3CA 4PLNA 4C1WA 1IS3A 3UKVA 4HK9A 3AB0A 1ND2B 5BNQA 2IXJA 3ILNA 1RUG2 1GZTA 2JDKA 1OVPA 2NYYA 2ZMKA 3MIFA 1PGW2 1D4VB 1IHMA 1V0AA 1KDMA 4H2AA 3K75B 3KV4A 3OPWA 2JX9A 2VQUA 4N9HA 1GKBA 3NNJA 3T1LA 2HBUA 1YIFA 4AYUA 3GJAA 1KFUL 4NPMA 5EHDA 5C3QA 4RR3A 1LGNA 3N36A 3R0RA 1VBD1 1R083 1IS4A 1MS8A 1GWKA 3VKOA 5HCBA 4ARYA 3FLPA 3K2OA 2E7QA 3UKNA 5JR7B 1Q8VA 1O6UA 2VVDA 4GH4C 1HB4A 2BQPA 1XSQA 3JUUA 5EIYB 2VMFA 3N35A 2ZTNA 5A6XA 1NA1A 2QQOA 1LOAA 4QPGA 4MSVA 3OEAA 3USSA 2WFF1 2C26A 1FNZA 2P6HA 2AYHA 3KF5A 5DDJ2 1T2XA 1SPPA 3VDAA 4CDXC 4DQAA 5F8PA 1DGRA 1GNZA 2Y26A 1W8WA 2GNBA 1F4HA 4CCCA 4FCAA 4XCAA 1PK6A 4KQ7A 4LA2A 4DZGA 1C5IA 3E5XA 4RQPC 3ZIXA 5JUVA 2MEV1 4AW7A 2XLGA 4P08A 1SMVA 4O7XA 3CQOA 4LK6A 5CB7A 4XF1A 4XDQA 1OI6A 3H50A 4MV2A 3S7EA 1PZ8A 2E31A 3WNOA 4UFKA 3T3YA 4AI8A 2PHFA 4LBNA 2C6SA 1NT0A 2JE9A 4A3ZA 5FOBB 4IV1B 5J36A 3O1RA 2VZPA 5I8TA 1OA3A 1ZRIA 3GBGA 3NNMA 2RS13 3MYXA 1CZVA 1F4AA 3ACLA 3T0AA 5BYNA 1QNWA 3A23A 2MHFA 2D3SA 2FMDA 3H42B 3LOIA 4AGGA 2EIBA 2DVBA 3VDDB 4IL7A 3EYPA 3T2OA 1DDLA 4ARXA 2OS2A 4GWNA 4AEJA 1OFSA 1QOTA 5LEJA 1JYIA 4Y3OA 4XVHA 4M3CB 4RHV3 5ERLA 4YGEA 4D3WA 1UD1A 1WCSA 3P5BA 4EN0A 5ISLA 4YPJA 5IVVA 1VMHA 1C5HA 1WD3A 2CDOA 2WLPA 3EQEA 1D0HA 1QJX1 1Q8PA 4HVRA 1NUKA 2F4PA 4MXVA 4EN7B 1POV0 2VAUA 2VQ0A 1S1AA 2FBEA 3NJYA 3JU9A 2C1FA 2VUAA 5K0UA 5LBBA 1NA1B 4QPGB 1TZOA 1CAWB 4CP2A 4RS5C 1V6KA 4XZPA 5FREA 5LRRA 3O1TA 1LCLA 1XNDA 3VL8A 4CDQC 1CN1A 3SC7X 1H1AA 1RHI3 1UOGA 5FK8A 1K5JA 4WZCA 3FL7A 3O0XA 4CDQB 4TZDA 2FDIA 2QQVA 5J37A 1F35A 4CEYC 2P6CA 4CUCA 2X10A 4AFCA 2P37A 1PVC2 5FYCA 1RUNA 2OUJA 2EICA 4CXXA 4BDVB 1QGLA 2CGOA 2G19A 3MFAA 4DUWA 1JH5A 4JZRA 3S0MA 2ZS6B 4YG3A 1VRBA 1UY4A 2WFF2 1FOD2 1GNHA 1A3KA 1W6NB 1W8FA 2RE9A 2VXRA 2WZR2 4FOYA 1UYZA 1XSRA 3MFCA 4L99A 5DG1A 3WCSA 2OIIA 3S57A 1V6NA 2PLV1 1BLZA 2WC2A 5DMYA 3Q8BA 1AHSA 3GDBA 3ZKUA 2VOXA 1CD3G 2ET1A 3WY6A 1LRHA 2G9ZA 2WT0A 3CNAA 2D6NA 3AFGA 5FZ9A 1ZBE1 3GCXA 2Y34A 5FY5A 2HLEA 2D5HA 5FY9A 1D7PM 1DGWX 3AKPA 2GNMA 4QX8A 4DIQA 3MIBA 1PVC3 4XMIA 5FPZA 3PVOA 3VBFA 4AI3A 5A3TA 2WSUA 4CXWA 2B9UA 5GLZA 1XYNA 2BFUL 1F15A 2IUWA 4YW6A 5JIAA 1W8ZA 2ADEA 2ZMNA 3BIWE 3ILRA 3UNPA 1RUD2 2FZ2A 1VRH2 2RV9A 4XBNA 4BK4A 5E16A 3LIGA 1ZNPA 1ZRFA 3OPTA 5GLVA 4E8CA 1VBA1 2J1EA 5IATA 2V5DA 2OW4A 2NMOA 4YLZA 3U4XA 2K46A 4MVTA 4SBVA 2WSVA 3MIGA 4Q27A 5HCHA 4F8AA 2FDKA 2ZJCA 2R061 4XJ9A 2OXBA 4M0HA 5IK4A 3QCWA 1KEXA 5DUVA 1V9U2 4CCJA 1VBB3 4RSUA 1YNAA 4W6YA 1PMIA 3NAPB 3QH7A 1AR63 3V0BB 2XUMA 4OI4A 2EVXA 1KITA 1RUC2 3CBNA 1RUG3 4OMCA 4PDWC 1TME3 2VXJA 2WINB 1LB2A 3ABZA 4H3WA 1C8M2 1BK1A 4Q4Y1 3HPNA 2ZABA 4FPGA 1OURA 4CDXA 5A33A 2DVGA 3OUJA 1L3JA 3BTZA 3QACA 5DAVA 1NA1C 1YEWA 1PGW1 2DU0A 2VBDA 2IZWA 4N53C 4QPGC 5A32A 3MUZ1 2JDNA 1VMJA 5DZGA 3OOXA 3H8OA 4NROA 4D0QA 3DECA 1HB2A 3DN7A 4CA9A 4K8RB 4AEDA 3OD0A 5FRAA 1DQ4A 4PHZA 4I3PA 2YUEA 2ZX1A 1KRIA 4NHXA 3PTRB 3LEMA 1WCUA 2QQLA 3RZLA 3JCIA 1EV12 3PJYA 4D69A 1LNSA 5IVBA 5CFDC 3AC0A 3WQBA 3HVDA 1QQP1 2HWF1 1Q43A 1US3A 4FOWA 1UIJA 4CDWB 4FQZA 1XYPA 1XOYA 1Z7S1 4XAAA 4JV4A 4NE9A 4XYXA 5EFUA 3WLUA 3WNXA 4TN7A 4IE0A 3NVCA 3I2JA 2LTNA 3G7DA 4HZFA 3R4SA 3ITQA 5FMOL 1NG0A 1X82A 1J3PA 4BMEA 4LITA 2RS32 4AE2A 4P9YA 5E1RA 3PUHA 3WDUA 1GP5A 1NY71 2L9LA 1YRZA 3GZEA 3ON7A 2ZEXA 5BV6A 2WWJA 4XXAA 2YBPA 3I4IA 5DUXA 4BHPA 3M4FA 4XDPA 1NLQA 4ATFA 4GQ7A 1AXKA 4LUMA 4XIOA 4W50A 2PHRA 3ZYBA 2BYVE 4IE7A 5FO7B 5KWRA 5L9BA 2WR9A 4JKKA 3PIJA 3ZXDA 2UY8A 4L2NA 3SH4A 3MF6A 4MH0E 3HEIA 1S4CA 1QDOA 2ZCWA 2I45A 1ULEA 2BW8A 1SLIA 2BWAA 5A3MA 4FFHA 4LKDA 5L36A 3VD3A 4U36A 1AR62 5BNNA 5A33B 4O65A 2GP3A 4QXKA 4XETA 4FI9A 5AVPA 1NCRB 5HXVA 4C91A 1W8OA 4Q29A 3AZWA 1PZ9A 5J48A 1VJ2A 1S0JA 3ZXFA 3VBFB 1ND3A 4LJHA 4I0BA 2HWC1 1MS0A 1NCQC 1A34A 3ACHA 4N8MA 1UZZA 3I3QA 1SFNA 2XUEA 3AXDA 1UMIA 2ZZQA 5C3OA 4YVSA 5FMDA 1H2NA 3SITA 2I74A 1PGSA 1W8NA 4IV3C 3RG0A 3WP5A 1PM7A 2JD9A 4QMAA 3KT4A 2BP6A 1EY2A 1ULFA 1RUC1 2ZOEB 2R49A 2XVGA 3LA2A 4Y20A 3SCHA 1Y9QA 1GANA 5ACA2 3AP5A 1MZ6A 4KBBA 2PHWA 4IEVA 3I97A 5FYUA 3P3NA 4Q4Y3 4CDUA 3MBWA 1RVF3 1ALYA 2CGNA 2R6QA 3MIEA 5CFCC 4LOSA 1B35C 1I5PA 2ZA9A 1JHNA 5FYTA 1N3PA 4NIHA 1JZ6A 4QX3A 3VKFC 1OLQA 2B4KA 4XF4A 3ZM8A 4HPKA 2VBPA 3CZUA 4H55A 2Q5TA 4Q26A 1LJ7A 2ZHMA 3HD8B 2Q1FA 3MLLA 5C70A 3RS6A 3BI3A 1IGOA 5J09A 2XJUA 2D97A 1DZTA 2EIDA 1ZZCA 1JMUB 1ASJ3 4MADA 3NW4A 3L2YA 1LAJA 4CDXB 5FZCA 3V65A 1GU3A 2HWF2 1NYWA 2ZGTA 4CCEA 1W2AX 1XNBA 3M3EA 4OFGA 3WINE 4HN0A 2E33A 2DYCA 1FPN3 1EP0A 1N3OA 2TEPA 1RUH3 3K51A 5DXDA 5LASA 1WUVA 5BNNB 1Z0HA 1RUE1 1JI6A 3OCPA 1JW6A 1MS4A 2DUOA 4HK8A 1A8DA 5DAQA 3ZYFA 3DL3A 2C0ZA 2WA4A 4Q4W2 3KCCA 1CJPA 3MIDA 1IG0A 2WQ4A 5I0SA 4XQ4A 1QEXA 2I2SA 4YVSB 5CKNA 2TUNA 4GH4A 1XPWA 1C57A 1TME1 2O8QA 2IXIA 3ACFA 4PBOA 3H1MA 3JBG2 1J1LA 4AI9A 4Y1YA 4V2WA 1NKGA 3AYCA 4XMAA 1QOOA 1YI9A 4BJ0A 3ZFFA 1H2MA 3IPVA 4PCRA 3A0KA 4FPLA 1WLCA 1V6JA 4NIGA 4RHV1 2QCSB 5FXVA 3V0AB 4CPBD 1UPIA 4N53A 2G9GA 4JHTA 3MHZA 4S2HA 1XE7A 4URAA 2W68A 4CP9B 2G4IA 2HWE3 2RMU2 2AZ5A 1J3QA 3FUOA 3NO8A 3RMYA 4PT6A 3WSOA 2ID4A 4WM7A 1CZSA 5GZFA 3MV01 3TWIA 1J59A 1Q56A 2Y0IA 2DCKA 2YG0A 2VO5A 1EPZA 1FT9A 1V9U1 3KGZA 4N43B 1GQPA 3AYDA 3VZOA 3VD9A 1UY2A 5E89A 4TXWA 3ZXGA 2Q1MA 1KD7A 4YW3A 1R081 1OLME 4M0NA 4IERA 4KGGA 5BUVA 2W47A 2PAMA 1RMU2 3IIAA 3V64A 2V72A 1TNRA
chains in the Genus database with same CATH topology
1SZBA 3POEA 5CKQA 2WNOA 4LOSA 2QQLA 5CISA 2QQOA 1NT0A 3DEMA 2QQMA 4LORA 1NZIA 3POJA 1SPPA 4LMFA 5CKMA 4LOTA 3POBA 1SPPB 5CKNA 4GZ9A 3POGA 3POIA 3POFA 3KQ4B 1SFPA 2QQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZB A;  3POE A;  5CKQ A;  2WNO A;  4LOS A;  2QQL A;  5CIS A;  2QQO A;  1NT0 A;  3DEM A;  2QQM A;  4LOR A;  1NZI A;  3POJ A;  1SPP A;  4LMF A;  5CKM A;  4LOT A;  3POB A;  1SPP B;  5CKN A;  4GZ9 A;  3POG A;  3POI A;  3POF A;  3KQ4 B;  1SFP A;  2QQK A; 
#chains in the Genus database with same CATH topology
 3AMP A;  4H7M A;  5CFC A;  2HWB 2;  4LHS A;  1PIV 3;  1HLC A;  1W99 A;  2A73 B;  2VUC A;  1SDD B;  4Q4X 1;  2VOW A;  2OKX A;  1UNB A;  1ONA A;  4IXL A;  2DF7 A;  3C7E A;  1UYY A;  4JQR A;  3RZK A;  4KI5 M;  1YHF A;  4AQ2 A;  2B9V A;  2ENR A;  2GN7 A;  4A2U A;  1EV1 1;  3B9I A;  4YVW A;  3KQR A;  2RR1 1;  3TYJ A;  3WNK A;  1LUL A;  1TEI A;  5A7P A;  4NJ4 A;  4UXA A;  5JOW A;  3CJX A;  1CAU A;  4A7Z A;  4A4A A;  3W9A A;  4GWJ A;  1ZRR A;  2YYO A;  1X33 A;  4HKW A;  4K8F A;  2DCJ A;  3APB A;  5A7W B;  3M3I A;  3WW3 A;  1FI2 A;  2P17 A;  4CDU B;  2OZJ A;  4NOT A;  1RUJ 1;  1ZZ9 A;  2PHU A;  2GH8 A;  4IDZ A;  2Z42 A;  3H3L A;  5BXX A;  5C6C A;  4M4R A;  2XOM A;  5GZE A;  1M4W A;  2DDU A;  3B69 A;  4J1W A;  2JG9 B;  3VBR B;  5KR7 A;  5C5U A;  1G7Y A;  2ETE A;  4ZKT B;  2Q1Z B;  1RUE 2;  2XG3 A;  2J1T A;  4Z1V A;  5GLU A;  5A3P A;  1NE6 A;  1NLR A;  3HN3 A;  3N9N A;  5HV0 A;  5GAL A;  3RYR A;  5F39 A;  1RIN A;  4IEZ A;  3RQ0 A;  3U10 A;  2W1W A;  3LGR A;  4NID A;  1FXZ A;  4N43 C;  1JTZ X;  3BU7 A;  3WG1 A;  2UY9 A;  5I0U A;  1UW8 A;  3WW2 A;  2GAU A;  5A32 B;  4CUA A;  4K9S A;  1DQ1 A;  3B00 A;  3S5Q A;  4BXS V;  1MZ5 A;  3WDX A;  1LKN A;  4FPY A;  3VZN A;  4X6Q B;  2K0G A;  4LK7 A;  1G9C A;  4AQT A;  3UL2 A;  3WDY A;  3LOB A;  1YQ2 A;  2Z79 A;  3JQX A;  4IND A;  2BFU S;  2VVE A;  2J1A A;  2X05 A;  4W4Z A;  2CWM A;  5F32 A;  3ELN A;  3S6P A;  5G05 L;  5I0T A;  3ZMN A;  4BQ5 A;  5A1L A;  5IVF A;  4RHV 2;  2AEY A;  3ZYG A;  2D6P A;  4ZON A;  3ZOI A;  2AEZ A;  1RUI 3;  1AR8 1;  4XEZ A;  2HWE 1;  3VDD A;  4E4Z A;  1O4Z A;  4COV A;  1UYX A;  2ZPX A;  2A70 A;  4E8D A;  5FR3 A;  3ZSJ A;  1CAX B;  2RMU 1;  1NXM A;  5T3N A;  4LHK A;  3NKG A;  2BJS A;  1MPX A;  1BK0 A;  1RUJ 3;  1W6M B;  4XFB A;  1W0O A;  5DAX A;  1O4T A;  2AGS A;  3WDV A;  2WNE A;  4AWD A;  4URT A;  2V09 A;  2GN3 A;  1PK6 C;  2R16 A;  4LXL A;  5FYS A;  2QUO A;  3E1F 1;  4YFW A;  1ULD A;  5A7N A;  1XYO A;  2ZKN A;  3G6J B;  4D6Q A;  5CG8 A;  3ZR5 A;  1OD5 A;  3VBH B;  3FBM A;  4NHM A;  2G1M A;  2VMI A;  1H1M A;  1S0C A;  2UYB A;  2YFZ A;  3KSC A;  4P00 B;  4OHV A;  5FP3 A;  4CU8 A;  3AJZ A;  5FOJ B;  4FXK B;  2E6V A;  2VCA A;  4XQD A;  4A42 A;  4NO4 A;  5A6Q A;  1JZ7 A;  3RMX A;  2CNA A;  2RDR A;  2A6W A;  4IV1 A;  4AQ6 A;  4MYE A;  2XWJ B;  2DFB A;  1XRU A;  1YUD A;  2OT7 A;  4M4P A;  4Y26 A;  1Y9G A;  1XNC A;  4Q4X 2;  5A7S A;  2XJT A;  2RDQ A;  3VBO C;  3ALQ A;  4A44 A;  4ZXE A;  4BK5 A;  4NWV A;  4R4X A;  4XZU G;  3VL9 A;  3ZYP A;  4CVU A;  3EBR A;  2IFW A;  3RJ2 X;  5JPN B;  3I49 A;  1CPN A;  5EZW A;  1L7R A;  3C2U A;  4CZS A;  1CQ9 A;  3RYK A;  1I6X A;  3IDE A;  4QB1 A;  4RN5 A;  3VKM A;  1MS1 A;  1Q8Q A;  3HNY M;  3OEB A;  5FMB A;  5GKA C;  3DPR C;  3H3Z A;  2Y6G A;  4FTS A;  5ANQ A;  1SLT A;  1S0F A;  1OOP C;  1IZ3 A;  1NXD 1;  2D44 A;  1CAU B;  1MEC 2;  4NN0 A;  1LOF C;  1POV 1;  1SBD A;  2ILM A;  3ZVX A;  5CIR A;  4BLJ A;  1GP6 A;  4CEW A;  4RR3 C;  1YFW A;  1CGP A;  1LOE A;  2DCT A;  3AP6 A;  4R4Z A;  3RYP A;  1YO8 A;  5DUW A;  2R32 A;  5E6H A;  2V4V A;  2AH2 A;  3RI9 A;  1WCQ A;  2VUD A;  2RHP A;  5CAD A;  2BTV C;  2CTV A;  1UO9 A;  1W6P A;  4CEY B;  4CU6 A;  5I8Y A;  3GHN A;  3VBR A;  5FQ0 B;  3ZYI B;  1VMF A;  4F83 A;  3OY8 A;  2DWR A;  4FP2 A;  4CCO A;  5A7W A;  1HKD A;  4DXZ A;  4EZH A;  4ZU7 A;  2JG8 B;  2W87 A;  1FV3 A;  1OQE A;  1GZ9 A;  2BV4 A;  3ETQ A;  3V56 A;  4Q0S A;  4FTE A;  3DYO A;  2HEW F;  2JJ6 A;  1TQ5 A;  3VDD C;  5C3S A;  4Z07 A;  2EXK A;  3PUR A;  3AKR A;  1HQN A;  1ZBA 1;  2IFR A;  3PUQ A;  4DY5 A;  5IT6 A;  5FJH A;  1HXS 2;  1RXF A;  5F5I A;  2UYA A;  1W6N A;  1WMF A;  4H14 A;  1RIT A;  1AYM 2;  3JD7 2;  2VMC A;  2YY1 A;  3GNE A;  1AZD A;  2VE1 A;  3TB0 A;  4CYD A;  2R30 A;  5GJ6 A;  1K5M C;  1R08 2;  2QBX A;  1POV 3;  3KD4 A;  5EV7 A;  4JGZ B;  4FFI A;  4JRL A;  1GBG A;  1RMU 1;  3T4V A;  1AL0 G;  5FWJ A;  3N9Q A;  1Z7S 3;  3I2I A;  1CON A;  5F1R A;  4XFA A;  5FZI A;  1HJF A;  4HT1 T;  3RI8 A;  2W2I A;  3C3V A;  1BKZ A;  1SHW B;  3CMG A;  4LKE A;  3ATG A;  2WN2 A;  3WNL A;  3ZDS A;  3J7H A;  5D8A C;  1H2L A;  4Y33 A;  4Y22 B;  4CEW B;  4XUO A;  5EYY A;  4IEX A;  4P9I A;  2WNO A;  2W1S A;  5FV3 A;  3SQO A;  3ZSE A;  2RR1 2;  3RZJ A;  1JOB A;  1CPM A;  1KS5 A;  2AUY A;  4WVM B;  3OBA A;  2B42 B;  3TN9 2;  1W8T A;  2CWS A;  5C33 A;  2ZX4 A;  2VTX A;  1E5I A;  3KT1 A;  1YFU A;  2JKX A;  1QOS A;  2ORZ A;  4NRP A;  2VZT A;  3WZ1 A;  1KFX L;  3QOP A;  4XFG A;  4W6W A;  1JU3 A;  3NAP A;  2PHT A;  3POB A;  1M06 G;  1DBN A;  2V5Y A;  4LNV A;  3JXS A;  3PVB B;  1VBC 1;  2BVB A;  3ZR6 A;  2WT1 A;  1J3R A;  1MVQ A;  1RUG 1;  3TEW A;  4QXC A;  2P5B A;  5IFT A;  5LEK A;  3ZFE A;  1A78 A;  2VME A;  2A3Y A;  1UF2 C;  1YCI A;  2Z69 A;  3LSD A;  1VBB 1;  4MGI E;  3HBZ A;  4N7I A;  1PHM A;  1MAC A;  3EHK A;  1W6Q B;  1OQD A;  2X5I C;  4DEQ A;  1N1V A;  3SH3 A;  2WNV A;  1ZBA 3;  4AHX A;  3ZXJ A;  4Q1R A;  3WDT A;  1LOC A;  2GH2 A;  2EAK A;  4QX1 A;  1J83 A;  1WW4 A;  3I3D A;  1VBD 2;  3PUA A;  3TNQ A;  4TLG A;  4LMF A;  4NIA A;  5KXB A;  2O1Q A;  1QJZ A;  1Y9M A;  2XR4 A;  2ERF A;  4ISR A;  1BXH A;  4P9L A;  1AX1 A;  3HIF A;  3KHC A;  1AR9 3;  1YFX A;  1O5U A;  2W9X A;  3WUC A;  3ZSM A;  3VKL A;  1RUF 2;  3JQW A;  5FZD A;  3J7M A;  4AL9 A;  2RM2 2;  3VBO A;  4HSJ A;  4AFA A;  2VMH A;  2XVK A;  4P5H A;  4UBH A;  1RC6 A;  3H9A A;  5H9S A;  2HWD 3;  1DLC A;  5DUU A;  5FY4 A;  2BUK A;  2QQW A;  1PGL 2;  5L73 A;  3O12 A;  4PQ9 A;  2D43 A;  1I9R A;  1R1A 1;  4XW3 A;  1D2Q A;  4EJR A;  5I0D A;  5KXE A;  3SCG A;  2W92 A;  1W3X A;  4ZU5 A;  5FPA A;  5TSW A;  4YZ5 A;  1PNG A;  1YJK A;  1W06 A;  1E5H A;  1ST8 A;  1XE8 A;  2GC1 A;  2E63 A;  1W3V A;  2EXI A;  3O7O A;  1R09 3;  3PVE A;  4IGP A;  4O9G A;  5HCF A;  1X8M A;  4RQP B;  2YPJ A;  4ZY9 A;  5T50 A;  1AYM 3;  3JD7 3;  3CJI C;  3WF2 A;  4CXY A;  1NAE A;  5EWS A;  2JG8 A;  5FZ4 A;  1PX3 A;  3BCW A;  4E4S A;  5A80 A;  1GSL A;  2GU9 A;  4KG0 A;  3LEK A;  4UI9 L;  3W5N A;  1AJK A;  2A3X A;  3M2M A;  4D8M A;  4XAE A;  4CU7 A;  3DF0 A;  2E53 A;  1O3S A;  5T5J A;  1RUD 3;  2IXK A;  3T0D A;  3AYE A;  1Y4W A;  1REE A;  5AC9 3;  4LUK A;  4XBL A;  4PLM A;  5JWP A;  3WQ7 A;  2VZO A;  1B35 B;  4K1Y A;  3ENR A;  1EV1 3;  2ORX A;  3H1Y A;  2VOK A;  2FD8 A;  5IK8 A;  3JB4 C;  3WG3 A;  1H1I A;  5HBA A;  4CCD A;  3VB9 A;  1G8W A;  4DY3 A;  2VZQ A;  3U1X A;  1SPP B;  3FHQ A;  5JIU A;  4JC1 A;  4AED C;  4AVS A;  4C8D A;  1S0G A;  4YWA A;  4CDW A;  3S30 A;  1JZ3 A;  1FAY A;  3IBM A;  4ERO A;  3WG4 A;  5C8C B;  4S2F A;  5FPB A;  2ZEZ A;  5A3U A;  3H3U A;  1DG6 A;  3AVR A;  4GMP 0;  2XLF A;  2E32 A;  4F7Z A;  5B2G B;  1H2K A;  4HFS A;  1N47 A;  2R1D A;  2XQR A;  1K12 A;  2OQ6 A;  4XJW A;  5AC9 1;  1LED A;  1W2U A;  5JXH A;  5T52 A;  4ZPI A;  1UMH A;  1UY0 A;  2HYK A;  2P3K A;  5FUN A;  2NQY A;  2QQM A;  4BPZ A;  4V2V A;  1ODN A;  3AZX A;  3D3A A;  4QPI C;  1FMD 3;  3T09 A;  1IPS A;  1BZW A;  2WO1 A;  1OF3 A;  1ENQ A;  3J9S A;  3MPB A;  4JRA A;  4N9I A;  4AVT A;  2FDG A;  3OPZ A;  4G3Y C;  5FCC A;  5IK7 A;  1SLC A;  4Y5Z 0;  4KGQ A;  2C9K A;  3J8F 3;  1SBE A;  2ES3 A;  3ZPO A;  2YC4 A;  3UYJ A;  4IEW A;  4QHO A;  4WZF A;  4Q1P A;  4RQP A;  3VBU A;  4BM8 A;  2Z4F A;  3B9C A;  5JSO A;  1PVC 1;  4A6S A;  2YV8 A;  1XE0 A;  2VM9 A;  4FFF A;  1AR7 1;  2WII B;  2XQX A;  3ES4 A;  3NNF A;  3PMS A;  4XJA A;  3THD A;  5FFO C;  4QX7 A;  1G9B A;  3NV2 A;  1JUH A;  1NCR A;  3OBZ A;  4DUX A;  1JZ5 A;  2WRA A;  2WJS A;  4XIK A;  1OH4 A;  1COV 1;  1TMF 2;  3CHX A;  4J1X A;  1RUF 3;  3VUO A;  3N9O A;  1QHD A;  2VTX J;  3AL6 A;  4JGY C;  1S0E A;  1WW7 A;  1EAH 1;  3NJZ A;  1X9T A;  4HKL A;  5JXG A;  2KA3 A;  3O1M A;  2YBS A;  4YYO A;  3U37 A;  1W6O B;  4LO7 A;  3ECQ A;  1ZA7 A;  1VBE 2;  3WX5 A;  4UW6 A;  2PHD A;  4UF0 B;  1G6N A;  2WO7 A;  4HET A;  2VBB A;  5IVE A;  1OBN A;  1Q3E A;  1S0B A;  2HH9 A;  5LA2 A;  3SH5 A;  4IV1 C;  2XON A;  2Y6H A;  3USU A;  5IK5 A;  3FLT A;  1OLR A;  5JOX A;  4ASL A;  3WNN A;  4GKX A;  3ZSK A;  3VHO A;  4JGY B;  1U5X A;  2VG9 A;  4MHU A;  2BEO A;  2PHX A;  2WN3 A;  4QM9 A;  3I3M A;  1XNT A;  2H6C A;  4HBN A;  1DFQ A;  5IJR A;  1QXR A;  1AX0 A;  2BNO A;  2CDP A;  2WAO A;  4LBK A;  1A6C A;  1AXY A;  1OSG A;  4LQR A;  3H7Y A;  5APA A;  1VP6 A;  2WYF A;  1D4M 3;  3U07 A;  1AL2 1;  3S5A A;  2GC2 A;  1WA4 A;  3O1O A;  1YFY A;  2R06 2;  5LK7 B;  4CDW C;  3GGL A;  3AK0 A;  4CSW A;  3RVH A;  2EIE A;  1PIV 1;  2E51 A;  3NL1 A;  5FBJ A;  2TNF A;  2W94 A;  4GJY A;  3KM5 A;  4IW3 A;  3Q9O A;  2V73 A;  2DVF A;  2DBI A;  3ETP A;  2D3R A;  3H1W A;  2WO3 A;  3M70 A;  5FYZ A;  5FZF A;  1LHO A;  1IS6 A;  4HAN A;  4OUE A;  5FJK A;  4OI1 A;  1UAI A;  2VCC A;  1PX4 A;  2JXA A;  4DUV A;  5I93 A;  2Y60 A;  3GXU A;  5LY2 A;  4LHN A;  1P8J A;  1VBC 2;  1C8M 1;  2J1V A;  2LS6 A;  2ARC A;  1HB1 A;  5JSP A;  1SDW A;  3NJX A;  3OGJ A;  4HXC A;  3VBS C;  1DP0 A;  2SLI A;  3WF0 A;  4LKS A;  1V9U 3;  1ND2 C;  4OUS A;  1VAL A;  3J4U H;  1VBB 2;  5FXZ A;  4IEQ A;  1RED A;  4BE3 A;  2ZX2 A;  2E26 A;  3ROU A;  1N1Y A;  4PJY A;  4X8N A;  1DQ0 A;  4XFH A;  5DAB A;  3E6C C;  2DCZ A;  2JG8 C;  1DF0 A;  4L11 A;  1E57 A;  4FPK A;  5FUI A;  5FYM A;  3HT2 A;  1HRI 2;  1LHW A;  5IYY A;  3W21 A;  2JIC A;  2DBN A;  4FFG A;  1FV2 A;  4Q0V A;  1CJD A;  3RGB A;  3EXU A;  5K4L A;  4GD4 A;  1QQP 2;  2R0H A;  4BIO A;  2Z2S B;  4QKN A;  2K9Z A;  5T55 A;  3ZMO A;  2GC0 A;  3O1U A;  4FAG A;  1UKG A;  1Q5O A;  4UWD A;  3IPV B;  4A45 A;  3ZN4 A;  3QLQ A;  1NCQ A;  3EB7 A;  4EWE A;  3N9M A;  2RM2 1;  4K20 A;  1QJU 3;  2QNK A;  4L97 A;  4EQV A;  5ABJ A;  4XUN A;  3BUC A;  1XQN A;  1RGS A;  1PO2 3;  5C8C C;  4LTA A;  3M3Q A;  1X36 A;  3V0B A;  2RS3 1;  4QKB A;  3O0V A;  1FYU A;  3WXP A;  1C1F A;  1ZM1 A;  1DLL A;  2QQU A;  2P34 A;  3KGL A;  4JCK A;  4PI0 A;  4Q4V 3;  4QWN A;  5G04 L;  1R1A 2;  1NY7 2;  5K7P A;  2QE3 A;  3ACG A;  3I3E A;  4DRR A;  3H7J A;  1W6M A;  4ZZ8 A;  1CWP A;  1EYB A;  1YYN A;  1DHK B;  2VD7 A;  4D6S A;  3H8U A;  3CJI B;  2QQK A;  4BB3 A;  3IDA A;  4QU1 A;  4E2Q A;  4BYY A;  3E5Q A;  5LZ6 A;  1CAV B;  3SIS A;  1ZA4 A;  2EF6 A;  1GUI A;  3WR0 A;  1W04 A;  2D40 A;  5CG9 A;  2OPW A;  3K48 A;  5FP7 A;  5DZE A;  4CDU C;  5JAX A;  5JCT A;  1KJR A;  1UOJ A;  4AOC A;  4XQW A;  1UMZ A;  1L7L A;  4YFZ A;  5JR2 A;  5CFC B;  1PO1 1;  1YI7 A;  1TNF A;  4S2G A;  2RS5 2;  1FX5 A;  5JDB A;  1W2N A;  5EJ1 B;  5EQU A;  4MOA A;  4AVA A;  1JUI A;  4XFI A;  4A7Y A;  1OLM A;  1QXJ A;  4KL1 A;  4ASM B;  3BTX A;  3IAQ A;  2FCV A;  4GZ9 A;  3POF A;  1HXS 3;  3WVJ A;  4D6R A;  1LEC A;  4LEJ A;  4YM2 A;  5FZ6 A;  2GMM A;  4R9C A;  2Y64 A;  1W8U A;  3T2P A;  5FQ0 A;  4KWL A;  4ASK A;  3UK9 A;  3AP9 A;  5FPL A;  2VR4 A;  3E6D A;  1GFF 2;  4HL0 A;  5A3O A;  5C71 A;  2PAE A;  5F7U A;  2RJ2 A;  4GAZ A;  1UCX A;  4Y1Z A;  2WO2 A;  1OFN A;  1AR9 2;  1IKP A;  3J7N A;  1PM4 A;  1UXZ A;  1OOP A;  3AZZ A;  3GHM A;  2IWG B;  3N7L A;  1WBF A;  5C9A B;  3RRD A;  5AC9 2;  5BNP A;  3M1H A;  3B5L B;  2HYX A;  4Q0P A;  2PMW B;  2XKO A;  4IGQ A;  1FMD 2;  5I91 A;  3ES1 A;  1VAV A;  1NE4 A;  4NWW A;  5DQ0 A;  4XJU A;  5K9Y A;  1ULC A;  4FVV A;  1ZVF A;  2ZML A;  3GM8 A;  3IT8 A;  4Q2F A;  1SLB A;  1W6P B;  4CEY A;  1QIQ A;  3E97 A;  3OD4 A;  1SEF A;  3SXW A;  2CAU A;  3HQR A;  4JTN A;  3DXT A;  3FJS A;  3AP4 A;  3AXE A;  2WT2 A;  4YVW C;  3SNM A;  1AYN 2;  1YQ8 A;  3HBK A;  3K3O A;  4LOR A;  2EXJ A;  3OF1 A;  4QX0 A;  2WFP A;  2CL2 A;  1DZQ A;  3DUI A;  4X8P A;  1DQ6 A;  4BCU A;  5KHJ A;  1B35 A;  4ITC A;  1EAH 3;  1W0N A;  3D8C A;  4D7Y A;  5FYB A;  2PXJ A;  1JYN A;  3DKQ A;  1EUU A;  1WCD J;  2FDJ A;  2BGO A;  1QWR A;  3LFM A;  4AED B;  2VU9 A;  4NRM A;  2VPV A;  3K4A A;  4L8Q A;  3WW1 A;  2Y33 A;  3NKT A;  1T6G C;  1W8H A;  4YW2 A;  1MZE A;  1FOD 3;  4UFJ A;  1VAK A;  1H8V A;  4Q4W 1;  5GZD A;  2WS9 1;  5FZM A;  3WD5 A;  3WUD A;  1WCK A;  4YZ1 A;  5GZG A;  3GZU C;  1LEN A;  2DTY A;  4QHZ A;  1WLT A;  4Q0Q A;  4COU A;  4AHY A;  4LHL A;  1RJ7 A;  3LWC A;  5KHK A;  2WNU B;  3ZFG A;  2P4E A;  1CX4 A;  4E27 A;  5F3C A;  3TRS B;  4K3U A;  4IEO A;  5FUP A;  1D4M 1;  1BCX A;  1KS4 A;  4LUL A;  2RS5 1;  3B93 A;  4LR4 A;  3AMM A;  4QQL A;  4OHW A;  2XBO 2;  4MO3 M;  3OGS A;  4XF3 A;  1VRH 3;  4ATE A;  4PDW A;  1VBE 3;  3Q8A A;  1AL2 2;  5JVV A;  2VMG A;  4JTO A;  1LHN A;  2PQS A;  3P3P A;  3N9P A;  4XDO A;  4OHY A;  3DYP A;  5FAX A;  3B94 A;  3LA3 A;  1OC1 A;  4LBQ A;  3FFQ A;  1STM A;  3CIH A;  4MX3 A;  3Q8E A;  4XOG A;  5FZ8 A;  5C4W A;  2R07 3;  3EMR A;  2ZGM A;  3SEP A;  3I54 A;  3T08 A;  2BGC A;  2PHL A;  2IXL A;  3FZ3 A;  5BNP C;  5L7O C;  2FDF A;  2VCM A;  4IE4 A;  4QDQ A;  3KCY A;  3PLQ A;  1VPH A;  4GAL A;  1QJX 2;  4BU2 A;  5FTT C;  3FMG A;  5I0R A;  1OHF A;  4JDO A;  1X8E A;  4Q4X 3;  4TTG A;  3SEE A;  5C3P A;  5FMC A;  1I3H A;  1UY3 A;  2R06 3;  2ZGS A;  3HN1 A;  1FMD 1;  2XGX A;  1QKQ A;  2VEC A;  3VD7 A;  4EN9 B;  3H8R A;  1UKR A;  3POE A;  4QX2 A;  4QU2 A;  5C9A A;  1RJ8 A;  4HON A;  1AR7 3;  4UW4 A;  3I59 B;  2X5I B;  2ZGO A;  4UW3 A;  1UU6 A;  2VNR A;  1H30 A;  1W9S A;  1YWK A;  4AG4 A;  3ZXL A;  4ZS3 A;  3POJ A;  5JMC A;  1O59 A;  3KZ4 C;  1KDK A;  2FHR A;  1HX6 A;  2B8M A;  2GZW A;  3CO2 A;  3D0S A;  4Q5O A;  3MW2 A;  3PU3 A;  4WVM A;  3CU7 A;  1DU3 D;  3ZLI A;  1OOP B;  3O1V A;  2DCY A;  4QXB A;  2CYF A;  4AI1 A;  3GCW A;  4XUP A;  3VBO B;  2IXC A;  2W1U A;  4OMD A;  4AR2 A;  4YW1 A;  2YMZ A;  2J7M A;  1CVN A;  3BB6 A;  4P14 A;  4TYS A;  3RFR A;  3AKQ A;  3O0W A;  3U75 A;  2FCU A;  2I07 B;  4AZZ A;  4V1P A;  1LGB A;  3LSE A;  4CCM A;  4YNI A;  1WZX A;  4Y1V A;  4DXR A;  1SLA A;  2WZR 1;  1X9P A;  2EAA A;  2WKK A;  4BQ2 A;  4EWD A;  5K8S A;  3KLS A;  2PLV 2;  3IKW A;  1RYY A;  4MGZ E;  1UOB A;  4LE4 A;  2IVJ A;  2JDM A;  3ACI A;  4Z82 A;  1LOG A;  3VBU C;  4C0B A;  1GR3 A;  3C7G A;  2HWB 3;  2PA7 A;  5JXI A;  3A22 A;  5L9R A;  3AFK A;  5BY5 A;  1I5Z A;  1UY1 A;  5FP9 A;  4DXT A;  3CZJ A;  1AL2 3;  2Q4S A;  3HT1 A;  4A3X A;  4B7E A;  3IB3 A;  3KMH A;  3HNM A;  4RFT 0;  4R9D A;  4YZ2 A;  5ACA 3;  2CU5 A;  1PMJ X;  1G9A A;  1NLS A;  3UET A;  3NJV A;  4K21 A;  1K5M A;  3DKW A;  1BJQ A;  2H0V A;  2BPA 2;  3NNL A;  4QXH A;  1DGW A;  2WYS A;  1E5R A;  1LTE A;  1ODM A;  1VRH 1;  3LCP A;  4BQ4 A;  5CFD B;  1K42 A;  4AGR A;  5KHG A;  1VBA 2;  1QJY 1;  1TMF 3;  3BTY A;  3RNS A;  2YBK A;  3WG2 A;  4ES9 A;  4QKF A;  5CZK A;  2JKB A;  1JYW A;  2X5I A;  1DQ5 A;  4FPJ A;  1JYT A;  3VKN A;  4HVO A;  2X09 A;  4COW A;  2JG9 A;  4NHY A;  2X8K A;  3IN9 A;  2QQI A;  1O3R A;  1AR9 1;  2DTW A;  2NN8 A;  3PIG A;  4WVV A;  4EV0 A;  1HN0 A;  2WWU A;  4MXW A;  1R64 A;  3MV1 1;  3K46 A;  2VJX A;  4Q4Y 2;  3OTF A;  4I0W B;  1OUX A;  5LCW L;  1H6Y A;  2JEC A;  5KC6 A;  1LU2 A;  4EYU A;  2WLQ A;  4HN1 A;  1SG3 A;  3VV1 A;  5CBL A;  2AC1 A;  1POQ A;  2ADD A;  3OJB A;  4LO4 B;  4LBQ B;  5IVY A;  2B39 A;  3WOG A;  3FLR A;  3ZN6 B;  4OUM A;  4Y5S A;  5FZ3 A;  4QQH A;  3CF6 E;  2W52 A;  2WQ8 A;  1LU1 A;  3PME A;  1ENR A;  2A5Z A;  3Q8F A;  5HCA A;  1GIC A;  1UZV A;  3N9L A;  1DGL A;  2ZGU A;  2JEM A;  1CZT A;  2CAV A;  2IVI B;  3M7A A;  3THP A;  5FPX A;  1RUH 2;  4KG8 A;  1HB3 A;  3NV1 A;  3HQU A;  5FY1 A;  1ASJ 1;  2O14 A;  3WDW A;  5DN2 A;  1Z7S 2;  3ZYR A;  4HLT A;  1HV1 A;  1GZW A;  1LHU A;  1U0A A;  3URF A;  1K5M B;  1A8M A;  1QF3 A;  1ZX5 A;  4Q8K A;  4CEW C;  3GAL A;  3ST7 A;  1CIW A;  1BYH A;  5FZ0 A;  4Q0U A;  2NMN A;  3MUY 1;  3F95 A;  4Q8L A;  4TSV A;  4GH4 B;  4ORF A;  4OLL A;  4NHL A;  1C8M 3;  1UQX A;  4RGA A;  4TLF A;  5JI9 A;  4B3N A;  5ABJ B;  4IV3 A;  4CP1 A;  4OQ8 A;  3MEP A;  3DPR A;  1GV9 A;  4Z8B A;  4OYU A;  1BEV 3;  1XNA A;  3HAG A;  3MPP G;  5FXW A;  2VNG A;  5DAP A;  5FO9 B;  4U2A A;  4QPI A;  1SFP A;  4B4R A;  1APN A;  2V4A A;  2ZHL A;  5JZG A;  3BTA A;  1QQP 3;  2VW2 A;  2ZEY A;  3OY8 B;  1BQP A;  5T5L A;  1SFY A;  4OI2 A;  3T0B A;  4BIS A;  2J1S A;  2XXZ A;  4N90 A;  4BLI A;  1H9W A;  1MVE A;  1RUD 1;  4GWM A;  3BOD A;  2LUW A;  4IEP A;  3VLB B;  1GLH A;  2XBO 1;  1HRI 3;  2BBV A;  2ARE A;  5FZO A;  3VHN A;  3CKH A;  4LBL A;  4YG0 A;  1UZW A;  3PVN A;  4XFF A;  1ZZ6 A;  4L92 A;  4E4D X;  3R4U A;  4RL7 A;  3WCR A;  2KXL A;  4XAB A;  4Y5T A;  2Q8D A;  5LY1 A;  2E7T A;  3ZN6 A;  5FP4 A;  1AYM 1;  3JD7 1;  4B4P A;  1U5Z A;  1PO1 3;  1RHI 1;  3U78 A;  1C3H A;  5FZA A;  3UV9 A;  5J98 B;  4G9S B;  4IES A;  5CFD A;  3PNA A;  4QGN A;  4GMP 3;  2JWP A;  4CPB A;  1ND3 B;  4IE6 A;  3TBD A;  4EE2 A;  2PQQ A;  2BER A;  1UYP A;  2ZHK A;  3OUH A;  3WP6 A;  1DGR N;  2JEN A;  2NLR A;  5KC5 A;  4GB3 2;  4LPL A;  3VBS B;  4PBP A;  5C7G A;  5CIS A;  4YW7 A;  1W90 A;  4LE3 A;  4JGY A;  5DAW A;  2WZR 3;  2ZX0 A;  4RYD A;  4UF0 A;  4AGV A;  4BMB A;  3AP7 A;  1NCR C;  2XJP A;  3D82 A;  1XU2 A;  3I2G A;  4QB2 A;  4JX0 A;  1KXG A;  1QJU 2;  1YQ5 A;  5CU1 A;  1LEM A;  2DVD A;  3GF6 A;  3LDR A;  4O61 A;  2EIG A;  2PN5 A;  1C8N A;  5ANN A;  5EXO A;  4B1L A;  1WMX A;  4GKY A;  3DPR B;  5D2A A;  1YLL A;  4UFM A;  4DMI A;  3ZYJ B;  5D21 A;  3OYW B;  1XXN A;  3VBH A;  1UZ0 A;  4YGB A;  2LW8 A;  4FAH A;  3N7M A;  1BVP 1;  1IKQ A;  2P3Y A;  1LGC A;  3ZKY A;  5F6K A;  1ASJ 2;  4QQP A;  3RJR A;  1OA4 A;  2VUL A;  2G9F A;  5HPO A;  1NZI A;  4PIY A;  5IFP A;  4MUV A;  3IMM A;  1GQH A;  4KWU A;  3WF3 A;  4K7J A;  5F37 A;  4HMZ A;  5DPN A;  4B8E A;  5LA1 A;  3VD4 A;  1BBT 3;  2JD4 A;  2ZEW A;  4PI2 A;  4UBG A;  1ULG A;  1RTV A;  3RWK X;  4NHK A;  3AMQ A;  4AEM A;  5A6Z A;  4BOW A;  5FYH A;  5IAX A;  5SV5 A;  1HIX A;  2OA2 A;  1H4G A;  1TE1 B;  2W1Q A;  1R1Z A;  3I2F A;  1C28 A;  5FLJ A;  1E5S A;  3DXU A;  4JHZ A;  3VBH C;  4YGD A;  2WNV B;  3VDB A;  2ZGL A;  2P3I A;  4NMI A;  2JE8 A;  2BU9 A;  4JGZ C;  3LD8 A;  2WUH A;  1HRV 1;  1MS3 A;  2D3P A;  1TME 2;  3K77 A;  3VGI A;  2H6B A;  1N1S A;  1GP4 A;  3MLJ A;  1BEV 2;  2DUR A;  3LFI A;  3KWV A;  1AR6 1;  4FPO B;  5IHR A;  2W39 A;  2XH6 A;  3AVS A;  4NR1 A;  4CUB A;  5FZK A;  3WF4 A;  1C1L A;  4I2O A;  2YRO A;  3ZX7 A;  5FDB A;  2Y8K A;  2VOV A;  1VBD 3;  2ARX A;  2D6L X;  4JVA A;  4UYB A;  3UJQ A;  3WV6 A;  3ZFG B;  2RS5 3;  2HWF 3;  1BMV 1;  1PGL 1;  3GYD A;  3IAP A;  4COY A;  4EZ4 A;  1OXC A;  1RUI 1;  3QH6 A;  5I8S A;  3T1M A;  4E2G A;  1QY4 A;  4DS0 A;  3BIE A;  4W8J A;  1N3Q A;  1W2O A;  4K6B A;  1GZC A;  2Y6F A;  1QMJ A;  4JAA A;  2ZBJ A;  3KVB A;  4RGK A;  4CP9 A;  4BZ4 A;  1JZ8 A;  1R09 1;  3AX4 A;  2IXH A;  1SAC A;  3PJQ A;  2ATF A;  5FPU A;  2CGP A;  5C8W A;  1XC6 A;  2YGL A;  1WD4 A;  5ACA 1;  3HQX A;  2YZ4 A;  4AFB A;  3MO4 A;  4XTP A;  1RVF 2;  3ZXK A;  1LHV A;  1AR8 3;  3GBF A;  4J6G A;  4D94 A;  1OKO A;  5ABJ C;  4OHX A;  2WNU C;  4BIF A;  4QGM A;  5EJZ B;  3N7K A;  2BOI A;  4WM7 B;  4AHW A;  5LWB A;  5FY8 A;  2PLV 3;  5LBF A;  1JBC A;  2E9Q A;  4Z2W A;  2R04 1;  4FQ4 A;  4CU9 A;  1SZB A;  2BWC A;  1ZRE A;  3B01 A;  3LKJ A;  1F2N A;  4NPR A;  2XLA A;  1DYO A;  3BVC A;  2VVF A;  3J7L A;  1QH7 A;  1LOB A;  5JOY A;  1RUH 1;  3VD5 A;  3GZT B;  4IET A;  4XUR A;  4HVQ A;  4XIL A;  4BQ1 A;  2HKX A;  2H0B A;  1W0P A;  2XHK A;  4BQW A;  2MNG A;  4RS5 A;  4LIU A;  4XHB A;  4E4H A;  3DCQ A;  4LOT A;  3NRU A;  3OB8 A;  4IEU A;  5KHI A;  5FZ7 A;  5IAV A;  1UU5 A;  5DDJ 1;  2XL9 A;  4XJZ A;  4AHZ A;  1NQJ A;  3THT A;  4PQQ A;  1Z78 A;  3KVA A;  3MIC A;  4QDS A;  3V0A A;  1NOV A;  1OUS A;  4M3C E;  2O8O A;  4MET A;  3T4H B;  3UJO A;  2JIG A;  2W3J A;  4AI0 A;  4CTE A;  1QH6 A;  1QU0 A;  1CX1 A;  2MEV 2;  4WVW A;  2D6K A;  1JXN A;  2D7F A;  2ZKL A;  3MIH A;  3PUI A;  3NWK A;  1KQR A;  2ZGN A;  1V6M A;  1TVG A;  2W46 A;  4YAR A;  3LIH A;  5A3N A;  3JBG 1;  4R8H A;  2VL4 A;  2DU1 A;  4XCB A;  1HRV 2;  2R1B A;  1GNY A;  4FXG B;  1JOP A;  2P3J A;  4XXP A;  2QDN A;  2A6V A;  2DV9 A;  2XL7 A;  1NZC A;  3P6B A;  1DYK A;  1IQA A;  1F9K A;  2NM1 A;  3GBW A;  3PTY A;  2WZP P;  2GP5 A;  2XPJ A;  3INA A;  1XJA A;  2IC1 A;  3BOW A;  2WA3 A;  4WVZ A;  5FY7 A;  4OZX A;  1KGY A;  3TNP B;  5C8C A;  5L7O B;  2D93 A;  2UU8 A;  3WQ0 A;  1AR8 2;  5CKQ A;  3W5M A;  5J1X A;  2VH9 A;  4Y1U A;  3OG2 A;  4Y4Y A;  4B4Q A;  1WLD A;  2QQN A;  5F2S A;  1ND3 C;  3DGT A;  1UL9 A;  2HEY F;  4M3C A;  5FKC A;  3QBQ A;  5BNN C;  3I2O A;  3POY A;  3HMY A;  4UW5 A;  5L7O A;  1O3Q A;  1TG7 A;  1UOF A;  1CES A;  3SKV A;  4GJZ A;  4UFL A;  2YB7 A;  1AX2 A;  4A6O A;  1Y43 B;  1RL3 A;  4FPH A;  4ZU4 A;  4CCN A;  4C1X A;  3USU B;  1U12 A;  4LBM A;  4FPC A;  2PYT A;  3UGH A;  2HWB 1;  5JPM B;  3B7M A;  2WNU A;  4AVC A;  2QZ2 A;  1RVF 1;  5JLV A;  1O5L A;  1DCS A;  2Q8O A;  3AMN A;  4C0H A;  1UZY A;  3I2D A;  3KS7 A;  1CAX A;  3LDB A;  3ZFF C;  1GOG A;  2DUQ A;  1QJU 1;  1V6I A;  2J22 A;  1WMD A;  2XDV A;  1V6L A;  1WLW A;  2C24 A;  2DUP A;  4NRQ A;  4CRQ A;  1RUC 3;  4QHB A;  2JE7 A;  1H4H A;  2WFF 3;  3WP3 A;  1JS9 A;  5GLT A;  2ARA A;  3VHP A;  2F17 A;  1OMI A;  3VZL A;  4XUQ A;  4YZ4 A;  3CDZ B;  4XPV A;  5J7M A;  2D6M A;  4ONU A;  3MF9 A;  3LE0 A;  3AKS A;  1ULP A;  4FOV A;  5FPV A;  3PL0 A;  3POI A;  5EYX A;  1VR3 A;  3B02 A;  1SCR A;  2BDR A;  5LA9 A;  4AVB A;  1VBC 3;  1H8T A;  1ENX A;  4P9W A;  3K4D A;  2RS1 2;  4WM8 A;  5FMO S;  1MEC 1;  2F6B A;  3N7J A;  4OCT A;  3SKJ E;  4L9B A;  5FYI A;  3AM2 A;  1IG3 A;  4FP3 A;  4XAC A;  1YIP A;  2W91 A;  2BZD A;  1IS5 A;  1FAT A;  2Y6J A;  1MZF A;  5L9V A;  2VZV A;  4XBQ A;  4O9E A;  3HR9 A;  4ZS2 A;  3PDQ A;  1I1E A;  3MZH A;  1GQG A;  2A6X A;  4D7T A;  4AI2 A;  2RR1 3;  4TWT A;  2CY6 A;  1U5I A;  2ZHN A;  3OBT A;  1HV0 A;  4NII A;  4FPF A;  5SV8 A;  1O8P A;  4NPL A;  5GM0 A;  4IV3 B;  1BEV 1;  3MW4 A;  3ZPY A;  4AXO A;  2HJI A;  4YSF A;  1O3T A;  1OH3 A;  3VBR C;  2YFU A;  1WW6 A;  2UWC A;  3JBG 3;  1YC6 1;  1F8V A;  4HG6 B;  4XE9 A;  1WBL A;  3K4Z A;  4OZO A;  2AR6 A;  2LRP A;  2QFE A;  3ORJ A;  1HRV 3;  1V00 A;  2B5H A;  3OGG A;  3U4S A;  5BNO C;  1DYP A;  4JKM A;  4GMP 1;  1AF9 A;  3X29 B;  3OSD A;  2HWE 2;  2A71 A;  4Y1X A;  3FE5 A;  3RZH A;  1PO2 1;  1S55 A;  3LAG A;  3LDK A;  2XB6 C;  1VB4 A;  3LA7 A;  3D4K A;  3NST A;  2QQJ A;  2EXH A;  5IWF A;  4QB6 A;  4BWO A;  5FZL A;  3HNB M;  5C4W B;  4HPK B;  1RMU 3;  1JN2 P;  2CHH A;  2Q8C A;  1MR5 A;  3BKZ A;  1R09 2;  4KU7 A;  1O7F A;  2XBO 3;  2WZE A;  4PF1 A;  2A7A A;  1REF A;  1S2E A;  2Y38 A;  3D6E A;  4AAX A;  1RXG A;  2Q30 A;  4NAM A;  3WEZ A;  4M3C F;  2QJV A;  1W39 A;  2F4L A;  4YM1 A;  5A7O A;  3ZXA C;  1HJG A;  2HWC 3;  2WS9 3;  2EAL A;  5JXJ A;  3I7D A;  4WV8 A;  3KHB A;  5F2W A;  1COV 3;  2FMY A;  3LEG A;  4PIZ A;  3DEM A;  3U11 A;  5DG2 A;  1ZRD A;  2KM2 A;  3AZY A;  5CA6 A;  2YU2 A;  1W05 A;  2OUH A;  4S2D A;  3SHR A;  5F6L B;  1ZBE 3;  2R04 2;  4RR3 B;  4EWA A;  2RG4 A;  5IVC A;  2ET7 A;  3J8F 2;  3VHR A;  4LIV A;  3WNP A;  5LRS A;  2C9A A;  1AXZ A;  2VZ3 A;  5AFB A;  1OPM A;  3LEI A;  2ZAC A;  2GME A;  2RS3 3;  5FBZ A;  2Z5W A;  3WHT A;  4P9J A;  2DVA A;  2R07 2;  4B29 A;  3VZM A;  1U5Y A;  3NMB A;  3PHM A;  4Y22 A;  3MI8 A;  1GYK A;  1UWW A;  4Y4R A;  2W08 A;  4DPN A;  2XJR A;  4A41 A;  1UPS A;  4LLF A;  3AMH A;  1LOD A;  2WQZ C;  3CEW A;  5FWE A;  3RDI A;  4QQ2 A;  1OF4 A;  5FZH A;  1OQ1 A;  3SCF A;  1FNY A;  3PU8 A;  3EJK A;  5HXM A;  2TBV A;  5B4X A;  4B1M A;  3HOB A;  4QGL A;  2QQP A;  1PK6 B;  1D2S A;  3I8T A;  2GDF A;  2QTW B;  2X29 A;  1JZ2 A;  1Y3T A;  2GMP A;  4GUL A;  4BQX A;  1VIW B;  1D0G A;  2UWA A;  4PDW B;  2GNT A;  4UOJ A;  3ZN5 A;  3ZIW A;  1GMM A;  4DIN B;  1W9T A;  4ZZ5 A;  4DNY A;  1AYN 1;  2Q8E A;  3T2T A;  4YRD A;  4KBZ A;  5GLW A;  2JDH A;  1G86 A;  3ASI A;  2YU1 A;  2FCT A;  4X6R B;  3O14 A;  2YC2 A;  3J26 N;  1H9P A;  5A70 A;  1ZBA 2;  3UES A;  4CDQ A;  3L2H A;  3VBF C;  1IPK A;  4MHR A;  2VC9 A;  1ZZ7 A;  3AJY A;  4JDN A;  5K0U C;  2HWC 2;  4NAO A;  3O1P A;  1GOH A;  4FO9 A;  1Q8S A;  2RVA A;  3ME2 A;  5BNP B;  3BOP A;  4WM8 C;  1JYC A;  4UT5 A;  5FY0 A;  2VTF A;  1CAW A;  3WNM A;  2FZ1 A;  1ZRC A;  3Q8C A;  3U0Z A;  5T5O A;  1PZ7 A;  2BRT A;  2ZGP A;  2PFW A;  3BPS A;  4IGO A;  3W20 A;  4EN8 B;  1BBT 2;  1O4Y A;  1S2K A;  3POS A;  4LO8 A;  2HWD 2;  3C8X A;  3TOJ A;  1HN1 A;  3FC0 A;  2FDH A;  3IWZ A;  4A7K A;  5FLI A;  1BVV A;  1DIW A;  3OUI A;  2OQ7 A;  2RMU 3;  4BQ3 A;  1JOJ A;  1MQT A;  1WW5 A;  2VZ1 A;  1W2T A;  3TEZ A;  1VBA 3;  3IZO A;  1BHG A;  1HQW A;  2C4X A;  1DZR A;  1WGP A;  4GXL A;  4W6X A;  5CKM A;  1ACC A;  2GC3 A;  2ZX3 A;  2O0O A;  3ZFE B;  5L19 A;  4XFC A;  3UGG A;  5JSR A;  3MLK A;  2JG9 C;  4R52 A;  3FBY A;  4QT6 A;  5J96 B;  2RDN A;  1US2 A;  4KWK A;  4P02 B;  3J8F 1;  4UFI A;  3TN9 1;  4ES8 A;  4P9G A;  3KT7 A;  3ZDV A;  3MDP A;  1YXW A;  3M3O A;  1ZZB A;  4MZU A;  1ZZ8 A;  1AUY A;  4IQP A;  5E8A A;  3UGF A;  2RJL A;  2R07 1;  5BPX A;  3ZYH A;  4NUB A;  2DFC A;  4QPW A;  2VOT A;  3FHI B;  1F5F A;  2VW0 A;  4LBJ A;  3WF1 A;  5BNO A;  2CSG A;  2JDY A;  4LKF A;  3I2K A;  2XJV A;  3NV4 A;  2XHN A;  1LOF A;  5T5P A;  3MW3 A;  2OVU A;  3F2Z A;  5LA0 A;  3RWN A;  3WHU A;  3W59 A;  4XF9 A;  2RS1 1;  4CCL A;  3D0J A;  1FPN 1;  3LZZ A;  1PNF A;  2P1B A;  3E6B A;  3LB9 A;  5KHH A;  3LF7 A;  1LR5 A;  1W03 A;  4RS5 B;  1MS5 A;  3RZZ A;  3TEX A;  5C4W C;  1J58 A;  5KBF A;  3UT0 A;  1XNK A;  4OVE A;  3FUQ A;  2D6O X;  2W5F A;  5AFE A;  4KMQ A;  4AFM A;  2FQP A;  1VE0 A;  1ENS A;  4R9B A;  2ZAH A;  4Y24 A;  1K3I A;  2A6Y A;  2XML A;  4WBB A;  5A3W A;  5JMO A;  1JHJ A;  1C4R A;  3ZSL A;  1WA6 X;  4J25 A;  3W58 A;  4D7S A;  1JZ4 A;  2W0X A;  5DZF A;  1RUF 1;  2XJQ A;  5CYY A;  1V6O A;  3ILF A;  4Q4V 2;  3P1I A;  1AR7 2;  5FKB A;  4P5Y A;  3UKT A;  4UFH A;  5FZO B;  3NNG A;  3ZFG C;  1X7N A;  1QNY A;  2VQT A;  5C3R A;  1MS9 A;  1OT5 A;  5M0T A;  1HQL A;  2RDS A;  2XVL A;  2OYZ A;  5A1A A;  5JZG C;  1PO2 2;  3BYW A;  3KCX A;  1CAV A;  1AVB A;  1B09 A;  3DV8 A;  3KV5 A;  5E88 A;  1QJY 3;  1TMF 1;  4MXW B;  4QQO A;  2WZ8 A;  3R4D B;  3ZFE C;  1OD3 A;  3IMN A;  4CP0 A;  4EN6 B;  2A75 A;  3VZK A;  1QJX 3;  2NP0 A;  2W95 A;  4HSL A;  1VBE 1;  5F3I A;  4MGQ A;  5FZB A;  2QKD A;  5IUQ A;  4E2S A;  4MGT A;  1JYX A;  2KD7 A;  2VMD A;  2UUR A;  1DQ2 A;  4XF0 A;  4ZXK A;  5LK5 A;  1G9D A;  2WNV C;  1OA2 A;  4UAP A;  1WME A;  2ZGQ A;  4IUG A;  3L9J T;  2R0F A;  5FYY A;  1OPO A;  1UN1 A;  2HWD 1;  2PAK A;  2PTM A;  2D98 A;  2WAB A;  3I3B A;  1VB2 A;  2VZR A;  5B4N A;  2YC0 A;  4RA0 A;  3WP4 A;  3ZXE A;  1ULO A;  2VCB A;  4DB5 A;  3AYA A;  3KV9 A;  2R04 3;  2J1R A;  2JDZ A;  2JB8 A;  4JKL A;  4QPY A;  4XTM A;  4F3J A;  3O5S A;  3TAY A;  2OPK A;  1CR7 A;  3KB5 A;  1W6O A;  3IM0 A;  1LES A;  5H9R A;  1QJY 2;  1YJL A;  5LB6 A;  2OZ6 A;  1R1A 3;  2MPF A;  1K45 A;  1O91 A;  1S0D A;  5FK7 A;  2Y6L A;  2NZ9 A;  3WQ1 A;  1UXX X;  1GOF A;  1RUO A;  4LT5 A;  2BOJ A;  3GZA A;  4PF5 A;  3TN9 3;  1RUE 3;  2MEV 3;  3POW A;  4KU8 A;  4LBQ D;  4RGG A;  4N53 B;  3RSJ A;  3E5U A;  1MQT B;  4QKD A;  1QJF A;  5FXX A;  4AQS A;  4G4F A;  5AVA A;  1RUJ 2;  3FFZ A;  2WL1 A;  3BPZ A;  1F31 A;  4GIQ A;  3R6S A;  5CNA A;  4ET7 A;  4YG6 A;  3POG A;  2Y6K A;  5LBE A;  3N4M A;  3AZV A;  3KV6 A;  5F5A A;  1FPN 2;  4BA6 A;  2XKP A;  2ZGK A;  1MQT C;  4H7L A;  4RFR B;  5F3E A;  1QJE A;  1RIR A;  2PEL A;  2WBK A;  4FTB A;  4LBO A;  1H8T B;  3HWJ A;  4AFD A;  3N3H A;  5GZC A;  3C7O A;  2N7G A;  2A1X A;  3D5O A;  4CE8 A;  4XJ8 A;  5J3U A;  2QDR A;  2VQA A;  5A7Q A;  4YM3 A;  3A4U A;  4MG2 A;  3BAL A;  3TEY A;  5BNO B;  5FYV A;  1W6Q A;  1XBF A;  2SBA A;  4K1Z A;  5FP8 A;  2CV6 A;  1GWL A;  5A6Y A;  4QAW A;  2P2K A;  2VY0 A;  2VZU A;  4FOQ A;  4N7U A;  3H8X A;  4C90 A;  5F9T A;  4CCK A;  3B3Q E;  1WKY A;  1WWY A;  1W9F A;  2ZZJ A;  4LO5 B;  4M01 A;  3JZV A;  1COV 2;  1GWM A;  2B46 X;  2JIJ A;  1GZW B;  2BNN A;  1PMH X;  3I2H A;  1AJO A;  2X53 S;  3A0N A;  1EAH 2;  4NVP A;  5KXC A;  4YW4 A;  1UIK A;  1W9Y A;  4AAP A;  1T6B X;  4FBF A;  2RM2 3;  3A7Q A;  3K3N A;  2YHJ A;  3LQC A;  3RPQ A;  4DXS A;  5HV4 A;  3VDC A;  4OI0 A;  3HJR A;  1SLL A;  2YGM A;  4DEV A;  1JOD A;  1MEC 3;  3LPF A;  2WDB A;  2AAC A;  3VZJ A;  1BBT 1;  2WWS A;  3BGA A;  4KNC A;  4I01 A;  1VAM A;  2B7Y A;  4KH9 A;  4M00 A;  1XU1 A;  2VNO A;  3QD6 A;  3RZG A;  3CJI A;  4MGS A;  2XJS A;  1Y7B A;  4B7K A;  4XC9 A;  3C7F A;  3A21 A;  1EUT A;  1VLN A;  1W28 A;  4ISQ A;  1NX9 A;  5C5T A;  1ND2 A;  5FO8 B;  3DYM A;  2VUJ A;  4HOO A;  3SLI A;  3OBR A;  2KR2 A;  1OVS A;  1NQD A;  2OX0 A;  3T2Q A;  4GA9 A;  2Y0O A;  2RJK A;  4Z92 B;  5A1F A;  4I30 A;  4AK3 A;  4RD7 A;  1PIV 2;  2J42 A;  5D8A B;  2HEV F;  2JB4 A;  1RHI 2;  2JDU A;  1S2B A;  3R05 A;  3CL1 A;  1UX6 A;  5F5C A;  2VW1 A;  3C7H A;  1QDC A;  1ZYB A;  1EPW A;  3FN9 A;  2YPD A;  3M8L A;  1UU4 A;  4HKO A;  5A3L A;  5FZ1 A;  2UWB A;  4GB3 1;  1HW5 A;  4I0A A;  3FWE A;  1URX A;  1Q8O A;  3O1S A;  2HBT A;  5LW9 A;  2LRO A;  4FSJ A;  1N1T A;  1YQC A;  1SCS A;  1H0B A;  2VNV A;  3I59 A;  3JB8 A;  2AEN A;  4Y20 B;  1W9W A;  3GJB A;  1NCQ B;  4IEY A;  2A6Z A;  1UX7 A;  4QPI B;  5C9A C;  4AEK A;  2XWB B;  4JQT A;  4R9A A;  2QVS B;  1HDK A;  4JGZ A;  1CIY A;  3III A;  3SMH A;  2EA7 A;  4LO6 B;  2VGD A;  3FHA A;  1QXP A;  1V70 A;  2GAL A;  4DRV A;  4Z2A A;  3BU0 A;  2K2S A;  1HRI 1;  4LA3 A;  4YZ3 A;  5F3G A;  3S7I A;  4PLO A;  2J1U A;  5LBC A;  4PIX A;  5EPA A;  1SQ4 A;  3LPG A;  4E9K A;  1YQ6 A;  3WT3 A;  2QZ3 A;  4MGY E;  2A3W A;  2YXS A;  4OHZ A;  4YGC A;  4COZ A;  4QD2 A;  1IOA A;  4YVS C;  2BBA A;  4N43 A;  4Q4V 1;  4AF9 A;  3NAP C;  2VZS A;  3AL5 A;  4IE5 A;  4DO0 A;  4CUG A;  4QDR A;  3VBU B;  2GND A;  3IDB B;  2JDA A;  4GWI A;  3WW4 A;  4LLO A;  2GSY A;  4Q4W 3;  5CEH A;  4XUT A;  5FLH A;  5H9P A;  5HI0 A;  3PUS A;  1FOD 1;  2C5D A;  5JOZ A;  1HXS 1;  2ZAA A;  4OQ9 A;  2E7A A;  5EJ3 A;  2YDE A;  1AYN 3;  5FZE A;  1L7Q A;  1XB9 A;  2B45 X;  4MLO A;  3VBS A;  3RZM A;  3ZO0 B;  4DOU A;  2D5F A;  3BN6 A;  1J84 A;  3MGU A;  4GB3 3;  4FT8 A;  4I09 A;  4JDM A;  4DFS A;  1S0I A;  5EP9 A;  5JI7 A;  3T30 A;  1G9F A;  2WS9 2;  4YM0 A;  5D8A A;  5F5Q A;  5FIX A;  3CLP A;  1PVX A;  2BNM A;  4XHX A;  1ZBE 2;  3NV3 A;  2LAL A;  5IVJ A;  5DDJ 3;  5T54 A;  2JDP A;  4K40 A;  1IPJ A;  4WM8 B;  3VN4 A;  4BXF A;  4BH9 A;  1SBF A;  1PO1 2;  5LAT A;  3KQ4 B;  4W65 A;  1RB8 G;  4ZHN A;  3EO6 A;  2LM3 A;  4KWJ A;  4I02 A;  3FX3 A;  4SLI A;  2Q0A A;  4YVW B;  2R7E B;  1H6X A;  5CAZ A;  2WAA A;  4QM8 A;  4OUL A;  1D4M 2;  1OKQ A;  2ZGR A;  1JYV A;  3AKT A;  3ZFF B;  3IDC B;  3KF3 A;  3OYW A;  1X50 A;  4FPE A;  1O8S A;  1H8T C;  5IW0 A;  3U14 A;  5D1I A;  1BMV 2;  2ARB A;  3THC A;  2NPI A;  1J1T A;  4AVV A;  1RUI 2;  1JU4 A;  4BQY A;  3NQH A;  4MGK E;  5CVR A;  4L0P A;  1KJL A;  4YW5 A;  3OGR A;  4WM7 C;  5KXD A;  3H0O A;  5K0U B;  4I3G A;  3OGV A;  2BGP A;  5FZG A;  5JZG B;  1IQD C;  4P9X A;  2BVV A;  4QX5 A;  1F5J A;  5H9Q A;  2ZXQ A;  3M3C A;  4PLN A;  4C1W A;  1IS3 A;  3UKV A;  4HK9 A;  3AB0 A;  1ND2 B;  5BNQ A;  2IXJ A;  3ILN A;  1RUG 2;  1GZT A;  2JDK A;  1OVP A;  2NYY A;  2ZMK A;  3MIF A;  1PGW 2;  1D4V B;  1IHM A;  1V0A A;  1KDM A;  4H2A A;  3K75 B;  3KV4 A;  3OPW A;  2JX9 A;  2VQU A;  4N9H A;  1GKB A;  3NNJ A;  3T1L A;  2HBU A;  1YIF A;  4AYU A;  3GJA A;  1KFU L;  4NPM A;  5EHD A;  5C3Q A;  4RR3 A;  1LGN A;  3N36 A;  3R0R A;  1VBD 1;  1R08 3;  1IS4 A;  1MS8 A;  1GWK A;  3VKO A;  5HCB A;  4ARY A;  3FLP A;  3K2O A;  2E7Q A;  3UKN A;  5JR7 B;  1Q8V A;  1O6U A;  2VVD A;  4GH4 C;  1HB4 A;  2BQP A;  1XSQ A;  3JUU A;  5EIY B;  2VMF A;  3N35 A;  2ZTN A;  5A6X A;  1NA1 A;  2QQO A;  1LOA A;  4QPG A;  4MSV A;  3OEA A;  3USS A;  2WFF 1;  2C26 A;  1FNZ A;  2P6H A;  2AYH A;  3KF5 A;  5DDJ 2;  1T2X A;  1SPP A;  3VDA A;  4CDX C;  4DQA A;  5F8P A;  1DGR A;  1GNZ A;  2Y26 A;  1W8W A;  2GNB A;  1F4H A;  4CCC A;  4FCA A;  4XCA A;  1PK6 A;  4KQ7 A;  4LA2 A;  4DZG A;  1C5I A;  3E5X A;  4RQP C;  3ZIX A;  5JUV A;  2MEV 1;  4AW7 A;  2XLG A;  4P08 A;  1SMV A;  4O7X A;  3CQO A;  4LK6 A;  5CB7 A;  4XF1 A;  4XDQ A;  1OI6 A;  3H50 A;  4MV2 A;  3S7E A;  1PZ8 A;  2E31 A;  3WNO A;  4UFK A;  3T3Y A;  4AI8 A;  2PHF A;  4LBN A;  2C6S A;  1NT0 A;  2JE9 A;  4A3Z A;  5FOB B;  4IV1 B;  5J36 A;  3O1R A;  2VZP A;  5I8T A;  1OA3 A;  1ZRI A;  3GBG A;  3NNM A;  2RS1 3;  3MYX A;  1CZV A;  1F4A A;  3ACL A;  3T0A A;  5BYN A;  1QNW A;  3A23 A;  2MHF A;  2D3S A;  2FMD A;  3H42 B;  3LOI A;  4AGG A;  2EIB A;  2DVB A;  3VDD B;  4IL7 A;  3EYP A;  3T2O A;  1DDL A;  4ARX A;  2OS2 A;  4GWN A;  4AEJ A;  1OFS A;  1QOT A;  5LEJ A;  1JYI A;  4Y3O A;  4XVH A;  4M3C B;  4RHV 3;  5ERL A;  4YGE A;  4D3W A;  1UD1 A;  1WCS A;  3P5B A;  4EN0 A;  5ISL A;  4YPJ A;  5IVV A;  1VMH A;  1C5H A;  1WD3 A;  2CDO A;  2WLP A;  3EQE A;  1D0H A;  1QJX 1;  1Q8P A;  4HVR A;  1NUK A;  2F4P A;  4MXV A;  4EN7 B;  1POV 0;  2VAU A;  2VQ0 A;  1S1A A;  2FBE A;  3NJY A;  3JU9 A;  2C1F A;  2VUA A;  5K0U A;  5LBB A;  1NA1 B;  4QPG B;  1TZO A;  1CAW B;  4CP2 A;  4RS5 C;  1V6K A;  4XZP A;  5FRE A;  5LRR A;  3O1T A;  1LCL A;  1XND A;  3VL8 A;  4CDQ C;  1CN1 A;  3SC7 X;  1H1A A;  1RHI 3;  1UOG A;  5FK8 A;  1K5J A;  4WZC A;  3FL7 A;  3O0X A;  4CDQ B;  4TZD A;  2FDI A;  2QQV A;  5J37 A;  1F35 A;  4CEY C;  2P6C A;  4CUC A;  2X10 A;  4AFC A;  2P37 A;  1PVC 2;  5FYC A;  1RUN A;  2OUJ A;  2EIC A;  4CXX A;  4BDV B;  1QGL A;  2CGO A;  2G19 A;  3MFA A;  4DUW A;  1JH5 A;  4JZR A;  3S0M A;  2ZS6 B;  4YG3 A;  1VRB A;  1UY4 A;  2WFF 2;  1FOD 2;  1GNH A;  1A3K A;  1W6N B;  1W8F A;  2RE9 A;  2VXR A;  2WZR 2;  4FOY A;  1UYZ A;  1XSR A;  3MFC A;  4L99 A;  5DG1 A;  3WCS A;  2OII A;  3S57 A;  1V6N A;  2PLV 1;  1BLZ A;  2WC2 A;  5DMY A;  3Q8B A;  1AHS A;  3GDB A;  3ZKU A;  2VOX A;  1CD3 G;  2ET1 A;  3WY6 A;  1LRH A;  2G9Z A;  2WT0 A;  3CNA A;  2D6N A;  3AFG A;  5FZ9 A;  1ZBE 1;  3GCX A;  2Y34 A;  5FY5 A;  2HLE A;  2D5H A;  5FY9 A;  1D7P M;  1DGW X;  3AKP A;  2GNM A;  4QX8 A;  4DIQ A;  3MIB A;  1PVC 3;  4XMI A;  5FPZ A;  3PVO A;  3VBF A;  4AI3 A;  5A3T A;  2WSU A;  4CXW A;  2B9U A;  5GLZ A;  1XYN A;  2BFU L;  1F15 A;  2IUW A;  4YW6 A;  5JIA A;  1W8Z A;  2ADE A;  2ZMN A;  3BIW E;  3ILR A;  3UNP A;  1RUD 2;  2FZ2 A;  1VRH 2;  2RV9 A;  4XBN A;  4BK4 A;  5E16 A;  3LIG A;  1ZNP A;  1ZRF A;  3OPT A;  5GLV A;  4E8C A;  1VBA 1;  2J1E A;  5IAT A;  2V5D A;  2OW4 A;  2NMO A;  4YLZ A;  3U4X A;  2K46 A;  4MVT A;  4SBV A;  2WSV A;  3MIG A;  4Q27 A;  5HCH A;  4F8A A;  2FDK A;  2ZJC A;  2R06 1;  4XJ9 A;  2OXB A;  4M0H A;  5IK4 A;  3QCW A;  1KEX A;  5DUV A;  1V9U 2;  4CCJ A;  1VBB 3;  4RSU A;  1YNA A;  4W6Y A;  1PMI A;  3NAP B;  3QH7 A;  1AR6 3;  3V0B B;  2XUM A;  4OI4 A;  2EVX A;  1KIT A;  1RUC 2;  3CBN A;  1RUG 3;  4OMC A;  4PDW C;  1TME 3;  2VXJ A;  2WIN B;  1LB2 A;  3ABZ A;  4H3W A;  1C8M 2;  1BK1 A;  4Q4Y 1;  3HPN A;  2ZAB A;  4FPG A;  1OUR A;  4CDX A;  5A33 A;  2DVG A;  3OUJ A;  1L3J A;  3BTZ A;  3QAC A;  5DAV A;  1NA1 C;  1YEW A;  1PGW 1;  2DU0 A;  2VBD A;  2IZW A;  4N53 C;  4QPG C;  5A32 A;  3MUZ 1;  2JDN A;  1VMJ A;  5DZG A;  3OOX A;  3H8O A;  4NRO A;  4D0Q A;  3DEC A;  1HB2 A;  3DN7 A;  4CA9 A;  4K8R B;  4AED A;  3OD0 A;  5FRA A;  1DQ4 A;  4PHZ A;  4I3P A;  2YUE A;  2ZX1 A;  1KRI A;  4NHX A;  3PTR B;  3LEM A;  1WCU A;  2QQL A;  3RZL A;  3JCI A;  1EV1 2;  3PJY A;  4D69 A;  1LNS A;  5IVB A;  5CFD C;  3AC0 A;  3WQB A;  3HVD A;  1QQP 1;  2HWF 1;  1Q43 A;  1US3 A;  4FOW A;  1UIJ A;  4CDW B;  4FQZ A;  1XYP A;  1XOY A;  1Z7S 1;  4XAA A;  4JV4 A;  4NE9 A;  4XYX A;  5EFU A;  3WLU A;  3WNX A;  4TN7 A;  4IE0 A;  3NVC A;  3I2J A;  2LTN A;  3G7D A;  4HZF A;  3R4S A;  3ITQ A;  5FMO L;  1NG0 A;  1X82 A;  1J3P A;  4BME A;  4LIT A;  2RS3 2;  4AE2 A;  4P9Y A;  5E1R A;  3PUH A;  3WDU A;  1GP5 A;  1NY7 1;  2L9L A;  1YRZ A;  3GZE A;  3ON7 A;  2ZEX A;  5BV6 A;  2WWJ A;  4XXA A;  2YBP A;  3I4I A;  5DUX A;  4BHP A;  3M4F A;  4XDP A;  1NLQ A;  4ATF A;  4GQ7 A;  1AXK A;  4LUM A;  4XIO A;  4W50 A;  2PHR A;  3ZYB A;  2BYV E;  4IE7 A;  5FO7 B;  5KWR A;  5L9B A;  2WR9 A;  4JKK A;  3PIJ A;  3ZXD A;  2UY8 A;  4L2N A;  3SH4 A;  3MF6 A;  4MH0 E;  3HEI A;  1S4C A;  1QDO A;  2ZCW A;  2I45 A;  1ULE A;  2BW8 A;  1SLI A;  2BWA A;  5A3M A;  4FFH A;  4LKD A;  5L36 A;  3VD3 A;  4U36 A;  1AR6 2;  5BNN A;  5A33 B;  4O65 A;  2GP3 A;  4QXK A;  4XET A;  4FI9 A;  5AVP A;  1NCR B;  5HXV A;  4C91 A;  1W8O A;  4Q29 A;  3AZW A;  1PZ9 A;  5J48 A;  1VJ2 A;  1S0J A;  3ZXF A;  3VBF B;  1ND3 A;  4LJH A;  4I0B A;  2HWC 1;  1MS0 A;  1NCQ C;  1A34 A;  3ACH A;  4N8M A;  1UZZ A;  3I3Q A;  1SFN A;  2XUE A;  3AXD A;  1UMI A;  2ZZQ A;  5C3O A;  4YVS A;  5FMD A;  1H2N A;  3SIT A;  2I74 A;  1PGS A;  1W8N A;  4IV3 C;  3RG0 A;  3WP5 A;  1PM7 A;  2JD9 A;  4QMA A;  3KT4 A;  2BP6 A;  1EY2 A;  1ULF A;  1RUC 1;  2ZOE B;  2R49 A;  2XVG A;  3LA2 A;  4Y20 A;  3SCH A;  1Y9Q A;  1GAN A;  5ACA 2;  3AP5 A;  1MZ6 A;  4KBB A;  2PHW A;  4IEV A;  3I97 A;  5FYU A;  3P3N A;  4Q4Y 3;  4CDU A;  3MBW A;  1RVF 3;  1ALY A;  2CGN A;  2R6Q A;  3MIE A;  5CFC C;  4LOS A;  1B35 C;  1I5P A;  2ZA9 A;  1JHN A;  5FYT A;  1N3P A;  4NIH A;  1JZ6 A;  4QX3 A;  3VKF C;  1OLQ A;  2B4K A;  4XF4 A;  3ZM8 A;  4HPK A;  2VBP A;  3CZU A;  4H55 A;  2Q5T A;  4Q26 A;  1LJ7 A;  2ZHM A;  3HD8 B;  2Q1F A;  3MLL A;  5C70 A;  3RS6 A;  3BI3 A;  1IGO A;  5J09 A;  2XJU A;  2D97 A;  1DZT A;  2EID A;  1ZZC A;  1JMU B;  1ASJ 3;  4MAD A;  3NW4 A;  3L2Y A;  1LAJ A;  4CDX B;  5FZC A;  3V65 A;  1GU3 A;  2HWF 2;  1NYW A;  2ZGT A;  4CCE A;  1W2A X;  1XNB A;  3M3E A;  4OFG A;  3WIN E;  4HN0 A;  2E33 A;  2DYC A;  1FPN 3;  1EP0 A;  1N3O A;  2TEP A;  1RUH 3;  3K51 A;  5DXD A;  5LAS A;  1WUV A;  5BNN B;  1Z0H A;  1RUE 1;  1JI6 A;  3OCP A;  1JW6 A;  1MS4 A;  2DUO A;  4HK8 A;  1A8D A;  5DAQ A;  3ZYF A;  3DL3 A;  2C0Z A;  2WA4 A;  4Q4W 2;  3KCC A;  1CJP A;  3MID A;  1IG0 A;  2WQ4 A;  5I0S A;  4XQ4 A;  1QEX A;  2I2S A;  4YVS B;  5CKN A;  2TUN A;  4GH4 A;  1XPW A;  1C57 A;  1TME 1;  2O8Q A;  2IXI A;  3ACF A;  4PBO A;  3H1M A;  3JBG 2;  1J1L A;  4AI9 A;  4Y1Y A;  4V2W A;  1NKG A;  3AYC A;  4XMA A;  1QOO A;  1YI9 A;  4BJ0 A;  3ZFF A;  1H2M A;  3IPV A;  4PCR A;  3A0K A;  4FPL A;  1WLC A;  1V6J A;  4NIG A;  4RHV 1;  2QCS B;  5FXV A;  3V0A B;  4CPB D;  1UPI A;  4N53 A;  2G9G A;  4JHT A;  3MHZ A;  4S2H A;  1XE7 A;  4URA A;  2W68 A;  4CP9 B;  2G4I A;  2HWE 3;  2RMU 2;  2AZ5 A;  1J3Q A;  3FUO A;  3NO8 A;  3RMY A;  4PT6 A;  3WSO A;  2ID4 A;  4WM7 A;  1CZS A;  5GZF A;  3MV0 1;  3TWI A;  1J59 A;  1Q56 A;  2Y0I A;  2DCK A;  2YG0 A;  2VO5 A;  1EPZ A;  1FT9 A;  1V9U 1;  3KGZ A;  4N43 B;  1GQP A;  3AYD A;  3VZO A;  3VD9 A;  1UY2 A;  5E89 A;  4TXW A;  3ZXG A;  2Q1M A;  1KD7 A;  4YW3 A;  1R08 1;  1OLM E;  4M0N A;  4IER A;  4KGG A;  5BUV A;  2W47 A;  2PAM A;  1RMU 2;  3IIA A;  3V64 A;  2V72 A;  1TNR A; 
#chains in the Genus database with same CATH homology
 1SZB A;  3POE A;  5CKQ A;  2WNO A;  4LOS A;  2QQL A;  5CIS A;  2QQO A;  1NT0 A;  3DEM A;  2QQM A;  4LOR A;  1NZI A;  3POJ A;  1SPP A;  4LMF A;  5CKM A;  4LOT A;  3POB A;  1SPP B;  5CKN A;  4GZ9 A;  3POG A;  3POI A;  3POF A;  3KQ4 B;  1SFP A;  2QQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...