3POMA

Crystal structure of the unliganded retinoblastoma protein pocket domain
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
345
structure length
342
Chain Sequence
b'QQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKLVPKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinoblastoma-associated protein
publication title Crystal structure of the unliganded retinoblastoma protein pocket domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 132
structure length 342
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3pomA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3pomA01
3G33B 5I5ZB 4CFNB 1VINA 3DDQB 3MIAB 3H4CA 4G6LB 4KRDB 4EOQB 1UNHD 2JGZB 4TTHA 5IDPB 3BHTB 2IW8B 4BCMB 4EC8B 5CYIB 4BCQD 2I53A 2C4GB 1G3NC 2W96A 5HVYB 4EOMB 3QHWB 2IVXA 2W9ZA 1GY3B 4BCMD 2WMBB 4F7LB 4BCGB 4EOLB 1JSTB 3LQ5B 1OKVB 4ROCA 4F7SB 5IDNB 4RODA 2QDJA 2WIPB 4F70B 4BCPB 4EOPB 2C6TB 2X1NB 4ROEA 4BCFB 1OI9B 2W9FA 4BCQB 2BPMB 2UZDB 3TN8B 4ELLA 2BKZB 1OIUB 5HQ0B 1H1QB 2WHBB 1QMZB 3TNHB 4ELJA 2PHGA 1OKWB 4EOOB 4EOJB 1H4LD 2UZLB 2WMAB 4I3ZB 4BCKB 2WFYB 5HBHB 1D3UB 1VYWB 4BCHB 2WEVB 1FVVB 1N4MA 4EONB 2W99A 1H28B 5EFQB 1UNGD 4IMYB 1H24B 1ZP2A 1H25B 2B9RA 3MI9B 3TNWB 2C5VB 2CJMB 3EOCB 1E9HB 2WXVB 3DOGB 3POMA 4YOOA 4CFWB 5ICPB 2EUFA 2CCHB 1JKWA 2UUEB 4EC9B 2PK2A 4BCIB 1PKDB 2R7GA 4NSTB 2W2HA 2C5NB 2C5OB 4YC3B 5IF1B 4BCJB 5L2WB 3MY1B 2V22B 2I40B 4Y72B 4OGRB 1JSUB 4CFMB 1F5QB 3EIDB 4BCND 3BLRB 5CEIB 4F7JB 2WPAB 4YOZA 4BCOB 1GH6B 1H27B 3EJ1B 1OL1B 4CFUD 4EOIB 1BU2A 5LQFB 5FGKB 4YOSA 2IW6B 1OIYB 5HBJB 2UZEB 4FX3B 1P5EB 2PMIB 3M03A 4F7NB 5BNJB 3RGFB 1AISB 3BHUB 2UZBB 2CCIB 1AD6A 4EORB 1W98B 2WIHB 1XO2A 4EOKB 4OR5B 1H1SB 3F5XB 4BCNB 3BHVB 4KRCB 3O0GD 4F6UB 1H1RB 1KXUA 1UNLD 2C5XB 3TNIB 3BLHB 4CFVB 5ACBA 4CFUB 1FINB 1OGUB 2F2CA 5HBEB 3MY5B 4EOSB 1VOLA 1C9BA 4F6WB 5HNBB 4CFXB 3DDPB 4CRLB 3QHRB 1O9KB 1H1PB 3BLQB 2PK9B 5LMKB 2IW9B 1GUXB 1JOWA 1URCB 4II5B 3K7AM 1O9KA 1H26B 2G9XB 1OL2B 4CXAB 4F6SB 1TFBA 1GUXA 4UN0A
chains in the Genus database with same CATH superfamily
3G33B 3QYGB 5I5ZB 3MIAB 4KRDB 1AHJB 3DTOA 2DXCB 4EC8B 2ZPFB 3HBLA 3QWLA 3VYGB 2W96A 4BCGB 3LQ5B 2DXBB 4Z6YA 2CZ1B 4F7SB 4LOCA 5IDNB 3X24B 2QDJA 4BCPB 2X1NB 2QF7A 2KR6A 2UZDB 3VKHA 4MFEA 1V29B 2ZPEB 2PHGA 4ZGEB 4EOJB 4NC6A 2UZLB 4BCKB 3NDQA 2WEVB 1N4MA 1H28B 3MI9B 2G77A 2QQ8A 3POMA 2UUEB 4EC9B 2D0QB 4BBRM 4BCJB 2V22B 5EJCA 3BLRB 3HZJA 1OL1B 1AISB 3M03A 4MFDA 5DQVA 3BHUB 4EORB 3QZ5B 3BHVB 2C5XB 1UGSB 1FINB 1OGUB 5HBEB 1VOLA 1C9BA 4F6WB 1O9KB 5LMKB 1GUXB 1JOWA 1O9KA 1H26B 2G9XB 1OL2B 4CXAB 1GUXA 4CFNB 1UGRB 4G6LB 3H4CA 2ZCFB 1UNHD 2JGZB 2QGSA 2ZPIB 3BHTB 2IW8B 2C4GB 1G3NC 4EOMB 4MIMA 3A8LB 1GY3B 4EOLB 1JSTB 1OKVB 2QDYB 4ROCA 4EOPB 2C6TB 4ROEA 2BPMB 3B57A 3X25B 4ELLA 5HQ0B 2WJ9A 2DD4B 2DMEA 4EOOB 1H4LD 4I3ZB 1UGPB 5HBHB 1VYWB 2W99A 5EFQB 1ZP2A 1H25B 2ZPHB 1E9HB 3HB9A 4YOOA 5ICPB 2BS2A 1JKWA 4OB3B 2R7GA 2W2HA 4YC3B 4HNUA 3BG9A 4Y72B 1JSUB 4CFMB 3EIDB 4AKHA 2WPAB 4YOZA 4BCOB 1GH6B 1BU2A 5LQFB 2IW6B 2UZEB 3RGFB 2UZBB 2CCIB 1AD6A 2WIHB 1XO2A 4AKIA 4OR5B 3F5XB 2DPPB 3QYBA 1KXUA 4JX5A 4CFVB 3BLHB 3VKGA 5ACBA 4HNTA 4HNVA 5HNBB 4CFXB 4CRLB 3DL1A 4AKGA 1FKMA 4QSHA 4ZGDB 1URCB 3QYEA 3K7AM 4BXXX 3KHIA 4F6SB 3QZ9B 2BS3A 1TFBA 4BY7X 4EOQB 2BS4A 4BCMB 3QHWB 2IVXA 2W9ZA 4M6VA 2WMBB 4F7LB 4BY1X 4RODA 2WIPB 1OI9B 2W9FA 3TN8B 2BKZB 1OIUB 1H1QB 2WHBB 1UGQB 3WVEB 5IHYA 4ELJA 1OKWB 2WFYB 4BCHB 3X28B 1FVVB 4OB0B 3VYHB 2C5VB 2CJMB 3EOCB 4CFWB 2EUFA 2CCHB 2PK2A 4BCIB 1PKDB 4AI6A 4NSTB 3HHTB 2C5OB 5L2WB 5IF1B 2ZPGB 4BCND 5CEIB 4F7JB 1IREB 1H27B 4CFUD 2CZ7B 2IN3A 4EOIB 4YOSA 4FM4B 1OIYB 1P5EB 2PMIB 3A8OB 1W98B 1H1SB 4BCNB 4KRCB 4OB2B 3O0GD 4F6UB 1H1RB 1UNLD 3TNIB 2KMGA 4CFUB 2F2CA 3MY5B 4EOSB 3GTMS 4OB1B 3DDPB 3QXEB 3QHRB 3X20B 2PK9B 3TW7A 2IW9B 4II5B 3PO3S 2DD5B 1VINA 3DDQB 4TTHA 2LW4A 5IDPB 5CYIB 4BCQD 2I53A 2CZ6B 5HVYB 4BCMD 3BG5A 4BBSM 2AHJB 3WVDB 4F70B 4BCFB 4BCQB 3QYHB 1QMZB 4JX4A 3TNHB 4HLQA 2WMAB 3A8MB 1D3UB 4HL4A 1TD6A 4EONB 3A8GB 1UNGD 4IMYB 1H24B 2B9RA 3BG3A 3TNWB 2WXVB 3DOGB 4JX6A 2C5NB 3MY1B 2I40B 4OGRB 2ZZDB 1F5QB 2PJQA 3TW6A 3EJ1B 2CYZB 3X26B 5FGKB 5HBJB 4FX3B 4F7NB 5BNJB 3DJBA 5DQWA 4EOKB 2QFZA 1QLBA 3HO8A 1E7PA 3A8HB 1H1PB 3BLQB 2ZPBB 1ENWA 2CZ0B 4ZGJB 4UN0A
chains in the Genus database with same CATH topology
3G33B 5I5ZB 4CFNB 1VINA 3DDQB 3MIAB 3H4CA 4G6LB 4KRDB 4EOQB 1UNHD 2JGZB 4TTHA 5IDPB 3BHTB 2IW8B 4BCMB 4EC8B 5CYIB 4BCQD 2I53A 2C4GB 1G3NC 2W96A 5HVYB 4EOMB 3QHWB 2IVXA 2W9ZA 1GY3B 4BCMD 2WMBB 4F7LB 4BCGB 4EOLB 1JSTB 3LQ5B 1OKVB 4ROCA 4F7SB 5IDNB 4RODA 2QDJA 2WIPB 4F70B 4BCPB 4EOPB 2C6TB 2X1NB 4ROEA 4BCFB 1OI9B 2W9FA 4BCQB 2BPMB 2UZDB 3TN8B 4ELLA 2BKZB 1OIUB 5HQ0B 1H1QB 2WHBB 1QMZB 3TNHB 4ELJA 2PHGA 1OKWB 4EOOB 4EOJB 1H4LD 2UZLB 2WMAB 4I3ZB 4BCKB 2WFYB 5HBHB 1D3UB 1VYWB 4BCHB 2WEVB 1FVVB 1N4MA 4EONB 2W99A 1H28B 5EFQB 1UNGD 4IMYB 1H24B 1ZP2A 1H25B 2B9RA 3MI9B 3TNWB 2C5VB 2CJMB 3EOCB 1E9HB 2WXVB 3DOGB 3POMA 4YOOA 4CFWB 5ICPB 2EUFA 2CCHB 1JKWA 2UUEB 4EC9B 2PK2A 4BCIB 1PKDB 2R7GA 4NSTB 2W2HA 2C5NB 2C5OB 4YC3B 5IF1B 4BCJB 5L2WB 3MY1B 2V22B 2I40B 4Y72B 4OGRB 1JSUB 4CFMB 1F5QB 3EIDB 4BCND 3BLRB 5CEIB 4F7JB 2WPAB 4YOZA 4BCOB 1GH6B 1H27B 3EJ1B 1OL1B 4CFUD 4EOIB 1BU2A 5LQFB 5FGKB 4YOSA 2IW6B 1OIYB 5HBJB 2UZEB 4FX3B 1P5EB 2PMIB 3M03A 4F7NB 5BNJB 3RGFB 1AISB 3BHUB 2UZBB 2CCIB 1AD6A 4EORB 1W98B 2WIHB 1XO2A 4EOKB 4OR5B 1H1SB 3F5XB 4BCNB 3BHVB 4KRCB 3O0GD 4F6UB 1H1RB 1KXUA 1UNLD 2C5XB 3TNIB 3BLHB 4CFVB 5ACBA 4CFUB 1FINB 1OGUB 2F2CA 5HBEB 3MY5B 4EOSB 1VOLA 1C9BA 4F6WB 5HNBB 4CFXB 3DDPB 4CRLB 3QHRB 1O9KB 1H1PB 3BLQB 2PK9B 5LMKB 2IW9B 1GUXB 1JOWA 1URCB 4II5B 3K7AM 1O9KA 1H26B 2G9XB 1OL2B 4CXAB 4F6SB 1TFBA 1GUXA 4UN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G33 B;  5I5Z B;  4CFN B;  1VIN A;  3DDQ B;  3MIA B;  3H4C A;  4G6L B;  4KRD B;  4EOQ B;  1UNH D;  2JGZ B;  4TTH A;  5IDP B;  3BHT B;  2IW8 B;  4BCM B;  4EC8 B;  5CYI B;  4BCQ D;  2I53 A;  2C4G B;  1G3N C;  2W96 A;  5HVY B;  4EOM B;  3QHW B;  2IVX A;  2W9Z A;  1GY3 B;  4BCM D;  2WMB B;  4F7L B;  4BCG B;  4EOL B;  1JST B;  3LQ5 B;  1OKV B;  4ROC A;  4F7S B;  5IDN B;  4ROD A;  2QDJ A;  2WIP B;  4F70 B;  4BCP B;  4EOP B;  2C6T B;  2X1N B;  4ROE A;  4BCF B;  1OI9 B;  2W9F A;  4BCQ B;  2BPM B;  2UZD B;  3TN8 B;  4ELL A;  2BKZ B;  1OIU B;  5HQ0 B;  1H1Q B;  2WHB B;  1QMZ B;  3TNH B;  4ELJ A;  2PHG A;  1OKW B;  4EOO B;  4EOJ B;  1H4L D;  2UZL B;  2WMA B;  4I3Z B;  4BCK B;  2WFY B;  5HBH B;  1D3U B;  1VYW B;  4BCH B;  2WEV B;  1FVV B;  1N4M A;  4EON B;  2W99 A;  1H28 B;  5EFQ B;  1UNG D;  4IMY B;  1H24 B;  1ZP2 A;  1H25 B;  2B9R A;  3MI9 B;  3TNW B;  2C5V B;  2CJM B;  3EOC B;  1E9H B;  2WXV B;  3DOG B;  3POM A;  4YOO A;  4CFW B;  5ICP B;  2EUF A;  2CCH B;  1JKW A;  2UUE B;  4EC9 B;  2PK2 A;  4BCI B;  1PKD B;  2R7G A;  4NST B;  2W2H A;  2C5N B;  2C5O B;  4YC3 B;  5IF1 B;  4BCJ B;  5L2W B;  3MY1 B;  2V22 B;  2I40 B;  4Y72 B;  4OGR B;  1JSU B;  4CFM B;  1F5Q B;  3EID B;  4BCN D;  3BLR B;  5CEI B;  4F7J B;  2WPA B;  4YOZ A;  4BCO B;  1GH6 B;  1H27 B;  3EJ1 B;  1OL1 B;  4CFU D;  4EOI B;  1BU2 A;  5LQF B;  5FGK B;  4YOS A;  2IW6 B;  1OIY B;  5HBJ B;  2UZE B;  4FX3 B;  1P5E B;  2PMI B;  3M03 A;  4F7N B;  5BNJ B;  3RGF B;  1AIS B;  3BHU B;  2UZB B;  2CCI B;  1AD6 A;  4EOR B;  1W98 B;  2WIH B;  1XO2 A;  4EOK B;  4OR5 B;  1H1S B;  3F5X B;  4BCN B;  3BHV B;  4KRC B;  3O0G D;  4F6U B;  1H1R B;  1KXU A;  1UNL D;  2C5X B;  3TNI B;  3BLH B;  4CFV B;  5ACB A;  4CFU B;  1FIN B;  1OGU B;  2F2C A;  5HBE B;  3MY5 B;  4EOS B;  1VOL A;  1C9B A;  4F6W B;  5HNB B;  4CFX B;  3DDP B;  4CRL B;  3QHR B;  1O9K B;  1H1P B;  3BLQ B;  2PK9 B;  5LMK B;  2IW9 B;  1GUX B;  1JOW A;  1URC B;  4II5 B;  3K7A M;  1O9K A;  1H26 B;  2G9X B;  1OL2 B;  4CXA B;  4F6S B;  1TFB A;  1GUX A;  4UN0 A; 
#chains in the Genus database with same CATH topology
 3G33 B;  3QYG B;  5I5Z B;  3MIA B;  4KRD B;  1AHJ B;  3DTO A;  2DXC B;  4EC8 B;  2ZPF B;  3HBL A;  3QWL A;  3VYG B;  2W96 A;  4BCG B;  3LQ5 B;  2DXB B;  4Z6Y A;  2CZ1 B;  4F7S B;  4LOC A;  5IDN B;  3X24 B;  2QDJ A;  4BCP B;  2X1N B;  2QF7 A;  2KR6 A;  2UZD B;  3VKH A;  4MFE A;  1V29 B;  2ZPE B;  2PHG A;  4ZGE B;  4EOJ B;  4NC6 A;  2UZL B;  4BCK B;  3NDQ A;  2WEV B;  1N4M A;  1H28 B;  3MI9 B;  2G77 A;  2QQ8 A;  3POM A;  2UUE B;  4EC9 B;  2D0Q B;  4BBR M;  4BCJ B;  2V22 B;  5EJC A;  3BLR B;  3HZJ A;  1OL1 B;  1AIS B;  3M03 A;  4MFD A;  5DQV A;  3BHU B;  4EOR B;  3QZ5 B;  3BHV B;  2C5X B;  1UGS B;  1FIN B;  1OGU B;  5HBE B;  1VOL A;  1C9B A;  4F6W B;  1O9K B;  5LMK B;  1GUX B;  1JOW A;  1O9K A;  1H26 B;  2G9X B;  1OL2 B;  4CXA B;  1GUX A;  4CFN B;  1UGR B;  4G6L B;  3H4C A;  2ZCF B;  1UNH D;  2JGZ B;  2QGS A;  2ZPI B;  3BHT B;  2IW8 B;  2C4G B;  1G3N C;  4EOM B;  4MIM A;  3A8L B;  1GY3 B;  4EOL B;  1JST B;  1OKV B;  2QDY B;  4ROC A;  4EOP B;  2C6T B;  4ROE A;  2BPM B;  3B57 A;  3X25 B;  4ELL A;  5HQ0 B;  2WJ9 A;  2DD4 B;  2DME A;  4EOO B;  1H4L D;  4I3Z B;  1UGP B;  5HBH B;  1VYW B;  2W99 A;  5EFQ B;  1ZP2 A;  1H25 B;  2ZPH B;  1E9H B;  3HB9 A;  4YOO A;  5ICP B;  2BS2 A;  1JKW A;  4OB3 B;  2R7G A;  2W2H A;  4YC3 B;  4HNU A;  3BG9 A;  4Y72 B;  1JSU B;  4CFM B;  3EID B;  4AKH A;  2WPA B;  4YOZ A;  4BCO B;  1GH6 B;  1BU2 A;  5LQF B;  2IW6 B;  2UZE B;  3RGF B;  2UZB B;  2CCI B;  1AD6 A;  2WIH B;  1XO2 A;  4AKI A;  4OR5 B;  3F5X B;  2DPP B;  3QYB A;  1KXU A;  4JX5 A;  4CFV B;  3BLH B;  3VKG A;  5ACB A;  4HNT A;  4HNV A;  5HNB B;  4CFX B;  4CRL B;  3DL1 A;  4AKG A;  1FKM A;  4QSH A;  4ZGD B;  1URC B;  3QYE A;  3K7A M;  4BXX X;  3KHI A;  4F6S B;  3QZ9 B;  2BS3 A;  1TFB A;  4BY7 X;  4EOQ B;  2BS4 A;  4BCM B;  3QHW B;  2IVX A;  2W9Z A;  4M6V A;  2WMB B;  4F7L B;  4BY1 X;  4ROD A;  2WIP B;  1OI9 B;  2W9F A;  3TN8 B;  2BKZ B;  1OIU B;  1H1Q B;  2WHB B;  1UGQ B;  3WVE B;  5IHY A;  4ELJ A;  1OKW B;  2WFY B;  4BCH B;  3X28 B;  1FVV B;  4OB0 B;  3VYH B;  2C5V B;  2CJM B;  3EOC B;  4CFW B;  2EUF A;  2CCH B;  2PK2 A;  4BCI B;  1PKD B;  4AI6 A;  4NST B;  3HHT B;  2C5O B;  5L2W B;  5IF1 B;  2ZPG B;  4BCN D;  5CEI B;  4F7J B;  1IRE B;  1H27 B;  4CFU D;  2CZ7 B;  2IN3 A;  4EOI B;  4YOS A;  4FM4 B;  1OIY B;  1P5E B;  2PMI B;  3A8O B;  1W98 B;  1H1S B;  4BCN B;  4KRC B;  4OB2 B;  3O0G D;  4F6U B;  1H1R B;  1UNL D;  3TNI B;  2KMG A;  4CFU B;  2F2C A;  3MY5 B;  4EOS B;  3GTM S;  4OB1 B;  3DDP B;  3QXE B;  3QHR B;  3X20 B;  2PK9 B;  3TW7 A;  2IW9 B;  4II5 B;  3PO3 S;  2DD5 B;  1VIN A;  3DDQ B;  4TTH A;  2LW4 A;  5IDP B;  5CYI B;  4BCQ D;  2I53 A;  2CZ6 B;  5HVY B;  4BCM D;  3BG5 A;  4BBS M;  2AHJ B;  3WVD B;  4F70 B;  4BCF B;  4BCQ B;  3QYH B;  1QMZ B;  4JX4 A;  3TNH B;  4HLQ A;  2WMA B;  3A8M B;  1D3U B;  4HL4 A;  1TD6 A;  4EON B;  3A8G B;  1UNG D;  4IMY B;  1H24 B;  2B9R A;  3BG3 A;  3TNW B;  2WXV B;  3DOG B;  4JX6 A;  2C5N B;  3MY1 B;  2I40 B;  4OGR B;  2ZZD B;  1F5Q B;  2PJQ A;  3TW6 A;  3EJ1 B;  2CYZ B;  3X26 B;  5FGK B;  5HBJ B;  4FX3 B;  4F7N B;  5BNJ B;  3DJB A;  5DQW A;  4EOK B;  2QFZ A;  1QLB A;  3HO8 A;  1E7P A;  3A8H B;  1H1P B;  3BLQ B;  2ZPB B;  1ENW A;  2CZ0 B;  4ZGJ B;  4UN0 A; 
#chains in the Genus database with same CATH homology
 3G33 B;  5I5Z B;  4CFN B;  1VIN A;  3DDQ B;  3MIA B;  3H4C A;  4G6L B;  4KRD B;  4EOQ B;  1UNH D;  2JGZ B;  4TTH A;  5IDP B;  3BHT B;  2IW8 B;  4BCM B;  4EC8 B;  5CYI B;  4BCQ D;  2I53 A;  2C4G B;  1G3N C;  2W96 A;  5HVY B;  4EOM B;  3QHW B;  2IVX A;  2W9Z A;  1GY3 B;  4BCM D;  2WMB B;  4F7L B;  4BCG B;  4EOL B;  1JST B;  3LQ5 B;  1OKV B;  4ROC A;  4F7S B;  5IDN B;  4ROD A;  2QDJ A;  2WIP B;  4F70 B;  4BCP B;  4EOP B;  2C6T B;  2X1N B;  4ROE A;  4BCF B;  1OI9 B;  2W9F A;  4BCQ B;  2BPM B;  2UZD B;  3TN8 B;  4ELL A;  2BKZ B;  1OIU B;  5HQ0 B;  1H1Q B;  2WHB B;  1QMZ B;  3TNH B;  4ELJ A;  2PHG A;  1OKW B;  4EOO B;  4EOJ B;  1H4L D;  2UZL B;  2WMA B;  4I3Z B;  4BCK B;  2WFY B;  5HBH B;  1D3U B;  1VYW B;  4BCH B;  2WEV B;  1FVV B;  1N4M A;  4EON B;  2W99 A;  1H28 B;  5EFQ B;  1UNG D;  4IMY B;  1H24 B;  1ZP2 A;  1H25 B;  2B9R A;  3MI9 B;  3TNW B;  2C5V B;  2CJM B;  3EOC B;  1E9H B;  2WXV B;  3DOG B;  3POM A;  4YOO A;  4CFW B;  5ICP B;  2EUF A;  2CCH B;  1JKW A;  2UUE B;  4EC9 B;  2PK2 A;  4BCI B;  1PKD B;  2R7G A;  4NST B;  2W2H A;  2C5N B;  2C5O B;  4YC3 B;  5IF1 B;  4BCJ B;  5L2W B;  3MY1 B;  2V22 B;  2I40 B;  4Y72 B;  4OGR B;  1JSU B;  4CFM B;  1F5Q B;  3EID B;  4BCN D;  3BLR B;  5CEI B;  4F7J B;  2WPA B;  4YOZ A;  4BCO B;  1GH6 B;  1H27 B;  3EJ1 B;  1OL1 B;  4CFU D;  4EOI B;  1BU2 A;  5LQF B;  5FGK B;  4YOS A;  2IW6 B;  1OIY B;  5HBJ B;  2UZE B;  4FX3 B;  1P5E B;  2PMI B;  3M03 A;  4F7N B;  5BNJ B;  3RGF B;  1AIS B;  3BHU B;  2UZB B;  2CCI B;  1AD6 A;  4EOR B;  1W98 B;  2WIH B;  1XO2 A;  4EOK B;  4OR5 B;  1H1S B;  3F5X B;  4BCN B;  3BHV B;  4KRC B;  3O0G D;  4F6U B;  1H1R B;  1KXU A;  1UNL D;  2C5X B;  3TNI B;  3BLH B;  4CFV B;  5ACB A;  4CFU B;  1FIN B;  1OGU B;  2F2C A;  5HBE B;  3MY5 B;  4EOS B;  1VOL A;  1C9B A;  4F6W B;  5HNB B;  4CFX B;  3DDP B;  4CRL B;  3QHR B;  1O9K B;  1H1P B;  3BLQ B;  2PK9 B;  5LMK B;  2IW9 B;  1GUX B;  1JOW A;  1URC B;  4II5 B;  3K7A M;  1O9K A;  1H26 B;  2G9X B;  1OL2 B;  4CXA B;  4F6S B;  1TFB A;  1GUX A;  4UN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...