3POWA

Crystal structure of the globular domain of human calreticulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
251
Chain Sequence
b'GREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calreticulin
molecule tags Chaperone
source organism Homo sapiens
publication title X-ray structure of the human calreticulin globular domain reveals a Peptide-binding area and suggests a multi-molecular mechanism
pubmed doi rcsb
total genus 76
structure length 251
sequence length 258
ec nomenclature
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3powA01
1GZ9A 4M01A 5KXEA 3AX4A 3OPZA 1LENA 4WZFA 2ZHNA 1LOBA 1MVEA 4Y20B 3H0OA 3IMNA 2ZGMA 1S0IA 1IKQA 3GNEA 1V6IA 2YMZA 3WZ1A 1HQWA 3ZXJA 4ATFA 1W6NB 3OY8A 1N1YA 3WG4A 1UZYA 5F9TA 1S0JA 3PMEA 1IS3A 5GZCA 2CYFA 3MW2A 3OY8B 4YW5A 2VW1A 2SBAA 1SLIA 2CWSA 2DVGA 2NP0A 1G8WA 1N3OA 4XIKA 5GM0A 4BMBA 1Y7BA 4YW1A 3PJQA 2PELA 1BJQA 1ULEA 2ZMLA 3AYDA 1UZZA 4C1XA 4DS0A 1VIWB 2EXHA 1KJRA 1SLBA 3LCPA 4R9CA 4ATEA 4Y22B 4FPOB 3WDXA 1GBGA 4Q8LA 1CESA 3N3HA 4AGRA 3W59A 4GKYA 4LBNA 2ZGQA 2A3YA 3WCSA 4XMIA 2VW2A 3V0AA 2JJ6A 2I2SA 4FP2A 2W39A 2ZGNA 4FPFA 4FPGA 4R9AA 3B00A 1JW6A 2DVFA 1VAVA 3OYWA 2EIGA 3WDWA 1YI7A 1MS8A 1QDOA 4Q1PA 1UN1A 2OVUA 5DG1A 3WHUA 4DPNA 2JKBA 3ZSJA 4JRAA 1IS5A 2R1DA 3ZSKA 1CPMA 1W6QB 1G9BA 1OKQA 3M2MA 5HCBA 1G9CA 2VW0A 3WDTA 2DWRA 1ULFA 2WSVA 3PVEA 5KXDA 1ULDA 1V00A 2ENRA 4K1YA 3V0BA 1LOCA 1V6KA 4JCKA 2AUYA 4GALA 3JUUA 3O0XA 2ARXA 1LU1A 1R1ZA 2GALA 2JD4A 5T50A 1WW5A 1AX0A 1C57A 2E7QA 1AJKA 5GZFA 3WUDA 1SLTA 5DUVA 5T52A 2D3RA 3ZXFA 2YXSA 1F5FA 1XQNA 5JOXA 4FPCA 1AJOA 4ISRA 2W08A 5IK4A 4XJWA 1GZWB 1PZ9A 3V64A 1N47A 5IK7A 1H9WA 3RMYA 1MS1A 5JLVA 5JVVA 1DYKA 2CNAA 2ZGRA 1AVBA 2GNTA 1CQ9A 1Q8SA 4PBOA 5EWSA 3SLIA 3I4IA 3RRDA 4FP3A 4FOQA 2TEPA 3ZYPA 2GDFA 2XB6C 3B69A 1S0BA 3R4UA 3NWKA 3INAA 2EF6A 2D44A 2ZMKA 4XDQA 4DRRA 2DUPA 4YG0A 2GN3A 2D7FA 4YM1A 2GNBA 3FLRA 4DRVA 4FOYA 2D6OX 4XHXA 5IT6A 1LOFA 5KXCA 3AYCA 4Z8BA 2VUAA 1Q8OA 3V65A 2AREA 1GNZA 4XJUA 2R0FA 4BPZA 1YXWA 1BQPA 1JYIA 4CZSA 2ZA9A 1AZDA 3POWA 3Q9OA 2PHWA 4Y24A 3SH5A 4XJAA 2YZ4A 2AYHA 1FAYA 4L8QA 4XJZA 1FNZA 2ZMNA 2DTYA 5H9QA 2ZGOA 4FPYA 2WJSA 2CL2A 4JC1A 2A6VA 4PF5A 4Q1RA 1I3HA 1LU2A 1WLCA 4XE9A 4XIOA 4Q26A 1DQ1A 5IK8A 4YW4A 1CJPA 1V6LA 1RITA 4Y1VA 1EPWA 1QNYA 2B7YA 2HYKA 1N1SA 1MZ6A 1WCSA 3AJYA 2D6PA 3AJZA 2ARBA 4YZ1A 4CTEA 4YM3A 4YGEA 3NV3A 1LEMA 2A3WA 1LHUA 3O0WA 1DQ4A 4UW5A 5CA6A 4WV8A 1BXHA 2GMMA 2E7TA 2P3JA 1O4YA 3NV1A 3WV6A 4HANA 4YW2A 2ZGUA 4NOTA 4XHBA 3TB0A 2ZGPA 3FUQA 5CBLA 3FBYA 1N3QA 3CNAA 1VLNA 2R0HA 5HCFA 4CRQA 2ZZJA 3FFZA 4M00A 5GZEA 3RMXA 4Y20A 2OW4A 3A0KA 4P9XA 1JN2P 3HMYA 1FNYA 4FOVA 1KDMA 1V6JA 3V0BB 2FMDA 1UX6A 2DU0A 3UJQA 1GANA 1LOAA 3AXDA 4BM8A 3T1MA 1JBCA 4YM0A 1QU0A 1ONAA 3KM5A 4AVVA 3BTAA 3USUA 1LEDA 4FOWA 4P9WA 2ZKNA 2BQPA 3AYEA 3OBRA 2DYCA 1YYNA 1QMJA 5T5LA 1SBEA 4Y1XA 2UWAA 3OBTA 1TEIA 1DFQA 3A4UA 1WW4A 3BODA 2WLQA 1IOAA 1GLHA 5E8AA 3M3CA 1G7YA 2DV9A 2NYYA 4M3CB 2UWBA 4YGDA 1IKPA 4OZXA 3WVJA 1CIWA 4YFWA 1AF9A 4LBKA 5DZEA 5IUQA 5LK5A 1WUVA 1YO8A 4KBBA 2WSUA 5DUXA 4U2AA 2NMOA 3ILRA 2ZACA 5BYNA 4XMAA 2C9AA 3B3QE 4PBPA 1FATA 2ZGTA 2JECA 5GLZA 2EALA 5E88A 2PHUA 5L73A 1W0OA 4DQAA 1HLCA 1DZQA 1LHWA 1QDCA 4LBMA 5JMCA 1SFYA 1MS4A 1F31A 1S0CA 3ZVXA 1FV3A 2ZHMA 2V5YA 4BMEA 5GLWA 3WOGA 2DVDA 5JOZA 2SLIA 1LULA 2CY6A 3M1HA 4K1ZA 3WHTA 2A3XA 5F5QA 2DVAA 2ERFA 1ENRA 1MS5A 1QGLA 4YLZA 1OQ1A 3PVNA 1QNWA 2AR6A 4YW3A 1NXD1 1VALA 3B01A 2D3SA 2E53A 3A0NA 3SH3A 2DVBA 4UW3A 4BOWA 5T55A 2ZHLA 4GWMA 3SH4A 3AZZA 4MYEA 1BYHA 2CTVA 5CAZA 4XJ8A 4K21A 2EAKA 5H9RA 5EYXA 2A75A 2AGSA 2ZBJA 2DU1A 4LBQD 1QOOA 2P34A 1GZCA 1WLWA 1DQ5A 2W52A 2KM2A 4XTPA 1MZ5A 2JDZA 2LTNA 5T5JA 1B09A 5JOWA 3ZXLA 1H9PA 2YY1A 4H55A 2PHFA 1X50A 5DUWA 4LBOA 2A70A 1QOSA 4ITCA 1W6MB 3AFKA 2A6WA 1SLAA 1JHNA 2RHPA 1JXNA 4YGBA 1JUIA 3AP4A 1HKDA 2Q5TA 2ZHKA 3NV2A 3SISA 4XBNA 2WNEA 2D6NA 1ENQA 1D2SA 1DHKB 3N35A 2DTWA 1ZM1A 3AZWA 5DZFA 3DUIA 4GXLA 4HL0A 1LHNA 1V6NA 5GLTA 3VV1A 2R16A 3WDYA 5GJ6A 3ILNA 2GNMA 4GWNA 4RL7A 1Q56A 3RG0A 3WCRA 3QCWA 3ZYRA 1OFSA 1W6OA 4U36A 3MW3A 1A78A 3O5SA 4Q27A 3R05A 3IN9A 2OUHA 1U0AA 1SLCA 3AZYA 3FLPA 2EXIA 4FPJA 3AK0A 5GZGA 1GNHA 4XTMA 1AXYA 2DURA 1FV2A 4I30A 4W65A 2VXRA 4YG6A 1MS9A 5SV8A 2UURA 1WBFA 2P3KA 1APNA 1N3PA 4SLIA 1GSLA 3O0VA 5GZDA 3ZXKA 1F9KA 1FYUA 1ENSA 1H30A 3JU9A 4Y26A 4R9DA 2NMNA 3ENRA 3W58A 3LSDA 4YZ2A 4XBLA 1MS0A 1LECA 3T1LA 3WDVA 1BZWA 5KXBA 1MACA 1S0FA 2P2KA 2Z42A 1CN1A 4XBQA 4XXAA 1YRZA 4XILA 5E89A 2NN8A 4ASMB 1DBNA 2NZ9A 2ZABA 1UMZA 1PZ8A 1VAMA 1QF3A 3AXEA 5FRAA 3WUCA 2ZGSA 2D6KA 4TYSA 3PVOA 4AVTA 3FLTA 5EYYA 4IQPA 1LOFC 1WD4A 1SCRA 2WKKA 4GA9A 1O4ZA 1GICA 1S1AA 4FVVA 4YZ4A 2E51A 1A8DA 1ULCA 4DFSA 3L2YA 3VUOA 1AXKA 2A6XA 5DXDA 1UAIA 1LOEA 1LESA 3R4SA 1Z78A 1MR5A 1JYCA 1Q8PA 3DGTA 3N36A 3M3QA 3N7LA 3ATGA 3N7JA 1G86A 1KDKA 3D6EA 5DUUA 4AGGA 1KITA 1AX2A 3AP6A 1V6MA 5GLVA 1RINA 3AP5A 3AYAA 4TZDA 5CNAA 1SBDA 3ILFA 2VU9A 2XG3A 4FQ4A 4M3CA 4P9YA 5FREA 1N1TA 4YFZA 1W6NA 3KQRA 4ZXKA 2G4IA 5H9PA 4XJ9A 1IS4A 2D6LX 5IK5A 1UPSA 5T54A 2V73A 4YZ3A 1WD3A 5AVAA 4LBQB 4F83A 3D4KA 1LJ7A 1PZ7A 4LBQA 1LTEA 1DLLA 3NV4A 4K20A 3RSJA 3T2TA 1KQRA 1LHVA 1WW7A 2P3IA 1SACA 4FPEA 1W6PA 2VH9A 3U4XA 2PHTA 3N7MA 1GV9A 4XYXA 2GN7A 1HQLA 1W6PB 1DIWA 1C1FA 4RA0A 3ZPYA 1RIRA 4AWDA 1I1EA 3SNMA 2VY0A 1GYKA 2A6YA 2WT2A 1G9DA 3N7KA 3WG2A 4FQZA 4AYUA 1W6MA 2JE9A 3QLQA 2E6VA 4WVVA 3WG3A 1G9AA 2A6ZA 1LGCA 2WT0A 3MEPA 4ISQA 2PHRA 1IS6A 4XZPA 1BKZA 4PQ9A 2GMPA 3VKFC 1GKBA 1NLSA 2OUJA 4XOGA 3RS6A 1D0HA 3WNXA 1KRIA 3OJBA 4YM2A 1W0PA 2FHRA 1DYPA 2YROA 3MPPG 3ZSMA 1S0DA 4Q8KA 1WBLA 3OGGA 1N1VA 4WVWA 3USUB 5GALA 1W6OB 1DQ0A 3AP9A 4D69A 1C1LA 1LGNA 1WW6A 2R49A 1DGLA 3V0AB 1LHOA 3IM0A 1V6OA 2YV8A 1DQ2A 3LSEA 3VKOA 1MVQA 4Y22A 2JE7A 1Q8VA 1WLDA 1Z0HA 2D43A 1JOJA 4AGVA 2GMEA 4M3CF 3RQ0A 4BQ1A 1G9FA 1LGBA 5HCAA 4Y1UA 1FX5A 2P37A 2DUOA 3B9CA 2ZGLA 5DG2A 3C2UA 2UWCA 2AENA 4XXPA 2PHXA 5DZGA 3UK9A 5JDBA 3UJOA 1DQ6A 4AVSA 4PCRA 1UKGA 2CWMA 1SBFA 3HR9A 3IPVB 4ZKTB 5CB7A 3WDUA 3AZXA 1AXZA 1ZA4A 2EXKA 1URXA 2NM1A 3ZSLA 2H0BA 4YZ5A 1Q8QA 2D3PA 3FUOA 4LBLA 4FPLA 3VKMA 5EXOA 1QOTA 1LOGA 1CR7A 2R1BA 3O12A 1S0EA 3IKWA 3M3OA 4Y1YA 5H9SA 1A3KA 1SCSA 2WT1A 1J1TA 2A71A 3MW4A 3POSA 5T5PA 3GALA 3TAYA 2DUQA 3POYA 3AP7A 3BIWE 2ES3A 1CVNA 3M3EA 3OYWB 3VKNA 1S0GA 4NO4A 1CONA 1GZWA 5T5OA 4R9BA 2A7AA 2C5DA 3AZVA 3ASIA 4Q2FA 4UW4A 1W6QA 3BOPA 4YGCA 4GKXA 4Y1ZA 1MS3A 1QKQA 5JOYA 3HN1A 3IPVA 1UL9A 2ZGKA 1LCLA 3VKLA 3ZXEA 4LBJA 3SITA 5GLUA 1KJLA 4BLIA 4UW6A 2WQZC 3WLUA 4M3CE 3WG1A 1SLLA 3I8TA 2D6MA 4C1WA 1CPNA 2A5ZA 4P14A 2W68A 4YG3A 1HDKA 1C4RA 2GNDA 4FPKA 3APBA 2UU8A 1AX1A 2AH2A 3UL2A 2ZAAA 3D5OA 2EXJA 2LALA 4BLJA 4FPHA 1LODA 1YIFA 1ULGA
chains in the Genus database with same CATH superfamily
1GZ9A 2V5DA 5FMOL 4NIIA 5KXEA 3H8UA 1HN1A 2ZHNA 1DZTA 1H4GA 2WWJA 4DXSA 1BVP1 2EAAA 2Y6KA 1S0IA 2WA4A 2ZGMA 3GNEA 1V6IA 2YMZA 3WW1A 5BXXA 3ZXJA 1RUH3 1W6NB 3HBKA 3OY8A 5I0TA 5F9TA 1S0JA 3PMEA 2PFWA 3PUAA 4B7KA 3E6BA 2JEMA 2RE9A 2VW1A 4SBVA 4HK8A 3WNNA 2ZAHA 4COZA 1SLIA 4Q29A 2NP0A 3U14A 1VRH1 2QDNA 1UWWA 3LOBA 3OBZA 5K4LA 3VD3A 1DU3D 2PELA 4XDPA 1ULEA 3ACFA 3AMQA 3DL3A 2IWGB 3LEMA 3R6SA 1SLBA 4XEZA 3AFGA 2BOJA 5A1AA 1GBGA 3N3HA 4LKEA 4N53C 4AGRA 4GKYA 4A45A 3POJA 1K5MB 3PUQA 2W39A 4FPGA 4D3WA 4D6RA 4QGLA 2WZR3 4ES9A 2EIGA 1XE7A 1EP0A 4I02A 2IUWA 4K8RB 4V2VA 2JENA 3WF4A 4D7SA 5JXIA 3ZSJA 1O3QA 3O1UA 2HWF3 4AFAA 3MIHA 5LBEA 2ZTNA 3LGRA 3CDZB 3VDCA 2HH9A 4G4FA 1YEWA 5FZ6A 2GH2A 4MXWB 3LA2A 2XGXA 2WSVA 3PVEA 1TME3 4TTGA 4EE2A 2VNVA 3DN7A 3W5NA 3SKVA 2RM22 1XYNA 2CHHA 3HNYM 2XLFA 1LOCA 4HT1T 4LE4A 5CADA 1CX1A 2R072 1KEXA 5C33A 5A1LA 3O0XA 2ARXA 3J4UH 1LU1A 1R1ZA 1OLME 2DCYA 2WO1A 3IDBB 3ZOIA 4QPIA 5GZFA 2VECA 3ZYIB 4XFAA 5T52A 4CXXA 1TNRA 5FKBA 3PTYA 2BGPA 1SPPA 4QQ2A 5FY4A 2XL7A 4JVAA 1OOPB 2GP5A 4ISRA 4B1LA 3WNLA 1ZRIA 1DGWA 1F8VA 4K40A 2P4EA 3DKWA 5A3UA 4LK6A 1OI6A 3RMYA 4QXCA 5JVVA 4KH9A 3AKSA 1AVBA 1DF0A 2GNTA 3H7YA 1Z7S3 1Q8SA 5EWSA 4HKLA 4L0PA 3RFRA 1DYOA 1AYM1 2HWD2 3RRDA 5C6CA 2RS11 4FOQA 2TEPA 1OUXA 3B69A 1VBA1 2DUPA 1VPHA 2GN3A 1R081 2GNBA 3PLQA 1F15A 4N43A 1JYXA 2WFF2 4FOYA 4P00B 3O1OA 3GYDA 1UY0A 5FYUA 2ARCA 2AZ5A 4H14A 2VUAA 2QZ3A 1QXRA 3FWEA 2ETEA 4LMFA 1DLCA 4Q4W2 3V65A 1I9RA 2WNUC 3OD0A 4XJUA 2R0FA 3VBRB 4M0NA 1AZDA 3Q9OA 2PHWA 4XJAA 2FZ1A 4LKDA 1FAYA 4F7ZA 3C7EA 3I97A 4AAXA 3WF3A 1W8ZA 4CYDA 4FPYA 2Q8EA 1XB9A 5FYMA 1BEV3 5C3OA 1VBD2 2WJSA 4UF0A 4LA2A 1HIXA 3KT4A 4Q1RA 1I3HA 5G04L 3VDDB 4I3GA 1UCXA 5FQ0B 2WFPA 4KI5M 4RS5C 1J1LA 4UAPA 5FQ0A 4H7MA 1EPWA 2HYKA 3BTXA 2WQ8A 1HV1A 4CTEA 1AR73 3MF9A 5EPAA 4LT5A 3O0WA 1LHUA 1QJU1 2JXAA 2R042 2DFBA 2HWB2 2W5FA 5CFCC 5L9VA 2QQVA 5FP7A 1O4YA 1ZYBA 3VBRA 1R091 1O8SA 1ALYA 3FUQA 4NHXA 2P6CA 3FBYA 5CBLA 2J1SA 4CRQA 5CKMA 5GZEA 5DDJ1 1JN2P 4WM7B 2JWPA 3H7JA 4TN7A 3RDIA 4D6SA 2FMDA 3IAQA 1UX6A 2W1SA 4I3PA 3UJQA 3CL1A 4MGQA 4QWNA 3T1MA 1ZBE2 2Y0OA 1NQJA 1FPN3 1U5ZA 4XVHA 4AVVA 2ZEWA 1CAUB 4P9WA 2BQPA 3AM2A 4QX8A 1H8TC 4NIAA 4M0HA 1W2AX 2QQJA 3DXTA 4LPLA 4BQ4A 3E6CC 1YYNA 3O1PA 4JDNA 1QMJA 2JDHA 4IGPA 3RNSA 2UWAA 5FFOC 1NCQB 1TEIA 4OCTA 1DZRA 1WW4A 2VOVA 1OT5A 4FXGB 2UY9A 1YLLA 2NYYA 4LOTA 4YGDA 1EAH2 4OZXA 3T2PA 5JZGB 3SHRA 4MXVA 1RVF3 5BYNA 4XF0A 3ZYGA 4EJRA 1RUE3 2YU2A 1QJU3 1J84A 3EB7A 1RYYA 2RS13 4KWJA 5E88A 2B42B 1WKYA 2Y6GA 2QJVA 3B5LB 5IFTA 3K2OA 1W0OA 1HLCA 1DZQA 1QDCA 2RJLA 3J7NA 2A1XA 2C4XA 1BLZA 1SFYA 3UKVA 1AL23 1PK6A 3HQXA 1S0CA 4D94A 4BMEA 3Q8FA 4CDUA 5F8PA 3OPTA 1RUE1 3RSJA 3O1RA 4RD7A 4K1ZA 4RQPC 3CZUA 4A42A 2A3XA 4O61A 2ERFA 2Q0AA 4YLZA 2ZEXA 4HMZA 2QFEA 2B39A 4HXCA 5AC92 4P02B 3B01A 3A0NA 2AC1A 3SC7X 4GWIA 5DMYA 1B35C 1AR82 4WBBA 1NE6A 4XCBA 3V56A 4F3JA 4L92A 4PIZA 3AZZA 3WQ0A 4BHPA 3JD71 3GHNA 4QXHA 5H9RA 1TZOA 3K4DA 4UYBA 5EYXA 2AGSA 4MH0E 2O14A 2DU1A 3OGRA 1QOOA 2XJTA 4UFKA 4NRMA 3ZR6A 1GZCA 1O3SA 1DQ5A 4PF1A 5FAXA 5JOWA 4H55A 1W8FA 2XBO1 2PLV3 4S2HA 2A70A 1QOSA 5JSRA 3JBG1 1T6GC 2WN2A 1I5PA 3I3BA 2YC0A 1ND2B 1NUKA 1W8NA 4QX3A 5CYYA 4J1WA 2A6WA 4PT6A 5FK8A 4YVSB 2RS52 3VB9A 3KT7A 3W5MA 2WZR1 4CDQA 5FK7A 1JUIA 1HKDA 2Q5TA 2B4KA 1RUG2 2ZHKA 3NV2A 4XF1A 5I0RA 1XNKA 2D6NA 3D8CA 4DIQA 2I45A 1D2SA 1DHKB 3N35A 1GP6A 1SMVA 5K8SA 1IPSA 4AVAA 5A33B 1AL21 1WCQA 5FYTA 1LNSA 5GLTA 2LUWA 4QDSA 5C4WA 3ILNA 3WDYA 3JZVA 5E16A 1Q56A 1OLMA 3VBHC 1D7PM 2D5FA 1BBT2 4XW3A 3ZSEA 5L19A 1WGPA 5CFDC 1DP0A 1A78A 1KXGA 3R05A 2OUHA 4ASKA 4Y3OA 1HB4A 4Z1VA 4FPJA 5IATA 1ULOA 5FY7A 4IV3A 4XTMA 1V0AA 1WCDJ 5FZEA 1FV2A 3J8F1 1TVGA 3RWKX 4N7IA 3FX3A 3MIFA 2RMU1 2RMU3 4FFIA 5F32A 1K5JA 2HWC2 5A33A 2PYTA 4RS5B 1ENSA 1H30A 2RDQA 4Y26A 2WINB 4BK4A 4C91A 3LFMA 1NE4A 4GD4A 1MS0A 1J58A 2X09A 1MACA 1H6XA 4ASMB 2W46A 3NNLA 5FXVA 5A6XA 1YRZA 1T6BX 1ZX5A 2NN8A 4XILA 5I8YA 1TMF2 3WUCA 3KV6A 1ZBA2 4LIVA 5SV5A 3I2HA 1JS9A 5FZOA 1R1A2 2W0XA 4YRDA 4TYSA 5FZGA 4AVTA 4A7ZA 5EYYA 1E5IA 4IQPA 1O8PA 1WD4A 3CLPA 5A32A 1GICA 4YZ4A 4OMCA 1A8DA 4XFHA 3ZFGA 3L2YA 2VMGA 1AXKA 3DYMA 3M7AA 1HXS1 5DXDA 4CDXB 4BA6A 4CU9A 5A70A 1JZ3A 4MGTA 1OQEA 1LESA 1OFNA 3R4SA 5DDJ3 1RUJ1 3CJIB 2W1QA 1KDKA 3D6EA 4QPIB 1NCQA 1SQ4A 5DUUA 4AGGA 4E4DX 1AX2A 1PO22 2FDKA 1YCIA 5GLVA 3AP5A 3AYAA 5D8AB 1XRUA 1SBDA 3ILFA 5BNQA 3H8RA 1WMEA 2XG3A 4FQ4A 2WO3A 4M3CA 1AR93 4P9YA 1WWYA 3CEWA 4XF9A 5FREA 2XL9A 1J59A 3I3MA 2G4IA 5ABJA 4XJ9A 3RYPA 4N53B 5IK5A 1UPSA 5T54A 2MPFA 4LEJA 2GH8A 2GU9A 4NPLA 5AVAA 5ABJB 2C6SA 4CUAA 2CGPA 2ADEA 4QQPA 4GH4B 4QGMA 2Q8CA 2HLEA 4YVSC 1W9YA 1ST8A 1KQRA 1LHVA 1XXNA 1L3JA 1XOYA 4PI2A 4QU1A 1QH7A 4FPEA 3S7EA 3GDBA 5CKNA 2EA7A 5CFCB 3N7MA 2LM3A 2VZSA 3EQEA 4QX1A 2ZEYA 4RA0A 3I2GA 1HRV3 4CUBA 3GBGA 3GF6A 5KBFA 4IV1A 3PIGA 1K5MA 3C7FA 1I1EA 1DG6A 4XAEA 2HBUA 5A6ZA 2VY0A 1OSGA 5LA0A 3WQ1A 2WT2A 1G9DA 3N7KA 1ZZ7A 1HB3A 5LZ6A 5B2GB 1D4M2 3WG3A 4Q4X2 1S4CA 5D8AA 2Q1FA 1W2OA 1C8NA 1NKGA 2X5IC 3VD5A 4XZPA 4N90A 1BKZA 5C9AB 2JG8A 1UY3A 2GMPA 1GKBA 3EJKA 1NLSA 4XOGA 4ET7A 2ID4A 3I2JA 3OJBA 3QACA 1AYM3 5LATA 4CEYC 5HV0A 5JPNB 2YYOA 3MPPG 1Y43B 4UFIA 4Y5TA 3ZSMA 4JKKA 4FSJA 1WBLA 2YUEA 4Q4X3 4EV0A 4DMIA 1OPOA 1RUI2 1R64A 4IL7A 4KG8A 5GALA 5A32B 4C8DA 2IC1A 1LGNA 5F7UA 3EBRA 4QM9A 5DAVA 5FYYA 1BEV1 4UI9L 2NQYA 3IM0A 5IAVA 1RVF1 4N9IA 3BU7A 2W95A 1DQ2A 1HRV2 2VTFA 2IXHA 4AEDB 3ETQA 2VOWA 3VD7A 4H2AA 4M3CF 3E1F1 1XPWA 2VZOA 5J1XA 3PL0A 1ENXA 4CDQB 2ZGLA 4LUKA 1W8UA 1VP6A 4LULA 3LDBA 5DZGA 5CFDA 5B4XA 5IW0A 3VBSB 4PCRA 5LBBA 5C9AA 2BVBA 1CAWB 1GZTA 1O5UA 2ATFA 2X10A 3LDKA 3UT0A 4CDUC 5F5AA 1WA6X 3IPVB 3JCIA 1ZA4A 4RHV2 2FDGA 2Z79A 1QJX3 4LBLA 5F2SA 3KCXA 5ACA2 1QOTA 5FPVA 1AR62 4NHKA 2WBKA 4QKBA 4KWKA 5JWPA 3FFQA 3OTFA 3IKWA 3M3OA 1RUF2 3H1WA 4ZU5A 3VBUB 2UY8A 4AOCA 3MW4A 1U5IA 3POSA 5T5PA 4AG4A 3GALA 3TAYA 1XU2A 3A22A 4MLOA 4OMDA 3VBUA 1CVNA 3OBAA 5J96B 5I91A 4J1XA 3IZOA 1DGWX 1PVXA 4TWTA 5DDJ2 3VKNA 5JXHA 3UGFA 1KGYA 5FZIA 5AFEA 4Q0UA 2IFWA 2QQMA 4R9BA 5D1IA 2BOIA 2C5DA 1RUJ3 4Q2FA 4YW6A 4Y5SA 1W6QA 4GKXA 3LAGA 1CAWA 2YFZA 4GZ9A 3FN9A 1QKQA 1W04A 1SZBA 1NT0A 1ZBA3 2WYFA 2JG8B 1F35A 4DO0A 3LKJA 5IWFA 2Y34A 2JDAA 3G6JB 3J7MA 4BLIA 2XQXA 4HVRA 5FXZA 4RYDA 1YQCA 2WQZC 3A7QA 3DXUA 1YNAA 3I8TA 3LA7A 1CPNA 2A5ZA 2BERA 4P14A 4PDWA 3E5XA 4UBGA 2W68A 2QQOA 2XWJB 4YG3A 2MNGA 2DCJA 4CDUB 2HWF1 2FBEA 4W6WA 4LLFA 3WP4A 4CP9B 1EPZA 2J1UA 3UL2A 3VZLA 1BMV2 4BLJA 2LALA 3JQXA 4FPHA 4V2WA 3G7DA 1LODA 1HW5A 4XUPA 5FUIA 4JDMA 5T50A 4M01A 4QHOA 4JAAA 2WRAA 2P1BA 1BHGA 3RJRA 3RJ2X 3BKZA 1SDWA 2VBDA 2WS93 2MEV1 1LOBA 4CU6A 4LO6B 4Y20B 3BTZA 2RS31 5EV7A 3IMNA 1BK1A 4AVBA 3H8OA 1JZ5A 3ROUA 2WUHA 1N1YA 4MXWA 3WG4A 2ORXA 1IS3A 2VMIA 5GZCA 2WNUA 3MW2A 3OY8B 1RL3A 1OH4A 2IFRA 3PNAA 4HKOA 2ZOEB 2DVGA 2WNUB 1NY72 3SXWA 5GM0A 4AW7A 4QX0A 1Y7BA 2DCZA 4HK9A 4NHLA 1BJQA 2IVIB 3RVHA 3I59B 4BIFA 3LCPA 1RC6A 2Y38A 5ANNA 3ZFFC 4Y22B 4WVMA 3WDXA 3KZ4C 1RUF3 4DEVA 1CESA 1HJFA 4IEVA 2ZGQA 5AC91 4CUCA 4MGKE 4XMIA 3V0AA 2D40A 2JJ6A 2I2SA 5FBZA 4FP2A 3TEXA 4GQ7A 5FZCA 4HETA 4R9AA 1H2LA 1XBFA 4CCJA 5JPMB 3HT2A 2Y6LA 1UY1A 1VAVA 4BQ3A 1UOBA 2MHFA 2W87A 4LK7A 5J98B 3WDWA 1MS8A 1QDOA 2AEZA 5FYSA 1UN1A 2OVUA 3WHUA 1JYTA 1IS5A 3OUHA 1W6QB 4HKWA 5HCBA 1G9CA 4FFGA 3WDTA 2DWRA 1STMA 2OQ6A 5C5TA 2RDRA 1K12A 2Q8DA 2R061 4B4QA 5JMOA 1VMFA 5KXDA 1TME1 5FMOS 1YQ8A 1C8M2 1ULDA 5JR7B 3ZPOA 5I93A 2ENRA 1W8TA 3FL7A 3CBNA 4META 3VBHB 5C3QA 2RS51 1AUYA 3N9NA 2DDUA 1J3RA 4RGGA 3CJIA 3EXUA 2VMHA 1H8TA 2C1FA 3RI9A 4JKMA 3VZNA 1C57A 2E7QA 1ZZ9A 2Y0IA 1GP4A 1H8TB 4HSJA 4BXSV 4B4PA 4JQRA 1XQNA 3KLSA 1VBA3 4FPCA 1RTVA 3AL6A 2PMWB 3BALA 3CQOA 4XJWA 3KVBA 4E4HA 3KMHA 5ISLA 1GWKA 3FJSA 1Y4WA 5FZOB 4BE3A 5LA9A 1H9WA 1HV0A 1NAEA 1UY4A 2ILMA 1DYKA 1IZ3A 2ZGRA 4R52A 2ZKLA 4PBOA 4DUXA 4XQDA 4W8JA 3TNPB 5AFBA 2FCUA 3I4IA 4X8NA 1VRH3 4XCAA 4FP3A 3ZYPA 4WM8A 1S0BA 5A3PA 4DRRA 4EWDA 2RDSA 5FP9A 1P8JA 3FZ3A 4YM1A 4BU2A 3FLRA 3T30A 1M06G 3UYJA 1RUH1 5LBFA 2G1MA 2D6OX 2VCMA 2QQPA 5FO7B 1W3XA 5C5UA 1UMHA 5KXCA 4HLTA 1Q8OA 4KL1A 5I8SA 2AREA 1OOPA 3MGUA 5FYIA 5CZKA 4ASLA 4FBFA 2ZA9A 4QQOA 3UESA 3ZMNA 3POWA 5IVYA 2WAOA 4CDWB 2WN3A 2YZ4A 3P3NA 3I7DA 4LOSA 4LNVA 2ZMNA 4Q0SA 2DTYA 2IZWA 1ASJ1 4E4SA 4IE5A 5C4WB 1GOHA 2CL2A 4EWEA 2FZ2A 3I2IA 4XE9A 4IE4A 1VBC2 1WLCA 2HEWF 3PDQA 3HNBM 1PGW1 4XIOA 5EP9A 1FPN1 1CJPA 1OOPC 1RUJ2 3OGJA 3PJYA 3RZHA 1RITA 3NKTA 4Y1VA 1QNYA 5LY1A 4EROA 1W8OA 1WCSA 3BYWA 3T0BA 2PHDA 2D6PA 1PO21 2ARBA 3M4FA 4AI9A 1AR91 2VULA 4E9KA 4YGEA 1NG0A 3VL9A 5CA6A 2A3WA 2QZ2A 3HJRA 4WV8A 2HWB3 5FPAA 1JYNA 4UT5A 2GMMA 2BU9A 2E7TA 1V9U1 3WV6A 5FYHA 2WDBA 2YBSA 4HANA 4YW2A 2ZGUA 4XHBA 3TB0A 3VLBB 2KD7A 4YNIA 5KC6A 5HCFA 3FFZA 4M00A 3PUIA 4Y20A 4BZ4A 1AR71 3HMYA 1O91A 1FNYA 4QKNA 1V6JA 3RZMA 2JDKA 3HN3A 1O7FA 1UU6A 4XF3A 4BM8A 5KWRA 2YU1A 1AYN1 2X5IB 3NAPB 2DFCA 4YM0A 1QU0A 4OI1A 1ONAA 3LE0A 4A6OA 1Q5OA 3BTAA 3USUA 4QX2A 2ZKNA 2PA7A 4GB33 3OBRA 1TNFA 3QH6A 4XUQA 3DYOA 5T5LA 3VBOB 1YFWA 2Z2SB 2YBPA 3OBTA 4QB6A 5FP3A 3UV9A 4EWAA 2WLQA 2H6CA 3MLLA 4A44A 3H50A 1RUNA 1W9TA 2VCBA 1G7YA 5GKAC 4M3CB 3S57A 1C28A 1C5IA 1BBT3 1IKPA 3JXSA 5AVPA 3WVJA 3WXPA 1AF9A 5IUQA 4NPMA 1SDDB 1A8MA 2HWD3 2WSUA 1HB1A 2QQNA 4XFIA 3ILRA 3GM8A 3U11A 4Q4Y1 4CPBD 2G19A 2ZX3A 3TN91 3VZOA 3WX5A 2PHUA 1QJY1 3GCWA 1VRBA 4Z07A 5L73A 3BGAA 4LUMA 5F3EA 3X29B 2DF7A 1OXCA 5FYVA 2Y6JA 3H3UA 5EJ3A 1W8WA 3NAPC 4LR4A 4H7LA 2ZHMA 3A21A 3ZFEA 4JRLA 3VN4A 5GLWA 5HXMA 1LULA 4XF4A 2CY6A 3M1HA 3WHTA 2NPIA 2DCKA 2QVSB 4NHYA 2J1VA 2OS2A 3S0MA 2W9XA 5F5QA 3CMGA 1ENRA 1QGLA 5L36A 4UFMA 2WL1A 2VQUA 4IV3C 1QNWA 2RM23 3LEIA 4W6YA 4Q5OA 1NXD1 5JSOA 1J3QA 3VHPA 4KQ7A 2E53A 3SH3A 4AVCA 2JG9C 4UW3A 4BOWA 2X29A 1UOGA 3NVCA 4P9LA 1CJDA 1RGSA 1WLTA 2ZHLA 3I54A 2RR11 4QPIC 4Y4YA 1HRI2 4NR1A 2I07B 4YVWC 5LBCA 5A7PA 2BGCA 2QDRA 1XNCA 2CTVA 5IVVA 1AR61 1UOJA 2BP6A 1A6CA 2EAKA 3J7LA 4XJ8A 1ZRDA 2ZBJA 2XJVA 4BQ5A 3SQOA 2YDEA 1O59A 2CAUA 2P34A 1RMU1 2VNGA 3GJAA 3KF3A 4PJYA 1QY4A 1XE8A 2KM2A 4XTPA 1MQTC 2R6QA 1H9PA 4B1MA 3ZFGC 4YVSA 5DPNA 1JZ4A 1O5LA 3AFKA 3K3OA 1JHNA 2H6BA 3SCFA 4YGBA 5DN2A 3SISA 2PQQA 4X6RB 5FKCA 2OPWA 3WY6A 4CE8A 2Q1ZB 4C90A 3C7GA 1ZM1A 4RSUA 5DZFA 3ZFEC 4GXLA 2CGNA 3NMBA 4QM8A 5KC5A 4RR3A 1ND3C 2X05A 1PO11 5GJ6A 1HJGA 1PGSA 1GMMA 4XC9A 3H1YA 4JGYC 1GP5A 1EV12 2DCTA 2KXLA 3VBOA 4OI0A 1XSQA 3O5SA 3IN9A 4BISA 5CU1A 3HEIA 1SLCA 2EXIA 5FZBA 5EFUA 5GZGA 2VZVA 4G3YC 3OEBA 4IV1B 2G9ZA 3U37A 4QHBA 2E26A 2FD8A 3NNGA 1CAXB 1PGL2 1X8EA 2RVAA 2IXCA 3MYXA 4NN0A 4QX5A 2ZXQA 5A6YA 3TBDA 3IMMA 2VD7A 5IVBA 4LO7A 1OQDA 1I6XA 1COV1 2K9ZA 1BK0A 1FYUA 3JU9A 3PMSA 1O4TA 5KHJA 1OKOA 1ZBE3 1K5MC 4TLGA 4YZ2A 5L9BA 5J3UA 2BZDA 3T1LA 3OF1A 2BUKA 1BZWA 3QD6A 1ND2C 1PNFA 2P2KA 4XBQA 1W90A 5E89A 1JTZX 5JZGA 2NZ9A 1PVC1 1UMZA 1PZ8A 1VAMA 4HONA 4IEWA 5FZKA 1W0NA 4QKDA 3FLTA 2X5IA 1SCRA 4GA9A 4KBZA 1O4ZA 1S1AA 4NRQA 4F8AA 3C3VA 3H42B 1UAIA 1MR5A 1RUD3 4CDXA 1Q8PA 5JIUA 3UETA 4OQ8A 1IHMA 1YFUA 3M3QA 5K0UA 4WM7C 2WO2A 3N7JA 2Z69A 3ME2A 1G86A 2ZPXA 4K6BA 4MO3M 5CKQA 1E5HA 4LHNA 3E5QA 1V6MA 2Y64A 2F6BA 4NWWA 1RINA 4ES8A 4TZDA 3K48A 2OPKA 5CNAA 2VBBA 5FXXA 3BI3A 4A6SA 3S5QA 2PHLA 1W2UA 4JGZA 2XVGA 4E27A 3UKNA 4ZXKA 3E5UA 5H9PA 1VB2A 1J83A 3CF6E 3VBUC 3R4DB 1UU5A 3MLJA 1UKRA 4AHYA 3I2KA 3GZEA 5JR2A 1LJ7A 1PZ7A 2VG9A 3DEMA 3HAGA 4EZ4A 3MIDA 4L2NA 1KS4A 2Q1MA 4E2QA 1ZZ6A 3T2TA 1EAH1 2QUOA 1VBE1 1DDLA 2KA3A 1XNAA 4YW7A 1GWMA 3AMPA 1W6PA 3AKRA 3PUSA 4QD2A 4AEDC 2PHTA 3KT1A 1GV9A 2JICA 4XYXA 4XZUG 3ES1A 5FZLA 3ZPYA 2WFF3 5F39A 4AWDA 4CCMA 5CVRA 5HV4A 4NUBA 3FHQA 2R7EB 5CISA 4BWOA 2RDNA 2VOKA 2ZEZA 4IESA 4FTEA 4FQZA 2VAUA 2J1TA 2XLGA 2XLAA 3KHCA 1EV13 2E6VA 1UZ0A 2D93A 1POQA 5CFDB 1LGCA 2WT0A 1JOBA 4ISQA 2PHRA 1KFUL 4W50A 1NX9A 1PNGA 2W92A 1QJU2 3JQWA 2WC2A 1D0HA 4KG0A 3MZHA 3PU3A 5DAXA 1DYPA 1NA1B 2LROA 1NCRA 3WD5A 2OXBA 4Q8KA 1VB4A 5F5IA 3T2OA 3ZXAC 2XDVA 2W91A 5L7OB 1CZTA 3MDPA 5FY1A 5FLIA 1DQ0A 2CSGA 1C1LA 1KS5A 3ZN5A 1AR81 1WW6A 2JB8A 2R49A 1LHOA 1V6OA 4JTOA 2YV8A 5FYCA 5BNPB 4YVWB 4GULA 4HVOA 4OZOA 1MVQA 1RJ8A 4P08A 4PDWC 1MZFA 2JE7A 2FDHA 1WLDA 2D43A 4HFSA 1JOJA 3PVBB 4QXKA 4AGVA 2GMEA 5ACA3 4BQ1A 5IAXA 1XU1A 5HCAA 1QJX2 2O8OA 4P5YA 1FX5A 2P37A 4QX7A 4RFRB 2DUOA 3B9CA 3KWVA 4EN7B 3RZGA 4FTBA 1PGW2 3UGHA 3C2UA 2UWCA 2AENA 5JUVA 1FPN2 3UK9A 5JDBA 2OZ6A 4V1PA 1YQ2A 1HRI3 3NAPA 2EIEA 3OGVA 4AVSA 4LJHA 3KS7A 1OLQA 5CB7A 2WZR2 3AZXA 2GC3A 1H2NA 2EXKA 3VBRC 3WNOA 4BXFA 2H0BA 4MVTA 4CDWC 4AQTA 5FPXA 3S5AA 2BNMA 3RPQA 3VKMA 1FMD1 1V9U2 3WR0A 4LTAA 2BWAA 1CR7A 2QBXA 1W8HA 3N9LA 3O12A 4IETA 1S0EA 2VOXA 3FMGA 3Q8AA 3SMHA 5JI9A 1J1TA 1F5JA 2R043 3AC0A 3POYA 4IUGA 3M3EA 1KD7A 1W28A 1IGOA 4QHZA 3RYRA 5FUPA 2X8KA 3D0SA 4ARYA 4FTSA 4A7YA 1GZWA 5T5OA 5K7PA 3ZO0B 1C3HA 1R1A3 1REDA 2WZ8A 3RZZA 5C71A 3OGSA 2J22A 4YGCA 4AK3A 1AYM2 2HWD1 1LB2A 2XJSA 4ZHNA 4GMP1 2VCAA 3FHIB 3HN1A 2HYXA 1PK6C 3N9QA 3PHMA 4GH4A 2ZGKA 4URAA 4B3NA 1OC1A 1VBA2 2GC0A 2WWSA 4LBJA 3SITA 2VQ0A 5FTTC 3ZDVA 4A7KA 1F4AA 1W9FA 2VM9A 2VMCA 5K0UC 2RMU2 2PQSA 2JB4A 2HWC1 3AMMA 3WG1A 5LEKA 1D4M3 5HBAA 1SG3A 2D6MA 3HQUA 2YG0A 5FZ9A 1FI2A 3CZJA 5FZFA 1MEC1 2LS6A 1SHWB 2UU8A 1AX1A 5DAPA 2BJSA 3HD8B 4NIHA 3WF2A 3RZLA 1NLQA 2EIDA 1ULGA 2DBIA 4CDWA 1OF3A 1VJ2A 3AX4A 3OPZA 4AHXA 4HOOA 4WZFA 3JB4C 4GB32 1ACCA 2V4VA 1MVEA 2C24A 3L9JT 3QOPA 2XVLA 1IKQA 1D2QA 2G9GA 3WZ1A 4ATFA 4A4AA 1HQWA 3S7IA 5IYYA 4D7YA 1C5HA 4XQ4A 5F3IA 1CAUA 1RUG3 1DGRA 3NNJA 4YW5A 2JG9B 5FPLA 3W21A 5L7OA 3TEZA 1N3OA 4XIKA 4BMBA 4PIXA 4RGKA 3ZIWA 5D8AC 4KU7A 1X82A 1X9TA 2WYSA 2XQRA 4M4RA 3E6DA 2ZMLA 4TSVA 5FJHA 4C1XA 4DS0A 1POV3 2PLV2 3OEAA 4ATEA 4OULA 5LK7B 4FPOB 4AFDA 1H1AA 2FDIA 1RUD2 4Q8LA 5KHGA 1ND2A 3W59A 3TYJA 4KWUA 2A3YA 3WCSA 4P9IA 1UU4A 2R073 4RFT0 4ZS3A 5HPOA 4FPFA 3HBZA 5EHDA 4DEQA 3B00A 1JW6A 3KV9A 5LW9A 2Y6FA 3IDCB 1YI7A 1ZBE1 1YFXA 2JKXA 4Q1PA 4ZU4A 3SCGA 4DPNA 2JKBA 1RUC1 3HQRA 3ZSKA 4IE0A 3PIJA 1OKQA 4FAGA 1TMF3 2IXIA 2QE3A 2VW0A 2VGDA 1U5XA 3DECA 1FOD1 1ULFA 1UXZA 2WS92 2YPJA 4YYOA 4K1YA 4ZZ5A 3H3LA 3MUZ1 5A7WA 4Y33A 3V0BA 4OFGA 4JCKA 1Q3EA 1BCXA 3LQCA 5BNOA 4GALA 3WW4A 3ZYJB 2VZ1A 1EY2A 1TMF1 1G6NA 2GALA 2B9VA 3WP6A 2BVVA 4LQRA 1GUIA 1OD3A 3MO4A 1AJKA 3WUDA 1SLTA 1NOVA 2I74A 2D3RA 3KSCA 3NJZA 2YXSA 4ARXA 4S2FA 5JOXA 4L11A 2VZ3A 1GQGA 2W08A 4XFGA 1PZ9A 3V64A 2J1AA 1RHI1 1RVF2 2CDOA 5IK7A 1MS1A 1ZZCA 2CDPA 2CNAA 3C8XA 4IE6A 1CQ9A 1EUTA 1X9PA 2JIJA 2QQUA 3VL8A 2ZX4A 4K8FA 4IEXA 5FLJA 1GOGA 5FP8A 4N8MA 3SEEA 5B4NA 2GDFA 4MGZE 3W20A 5K9YA 1PGL1 3NWKA 2EF6A 2D44A 2ZMKA 2XHKA 5JAXA 5FO9B 4M4PA 4XDOA 4RN5A 4XHXA 1A34A 4R4ZA 3FBMA 3AYCA 3ACLA 4Z8BA 5HCHA 1OPMA 5FY9A 3VZJA 4QKFA 4RHV3 4RHV1 3WQ7A 1YXWA 4N43C 1F2NA 1UX7A 1PVC2 3WW3A 3AL5A 3SKJE 4CZSA 3VDBA 1JYIA 5ACA1 3SH5A 4XJZA 1WA4A 1CAVB 3N4MA 5C8WA 1FNZA 1YQ5A 2ZGOA 2C0ZA 4AI8A 5F3CA 1YWKA 2QTWB 3URFA 4JC1A 2VBPA 4PF5A 2CGOA 3WNPA 3OG2A 5TSWA 4Q26A 1DQ1A 5FLHA 5IK8A 1NCQC 2VTXJ 3HVDA 3I59A 4BQWA 1Y3TA 2B7YA 4AL9A 1PMIA 1D4M1 1N1SA 1MZ6A 2KR2A 4AI2A 5CFCA 3AJYA 3AVRA 5FO8B 4CPBA 1WMFA 4ONUA 4YZ1A 5F3GA 3HIFA 4PDWB 5FMDA 2GZWA 4E2SA 5F2WA 3POFA 4UW5A 4CP1A 1S2EA 4JDOA 4OI2A 3NJXA 2FCTA 1BXHA 2W1WA 5JXGA 2E31A 1ULPA 3NV1A 3OSDA 3T4VA 1AL22 2ZGPA 1YQ6A 4OUMA 1TQ5A 4YWAA 2BFUL 4LXLA 3CNAA 1VLNA 1RUI1 2ZZJA 3NO8A 2YFUA 3ACHA 3CIHA 3RMXA 2OW4A 4P9XA 4UFJA 1VBD3 2EIBA 4COYA 2P3YA 3V0BB 1KDMA 2DU0A 3J9SA 4BQ2A 1LOAA 3AXDA 4BK5A 4Q4V3 4ORFA 1JBCA 3MIGA 4BCUA 2FCVA 4HN1A 3KM5A 3NRUA 4DUVA 4FOWA 2WNVC 2OIIA 5FPZA 1FMD3 4A2UA 1OVSA 3M70A 4MX3A 3AYEA 2RV9A 4Y4RA 4CEYB 1KFXL 2BNNA 1NLRA 1UYYA 3ES4A 4AFBA 1SBEA 5J7MA 5ABJC 4CP0A 4MZUA 1IQAA 1RUC3 1ND3B 3GZUC 3A4UA 1W06A 5FDBA 2C9KA 3BODA 2XXZA 2EICA 1IOAA 1GQHA 4BQXA 4LITA 3M3CA 2OX0A 3VHOA 2BTVC 4NROA 2VUCA 4DY5A 1JODA 2VNOA 5DZEA 2YC2A 5FPBA 3RYKA 1R1A1 1UZVA 4XAAA 2V09A 5LB6A 5DUXA 4AFMA 2K0GA 2Q8OA 1O3TA 2XKOA 2FDJA 3B3QE 4OYUA 4XABA 4PBPA 1FATA 2ZGTA 5GLZA 2VQAA 3NL1A 3B9IA 4OQ9A 2Y6HA 3TOJA 4K9SA 4KGQA 4DQAA 4MV2A 4N43B 2BGOA 4LBMA 4RQPA 5I0DA 1IG3A 1ND3A 1PO23 3MBWA 4QB1A 4D6QA 5JMCA 4NAMA 1MS4A 4URTA 5A7WB 2ZX0A 3BPSA 4O65A 1X36A 4JHZA 4ZONA 2DVDA 2SLIA 5A80A 4ZPIA 2IXJA 3ZFEB 1V70A 4DUWA 5BV6A 4GMP0 4Z82A 1AR63 2DVAA 4JGZB 1UXXX 1TME2 3VBFC 5L7OC 4IEYA 1OQ1A 1L7RA 2AR6A 2VMFA 3PVNA 4PHZA 4UWDA 4CDXC 3BTYA 3IIAA 4YW3A 1VBC3 3ZX7A 3IIIA 1VALA 2F4PA 5IHRA 2DVBA 1UYPA 3MIBA 4Q4W1 2HWF2 3CJIC 5LRRA 1YUDA 5T55A 2VVFA 3W9AA 4R8HA 4FXKB 5CAZA 2VZRA 1RUOA 1GR3A 1REFA 2Q4SA 2XVKA 4LBQD 4OHYA 3DPRB 3FHAA 4FAHA 4BJ0A 2OZJA 1VBE3 5FY0A 2O0OA 3K4ZA 2W47A 2W52A 5K0UB 1WMDA 5FCCA 4D0QA 5JCTA 4GMP3 4X8PA 1PO13 3ACIA 2YY1A 4Q4V1 4KNCA 2PHFA 1X50A 5FMBA 3ZXLA 5F1RA 5DUWA 4WVMB 4LBOA 5FUNA 4ITCA 1W6MB 3RZJA 1IPKA 2PAMA 3KB5A 4HZFA 4PLMA 1E57A 1SLAA 4MADA 3KD4A 1VRH2 1CAXA 2RHPA 5L9RA 1AL0G 1RUI3 2QQIA 4CEWC 3O1MA 2ZX2A 2WNEA 4ZU7A 1VE0A 1ENQA 1VMJA 5FY5A 2FQPA 4EYUA 4IEZA 3DUIA 1RUH2 3LEGA 4HL0A 4FT8A 1LHNA 4BH9A 5BNOC 1JUHA 4PIYA 1X33A 2IVJA 2R16A 5FMCA 3WNMA 1CD3G 1WZXA 4PQQA 3S30A 3WCRA 3ZYRA 4A41A 1W3VA 1OFSA 1W6OA 5FZDA 2DBNA 1S2KA 4Z2WA 5A3WA 1UF2C 3WQBA 2XJUA 3KV4A 4GIQA 5D2AA 3AK0A 2HEVF 4Z2AA 1AXYA 3KGZA 2B5HA 1W03A 2DURA 1XC6A 4W65A 2F4LA 2VXRA 2YGMA 3O7OA 4YG6A 2GP3A 1MS9A 5FOJB 3S6PA 1WBFA 3MPBA 3ZDSA 1C8M3 2FMYA 5IVCA 4JGYA 4RS5A 4CCLA 3ZXKA 2RM21 1COV3 1F9KA 3W58A 4IEOA 5J37A 3IWZA 1WMXA 2NMNA 2Y33A 3ENRA 3LSDA 4R9DA 4RR3B 4XBLA 1LECA 2VZUA 5KXBA 3I2DA 3GCXA 3IBMA 1W9WA 2Z42A 4CCOA 4AAPA 4DZGA 2ZABA 4HPKB 3RWNA 3ZFFA 2FDFA 5C3RA 2D6KA 1W2TA 4GJYA 5FP4A 4O9GA 3WNKA 2BRTA 1DCSA 2WKKA 1RB8G 4FVVA 2OQ7A 2E51A 2XUEA 1ULCA 4DFSA 4IV3B 3LA3A 1LOEA 4MUVA 3DGTA 2VL4A 2BDRA 3N7LA 3ATGA 1HQNA 5ERLA 4NMIA 1CX4A 4JTNA 4CCEA 1KITA 1MPXA 3IDEA 3AP6A 2V4AA 2RS12 3K77A 5LEJA 3RGBA 3DPRC 2WIIB 1ASJ3 1N1TA 4IE7A 1W6NA 1FOD2 4YSFA 5FIXA 1IS4A 1YC61 2D6LX 2WFF1 5CG9A 4E8CA 4LBQB 4F83A 4AHZA 1XYPA 1W05A 4JV4A 1I5ZA 3TEYA 5FPUA 5I0UA 5BPXA 5FWJA 1FXZA 4LBQA 4LO8A 1LTEA 3T2QA 1DLLA 5FZ1A 3NV4A 4QAWA 4EN9B 3BIEA 1Q43A 2P3IA 2XWBB 1SACA 2XJPA 2HWC3 3P5BA 3AVSA 1QEXA 4HN0A 3OD4A 3P6BA 4KU8A 2VH9A 3I2FA 3THTA 2YGLA 1JZ8A 2J42A 1W6PB 3OCPA 1AYN3 1VBD1 1CIYA 3HT1A 1W99A 1RIRA 2AACA 3MV11 4MHRA 2RR13 3WEZA 3SNMA 2B45X 4LHSA 2A73B 4P9JA 3WG2A 3LIHA 4AYUA 2BW8A 4IEUA 2CAVA 3B02A 3U78A 4WVVA 2WNVA 4Q0VA 2JDYA 1G9AA 2B8MA 1J3PA 3JBG2 3MEPA 3T08A 1H0BA 3VBSA 3ZXGA 1NY71 5A3NA 2R041 4QQLA 3VKFC 4EZHA 2HWB1 2OUJA 3WNXA 2JDNA 1W0PA 2FHRA 3LF7A 3MIEA 4DY3A 1QIQA 1Y9QA 4ZZ8A 1S0DA 1E5SA 3OUJA 2ZS6B 2Z4FA 3OGGA 1N1VA 3LPGA 4QXBA 4AZZA 4D8MA 3H8XA 1GOFA 1W6OB 1JMUB 2RS53 4XFBA 4ZY9A 3U4SA 4CEYA 2HWE2 3UKTA 4Z92B 3BN6A 3V0AB 1MZEA 2Z5WA 4AXOA 4CEWA 4DB5A 1LKNA 3NJVA 3VKOA 1LR5A 4Y22A 4C0BA 5LCWL 1DGRN 4GWJA 3VUOA 4COWA 5KHHA 4FFFA 1L7LA 3WSOA 5F37A 1G9FA 1LGBA 1ZNPA 4Y1UA 4IXLA 5FXWA 4XURA 5DG2A 3NKGA 3IB3A 4XXPA 2VZPA 3LIGA 3ZM8A 2XHNA 1QJEA 4N53A 1S2BA 4EN0A 3DF0A 2JD9A 2ZX1A 2XUMA 3TRSB 3U07A 2VUJA 1SBFA 3HR9A 3ZIXA 1FOD3 4YZ5A 4NJ4A 3THCA 1Q8QA 4Q4W3 3FUOA 3POGA 2LW8A 4IW3A 2B9UA 3ELNA 4QQHA 1CZVA 1LOGA 3WP5A 1XNBA 1RHI3 2R1BA 4TLFA 4Y1YA 3SEPA 4YPJA 1A3KA 1SCSA 2WT1A 2A71A 5A3MA 4IGOA 2YB7A 4E8DA 3AP7A 1HXS2 3BIWE 3NQHA 2XH6A 4CU8A 5BNOB 3VBOC 3I49A 3OYWB 1S0GA 3ZN6B 3TN92 4MGYE 1QJY2 2WLPA 4XUTA 5A7OA 5CEHA 3AZVA 3ASIA 2XR4A 4EN6B 4CCKA 3KCYA 3BOPA 3IAPA 4Y1ZA 4WZCA 5JOYA 2QKDA 1RUE2 2BV4A 2VMEA 1LCLA 4AEMA 5GLUA 1KJLA 4CXWA 5BNNB 3BPZA 4CDQC 1RMU3 4UW6A 4W4ZA 1ZREA 3OPWA 1OLRA 5A7NA 4M3CE 3AMNA 1COV2 1EAH3 1SLLA 1B35A 2ET7A 3FC0A 2D98A 3GZAA 2XONA 4C1WA 5HI0A 3MFAA 1NZCA 3ZFGB 3HPNA 3D82A 3LWCA 5F5CA 1ZA7A 5FZ3A 5F6KA 4COVA 3R0RA 4FPKA 1OF4A 4X6QB 1SFNA 2BWCA 1HRI1 2ZAAA 3TEWA 3D5OA 3HOBA 3ZYBA 4CEWB 3MI8A 2WNVB 3K75B 4AQSA 1QQP2 2E63A 1JYWA 2QQKA 4B29A 3VDAA 4NRPA 1GWLA 1LENA 4AEDA 1NYWA 1RMU2 3SCHA 4AI0A 4NIGA 1NQDA 3H0OA 3H9AA 3POEA 2QCSB 4OVEA 4A3ZA 4AF9A 4AQ2A 1QJFA 3DCQA 3DYPA 3B93A 1H8VA 1YJLA 5M0TA 1EUUA 1UZYA 1WCUA 2XBO2 4PLNA 4DOUA 2CYFA 3NJYA 2NLRA 1AR92 4JZRA 1PM7A 1B35B 2SBAA 1UIJA 4IEQA 2CWSA 4O9EA 3CHXA 1G8WA 3OB8A 3TN93 4YW1A 2VO5A 3PJQA 4N7UA 5BNNA 4IERA 4XACA 4NIDA 1GFF2 3AYDA 1UZZA 2QQLA 1VIWB 1JU4A 3MICA 2EXHA 1KJRA 4R9CA 4OI4A 5FY8A 5CG8A 5C4WC 4JX0A 3VBHA 3MLKA 2WQ4A 1UW8A 4LBNA 1NCRC 1PO12 2VW2A 4BQYA 3ALQA 1AR72 4RR3C 3THDA 1MQTB 2ZGNA 5IVJA 1BBT1 1XE0A 4FI9A 1Y9GA 2DVFA 1VBE2 2H0VA 3OYWA 1EV11 1S55A 3N9OA 2UYBA 5DG1A 3DKQA 4JRAA 1SPPB 2R1DA 3MV01 1CPMA 1MEC3 1QJZA 4P5HA 4PLOA 2WA3A 1G9BA 3M2MA 3ZYHA 4TXWA 3WW2A 4QPGB 3MFCA 3T4HB 1SEFA 2TNFA 2PXJA 4OHZA 2VPVA 5BY5A 1V00A 3WP3A 2WNOA 1ZZ8A 4HSLA 5FJKA 1V6KA 4CXYA 1R083 4WVZA 2AUYA 3K51A 3Q8EA 5KR7A 2VC9A 2PAKA 3JUUA 1ZBA1 4RGAA 5G05L 1GNYA 2JD4A 4XFCA 1OURA 3T3YA 3JD72 1ZZBA 1WW5A 4I0BA 1AX0A 1UPIA 4K7JA 4E4ZA 5J36A 3OOXA 4JKLA 5DUVA 2JDMA 4MGIE 3RZKA 3ZXFA 4CP2A 5A6QA 1F5FA 1PMJX 4NPRA 2JIGA 3A23A 3GGLA 3LEKA 2W3JA 5IFPA 1AJOA 3J7HA 5IK4A 1GZWB 2WR9A 5LRSA 4UBHA 1Z7S2 3VD9A 1N47A 4WM8C 1O6UA 5JLVA 1CAVA 5LY2A 5IJRA 2J1EA 2GAUA 3O1TA 3EYPA 3WINE 4CUGA 2XJRA 3U75A 3SLIA 3GBFA 3I3QA 5JIAA 2VVDA 5LWBA 2VXJA 4YARA 1QJX1 5FZHA 3T0DA 2XB6C 4OHXA 1UNBA 3R4UA 4G9SB 4XDQA 3INAA 2PN5A 4CP9A 3IT8A 3NSTA 1OD5A 5DQ0A 4YG0A 2D7FA 2E9QA 4AI1A 2HJIA 1QWRA 4DRVA 4IDZA 2D97A 2XMLA 2VZQA 3N9MA 5EZWA 5IT6A 1WCKA 1LOFA 3BCWA 3ST7A 4MOAA 3VZKA 1XSRA 1LRHA 2YHJA 1JHJA 1UO9A 2VMDA 4NHMA 1GNZA 1D0GA 2GSYA 2YPDA 5C8CC 4BPZA 2ADDA 1BQPA 2RS33 3E97A 4MGSA 5I0SA 4Y5Z0 3ITQA 1M4WA 1FMD2 4Y24A 1BMV1 4L8QA 2AYHA 4GJZA 3K3NA 4UF0B 5H9QA 4AEKA 1XNDA 3ABZA 1AR83 4OLLA 5FZ4A 1CWPA 2JDUA 3C7HA 2XJQA 3GBWA 2A6VA 4BYYA 3J8F2 1LU2A 5AC93 5IVFA 2ARAA 2WAAA 3ZKYA 4QB2A 1BVVA 2VNRA 2J7MA 4YW4A 1YHFA 4QPGA 1YFYA 1V6LA 5A3LA 1JOPA 5C3SA 1QJY3 3AMHA 1ZRCA 4Q4X1 3ON7A 3AJZA 3PU8A 4YM3A 4XUOA 4XQWA 5T3NA 3WF1A 3NV3A 1LEMA 1DQ4A 3CKHA 4DXTA 5JZGC 1K42A 1PIV2 3TNQA 2P3JA 1OHFA 2P17A 4ZS2A 5FZ7A 1OA2A 4NOTA 5A1FA 2JX9A 5J09A 3ZKUA 4AQ6A 1U5YA 1N3QA 2AEYA 2R0HA 1D4VB 2HEYF 2W94A 2PAEA 3ZYFA 3A0KA 4HBNA 4QDQA 1EYBA 4LKSA 1REEA 3VDDA 4AR2A 5LA1A 4FOVA 4DINB 3NNFA 4UFHA 2Y60A 2E7AA 1GANA 4WM7A 3EHKA 2CV6A 4DXRA 5A7SA 3EMRA 5C70A 1LEDA 4H3WA 2BBVA 4GB31 2R063 4QT6A 3BUCA 3BVCA 2DYCA 1NA1C 4JGZC 3VDDC 4Y1XA 3LDRA 5EJZB 1IG0A 4NVPA 4OHWA 1DFQA 1C8M1 2XKPA 3AKPA 1GLHA 4AI3A 5E8AA 1VAKA 4MHUA 2DV9A 2YC4A 2YBKA 2UWBA 2RG4A 4MSVA 1CIWA 4YFWA 4LBKA 5LK5A 1WUVA 1YO8A 4KBBA 1VBB2 5BNNC 4U2AA 2NMOA 1PHMA 2E32A 2ZACA 3GXUA 4XMAA 5FZMA 3MHZA 2C9AA 1NZIA 2K2SA 1UZWA 1R093 1QXJA 2JECA 5APAA 1SFPA 1H1IA 2XOMA 2EALA 2QQWA 3QH7A 2X53S 2HWE1 3JBG3 2BFUS 5C8CB 4UXAA 1LHWA 2L9LA 1VR3A 1UYZA 2VZTA 1F31A 3ZVXA 1FV3A 4OUSA 2V5YA 2ORZA 3O1SA 3WOGA 5JOZA 5DABA 4LIUA 1UD1A 4HG6B 2LRPA 2W2IA 3RI8A 3OUIA 5FZ0A 3ZN6A 4FO9A 2WS91 4AFCA 3WF0A 1GU3A 1AHSA 3M3IA 1MS5A 3LOIA 1XYOA 3GZTB 1X7NA 2BNOA 1JZ2A 3LFIA 3PTRB 1UIKA 2ET1A 1CZSA 1PX4A 5EJ1B 1XNTA 1UY2A 1IPJA 1HB2A 2D3SA 4J25A 1BEV2 1MEC2 1UMIA 4CVUA 2IXLA 3EO6A 1HN0A 2N7GA 3J8F3 4I0AA 2K46A 4GWMA 4JQTA 4COUA 3K4AA 3Q8BA 5BNPC 4MYEA 1BYHA 1HRV1 1UYXA 2RJ2A 4IV1C 4K21A 4S2GA 1GQPA 3B94A 2A75A 3DPRA 1ODMA 1ASJ2 3ECQA 4AE2A 3MUY1 4LHLA 2MEV2 2UYAA 3GJBA 2RS32 1WLWA 4I0WB 4OHVA 1VBC1 1YIPA 4P9GA 5LA2A 4IEPA 1ZRFA 3F2ZA 4FFHA 3CJXA 1MZ5A 2JDZA 2G9FA 2LTNA 1B09A 1X8MA 5T5JA 5F6LB 4BDVB 4AHWA 4FCAA 4LORA 3NNMA 4BB3A 1JZ7A 1JYVA 3LZZA 5LASA 1RXFA 2OA2A 2R071 4I01A 1JXNA 1MQTA 3VZMA 1H2MA 3AP4A 3N9PA 4AEJA 1UQXA 3K46A 4XBNA 3KCCA 2VQTA 1VMHA 4OUEA 4QPGC 2DTWA 3AZWA 1W2NA 2TUNA 3I3DA 1RUF1 3F95A 1V6NA 3JB8A 1RUD1 5BUVA 3VV1A 2GNMA 3D0JA 4GWNA 4RL7A 5FYBA 3KV5A 3RG0A 3H3ZA 3QCWA 5FZ8A 2CU5A 2IXKA 3KF5A 4U36A 3MW3A 3Q8CA 4Q27A 2VE1A 3ZN4A 1U0AA 3AZYA 3FLPA 5C8CA 1QQP1 4N9HA 3T09A 4O7XA 1GNHA 4GAZA 1RUC2 4LHKA 2JG8C 3JD73 4CCDA 1JZ6A 1FT9A 1W9SA 4I30A 1TE1B 5SV8A 1OH3A 2UURA 2EVXA 2P3KA 1APNA 1N3PA 4QPWA 4R4XA 4SLIA 2MEV3 2BPA2 1GSLA 1OMIA 1R082 3O0VA 4W6XA 5GZDA 1T2XA 5JI7A 2VVEA 4CU7A 4XPVA 3WDVA 4E2GA 3TWIA 4NAOA 1S0FA 4XXAA 1CN1A 4LE3A 3VGIA 1DBNA 1NA1A 1W39A 3AXEA 4B8EA 1QF3A 1U12A 5FRAA 2ZGSA 2ZJCA 3B7MA 3PVOA 3PUHA 3LPFA 4XUNA 1LOFC 2BEOA 1RXGA 3KQ4B 4JHTA 4I09A 3U1XA 4A3XA 1OVPA 4QPYA 3C7OA 4KGGA 3VBFB 3NW4A 2A6XA 4L9BA 1HXS3 4INDA 3PURA 1Z78A 3IDAA 4UOJA 5FBJA 1JYCA 3VD4A 2XPJA 3N36A 2BYVE 1RHI2 4CCCA 5DAQA 3U10A 5A3OA 4ZXEA 5C9AC 5ANQA 3ZR5A 5FYZA 2ZZQA 3BB6A 1V9U3 1K3IA 2VU9A 5J48A 5IVEA 1H1MA 2Q30A 2VCCA 4KMQA 4YFZA 3ZMOA 3KQRA 1R092 2WZEA 2VUDA 3H1MA 4LA3A 5E1RA 2V73A 4YZ3A 1WD3A 2R30A 3USSA 3GHMA 2XBO3 2QNKA 1VBB3 2TBVA 2O8QA 3D4KA 1JH5A 3ACGA 1H6YA 3MF6A 3O1VA 1CGPA 1PVC3 3QBQA 4K20A 3ORJA 3HWJA 1WW7A 4LO5B 2OKXA 3ZLIA 4CSWA 5EIYB 5KHIA 1QXPA 3U4XA 1QQP3 3ETPA 3I3EA 2GN7A 1HQLA 2BBAA 1DIWA 1C1FA 1PK6B 1NXMA 2V72A 3POIA 2WZPP 3THPA 5C3PA 3POBA 1TG7A 1GYKA 3I2OA 2A6YA 1Z7S1 2R062 3LD8A 3AB0A 1O3RA 1W6MA 4Q0QA 2JE9A 3QLQA 4CA9A 3M8LA 2HBTA 1JI6A 2A6ZA 1PMHX 2WWUA 3BOWA 2Y8KA 3CU7A 5JSPA 1IS6A 2VR4A 5FV3A 2GC2A 4PQ9A 2ZCWA 3UNPA 3RS6A 3HNMA 4S2DA 1KRIA 2PLV1 3LB9A 2VOTA 4YM2A 3UGGA 2E33A 2YROA 4UFLA 5KHKA 5FWEA 3CO2A 3AKTA 3USUB 4WVWA 2J1RA 4QDRA 3BU0A 4D69A 1PIV3 1JU3A 2R32A 3AP9A 3P3PA 4QGNA 3ZXDA 4C0HA 4Q4Y3 5EQUA 1DGLA 5BNPA 1XJAA 1POV0 2JDPA 2P5BA 1OUSA 4B4RA 5HXVA 1IQDC 3LSEA 4QU2A 1F4HA 1Q8VA 1Z0HA 3WT3A 2GC1A 3RQ0A 1HX6A 4L97A 4L99A 5FOBB 1ODNA 1PX3A 3U0ZA 1H4HA 2W1UA 3SH4A 2PHXA 1YI9A 3KGLA 1OBNA 2RJKA 4NWVA 4Q4V2 1DQ6A 3UJOA 2F17A 3L2HA 4EN8B 1QH6A 1UKGA 3O14A 4EQVA 4KWLA 2B46X 2CWMA 1ZRRA 3KVAA 4XETA 4PI0A 4D7TA 1LAJA 1OA4A 3WDUA 3ZSLA 4ZKTB 1AXZA 2NM1A 2D5HA 1URXA 1US3A 2VTXA 2P6HA 2D3PA 3AKQA 1PIV1 2OYZA 4FPLA 5EXOA 3VHNA 3VHRA 5C7GA 2O1QA 4RQPB 3J26N 4YVWA 4LKFA 2OT7A 1K45A 4Q4Y2 4Q0PA 5H9SA 5A7QA 1ZVFA 3DV8A 2DUQA 5FZAA 2ES3A 4BIOA 4DNYA 1E5RA 2HWE3 5DAWA 1RJ7A 1UOFA 2Y26A 4GH4C 4NO4A 1CONA 2PTMA 4JGYB 1POV1 4IGQA 2A7AA 4QMAA 4B7EA 4UW4A 1US2A 4NE9A 3FE5A 1YJKA 5E6HA 4MG2A 1MS3A 4HVQA 3IPVA 1UL9A 2JE8A 1RUG1 3P1IA 5D21A 1QHDA 4LLOA 3VKLA 3ZXEA 5I8TA 4HPKA 2VJXA 3ZFFB 5JXJA 4XFFA 4I2OA 2HKXA 3T0AA 1Y9MA 4J6GA 5FR3A 1OA3A 4K3UA 1L7QA 1NCRB 3WLUA 4DXZA 1H2KA 2JG9A 1PM4A 2C26A 4LO4B 3VBFA 3VBSC 3KHBA 1HDKA 1C4RA 2GNDA 4CCNA 5A3TA 3APBA 4WM8B 2RR12 2AH2A 5CIRA 2EXJA 2WO7A 1AYN2 1VBB1 2WABA 1YIFA 3D3AA
chains in the Genus database with same CATH topology
1GZ9A 5FMOL 5KXEA 3H8UA 2ZHNA 1DZTA 1H4GA 1BVP1 2EAAA 2ZGMA 1S0IA 2WA4A 3GNEA 3WW1A 1V6IA 2YMZA 3ZXJA 5BXXA 1RUH3 1W6NB 3OY8A 5I0TA 5F9TA 1S0JA 3PMEA 2PFWA 4B7KA 3E6BA 2JEMA 2RE9A 2VW1A 4SBVA 4HK8A 4COZA 2ZAHA 1SLIA 4Q29A 2NP0A 1VRH1 2QDNA 3LOBA 1DU3D 2PELA 1ULEA 3AMQA 3DL3A 2IWGB 3R6SA 1SLBA 4XEZA 3AFGA 1GBGA 3N3HA 4N53C 4AGRA 4GKYA 1K5MB 2W39A 4FPGA 4D3WA 4QGLA 2WZR3 4ES9A 2EIGA 1XE7A 1EP0A 4I02A 2JENA 4D7SA 3ZSJA 1O3QA 2HWF3 4AFAA 3MIHA 2ZTNA 3LGRA 4G4FA 2GH2A 4MXWB 3LA2A 2XGXA 2WSVA 3PVEA 1TME3 3DN7A 2RM22 1XYNA 2XLFA 1LOCA 4HT1T 4LE4A 5CADA 2R072 5C33A 3O0XA 2ARXA 3J4UH 1LU1A 1R1ZA 2DCYA 3IDBB 4QPIA 5GZFA 2VECA 3ZYIB 4XFAA 5T52A 1TNRA 3PTYA 4QQ2A 2XL7A 4JVAA 1OOPB 4ISRA 1DGWA 1F8VA 4K40A 3DKWA 1OI6A 3RMYA 5JVVA 4KH9A 3AKSA 1AVBA 1DF0A 2GNTA 3H7YA 1Z7S3 1Q8SA 5EWSA 4HKLA 1AYM1 2HWD2 3RRDA 5C6CA 2RS11 4FOQA 2TEPA 3B69A 1VBA1 2DUPA 2GN3A 1R081 2GNBA 3PLQA 4N43A 2WFF2 4FOYA 3GYDA 2AZ5A 4H14A 2VUAA 2QZ3A 1QXRA 3FWEA 2ETEA 4Q4W2 3V65A 1I9RA 2WNUC 3OD0A 4XJUA 2R0FA 3VBRB 4M0NA 1AZDA 3Q9OA 2PHWA 4XJAA 2FZ1A 4F7ZA 1FAYA 4CYDA 4FPYA 1BEV3 1VBD2 2WJSA 4LA2A 1HIXA 3KT4A 4Q1RA 1I3HA 3VDDB 4I3GA 1UCXA 5FQ0B 2WFPA 4RS5C 1J1LA 5FQ0A 4H7MA 1EPWA 2HYKA 4CTEA 1HV1A 1AR73 3MF9A 4LT5A 3O0WA 1LHUA 1QJU1 2JXAA 2R042 2DFBA 2HWB2 5CFCC 3VBRA 1O4YA 1ZYBA 1R091 1ALYA 3FUQA 5CBLA 3FBYA 4CRQA 5GZEA 5DDJ1 1JN2P 4WM7B 3H7JA 3RDIA 2FMDA 1UX6A 4I3PA 3UJQA 3CL1A 3T1MA 1ZBE2 2Y0OA 1NQJA 1FPN3 1U5ZA 4AVVA 1CAUB 4P9WA 2BQPA 3AM2A 1H8TC 4M0HA 3E6CC 1YYNA 4JDNA 1QMJA 3RNSA 2UWAA 5FFOC 1NCQB 1TEIA 1DZRA 1WW4A 2VOVA 4FXGB 2UY9A 1YLLA 2NYYA 4YGDA 1EAH2 4OZXA 5JZGB 3SHRA 4MXVA 1RVF3 5BYNA 4XF0A 3ZYGA 4EJRA 1RUE3 1QJU3 4KWJA 2RS13 5E88A 2B42B 3B5LB 2QJVA 1W0OA 1HLCA 1DZQA 1QDCA 2RJLA 1SFYA 3UKVA 1AL23 1PK6A 3HQXA 1S0CA 4D94A 4BMEA 4CDUA 1RUE1 4RD7A 4K1ZA 4RQPC 2A3XA 2ERFA 2Q0AA 4YLZA 4HMZA 2QFEA 2B39A 5AC92 3B01A 3A0NA 1B35C 1AR82 4WBBA 1NE6A 3V56A 4F3JA 4L92A 4PIZA 3AZZA 3WQ0A 4BHPA 3JD71 3GHNA 5H9RA 5EYXA 2AGSA 4MH0E 2DU1A 1QOOA 2XJTA 1GZCA 1O3SA 1DQ5A 5FAXA 5JOWA 4H55A 2XBO1 2PLV3 4S2HA 2A70A 1QOSA 5JSRA 3JBG1 1T6GC 2YC0A 1ND2B 4J1WA 2A6WA 4YVSB 2RS52 3KT7A 2WZR1 4CDQA 1JUIA 1HKDA 2Q5TA 2ZHKA 1RUG2 3NV2A 4XF1A 5I0RA 1XNKA 3D8CA 2D6NA 2I45A 1D2SA 1DHKB 3N35A 5K8SA 1SMVA 4AVAA 5A33B 1AL21 5GLTA 2LUWA 5C4WA 3WDYA 3ILNA 3JZVA 5E16A 1Q56A 3VBHC 2D5FA 1BBT2 4XW3A 3ZSEA 5L19A 1WGPA 5CFDC 1A78A 1KXGA 3R05A 2OUHA 4Z1VA 4FPJA 4IV3A 4XTMA 1WCDJ 1FV2A 3J8F1 4N7IA 3FX3A 3MIFA 2RMU1 2RMU3 2HWC2 5A33A 2PYTA 4RS5B 1ENSA 1H30A 4Y26A 2WINB 4C91A 1NE4A 1MS0A 1J58A 1MACA 4ASMB 1YRZA 1ZX5A 4XILA 2NN8A 5I8YA 1TMF2 3WUCA 5SV5A 1ZBA2 4AVTA 3V0BA 1R1A2 2W0XA 4YRDA 4TYSA 4A7ZA 5EYYA 4IQPA 3CLPA 1WD4A 5A32A 1GICA 4YZ4A 4XFHA 1A8DA 3ZFGA 3L2YA 2VMGA 1AXKA 4CDXB 3M7AA 1HXS1 5DXDA 3VUOA 4BA6A 1OQEA 1LESA 1OFNA 3R4SA 5DDJ3 1RUJ1 3CJIB 1KDKA 3D6EA 4QPIB 1NCQA 1SQ4A 5DUUA 4AGGA 4E4DX 1AX2A 1PO22 1YCIA 5GLVA 3AP5A 3AYAA 5D8AB 1XRUA 1SBDA 3ILFA 5BNQA 1WMEA 2XG3A 4FQ4A 4M3CA 4P9YA 1AR93 4XF9A 3CEWA 5FREA 1J59A 2XL9A 2G4IA 5ABJA 4XJ9A 3RYPA 4N53B 5IK5A 1UPSA 5T54A 2MPFA 4LEJA 2GH8A 2GU9A 5AVAA 5ABJB 2CGPA 4QQPA 4GH4B 4QGMA 4YVSC 3RSJA 1KQRA 1LHVA 1XXNA 1L3JA 5JAXA 3S7EA 1QH7A 4FPEA 2EA7A 5CFCB 3N7MA 2LM3A 3EQEA 4RA0A 1HRV3 5KBFA 3GBGA 3GF6A 4IV1A 1K5MA 1I1EA 1DG6A 2VY0A 1OSGA 3WQ1A 2WT2A 1G9DA 3N7KA 1ZZ7A 5B2GB 1D4M2 3WG3A 4Q4X2 5D8AA 1C8NA 2X5IC 4XZPA 4N90A 1BKZA 5C9AB 2JG8A 2GMPA 1GKBA 3EJKA 1NLSA 4XOGA 3QACA 3OJBA 5JPNB 4CEYC 1AYM3 2YYOA 3MPPG 1Y43B 3ZSMA 4FSJA 1WBLA 2YUEA 4Q4X3 4EV0A 4DMIA 1OPOA 1RUI2 4IL7A 4KG8A 5A32B 5GALA 2IC1A 1LGNA 3EBRA 4QM9A 1BEV1 2NQYA 3IM0A 1RVF1 4N9IA 3BU7A 1DQ2A 1HRV2 2IXHA 4AEDB 3ETQA 2VOWA 4M3CF 1ENXA 4CDQB 2ZGLA 4LUKA 1VP6A 4LULA 5DZGA 5CFDA 3VBSB 4PCRA 5C9AA 2BVBA 1CAWB 1O5UA 2ATFA 4CDUC 3IPVB 3JCIA 1ZA4A 4RHV2 2Z79A 1QJX3 4LBLA 3KCXA 5ACA2 1QOTA 1AR62 4NHKA 5JWPA 4KWKA 3FFQA 3OTFA 3IKWA 3M3OA 1RUF2 3H1WA 4ZU5A 3VBUB 2UY8A 3MW4A 1U5IA 3POSA 5T5PA 4AG4A 3GALA 3TAYA 1XU2A 4MLOA 3VBUA 1CVNA 5J96B 5I91A 4J1XA 4TWTA 1DGWX 1PVXA 5DDJ2 3VKNA 5AFEA 4Q0UA 2IFWA 4R9BA 5D1IA 2C5DA 1RUJ3 4Q2FA 1W6QA 4GKXA 3LAGA 1CAWA 1QKQA 1ZBA3 2JG8B 3LKJA 3G6JB 4BLIA 4HVRA 2WQZC 1YNAA 3I8TA 3LA7A 1CPNA 2A5ZA 4P14A 4PDWA 2Q8OA 3E5XA 4UBGA 2W68A 4YG3A 2XWJB 2MNGA 2DCJA 4CDUB 2HWF1 2FBEA 4W6WA 4LLFA 3WP4A 1EPZA 3UL2A 3VZLA 1BMV2 4BLJA 2LALA 3JQXA 4FPHA 3G7DA 1LODA 1HW5A 5T50A 4JDMA 4M01A 4JAAA 3RJRA 3RJ2X 1SDWA 2WS93 2MEV1 1LOBA 4LO6B 4Y20B 2RS31 5EV7A 3IMNA 1BK1A 4AVBA 3ROUA 1N1YA 4MXWA 3WG4A 1IS3A 2VMIA 5GZCA 2WNUA 3MW2A 3OY8B 1RL3A 2IFRA 3PNAA 4HKOA 2ZOEB 2DVGA 2WNUB 1NY72 3SXWA 5GM0A 4AW7A 1Y7BA 2DCZA 4HK9A 4NHLA 1BJQA 3I59B 4BIFA 3LCPA 1RC6A 2Y38A 3ZFFC 4Y22B 4WVMA 3WDXA 3KZ4C 1RUF3 1CESA 4IEVA 2ZGQA 5AC91 4MGKE 4XMIA 3V0AA 2D40A 2JJ6A 2I2SA 5FBZA 4FP2A 4GQ7A 4HETA 4R9AA 1H2LA 5JPMB 3HT2A 1VAVA 2MHFA 3WDWA 5J98B 1MS8A 1QDOA 1UN1A 2OVUA 3WHUA 1IS5A 1W6QB 4HKWA 5HCBA 1G9CA 3WDTA 2DWRA 2R061 4B4QA 5KXDA 1TME1 5FMOS 1C8M2 1ULDA 5JR7B 5I93A 2ENRA 4META 3VBHB 2RS51 1AUYA 1J3RA 4RGGA 3CJIA 3EXUA 2VMHA 1H8TA 2C1FA 3RI9A 3VZNA 1C57A 2E7QA 1ZZ9A 2Y0IA 1H8TB 4HSJA 4B4PA 4JQRA 1XQNA 3KLSA 1VBA3 4FPCA 1RTVA 3BALA 4XJWA 3KMHA 3FJSA 4BE3A 1H9WA 1HV0A 2ILMA 1DYKA 1IZ3A 2ZGRA 4R52A 2ZKLA 4PBOA 4XQDA 3TNPB 5AFBA 3I4IA 4X8NA 1VRH3 4FP3A 3ZYPA 4WM8A 1S0BA 4DRRA 4EWDA 3FZ3A 4YM1A 3FLRA 1M06G 1RUH1 2QQPA 2D6OX 5FO7B 5KXCA 4HLTA 1Q8OA 4KL1A 5I8SA 2AREA 1OOPA 3MGUA 4ASLA 4FBFA 2ZA9A 4QQOA 3ZMNA 4CDWB 3POWA 2YZ4A 3P3NA 3I7DA 4LNVA 2ZMNA 4Q0SA 2DTYA 2IZWA 1ASJ1 4E4SA 5C4WB 2CL2A 4EWEA 2FZ2A 4XE9A 1VBC2 1WLCA 2HEWF 4XIOA 1PGW1 1FPN1 1CJPA 1OOPC 1RUJ2 3OGJA 3PJYA 1RITA 3NKTA 4Y1VA 1QNYA 4EROA 1WCSA 2PHDA 2D6PA 1PO21 2ARBA 3M4FA 1AR91 2VULA 4E9KA 4YGEA 1NG0A 3VL9A 5CA6A 2A3WA 2QZ2A 4WV8A 2HWB3 2GMMA 2E7TA 1V9U1 3WV6A 4HANA 4YW2A 2ZGUA 4XHBA 3TB0A 3VLBB 4YNIA 5KC6A 5HCFA 3FFZA 4M00A 4Y20A 4BZ4A 1AR71 3HMYA 1O91A 1FNYA 1V6JA 1O7FA 1UU6A 4XF3A 4BM8A 5KWRA 1AYN1 2X5IB 3NAPB 2DFCA 4YM0A 1QU0A 4OI1A 1ONAA 1Q5OA 3BTAA 3USUA 2ZKNA 2PA7A 4GB33 3OBRA 1TNFA 3QH6A 5T5LA 3VBOB 1YFWA 2Z2SB 3OBTA 3UV9A 4EWAA 2WLQA 2H6CA 3MLLA 3H50A 1RUNA 5GKAC 1G7YA 4M3CB 1C28A 1C5IA 1BBT3 1IKPA 5AVPA 3WVJA 3WXPA 1AF9A 5IUQA 1A8MA 2HWD3 2WSUA 4XFIA 3ILRA 3U11A 4Q4Y1 2ZX3A 3TN91 3WX5A 2PHUA 1QJY1 4Z07A 5L73A 4LUMA 3X29B 2DF7A 3H3UA 5EJ3A 3NAPC 4LR4A 4H7LA 2ZHMA 3ZFEA 4JRLA 3VN4A 5GLWA 1LULA 4XF4A 2CY6A 3M1HA 3WHTA 2NPIA 2DCKA 2QVSB 3S0MA 5F5QA 1ENRA 1QGLA 5L36A 2WL1A 4IV3C 1QNWA 2RM23 4W6YA 1NXD1 5JSOA 1J3QA 3VHPA 4KQ7A 2E53A 3SH3A 4AVCA 2JG9C 4UW3A 4BOWA 2X29A 5BNPC 3NVCA 4P9LA 1CJDA 1RGSA 1WLTA 2ZHLA 3I54A 2RR11 4QPIC 4Y4YA 1HRI2 4NR1A 2I07B 4YVWC 3SH4A 2BGCA 2QDRA 1XNCA 2CTVA 1AR61 4XJ8A 1A6CA 2EAKA 1ZRDA 2ZBJA 2XJVA 2YDEA 2CAUA 2P34A 1RMU1 2VNGA 4PJYA 1QY4A 1XE8A 2KM2A 4XTPA 1MQTC 2R6QA 1H9PA 3ZFGC 4YVSA 1O5LA 3AFKA 1JHNA 2H6BA 3SCFA 4YGBA 3SISA 2PQQA 4X6RB 3WY6A 4C90A 2Q1ZB 3ZFEC 1ZM1A 4RSUA 5DZFA 4GXLA 2CGNA 4QM8A 5KC5A 4RR3A 1ND3C 1PO11 5GJ6A 1PGSA 3H1YA 4JGYC 1EV12 2DCTA 2KXLA 3VBOA 4OI0A 3O5SA 3IN9A 5CU1A 1SLCA 2EXIA 5EFUA 5GZGA 4G3YC 4IV1B 4QHBA 1CAXB 1PGL2 1X8EA 2IXCA 3MYXA 4NN0A 4QX5A 3TBDA 4LO7A 1OQDA 1COV1 1I6XA 2K9ZA 1FYUA 3JU9A 3PMSA 3VZOA 1O4TA 5KHJA 1ZBE3 1K5MC 4YZ2A 5J3UA 3T1LA 3OF1A 2BUKA 1BZWA 3QD6A 1ND2C 1PNFA 2P2KA 4XBQA 5E89A 1JTZX 5JZGA 2NZ9A 1PVC1 1UMZA 1PZ8A 1VAMA 4IEWA 3FLTA 2X5IA 1SCRA 4GA9A 4F8AA 1O4ZA 1S1AA 3C3VA 1UAIA 1MR5A 1RUD3 4CDXA 1Q8PA 5JIUA 1IHMA 1YFUA 3M3QA 5K0UA 4WM7C 3N7JA 2Z69A 3ME2A 1G86A 2ZPXA 4K6BA 4LHNA 3E5QA 1V6MA 2F6BA 4NWWA 1RINA 4ES8A 4TZDA 3K48A 2OPKA 5CNAA 2PHLA 1W2UA 4JGZA 2XVGA 4E27A 3UKNA 4ZXKA 3E5UA 5H9PA 1VB2A 3CF6E 3VBUC 3R4DB 1UU5A 3MLJA 1UKRA 4AHYA 1LJ7A 1PZ7A 2VG9A