3POWA

Crystal structure of the globular domain of human calreticulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
251
Chain Sequence
GREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the human calreticulin globular domain reveals a Peptide-binding area and suggests a multi-molecular mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords calreticulin
total genus 76
structure length 251
sequence length 258
ec nomenclature
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3powA01
2D7FA 3ZSKA 1GZWA 4YM2A 5CA6A 1I3HA 4HL0A 3MPPG 4YM1A 4Z8BA 5GLUA 3AFKA 4IQPA 4XIOA 1WW5A 3VKOA 2W52A 1MS9A 3AYCA 2A6XA 1G9AA 5DUUA 1BKZA 1BXHA 1FYUA 3N35A 4LBQA 1Q8PA 2CWMA 1G9DA 4P14A 4GALA 4YM3A 3NV3A 4Y20A 4KBBA 3AZYA 1HQWA 3Q9OA 1ENSA 4P9WA 1DLLA 1IS6A 2WLQA 4R9BA 4YW3A 4F83A 3WDTA 4YZ3A 3PJQA 5F5QA 2D43A 2DUOA 4NOTA 1W6NA 5FREA 3ZSMA 3V0BB 1JYIA 1FATA 2Z42A 4TYSA 1U0AA 5DZFA 1AX1A 1V6LA 3QCWA 4DQAA 2OVUA 2WSVA 4Y1XA 4M3CF 1WCSA 3ENRA 1IS5A 1GNHA 1LOGA 4XBLA 2SBAA 2DURA 3RSJA 3LSEA 1EPWA 1G9BA 3M2MA 5GZGA 1GBGA 4U2AA 5IUQA 2GALA 2WSUA 1JOJA 1URXA 5JOZA 1MZ5A 4JRAA 4C1XA 1GZWB 5DG2A 3PVOA 4BOWA 2A3WA 2A3XA 2ARXA 3POSA 3VUOA 3IPVA 3WG2A 5E89A 4L8QA 3RG0A 1IOAA 1LOFC 2DVFA 2AH2A 4P9XA 5HCAA 5H9PA 1S0FA 3APBA 1BZWA 1LGCA 1DGLA 2E6VA 3OYWB 2AYHA 4K1ZA 5E88A 1AXYA 1PZ8A 1OFSA 2OW4A 1V6KA 3HMYA 1WD3A 3WDXA 2ZKNA 3N7MA 4YW4A 4BM8A 1GZ9A 5KXEA 2WKKA 3AZWA 3WV6A 1B09A 1VIWB 4XJUA 2ES3A 1ONAA 1BYHA 3AZXA 4XZPA 5DUVA 3SLIA 1W6PA 2A7AA 1JBCA 1VLNA 1LHOA 2ERFA 2BQPA 1CQ9A 4Y22A 4YG0A 1LJ7A 4ISQA 1CPNA 3FLTA 4XMIA 1CVNA 1LGBA 1W6OB 4PBPA 4U36A 2R16A 3POWA 1AJOA 1SCSA 4Q2FA 5GZEA 1QNYA 3SITA 2EXJA 5T54A 1C1FA 2V73A 2A6ZA 3LCPA 3GNEA 4PBOA 4XJ9A 4CTEA 2CTVA 1ULGA 1TEIA 3V64A 2D6LX 4PQ9A 2ZHKA 1SLTA 4XTMA 1DBNA 1CIWA 2JD4A 1DZQA 1VAMA 3OGGA 1CONA 1SCRA 1LHWA 1DYKA 1GZCA 2P34A 1XQNA 1W6MB 1JUIA 3RMXA 1SLIA 1O4ZA 3BODA 4FPFA 4YW2A 3VKNA 2ZGTA 3WVJA 5IK4A 3HR9A 2AREA 2JDZA 5HCFA 2VU9A 2DVBA 3UJOA 1DQ6A 3IMNA 5DUWA 1GKBA 2CWSA 1DIWA 2ZABA 4SLIA 3AP6A 1G9CA 2LALA 2PHTA 5T5JA 5H9RA 2G4IA 1QOOA 4ZKTB 2A6WA 3ATGA 4GA9A 4FPCA 1W6PB 1S0JA 3MW4A 4R9AA 2WT1A 4XTPA 1KRIA 3UL2A 3MW2A 4K20A 4ATEA 1LENA 1DQ0A 4BLJA 4W65A 2JECA 4Y1YA 2ZMLA 5T52A 3SH4A 5KXDA 1LECA 2D3SA 2ENRA 4WV8A 3ZYPA 2ZHMA 1UAIA 2NZ9A 3AXEA 1KITA 1HLCA 1F31A 3NV1A 4FOQA 1A78A 4TZDA 5EWSA 3W59A 1MS4A 3O12A 3A0KA 4XDQA 2EIGA 4YGCA 5LK5A 3B3QE 4YZ2A 5JOYA 4LBLA 3V65A 4PCRA 1DFQA 3WCSA 4I30A 5H9QA 4Q27A 2E7QA 3OPZA 2VW2A 4WVVA 4XJWA 1LULA 3A4UA 3AZZA 2ZMKA 3ZVXA 2UWBA 2EXIA 2XG3A 2A70A 1GV9A 2ZA9A 4Y24A 5E8AA 1MS0A 1DHKB 3FUOA 5T5PA 1WLCA 2FMDA 2LTNA 3O0XA 1W6MA 2UU8A 1N1TA 3N7JA 3OYWA 2VH9A 1YIFA 3N7KA 2CYFA 1QDOA 3VKLA 1G86A 1RIRA 1WW7A 2GDFA 2JE7A 3B01A 1W6NB 3MEPA 4UW6A 4XJZA 3IPVB 3WDWA 5GJ6A 1MZ6A 2SLIA 5JLVA 4ITCA 5SV8A 4FVVA 4AVSA 3M1HA 2A75A 2GMEA 4LBMA 1KQRA 5JOXA 1N3PA 1V6MA 3DGTA 3M3CA 1AVBA 3T1MA 3O0VA 1VAVA 1QU0A 3AYDA 3QLQA 4GXLA 4Q8LA 1UKGA 5DUXA 2VY0A 2VXRA 4XHBA 3SH5A 1W6OA 3R05A 4YFZA 1G8WA 5DZEA 4DRVA 2ZGSA 1WW6A 1KDKA 2ZHLA 3ZSLA 2E51A 3ASIA 1VALA 3KM5A 1BQPA 5JDBA 3UJQA 2D6NA 1W6QA 2ZGOA 4H55A 3ZXEA 4LBJA 4GKXA 3JU9A 3TB0A 3W58A 5EYXA 3VKFC 1YI7A 3B00A 1S0EA 3D5OA 1W6QB 4BMBA 2ZGQA 2NM1A 1UZZA 1LU2A 5JMCA 1SBFA 3OY8B 2A6YA 5DXDA 4YG6A 2P2KA 4LBQD 1V6NA 3FLPA 2GMPA 1GICA 4K21A 1C57A 2AR6A 2VW1A 3AJZA 1LHUA 2DVDA 1S0BA 1IS4A 1LHNA 1QOTA 2EXKA 1SACA 2AUYA 2OUHA 1LOCA 2PHUA 2E53A 1G9FA 5AVAA 1DYPA 2A3YA 4FPGA 4GKYA 1DQ4A 1MVQA 2W08A 1R1ZA 4M3CB 1AXZA 1FNYA 3R4UA 4BMEA 4RA0A 4Q1PA 4XBQA 2NMNA 1N1VA 4CZSA 4AGGA 5GALA 4LBOA 5IK5A 4M00A 4Y1ZA 4AVTA 1GYKA 1JYCA 4YG3A 4UW5A 2WT0A 3AYAA 3WHUA 3POYA 2PHRA 1FX5A 2V5YA 2P3KA 1X50A 2YY1A 3AP9A 3NWKA 3OBRA 4RL7A 3T2TA 4UW3A 3PVEA 4FP2A 3WDUA 3ZXFA 4C1WA 1F5FA 3GALA 3RS6A 4DFSA 4AWDA 3ZXJA 3WHTA 5GZCA 4BLIA 3FFZA 2I2SA 4YZ1A 1PZ7A 1DQ2A 1ULCA 4XXPA 3N3HA 2A71A 2XB6C 1UPSA 3AP5A 3ILRA 1RINA 3JUUA 2ZBJA 1CR7A 3WDVA 1HKDA 1SBEA 4FPHA 5BYNA 1LEMA 2GMMA 4LBQB 4DRRA 2W68A 3RMYA 1SFYA 1S0DA 2GNBA 2NYYA 1ENRA 3PMEA 2A6VA 4Q1RA 2D3RA 4Y1VA 3V0AB 3FUQA 3HN1A 5CNAA 1ZA4A 1OKQA 4FPEA 1Q8OA 4XJAA 1WLDA 1N1YA 1YO8A 4BPZA 3OY8A 2YROA 3MW3A 1W0OA 2UWAA 5DZGA 4GWNA 1HQLA 1KDMA 2ZGKA 1H30A 3RQ0A 4Q8KA 1UMZA 2DUQA 4YFWA 4YW5A 2E7TA 3WNXA 3R4SA 2DTYA 3PVNA 2R1DA 5L73A 3M3QA 1Z0HA 3D6EA 1C4RA 3V0AA 4Y1UA 1N47A 4LBNA 4ASMB 1JN2P 4M01A 3WOGA 4Y20B 3WG3A 4FOVA 1MS8A 2P3JA 2C9AA 3WCRA 3O0WA 1G7YA 2DWRA 4XHXA 5GLZA 4JCKA 2PELA 3C2UA 3INAA 3AZVA 1KJLA 1UZYA 2D6OX 2D44A 5EYYA 3B9CA 1D0HA 1GNZA 1DQ5A 2CY6A 2D3PA 2YXSA 3AJYA 5GLVA 5IK8A 1AJKA 1V6JA 5CB7A 4PF5A 1QGLA 3AXDA 1UL9A 2DUPA 1Q8SA 3M3EA 2WJSA 2CNAA 4NO4A 1NLSA 2YV8A 3IKWA 4YM0A 1SBDA 1CPMA 1LTEA 1LEDA 1MVEA 2NN8A 4XYXA 4YGBA 2EAKA 2GN7A 1A3KA 3BOPA 3LSDA 2JJ6A 3WZ1A 3I4IA 3SNMA 3ZXKA 5HCBA 4FOWA 3CNAA 3WG4A 2DU0A 1RITA 4XIKA 3O5SA 4XILA 2NMOA 3UK9A 3ZYRA 5JOWA 4MYEA 3TAYA 3KQRA 1LOEA 1IKQA 1LCLA 1V6OA 4HANA 4Y22B 4BQ1A 1UX6A 3AX4A 4WVWA 1MS1A 1KJRA 1MACA 4JC1A 1ZM1A 1S1AA 1BJQA 1NXD1 4ATFA 4AYUA 2EXHA 2WT2A 4DPNA 2YZ4A 5H9SA 2WNEA 1AZDA 2PHFA 4AVVA 1Q8QA 2B7YA 4FPYA 4Y26A 5JVVA 1MS5A 1N1SA 2CL2A 4FQ4A 3N7LA 4P9YA 2RHPA 4YGEA 4DS0A 1QKQA 1I1EA 2EF6A 1YXWA 3OJBA 2ZGPA 1JW6A 2GNMA 1FAYA 1FV3A 3ILFA 2DYCA 3FBYA 5DG1A 5KXBA 1FV2A 4YW1A 2VUAA 4ISRA 2C5DA 4XJ8A 2A5ZA 1PZ9A 5EXOA 2D6MA 1WBLA 5GLTA 5IT6A 1CJPA 1DQ1A 2ARBA 1QF3A 3SH3A 1UN1A 2AENA 1AF9A 2D6PA 1JHNA 3T1LA 1J1TA 2D6KA 5T5LA 1ULFA 1QOSA 2DTWA 2HYKA 1AX0A 4FPOB 1IS3A 2GNDA 2GN3A 1D2SA 4YZ4A 2UWCA 2DVGA 4ZXKA 1N3OA 1QDCA 3M3OA 2WQZC 3WUDA 4FQZA 1A8DA 5KXCA 3IM0A 3VKMA 3ZSJA 4D69A 4XOGA 3V0BA 1LODA 3SISA 2ZGLA 1LU1A 4YZ5A 3A0NA 2UURA 1LESA 1H9WA 2ZACA 2ZGNA 3WLUA 2JKBA 3WG1A 3ILNA 2ZGMA 1Q56A 2EALA 5GZDA 1Q8VA 2P37A 1C1LA 1W0PA 4AGVA 5T55A 2R49A 4XE9A 1ULDA 4YGDA 5GM0A 4K1YA 2P3IA 5GZFA 2PHXA 1S0GA 1CESA 3IN9A 1GANA 2OUJA 3L2YA 2VW0A 4YLZA 1HDKA 3U4XA 5F9TA 1O4YA 2NP0A 2FHRA 2JE9A 1WD4A 2YMZA 2R0HA 5T5OA 1V00A 3NV4A 2DVAA 2R1BA 5T50A 3WDYA 2KM2A 2ZHNA 4FPJA 3ZPYA 1YYNA 1Y7BA 1ULEA 4WZFA 3AP7A 2ZAAA 1AXKA 2PHWA 4R9DA 3RRDA 1WBFA 2ZZJA 3USUA 1S0IA 2DV9A 5CAZA 1WW4A 4XBNA 3BTAA 4M3CE 4R9CA 4FP3A 1LOBA 2ZGUA 1SLBA 1AX2A 1LOFA 1V6IA 4AGRA 2AGSA 1CN1A 2TEPA 3N36A 2Q5TA 3B69A 1H9PA 1LHVA 1F9KA 1S0CA 1GLHA 1WLWA 3BIWE 3D4KA 2W39A 4FPKA 1FNZA 4M3CA 2R0FA 1SLCA 4GWMA 2ZMNA 1QNWA 1MS3A 3H0OA 1LGNA 2GNTA 4FOYA 3ZXLA 1MR5A 3AP4A 1APNA 3AK0A 3AYEA 1ENQA 3FLRA 3NV2A 3OBTA 1N3QA 4OZXA 5GLWA 1LOAA 1Z78A 3DUIA 5IK7A 4FPLA 4LBKA 1IKPA 3USUB 3I8TA 2DU1A 4CRQA 1WUVA 2H0BA 1JXNA 1YRZA 1GSLA 4UW4A 1SLAA 4XXAA 4XMAA 1OQ1A 4Q26A 2ZGRA 5FRAA 1SLLA 1QMJA 5CBLA 3VV1A 3WUCA
chains in the Genus database with same CATH superfamily
2D7FA 1NCRB 5HPOA 4PI0A 1J3PA 4IEOA 1CGPA 2XXZA 5I93A 1PK6B 4IQPA 1XRUA 5JZGA 4AI3A 1G9AA 2JDYA 4GH4A 1BKZA 2ZEWA 5C4WC 1Q8PA 1G9DA 4CDQC 5DN2A 1PNGA 1JODA 2W94A 3OD4A 3AZYA 1ENSA 4JHZA 3E6CC 3IAPA 2XWJB 2W0XA 4Z07A 3PJQA 4QPIA 3IZOA 2DUOA 3AM2A 3OGRA 2XJUA 4MXWB 2IFRA 3IDBB 3J8F2 4RS5C 1VBB1 4CDWA 2Z42A 3HNYM 2W1UA 1AX1A 1ZYBA 3QCWA 2ZJCA 3OSDA 2OVUA 2WSVA 3FJSA 4NRMA 5DAQA 2FQPA 2VD7A 3IDAA 5JSRA 3VD5A 2RS11 4MZUA 4QHOA 2LW8A 5FLJA 4DO0A 2HWE3 4K6BA 1GNHA 1LOGA 1H1AA 1W2NA 4LULA 5D8AC 5FY4A 3WXPA 2XONA 3M2MA 5GZGA 2QQKA 1Q3EA 1GWMA 4W6XA 2OKXA 2XLFA 2N7GA 1XPWA 2D5HA 4BWOA 1URXA 4HSJA 4JRAA 1PK6A 3GJBA 3MLJA 4B29A 1RUE1 1AYM3 4LHKA 1ZBE1 3TEWA 5FZ6A 4B7KA 3RFRA 3RG0A 4MGKE 5CU1A 1WCUA 2DF7A 2DVFA 2Y6GA 2YC4A 4A6SA 4KGQA 4AEDB 3HN3A 4YVSB 4WVMA 1BZWA 3KT4A 5CFCA 2I45A 4DY5A 1RHI2 2J1RA 3SEPA 4GULA 2IZWA 3JXSA 1W3XA 1YFXA 1O5UA 4O7XA 2G9GA 4GB32 2ZKNA 4P08A 3N7MA 4RHV2 5FYYA 4AHYA 2WINB 5A6YA 4WBBA 4CUBA 1H6YA 1DGWA 2PN5A 2R062 4XZPA 2A7AA 4NWVA 2RS53 3RI9A 2ERFA 3WR0A 2IXCA 5LBEA 3MIFA 4YRDA 1H1IA 2WC2A 4MGQA 1CPNA 3EMRA 1BEV2 3WF0A 2QCSB 3IDCB 4PBPA 2QJVA 3POWA 1POV1 2EICA 5J37A 1AJOA 2VNRA 3GZUC 3SITA 1UYPA 2BEOA 3LCPA 4BZ4A 1FI2A 5DQ0A 1C5HA 4CEYA 3N9QA 1ULGA 5DAXA 5A7NA 4CXWA 4PQ9A 4XTMA 4XVHA 5FUIA 1DBNA 5BNPC 2JIJA 1ZBA2 2GP3A 2JD4A 3U1XA 2VNGA 1OD3A 4CDQA 4M0HA 5C9AC 4OQ8A 1VBA3 5FZ9A 1SCRA 5CKNA 1XU2A 2VUJA 3KZ4C 3M8LA 1LNSA 1W6MB 1SLIA 3BODA 1VB4A 5JPNB 2CHHA 1O7FA 1OA4A 3VKNA 4CXXA 1YFUA 2ZX4A 4PIZA 4NIIA 3HR9A 2BU9A 2VU9A 1OC1A 1KEXA 1XSRA 4Q4W2 1AR82 4AK3A 4AFAA 1BCXA 1B35A 1DIWA 1VBE1 4SLIA 2WZR2 3VHPA 1F2NA 2JB8A 3CJXA 3RYKA 2Q8EA 4QPYA 1X9PA 5BY5A 1PO12 5A7SA 2V4AA 1UY3A 3B93A 3ZFGB 2BW8A 2Q1ZB 4WM7B 4M4RA 2GSYA 2QQIA 1BLZA 4GJZA 5A7WB 3UL2A 2VO5A 4K20A 4ATEA 1LENA 2GH8A 1D2QA 4LHLA 5T52A 5FFOC 1EP0A 1FOD2 4WM8B 1OMIA 2WQ4A 2ENRA 4WV8A 2VPVA 3OEAA 1MEC2 3AXEA 4QGMA 2JDKA 1KITA 2VXJA 1BEV1 2QQLA 5EWSA 4URTA 2LRPA 5EIYB 2NLRA 1CX4A 3F95A 4YGCA 1R092 3MLLA 5BNOA 4K8RB 3OUIA 4PCRA 1STMA 4CPBD 2OPKA 3P6BA 1DU3D 1T6BX 1HRV1 4IL7A 2RJ2A 3FHIB 5FZLA 5JXIA 4O61A 3AZZA 2ZMKA 5B4NA 2UWBA 3OCPA 2YBKA 2XG3A 2YU2A 1GV9A 1CAXB 2ZA9A 4Y24A 3T2PA 1E57A 5J7MA 1BK1A 2QQPA 3FUOA 1GNYA 3NAPB 3S5QA 2FDFA 5T5PA 2FMDA 4NROA 3N7JA 2VZSA 2VH9A 1W06A 5KHJA 2LS6A 2CYFA 4CEWA 2Q8OA 3LEMA 2R042 2R7EB 2G19A 2JE7A 1W6NB 4XJZA 5IATA 3IPVB 3LIHA 1NT0A 1MZ6A 4S2FA 5FPVA 5G05L 3W5MA 4ITCA 5SV8A 2FDGA 1JZ4A 2NPIA 4Z2WA 1KQRA 1RUI1 5F8PA 3HNMA 1V6MA 1WCKA 2IXIA 1YFYA 4Z1VA 2OS2A 3GM8A 2XQXA 3HD8B 2VNOA 5K0UA 1W8UA 3NMBA 3SH5A 1W6OA 2AEYA 3BTXA 2FBEA 2ET7A 3VGIA 4DRVA 4UF0B 2ZGSA 2TBVA 3ZN6A 4AVCA 2VCAA 3E5XA 1XNDA 3KCCA 5L9BA 3UJQA 1X33A 3R0RA 3ACHA 1RUI2 2XMLA 3JU9A 3OPTA 4GKXA 5JI7A 2HWD2 1ASJ1 4COVA 2W1WA 2DFCA 2PHDA 3W21A 1WCDJ 1W6QB 4KU7A 2AC1A 2ZGQA 3DKWA 2GC1A 4N53C 3H8UA 1R1A1 5DXDA 4YG6A 4CEYB 4YVSA 4COUA 1OOPA 3GCXA 5ABJC 1JYWA 3RZHA 1RUC3 4JVAA 2JDMA 2RM21 4XQWA 5LEKA 1GICA 4XF4A 5FP7A 3VD7A 2AR6A 2VW1A 1JZ7A 1LHUA 1QOTA 2EXKA 1PMJX 3OD0A 4UAPA 4A7ZA 1GWLA 2ZTNA 2E53A 1G9FA 1OURA 3W20A 3RWKX 1XE7A 1MEC3 4TWTA 4CDUC 5C3OA 3RZGA 4AE2A 2NQYA 4RA0A 2F4PA 2NMNA 3DPRC 4AGGA 4CZSA 1US2A 3BB6A 4E27A 4R52A 2X05A 1LB2A 1DP0A 4UW5A 1BVP1 4CU9A 5AC91 1CAVB 1RUF2 2WT0A 3FFQA 1GP6A 1C8M1 4LOSA 5FZEA 5CFCB 1J59A 4TN7A 2YY1A 5LY1A 4BLJA 5FY1A 1RJ7A 2GC0A 2H6BA 1UQXA 3WDUA 4E2QA 3RS6A 2Z4FA 3ZKUA 3C7OA 2I2SA 2RDNA 4LPLA 1ULCA 4C91A 4LKSA 2A71A 2XB6C 3GXUA 1UPSA 3AP5A 1HJFA 4JX0A 3LGRA 1CD3G 4L2NA 3O1MA 1HRI3 2CAUA 2X10A 1PVC1 5FYBA 5BNNA 1CR7A 1NCRC 4LA3A 4A42A 3PVBB 1JI6A 4AI2A 3LIGA 5F5CA 4DRRA 2BP6A 1SFYA 1S0DA 2NYYA 4Q1RA 4COYA 4X6QB 1YLLA 3KF3A 3M3IA 4KWUA 5HBAA 1OKQA 3TEXA 1AYN2 4NVPA 1AR81 2VMGA 2AZ5A 1L3JA 1YO8A 4I3GA 3OPWA 5DDJ1 1UW8A 2OYZA 4GH4C 4QU1A 1W0OA 3T4VA 2JXAA 4Q8KA 3RQ0A 1POV3 2HWF2 3VD3A 1BEV3 1ODNA 1UMZA 2DUQA 2RMU3 3ZXDA 5C3PA 2E7TA 3R4SA 4IEYA 3THCA 5A1AA 1XNTA 3I3EA 2CGOA 3J7LA 4OI4A 2IVIB 3PTRB 1NA1C 1Z0HA 4GB33 2WA4A 1C4RA 3BCWA 3H1YA 4Y1UA 1RGSA 4ZS2A 5ACA1 4N53A 4LBNA 4YYOA 2VBBA 4DNYA 4Q0PA 1JN2P 5B2GB 2A73B 2QQNA 5F5IA 4FOVA 1MS8A 4AQSA 2PFWA 5ABJB 2C9AA 1ODMA 1G7YA 3O0WA 3U4SA 1PGL1 4JCKA 2GC2A 3C2UA 1EV13 2GZWA 1DCSA 3INAA 2B39A 1UZYA 2D44A 5EYYA 4E2SA 5A3NA 1D0HA 1GNZA 1DQ5A 5GLVA 2YXSA 5IK8A 2ZX3A 5F3IA 3FHQA 1OQDA 2YPJA 1DYOA 2RJKA 3I49A 4AQ2A 4CDWB 4NHLA 4OVEA 3UETA 3M3EA 2WJSA 2CNAA 2WZPP 1WMFA 3N9NA 1XBFA 1CPMA 1LTEA 5A33B 2BFUL 3WW4A 5D2AA 5ACA3 3O1UA 4QX0A 3AL5A 4N7UA 3LDRA 3NAPA 4BH9A 4I3PA 1VBA1 2ZEXA 5F3EA 3SNMA 2WDBA 1OKOA 3QOPA 1PO13 2XHNA 4KWKA 3ZSEA 5EP9A 3IIIA 3VDBA 4LUKA 4MHRA 4CEWC 4FO9A 1PO21 1PX3A 5FMDA 4MYEA 1TZOA 3KQRA 3TAYA 5CVRA 1LOEA 2BTVC 4V2WA 3POFA 2JE8A 3DYOA 3AX4A 3FN9A 3VDAA 1ZBE2 4BQ1A 4DY3A 4N43A 1FOD3 2Q1FA 3ETQA 2X5IC 4AI9A 1ALYA 5BUVA 3IB3A 4XF0A 1ENXA 3EBRA 4AYUA 2WT2A 4X6RB 3K48A 5H9SA 5KHIA 3NL1A 4YVWA 1O8PA 3RYRA 1QH6A 4AVVA 1Q8QA 3J7HA 4META 5FZ7A 4LTAA 3OBZA 2DCZA 2J1VA 4FPYA 3SXWA 3FBMA 4M0NA 1N1SA 4FQ4A 3VD9A 5F39A 4YGEA 4DS0A 1I1EA 1UKRA 1YXWA 2EF6A 2ZGPA 1BHGA 1JW6A 2VZQA 4HLTA 5IWFA 4BB3A 2VZ3A 3D0SA 5FTTC 3ALQA 2FDJA 3ILFA 2UY8A 4DUXA 4HPKA 1JS9A 4KU8A 1FT9A 1WBLA 1OXCA 5GLTA 3ZO0B 3U0ZA 1CJPA 2W92A 1DQ1A 4PDWB 4LLFA 4OHYA 1QJU3 5JAXA 4P00B 2LUWA 4FXKB 3PIGA 2XJQA 2YBPA 4PQQA 4XAEA 3UGFA 1ULFA 2B8MA 3E5QA 3AMPA 1H8TB 2GNDA 4GAZA 1D2SA 3ZYHA 1QIQA 2DVGA 4JAAA 2WQZC 4WM7C 3AKTA 4FQZA 1VBD3 4HMZA 3IM0A 2WNVB 1B35C 5A80A 3KV4A 3V0BA 5BNNC 1RTVA 4CPBA 2QVSB 3D82A 4XUTA 3CQOA 4JTOA 2ZGNA 3WG1A 4LLOA 2QQVA 2RM23 2ZGMA 3OUHA 4O9GA 1NA1B 3RWNA 1C1LA 3VBRB 3MV11 3VD4A 1VE0A 3FHAA 2EIDA 4QX3A 1NY71 3VBHB 5C3RA 5GM0A 2IXJA 4N43B 4IEUA 4IDZA 5JR7B 5A3LA 2VTXA 3L2YA 3BPZA 3DXTA 3MUZ1 3GZAA 2RDQA 5FO8B 4WVZA 1WGPA 2PLV1 2F4LA 3EHKA 1DG6A 2VL4A 5F9TA 4R4ZA 2FHRA 3FL7A 5DMYA 4H2AA 2JIGA 1V00A 5T50A 4AFCA 3LA3A 3WF1A 2ZHNA 4RR3B 1JZ8A 1BMV1 1YFWA 1QJX1 1RUI3 4CE8A 5JPMB 3ZMNA 5FZ3A 3GGLA 2Y6KA 3BTAA 4M3CE 3V56A 1LOBA 1SLBA 4AAXA 1LOFA 3P3NA 5DAPA 1V6IA 2AGSA 2TEPA 4BHPA 1ZZ6A 1H4HA 5JI9A 2XBO2 2WAAA 1JTZX 1LHVA 3BIWE 3NNJA 1GLHA 1WLWA 3OTFA 2Y6LA 2W39A 3POJA 3DF0A 4FPKA 4Q4X1 2R0FA 1E5SA 4GWMA 5FAXA 5AVPA 3WNLA 3LAGA 1TQ5A 5CFCC 2B5HA 3ST7A 2BJSA 2RVAA 3ZXLA 2ZKLA 1MR5A 4OUSA 1UZ0A 4H3WA 5B4XA 4BA6A 1ENQA 3FLRA 3OBTA 4RFT0 1N3QA 1H2NA 3L9JT 3ZDVA 3VBRA 1DLCA 3I8TA 4OCTA 4OULA 4XFGA 3T0BA 4N8MA 1CAUA 1WUVA 3VBSB 4CP0A 1HRV3 4LKFA 2IFWA 4UW4A 5A33A 1AL21 4XXAA 5FBJA 5EJ3A 4JQTA 4Q26A 5CBLA 4XZUG 3VV1A 4UFJA 3LB9A 4OZOA 4YVWC 1OA2A 2BYVE 2XHKA 1Y9QA 4YM2A 1U5YA 5CA6A 1ZZBA 4OI1A 3MGUA 2W9XA 5A6ZA 3UESA 1MS9A 4BXFA 1CZTA 1UOBA 4INDA 4AHXA 1FYUA 2VBDA 2ATFA 2D98A 3N35A 5FR3A 2CWMA 4JHTA 4AG4A 4GALA 3NV3A 1D4M3 1SZBA 5JWPA 5I0DA 1V9U1 1W99A 4Z2AA 3N9LA 4R9BA 3TNQA 3MHZA 4N43C 3NAPC 1VBC2 4Q4Y3 4X8PA 1UYZA 3HOBA 1OLMA 4MGTA 5C4WA 3ZSMA 1ND2A 3V0BB 4NUBA 2Y60A 4Q5OA 3O1VA 1U0AA 5DZFA 1V6LA 4QKNA 5FZBA 5F37A 3H8XA 1RUH1 1RL3A 1Y9GA 2RDRA 1QJY2 1WCSA 4KWJA 3NJXA 1UIJA 1UPIA 2MNGA 3LFIA 2RMU1 4JRLA 2Q8DA 2TNFA 3RSJA 2XWBB 5FZCA 1G9BA 3U07A 1GBGA 1AYN1 2QQWA 3U11A 1AR83 1OPOA 2GALA 4RR3C 1D4VB 1J84A 3A23A 5HXVA 1JOJA 1UF2C 2ZXQA 4D6SA 4C1XA 3PVOA 4BOWA 4F8AA 2ARXA 4RD7A 4BQXA 4LO7A 2CDOA 4HOOA 5E89A 4CVUA 1UIKA 1LOFC 4NWWA 2J22A 4BE3A 2XBO1 2VZPA 3APBA 4NIHA 1CZVA 1DGLA 3I54A 4QX7A 2AYHA 3VZKA 4K1ZA 4Y5TA 3VZNA 1AXYA 2D93A 2KA3A 3BIEA 1V6KA 1ZZ7A 2W5FA 3WDXA 5A3TA 5A7QA 3BTYA 2XVGA 1OHFA 2V09A 3AZXA 1OH4A 2YDEA 1JBCA 2BQPA 1UU5A 5KC6A 1OBNA 3KT7A 3FLTA 1RUOA 5L9RA 1CVNA 1W6OB 2JG9C 2BOIA 2VOKA 5FYZA 1SCSA 1PGW1 1QNYA 4UBHA 4AEDC 2QE3A 3HQUA 4JKLA 2HBUA 2PA7A 2P17A 3GNEA 4PBOA 4XJ9A 5KWRA 3BKZA 4ZU4A 1U5XA 2CDPA 3MFAA 3LEGA 2CTVA 4MV2A 1TEIA 2VUDA 3V64A 2O8QA 1CAWA 2X29A 2XJVA 1NCRA 2E7AA 5KHKA 3B9IA 1CIWA 2C1FA 1VRH1 2WA3A 2BPA2 5I0RA 5LW9A 4QMAA 1GZCA 1SQ4A 2P34A 5JXHA 1JYNA 1QXRA 4OQ9A 1BK0A 1REFA 3K75B 5AFBA 2CU5A 2Y26A 2ZGTA 1OVSA 3H42B 1YQCA 4Q0VA 3WW3A 3VL9A 1DQ6A 2ORXA 1GKBA 5FWEA 2VNVA 3ZFFB 4GH4B 2LALA 1ZRCA 1H2LA 3JB8A 2G4IA 1QOOA 1W03A 4Q0SA 5FPUA 4GWJA 2BUKA 1K45A 1PIV3 2YU1A 1AR91 1QQP3 2JG8A 3ZXAC 3VBOA 1QJZA 3HEIA 4XTPA 1TMF2 4I0BA 2IC1A 3MPBA 1JH5A 2JECA 2JDPA 3I2DA 3SH4A 3WW2A 1LECA 1NXMA 4NIDA 1E5IA 2D3SA 4P5YA 1UMHA 3H8RA 2QQJA 4HSLA 3ZYGA 3BI3A 4HT1T 3ZFFC 1HLCA 1WWYA 4RGGA 4A44A 3A22A 2UYAA 2RG4A 1O3RA 4JGYB 4XDQA 5LK5A 1M4WA 4QPWA 3U75A 3B3QE 4LBLA 2QNKA 4DUWA 1H2MA 3OGVA 2FDHA 2K46A 4A7KA 4IGPA 4CCJA 1V0AA 2CV6A 4Q27A 3RJRA 3OPZA 4XF1A 2VW2A 3M70A 2WZR3 5A32B 3TNPB 3ZVXA 3AMNA 2HWB3 3M7AA 3NNGA 3T2QA 2E9QA 2ZOEB 3KS7A 5CKQA 3TBDA 2LTNA 3O0XA 1W6MA 2UU8A 3PIJA 4V1PA 5FKCA 3SCGA 4FTBA 5FWJA 2MPFA 5C70A 3N7KA 1JUHA 1QDOA 3KGLA 3I59B 1WW7A 1DGWX 3VBUA 2HYXA 2PAMA 4UW6A 5JIAA 4BDVB 1BBT1 3U78A 3ELNA 1JOBA 3JD72 2HBTA 4KH9A 4Q4W1 5FYVA 2VOVA 4AVSA 2VMCA 2W47A 2GMEA 4LBMA 1TE1B 5CG8A 1SHWB 2GP5A 1AVBA 4X8NA 3GJAA 2YG0A 4XFCA 2RR13 1VAVA 2B9UA 4GXLA 4Q8LA 4W6YA 3RZMA 3LWCA 1UMIA 2Q1MA 4N9IA 2W2IA 1JOPA 3C7EA 3R05A 1U12A 4NHMA 5FP4A 3THTA 1G8WA 4A7YA 5DZEA 5FP3A 1VMFA 3I2KA 4HN1A 4CU8A 1EYBA 1RMU1 2E51A 3CIHA 1NAEA 3KM5A 2WS92 4CDXB 5L7OB 2JICA 3ZXEA 1W6QA 5LASA 4IE5A 2WYFA 3K51A 5FMBA 3BVCA 1HX6A 4AF9A 2XJSA 4KG8A 4HETA 1W9YA 4IV3B 2H0VA 3GYDA 4QX8A 5BNOC 3NW4A 2VC9A 2Q30A 1UZZA 3VDDB 1LU2A 3OY8B 2WFPA 1RUD1 1COV3 3H3ZA 3VBSA 2P2KA 4XUOA 1UU4A 1UU6A 4LR4A 4QQLA 3FLPA 4XAAA 3U10A 4D0QA 3J9SA 1PM4A 2Y34A 3AJZA 1TNFA 1R081 4DQAA 2R061 2AUYA 5AVAA 1LOCA 4RFRB 1GP5A 4FPGA 5F32A 3PUHA 1I5PA 2VZUA 1ST8A 5AC93 2X5IB 1GZTA 3VZMA 4DIQA 3DYPA 3UKTA 1O3QA 4ES8A 1DGRA 1PMHX 1RHI1 1QQP1 2XDVA 4HKWA 4UXAA 1TNRA 5GALA 4LBOA 4EN0A 4M00A 1I9RA 1NG0A 4AVTA 3HBZA 2WLPA 1JYCA 4LXLA 4BK5A 3VZJA 4CEWB 3RZKA 2BNMA 2VQUA 4MGSA 5I0UA 1NE6A 3GBGA 4QX2A 3WHUA 2F6BA 3JD71 3OOXA 1J3QA 2V5YA 1GMMA 3OBRA 3WZ1A 2ARAA 2QZ3A 1YQ2A 5K4LA 4UW3A 3RVHA 3ZXFA 2E31A 2RDSA 4MXWA 3VL8A 4AWDA 2ZX1A 5LA9A 3WX5A 1Z7S1 4FFFA 4RQPC 4XUPA 3ZXJA 4Q4V3 1DQ2A 2OZJA 1HIXA 2HWE1 3S6PA 4OFGA 5C9AA 1AL23 1H6XA 3C7GA 2Q0AA 3GHMA 3J7MA 1HB4A 2B42B 1RINA 1O6UA 1WA4A 2W1SA 2ZBJA 4QB2A 4D6QA 4CU6A 1PMIA 2HWB1 2GMMA 4LITA 5IVCA 1ZBE3 1VBB3 1AR63 2W68A 3RMYA 1ENRA 4F7ZA 1PGL2 4Y1VA 5CNAA 2PHLA 1GQPA 5I8YA 1CX1A 4IE4A 1UXZA 5J36A 1WLDA 5EZWA 3EO6A 5FZOA 4BPZA 4NIGA 2W95A 2O0OA 2YROA 3BGAA 5FK7A 5A3MA 1KDMA 3S30A 3WW1A 3GCWA 4KNCA 2OIIA 4DXRA 2ZEZA 4YFWA 3PURA 4BYYA 4C0BA 4WM7A 5FPAA 2WS93 2DTYA 2OQ7A 2BOJA 2L9LA 3DKQA 3M3QA 4IV3C 4CCCA 3SMHA 1VRH2 1TMF1 2ZPXA 3J8F1 3TRSB 1E5RA 1ZRRA 2RS52 3WOGA 1WMDA 3RJ2X 1UNBA 1PIV1 1UO9A 3OF1A 3WG3A 3ZXGA 5LA0A 2DWRA 4XHXA 3VZOA 1ZZCA 4AI1A 3AZVA 5FUPA 1X36A 3ZSJA 1KFUL 2CY6A 3B9CA 3AJYA 3KV5A 3LKJA 3PNAA 4MVTA 4CYDA 2VZOA 5FBZA 1YEWA 4RQPA 3ES4A 5CB7A 2YUEA 3AXDA 2WZ8A 5FZDA 2DUPA 2JDAA 3ZR6A 1Q8SA 4W50A 1VBD2 2QUOA 4I2OA 1X82A 2YV8A 2GC3A 3IKWA 4L99A 1RUJ2 4YM0A 5C8CB 5F5AA 3TOJA 2RS32 1NCQB 1EUTA 3J8F3 5EFUA 1OA3A 4YGBA 2WFF2 1GUIA 4O9EA 1A3KA 5J09A 5HCBA 2HWF3 3ZFEA 1HV1A 4FOWA 3CNAA 5K0UC 5FY8A 5F6KA 3WG4A 2VQTA 4XEZA 2EVXA 3O5SA 4NE9A 4XILA 3UK9A 3ZYRA 5JOWA 4R9DA 5A70A 2Z5WA 1IKQA 1LCLA 1V6OA 2HH9A 2VZRA 4ORFA 5FY5A 4OHZA 5DPNA 4HKOA 1K5JA 1MS1A 4OYUA 4WVWA 2YB7A 4YNIA 4YW6A 5DABA 5C5UA 3I3QA 4EN6B 4Q4Y1 2YC2A 1DDLA 1S1AA 1BJQA 1NXD1 2WNUB 4ATFA 2ZZQA 4DPNA 5EV7A 2C26A 5K9YA 1PHMA 1V9U3 2HEVF 5FPZA 4WZCA 3PU8A 4MUVA 5I0SA 2OT7A 1XJAA 5FXVA 2AEZA 1D4M1 3HQRA 4Y26A 5C8CA 1MS5A 4C90A 4BCUA 3FMGA 3N7LA 1EV11 2B4KA 1ND3A 3PLQA 4YVWB 5JCTA 3T30A 2VZTA 1SMVA 4KG0A 1R1A2 4P9LA 3ZYIB 4AQTA 2K2SA 3PJYA 4QX5A 2DYCA 5DG1A 3AVSA 1FV2A 2Y38A 1Q43A 2PQQA 4QM9A 4XJ8A 4IE6A 1R093 1PZ9A 3H3UA 5EXOA 4B3NA 2RE9A 1NYWA 4ARXA 5C71A 2XBO3 5K7PA 1ULOA 1KD7A 5IT6A 1AR92 2ARBA 5FOJB 4RS5B 1WCQA 1UN1A 2AENA 1JHNA 1V9U2 3ACFA 3GBWA 3T1LA 5FJKA 1O4TA 4N53B 1QOSA 1RUG3 2DTWA 2HYKA 1FMD2 2CSGA 4FFGA 1IPSA 1OT5A 1VBE2 4EJRA 4XC9A 4G3YC 3ON7A 3RPQA 4ZXKA 1N3OA 3S57A 4E8DA 3ZDSA 1XYOA 1Y4WA 4CXYA 3VKMA 3VZLA 4XOGA 1QHDA 4MADA 4YSFA 2WN3A 3SISA 3B02A 1HXS2 4PF1A 2JD9A 2RR12 4Q0UA 5EPAA 1IQAA 4PIYA 1C5IA 1CAWB 1ZBA3 1GOHA 2WO3A 3ILNA 3LQCA 1REDA 3WLUA 1RUH3 2EALA 3QD6A 4I01A 2P37A 4A45A 4AGVA 5T55A 2R49A 2WO1A 3SKVA 4GZ9A 3UGGA 2P4EA 3LDKA 4K1YA 3RZZA 4QXBA 1RVF2 5GZFA 1CESA 3IN9A 1GANA 2OUJA 2PAKA 3ES1A 1XYNA 3J4UH 4COZA 3OGJA 5FYIA 1JZ6A 4ASKA 3WNKA 1AYM1 1O4YA 3SCFA 2JE9A 4QD2A 2FZ2A 1WD4A 2XKPA 2YMZA 2QDNA 5T5OA 1YHFA 3NV4A 1IG3A 1CIYA 3WDYA 2GH2A 2KM2A 1ZRDA 1YYNA 1Y7BA 3D8CA 4WZFA 2P6CA 2WIIB 2O14A 2VMEA 5CAZA 4LMFA 3KHBA 1WW4A 2XJPA 5DAWA 4LIVA 4TSVA 3AKPA 1QJY3 1RVF3 2VJXA 3VBOC 1AX2A 2G1MA 4AGRA 3T0DA 1CN1A 3O1OA 5C33A 5LA1A 1JU3A 2Q5TA 4I0AA 3I3BA 4UYBA 5FZHA 2JENA 2ZMNA 1QNWA 1MS3A 1TVGA 2YGMA 2QQMA 4UI9L 1APNA 3AYEA 5E1RA 2JDUA 3EJKA 1LOAA 1K42A 3DUIA 4LBKA 4CUAA 3SEEA 2WWJA 1A8MA 3USUB 2DU1A 1XNBA 2WZR1 1TME3 5FDBA 3OEBA 3ZN4A 3BN6A 4XCAA 4TLGA 1US3A 1SLAA 2VULA 4S2HA 3X29B 4EN9B 5IW0A 1OQ1A 4XDPA 1RUG2 2ZGRA 4BQ3A 1QMJA 3UNPA 4A3XA 4J6GA 1SEFA 5FPLA 3JZVA 1QJX2 1PIV2 3ZR5A 2P6HA 1GZWA 1VBB2 1PK6C 4HG6B 1I3HA 4M4PA 4HL0A 3MPPG 5FCCA 4Z8BA 1C3HA 1GQHA 3AFKA 1DZTA 4RYDA 4IETA 1GR3A 1W2AX 2W52A 3NVCA 4XABA 4XQDA 3LE0A 5FZKA 2WYSA 3VKOA 2OA2A 1LR5A 4CA9A 3HT2A 2BGPA 4K40A 4IESA 3K4DA 4P14A 4YM3A 4Y20A 4TTGA 1OI6A 3GBFA 2E32A 3IIAA 4D7YA 1JYVA 3NKGA 1HQWA 3Q9OA 4P9WA 1DLLA 5LY2A 1IS6A 4YW3A 3B5LB 1YI9A 5KHHA 2W87A 4YZ3A 5C7GA 5F3CA 4IGQA 2D43A 5F5QA 2DCYA 2VCMA 3LA7A 4NOTA 3RI8A 2BVVA 2YBSA 3WP6A 5FREA 4GIQA 4QT6A 3PUAA 1JYIA 4AXOA 3LEKA 5FXXA 1QXJA 2YHJA 4Y1XA 4M3CF 4I02A 1S2KA 2BRTA 5L7OA 1HRV2 1WA6X 4ZONA 3ENRA 3R6SA 4XFIA 4AEDA 1D7PM 1CAXA 1EAH2 1X8EA 2MHFA 4ZU7A 2DURA 1UYYA 2VOWA 3ECQA 4XQ4A 3SQOA 3LSEA 3T3YA 1EPWA 3BUCA 1RXFA 4HKLA 4JKKA 1VAKA 3ZYFA 3I3MA 3G6JB 4U2AA 1ZZ8A 1VJ2A 4SBVA 5IUQA 4UWDA 5HXMA 2WSUA 2Y64A 2R041 4ZXEA 1MZ5A 3I2FA 3KSCA 1HV0A 1GZWB 3CBNA 4IEWA 5DG2A 3MF6A 4S2GA 2A3WA 4PT6A 3VUOA 3IPVA 4J25A 1SDWA 2E63A 2XL7A 4L8QA 1QY4A 1IOAA 2WWUA 4P9XA 4QXCA 3MIHA 3O14A 3ZN5A 5FP8A 3MICA 5H9PA 1S0FA 1RHI3 5IJRA 1HB2A 5FYSA 1LGCA 2E6VA 1SPPB 4JTNA 3FZ3A 3KWVA 1PZ8A 1OFSA 2OW4A 3BU7A 3HMYA 1WD3A 2PMWB 1UY2A 3MUY1 4YW4A 3R4DB 1GZ9A 4BM8A 2QKDA 1POV0 1BVVA 2BZDA 4RHV3 4AHZA 5DUVA 1VIWB 4XJUA 1BYHA 2WZEA 3SLIA 1W6PA 2RS33 1VLNA 1NY72 2X5IA 1CQ9A 1VB2A 5FYTA 4YG0A 1YCIA 2C9KA 4ISQA 5ERLA 1COV1 3KF5A 1PX4A 1B35B 3JB4C 4P5HA 4U36A 5BNQA 3ZIWA 1RUE2 2EIBA 4Q2FA 5GZEA 2C0ZA 5A6XA 3BYWA 5T54A 4IUGA 3ZPOA 1C1FA 2V73A 1FOD1 1IQDC 4NAMA 2Y6FA 4IV1C 4CP2A 1NZIA 2D6LX 2ZHKA 5GKAC 1OSGA 4LO4B 1OUSA 3NQHA 3VLBB 2XGXA 1PO11 4LO5B 1UX7A 1DZQA 1AYN3 1VAMA 2WNOA 4GMP3 4RSUA 2E26A 2WNVA 3AKSA 4QU2A 5EJ1B 4JV4A 1UOGA 5FPBA 4YPJA 1O5LA 1XQNA 3B94A 4B7EA 4GWIA 5FMOS 1JUIA 1KXGA 3QH7A 1O4ZA 1P8JA 1HXS1 4YW2A 3RMXA 5HI0A 5JSPA 1NUKA 2ZAHA 1A34A 1X9TA 2X8KA 2WBKA 3NNMA 3ZIXA 5IK4A 2AREA 5HCFA 2RS51 4E4ZA 3ACIA 5DUWA 5KR7A 1WMEA 3LEIA 3F2ZA 3KCYA 5I0TA 2ZABA 3FX3A 4B1MA 4CP1A 1G9CA 1J83A 2PHTA 1C8M3 1RMU3 1NQJA 3PMSA 4XFBA 5T5JA 5FOBB 2BGCA 3ATGA 4XFHA 4GA9A 2R072 2A1XA 2WABA 1W6PB 2XUMA 1S0JA 3NKTA 4MLOA 4MOAA 1JMUB 1HN0A 2CAVA 1PM7A 2VZVA 4R9AA 1OQEA 3TEZA 5FLHA 2B46X 3MYXA 3T0AA 2WQ8A 4AVBA 1MQTB 4CDQB 2H6CA 4Y1YA 3HPNA 2ZMLA 1E5HA 1MPXA 3ABZA 4MGZE 4Y5SA 2ILMA 1OLRA 1JZ2A 4KGGA 3WQBA 1QXPA 2QQUA 5FO9B 1KFXL 1UAIA 2NZ9A 4TZDA 1MZEA 1ZRIA 1A78A 2FMYA 5DAVA 1COV2 3CL1A 1MS4A 3O12A 3A0KA 4UFLA 4COWA 1GWKA 4ZZ8A 2K9ZA 2XVLA 5DDJ3 3S7IA 4EQVA 4GMP1 1DFQA 3I2OA 3WCSA 4LO6B 4AZZA 2E7QA 3H7JA 4K8FA 1W9TA 4QXHA 5J3UA 4XJWA 4WVVA 1LULA 5D8AA 2CGPA 3ORJA 3ZMOA 4FI9A 1XB9A 5LBFA 2EXIA 1PVC2 3GZTB 1JZ5A 1YUDA 3VN4A 5E8AA 1HRI1 1DHKB 2YFUA 1UCXA 2R30A 4IGOA 1N1TA 4V2VA 1O3TA 1YIFA 3GDBA 2WUHA 1FPN3 4H7MA 1W9WA 1Q5OA 3UGHA 2GDFA 3B01A 4QPIB 2BFUS 3DL3A 3KV6A 1YIPA 5GJ6A 2E33A 5JLVA 3I2GA 2J1SA 3DPRA 4FVVA 2Y8KA 2DBNA 2A75A 2OXBA 4PLOA 5J1XA 3NSTA 5FZGA 1N3PA 4LA2A 2BNNA 2VTFA 3DGTA 3Q8EA 4UFHA 1AYM2 3VBFA 5FXWA 3O0VA 4MO3M 1FPN1 3AYDA 3HJRA 3QLQA 5A7OA 5KC5A 2VY0A 2VXRA 4XHBA 1V70A 2ZX0A 3MLKA 5JIUA 4CCEA 4UOJA 1WW6A 5ANQA 1QJU2 4FCAA 5I8TA 4AI0A 3ASIA 1FPN2 1VALA 2I74A 5LBBA 1GFF2 2ZGOA 4YVSC 3AC0A 1REEA 3VKFC 4OI0A 1NKGA 4A6OA 3B00A 2JG8B 3D5OA 4BMBA 3PU3A 1H8VA 2NM1A 2G9ZA 5E16A 4Z92B 4AR2A 2ADDA 1VP6A 2YYOA 4Q4V1 1L7LA 4J1XA 2PYTA 2MEV2 2Q8CA 5FJHA 4MHUA 1V6NA 2GMPA 4K21A 4NPMA 1C57A 1F8VA 3U14A 2DVDA 1VRH3 4NRPA 2OUHA 1LHNA 5HV4A 1SACA 4RN5A 5BNNB 3VBFB 1K5MC 2WNVC 1MVQA 4LK7A 4QHBA 4BK4A 1FNYA 4XW3A 3I7DA 2K0GA 5A3UA 4Q1PA 1PGW2 1MZFA 1W2OA 3LPGA 4NR1A 4QPGC 5DDJ2 4RGAA 4Y1ZA 5FP9A 3E1F1 2Z2SB 3HNBM 1GYKA 4Q4X2 4YG3A 4NJ4A 3AL6A 4AI8A 4HK8A 4PDWC 3RZJA 3N4MA 3AYAA 5EQUA 1Z7S2 5C6CA 3POYA 2PHRA 1X50A 3AFGA 4RL7A 3T2TA 3VHOA 3PVEA 2EIEA 4LEJA 1F5FA 5FIXA 4EN8B 2XL9A 5FY0A 4CUGA 4AEMA 1R64A 2VMDA 4D94A 5GZCA 3AMHA 4YZ1A 3IDEA 1QH7A 4P9GA 5BNPB 1RUD3 4XXPA 3MIEA 4XPVA 3DXUA 4LORA 4XCBA 5F1RA 3BPSA 4I0WB 3ILRA 4IE0A 1WKYA 3JUUA 5F3GA 4FPHA 3WSOA 1LEMA 5FO7B 3HQXA 1OF3A 2R6QA 4LBQB 3N9OA 2RV9A 2ID4A 5FK8A 1RUF1 2A6VA 2ARCA 3V0AB 3LZZA 3Q8CA 2KD7A 5JMOA 3BU0A 1NA1A 2PTMA 1OPMA 5FUNA 3KLSA 1VBC1 3E5UA 1Q8OA 4NMIA 2HWC2 3CU7A 4L0PA 4UFKA 2VUCA 4XJAA 1W90A 4FBFA 4PJYA 4DEQA 3NJZA 3OY8A 1K5MA 2X09A 3MW3A 1XC6A 1WLTA 3CEWA 1U5IA 3NJYA 2ZGKA 1H30A 3CMGA 4R8HA 3T4HB 5LRSA 1W8HA 4UFMA 2JEMA 4PLNA 5FXZA 4AQ6A 4KI5M 5IVBA 3PTYA 3WNXA 4AOCA 2OPWA 5FZIA 3VBRC 3I3DA 1LAJA 4GQ7A 3MO4A 3KB5A 3V0AA 4MGIE 5FQ0B 3VB9A 5IVEA 4BIFA 1H0BA 3K46A 4M01A 4Y20B 2XUEA 3NJVA 2R071 5IVFA 1HB1A 2O1QA 3MDPA 1W8OA 4ARYA 2PELA 4XURA 4LK6A 1OLME 1EV12 2D3PA 2HWD1 2WWSA 4AHWA 3TN93 3O7OA 1AJKA 2XLGA 2GAUA 1VBE3 2OX0A 3SKJE 4PF5A 1QGLA 2HEYF 2VMFA 1UL9A 1AUYA 5APAA 3ACLA 5HV0A 4JDMA 4NO4A 4FFHA 1K5MB 1NLSA 1RC6A 2V4VA 1SBDA 4MG2A 3VBFC 2O8OA 3C7FA 3G7DA 1LEDA 3ZX7A 4XYXA 1HXS3 3ACGA 5BPXA 2GN7A 3ZN6B 3BOPA 3LSDA 2JJ6A 3N9MA 3I4IA 4QB1A 2HWE2 2VE1A 4KWLA 4EZ4A 3CJIB 1RITA 3DEMA 4FSJA 1VRBA 2VOXA 4Y22B 1W04A 4H7LA 4A2UA 4CP9B 1UX6A 1KJRA 1QJX3 1OUXA 2QTWB 3P3PA 4JC1A 4IERA 2HWB2 1ZM1A 3HVDA 4LHSA 4KL1A 1C8M2 1SFNA 4JGYA 2EXHA 5I91A 4Q0QA 2HLEA 2YZ4A 3OGSA 4ONUA 2EA7A 2PHFA 4IEPA 1KS4A 2B7YA 1NE4A 4WM8A 4B4QA 2J7MA 4DOUA 1VBA2 5JVVA 1RUC2 2CL2A 2FDIA 2RS12 3PL0A 1F35A 1VMHA 2Y0IA 4QQOA 5BV6A 5IFTA 3K4ZA 1JU4A 2Z79A 2IXKA 1FAYA 5FYCA 3U37A 1K12A 2JX9A 5KXBA 4CCMA 2JB4A 5J98B 1O8SA 2RJLA 2C5DA 3WNNA 2VTXJ 2WFF3 2A5ZA 4Q29A 4NIAA 2D6MA 3NRUA 4FXGB 1QF3A 2WS91 3SH3A 5A1FA 4B4PA 3E6BA 2D6KA 2X53S 4LKDA 1AX0A 4FPOB 1IS3A 2GN3A 2C4XA 3I2HA 4XACA 3DPRB 4YZ4A 1XSQA 2D40A 2UWCA 4LO8A 5LB6A 4E4DX 5FYUA 1L7RA 1VR3A 1UOJA 1A8DA 2AACA 4G9SB 4IEZA 4XETA 4RR3A 4D69A 3ZFGC 3K2OA 1DGRN 2JG9B 3ZKYA 4YZ5A 2ZGLA 1LU1A 3Q8AA 2VVDA 2VCBA 1LESA 1RXGA 3MFCA 1H9WA 2ZACA 4OHWA 2OZ6A 4E8CA 1RJ8A 3CLPA 1RUNA 5GZDA 5LCWL 1Q8VA 4NHKA 4ZZ5A 2VQAA 1W0PA 1ND3C 1IGOA 4Y4YA 4D6RA 4DZGA 1ULDA 4YGDA 3KT1A 4PI2A 2DCKA 1NLQA 3UKVA 2P3IA 4ES9A 3MBWA 2V5DA 4XDOA 4L9BA 3H50A 1M06G 1XNCA 2FCVA 2VW0A 4PHZA 1O59A 4F3JA 5JZGC 4LE3A 4JGZC 5FMCA 1UY1A 4PLMA 5IAVA 3VBUB 1XE0A 3ZYBA 5A3OA 5IVYA 2NP0A 3ZYJB 4DINB 3KV9A 2R0HA 1GOFA 4AVAA 1D0GA 3GZEA 2P3YA 1S2BA 3WY6A 5F2SA 2ZAAA 2PHWA 1GQGA 4QGNA 2W3JA 3RRDA 5FZ1A 3USUA 1S0IA 4EWAA 3OUJA 1H8TA 3QBQA 4B4RA 4CCDA 4R9CA 1PO23 1UY0A 2ZGUA 4FP3A 5A32A 3FC0A 1R083 3LDBA 3PUIA 3MIDA 3MI8A 1H9PA 3D4KA 1F9KA 4FT8A 1S4CA 1FNZA 3KD4A 1TME1 1SLCA 3H0OA 1LGNA 2GNTA 4FOYA 4ZU5A 4EE2A 4FFIA 1AR62 3NV2A 1AR72 2JG8C 5GLWA 1IPKA 3CJIA 5FZ8A 2BWCA 4FPLA 1CZSA 4EN7B 3LOIA 1JZ3A 4IEXA 1J1LA 3BALA 1JXNA 4KBZA 1YRZA 3IT8A 3KCXA 3PUQA 4XMAA 1RMU2 5FKBA 1YQ8A 2MEV1 5C4WB 5FRAA 4QWNA 1SLLA 2YC0A 4IXLA 4IV3A 1HB3A 3WUCA 2R073 1Z7S3 2W91A 2WN2A 2RR11 1UWWA 3ZSKA 4JGYC 3EQEA 5JXJA 4YM1A 2JKXA 4CCLA 5GLUA 3JBG3 4CEYC 4L92A 4XIOA 2KXLA 1WW5A 3CKHA 3AYCA 2A6XA 4WM8C 3C8XA 5DUUA 4LBQA 1BXHA 2YGLA 5BXXA 1RUD2 1T2XA 3TEYA 4AAPA 4KBBA 4S2DA 5JZGB 5ANNA 4MXVA 2VVEA 3CDZB 3JQXA 4QHZA 2WLQA 3D0JA 4F83A 1NCQA 5LA2A 2ZS6B 3WDTA 3S0MA 2XJTA 5A1LA 4HVOA 1TG7A 2HJIA 5C3QA 2JDNA 1RUF3 1W6NA 1EUUA 3CZUA 2ZCWA 3H3LA 5ACA2 5A7PA 2JG9A 4C0HA 1FATA 2R063 3CF6E 4TYSA 3OG2A 5L9VA 3CO2A 1OF4A 2WRAA 4Q4X3 3FE5A 4BJ0A 4UBGA 2DCJA 5FZFA 1NCQC 4OI2A 2QBXA 1IS5A 3PUSA 2F17A 2HWF1 1F4HA 3L2HA 3H1WA 2SBAA 4XBLA 5EJZB 4A41A 5C3SA 2LROA 1FXZA 3KMHA 3TN92 1OOPC 5ABJA 1NZCA 3H7YA 4MX3A 4C8DA 3WF3A 5C9AB 4BQWA 3WNOA 1AR71 2YPDA 4H14A 3W9AA 3WQ7A 4AFBA 2VQ0A 5JOZA 3AKRA 3POIA 1J58A 3LOBA 5BNOB 1XYPA 3NNLA 1VPHA 4NHYA 3WF2A 2A3XA 3POSA 1X8MA 3WG2A 3HIFA 2DBIA 3Q8BA 5HCAA 2AH2A 5LEJA 3IMMA 4OMDA 3T2OA 4LT5A 1CJDA 3AB0A 4OHVA 3OYWB 5FZOB 3ETPA 5E88A 4K7JA 2RMU2 3LF7A 1DZRA 2B45X 3DYMA 4Y3OA 4DB5A 4HONA 4YARA 3H1MA 4OUEA 2RS31 3CJIC 5KXEA 3HWJA 2WKKA 3AZWA 3WV6A 1EPZA 2J42A 1B09A 4DUVA 2ES3A 1ONAA 4CDXA 3C7HA 4QQ2A 5SV5A 1LHOA 4B1LA 4Y22A 4CP9A 1NX9A 1C28A 3BOWA 3BTZA 1LJ7A 3GF6A 3H9AA 4XMIA 3AMQA 3S7EA 2PLV2 1LGBA 4MH0E 4Q4V2 4HFSA 1W8ZA 2R16A 3ZFEB 2CGNA 4OHXA 2EXJA 3ZLIA 3VBHA 1FMD3 2A6ZA 1QWRA 4Y5Z0 5IYYA 2P1BA 1KGYA 4XF9A 4CTEA 5CKMA 4LOTA 1XNAA 1SLTA 4IW3A 1QJU1 2B9VA 3B7MA 4KQ7A 1W3VA 1C8NA 1CONA 1FMD1 2IXHA 1LHWA 2Z69A 3OGGA 1DYKA 4W6WA 4NN0A 3MF9A 4P9JA 4FAHA 3ZFGA 4FPFA 4URAA 1RUH2 1I6XA 1R1A3 2HEWF 2W46A 4JGZA 2RS13 4CCOA 1POQA 3WVJA 3WEZA 2JDZA 1UZWA 2DVBA 3UJOA 3IMNA 4BU2A 3VBSC 5IVVA 4PDWA 3QACA 2CWSA 3AP6A 1NOVA 4XUQA 1YQ6A 1A6CA 1UYXA 1EY2A 1K3IA 2XH6A 5H9RA 5FQ0A 4L11A 3IAQA 4ZKTB 4QKDA 1AL22 2A6WA 5EHDA 4CSWA 4FPCA 1D4M2 3NNFA 4JGZB 2FD8A 3A21A 4HN0A 4ASLA 3MW4A 3T08A 2WT1A 1JHJA 2Q4SA 4Y4RA 1KRIA 3MW2A 5D21A 5KXDA 1DQ0A 1TMF3 1XOYA 4W65A 2TUNA 4GJYA 3O1RA 4Q4Y2 1H1MA 4WVMB 5FYHA 1IHMA 3EXUA 1MQTA 3ZYPA 2ZHMA 3TYJA 4FOQA 1F31A 3NV1A 2D5FA 1RB8G 4Y33A 5A3PA 3W59A 5JOYA 4YZ2A 1YWKA 2EIGA 2VAUA 3AKQA 3KQ4B 4A3ZA 3V65A 1Y3TA 5D8AB 3QH6A 1JYXA 4I09A 2FDKA 3VBUC 5C8CC 2LM3A 4I30A 1RYYA 5H9QA 1J3RA 2QDRA 5CIRA 1H4GA 4BIOA 4HZFA 4ET7A 1W05A 1AR61 5FMOL 2C24A 3A4UA 5BNPA 5CADA 3K77A 2VZ1A 1BMV2 3WF4A 2A70A 5LBCA 3DN7A 3LA2A 4BXSV 1TME2 1PO22 1MS0A 5CFDA 3RNSA 1AHSA 3P5BA 4B8EA 1R082 1WLCA 4O65A 4TXWA 4CDUB 3MIBA 3OYWA 2DDUA 5C5TA 5TSWA 5CEHA 2IXLA 3VKLA 1G86A 1RIRA 5HCHA 5IFPA 2J1AA 3ZFEC 2ORZA 4GD4A 4QQPA 3MEPA 3MIGA 3WDWA 4OMCA 4CUCA 1O91A 2XLAA 4EROA 1OH3A 2SLIA 1RVF1 3I2JA 5K8SA 2ADEA 3JD73 1RUJ1 5E6HA 4CU7A 3M1HA 4W4ZA 1BBT3 5FV3A 5JOXA 3ZFFA 3M3CA 1SDDB 3HT1A 1W0NA 4IEVA 3T1MA 4YFZA 1QU0A 1Y9MA 1UKGA 5DUXA 1H2KA 2J1TA 2G9FA 3SHRA 4ZY9A 2VCCA 1VBC3 4CCNA 3WP4A 1KDKA 2ZHLA 3ZSLA 5FPXA 3KGZA 4HVRA 1BQPA 3I97A 3PDQA 5JDBA 1IG0A 2D6NA 4JDOA 4H55A 4LBJA 1W28A 3TB0A 3W58A 2WL1A 1HJGA 5EYXA 2HWC3 4ZHNA 1HN1A 2VGDA 4P02B 1YI7A 1PVXA 1S0EA 4JDNA 1BBT2 3N9PA 5JMCA 1SBFA 5LZ6A 2A6YA 3JQWA 5CFDB 4LBQD 3WQ1A 5JXGA 5JR2A 1ZBA1 2HWC1 1S0BA 1IS4A 1KS5A 2PHUA 4YLZA 3UKNA 2DCTA 1DYPA 2A3YA 4GKYA 1DF0A 4NPLA 1DQ4A 2BBAA 5L36A 2W08A 1R1ZA 4M3CB 1AXZA 2Y6JA 3R4UA 4CDWC 3WP5A 4BMEA 4E4HA 4BISA 4XBQA 1N1VA 3POBA 1XU1A 3NO8A 1AR93 4UT5A 1PNFA 4QPGB 5IK5A 1H8TC 1QEXA 4N9HA 2XPJA 1OFNA 3POGA 2VMIA 3AVRA 1T6GC 2XQRA 1YC61 4NAOA 4Q4W3 1W8NA 5F2WA 1FX5A 2P3KA 3AP9A 3NWKA 4J1WA 3WNPA 3JBG1 4FP2A 1CAVA 4QPIC 4AFDA 3GALA 4C1WA 3MZHA 4RHV1 2WNUA 5FYMA 4LUMA 2BERA 4DFSA 3GHNA 5ISLA 1XE8A 1RUC1 2BDRA 3WHTA 5LATA 4BLIA 1W8TA 3FFZA 4MSVA 1WMXA 1PZ7A 2WO7A 3N3HA 2BV4A 2Y0OA 2MEV3 5G04L 4D7SA 4CCKA 4EWEA 3O1SA 4QXKA 3J26N 1F5JA 4N7IA 3PHMA 3URFA 4AEKA 3RGBA 3WDVA 1HKDA 1SBEA 3A7QA 4YWAA 5BYNA 3IWZA 3JBG2 1QQP2 3LPFA 3RYPA 1ZRFA 4BQ2A 2JWPA 1W2UA 2GNBA 2VECA 3PMEA 3EYPA 5CISA 2IWGB 2D3RA 2BWAA 3DECA 3UV9A 3FUQA 3HN1A 1ZREA 1ZA4A 1VBD1 4FPEA 2C6SA 3LFMA 1N1YA 1HQNA 5FY7A 5FZ4A 3CZJA 3EB7A 4XF3A 4DXZA 2J1EA 2UWAA 5DZGA 3VDDA 4GWNA 1HQLA 2VMHA 3USSA 1EAH1 1UY4A 4EWDA 4LKEA 4YW5A 4QPGA 5FZAA 3ROUA 5J48A 2WO2A 3ME2A 3PVNA 1W8FA 1CAUB 2R1DA 5L73A 3D6EA 4K3UA 1LKNA 4HXCA 1N47A 2BNOA 2QFEA 4FTSA 3KVBA 1SFPA 4ASMB 2OQ6A 1U5ZA 2VG9A 4QGLA 1S2EA 2J1UA 2P3JA 2R32A 2VOTA 5I8SA 3THDA 3WCRA 5IHRA 1YJKA 1ND2C 3ITQA 5GLZA 3WNMA 4HVQA 4NHXA 1YQ5A 1WZXA 1HW5A 2WAOA 1KJLA 2PLV3 2D6OX 2UY9A 4OLLA 3U4XA 2D97A 1NLRA 2ET1A 2QZ2A 4BQYA 5LK7B 4D8MA 1V6JA 3FWEA 4GMP0 3MV01 1GP4A 1OVPA 3POEA 1L7QA 3RDIA 3VHRA 3OB8A 1MVEA 2NN8A 1AL0G 2VBPA 5IVJA 1QJFA 2EAKA 2XVKA 4EYUA 5JUVA 3ZXKA 3WINE 4DXTA 5LWBA 2Y6HA 1SG3A 2XR4A 2ZEYA 4QAWA 2V72A 2DU0A 3VBHC 5K0UB 4XIKA 1HRI2 2NMOA 1EAH3 5F7UA 4HK9A 4D3WA 3AMMA 4HANA 4JKMA 4AEJA 5FLIA 2Y33A 5KBFA 4E9KA 5C8WA 1MACA 2FCTA 4NPRA 3Q8FA 3WD5A 3W5NA 4EZHA 4DEVA 2BBVA 4CDXC 5AC92 2WNUC 5M0TA 3LD8A 1ZA7A 2VVFA 4IE7A 1UZVA 4QDQA 2WNEA 1AZDA 1JYTA 2HKXA 4EV0A 1W8WA 5LRRA 1SPPA 3TN91 3K3OA 4FTEA 3UYJA 4CDUA 3IBMA 2RM22 4P9YA 3CHXA 3ZM8A 2PXJA 4E2GA 2RHPA 2KR2A 2WFF1 1LRHA 1QKQA 3J7NA 3E97A 1W2TA 4NRQA 3OJBA 5D1IA 3WQ0A 1QJY1 4P9IA 2GNMA 1YNAA 2EAAA 3OBAA 4QDSA 3T09A 4AFMA 1CWPA 1FV3A 3FBYA 4YW1A 1G6NA 2VUAA 4XUNA 4ISRA 4JZRA 1ASJ2 5JSOA 2VR4A 3RZLA 4LIUA 2GU9A 4QM8A 2XKOA 5A6QA 2I07B 1W9FA 1AF9A 1IZ3A 2D6PA 3DV8A 1J1TA 4MGYE 5T5LA 5AFEA 2P5BA 1ZNPA 2ETEA 3JCIA 1F15A 4QQHA 4QDRA 3E6DA 1AR73 1NQDA 4IV1B 1XNKA 1OLQA 3HAGA 2BGOA 3I2IA 4Z82A 5FZ0A 1QDCA 3M3OA 1I5ZA 3WUDA 1Y43B 4QKBA 5KXCA 3S5AA 1X7NA 1O3SA 1ND2B 2FCUA 4K9SA 3C3VA 4LNVA 3H8OA 3I59A 1ZVFA 2PQSA 5A7WA 1LODA 3A0NA 2UURA 4ZS3A 4AL9A 2JKBA 1QJEA 4LQRA 5T3NA 3UT0A 1W39A 4QKFA 1Q56A 4UF0A 3O1PA 2DFBA 3KHCA 5CFDC 3TWIA 1W9SA 4IEQA 2IUWA 4TLFA 3K4AA 4XE9A 1ULPA 4E4SA 4DXSA 5L19A 4DMIA 4OUMA 2PHXA 3D3AA 4RS5A 4XFFA 5KHGA 5CG9A 1S0GA 3SC7X 4N90A 5FY9A 5IAXA 1F4AA 2XOMA 4LJHA 1VMJA 1RUG1 2HWD3 2PAEA 3WT3A 4BQ5A 4D7TA 1HDKA 1XXNA 1RUE3 5CZKA 3WP3A 2BVBA 4LE4A 4R4XA 2R043 1ND3B 1ACCA 1ZZ9A 2DVAA 2FZ1A 1R091 2R1BA 2YFZA 3HBKA 4FPJA 3ZPYA 1ULEA 1PGSA 1UOFA 1OD5A 3AP7A 4HBNA 1AXKA 3DCQA 2VM9A 3P1IA 1WBFA 2ZZJA 4GB31 4IV1A 1MEC1 2DV9A 4L97A 2XJRA 1RUJ3 1UD1A 4XBNA 4RGKA 4W8JA 4RQPB 4FAGA 3KVAA 3N36A 4PIXA 4ZPIA 3VHNA 3B69A 1S55A 5J96B 1S0CA 4UFIA 4M3CA 2UYBA 3THPA 1YJLA 2W1QA 4QX1A 4YW7A 4BQ4A 4G4FA 4HPKB 4AW7A 3AP4A 3VDDC 3AK0A 4OZXA 4KMQA 2IVJA 1Z78A 2QQOA 5IK7A 1ASJ3 2ZX2A 1IKPA 1MQTC 3K3NA 4JQRA 2WR9A 1UXXX 1GOGA 3M4FA 4XFAA 4CRQA 2H0BA 1OOPB 4A4AA 1PVC3 5FZMA 5A3WA 1GSLA 1GU3A 2JDHA 5L7OC 3O1TA 1ZX5A 3VBOB 3VDCA 3SCHA 4LHNA 3ZOIA 4QB6A 5F6LB 1IPJA 5CYYA
chains in the Genus database with same CATH topology
2D7FA 1NCRB 1J3PA 4IEOA 1CGPA 5I93A 1PK6B 4IQPA 1XRUA 5JZGA 4AI3A 1G9AA 4GH4A 1BKZA 5C4WC 1Q8PA 1G9DA 4CDQC 1PNGA 3OD4A 3AZYA 1ENSA 3E6CC 2XWJB 2W0XA 4Z07A 3PJQA 4QPIA 2DUOA 3AM2A 2XJUA 4MXWB 2IFRA 3IDBB 3J8F2 4RS5C 1VBB1 4CDWA 2Z42A 1AX1A 1ZYBA 3QCWA 2ZJCA 2OVUA 2WSVA 3FJSA 2FQPA 5JSRA 2RS11 4MZUA 5FLJA 2HWE3 4K6BA 1GNHA 1LOGA 1H1AA 4LULA 5D8AC 3WXPA 3M2MA 5GZGA 1Q3EA 4W6XA 2XLFA 2N7GA 2D5HA 4BWOA 1URXA 4HSJA 4JRAA 1PK6A 3MLJA 4B29A 1RUE1 1AYM3 4LHKA 1ZBE1 4B7KA 3RG0A 4MGKE 5CU1A 2DF7A 2DVFA 4AEDB 4KGQA 4YVSB 4WVMA 1BZWA 3KT4A 5CFCA 2I45A 4DY5A 1RHI2 4GULA 2IZWA 1YFXA 1O5UA 4AHYA 2G9GA 4GB32 2ZKNA 3N7MA 4RHV2 2WINB 4WBBA 1DGWA 2PN5A 2R062 4XZPA 2A7AA 4NWVA 2RS53 3RI9A 2ERFA 3WR0A 2IXCA 3MIFA 4YRDA 1H1IA 2WC2A 1CPNA 1BEV2 2QCSB 3IDCB 4PBPA 2QJVA 3POWA 1POV1 5J37A 1AJOA 2VNRA 3GZUC 3SITA 2BEOA 3LCPA 4BZ4A 1FI2A 1C5HA 4CEYA 1ULGA 4PQ9A 4XTMA 1DBNA 5BNPC 1ZBA2 2JD4A 5C9AC 2VNGA 4CDQA 4M0HA 1VBA3 1SCRA 1XU2A 2VUJA 3KZ4C 3M8LA 1W6MB 1SLIA 3BODA 1VB4A 5JPNB 1O7FA 1OA4A 3VKNA 1YFUA 2ZX4A 4PIZA 3HR9A 2VU9A 4Q4W2 1AR82 4AK3A 4AFAA 1BCXA 1B35A 1DIWA 1VBE1 4SLIA 2WZR2 3VHPA 1F2NA 3CJXA 3RYKA 4QPYA 5BY5A 1PO12 3B93A 3ZFGB 2BW8A 2Q1ZB 4WM7B 2GSYA 3UL2A 4K20A 4ATEA 1LENA 2GH8A 1D2QA 4LHLA 5T52A 5FFOC 1EP0A 1FOD2 4WM8B 1OMIA 2WQ4A 2ENRA 4WV8A 2VPVA 1MEC2 3AXEA 4QGMA 1KITA 5EWSA 1BEV1 4URTA 2NLRA 1CX4A 4YGCA 1R092 3MLLA 5BNOA 4PCRA 2OPKA 1DU3D 4IL7A 1HRV1 3FHIB 3AZZA 2ZMKA 2UWBA 3OCPA 2XG3A 2ZA9A 1GV9A 1CAXB 4Y24A 1E57A 5J7MA 1BK1A 2QQPA 3FUOA 3NAPB 5T5PA 2FMDA 3N7JA 2VH9A 5KHJA 2CYFA 4CEWA 2Q8OA 2R042 2JE7A 1W6NB 4XJZA 3IPVB 1MZ6A 4S2FA 4ITCA 5SV8A 2NPIA 4Z2WA 1KQRA 1RUI1 1V6MA 1WCKA 2IXIA 1YFYA 4Z1VA 3HD8B 2VNOA 5K0UA 3SH5A 1W6OA 2FBEA 2ET7A 3VGIA 4DRVA 2ZGSA 2TBVA 3ZN6A 4AVCA 3E5XA 1XNDA 3KCCA 3UJQA 1X33A 3R0RA 1RUI2 4GKXA 3JU9A 5JI7A 2HWD2 1ASJ1 4COVA 2DFCA 2PHDA 1WCDJ 1W6QB 4KU7A 2ZGQA 4N53C 3DKWA 2GC1A 3H8UA 1R1A1 5DXDA 4YG6A 4CEYB 4YVSA 4COUA 1OOPA 5ABJC 1RUC3 4JVAA 2RM21 4XQWA 5LEKA 1GICA 4XF4A 2AR6A 2VW1A 1LHUA 1QOTA 2EXKA 3OD0A 4A7ZA 2ZTNA 2E53A 1G9FA 1XE7A 1MEC3 4TWTA 4CDUC 4AE2A 2NQYA 4RA0A 2F4PA 2NMNA 3DPRC 4AGGA 4CZSA 3BB6A 4E27A 4R52A 1LB2A 4UW5A 1BVP1 5AC91 1CAVB 1RUF2 2WT0A 3FFQA 1C8M1 5CFCB 1J59A 2YY1A 4BLJA 1RJ7A 2GC0A 2H6BA 3WDUA 4E2QA 3RS6A 2I2SA 1ULCA 4C91A 2A71A 2XB6C 1UPSA 3AP5A 3LGRA 1CD3G 4L2NA 1HRI3 2CAUA 1PVC1 5BNNA 1CR7A 1NCRC 4LA3A 3PVBB 4AI2A 4DRRA 1SFYA 1S0DA 2NYYA 4Q1RA 4COYA 4X6QB 1YLLA 3M3IA 5HBAA 1OKQA 1AYN2 4NVPA 1AR81 2VMGA 2AZ5A 1L3JA 1YO8A 4I3GA 5DDJ1 1UW8A 2OYZA 4GH4C 1W0OA 2JXAA 4Q8KA 3RQ0A 1POV3 2HWF2 1BEV3 1UMZA 2DUQA 2RMU3 3ZXDA 2E7TA 3R4SA 4IEYA 2CGOA 4OI4A 1NA1C 1Z0HA 4GB33 2WA4A 1C4RA 3BCWA 3H1YA 4Y1UA 1RGSA 5ACA1 4N53A 4LBNA 4YYOA 4DNYA 4Q0PA 1JN2P 5B2GB 2A73B 4FOVA 1MS8A 4AQSA 2PFWA 5ABJB 2C9AA 3O0WA 1G7YA 1PGL1 4JCKA 3C2UA 2GC2A 1EV13 2GZWA 3INAA 4E2SA 2B39A 1UZYA 2D44A 5EYYA 1D0HA 1GNZA 1DQ5A 5GLVA 2YXSA 5IK8A 2ZX3A 1OQDA 2YPJA 2RJKA 4AQ2A 4CDWB 4NHLA 4OVEA 3M3EA 2WJSA 2CNAA 2WZPP 1WMFA 1CPMA 1LTEA 5A33B 2BFUL 3WW4A 5ACA3 4N7UA 3NAPA 4BH9A 4I3PA 1VBA1 3SNMA 3QOPA 1PO13 4KWKA 3ZSEA 4LUKA 4CEWC 4FO9A 1PO21 4MYEA 3TAYA 3KQRA 5CVRA 1LOEA 2BTVC 4DY3A 4BQ1A 3AX4A 1ZBE2 4N43A 1FOD3 3ETQA 2X5IC 1ALYA 5BUVA 4XF0A 1ENXA 3EBRA 4AYUA 2WT2A 4X6RB 3K48A 5H9SA 5KHIA 3NL1A 4YVWA 4AVVA 3RYRA 1QH6A 1Q8QA 4META 4LTAA 2DCZA 4FPYA 3SXWA 3FBMA 4M0NA 1N1SA 4FQ4A 4YGEA 4DS0A 1I1EA 1UKRA 1YXWA 2EF6A 2ZGPA 4HLTA 1JW6A 5FTTC 3D0SA 3ALQA 3ILFA 2UY8A 4HPKA 4KU8A 1FT9A 1WBLA 5GLTA 3ZO0B 3U0ZA 1CJPA 1DQ1A 4PDWB 4LLFA 4OHYA 1QJU3 2LUWA 4FXKB 2XJQA 1ULFA 2B8MA 3E5QA 3AMPA 1H8TB 2GNDA 1D2SA 2DVGA 4JAAA 2WQZC 4WM7C 3AKTA 4FQZA 1VBD3 4HMZA 3IM0A 2WNVB 1B35C 3V0BA 5BNNC 1RTVA 2QVSB 3D82A 4JTOA 2ZGNA 3WG1A 4LLOA 2RM23 2ZGMA 4O9GA 1NA1B 3RWNA 1C1LA 3VBRB 3VBHB 1NY71 5GM0A 2IXJA 4N43B 4IEUA 5JR7B 5A3LA 3L2YA 3BPZA 3GZAA 5FO8B 4WVZA 1WGPA 2PLV1 3EHKA 1DG6A 5F9TA 4R4ZA 2FHRA 1V00A 4AFCA 5T50A 1BMV1 3LA3A 2ZHNA 4RR3B 1YFWA 1QJX1 1RUI3 5JPMB 3ZMNA 3BTAA 4M3CE 3V56A 1LOBA 1SLBA 1LOFA 3P3NA 1V6IA 2AGSA 2TEPA 4BHPA 1ZZ6A 1H4HA 5JI9A 2XBO2 1JTZX 1LHVA 3BIWE 4FPKA 1GLHA 1WLWA 3OTFA 5FAXA 2W39A 5I0SA 3DF0A 4Q4X1 5AVPA 2R0FA 4GWMA 3LAGA 1TQ5A 5CFCC 2B5HA 3ST7A 3ZXLA 2ZKLA 1MR5A 4OUSA 4H3WA 4BA6A 1ENQA 3FLRA 3OBTA 4RFT0 1N3QA 1H2NA 3L9JT 3VBRA 3I8TA 4OULA 4XFGA 3VBSB 1CAUA 1WUVA 4CP0A 1HRV3 2IFWA 4UW4A 5A33A 1AL21 4XXAA 5EJ3A 4Q26A 5CBLA 3VV1A 3LB9A 4YVWC 1OA2A 2BYVE 2XHKA 1Y9QA 4YM2A 1U5YA 5CA6A 1ZZBA 4OI1A 3MGUA 1MS9A 4INDA 4AHXA 1FYUA 2ATFA 2D98A 3N35A 2CWMA 4AG4A 4GALA 3NV3A 1D4M3 5JWPA 1V9U1 4R9BA 3TNQA 4N43C 3NAPC 1VBC2 4Q4Y3 4X8PA 5C4WA 3ZSMA 1ND2A 3V0BB 1U0AA 5DZFA 1V6LA 1RUH1 1RL3A 1QJY2 1WCSA 4KWJA 1UIJA 1UPIA 2MNGA 2RMU1 4JRLA 2TNFA 3RSJA 2XWBB 1G9BA 3U07A 1GBGA 1AYN1 3U11A 1AR83 1OPOA 2GALA 4RR3C 1D4VB 5HXVA 1JOJA 1UF2C 4C1XA 3PVOA 4BOWA 4F8AA 2ARXA 4RD7A 4LO7A 5E89A 1UIKA 1LOFC 4NWWA 4BE3A 2XBO1 3APBA 1DGLA 3I54A 2AYHA 3VZKA 4K1ZA 3VZNA 1AXYA 2D93A 2KA3A 1V6KA 1ZZ7A 3WDXA 2XVGA 1OHFA 2V09A 3AZXA 2YDEA 1JBCA 2BQPA 1UU5A 5KC6A 3KT7A 3FLTA 1RUOA 1CVNA 1W6OB 2JG9C 2VOKA 1SCSA 1PGW1 1QNYA 4UBHA 4AEDC 2QE3A 4PBOA 2PA7A 3GNEA 2P17A 4XJ9A 5KWRA 4ZU4A 1U5XA 3MFAA 2CTVA 4MV2A 1TEIA 3V64A 2O8QA 1CAWA 2X29A 2XJVA 1NCRA 2E7AA 5KHKA 3B9IA 1CIWA 2C1FA 1VRH1 2WA3A 2BPA2 5I0RA 4QMAA 1GZCA 1SQ4A 2P34A 1QXRA 1REFA 5AFBA 2Y26A 2ZGTA 4Q0VA 3WW3A 3VL9A 1DQ6A 1GKBA 3ZFFB 4GH4B 2LALA 1ZRCA 1H2LA 3JB8A 2G4IA 1QOOA 4Q0SA 2BUKA 1PIV3 1AR91 1QQP3 2JG8A 3ZXAC 3VBOA 1QJZA 4XTPA 1TMF2 4I0BA 2IC1A 3MPBA 1JH5A 2JECA 3I2DA 3SH4A 3WW2A 1LECA 1NXMA 2D3SA 4HSLA 3ZYGA 4HT1T 3ZFFC 1HLCA 4RGGA 2UYAA 1O3RA 4JGYB 4XDQA 5LK5A 1M4WA 3B3QE 4LBLA 2QNKA 1H2MA 4A7KA 2CV6A 3RJRA 4Q27A 3OPZA 4XF1A 2VW2A 3M70A 2WZR3 5A32B 3TNPB 3ZVXA 3AMNA 2HWB3 3M7AA 2E9QA 2ZOEB 3KS7A 3TBDA 2LTNA 3O0XA 1W6MA 2UU8A 3SCGA 4FTBA 2MPFA 3N7KA 1JUHA 1QDOA 3KGLA 3I59B 1WW7A 1DGWX 3VBUA 2PAMA 4UW6A 5JIAA 1BBT1 3ELNA 3JD72 4KH9A 4Q4W1 2VOVA 4AVSA 2GMEA 4LBMA 1TE1B 5CG8A 1AVBA 4X8NA 4XFCA 2RR13 1VAVA 2B9UA 4GXLA 4Q8LA 4W6YA 3LWCA 2Q1MA 4N9IA 3THTA 3R05A 1U12A 4NHMA 1G8WA 4A7YA 5DZEA 4HN1A 1EYBA 1RMU1 2E51A 3KM5A 2WS92 4CDXB 5L7OB 2JICA 3ZXEA 1W6QA 3K51A 1HX6A 4AF9A 2XJSA 4KG8A 4HETA 4IV3B 2H0VA 3GYDA 5BNOC 3NW4A 2Q30A 1UZZA 3VDDB 1LU2A 3OY8B 2WFPA 1RUD1 1COV3 3H3ZA 3VBSA 2P2KA 1UU4A 1UU6A 4LR4A 4QQLA 3FLPA 3U10A 3J9SA 3AJZA 1TNFA 1R081 4DQAA 2R061 2AUYA 5AVAA 1LOCA 4FPGA 5AC93 2X5IB 3VZMA 3UKTA 1O3QA 4ES8A 1DGRA 1RHI1 1QQP1 4HKWA 4UXAA 1TNRA 5GALA 4LBOA 4EN0A 4M00A 1I9RA 1NG0A 4AVTA 3HBZA 2WLPA 1JYCA 1RUNA 3VZJA 4CEWB 2BNMA 5I0UA 1NE6A 3GBGA 3WHUA 2F6BA 3JD71 1J3QA 2V5YA 3OBRA 3WZ1A 2QZ3A 4UW3A 3ZXFA 4MXWA 3VL8A 4AWDA 2ZX1A 3WX5A 1Z7S1 4RQPC 3ZXJA 4Q4V3 1DQ2A 2OZJA 1HIXA 2HWE1 3S6PA 4OFGA 5C9AA 1AL23 2Q0AA 3GHMA 4V1PA 2B42B 1RINA 1WA4A 2ZBJA 1PMIA 2HWB1 2GMMA 1ZBE3 1VBB3 1AR63 2W68A 3RMYA 1ENRA 4F7ZA 1PGL2 4Y1VA 5CNAA 2PHLA 5I8YA 5J36A 1WLDA 5EZWA 3EO6A 4BPZA 2YROA 2O0OA 5A3MA 1KDMA 3S30A 3WW1A 4KNCA 2OIIA 4YFWA 4BYYA 4C0BA 4WM7A 2WS93 2DTYA 3M3QA 4IV3C 3SMHA 1VRH2 1TMF1 2ZPXA 3J8F1 3TRSB 1ZRRA 2RS52 3WOGA 1WMDA 3RJ2X 3WG3A 1PIV1 3OF1A 3ZXGA 2DWRA 4XHXA 3VZOA 1ZZCA 4AI1A 3AZVA 1X36A 3ZSJA 3B9CA 1KFUL 2CY6A 3AJYA 3LKJA 3PNAA 4MVTA 4CYDA 5FBZA 4RQPA 3ES4A 5CB7A 2YUEA 3AXDA 2DUPA 1Q8SA 1VBD2 2QUOA 4I2OA 1X82A 2YV8A 2GC3A 3IKWA 4L99A 1RUJ2 4YM0A 5C8CB 3TOJA 2RS32 1NCQB 3J8F3 5EFUA 1OA3A 4YGBA 2WFF2 4O9EA 1A3KA 5J09A 5HCBA 2HWF3 3ZFEA 1HV1A 4FOWA 3CNAA 5K0UC 3WG4A 5F6KA 4XEZA 2EVXA 3O5SA 4XILA 3UK9A 3ZYRA 5JOWA 2Z5WA 1IKQA 1LCLA 1V6OA 4ORFA 4OHZA 4HKOA 4WVWA 1MS1A 4YNIA 4EN6B 4Q4Y1 1DDLA 1S1AA 1BJQA 1NXD1 2WNUB 4ATFA 2ZZQA 4DPNA 5EV7A 5K9YA 1PHMA 1V9U3 2HEVF 5FPZA 4WZCA 4MUVA 1D4M1 4Y26A 5C8CA