3POKA

Interleukin-1-beta lbt l3 mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
166
structure length
159
Chain Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLGYIDTNDELYPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering encodable lanthanide-binding tags into loop regions of proteins.
pubmed doi rcsb
molecule keywords Interleukin-1 beta
molecule tags Cytokine
source organism Homo sapiens
total genus 32
structure length 159
sequence length 166
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pokA00
1TWMA 1RMLA 2D44A 4KBBA 3K1XA 3MALA 4OWLA 3O4BA 5BP5C 3AKFA 5F8SA 3AH2A 1S0EA 1XYFA 2D22A 7I1BA 2ESUA 3ZX7A 1JY0A 3O3QA 3I29B 3IAGC 4J2XA 5EHAA 4IZEA 2X2SA 4I1BA 2MLLB 5I1BA 1D0HA 1HCEA 2J3PA 4D8HA 3AKGA 3W9TA 2VSAA 2ERMA 4G1RA 1YF8B 4I1EA 3FJHA 1E0OA 3N7MA 2MC2A 2KI4A 3BAQA 4J2YA 3BAUA 3FJDA 3I2XA 1BFCA 4Q91A 2HW9A 1I1BA 1V6UA 3UD8A 3V0AA 3RTIB 1IHKA 2AAIB 4LO8B 1ONKB 5EC5A 2LIEA 3H6SE 2Q3NB 3ZC8A 3RMYA 4ISRA 4IYBA 3O5WB 3A21A 5FZUA 3V0AB 5BQUC 3WO2A 4P6AA 3FJCA 8I1BA 2KKIA 3CA4A 5JLVA 3C9ZA 4J2SA 1NUNA 1SZ6B 3BAGA 3OJ2A 1QQLA 1VCLA 3F62B 2D24A 4I4UA 5DVHA 1BFFA 5D61A 3BB2A 3FGMA 4ISQA 1BARA 1XHBA 1J0SA 3O4CA 2K43A 2GZBA 4IQPA 1S0FA 5D62A 4ZBVB 3JUTA 5BXRA 2NM1A 4FGFA 2ZR1B 4Q9PA 3LTQA 3BA5A 4AN7B 3CRIA 3I2AA 1IT0A 3NJ5A 3CAHA 1DQGA 3O4AA 4X39A 1KNMA 1IOBA 1FWVA 2D43A 2Y9FA 3HSMA 4YOLA 2NYYA 2Q9XA 2HZ9A 4QC4A 1TWEA 5F8WA 3F1RA 1T9FA 1SR4A 2F2FC 3RTJB 4I8MA 5FNXA 2UUSA 2Y9XE 2RG9B 1GGPB 2LIQA 1RY7A 1S0CA 4JAWA 5E24E 3UJ0A 3AH4A 2X2TA 3CA0A 1PUMB 3BX1C 3BA7A 1V6XA 1A8DA 4ZLBB 4IZXA 1Z0HA 2D7RA 3HMYA 1W3FA 3CRHA 3VSFA 4DENA 2RSTA 4X3AA 4I2SA 3O44A 3BA4A 4KEIA 1TP0A 1ITBA 4I96A 2Y9WC 1FMZA 4JKXB 1JLXA 3BRGC 1NZKA 3V0BB 3Q7XA 4LO2A 3IM5A 4ZFUB 1EYLA 2VU9A 3B9UA 1EPWA 4A7YA 4R6UB 1IILA 4GP3A 3VT1A 4LO0A 3BRDA 4XFSA 1JQZA 4I37A 4EFQA 1G9BA 2E4MA 5BVPI 4LO3C 2NTDA 1S0LA 3IIRA 2P39A 4I4PA 3UDAA 5F90A 2NVHA 1V6WA 3VSZA 2GO2A 3VEQA 1Z2VA 1FV2A 3HN1A 2WBCA 1V6VA 2L5XA 3UD7A 3OBRA 4XFTA 4ZFYB 2Z49A 41BIA 3AZVA 1JT3A 3HBWA 4I4OA 4QO3A 3OGGA 4JQ0A 1XZZA 1PC8B 2QYIB 3S8JA 2DRYA 3EF2A 3BTAA 1G82A 5DSSB 3IM6A 1YYNA 1G9DA 2NP0A 5DUYA 2DS0A 2HWAA 3KMVA 1JTCA 2ZQOA 1G9CA 1EVTA 1WD3A 4JKQA 4QALA 4J2KA 3H6RA 1QXMA 4GOVA 1YBIA 2NZ9A 4I4VA 1W3GA 5GAQA 3QR5A 3WINA 3H6RB 1IRAX 4I4RA 2DRZA 2VXRA 2HWMA 1DLLA 3O4OA 4EKXB 1G9AA 3CA1A 1ISXA 1HWPB 1FN0A 3OGFA 4I6IA 2FFUA 1PUUB 3ZC9A 1R8OA 4OEGA 1MC9A 2AFGA 3D7WB 4II0A 1BA7A 4KEJA 4USPA 4H04A 1FWUA 2QN4A 4LO1A 4EFRA 21BIA 3FJIA 5HPZA 5FNWA 3ZXGA 3NBDA 1AFCA 3A22A 4L4IA 1BFGA 1ABRB 3QYDA 1FQ9A 1F31A 1SR4C 4LO7C 2VXTI 2AQZA 1FV3A 1HWNB 1TFMB 2D23A 1ISVA 2F8XC 2FGFA 3ZXDA 1EV2A 2FFVA 4H9WA 4IHZA 1BFBA 3WA1A 3WMVA 3R4SA 1AVAC 4X38A 4G9NA 5BXSA 4OEEA 2FDBM 4LO7B 4IONA 3FJAA 4KC3A 3V79C 1CE7B 4QBVA 3T8SA 3RSJA 1DZDA 2M49A 4A7KA 3RMXA 2VLCA 4LO2C 5FZYA 2VUAA 2FO1A 1TTUA 1OQLB 1BASA 4IY9A 3OJVA 4LO0C 3FUOA 3SNVA 5JMCA 3WO3A 4EB2B 3WMUA 4TLPA 2D7IA 5FZZA 5B2HA 4HA2A 2K4AB 1Q03A 4ZOTA 3S8KA 4JPZA 3VWCA 6I1BA 4I4SA 4QKSA 3N7LA 4OWKA 4DEPA 3FJJA 4X37A 9ILBA 4GOYA 1PWAA 1HIBA 3PMEA 1ISZA 3HALA 4CJMA 3WO4A 4OWJA 3VUOA 3PHZA 4OW4A 1YTOA 3FUQA 4GP0A 1K5UA 1IRPA 1JT7A 3CQAA 3JRRA 3ILAA 5D63A 4I0YA 1S0BA 1HKNA 1Q1UA 1DZCA 3CA3A 2I1BA 1ISYA 1DJSB 2BEAA 2XOAA 3N7JA 3A07A 3FJEA 3NBCA 1Q04A 4DCKC 5BP5A 1I1EA 1AVXB 1HWOB 4LO3A 3LLPA 3AJ5A 3WINC 4G6JA 4G9MA 1FGAA 1QQKA 3CRGA 2VSEA 4P0LA 5BXTA 3BADA 4Z9WB 1CVSA 2D1ZA 5F8YA 4A7ZA 2RQ9A 3P6JA 1II4A 3FJBA 1AVUA 1S0DA 1ILR1 1DFQA 1XG6A 3HOMA 5EG6C 4QD2C 2KI6B 3N7KA 3FFZA 4ZGRB 1HWMB 1DIWA 3VT2A 1TIEA 5BXPA 4IY8A 1MD6A 4WBCA 4JRAA 2D20A 1YXWA 3BRFA 4LO1C 2DREA 4FVVA 2WRYA 4OUJA 3MPPG 2YUGA 4ZFWB 4G6MA 1TOOA 3H6QA 3P6IA 4KEKA 3BAVA 3AH1A 4P0KA 5G00A 4P0JA 3AJ6A 4QD2B 4Q9GA 3FJ9A 3IM7A 2ET2A 4L4HA 3NBEA 3AZWA 4JP0A 4XKIA 5BQUA 5BOWA 4QKRA 1WBCA 1RZOB 1HCDA 1DFCA 1M2TB 2P23A 1WBAA 4I4YA 1AF9A 2AXMA 3POKA 1K5VA 3VT0A 2K8RA 3Q7YA 5DZUA 1T4QA 3FJFA 1M16A 2IWTB 1BLAA 3CU1B 4ENDA 3O49A 2KH2A 4ZKTB 2BFHA 3A23A 3O4DA 3E8LC 4HR6C 3PUBA 1L2HA 1W3AA 3R4UA 3PG0A 4QBCA 2MIBA 1ISWA 3BAHA 4USOA 3N0KA 2ZQNA 1WD4A 1N4KA 4I7IA 1RG8A 1FMMS 1AVWB 3FJKA 1UPSA 1AXMA 2Y9GA 3CA6A 2KLLA 2F2FA 4ZA3B 1IJTA 3UJ4A 3Q7WA 3OBTA 2R9KB 1JT5A 4XFUA 2E4MC 1BLDA 3P53A 4D0ZA 4GAIA 3AKIA 31BIA 4Z8SB 4I4QA 3BAOA 4I3NA 1R8NA 3V0BA 3FJ8A 4AN6A 4F83A 4EFPA 4EEEB 3AKHA 4I4XA 1JLYA 3NBNA 3CA5A 2BEBA 3UD9A 4D0TA 4F34A 1S0GA 4PC4A 1DQOA 4J23B 3TC2A 1P63A 1PZZA 4GAFA 4HJJA 4OEFA 1JT4A 2IHOA 1Z4SA 3OJMA 2Z48A
chains in the Genus database with same CATH superfamily
1TWMA 1RMLA 2D44A 4KBBA 3K1XA 3MALA 4OWLA 3O4BA 5BP5C 3AKFA 5F8SA 3AH2A 1S0EA 1XYFA 2D22A 7I1BA 2ESUA 3ZX7A 1JY0A 3O3QA 3I29B 3IAGC 4J2XA 5EHAA 4IZEA 2X2SA 4I1BA 2MLLB 5I1BA 1D0HA 1HCEA 2J3PA 4UY4A 4D8HA 3AKGA 3W9TA 2VSAA 2ERMA 4G1RA 1YF8B 4I1EA 3FJHA 1E0OA 3N7MA 2MC2A 2KI4A 3BAQA 4J2YA 3BAUA 3FJDA 3I2XA 1BFCA 4Q91A 2HW9A 1I1BA 1V6UA 3UD8A 3V0AA 3RTIB 1IHKA 2AAIB 4LO8B 1ONKB 5EC5A 2LIEA 3H6SE 2Q3NB 3ZC8A 3RMYA 4ISRA 4IYBA 3O5WB 3A21A 5FZUA 3V0AB 5BQUC 3WO2A 4P6AA 3FJCA 8I1BA 2KKIA 3CA4A 5JLVA 3C9ZA 4J2SA 1NUNA 1SZ6B 3BAGA 3OJ2A 1QQLA 1VCLA 3F62B 2D24A 4I4UA 5DVHA 1BFFA 5D61A 3BB2A 3FGMA 4ISQA 1BARA 1XHBA 1J0SA 3O4CA 2K43A 2GZBA 4IQPA 1S0FA 5D62A 4ZBVB 3JUTA 5BXRA 2NM1A 4FGFA 2ZR1B 4Q9PA 3LTQA 3BA5A 4AN7B 3CRIA 3I2AA 1IT0A 3NJ5A 3CAHA 1DQGA 3O4AA 4X39A 1KNMA 1IOBA 1FWVA 2D43A 2Y9FA 3HSMA 4YOLA 2NYYA 2Q9XA 2HZ9A 4QC4A 1TWEA 5F8WA 3F1RA 1T9FA 1SR4A 2F2FC 3RTJB 4I8MA 5FNXA 2UUSA 2Y9XE 2RG9B 1GGPB 2LIQA 1RY7A 1S0CA 4JAWA 5E24E 3UJ0A 3AH4A 2X2TA 3CA0A 1PUMB 3BX1C 3BA7A 1V6XA 1A8DA 4ZLBB 4IZXA 1Z0HA 2D7RA 3HMYA 1W3FA 3CRHA 3VSFA 4DENA 2RSTA 4X3AA 4I2SA 3O44A 3BA4A 4KEIA 1TP0A 1ITBA 4I96A 2Y9WC 1FMZA 4JKXB 1JLXA 3BRGC 1NZKA 3V0BB 3Q7XA 4LO2A 3IM5A 4ZFUB 1EYLA 2VU9A 3B9UA 1EPWA 4A7YA 4R6UB 1IILA 4GP3A 3VT1A 4LO0A 3BRDA 4XFSA 1JQZA 4I37A 4EFQA 1G9BA 2E4MA 5BVPI 4LO3C 2NTDA 1S0LA 3IIRA 2P39A 4I4PA 3UDAA 5F90A 2NVHA 1V6WA 3VSZA 2GO2A 3VEQA 1Z2VA 1FV2A 3HN1A 2WBCA 1V6VA 2L5XA 3UD7A 3OBRA 4XFTA 4ZFYB 2Z49A 41BIA 3AZVA 1JT3A 3HBWA 4I4OA 4QO3A 3OGGA 4JQ0A 1XZZA 1PC8B 2QYIB 3S8JA 2DRYA 3EF2A 4MZGB 3BTAA 1G82A 5DSSB 3IM6A 1YYNA 1G9DA 2NP0A 5DUYA 2DS0A 2HWAA 3KMVA 1JTCA 2ZQOA 1G9CA 1EVTA 1WD3A 4JKQA 4QALA 4J2KA 3H6RA 1QXMA 4GOVA 1YBIA 2NZ9A 4I4VA 1W3GA 5GAQA 3QR5A 3WINA 3H6RB 1IRAX 4I4RA 2DRZA 2VXRA 2HWMA 1DLLA 3O4OA 4EKXB 1G9AA 3CA1A 1ISXA 1HWPB 1FN0A 3OGFA 4I6IA 2FFUA 1PUUB 3ZC9A 1R8OA 4OEGA 1MC9A 2AFGA 3D7WB 4II0A 1BA7A 4KEJA 4USPA 4H04A 1FWUA 2QN4A 4LO1A 4EFRA 21BIA 3FJIA 5HPZA 5FNWA 3ZXGA 3NBDA 1AFCA 3A22A 4L4IA 1BFGA 1ABRB 3QYDA 1FQ9A 1F31A 1SR4C 4LO7C 2VXTI 2AQZA 1FV3A 1HWNB 1TFMB 2D23A 1ISVA 2NS2A 2F8XC 2FGFA 3ZXDA 1EV2A 2FFVA 4H9WA 4IHZA 1BFBA 3WA1A 4MZHA 3WMVA 3R4SA 1AVAC 4X38A 4G9NA 5BXSA 4OEEA 2FDBM 4LO7B 4IONA 3FJAA 4KC3A 3V79C 1CE7B 4QBVA 3T8SA 3RSJA 1DZDA 2M49A 4A7KA 3RMXA 2VLCA 4LO2C 5FZYA 2VUAA 2FO1A 1TTUA 1OQLB 1BASA 4H75A 4IY9A 3OJVA 4LO0C 3FUOA 3SNVA 5JMCA 3WO3A 4EB2B 3WMUA 4TLPA 2D7IA 5FZZA 5B2HA 4HA2A 2K4AB 1Q03A 4ZOTA 3S8KA 4JPZA 3VWCA 6I1BA 4I4SA 4QKSA 3N7LA 4OWKA 4DEPA 3FJJA 4X37A 9ILBA 4GOYA 1PWAA 1HIBA 3PMEA 1ISZA 3HALA 4CJMA 3WO4A 4OWJA 3VUOA 3PHZA 4OW4A 1YTOA 3FUQA 4GP0A 1K5UA 1IRPA 1JT7A 3CQAA 3JRRA 3ILAA 5D63A 4I0YA 1S0BA 1HKNA 1Q1UA 1DZCA 3CA3A 2I1BA 1ISYA 1DJSB 2BEAA 2XOAA 3N7JA 3A07A 3FJEA 3NBCA 1Q04A 4DCKC 5BP5A 1I1EA 1AVXB 1HWOB 4LO3A 3LLPA 3AJ5A 3WINC 4G6JA 4G9MA 1FGAA 1QQKA 3CRGA 2VSEA 4P0LA 5BXTA 3BADA 4Z9WB 1CVSA 2D1ZA 5F8YA 4A7ZA 2RQ9A 3P6JA 1II4A 3FJBA 1AVUA 1S0DA 1ILR1 1DFQA 1XG6A 3HOMA 5EG6C 4QD2C 2KI6B 3N7KA 3FFZA 4ZGRB 1HWMB 1DIWA 3VT2A 1TIEA 5BXPA 4IY8A 1MD6A 4WBCA 4JRAA 2D20A 1YXWA 3BRFA 4LO1C 2DREA 4FVVA 2WRYA 4OUJA 3MPPG 2YUGA 4ZFWB 4G6MA 1TOOA 3H6QA 3P6IA 4KEKA 3BAVA 3AH1A 4P0KA 5G00A 4P0JA 3AJ6A 4QD2B 4Q9GA 3FJ9A 3IM7A 2ET2A 4L4HA 3NBEA 3AZWA 4MZFB 4JP0A 4XKIA 5BQUA 5BOWA 4QKRA 1WBCA 1RZOB 1HCDA 1DFCA 1M2TB 2P23A 1WBAA 4I4YA 1AF9A 2AXMA 3POKA 1K5VA 3VT0A 2K8RA 3Q7YA 5DZUA 1T4QA 3FJFA 1M16A 2IWTB 1BLAA 3CU1B 4ENDA 3O49A 2KH2A 4ZKTB 2BFHA 3A23A 3O4DA 3E8LC 4HR6C 3PUBA 1L2HA 1W3AA 3R4UA 3PG0A 4QBCA 2MIBA 1ISWA 3BAHA 4USOA 3N0KA 2ZQNA 1WD4A 1N4KA 4I7IA 1RG8A 1FMMS 1AVWB 3FJKA 1UPSA 1AXMA 2Y9GA 3CA6A 2KLLA 2F2FA 4ZA3B 1IJTA 3UJ4A 3Q7WA 3OBTA 2R9KB 1JT5A 4XFUA 2E4MC 1BLDA 3P53A 4D0ZA 4GAIA 3AKIA 31BIA 4Z8SB 4I4QA 3BAOA 4I3NA 1R8NA 3V0BA 3FJ8A 4AN6A 4F83A 4EFPA 4EEEB 3AKHA 4I4XA 1JLYA 3NBNA 3CA5A 2BEBA 3UD9A 4D0TA 4F34A 1S0GA 4PC4A 1DQOA 4J23B 3TC2A 1P63A 1PZZA 4GAFA 4HJJA 4OEFA 1JT4A 2IHOA 1Z4SA 3OJMA 2Z48A
chains in the Genus database with same CATH topology
1TWMA 1RMLA 2D44A 4KBBA 3K1XA 3MALA 4OWLA 3O4BA 5BP5C 3AKFA 5F8SA 3AH2A 1S0EA 1XYFA 2D22A 7I1BA 2ESUA 3ZX7A 1JY0A 3O3QA 3I29B 3IAGC 4J2XA 5EHAA 4IZEA 2X2SA 4I1BA 2MLLB 5I1BA 1D0HA 1HCEA 2J3PA 4UY4A 4D8HA 3AKGA 3W9TA 2VSAA 2ERMA 4G1RA 1YF8B 4I1EA 3FJHA 1E0OA 3N7MA 2MC2A 2KI4A 3BAQA 4J2YA 3BAUA 3FJDA 3I2XA 1BFCA 4Q91A 2HW9A 1I1BA 1V6UA 3UD8A 3V0AA 3RTIB 1IHKA 2AAIB 4LO8B 1ONKB 5EC5A 2LIEA 3H6SE 2Q3NB 3ZC8A 3RMYA 4ISRA 4IYBA 3O5WB 3A21A 5FZUA 3V0AB 5BQUC 3WO2A 4P6AA 3FJCA 8I1BA 2KKIA 3CA4A 5JLVA 3C9ZA 4J2SA 1NUNA 1SZ6B 3BAGA 3OJ2A 1QQLA 1VCLA 3F62B 2D24A 4I4UA 5DVHA 1BFFA 5D61A 3BB2A 3FGMA 4ISQA 1BARA 1XHBA 1J0SA 3O4CA 2K43A 2GZBA 4IQPA 1S0FA 5D62A 4ZBVB 3JUTA 5BXRA 2NM1A 4FGFA 2ZR1B 4Q9PA 3LTQA 3BA5A 4AN7B 3CRIA 3I2AA 1IT0A 3NJ5A 3CAHA 1DQGA 3O4AA 4X39A 1KNMA 1IOBA 1FWVA 2D43A 2Y9FA 3HSMA 4YOLA 2NYYA 2Q9XA 2HZ9A 4QC4A 1TWEA 5F8WA 3F1RA 1T9FA 1SR4A 2F2FC 3RTJB 4I8MA 5FNXA 2UUSA 2Y9XE 2RG9B 1GGPB 2LIQA 1RY7A 1S0CA 4JAWA 5E24E 3UJ0A 3AH4A 2X2TA 3CA0A 1PUMB 3BX1C 3BA7A 1V6XA 1A8DA 4ZLBB 4IZXA 1Z0HA 2D7RA 3HMYA 1W3FA 3CRHA 3VSFA 4DENA 2RSTA 4X3AA 4I2SA 3O44A 3BA4A 4KEIA 1TP0A 1ITBA 4I96A 2Y9WC 1FMZA 4JKXB 1JLXA 3BRGC 1NZKA 3V0BB 3Q7XA 4LO2A 3IM5A 4ZFUB 1EYLA 2VU9A 3B9UA 1EPWA 4A7YA 4R6UB 1IILA 4GP3A 3VT1A 4LO0A 3BRDA 4XFSA 1JQZA 4I37A 4EFQA 1G9BA 2E4MA 5BVPI 4LO3C 2NTDA 1S0LA 3IIRA 2P39A 4I4PA 3UDAA 5F90A 2NVHA 1V6WA 3VSZA 2GO2A 3VEQA 1Z2VA 1FV2A 3HN1A 2WBCA 1V6VA 2L5XA 3UD7A 3OBRA 4XFTA 4ZFYB 2Z49A 41BIA 3AZVA 1JT3A 3HBWA 4I4OA 4QO3A 3OGGA 4JQ0A 1XZZA 1PC8B 2QYIB 3S8JA 2DRYA 3EF2A 4MZGB 3BTAA 1G82A 5DSSB 3IM6A 1YYNA 1G9DA 2NP0A 5DUYA 2DS0A 2HWAA 3KMVA 1JTCA 2ZQOA 1G9CA 1EVTA 1WD3A 4JKQA 4QALA 4J2KA 3H6RA 1QXMA 4GOVA 1YBIA 2NZ9A 4I4VA 1W3GA 5GAQA 3QR5A 3WINA 3H6RB 1IRAX 4I4RA 2DRZA 2VXRA 2HWMA 1DLLA 3O4OA 4EKXB 1G9AA 3CA1A 1ISXA 1HWPB 1FN0A 3OGFA 4I6IA 2FFUA 1PUUB 3ZC9A 1R8OA 4OEGA 1MC9A 2AFGA 3D7WB 4II0A 1BA7A 4KEJA 4USPA 4H04A 1FWUA 2QN4A 4LO1A 4EFRA 21BIA 3FJIA 5HPZA 5FNWA 3ZXGA 3NBDA 1AFCA 3A22A 4L4IA 1BFGA 1ABRB 3QYDA 1FQ9A 1F31A 1SR4C 4LO7C 2VXTI 2AQZA 1FV3A 1HWNB 1TFMB 2D23A 1ISVA 2NS2A 2F8XC 2FGFA 3ZXDA 1EV2A 2FFVA 4H9WA 4IHZA 1BFBA 3WA1A 4MZHA 3WMVA 3R4SA 1AVAC 4X38A 4G9NA 5BXSA 4OEEA 2FDBM 4LO7B 4IONA 3FJAA 4KC3A 3V79C 1CE7B 4QBVA 3T8SA 3RSJA 1DZDA 2M49A 4A7KA 3RMXA 2VLCA 4LO2C 5FZYA 2VUAA 2FO1A 1TTUA 1OQLB 1BASA 4H75A 4IY9A 3OJVA 4LO0C 3FUOA 3SNVA 5JMCA 3WO3A 4EB2B 3WMUA 4TLPA 2D7IA 5FZZA 5B2HA 4HA2A 2K4AB 1Q03A 4ZOTA 3S8KA 4JPZA 3VWCA 6I1BA 4I4SA 4QKSA 3N7LA 4OWKA 4DEPA 3FJJA 4X37A 9ILBA 4GOYA 1PWAA 1HIBA 3PMEA 1ISZA 3HALA 4CJMA 3WO4A 4OWJA 3VUOA 3PHZA 4OW4A 1YTOA 3FUQA 4GP0A 1K5UA 1IRPA 1JT7A 3CQAA 3JRRA 3ILAA 5D63A 4I0YA 1S0BA 1HKNA 1Q1UA 1DZCA 3CA3A 2I1BA 1ISYA 1DJSB 2BEAA 2XOAA 3N7JA 3A07A 3FJEA 3NBCA 1Q04A 4DCKC 5BP5A 1I1EA 1AVXB 1HWOB 4LO3A 3LLPA 3AJ5A 3WINC 4G6JA 4G9MA 1FGAA 1QQKA 3CRGA 2VSEA 4P0LA 5BXTA 3BADA 4Z9WB 1CVSA 2D1ZA 5F8YA 4A7ZA 2RQ9A 3P6JA 1II4A 3FJBA 1AVUA 1S0DA 1ILR1 1DFQA 1XG6A 3HOMA 5EG6C 4QD2C 2KI6B 3N7KA 3FFZA 4ZGRB 1HWMB 1DIWA 3VT2A 1TIEA 5BXPA 4IY8A 1MD6A 4WBCA 4JRAA 2D20A 1YXWA 3BRFA 4LO1C 2DREA 4FVVA 2WRYA 4OUJA 3MPPG 2YUGA 4ZFWB 4G6MA 1TOOA 3H6QA 3P6IA 4KEKA 3BAVA 3AH1A 4P0KA 5G00A 4P0JA 3AJ6A 4QD2B 4Q9GA 3FJ9A 3IM7A 2ET2A 4L4HA 3NBEA 3AZWA 4MZFB 4JP0A 4XKIA 5BQUA 5BOWA 4QKRA 1WBCA 1RZOB 1HCDA 1DFCA 1M2TB 2P23A 1WBAA 4I4YA 1AF9A 2AXMA 3POKA 1K5VA 3VT0A 2K8RA 3Q7YA 5DZUA 1T4QA 3FJFA 1M16A 2IWTB 1BLAA 3CU1B 4ENDA 3O49A 2KH2A 4ZKTB 2BFHA 3A23A 3O4DA 3E8LC 4HR6C 3PUBA 1L2HA 1W3AA 3R4UA 3PG0A 4QBCA 2MIBA 1ISWA 3BAHA 4USOA 3N0KA 2ZQNA 1WD4A 1N4KA 4I7IA 1RG8A 1FMMS 1AVWB 3FJKA 1UPSA 1AXMA 2Y9GA 3CA6A 2KLLA 2F2FA 4ZA3B 1IJTA 3UJ4A 3Q7WA 3OBTA 2R9KB 1JT5A 4XFUA 2E4MC 1BLDA 3P53A 4D0ZA 4GAIA 3AKIA 31BIA 4Z8SB 4I4QA 3BAOA 4I3NA 1R8NA 3V0BA 3FJ8A 4AN6A 4F83A 4EFPA 4EEEB 3AKHA 4I4XA 1JLYA 3NBNA 3CA5A 2BEBA 3UD9A 4D0TA 4F34A 1S0GA 4PC4A 1DQOA 4J23B 3TC2A 1P63A 1PZZA 4GAFA 4HJJA 4OEFA 1JT4A 2IHOA 1Z4SA 3OJMA 2Z48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWM A;  1RML A;  2D44 A;  4KBB A;  3K1X A;  3MAL A;  4OWL A;  3O4B A;  5BP5 C;  3AKF A;  5F8S A;  3AH2 A;  1S0E A;  1XYF A;  2D22 A;  7I1B A;  2ESU A;  3ZX7 A;  1JY0 A;  3O3Q A;  3I29 B;  3IAG C;  4J2X A;  5EHA A;  4IZE A;  2X2S A;  4I1B A;  2MLL B;  5I1B A;  1D0H A;  1HCE A;  2J3P A;  4D8H A;  3AKG A;  3W9T A;  2VSA A;  2ERM A;  4G1R A;  1YF8 B;  4I1E A;  3FJH A;  1E0O A;  3N7M A;  2MC2 A;  2KI4 A;  3BAQ A;  4J2Y A;  3BAU A;  3FJD A;  3I2X A;  1BFC A;  4Q91 A;  2HW9 A;  1I1B A;  1V6U A;  3UD8 A;  3V0A A;  3RTI B;  1IHK A;  2AAI B;  4LO8 B;  1ONK B;  5EC5 A;  2LIE A;  3H6S E;  2Q3N B;  3ZC8 A;  3RMY A;  4ISR A;  4IYB A;  3O5W B;  3A21 A;  5FZU A;  3V0A B;  5BQU C;  3WO2 A;  4P6A A;  3FJC A;  8I1B A;  2KKI A;  3CA4 A;  5JLV A;  3C9Z A;  4J2S A;  1NUN A;  1SZ6 B;  3BAG A;  3OJ2 A;  1QQL A;  1VCL A;  3F62 B;  2D24 A;  4I4U A;  5DVH A;  1BFF A;  5D61 A;  3BB2 A;  3FGM A;  4ISQ A;  1BAR A;  1XHB A;  1J0S A;  3O4C A;  2K43 A;  2GZB A;  4IQP A;  1S0F A;  5D62 A;  4ZBV B;  3JUT A;  5BXR A;  2NM1 A;  4FGF A;  2ZR1 B;  4Q9P A;  3LTQ A;  3BA5 A;  4AN7 B;  3CRI A;  3I2A A;  1IT0 A;  3NJ5 A;  3CAH A;  1DQG A;  3O4A A;  4X39 A;  1KNM A;  1IOB A;  1FWV A;  2D43 A;  2Y9F A;  3HSM A;  4YOL A;  2NYY A;  2Q9X A;  2HZ9 A;  4QC4 A;  1TWE A;  5F8W A;  3F1R A;  1T9F A;  1SR4 A;  2F2F C;  3RTJ B;  4I8M A;  5FNX A;  2UUS A;  2Y9X E;  2RG9 B;  1GGP B;  2LIQ A;  1RY7 A;  1S0C A;  4JAW A;  5E24 E;  3UJ0 A;  3AH4 A;  2X2T A;  3CA0 A;  1PUM B;  3BX1 C;  3BA7 A;  1V6X A;  1A8D A;  4ZLB B;  4IZX A;  1Z0H A;  2D7R A;  3HMY A;  1W3F A;  3CRH A;  3VSF A;  4DEN A;  2RST A;  4X3A A;  4I2S A;  3O44 A;  3BA4 A;  4KEI A;  1TP0 A;  1ITB A;  4I96 A;  2Y9W C;  1FMZ A;  4JKX B;  1JLX A;  3BRG C;  1NZK A;  3V0B B;  3Q7X A;  4LO2 A;  3IM5 A;  4ZFU B;  1EYL A;  2VU9 A;  3B9U A;  1EPW A;  4A7Y A;  4R6U B;  1IIL A;  4GP3 A;  3VT1 A;  4LO0 A;  3BRD A;  4XFS A;  1JQZ A;  4I37 A;  4EFQ A;  1G9B A;  2E4M A;  5BVP I;  4LO3 C;  2NTD A;  1S0L A;  3IIR A;  2P39 A;  4I4P A;  3UDA A;  5F90 A;  2NVH A;  1V6W A;  3VSZ A;  2GO2 A;  3VEQ A;  1Z2V A;  1FV2 A;  3HN1 A;  2WBC A;  1V6V A;  2L5X A;  3UD7 A;  3OBR A;  4XFT A;  4ZFY B;  2Z49 A;  41BI A;  3AZV A;  1JT3 A;  3HBW A;  4I4O A;  4QO3 A;  3OGG A;  4JQ0 A;  1XZZ A;  1PC8 B;  2QYI B;  3S8J A;  2DRY A;  3EF2 A;  3BTA A;  1G82 A;  5DSS B;  3IM6 A;  1YYN A;  1G9D A;  2NP0 A;  5DUY A;  2DS0 A;  2HWA A;  3KMV A;  1JTC A;  2ZQO A;  1G9C A;  1EVT A;  1WD3 A;  4JKQ A;  4QAL A;  4J2K A;  3H6R A;  1QXM A;  4GOV A;  1YBI A;  2NZ9 A;  4I4V A;  1W3G A;  5GAQ A;  3QR5 A;  3WIN A;  3H6R B;  1IRA X;  4I4R A;  2DRZ A;  2VXR A;  2HWM A;  1DLL A;  3O4O A;  4EKX B;  1G9A A;  3CA1 A;  1ISX A;  1HWP B;  1FN0 A;  3OGF A;  4I6I A;  2FFU A;  1PUU B;  3ZC9 A;  1R8O A;  4OEG A;  1MC9 A;  2AFG A;  3D7W B;  4II0 A;  1BA7 A;  4KEJ A;  4USP A;  4H04 A;  1FWU A;  2QN4 A;  4LO1 A;  4EFR A;  21BI A;  3FJI A;  5HPZ A;  5FNW A;  3ZXG A;  3NBD A;  1AFC A;  3A22 A;  4L4I A;  1BFG A;  1ABR B;  3QYD A;  1FQ9 A;  1F31 A;  1SR4 C;  4LO7 C;  2VXT I;  2AQZ A;  1FV3 A;  1HWN B;  1TFM B;  2D23 A;  1ISV A;  2F8X C;  2FGF A;  3ZXD A;  1EV2 A;  2FFV A;  4H9W A;  4IHZ A;  1BFB A;  3WA1 A;  3WMV A;  3R4S A;  1AVA C;  4X38 A;  4G9N A;  5BXS A;  4OEE A;  2FDB M;  4LO7 B;  4ION A;  3FJA A;  4KC3 A;  3V79 C;  1CE7 B;  4QBV A;  3T8S A;  3RSJ A;  1DZD A;  2M49 A;  4A7K A;  3RMX A;  2VLC A;  4LO2 C;  5FZY A;  2VUA A;  2FO1 A;  1TTU A;  1OQL B;  1BAS A;  4IY9 A;  3OJV A;  4LO0 C;  3FUO A;  3SNV A;  5JMC A;  3WO3 A;  4EB2 B;  3WMU A;  4TLP A;  2D7I A;  5FZZ A;  5B2H A;  4HA2 A;  2K4A B;  1Q03 A;  4ZOT A;  3S8K A;  4JPZ A;  3VWC A;  6I1B A;  4I4S A;  4QKS A;  3N7L A;  4OWK A;  4DEP A;  3FJJ A;  4X37 A;  9ILB A;  4GOY A;  1PWA A;  1HIB A;  3PME A;  1ISZ A;  3HAL A;  4CJM A;  3WO4 A;  4OWJ A;  3VUO A;  3PHZ A;  4OW4 A;  1YTO A;  3FUQ A;  4GP0 A;  1K5U A;  1IRP A;  1JT7 A;  3CQA A;  3JRR A;  3ILA A;  5D63 A;  4I0Y A;  1S0B A;  1HKN A;  1Q1U A;  1DZC A;  3CA3 A;  2I1B A;  1ISY A;  1DJS B;  2BEA A;  2XOA A;  3N7J A;  3A07 A;  3FJE A;  3NBC A;  1Q04 A;  4DCK C;  5BP5 A;  1I1E A;  1AVX B;  1HWO B;  4LO3 A;  3LLP A;  3AJ5 A;  3WIN C;  4G6J A;  4G9M A;  1FGA A;  1QQK A;  3CRG A;  2VSE A;  4P0L A;  5BXT A;  3BAD A;  4Z9W B;  1CVS A;  2D1Z A;  5F8Y A;  4A7Z A;  2RQ9 A;  3P6J A;  1II4 A;  3FJB A;  1AVU A;  1S0D A;  1ILR 1;  1DFQ A;  1XG6 A;  3HOM A;  5EG6 C;  4QD2 C;  2KI6 B;  3N7K A;  3FFZ A;  4ZGR B;  1HWM B;  1DIW A;  3VT2 A;  1TIE A;  5BXP A;  4IY8 A;  1MD6 A;  4WBC A;  4JRA A;  2D20 A;  1YXW A;  3BRF A;  4LO1 C;  2DRE A;  4FVV A;  2WRY A;  4OUJ A;  3MPP G;  2YUG A;  4ZFW B;  4G6M A;  1TOO A;  3H6Q A;  3P6I A;  4KEK A;  3BAV A;  3AH1 A;  4P0K A;  5G00 A;  4P0J A;  3AJ6 A;  4QD2 B;  4Q9G A;  3FJ9 A;  3IM7 A;  2ET2 A;  4L4H A;  3NBE A;  3AZW A;  4JP0 A;  4XKI A;  5BQU A;  5BOW A;  4QKR A;  1WBC A;  1RZO B;  1HCD A;  1DFC A;  1M2T B;  2P23 A;  1WBA A;  4I4Y A;  1AF9 A;  2AXM A;  3POK A;  1K5V A;  3VT0 A;  2K8R A;  3Q7Y A;  5DZU A;  1T4Q A;  3FJF A;  1M16 A;  2IWT B;  1BLA A;  3CU1 B;  4END A;  3O49 A;  2KH2 A;  4ZKT B;  2BFH A;  3A23 A;  3O4D A;  3E8L C;  4HR6 C;  3PUB A;  1L2H A;  1W3A A;  3R4U A;  3PG0 A;  4QBC A;  2MIB A;  1ISW A;  3BAH A;  4USO A;  3N0K A;  2ZQN A;  1WD4 A;  1N4K A;  4I7I A;  1RG8 A;  1FMM S;  1AVW B;  3FJK A;  1UPS A;  1AXM A;  2Y9G A;  3CA6 A;  2KLL A;  2F2F A;  4ZA3 B;  1IJT A;  3UJ4 A;  3Q7W A;  3OBT A;  2R9K B;  1JT5 A;  4XFU A;  2E4M C;  1BLD A;  3P53 A;  4D0Z A;  4GAI A;  3AKI A;  31BI A;  4Z8S B;  4I4Q A;  3BAO A;  4I3N A;  1R8N A;  3V0B A;  3FJ8 A;  4AN6 A;  4F83 A;  4EFP A;  4EEE B;  3AKH A;  4I4X A;  1JLY A;  3NBN A;  3CA5 A;  2BEB A;  3UD9 A;  4D0T A;  4F34 A;  1S0G A;  4PC4 A;  1DQO A;  4J23 B;  3TC2 A;  1P63 A;  1PZZ A;  4GAF A;  4HJJ A;  4OEF A;  1JT4 A;  2IHO A;  1Z4S A;  3OJM A;  2Z48 A; 
#chains in the Genus database with same CATH topology
 1TWM A;  1RML A;  2D44 A;  4KBB A;  3K1X A;  3MAL A;  4OWL A;  3O4B A;  5BP5 C;  3AKF A;  5F8S A;  3AH2 A;  1S0E A;  1XYF A;  2D22 A;  7I1B A;  2ESU A;  3ZX7 A;  1JY0 A;  3O3Q A;  3I29 B;  3IAG C;  4J2X A;  5EHA A;  4IZE A;  2X2S A;  4I1B A;  2MLL B;  5I1B A;  1D0H A;  1HCE A;  2J3P A;  4UY4 A;  4D8H A;  3AKG A;  3W9T A;  2VSA A;  2ERM A;  4G1R A;  1YF8 B;  4I1E A;  3FJH A;  1E0O A;  3N7M A;  2MC2 A;  2KI4 A;  3BAQ A;  4J2Y A;  3BAU A;  3FJD A;  3I2X A;  1BFC A;  4Q91 A;  2HW9 A;  1I1B A;  1V6U A;  3UD8 A;  3V0A A;  3RTI B;  1IHK A;  2AAI B;  4LO8 B;  1ONK B;  5EC5 A;  2LIE A;  3H6S E;  2Q3N B;  3ZC8 A;  3RMY A;  4ISR A;  4IYB A;  3O5W B;  3A21 A;  5FZU A;  3V0A B;  5BQU C;  3WO2 A;  4P6A A;  3FJC A;  8I1B A;  2KKI A;  3CA4 A;  5JLV A;  3C9Z A;  4J2S A;  1NUN A;  1SZ6 B;  3BAG A;  3OJ2 A;  1QQL A;  1VCL A;  3F62 B;  2D24 A;  4I4U A;  5DVH A;  1BFF A;  5D61 A;  3BB2 A;  3FGM A;  4ISQ A;  1BAR A;  1XHB A;  1J0S A;  3O4C A;  2K43 A;  2GZB A;  4IQP A;  1S0F A;  5D62 A;  4ZBV B;  3JUT A;  5BXR A;  2NM1 A;  4FGF A;  2ZR1 B;  4Q9P A;  3LTQ A;  3BA5 A;  4AN7 B;  3CRI A;  3I2A A;  1IT0 A;  3NJ5 A;  3CAH A;  1DQG A;  3O4A A;  4X39 A;  1KNM A;  1IOB A;  1FWV A;  2D43 A;  2Y9F A;  3HSM A;  4YOL A;  2NYY A;  2Q9X A;  2HZ9 A;  4QC4 A;  1TWE A;  5F8W A;  3F1R A;  1T9F A;  1SR4 A;  2F2F C;  3RTJ B;  4I8M A;  5FNX A;  2UUS A;  2Y9X E;  2RG9 B;  1GGP B;  2LIQ A;  1RY7 A;  1S0C A;  4JAW A;  5E24 E;  3UJ0 A;  3AH4 A;  2X2T A;  3CA0 A;  1PUM B;  3BX1 C;  3BA7 A;  1V6X A;  1A8D A;  4ZLB B;  4IZX A;  1Z0H A;  2D7R A;  3HMY A;  1W3F A;  3CRH A;  3VSF A;  4DEN A;  2RST A;  4X3A A;  4I2S A;  3O44 A;  3BA4 A;  4KEI A;  1TP0 A;  1ITB A;  4I96 A;  2Y9W C;  1FMZ A;  4JKX B;  1JLX A;  3BRG C;  1NZK A;  3V0B B;  3Q7X A;  4LO2 A;  3IM5 A;  4ZFU B;  1EYL A;  2VU9 A;  3B9U A;  1EPW A;  4A7Y A;  4R6U B;  1IIL A;  4GP3 A;  3VT1 A;  4LO0 A;  3BRD A;  4XFS A;  1JQZ A;  4I37 A;  4EFQ A;  1G9B A;  2E4M A;  5BVP I;  4LO3 C;  2NTD A;  1S0L A;  3IIR A;  2P39 A;  4I4P A;  3UDA A;  5F90 A;  2NVH A;  1V6W A;  3VSZ A;  2GO2 A;  3VEQ A;  1Z2V A;  1FV2 A;  3HN1 A;  2WBC A;  1V6V A;  2L5X A;  3UD7 A;  3OBR A;  4XFT A;  4ZFY B;  2Z49 A;  41BI A;  3AZV A;  1JT3 A;  3HBW A;  4I4O A;  4QO3 A;  3OGG A;  4JQ0 A;  1XZZ A;  1PC8 B;  2QYI B;  3S8J A;  2DRY A;  3EF2 A;  4MZG B;  3BTA A;  1G82 A;  5DSS B;  3IM6 A;  1YYN A;  1G9D A;  2NP0 A;  5DUY A;  2DS0 A;  2HWA A;  3KMV A;  1JTC A;  2ZQO A;  1G9C A;  1EVT A;  1WD3 A;  4JKQ A;  4QAL A;  4J2K A;  3H6R A;  1QXM A;  4GOV A;  1YBI A;  2NZ9 A;  4I4V A;  1W3G A;  5GAQ A;  3QR5 A;  3WIN A;  3H6R B;  1IRA X;  4I4R A;  2DRZ A;  2VXR A;  2HWM A;  1DLL A;  3O4O A;  4EKX B;  1G9A A;  3CA1 A;  1ISX A;  1HWP B;  1FN0 A;  3OGF A;  4I6I A;  2FFU A;  1PUU B;  3ZC9 A;  1R8O A;  4OEG A;  1MC9 A;  2AFG A;  3D7W B;  4II0 A;  1BA7 A;  4KEJ A;  4USP A;  4H04 A;  1FWU A;  2QN4 A;  4LO1 A;  4EFR A;  21BI A;  3FJI A;  5HPZ A;  5FNW A;  3ZXG A;  3NBD A;  1AFC A;  3A22 A;  4L4I A;  1BFG A;  1ABR B;  3QYD A;  1FQ9 A;  1F31 A;  1SR4 C;  4LO7 C;  2VXT I;  2AQZ A;  1FV3 A;  1HWN B;  1TFM B;  2D23 A;  1ISV A;  2NS2 A;  2F8X C;  2FGF A;  3ZXD A;  1EV2 A;  2FFV A;  4H9W A;  4IHZ A;  1BFB A;  3WA1 A;  4MZH A;  3WMV A;  3R4S A;  1AVA C;  4X38 A;  4G9N A;  5BXS A;  4OEE A;  2FDB M;  4LO7 B;  4ION A;  3FJA A;  4KC3 A;  3V79 C;  1CE7 B;  4QBV A;  3T8S A;  3RSJ A;  1DZD A;  2M49 A;  4A7K A;  3RMX A;  2VLC A;  4LO2 C;  5FZY A;  2VUA A;  2FO1 A;  1TTU A;  1OQL B;  1BAS A;  4H75 A;  4IY9 A;  3OJV A;  4LO0 C;  3FUO A;  3SNV A;  5JMC A;  3WO3 A;  4EB2 B;  3WMU A;  4TLP A;  2D7I A;  5FZZ A;  5B2H A;  4HA2 A;  2K4A B;  1Q03 A;  4ZOT A;  3S8K A;  4JPZ A;  3VWC A;  6I1B A;  4I4S A;  4QKS A;  3N7L A;  4OWK A;  4DEP A;  3FJJ A;  4X37 A;  9ILB A;  4GOY A;  1PWA A;  1HIB A;  3PME A;  1ISZ A;  3HAL A;  4CJM A;  3WO4 A;  4OWJ A;  3VUO A;  3PHZ A;  4OW4 A;  1YTO A;  3FUQ A;  4GP0 A;  1K5U A;  1IRP A;  1JT7 A;  3CQA A;  3JRR A;  3ILA A;  5D63 A;  4I0Y A;  1S0B A;  1HKN A;  1Q1U A;  1DZC A;  3CA3 A;  2I1B A;  1ISY A;  1DJS B;  2BEA A;  2XOA A;  3N7J A;  3A07 A;  3FJE A;  3NBC A;  1Q04 A;  4DCK C;  5BP5 A;  1I1E A;  1AVX B;  1HWO B;  4LO3 A;  3LLP A;  3AJ5 A;  3WIN C;  4G6J A;  4G9M A;  1FGA A;  1QQK A;  3CRG A;  2VSE A;  4P0L A;  5BXT A;  3BAD A;  4Z9W B;  1CVS A;  2D1Z A;  5F8Y A;  4A7Z A;  2RQ9 A;  3P6J A;  1II4 A;  3FJB A;  1AVU A;  1S0D A;  1ILR 1;  1DFQ A;  1XG6 A;  3HOM A;  5EG6 C;  4QD2 C;  2KI6 B;  3N7K A;  3FFZ A;  4ZGR B;  1HWM B;  1DIW A;  3VT2 A;  1TIE A;  5BXP A;  4IY8 A;  1MD6 A;  4WBC A;  4JRA A;  2D20 A;  1YXW A;  3BRF A;  4LO1 C;  2DRE A;  4FVV A;  2WRY A;  4OUJ A;  3MPP G;  2YUG A;  4ZFW B;  4G6M A;  1TOO A;  3H6Q A;  3P6I A;  4KEK A;  3BAV A;  3AH1 A;  4P0K A;  5G00 A;  4P0J A;  3AJ6 A;  4QD2 B;  4Q9G A;  3FJ9 A;  3IM7 A;  2ET2 A;  4L4H A;  3NBE A;  3AZW A;  4MZF B;  4JP0 A;  4XKI A;  5BQU A;  5BOW A;  4QKR A;  1WBC A;  1RZO B;  1HCD A;  1DFC A;  1M2T B;  2P23 A;  1WBA A;  4I4Y A;  1AF9 A;  2AXM A;  3POK A;  1K5V A;  3VT0 A;  2K8R A;  3Q7Y A;  5DZU A;  1T4Q A;  3FJF A;  1M16 A;  2IWT B;  1BLA A;  3CU1 B;  4END A;  3O49 A;  2KH2 A;  4ZKT B;  2BFH A;  3A23 A;  3O4D A;  3E8L C;  4HR6 C;  3PUB A;  1L2H A;  1W3A A;  3R4U A;  3PG0 A;  4QBC A;  2MIB A;  1ISW A;  3BAH A;  4USO A;  3N0K A;  2ZQN A;  1WD4 A;  1N4K A;  4I7I A;  1RG8 A;  1FMM S;  1AVW B;  3FJK A;  1UPS A;  1AXM A;  2Y9G A;  3CA6 A;  2KLL A;  2F2F A;  4ZA3 B;  1IJT A;  3UJ4 A;  3Q7W A;  3OBT A;  2R9K B;  1JT5 A;  4XFU A;  2E4M C;  1BLD A;  3P53 A;  4D0Z A;  4GAI A;  3AKI A;  31BI A;  4Z8S B;  4I4Q A;  3BAO A;  4I3N A;  1R8N A;  3V0B A;  3FJ8 A;  4AN6 A;  4F83 A;  4EFP A;  4EEE B;  3AKH A;  4I4X A;  1JLY A;  3NBN A;  3CA5 A;  2BEB A;  3UD9 A;  4D0T A;  4F34 A;  1S0G A;  4PC4 A;  1DQO A;  4J23 B;  3TC2 A;  1P63 A;  1PZZ A;  4GAF A;  4HJJ A;  4OEF A;  1JT4 A;  2IHO A;  1Z4S A;  3OJM A;  2Z48 A; 
#chains in the Genus database with same CATH homology
 1TWM A;  1RML A;  2D44 A;  4KBB A;  3K1X A;  3MAL A;  4OWL A;  3O4B A;  5BP5 C;  3AKF A;  5F8S A;  3AH2 A;  1S0E A;  1XYF A;  2D22 A;  7I1B A;  2ESU A;  3ZX7 A;  1JY0 A;  3O3Q A;  3I29 B;  3IAG C;  4J2X A;  5EHA A;  4IZE A;  2X2S A;  4I1B A;  2MLL B;  5I1B A;  1D0H A;  1HCE A;  2J3P A;  4UY4 A;  4D8H A;  3AKG A;  3W9T A;  2VSA A;  2ERM A;  4G1R A;  1YF8 B;  4I1E A;  3FJH A;  1E0O A;  3N7M A;  2MC2 A;  2KI4 A;  3BAQ A;  4J2Y A;  3BAU A;  3FJD A;  3I2X A;  1BFC A;  4Q91 A;  2HW9 A;  1I1B A;  1V6U A;  3UD8 A;  3V0A A;  3RTI B;  1IHK A;  2AAI B;  4LO8 B;  1ONK B;  5EC5 A;  2LIE A;  3H6S E;  2Q3N B;  3ZC8 A;  3RMY A;  4ISR A;  4IYB A;  3O5W B;  3A21 A;  5FZU A;  3V0A B;  5BQU C;  3WO2 A;  4P6A A;  3FJC A;  8I1B A;  2KKI A;  3CA4 A;  5JLV A;  3C9Z A;  4J2S A;  1NUN A;  1SZ6 B;  3BAG A;  3OJ2 A;  1QQL A;  1VCL A;  3F62 B;  2D24 A;  4I4U A;  5DVH A;  1BFF A;  5D61 A;  3BB2 A;  3FGM A;  4ISQ A;  1BAR A;  1XHB A;  1J0S A;  3O4C A;  2K43 A;  2GZB A;  4IQP A;  1S0F A;  5D62 A;  4ZBV B;  3JUT A;  5BXR A;  2NM1 A;  4FGF A;  2ZR1 B;  4Q9P A;  3LTQ A;  3BA5 A;  4AN7 B;  3CRI A;  3I2A A;  1IT0 A;  3NJ5 A;  3CAH A;  1DQG A;  3O4A A;  4X39 A;  1KNM A;  1IOB A;  1FWV A;  2D43 A;  2Y9F A;  3HSM A;  4YOL A;  2NYY A;  2Q9X A;  2HZ9 A;  4QC4 A;  1TWE A;  5F8W A;  3F1R A;  1T9F A;  1SR4 A;  2F2F C;  3RTJ B;  4I8M A;  5FNX A;  2UUS A;  2Y9X E;  2RG9 B;  1GGP B;  2LIQ A;  1RY7 A;  1S0C A;  4JAW A;  5E24 E;  3UJ0 A;  3AH4 A;  2X2T A;  3CA0 A;  1PUM B;  3BX1 C;  3BA7 A;  1V6X A;  1A8D A;  4ZLB B;  4IZX A;  1Z0H A;  2D7R A;  3HMY A;  1W3F A;  3CRH A;  3VSF A;  4DEN A;  2RST A;  4X3A A;  4I2S A;  3O44 A;  3BA4 A;  4KEI A;  1TP0 A;  1ITB A;  4I96 A;  2Y9W C;  1FMZ A;  4JKX B;  1JLX A;  3BRG C;  1NZK A;  3V0B B;  3Q7X A;  4LO2 A;  3IM5 A;  4ZFU B;  1EYL A;  2VU9 A;  3B9U A;  1EPW A;  4A7Y A;  4R6U B;  1IIL A;  4GP3 A;  3VT1 A;  4LO0 A;  3BRD A;  4XFS A;  1JQZ A;  4I37 A;  4EFQ A;  1G9B A;  2E4M A;  5BVP I;  4LO3 C;  2NTD A;  1S0L A;  3IIR A;  2P39 A;  4I4P A;  3UDA A;  5F90 A;  2NVH A;  1V6W A;  3VSZ A;  2GO2 A;  3VEQ A;  1Z2V A;  1FV2 A;  3HN1 A;  2WBC A;  1V6V A;  2L5X A;  3UD7 A;  3OBR A;  4XFT A;  4ZFY B;  2Z49 A;  41BI A;  3AZV A;  1JT3 A;  3HBW A;  4I4O A;  4QO3 A;  3OGG A;  4JQ0 A;  1XZZ A;  1PC8 B;  2QYI B;  3S8J A;  2DRY A;  3EF2 A;  4MZG B;  3BTA A;  1G82 A;  5DSS B;  3IM6 A;  1YYN A;  1G9D A;  2NP0 A;  5DUY A;  2DS0 A;  2HWA A;  3KMV A;  1JTC A;  2ZQO A;  1G9C A;  1EVT A;  1WD3 A;  4JKQ A;  4QAL A;  4J2K A;  3H6R A;  1QXM A;  4GOV A;  1YBI A;  2NZ9 A;  4I4V A;  1W3G A;  5GAQ A;  3QR5 A;  3WIN A;  3H6R B;  1IRA X;  4I4R A;  2DRZ A;  2VXR A;  2HWM A;  1DLL A;  3O4O A;  4EKX B;  1G9A A;  3CA1 A;  1ISX A;  1HWP B;  1FN0 A;  3OGF A;  4I6I A;  2FFU A;  1PUU B;  3ZC9 A;  1R8O A;  4OEG A;  1MC9 A;  2AFG A;  3D7W B;  4II0 A;  1BA7 A;  4KEJ A;  4USP A;  4H04 A;  1FWU A;  2QN4 A;  4LO1 A;  4EFR A;  21BI A;  3FJI A;  5HPZ A;  5FNW A;  3ZXG A;  3NBD A;  1AFC A;  3A22 A;  4L4I A;  1BFG A;  1ABR B;  3QYD A;  1FQ9 A;  1F31 A;  1SR4 C;  4LO7 C;  2VXT I;  2AQZ A;  1FV3 A;  1HWN B;  1TFM B;  2D23 A;  1ISV A;  2NS2 A;  2F8X C;  2FGF A;  3ZXD A;  1EV2 A;  2FFV A;  4H9W A;  4IHZ A;  1BFB A;  3WA1 A;  4MZH A;  3WMV A;  3R4S A;  1AVA C;  4X38 A;  4G9N A;  5BXS A;  4OEE A;  2FDB M;  4LO7 B;  4ION A;  3FJA A;  4KC3 A;  3V79 C;  1CE7 B;  4QBV A;  3T8S A;  3RSJ A;  1DZD A;  2M49 A;  4A7K A;  3RMX A;  2VLC A;  4LO2 C;  5FZY A;  2VUA A;  2FO1 A;  1TTU A;  1OQL B;  1BAS A;  4H75 A;  4IY9 A;  3OJV A;  4LO0 C;  3FUO A;  3SNV A;  5JMC A;  3WO3 A;  4EB2 B;  3WMU A;  4TLP A;  2D7I A;  5FZZ A;  5B2H A;  4HA2 A;  2K4A B;  1Q03 A;  4ZOT A;  3S8K A;  4JPZ A;  3VWC A;  6I1B A;  4I4S A;  4QKS A;  3N7L A;  4OWK A;  4DEP A;  3FJJ A;  4X37 A;  9ILB A;  4GOY A;  1PWA A;  1HIB A;  3PME A;  1ISZ A;  3HAL A;  4CJM A;  3WO4 A;  4OWJ A;  3VUO A;  3PHZ A;  4OW4 A;  1YTO A;  3FUQ A;  4GP0 A;  1K5U A;  1IRP A;  1JT7 A;  3CQA A;  3JRR A;  3ILA A;  5D63 A;  4I0Y A;  1S0B A;  1HKN A;  1Q1U A;  1DZC A;  3CA3 A;  2I1B A;  1ISY A;  1DJS B;  2BEA A;  2XOA A;  3N7J A;  3A07 A;  3FJE A;  3NBC A;  1Q04 A;  4DCK C;  5BP5 A;  1I1E A;  1AVX B;  1HWO B;  4LO3 A;  3LLP A;  3AJ5 A;  3WIN C;  4G6J A;  4G9M A;  1FGA A;  1QQK A;  3CRG A;  2VSE A;  4P0L A;  5BXT A;  3BAD A;  4Z9W B;  1CVS A;  2D1Z A;  5F8Y A;  4A7Z A;  2RQ9 A;  3P6J A;  1II4 A;  3FJB A;  1AVU A;  1S0D A;  1ILR 1;  1DFQ A;  1XG6 A;  3HOM A;  5EG6 C;  4QD2 C;  2KI6 B;  3N7K A;  3FFZ A;  4ZGR B;  1HWM B;  1DIW A;  3VT2 A;  1TIE A;  5BXP A;  4IY8 A;  1MD6 A;  4WBC A;  4JRA A;  2D20 A;  1YXW A;  3BRF A;  4LO1 C;  2DRE A;  4FVV A;  2WRY A;  4OUJ A;  3MPP G;  2YUG A;  4ZFW B;  4G6M A;  1TOO A;  3H6Q A;  3P6I A;  4KEK A;  3BAV A;  3AH1 A;  4P0K A;  5G00 A;  4P0J A;  3AJ6 A;  4QD2 B;  4Q9G A;  3FJ9 A;  3IM7 A;  2ET2 A;  4L4H A;  3NBE A;  3AZW A;  4MZF B;  4JP0 A;  4XKI A;  5BQU A;  5BOW A;  4QKR A;  1WBC A;  1RZO B;  1HCD A;  1DFC A;  1M2T B;  2P23 A;  1WBA A;  4I4Y A;  1AF9 A;  2AXM A;  3POK A;  1K5V A;  3VT0 A;  2K8R A;  3Q7Y A;  5DZU A;  1T4Q A;  3FJF A;  1M16 A;  2IWT B;  1BLA A;  3CU1 B;  4END A;  3O49 A;  2KH2 A;  4ZKT B;  2BFH A;  3A23 A;  3O4D A;  3E8L C;  4HR6 C;  3PUB A;  1L2H A;  1W3A A;  3R4U A;  3PG0 A;  4QBC A;  2MIB A;  1ISW A;  3BAH A;  4USO A;  3N0K A;  2ZQN A;  1WD4 A;  1N4K A;  4I7I A;  1RG8 A;  1FMM S;  1AVW B;  3FJK A;  1UPS A;  1AXM A;  2Y9G A;  3CA6 A;  2KLL A;  2F2F A;  4ZA3 B;  1IJT A;  3UJ4 A;  3Q7W A;  3OBT A;  2R9K B;  1JT5 A;  4XFU A;  2E4M C;  1BLD A;  3P53 A;  4D0Z A;  4GAI A;  3AKI A;  31BI A;  4Z8S B;  4I4Q A;  3BAO A;  4I3N A;  1R8N A;  3V0B A;  3FJ8 A;  4AN6 A;  4F83 A;  4EFP A;  4EEE B;  3AKH A;  4I4X A;  1JLY A;  3NBN A;  3CA5 A;  2BEB A;  3UD9 A;  4D0T A;  4F34 A;  1S0G A;  4PC4 A;  1DQO A;  4J23 B;  3TC2 A;  1P63 A;  1PZZ A;  4GAF A;  4HJJ A;  4OEF A;  1JT4 A;  2IHO A;  1Z4S A;  3OJM A;  2Z48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...