3POWA

Crystal structure of the globular domain of human calreticulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
251
Chain Sequence
GREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calreticulin
publication title X-ray structure of the human calreticulin globular domain reveals a Peptide-binding area and suggests a multi-molecular mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 76
structure length 251
sequence length 258
ec nomenclature
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3powA01
1F5FA 1I3HA 1DZQA 5SV8A 3W59A 1WW5A 4BMEA 1QOSA 1LGBA 2SLIA 1MS4A 3JUUA 1VAMA 1Q8VA 2NM1A 1TEIA 3BOPA 3ENRA 5EXOA 3AZVA 3RMYA 1SBFA 1MVEA 4P14A 1SLCA 2DUQA 1XQNA 4U36A 1CONA 2ZMNA 2DVGA 4Q27A 2R49A 1S0IA 2W68A 2AGSA 1Q8PA 4AGRA 3DGTA 3INAA 4Y1ZA 1JW6A 4XXAA 3AX4A 4P9XA 1Z78A 1YO8A 1UAIA 3RS6A 2DTWA 1CPMA 1LHOA 4FPHA 3HN1A 4YW3A 4YW2A 1HQWA 3SLIA 4YM2A 1C1LA 1DQ6A 5EWSA 3KQRA 2DVBA 5T52A 4XJ8A 1MS1A 1SLAA 1PZ7A 2A6ZA 1ULEA 5JOWA 2NP0A 4P9WA 2D7FA 3AP4A 2CWMA 5HCBA 3USUA 1X50A 3AZXA 1OQ1A 3WDVA 2CL2A 1DYPA 1LOFC 1QOTA 1QDOA 5T5JA 2GMPA 1V6LA 2VY0A 5IUQA 5T5PA 1WBLA 5H9PA 4XZPA 1MS3A 4FVVA 5GJ6A 2ZKNA 3A0KA 1LHVA 4FPGA 1MZ5A 4YM0A 3WDWA 4FPOB 1WCSA 4XBNA 3OYWB 5T54A 4XJZA 3NWKA 4FPCA 1W6OB 2LTNA 4NOTA 5GZCA 3LCPA 1GZCA 4LBQD 1G8WA 3AZWA 1IS5A 2R0HA 5E89A 5GM0A 1N1TA 3FUQA 4Z8BA 2A6YA 1V00A 4XMIA 3H0OA 3AP5A 3VKFC 4K20A 5L73A 3AYDA 1G9FA 1MZ6A 3A4UA 3O0WA 1ENSA 2YMZA 4Y1UA 5CNAA 4BQ1A 1AX2A 1G9BA 3MW2A 1W6PB 3POWA 3R4UA 3ZXLA 1GV9A 1LEDA 2ZGPA 3HMYA 2ZABA 3QCWA 4BMBA 2ARXA 4D69A 2D43A 2D6PA 5CB7A 5T50A 3L2YA 5H9SA 4C1XA 3ZSLA 4PBOA 5IK5A 1QOOA 4U2AA 1ONAA 4BOWA 1QMJA 2ENRA 3IPVB 1ZA4A 3AP9A 2JE9A 4WV8A 1APNA 4WZFA 5JVVA 4YZ5A 3B00A 2YZ4A 4ZKTB 1BJQA 5JMCA 1AJOA 2DTYA 2WT1A 4Y22A 1BKZA 4PQ9A 1WUVA 4GWNA 4ASMB 1FYUA 4M3CB 2WQZC 4UW3A 2EXIA 1YXWA 3APBA 1N3OA 2I2SA 4FP2A 5KXEA 2UWBA 1LOEA 1N47A 2D6MA 2ERFA 2NMNA 4FPKA 3WG3A 5JOXA 4JCKA 3D4KA 1MS9A 3I4IA 4KBBA 4IQPA 3TB0A 3N7MA 2RHPA 3MEPA 2ZHKA 1V6OA 3MW4A 4Y20B 3OYWA 1FV3A 5T55A 1CIWA 3FLTA 2ZGLA 1W6OA 3R4SA 4AGVA 3UJOA 1DQ0A 4FPJA 3ZVXA 2A3XA 2A3WA 2EF6A 4LBKA 3RMXA 4R9AA 2NZ9A 4YW1A 4XIKA 3VKMA 4WVWA 1C57A 5GALA 1S0EA 4GKXA 4XILA 1KQRA 4DS0A 2WKKA 2GNTA 4HANA 4XHXA 2VXRA 4AYUA 1KDMA 5GZDA 2ZGOA 4R9DA 2OUHA 1W6PA 3IKWA 5GZFA 1LULA 3PMEA 4BM8A 4FPYA 2DUPA 4FOVA 4FQZA 2PELA 1F31A 3Q9OA 5FRAA 1C4RA 1Q56A 2BQPA 3I8TA 3WV6A 4NO4A 2WLQA 1BQPA 3QLQA 5H9QA 1CESA 4FOQA 4YGEA 1BXHA 1A78A 1Q8OA 3IPVA 3ILRA 3V0BA 2A70A 2DVDA 3WG4A 1W6QB 1UMZA 4PF5A 1D2SA 2OUJA 1LGNA 5GLWA 3OJBA 1DIWA 2P3IA 4XYXA 3AYAA 2CY6A 4M3CA 1HKDA 2JDZA 1N1SA 1SLIA 1YIFA 3SISA 4ZXKA 3ZSJA 1CVNA 1IOAA 2A6WA 4DQAA 2VW1A 4W65A 1WW4A 1JOJA 1H9PA 1S0BA 2A5ZA 2AUYA 3PVOA 4Y20A 3N7KA 5FREA 5KXBA 3ILNA 4R9BA 2E7TA 3WDXA 1DQ2A 2GNMA 3O5SA 1AZDA 5DZGA 1LJ7A 3T2TA 2ARBA 3M3OA 3BODA 1J1TA 1WLCA 4XTPA 3W58A 2JECA 1QGLA 1DBNA 1UZZA 2AR6A 1UL9A 4Q1RA 2NYYA 1QF3A 4DPNA 4TYSA 4YFZA 1CQ9A 4RA0A 1QNYA 1SBDA 4XJUA 5GZEA 2ZGMA 4LBQB 5IT6A 3UK9A 4Q26A 1MS8A 1LOGA 1GICA 1O4YA 1JN2P 2JE7A 1V6NA 1AX0A 1V6KA 2P3KA 3RSJA 1FNZA 3HR9A 3WDTA 2OVUA 1N3QA 1YRZA 3M1HA 3V64A 1S0GA 2GN7A 2C5DA 4FPFA 2A75A 5DG2A 2GALA 1W6QA 2D3PA 2R1BA 1Z0HA 3N7JA 2ZAAA 4BPZA 3VV1A 3LSDA 3WZ1A 4ISQA 5JLVA 1MVQA 4RL7A 1LHNA 1DGLA 4YLZA 2W52A 5DUWA 3FLRA 4L8QA 1ULGA 2D6LX 3N3HA 1G9AA 1VAVA 1ENQA 1KDKA 1GZWB 1QNWA 1DYKA 1MR5A 2C9AA 4CTEA 2ZZJA 4YZ2A 2H0BA 1QKQA 3N7LA 3NV3A 1VALA 4TZDA 1G7YA 1V6IA 4AVSA 3ZPYA 3ZYPA 5CBLA 4YZ1A 2YROA 2GDFA 5E88A 3AP6A 5HCAA 3WG2A 3WUDA 1LU2A 5F5QA 5KXCA 2DVAA 3PJQA 2ES3A 2P37A 3BIWE 4GA9A 4LBLA 1W0PA 4XHBA 4YG3A 4AGGA 4M00A 3BTAA 2ZGTA 1WBFA 2CYFA 3WHTA 3AYEA 2D6KA 5IK7A 3MW3A 3ZXFA 3NV2A 5CAZA 2DURA 1N1YA 2ZHMA 4SLIA 1KITA 2ZGKA 4BLIA 2E51A 5GLZA 3ASIA 3B3QE 4LBQA 1JBCA 1QDCA 1UX6A 3CNAA 1C1FA 2A6XA 2ZMKA 3POSA 2UWCA 4Y26A 1JHNA 1CN1A 5EYYA 1S1AA 2W39A 2ZGQA 4C1WA 2V5YA 4YGDA 2A71A 2NMOA 4YG0A 4ITCA 5GLVA 1LOCA 5DZFA 1MS0A 3T1MA 4Q8KA 3WNXA 1MACA 4XJWA 3WOGA 4DRVA 1RINA 4DFSA 3OBTA 2Z42A 3UJQA 1GNZA 5E8AA 4PBPA 3M2MA 3ZXEA 4YG6A 4YGCA 1GSLA 1FATA 2D44A 1AVBA 2YY1A 1A8DA 4FOWA 3RRDA 3IMNA 3ZYRA 4MYEA 2EXJA 3SH5A 4BLJA 1N1VA 2ZA9A 5IK8A 1GZWA 1R1ZA 1KRIA 4JC1A 4K1ZA 4XJAA 2PHFA 1SCSA 3OBRA 4FP3A 4GKYA 5IK4A 1CR7A 2VW0A 5T5OA 1GKBA 1WD4A 2A3YA 2GNBA 1FV2A 4XXPA 1GBGA 4AWDA 2ZGSA 1W6NB 2ZHNA 1UPSA 3KM5A 3DUIA 1WW6A 4GALA 4FPEA 2R16A 4F83A 5CA6A 1AJKA 5GZGA 2W08A 4YZ3A 2WSUA 3T1LA 2D3RA 3M3CA 1IS4A 2PHRA 1YYNA 3SNMA 1S0JA 3VUOA 1VLNA 2ZGUA 2EAKA 1BZWA 5KXDA 4M3CE 2A6VA 1SLTA 2DV9A 5DZEA 1YI7A 2B7YA 4PCRA 4Y24A 2AYHA 3SH3A 5DUUA 2FMDA 5LK5A 1LOBA 3ZXKA 2EIGA 1B09A 2CTVA 3C2UA 1IKPA 2P2KA 4XDQA 1GLHA 3ZSMA 3AXDA 2AENA 2VW2A 3WDYA 4WVVA 1LEMA 1IS6A 2E6VA 1OFSA 3IN9A 1G86A 3AP7A 4YZ4A 2D6NA 3AK0A 4AVTA 1FNYA 1S0CA 3A0NA 3PVEA 5H9RA 4YW5A 1S0FA 5HCFA 1LESA 3GALA 2AREA 3TAYA 5BYNA 4YW4A 3WG1A 1LOFA 2P34A 1HDKA 5AVAA 3WVJA 4UW4A 3VKOA 1DQ4A 1RIRA 1N3PA 1LU1A 2E7QA 1VIWB 4YM1A 1LECA 1W6NA 3VKLA 1IKQA 2WSVA 1GZ9A 1RITA 3SITA 3RG0A 5F9TA 1LGCA 1JYIA 2DVFA 4K21A 1SCRA 1DQ5A 5T5LA 1FX5A 2UURA 1UZYA 2VU9A 3N35A 3OY8B 4FOYA 4I30A 4Q1PA 3B9CA 5DG1A 3POYA 2XG3A 4XBQA 1GNHA 2FHRA 4FQ4A 4YFWA 1WW7A 2DWRA 2GMMA 2WNEA 3VKNA 4YM3A 1DFQA 3M3QA 1DHKB 2EALA 5EYXA 1W6MB 1O4ZA 1CPNA 2CWSA 1QU0A 4R9CA 1WLDA 3SH4A 1GANA 1LHUA 3V65A 3JU9A 4Y22B 4GXLA 3V0AB 3O0VA 1ULDA 1WLWA 4UW6A 1HLCA 1SFYA 3WHUA 1G9DA 1I1EA 2HYKA 4XE9A 1AX1A 3O12A 4LBMA 4M3CF 2UWAA 3WDUA 4ATEA 4OZXA 1LCLA 2JD4A 4P9YA 2DU0A 2GNDA 1EPWA 4LBOA 5DXDA 1W0OA 4DRRA 2R0FA 1PZ9A 4XBLA 1Y7BA 3FUOA 3FFZA 1SLBA 2ZACA 1LTEA 3D5OA 2NN8A 1UKGA 3B69A 2XB6C 2ZGNA 2LALA 4HL0A 4Q2FA 4Q8LA 4XTMA 1LODA 2V73A 5JOYA 2D6OX 1PZ8A 2PHTA 3AJZA 4XMAA 4FPLA 3ZSKA 5JOZA 4GWMA 2R1DA 1NLSA 3M3EA 1AXZA 4XOGA 2YXSA 3ILFA 2ZGRA 2PHUA 1WD3A 4XJ9A 3O0XA 2A7AA 2P3JA 3PVNA 4K1YA 2EXKA 2VH9A 3NV1A 3N36A 1CJPA 3MPPG 3OY8A 2E53A 4YGBA 4CRQA 2CNAA 3U4XA 1LHWA 1ULFA 2OW4A 2G4IA 3D6EA 3FBYA 5GLTA 4CZSA 3V0BB 1SACA 1W6MA 2ZHLA 3WCRA 1AXYA 5DUXA 1V6JA 4JRAA 3ATGA 3GNEA 3V0AA 3OGGA 3IM0A 1S0DA 4XIOA 1SBEA 2DU1A 2JKBA 2WJSA 2Q5TA 3AJYA 1G9CA 3WCSA 1KJLA 1LOAA 2JJ6A 1D0HA 4Y1XA 2TEPA 5GLUA 4ATFA 3ZXJA 1SLLA 1OKQA 1Q8QA 2DUOA 3RQ0A 1FAYA 2VUAA 4LBNA 4Y1YA 2GN3A 1U0AA 1F9KA 2WT2A 1A3KA 3AZZA 4ISRA 1AF9A 3AZYA 1H30A 1JXNA 3UL2A 1ENRA 2PHXA 2D3SA 2EXHA 1DLLA 2SBAA 2AH2A 1ZM1A 3R05A 3OPZA 2GMEA 2KM2A 4LBJA 4M01A 1UN1A 4UW5A 2ZBJA 5JDBA 3USUB 1IS3A 2ZMLA 5DUVA 1LENA 2UU8A 2YV8A 1AXKA 1DQ1A 2DYCA 1JUIA 1V6MA 1GYKA 4AVVA 3FLPA 1MS5A 1BYHA 1HQLA 3NV4A 3AXEA 4H55A 1JYCA 3B01A 4Y1VA 1NXD1 1Q8SA 1URXA 1ULCA 2WT0A 3WLUA 3AFKA 2PHWA 3WUCA 3AYCA 1H9WA 1KJRA 3LSEA
chains in the Genus database with same CATH superfamily
4LE3A 1OVPA 1AL21 1F5FA 4GWIA 5C5UA 5EP9A 4AK3A 4OQ8A 3JUUA 4BQXA 1MS4A 1KS4A 4JHTA 3VBHA 3RMYA 3ENRA 4AEDA 1SBFA 5L7OC 4AVBA 1X82A 5FYMA 1SLCA 5F8PA 2W47A 1P8JA 4U36A 1CONA 2VC9A 1ALYA 2W68A 1S0IA 2VZRA 4YVWC 3VBSC 3L9JT 3JD72 1Q8PA 4AGRA 4B8EA 3GDBA 4YRDA 3INAA 1JU3A 1JW6A 3W5NA 3AX4A 4Q4V2 5F2SA 4AI2A 3MUZ1 5CU1A 2DFCA 4FPHA 3ETPA 1HQWA 3LEKA 3WXPA 2CSGA 1DQ6A 3ZSEA 3PU8A 5T52A 4XJ8A 2C6SA 1PZ7A 2VZQA 3NRUA 2A6ZA 5JOWA 1OF4A 5FK7A 4AVAA 3AKTA 4P9WA 1Z7S1 5HCBA 3W9AA 2VMHA 2RM21 1FOD3 3LF7A 4DZGA 2ORZA 1F15A 4AEMA 1DYPA 1C8M3 4NWWA 1ZBE1 1V6LA 1WLTA 2FZ1A 1GP6A 3DF0A 4D94A 1AR82 5LEKA 2QQMA 1PK6B 1XNCA 2J42A 5IUQA 4QX1A 4Z2AA 1WBLA 1NQJA 1M4WA 3BALA 1YWKA 2JIJA 4UFLA 1UX7A 4I0WB 1Y9GA 2Y6HA 4I0BA 4BYYA 2P6CA 5B4NA 4KBZA 1XJAA 1WCSA 1D7PM 3OYWB 5FPZA 3LEGA 1W39A 1VBA3 2I07B 3K75B 2VL4A 2LTNA 4KH9A 5IVJA 5JMOA 2I45A 2VUDA 2VM9A 3ZKUA 2Y8KA 3AZWA 3UNPA 2Y26A 5E89A 3SCFA 4COYA 1N1TA 3FUQA 4EZ4A 5CG9A 3JCIA 4QPIA 1G6NA 3ACLA 1H8VA 1NCRA 2Q0AA 3AKQA 4CUCA 5FMOS 4LIUA 1RUC2 3O0WA 5KHHA 3ZMOA 4CEYC 5C7GA 1G9BA 4NPMA 4OYUA 5LATA 3R4UA 3ZXLA 2QQWA 4YW6A 4AFDA 3BTYA 3QCWA 2MEV2 2ZGPA 3MICA 4NPLA 4RHV3 1ND3B 4BMBA 3PUSA 4IEPA 1XNBA 1NT0A 5CZKA 1YLLA 2UYAA 2XUEA 4H2AA 3IWZA 1XYOA 4PDWC 1PNGA 3ZSLA 5C9AB 4IE0A 4BOWA 1IHMA 1QMJA 4GD4A 1ZA4A 5IWFA 3X29B 4DOUA 4NR1A 2O0OA 4OHYA 4B7EA 5IYYA 2YZ4A 4M4PA 4ZKTB 5BNNA 1F4HA 3D0JA 5C33A 2WT1A 4Y22A 5FXZA 4DMIA 4GWNA 4CCCA 4QXBA 3GZTB 1UY3A 4WM8B 3OF1A 1N3OA 2I2SA 5KXEA 2YHJA 3PURA 4HVOA 2D6MA 3D4KA 3I4IA 4JRLA 3HVDA 1VBE2 2RHPA 3HD8B 3JB4C 3MIDA 1SQ4A 4L11A 2W0XA 3ZXDA 2ZGLA 1W6OA 2WO3A 3R4SA 5FMBA 4AGVA 3RZLA 1DQ0A 4FPJA 2IUWA 3SXWA 5LBBA 4LBKA 2EF6A 3WNMA 3WQ0A 5M0TA 5FO9B 4R9AA 1W9WA 1XXNA 1RUOA 4S2GA 4HBNA 1JUHA 3H42B 2XKPA 1C57A 1D0GA 5GALA 2VBPA 1RXFA 4DS0A 1K5JA 1K5MA 4CDWC 4X6RB 3RJ2X 2OYZA 2HWB3 2WYSA 5GZDA 4AYUA 1VMFA 2QQUA 3D8CA 4FTBA 3H1MA 4NIGA 3BKZA 5LY1A 3WQ1A 4AFCA 1LULA 3RPQA 1HJFA 1UU6A 2Y6GA 3GM8A 5E16A 3KS7A 3OPWA 3Q9OA 2XBO3 4XF1A 2AEZA 1BQPA 2YBSA 4MGYE 5D1IA 5H9QA 1O3TA 1VAKA 2Z79A 4OFGA 4FOQA 4CA9A 4KGQA 4YGEA 1FXZA 1JZ5A 3V0BA 2DVDA 5LBCA 2OUJA 1LGNA 1FPN1 5CKMA 5FAXA 3KSCA 1A8MA 2P3IA 2XXZA 2WA4A 1N1SA 1R092 3J9SA 1ZYBA 3I2JA 3KGZA 3DPRB 2XL7A 4P00B 2L9LA 4PJYA 2DFBA 2WZR1 3ACGA 1IOAA 2A6WA 2PQSA 4DQAA 4W6YA 2PXJA 1ZBA2 1REFA 1H9PA 2A5ZA 4Y20A 1ND3C 2PTMA 1QH6A 1RXGA 2VZTA 2WWUA 3N7KA 4PLOA 3AVSA 4UI9L 4QDQA 4R9BA 3NNJA 3WDXA 2GNMA 3ZFGA 1TNRA 2C1FA 4IETA 3FHAA 4HPKB 4JQTA 5DABA 1CX4A 5C9AC 3KHCA 2WFF3 5FZ7A 1WLCA 3F2ZA 1HRI2 5IW0A 4LJHA 2RR13 2WA3A 5FFOC 1PGSA 4RR3C 5IVBA 1QJEA 1UZZA 5IJRA 4LITA 2VZ3A 3VBHC 5IAXA 1DU3D 4IV1A 4DPNA 1JODA 4TYSA 1UYPA 1YQ6A 3UT0A 1JZ7A 4QM9A 4UOJA 2ZGMA 5FLHA 4YNIA 3JQWA 4NIIA 1W90A 1ZA7A 4NIDA 3P6BA 2EIBA 3IDBB 4JGYB 4IGPA 1XNTA 2IWGB 2JE7A 4HN0A 3PL0A 4N7IA 2R063 2P3KA 3HQRA 1BMV2 3CZJA 4LLFA 1RGSA 1ZNPA 4C8DA 3VL9A 3WDTA 1N3QA 1YRZA 3LKJA 3ROUA 4QX3A 2O8QA 2XJSA 3T2PA 1W6QA 1JU4A 4OI2A 1ZX5A 1Z0HA 2ZAAA 3LA7A 2VXJA 1MVQA 5DDJ1 4O9EA 4PI2A 2W52A 3FLRA 1ULGA 4PF1A 2RMU2 4DIQA 1CIYA 5FZMA 3KV6A 1KDKA 1OF3A 1GZWB 2B9VA 1D4M3 2QUOA 4WVMB 4XACA 1MR5A 5JCTA 2MPFA 1CAVB 1AYM1 1SFNA 1QKQA 1VALA 5FCCA 2PFWA 4HZFA 5B2GB 1OD3A 3VBOA 3ZFEA 4AVSA 3LPGA 4F7ZA 4V2VA 2YFZA 1QQP2 3GZUC 4RD7A 1OI6A 2R071 5C71A 4LKEA 5KHIA 4IV3A 5KXCA 1TG7A 3I3QA 5AFBA 2K2SA 2Y33A 3BIWE 4AGGA 4H7LA 1OLMA 4XABA 1E5HA 4BQYA 3BUCA 5IVEA 1ZREA 2W1WA 4A3XA 5IK7A 4GMP1 3VN4A 1XBFA 4W8JA 4MG2A 5GLZA 3ASIA 4GH4A 4IDZA 4JKKA 4OVEA 1UX6A 1MEC1 5FY9A 3KT4A 2ZMKA 4Q4W1 1GMMA 4LLOA 4QB2A 1NCRC 4ASLA 3U10A 2RS33 1ZRIA 2AC1A 3K3NA 4M0NA 4YGDA 1POV1 2A71A 2NMOA 2GZWA 5A3WA 4LQRA 4ITCA 1LOCA 5KC6A 1GU3A 2RS13 4P9LA 4AE2A 4Q8KA 3WNXA 1QEXA 3VBUB 2X8KA 4WVZA 5FV3A 3ECQA 4DRVA 1UF2C 2ZAHA 2ZEXA 5EJZB 1GNZA 2CAVA 1OOPA 3M2MA 2IXKA 4AHYA 4YGCA 4QAWA 3C7EA 4GB31 2YY1A 4G4FA 3ZXAC 5FPXA 4QPGB 5BNNC 2EXJA 3SH5A 4BLJA 1YQCA 5FZLA 5C6CA 1KRIA 4XJAA 5FYHA 3ZN6A 1E5IA 4GKYA 3U37A 1GKBA 1W8FA 4XCAA 1NKGA 3VBFB 4JGYC 1GBGA 3MIGA 4AWDA 5FDBA 4TLGA 2PAKA 1WA6X 2ZGSA 2ZHNA 3KM5A 1XE0A 1W99A 2GC1A 3DUIA 5FTTC 4ES9A 4N8MA 4DUVA 4XEZA 5FO8B 5GZGA 3J8F3 2RS53 2HEWF 2D3RA 4B4RA 1IS4A 2PHRA 1YYNA 2VQ0A 3VUOA 3O1VA 3O7OA 4LIVA 1S2EA 2EAKA 1CZVA 2XJPA 5FUNA 3A7QA 2DV9A 3KVAA 3ZOIA 1YI7A 1ZBE2 4QXHA 4LTAA 2GP5A 5FZAA 2VBDA 4KWLA 4Y24A 3I3MA 2BOIA 2QKDA 5DUUA 3R6SA 1FOD1 2IZWA 1JH5A 3LIGA 1IPSA 1H1AA 4HG6B 2P2KA 2WINB 1C8M1 2HWF2 4ES8A 4E8CA 2F17A 3CEWA 2BPA2 4AFMA 1LEMA 1BBT1 2WO1A 2WQ8A 5HXVA 2VR4A 3VBRB 3VDAA 3HPNA 1PO12 1B35A 1Q43A 3AK0A 4QKFA 2OPKA 1PVXA 4ZONA 5H9RA 4YW5A 4B7KA 3DL3A 1CAXA 1VBA1 4RS5B 1QJX3 1W2UA 1LESA 5IHRA 3ZR5A 4JX0A 4CU9A 1RUH3 4URTA 1O3QA 2XVLA 4RSUA 3H8UA 3I3EA 4DB5A 1H2MA 5T3NA 4DXZA 5FMOL 1N3PA 4HXCA 4YVSB 4Y5SA 2RDSA 3WW1A 2BRTA 4DXTA 2P6HA 1TVGA 1RITA 3CU7A 1NA1A 1XNKA 5A6QA 3EB7A 4ARXA 2GC3A 1VBD3 1ASJ2 4J1XA 3ZFFB 1OD5A 2DVFA 3DCQA 4A45A 1DQ5A 1JYIA 2Y6LA 4IGOA 5FJKA 4ET7A 4I30A 4LA2A 4FOYA 4Q1PA 4W4ZA 2FDKA 4XFIA 4FQ4A 2FHRA 3VBUC 1VRH1 3BCWA 2QQNA 2Z2SB 3N9PA 3MHZA 2HBUA 3M3QA 3KV9A 5F37A 1PMJX 1NE6A 4Y33A 3OSDA 2G9ZA 2CWSA 1STMA 1O59A 4DUWA 2FZ2A 3SH4A 2YC4A 3TNPB 4QPGC 5ABJC 4QMAA 4R52A 3OPTA 2XWJB 1Y9QA 4BISA 4CCOA 4OLLA 5I93A 1WCKA 1DG6A 1JYVA 3I3DA 1MQTA 3M7AA 3RWNA 3WHUA 4CPBD 3HN3A 2DF7A 3VBFC 2D5HA 1O4TA 2HYKA 2OQ7A 3O12A 4M3CF 4MV2A 5FP8A 4S2HA 4OZXA 4ATEA 5C5TA 4HKLA 4JZRA 4P9YA 5FZCA 1PVC1 2YC2A 2R0FA 4A7ZA 1PZ9A 3FWEA 4OUSA 4D3WA 3BOWA 3FN9A 4D6QA 3HJRA 2VAUA 4ATFA 2XB6C 2ZX1A 2LALA 4XTMA 3WY6A 1Z7S3 3BPZA 1D4VB 4XQ4A 2RM23 1W2OA 2XJQA 2PHTA 3H8RA 2R6QA 4GJZA 2WS93 4EN9B 1QJFA 2HWB1 4GWMA 3U07A 4IGQA 2O1QA 3ILFA 3WNPA 2YB7A 1US2A 1HRV1 1EUUA 2PHUA 4OULA 5DPNA 5FJHA 3VBRC 4E8DA 1NG0A 1PO21 2P3JA 1UW8A 2XBO1 3TYJA 1CWPA 4QQ2A 3I2IA 1CJPA 1RUJ3 3MPPG 5FPVA 3UKNA 5CKQA 3VBOC 4JAAA 5ACA1 1IPJA 4HKOA 4KWKA 3UESA 4RS5C 1SACA 1VB4A 1W6MA 2VE1A 1UOFA 4COWA 4CZSA 1AXYA 2EIEA 4Z92B 3RZJA 3IZOA 3URFA 3VZOA 1GNYA 3GNEA 4XF3A 3AL6A 3V0AA 3OGGA 3E5QA 1S0DA 3IM0A 1RUF2 1SBEA 3ON7A 2WJSA 1JTZX 3HBKA 3WCSA 1YQ2A 1KJLA 3FL7A 4NPRA 2XL9A 5FZGA 4NROA 1D0HA 4YVSC 2TEPA 2JDYA 2DUOA 1W8OA 4LUKA 1QXPA 3RQ0A 4E2GA 5LCWL 3OD0A 3GBWA 4Q4Y1 3UGFA 4OHVA 1YIPA 3VD9A 3ZFFC 1H2KA 1BK0A 4WZCA 5A33B 3PDQA 3A22A 1ENRA 1L3JA 1WWYA 3LA3A 4IEOA 3WT3A 3K51A 4Q5OA 1AYN2 1TMF1 2SBAA 4N53B 5L7OA 2LM3A 3RZGA 1RMU2 2JDHA 3R05A 3OPZA 4CCKA 2GMEA 1ZZ7A 5C8CB 1UIKA 4A41A 3OGRA 4YSFA 2FDIA 3VBSA 1UZVA 1XU2A 1JMUB 3N9LA 5DUVA 4LHNA 3USUB 5JDBA 4AI3A 2E63A 2Z69A 2DYCA 1JUIA 5FYCA 1RUG1 2A1XA 3FLPA 3TEYA 1L7LA 1SHWB 2WO7A 4EJRA 3NMBA 1F8VA 1CJDA 2R061 2NQYA 3WQBA 1ULCA 5LRSA 3WLUA 3AFKA 3ZIXA 1AR61 2AZ5A 4Q0QA 4QKDA 1EAH3 2ZEWA 3MUY1 5KC5A 2OT7A 2WO2A 4EROA 1O3RA 1DZQA 5EPAA 5FZ6A 3W59A 4BMEA 1XC6A 2W46A 3N9NA 5FZ1A 2NM1A 5EXOA 3P3NA 3VZKA 2C4XA 2QE3A 1MVEA 2ET1A 3DXUA 4P14A 2FCTA 5JZGB 3HT1A 1V9U3 1COV2 1UZ0A 3VZJA 2DVGA 2Y6JA 3EBRA 4Q0UA 1W28A 3ES4A 2VO5A 2E26A 2R072 1D4M1 1CAWA 1ND2B 4Y1ZA 3GCXA 1XSQA 1X36A 3WSOA 1Z78A 3GZEA 1YO8A 1UAIA 4BHPA 2DTWA 1CPMA 3H7JA 4EQVA 2C26A 4YW2A 2BFUS 4BQ5A 3SLIA 1B35C 1PMIA 3LZZA 2JDAA 4CP1A 3KQRA 5I0SA 2DVBA 2BV4A 4MHRA 4CDXB 5C3RA 1AR93 4C91A 2CAUA 3KD4A 2LRPA 2NP0A 2B46X 2CWMA 3AP4A 2XJUA 1X50A 3SCHA 4CEYA 1OQ1A 1W9YA 5A3NA 3VB9A 2CL2A 3RVHA 4L0PA 2W9XA 1JYXA 1U5ZA 2JDNA 3C8XA 3JBG1 1UYXA 2GMPA 1OVSA 4KL1A 1RUI2 1W3XA 4OUEA 3TEZA 1HB4A 1DCSA 5T5PA 5F7UA 2OX0A 4UBGA 1MS3A 5GJ6A 3LOIA 3CQOA 1UY2A 2C24A 2NPIA 2PAMA 4N43B 5A32B 2VG9A 4YM0A 1UZWA 3WDWA 1JZ8A 1IQAA 4XJZA 2RS11 2J1UA 1REEA 5GZCA 2ZZQA 3LCPA 1R1A2 4LBQD 1G8WA 5FY7A 1O8SA 5I8YA 3I2HA 4JVAA 2R042 2OS2A 2YBPA 5C8CC 5CFCB 3LOBA 5BNQA 1UMHA 4JDMA 4K20A 4XCBA 2B4KA 3A4UA 2YMZA 2IXIA 2Q30A 4Y1UA 4E4DX 2DCKA 5BV6A 1W6PB 4P02B 3T0BA 1JZ4A 3G7DA 3HMYA 3KWVA 2BBAA 1QY4A 4D69A 2RVAA 2WDBA 3HOBA 1QJU3 5CB7A 2GSYA 1OUSA 2JKXA 2ID4A 2VTFA 3J8F1 4C1XA 2RS51 3T0DA 3CJIB 5IK5A 1ONAA 5FZKA 3AKSA 4WZFA 4YZ5A 4MOAA 1PGW2 3KZ4C 1ZZ8A 3C3VA 5C3SA 4N9HA 4Q4X1 4AQ6A 3ZYHA 3K48A 5JMCA 4MXWB 5AC91 3OGJA 4PQ9A 4ASMB 1PX4A 3MLLA 4AI8A 2Y38A 4UW3A 3T09A 4CDUB 4LMFA 4NAOA 4XF9A 5L9RA 4CVUA 3CBNA 4QGLA 5JOXA 1LOEA 1N47A 4FPKA 3WG3A 4QXCA 3KGLA 1NX9A 3WNKA 4JCKA 5HCHA 3TB0A 4KBBA 3N7MA 3KV5A 1VJ2A 1K45A 1JYNA 2OZ6A 3HAGA 5C70A 3Q8BA 3OYWA 1FV3A 5I0DA 5KHGA 1JOPA 2VPVA 3FLTA 3ZN5A 1JHJA 1H4HA 1ZRCA 2VMDA 2YBKA 3RMXA 1T6BX 2NZ9A 5I0UA 5LRRA 1V70A 1QJX1 4YW1A 4XIKA 3VKMA 2HWC3 4CEWB 5A7QA 2VZVA 2W1SA 4GMP3 4XILA 5BNOB 2VCBA 2GNTA 3CMGA 2WNUB 3HNMA 4RHV2 5FZ8A 2ZGOA 4UFKA 4R9DA 1DF0A 2V4AA 2QBXA 3B93A 3UV9A 1IZ3A 2DUPA 1ND3A 4FOVA 5F3EA 2DDUA 2VUJA 5FRAA 3BU7A 1C4RA 1Q56A 2BQPA 5CEHA 2VMGA 4KG8A 1VBD1 3WV6A 3HNYM 5C9AA 4UYBA 3ZLIA 1VBC3 1A78A 2PHDA 2EAAA 3OEAA 3HQXA 4RR3A 3WG4A 1UMZA 2Q8DA 3ZYIB 4TTGA 1ZZ9A 3NJZA 5GLWA 1PGL1 3OJBA 1DIWA 2RJ2A 1ULPA 1XSRA 2WNVB 4GB33 3VHRA 4NE9A 5CFCC 4XUNA 1UIJA 2KA3A 4CP9B 1LKNA 1PMHX 2BYVE 5DAVA 1UCXA 1YIFA 4A7KA 4QKNA 5FP4A 3VLBB 1J3RA 2VMFA 2XVGA 3WNOA 2BBVA 1CVNA 3IBMA 3TNQA 4OI0A 3IDEA 4FT8A 5A70A 1HXS3 3PVOA 1S2KA 5LBFA 4L92A 3EQEA 4Y4RA 4BCUA 3O14A 2XLAA 1DQ2A 3PU3A 5IVYA 4ORFA 2ARBA 3CJIC 1XU1A 1VBB1 3B02A 1C8NA 4MGSA 4XZUG 1TME2 3Q8CA 1CAUB 2E9QA 4DNYA 2HWB2 2QQLA 1AUYA 1Y43B 2BOJA 1UL9A 1YFXA 4IE5A 2B39A 4NHKA 2ZKLA 1GQHA 3WF0A 2VZPA 1W8HA 2XDVA 4XJUA 5GZEA 2X53S 2WS91 4BWOA 4LBQB 5IT6A 4D7TA 3MBWA 1HV1A 3JQXA 1MS8A 4EE2A 4HONA 2I74A 1BBT3 1O4YA 2XLGA 4QWNA 5F5AA 5CKNA 3RSJA 1FNZA 5F2WA 3HR9A 1XYPA 1UU4A 4FSJA 2LROA 3V64A 1RUJ1 2J1RA 3M1HA 2V4VA 5FYSA 5DG2A 2A75A 3NJYA 5KBFA 5G05L 3PLQA 3CKHA 2D3PA 3ZO0B 1OMIA 2B8MA 5ANNA 4AHXA 3LSDA 3WZ1A 4LORA 5A3LA 2WNOA 3ZDSA 3OB8A 1YUDA 3AL5A 5JIUA 1BEV2 5BNOC 4OI1A 2WNUC 3POEA 3DPRA 3QD6A 4MHUA 1YFWA 4Q0VA 4WBBA 1NOVA 3N3HA 2IVJA 3KCYA 3BB6A 4HOOA 5G04L 1QNWA 3CZUA 4CTEA 2V09A 2ZZJA 3T3YA 4YZ2A 3J7HA 3S5AA 2WFF2 1V6IA 3KHBA 3ZPYA 3ZYPA 5F6KA 4YZ1A 2YROA 2GDFA 2RR12 4HPKA 4MXVA 4I3PA 2YU2A 3AP6A 4BIOA 3WUDA 1LU2A 5J1XA 4XHBA 2BDRA 2P37A 3NL1A 3PJQA 1W0PA 3TN92 4KU7A 1VRH3 4KI5M 4M00A 1A6CA 4QQPA 3CF6E 2ZGTA 1NY71 4MGIE 2VZUA 2RDRA 2D6KA 5B4XA 3ACHA 3MW3A 1QH7A 3EO6A 5CAZA 1UPIA 2Y0OA 2ZHMA 3EHKA 1KITA 2WNVC 2E51A 1AR73 3B9IA 4HMZA 3TEXA 5A1AA 1JBCA 1QDCA 2R062 2A6XA 3POSA 2UWCA 4Y26A 5LEJA 4JGYA 3GJAA 3MIHA 5FO7B 3WP5A 2W39A 2ZGQA 4WM7B 1JI6A 2Q4SA 2V5YA 4R4ZA 1BHGA 3B94A 3H7YA 1PM4A 2ILMA 4O9GA 5HPOA 5LZ6A 2EIDA 3H9AA 1PVC3 1UXZA 3LE0A 2HWE1 1EAH1 2PYTA 5J09A 4XJWA 1RINA 3OBTA 2TBVA 3UJQA 4OI4A 1SPPB 1UOGA 1OQEA 1D4M2 2D44A 1AVBA 3I59B 1O6UA 4MYEA 3WNNA 4CCJA 1N1VA 1V9U1 3GF6A 1GZWA 4WVMA 1R1ZA 2XQRA 4DY5A 2BVBA 1CAVA 1RJ7A 2VW0A 5A7NA 2YGMA 1WD4A 5T5OA 4AAXA 4RGAA 4EV0A 2JEMA 1HRV3 1PK6C 1J83A 1W6NB 1UPSA 1PO23 3JXSA 3THTA 4C0HA 5LA9A 4FPEA 2XPJA 4D8MA 1AJKA 2BFUL 2DCTA 4OHXA 1S0JA 4JTOA 5ACA3 2CHHA 2WAAA 2QQKA 2ZGUA 1BZWA 5KXDA 1SLTA 2VMIA 1AR91 5A1LA 5A7OA 1PNFA 2BVVA 4PCRA 3UETA 1HV0A 2AYHA 2FCUA 3AKPA 4EN8B 4AR2A 2RS32 3PUQA 4CXXA 2JB4A 3RNSA 2XJRA 2YU1A 4IL7A 4Y3OA 2ORXA 1XB9A 1GLHA 3LWCA 3ZSMA 3AXDA 2AENA 2VW2A 3J4UH 4WVVA 5FZ3A 3KQ4B 1POV0 1UOJA 1IS6A 3JB8A 4Q4Y3 3LB9A 3TRSB 4AZZA 2WWJA 5CG8A 1RHI2 1G86A 2D6NA 4AVTA 3E5XA 4PIXA 5FMCA 2WQ4A 1S0CA 3VBUA 3A0NA 2W92A 4PIYA 1S0FA 3LA2A 5HCFA 3C7OA 3AB0A 2F4LA 1SFPA 1TMF3 2JB8A 2YUEA 3OUHA 3GYDA 4OHZA 4QPGA 3TAYA 4QPIB 3SHRA 3ZR6A 5ABJA 3LFMA 1LOFA 2P34A 4QGMA 5AVAA 3WNLA 3WVJA 1SG3A 4CDXC 1ZRRA 1OSGA 1JZ3A 4I01A 4BIFA 1YCIA 3O1OA 3KB5A 4MGKE 4WM8C 3VBFA 1VIWB 2WYFA 1RUG3 4MGTA 4YM1A 5EV7A 4GULA 5C4WB 4XPVA 4D6SA 4QPWA 1RUC3 3WF4A 3SITA 1Y9MA 4AFAA 2QDRA 4HETA 1SCRA 2G1MA 1QJU1 2CV6A 4XQWA 4AI1A 3NNLA 4I2OA 1AR63 1RUD1 2VU9A 3OY8B 5DG1A 4A6OA 3BVCA 4FXGB 1GNHA 3VKNA 5C3OA 1NQDA 2GMMA 1DFQA 1H1IA 1DHKB 2V72A 4QX2A 3MIEA 1CPNA 1QU0A 4R9CA 3ITQA 1C3HA 1VMJA 5FY8A 3V65A 3JU9A 4Y22B 3ZX7A 3HNBM 3D0SA 2HWD2 4LEJA 3KLSA 2IC1A 1S4CA 1H0BA 3CIHA 4UW6A 3RYKA 4AHWA 1S2BA 2PLV1 1EV12 1GWLA 3VBRA 5CYYA 1QWRA 1KD7A 1PX3A 1U5XA 4MZUA 4Z82A 3N4MA 4FTSA 4XE9A 1AX1A 4R8HA 1H1MA 4AOCA 5CADA 4NMIA 2JD4A 3IB3A 4LBOA 4AF9A 1W0OA 4DRRA 5FZDA 4AI0A 4KQ7A 2DBIA 4RS5A 1EUTA 1RUH2 1WGPA 2VJXA 1SLBA 3D5OA 2LS6A 4Q8LA 2ZGNA 1OA3A 2HWC1 4HL0A 4ZS3A 5J98B 2WN2A 3T4VA 3RZHA 1PZ8A 4KMQA 3RGBA 4FPLA 4YVSA 1PIV1 5A3MA 2Y34A 3JBG3 4XOGA 1RUE1 1QJZA 3DPRC 3SEEA 4ASKA 1NLRA 1W2TA 3I49A 3ZFFA 1AL22 5CFDB 3O0XA 2A7AA 3IT8A 2VCCA 4CUBA 1LR5A 4K1YA 2OQ6A 2EXKA 1J58A 1Q5OA 4JDNA 4QT6A 4YGBA 5D8AB 1Y4WA 4PLNA 1LHWA 3K2OA 3NNMA 5J36A 1ULFA 2OW4A 4DXSA 1VBC1 2G4IA 3T4HB 3V0BB 2ZHLA 2VBBA 4NHLA 4N9IA 2W94A 5JXGA 1C5IA 1V6JA 4JRAA 2QZ2A 2OIIA 2VOTA 4XIOA 1O7FA 4UXAA 1EP0A 3AJYA 5C3QA 1G9CA 1YQ8A 1RVF1 3S5QA 3K3OA 3PTYA 5BUVA 1R093 4EN7B 4LBNA 5C4WC 4ISRA 2ZCWA 4RGKA 4XF0A 1HXS1 3PNAA 4IW3A 3UL2A 3LPFA 3I97A 2XQXA 4K3UA 4QKBA 4LHSA 1Z7S2 1NXMA 2QVSB 5FQ0B 2FCVA 2OA2A 2QQOA 1W8NA 2RM22 3DECA 3ZXGA 1DLLA 3C7FA 2AH2A 2EICA 3CJXA 3GZAA 4UF0B 4Q4X3 1PM7A 4COUA 1HRI3 5AC93 4LBJA 3NAPB 5EHDA 2G19A 5FYZA 3H1YA 1UXXX 3MLJA 5IFTA 2YV8A 5GKAC 2IXCA 3T0AA 1V6MA 1GYKA 4QB1A 2VOWA 3H50A 1OFNA 2Z5WA 2FDJA 4JKLA 3K4ZA 3WW3A 2XGXA 4A44A 4AW7A 4N90A 1HQLA 4DXRA 1H8TB 1VRBA 5BPXA 4FXKB 4H55A 3B01A 5JR7B 3LAGA 4BJ0A 1NXD1 3AVRA 1URXA 4FFHA 3VGIA 1KJRA 4L9BA 1OH4A 3FX3A 4CP2A 3J7NA 4OUMA 4AHZA 4E4ZA 5K9YA 4LNVA 4M4RA 2WZPP 2BW8A 4BE3A 5DAPA 1Q8VA 1TEIA 3OD4A 2ATFA 2DUQA 1JYTA 5DMYA 1XNDA 3RDIA 2IFRA 4Q27A 3THPA 1DP0A 2WFPA 3LGRA 3DGTA 2RJLA 1OPOA 3E6DA 4X8NA 4QU2A 5A3PA 3MLKA 1GQGA 1OBNA 5CFDC 5A33A 4BA6A 1D2QA 3HN1A 4IEUA 5D8AC 4QDSA 4YW3A 3WF2A 4JGZB 5EWSA 5FZFA 5BNPB 4UFIA 1QQP3 4N53A 2ZX4A 1O8PA 2LW8A 2MNGA 3WF3A 5C8CA 4OHWA 1LNSA 1MPXA 2XONA 3USUA 4F3JA 5FYIA 1AR71 2J1VA 1LOFC 1QDOA 2VECA 2VVDA 5FY1A 1ZRDA 1R083 2VNOA 4HN1A 2K9ZA 4MLOA 2IXJA 3ZM8A 4DY3A 5H9PA 4AEKA 3AMHA 4FVVA 2ZKNA 3A0KA 4FPGA 1MZ5A 1ULOA 4XBNA 3NWKA 4NOTA 1VBB3 3PUHA 1CZTA 3OGVA 5FBJA 5GM0A 3HBZA 5FZEA 4QDRA 4Z8BA 5JI9A 4NHYA 5JZGA 1WMXA 2PN5A 4NN0A 2UYBA 1V00A 4XMIA 3NAPC 1HJGA 2HH9A 5FYYA 4DEQA 5LA1A 1S55A 1TNFA 1MZ6A 1ENSA 1VPHA 1YI9A 4BQ1A 1ND2A 3RWKX 1O3SA 1GV9A 2JXAA 4DINB 1LEDA 1RUNA 4IEZA 3NKTA 3JD71 1NUKA 2C9KA 1BVVA 3L2YA 1OT5A 4FFGA 4XVHA 3U4SA 4CPBA 4O7XA 3RFRA 5H9SA 1FPN2 2QQJA 2QQVA 3GCWA 4PBOA 4Q29A 4Q4V1 5F5IA 1QOOA 3M8LA 4XDPA 3ME2A 2VTXJ 4CDXA 3IPVB 2BERA 4GWJA 4WV8A 1APNA 5FZ4A 5JVVA 2OZJA 2XR4A 1BJQA 4ZU4A 3U1XA 1WZXA 1DGRN 2WZR2 4Y5Z0 1BKZA 1WUVA 1FYUA 1RJ8A 1QJY3 3MIFA 4M3CB 2EXIA 1YXWA 2X5IB 3POJA 2Q1FA 2UWBA 2NMNA 4QHBA 4TN7A 5JR2A 3OBAA 1MS9A 4DUXA 4IQPA 2VNRA 3SMHA 3LFIA 1W9TA 3MEPA 5I8SA 4N43A 5A32A 4LO8A 4I09A 4ZS2A 2JDUA 3I2FA 1AR81 1XNAA 3WF1A 4IE4A 1NCQB 3T30A 3UJOA 2CDOA 3ZVXA 2A3XA 3IAPA 2A3WA 1CAXB 2V5DA 3NVCA 4CUAA 3MV11 2AACA 5CFCA 5J96B 1S0EA 1KQRA 1UWWA 1GOFA 2ZEYA 4HANA 4L2NA 2VXRA 5K4LA 1MZEA 5LA2A 3KF5A 2Y60A 5FP9A 5FR3A 1W6PA 4LR4A 5FZBA 1UMIA 5GZFA 3POFA 1SDDB 3SC7X 4A7YA 1KEXA 4AG4A 4FQZA 3VDCA 2PELA 4ZZ5A 1IPKA 2VUCA 1RUC1 1UNBA 3I8TA 4AL9A 1CZSA 3EMRA 5FZIA 3VD7A 4NO4A 1CESA 3CJIA 5E1RA 2MEV1 2DCJA 1BXHA 1ASJ3 1Q8OA 2HWE3 2PAEA 1GWKA 3ELNA 5DDJ2 5K0UB 5JPMB 4RYDA 4PF5A 1D2SA 4XFAA 1QXRA 4LOTA 3C7HA 2VVFA 4E4SA 4QXKA 4MXWA 4XYXA 1TQ5A 3BI3A 1JZ2A 2CY6A 1ENXA 3LDKA 3SKJE 1HKDA 2JDZA 2YDEA 4L97A 4B4QA 2J1EA 3THDA 1AYM2 4CDUA 5F3CA 1SLIA 2PQQA 5FY5A 5IVCA 1OA4A 4K8FA 2VGDA 4NUBA 4RFRB 3W21A 5A7WB 5LA0A 4N7UA 2XJTA 2VW1A 1KGYA 1RTVA 1WW4A 1JOJA 4MGZE 1W04A 1DGWX 3FZ3A 4IE6A 3O1RA 2E7TA 4IEYA 3RZMA 2ZX0A 1ZZ6A 2JD9A 1AZDA 1GP5A 5DZGA 1VBE1 1XE8A 3AMQA 3M3OA 5DN2A 3UKVA 3BODA 1J1TA 4CEWA 4FBFA 1FMD3 1DLCA 1OUXA 2ZX2A 4XTPA 3K4DA 1MEC2 2B5HA 5EQUA 5BNOA 3PUAA 4K40A 4Q4W2 2JE8A 1YJLA 4H14A 2WNUA 1FT9A 2ZJCA 3WD5A 1QF3A 3NO8A 4YFZA 1CQ9A 3OTFA 1DDLA 1QNYA 2JX9A 3J26N 2BNOA 3SKVA 2UY9A 4RQPB 2X5IC 3GBGA 4Q26A 4O65A 4D7SA 1HB1A 1JYWA 1LOGA 3ABZA 3NNGA 1GICA 3VZNA 1V6NA 4JKMA 1AX0A 3OCPA 3CDZB 1VBC2 4XURA 5HXMA 2VZSA 5KR7A 3DYOA 2OVUA 1RB8G 2XHNA 5FMDA 1S0GA 2C5DA 3H1WA 2GALA 4PQQA 4GB32 5F6LB 2R1BA 4P9IA 3S30A 2VMCA 1OKOA 3N7JA 2WL1A 4BPZA 3NKGA 2WNVA 3VD4A 4N53C 1LAJA 4RL7A 3UYJA 1LHNA 4V1PA 4YLZA 4CP9A 1GR3A 5DUWA 5JI7A 1R64A 2BNMA 2VNGA 4IESA 4L8QA 2J7MA 4P5HA 1FI2A 1GWMA 4XFGA 5F1RA 2JG9B 1K42A 1DYKA 4QGNA 1R091 2C9AA 1UY4A 1GUIA 2X09A 4XUOA 2H0BA 5KHJA 3NV3A 4TZDA 1G7YA 1SEFA 2KXLA 4BH9A 3ZDVA 1AHSA 5E88A 5IVVA 3VDBA 1RUD3 1XOYA 1ZBA1 2JDPA 2DVAA 2WN3A 2ES3A 4LBLA 4QQLA 1CAUA 4TLFA 3RZKA 2CGPA 5K0UC 2P3YA 3BTAA 1FOD2 5ERLA 1WBFA 2CYFA 4LHKA 1SZBA 3AYEA 5L7OB 3D82A 1CD3G 4BQ3A 3NV2A 2DBNA 4LXLA 5FLJA 4FCAA 1C8M2 4P5YA 4SBVA 4SLIA 2IVIB 4CDQB 2ZGKA 1HRI1 3SEPA 5JZGC 4LBQA 1BBT2 1RMU3 4KG0A 4YVWB 1C1FA 2H0VA 2R7EB 4A2UA 2TNFA 4E27A 2PLV3 1S1AA 1PK6A 5FWEA 1I5ZA 2X29A 4UFJA 1ND2C 3O1SA 4YG0A 1VBA2 4EWEA 5GLVA 5F32A 3MIBA 5EIYB 1MS0A 4LUMA 4NRPA 1WMEA 3POGA 5FXVA 4Z07A 1BMV1 4QHZA 2VOKA 3WOGA 4BQWA 4QX7A 2Z42A 4PBPA 4YG6A 2XH6A 4AQSA 4FTEA 1GSLA 1FATA 2DCZA 2RE9A 3RRDA 4FOWA 2WABA 5HBAA 1O5UA 4BXSV 2ZA9A 4CCMA 3J7MA 1PIV3 4I02A 4JC1A 4K1ZA 4MVTA 4RQPC 1SCSA 3OBRA 3NNFA 1RUE3 5IK4A 2K46A 2GC0A 4B3NA 1CAWB 2IXLA 1X33A 2RMU1 1M06G 1GOHA 3GHMA 5FZOB 2HKXA 1VRH2 1A34A 3E97A 3IIAA 5EFUA 4GALA 1WW6A 2VCMA 4F83A 2JWPA 5CA6A 4N43C 2W08A 3T1LA 2ET7A 3M3CA 4HLTA 5ANQA 1VLNA 1QQP1 1U12A 4M3CE 2A6VA 2XVKA 1JS9A 5DZEA 2XUMA 5FXXA 5FZHA 3VDDB 3U0ZA 5F5CA 2B7YA 3SH3A 3S7IA 2GH8A 3ACIA 2R30A 4J6GA 2FMDA 5LK5A 3WW2A 4WM8A 3WINE 3ZXKA 2EIGA 4QB6A 1B09A 1RVF3 2CTVA 1NZCA 3C2UA 4HKWA 1MZFA 3HIFA 4EN0A 2JG9C 4WM7A 3WDYA 2W1QA 2FD8A 1PVC2 2ARCA 1R081 4KWJA 4CYDA 1QIQA 3IN9A 2Q8CA 3HT2A 1OQDA 3S57A 3AP7A 2PA7A 4LE4A 4W50A 2O14A 2BGCA 3BGAA 4PDWB 1FNYA 4XFCA 3MGUA 2G9FA 3VL8A 2JENA 3FC0A 3HEIA 5FKBA 5EZWA 2W5FA 4ZU7A 1UY0A 2E31A 3GALA 1SPPA 3I59A 2KR2A 5BYNA 4CDQC 1YFUA 1R1A3 1HRV2 1W3VA 1W8TA 2R043 5EJ1B 1RIRA 5ISLA 3H3LA 4EZHA 1PO22 2XBO2 4B4PA 4CDUC 4CP0A 4LK6A 1W6NA 3KCXA 3VKLA 1IKQA 5A3TA 1GZ9A 4CUGA 5ACA2 2IXHA 1DZTA 4G3YC 5F9TA 4K21A 5CIRA 5FYUA 2JG8B 3PMSA 1FX5A 4R4XA 2BWCA 3E1F1 3N35A 4CE8A 2VQAA 3POYA 2XG3A 4XBQA 5AFEA 2WNEA 5KWRA 2W87A 4CEWC 3I2GA 5DQ0A 1EPZA 5FP7A 4CDWB 1W9FA 1DYOA 1GANA 2RV9A 4GXLA 3O0VA 4CSWA 2WLPA 2XWBB 4Q0PA 4Q4Y2 5F3IA 2VQTA 2YFUA 1QJY1 5LW9A 3QH7A 1SFYA 3DXTA 1J84A 1G9DA 4TWTA 5FYVA 1LB2A 2CGNA 2W1UA 1I5PA 5I0TA 3U75A 2VNVA 4LBMA 4IUGA 3VD5A 2HWF1 1YEWA 4S2DA 1TMF2 2GNDA 1EPWA 4V2WA 1PO11 2ZTNA 4XBLA 4BDVB 5CVRA 3I2OA 4AFBA 2ZACA 1LTEA 4QX8A 2NN8A 4IERA 2BNNA 1UKGA 5JIAA 3VDDC 3ZIWA 3F95A 3PVBB 4DO0A 1LODA 4COVA 5JOYA 1RUG2 2D6OX 1YFYA 5FUPA 4IXLA 4NIAA 1O91A 1UYYA 3EXUA 3FBMA 2YG0A 1NLSA 1AXZA 2QNKA 4K6BA 2YXSA 5FPLA 5C4WA 4I3GA 4ONUA 4EWDA 4XAEA 1AR62 1QHDA 1WD3A 3BPSA 3QH6A 4XJ9A 4NRMA 2VVEA 2OXBA 3NV1A 3OY8A 3N36A 3MYXA 3U4XA 2ZOEB 3KCCA 4MSVA 1HQNA 4A42A 1ZZCA 4GZ9A 3FBYA 1ASJ1 5IATA 4RR3B 1W05A 3WCRA 2ZXQA 2YGLA 3VBHB 5FP3A 2FDHA 4AEJA 4AEDB 2DU1A 1OHFA 4KU8A 2Q8EA 4ZHNA 1LOAA 2JJ6A 2RDQA 5A6ZA 3LEMA 5GLUA 3ES1A 2E7AA 3PJYA 4MX3A 2DCYA 1SLLA 1GP4A 1Q8QA 3ZXJA 1FAYA 4KGGA 2BGPA 4K7JA 1UD1A 2WT2A 1Y3TA 3DKWA 1A3KA 3IIIA 3AKRA 1AF9A 4IE7A 1JXNA 1GQPA 1ODNA 1YHFA 3JD73 5K8SA 2JG8C 5KHKA 1XPWA 5FPAA 2HBTA 1BLZA 1W06A 3I7DA 4Q4V3 2PHXA 1E5RA 3KT7A 4UWDA 2YC0A 1FMD1 4CXWA 3H3ZA 5FK8A 4GMP0 1ZM1A 3E6CC 3WP6A 3JBG2 1WA4A 2J1TA 1TME3 1X9PA 2YPDA 1UN1A 4M01A 1Q3EA 4ZY9A 4YWAA 3THCA 1IS3A 1J3QA 1LENA 1DQ1A 1VE0A 3IDCB 1NYWA 4GIQA 4GQ7A 3O1MA 2J1AA 1MS5A 3IAQA 5CFDA 1BYHA 3NV4A 3AXEA 2RS12 5D8AA 4EWAA 1Q8SA 2WZ8A 4KWUA 4YARA 3ZN4A 1AR83 2PHWA 2JDMA 1OLRA 1H9WA 2KM2A 3AYAA 2YYOA 3LSEA 5L9BA 3UGHA 1KFXL 1H6XA 3LD8A 2HEYF 1I3HA 5SV8A 3CO2A 1WW5A 4GJYA 1QOSA 1LGBA 2SLIA 1VAMA 3BOPA 3AZVA 2XMLA 3NW4A 4QX5A 3RI9A 3CLPA 4E2QA 1XQNA 4OMCA 2O8OA 2ZMNA 4URAA 1L7RA 4MADA 1NCRB 2R49A 4QQHA 1BEV3 2AGSA 4E9KA 3OOXA 1RUF1 3ZYGA 1H2LA 4XXAA 2VOVA 4LPLA 4UBHA 3J8F2 4P9XA 2RS52 2AEYA 2GAUA 4WM7C 5FY0A 2J1SA 3RS6A 3ZYBA 4F8AA 2GH2A 1LHOA 1I6XA 4FAGA 5FQ0A 4YM2A 1F4AA 1C1LA 4Q4X2 2MEV3 5AC92 2XKOA 1MS1A 1SLAA 2H6CA 5FWJA 4UF0A 1ULEA 4PHZA 5JXIA 1ZZBA 1WMFA 2D7FA 3NAPA 3TN93 2R32A 5BNNB 4AEDC 3IDAA 3MZHA 3AZXA 4NAMA 1K12A 3OEBA 1AYN1 4TXWA 3W20A 5FIXA 3RZZA 1RMU1 2XLFA 3WDVA 1QOTA 3POIA 5T5JA 4FI9A 5J37A 2BJSA 4YW7A 4ARYA 2VY0A 3QOPA 1H8TA 2Y6KA 4BQ2A 4LO6B 4D0QA 3KVBA 4XZPA 3MF6A 3PTRB 4HSJA 4OQ9A 4XFFA 5APAA 1LHVA 4CU7A 5FUIA 1QJX2 5JUVA 4FPOB 2P5BA 5T54A 3NQHA 4M0HA 1VBE3 4XUQA 3KF3A 1W6OB 4FPCA 5D21A 1YQ5A 1RL3A 1GZCA 4CCDA 2B42B 1IS5A 2ADDA 2R0HA 3OUIA 5D2AA 1OLQA 1F2NA 2A6YA 3GBFA 2W91A 4RFT0 4LKDA 1UOBA 3H0OA 3AP5A 3VKFC 4XUTA 1K5MB 5L73A 3AYDA 3FHQA 1G9FA 3N9OA 5CNAA 1AX2A 1VBD2 3MW2A 2XJVA 3POWA 3DN7A 2Z4FA 1COV1 2ZABA 2ARXA 2QFEA 2D43A 2D6PA 3I2KA 5T50A 5DAQA 3OUJA 2EA7A 2OPWA 4JGZA 4COZA 4CU8A 5BNPA 3UGGA 1TE1B 3LQCA 1PGL2 4NIHA 1OC1A 4U2AA 2ENRA 3AP9A 3EYPA 2JE9A 3ACFA 2ZS6B 2WC2A 3B00A 3I2DA 3MV01 5JXJA 1XE7A 1AJOA 2DTYA 1YNAA 3GXUA 4HK8A 4IEQA 1F35A 1R082 2F4PA 4NJ4A 4QPIC 2WQZC 3TBDA 2WBKA 1IG0A 3APBA 4J1WA 4XDOA 4FP2A 1W2AX 4OCTA 2ARAA 2ERFA 3U78A 2WIIB 3VHPA 2BUKA 4LA3A 3FJSA 3USSA 1WCDJ 5SV5A 5C3PA 1VBB2 1NLQA 2ZHKA 1V6OA 3MW4A 1RUI1 4Y20B 5T55A 1CIWA 5CISA 4LOSA 4MGQA 1IG3A 1RHI3 1ZBA3 3ZFGB 4AQ2A 5L36A 3RYPA 2D98A 4FAHA 4MO3M 2W95A 2WS92 3Q8EA 4WVWA 4FFFA 1UQXA 4UAPA 4B1MA 4UT5A 3SQOA 5BXXA 1WCUA 4GKXA 4LO7A 5ABJB 1HIXA 4YYOA 2CDPA 2WKKA 1SMVA 5AVPA 2BEOA 5JWPA 1R1A1 3K46A 4XHXA 3B5LB 4IV1B 3BYWA 1KDMA 2OUHA 2R041 3IKWA 4BM8A 2GP3A 3PMEA 2HLEA 3ST7A 3AFGA 4OMDA 4FPYA 1W0NA 3AC0A 1RUJ2 3POBA 1F31A 4UFMA 4LT5A 4I0AA 2VZ1A 1X8MA 3WP3A 4BZ4A 2WLQA 3QLQA 4C90A 4J25A 5K7PA 5HI0A 1W8ZA 3DKQA 1V0AA 3CL1A 1H6YA 3IPVA 4GAZA 3ILRA 4Z2WA 2A70A 4XF4A 3BTZA 1W6QB 4E4HA 2YPJA 1QJY2 1KS5A 1TZOA 4PLMA 5LB6A 1XYNA 1ACCA 1J3PA 4A6SA 4JQRA 4M3CA 4KNCA 1PGW1 2X5IA 1I9RA 1K5MC 5A3OA 4AAPA 2X10A 4NWVA 3SISA 2ADEA 4ZXKA 4QD2A 3ZSJA 4YPJA 3N9MA 3R4DB 2UY8A 3O1TA 2HWD3 1X9TA 4W65A 2RMU3 1S0BA 1CGPA 2AUYA 3KMHA 1EV13 4IEVA 1IQDC 5FREA 5KXBA 3W5MA 3ILNA 3BN6A 3VBOB 1WKYA 1NCQA 1NY72 1VB2A 3ZFEB 1LJ7A 3IMMA 1F5JA 3T2TA 4IV3B 3BTXA 2WRAA 4PT6A 3W58A 5HV4A 4QHOA 4JHZA 2JECA 1W2NA 1QGLA 4PIZA 4HSLA 3VZLA 4OZOA 1DBNA 5FYBA 4QPYA 2AR6A 4Y5TA 4Q1RA 5FBZA 2NYYA 5FYTA 3J7LA 4AI9A 4RA0A 1SBDA 1GZTA 4GH4B 1DZRA 1E5SA 3UK9A 1JOBA 2HJIA 3ZYJB 5DAWA 5JPNB 2VOXA 1JN2P 4RHV1 1K3IA 3MPBA 1X8EA 2HWE2 1EAH2 1V6KA 3MO4A 5C8WA 3U11A 3K4AA 1HN0A 4HK9A 1GOGA 4LK7A 3U14A 3ZYFA 3E5UA 5FOBB 4XFHA 1AL23 4C0BA 4FPFA 2GN7A 4P08A 5K0UA 3WW4A 5A1FA 2ETEA 3ZFGC 1UU5A 5TSWA 1V9U2 3VV1A 3Q8AA 3K77A 1WMDA 4ISQA 5JLVA 5FZ9A 2BTVC 1DGLA 3ZPOA 5I91A 1OOPB 4L99A 1OPMA 3A23A 5LWBA 2VD7A 4IV1C 2D6LX 2ZX3A 3M70A 1G9AA 1VAVA 1ENQA 5A7WA 1W8UA 3ZN6B 4AVCA 1JZ6A 1POQA 4FFIA 4BQ4A 4P9GA 3N7LA 3HQUA 2K0GA 4CCNA 4BU2A 1H8TC 1YC61 1FMD2 5CBLA 5FKCA 3MI8A 1BVP1 5LY2A 1ZVFA 3NSTA 1AR92 3WG2A 5HCAA 5F5QA 4QX0A 1OH3A 4GA9A 4YG3A 5JAXA 2VCAA 1O5LA 2XOMA 3WHTA 3ZXFA 2WAOA 2DURA 1N1YA 3Q8FA 5LBEA 4H3WA 3OBZA 3FFQA 4XC9A 4BLIA 3TEWA 4CXYA 1TME1 3B3QE 3SCGA 2Y6FA 4RQPA 2HYXA 2C0ZA 3CNAA 3O1UA 1W8WA 1ZBE3 3I3BA 3BIEA 1JHNA 1CN1A 2J22A 5EYYA 3RI8A 3JZVA 4C1WA 4Z1VA 1T6GC 4LULA 3FHIB 4D7YA 4P9JA 2D93A 2RDNA 2QCSB 3A21A 2HWF3 4MH0E 1B35B 5DZFA 3ZFEC 4MUVA 3DYPA 5A3UA 4META 1PO13 3T1MA 1MACA 4IV3C 4JGZC 3B7MA 2JIGA 3P1IA 4DFSA 5BNPC 4PI0A 2LUWA 5E8AA 4O61A 3T2QA 3ZXEA 1U5IA 3T08A 1A8DA 3IMNA 1ODMA 2EVXA 2ZEZA 4XAAA 3VZMA 5IK8A 4H7MA 4S2FA 2JG9A 4GH4C 2QJVA 4W6WA 2PHFA 4FP3A 2VMEA 1BEV1 4X8PA 1CR7A 3LEIA 4BB3A 5FOJB 1QJU2 2GNBA 1UYZA 1HN1A 1FV2A 2A3YA 4INDA 1RUD2 4XXPA 4E2SA 2FMYA 4QU1A 5FZ0A 1H4GA 3CHXA 1NA1B 4ZXEA 4LKFA 2R16A 1CX1A 2GC2A 4YZ3A 4BK4A 2WSUA 2VZOA 2N7GA 4BK5A 3SNMA 4W6XA 1X7NA 2WFF1 2WWSA 3D3AA 5FLIA 4LO4B 5BY5A 1EY2A 1EYBA 2RR11 4CDQA 4G9SB 4LO5B 4XETA 3UKTA 2PLV2 3TN91 1OOPC 5L19A 4YVWA 1LOBA 1KXGA 4CCEA 2W2IA 5E6HA 1IKPA 2E33A 3N9QA 4XDQA 4RN5A 2BGOA 5LASA 3WX5A 2G9GA 1C28A 1MQTB 5F39A 2E6VA 1OFSA 3H8OA 5A6YA 3I54A 4K9SA 4YZ4A 5IAVA 3M3IA 5FY4A 1DGRA 2FBEA 1YJKA 2HWC2 4HT1T 1H2NA 3PVEA 1ZRFA 2WUHA 4TSVA 5A7PA 3AMMA 5JXHA 3PHMA 2AREA 3FMGA 1PIV2 2B9UA 1OURA 3WR0A 1ST8A 4YW4A 3T2OA 1RUE2 3WEZA 5IVFA 3M4FA 3WG1A 3AMPA 3QBQA 3AMNA 1HDKA 2Q1ZB 3P5BA 2ZPXA 2RG4A 4UW4A 3TWIA 3VKOA 2P1BA 2FDGA 3S6PA 1UY1A 1DQ4A 3BU0A 4JTNA 2E7QA 1LU1A 3WP4A 3VHOA 2KD7A 3DYMA 3GJBA 5HV0A 1VMHA 4IEWA 1WCQA 1LECA 1J1LA 2FQPA 5FZOA 2WSVA 4AXOA 1HX6A 3O1PA 3RG0A 2F6BA 1LGCA 1GFF2 1RC6A 4AQTA 1LRHA 3KT1A 3LDBA 5T5LA 1BCXA 2UURA 1UZYA 5DAXA 1UKRA 3B9CA 3OGSA 5I8TA 4YFWA 1NCQC 3VDDA 1WW7A 2DWRA 4YM3A 2XHKA 4B1LA 4XFBA 2QQPA 2EALA 1FPN3 4IEXA 1W6MB 1OXCA 1O4ZA 1RVF2 2NLRA 3ALQA 2BU9A 5EYXA 3ZKYA 1SDWA 5A7SA 1WLDA 4BXFA 2BWAA 1LHUA 3V0AB 4LKSA 1ULDA 4NRQA 5J7MA 3S7EA 4NVPA 3H8XA 1US3A 1WLWA 2WZR3 1HXS2 1HLCA 2QTWB 4NHXA 2Q1MA 2W3JA 3H3UA 1RUF3 2H6BA 4B29A 1I1EA 2FDFA 1UO9A 1HB3A 2RS31 3NJXA 4QQOA 3L2HA 2GU9A 3MFAA 3LIHA 4Y4YA 2TUNA 4PDWA 2UWAA 5JSRA 3WDUA 3HWJA 1LCLA 4DEVA 1NA1C 4JV4A 1OLME 4ZU5A 2DU0A 5DXDA 2BZDA 1PHMA 5A80A 2X05A 1RHI1 3MF9A 1Y7BA 3FUOA 2D40A 2WR9A 3FFZA 2MHFA 2PMWB 4XQDA 3GHNA 3NJVA 2HEVF 3B69A 4D6RA 4Q2FA 4ZPIA 2V73A 3ORJA 1BK1A 2IFWA 2VQUA 5F3GA 3R0RA 3AJZA 1AYN3 4NHMA 4XUPA 1W03A 4Q0SA 4XMAA 3ZSKA 5JOZA 2JICA 2QQIA 2D5FA 2R1DA 3M3EA 3VBSB 4X6QB 2WZEA 4XW3A 4ZZ8A 2ZGRA 4HVQA 2P4EA 1MQTC 2Y0IA 3S0MA 2PHLA 1C5HA 4LHLA 2JG8A 3PVNA 4UFHA 3OG2A 2VH9A 2QZ3A 4CRQA 2E53A 1NE4A 3KV4A 2CNAA 3C7GA 4EN6B 3P3PA 1L7QA 1W9SA 2RJKA 4JDOA 3D6EA 1IGOA 3GGLA 3PUIA 5GLTA 3WQ7A 1J59A 2P17A 5JSPA 5DUXA 4CDWA 4EYUA 3ATGA 1OA2A 4K8RB 5DDJ3 3PIJA 2VTXA 2JKBA 2Q5TA 1KFUL 4FO9A 1NAEA 4CU6A 5EJ3A 1VP6A 3AM2A 4Y1XA 1E57A 2OKXA 3VHNA 1OKQA 2B45X 1AYM3 3E6BA 2VUAA 3VD3A 4Y1YA 3ZYRA 1COV3 1U0AA 1F9KA 2GN3A 2HWD1 3AZZA 4QM8A 3AZYA 1H30A 2D97A 1U5YA 5IFPA 1EV11 1AL0G 2R073 3RYRA 3RJRA 3V56A 5FPBA 2CGOA 5I0RA 1NZIA 1T2XA 3TOJA 5FPUA 2D3SA 2BP6A 2EXHA 4RGGA 2VULA 5J3UA 1HB2A 1AR72 2Y64A 3ETQA 3MFCA 1DGWA 5A6XA 5J48A 1VR3A 3EJKA 1RUH1 1QXJA 2E32A 3MDPA 2ZBJA 4UW5A 5LK7B 1MEC3 2A73B 2ZMLA 4Q4W3 4HFSA 3QACA 2UU8A 4CEYB 4HVRA 1AXKA 4A4AA 5L9VA 2JDKA 3LDRA 5FXWA 4AVVA 1RYYA 2QDNA 3DEMA 1POV3 3G6JB 1XRUA 1JYCA 4Y1VA 4A3ZA 2Q8OA 5JSOA 4CCLA 2WT0A 3ZMNA 3DV8A 1RUI3 1HW5A 3FE5A 1REDA 3PIGA 3WUCA 3AYCA 2CU5A 3O5SA
chains in the Genus database with same CATH topology
4LE3A 1AL21 1F5FA 4AK3A 3JUUA 1MS4A 1KS4A 3VBHA 3RMYA 3ENRA 4AEDA 1SBFA 5L7OC 4AVBA 1X82A 1SLCA 4U36A 1CONA 1ALYA 2W68A 1S0IA 4YVWC 3VBSC 3L9JT 3JD72 1Q8PA 4AGRA 4B8EA 4YRDA 3INAA 1JW6A 3AX4A 4Q4V2 4AI2A 5CU1A 2DFCA 4FPHA 1HQWA 3WXPA 1DQ6A 3ZSEA 5T52A 4XJ8A 1PZ7A 2A6ZA 5JOWA 4AVAA 3AKTA 4P9WA 1Z7S1 5HCBA 3W9AA 2VMHA 2RM21 1FOD3 4DZGA 4AEMA 1DYPA 1C8M3 4NWWA 1ZBE1 1V6LA 1WLTA 2FZ1A 3DF0A 4D94A 5LEKA 1AR82 1PK6B 1XNCA 5IUQA 1WBLA 1NQJA 1M4WA 3BALA 1YWKA 4I0WB 4I0BA 4BYYA 1WCSA 3OYWB 5FPZA 1W39A 1VBA3 2I07B 4KH9A 2LTNA 2I45A 3AZWA 2Y26A 5E89A 3SCFA 4COYA 1N1TA 3FUQA 5CG9A 3JCIA 4QPIA 1G6NA 3ACLA 1H8VA 1NCRA 2Q0AA 3AKQA 5FMOS 4CEYC 1RUC2 3O0WA 5KHHA 3ZMOA 1G9BA 3R4UA 3ZXLA 4AFDA 3QCWA 2MEV2 2ZGPA 3MICA 4RHV3 1ND3B 4IEPA 1XNBA 1YLLA 2UYAA 3IWZA 1XYOA 4PDWC 1PNGA 3ZSLA 5C9AB 4BOWA 1IHMA 1QMJA 3X29B 1ZA4A 4DOUA 4NR1A 2O0OA 4OHYA 4B7EA 2YZ4A 4ZKTB 5BNNA 3D0JA 5C33A 2WT1A 4Y22A 4DMIA 4GWNA 3GZTB 4WM8B 3OF1A 1N3OA 2I2SA 5KXEA 2YHJA 4HVOA 2D6MA 3D4KA 3I4IA 4JRLA 1VBE2 2RHPA 3HD8B 3JB4C 3MIDA 1SQ4A 4L11A 2W0XA 3ZXDA 2ZGLA 1W6OA 3R4SA 4AGVA 1DQ0A 4FPJA 3SXWA 4LBKA 2EF6A 3WQ0A 5FO9B 4R9AA 1XXNA 1RUOA 4S2GA 4HBNA 1JUHA 2XKPA 1C57A 1D0GA 5GALA 4DS0A 1K5MA 4CDWC 4X6RB 3RJ2X 2OYZA 2HWB3 4AYUA 5GZDA 4FTBA 3D8CA 3H1MA 3WQ1A 4AFCA 1LULA 3RPQA 1UU6A 5E16A 3KS7A 3Q9OA 2XBO3 4XF1A 1BQPA 4MGYE 5D1IA 5H9QA 1O3TA 1VAKA 2Z79A 4OFGA 4FOQA 4KGQA 4YGEA 1FXZA 3V0BA 2DVDA 2OUJA 1LGNA 1FPN1 5FAXA 3KSCA 1A8MA 2P3IA 2WA4A 1N1SA 1R092 3J9SA 1ZYBA 3KGZA 3DPRB 2XL7A 4PJYA 2DFBA 2WZR1 1IOAA 2A6WA 4DQAA 4W6YA 1ZBA2 1REFA 1H9PA 2A5ZA 4Y20A 1ND3C 2PTMA 1QH6A 3N7KA 4PLOA 4R9BA 3WDXA 2GNMA 3ZFGA 1TNRA 2C1FA 4IETA 4HPKB 1CX4A 5C9AC 2WFF3 1WLCA 1HRI2 2RR13 2WA3A 5FFOC 1PGSA 4RR3C 1UZZA 3VBHC 1DU3D 4IV1A 4DPNA 4TYSA 4QM9A 2ZGMA 5FLHA 4YNIA 3JQWA 3IDBB 4JGYB 2IWGB 2JE7A 4HN0A 4N7IA 2R063 2P3KA 1BMV2 4LLFA 1RGSA 1ZNPA 3VL9A 3WDTA 1N3QA 1YRZA 3LKJA 3ROUA 2O8QA 2XJSA 1W6QA 4OI2A 1ZX5A 1Z0HA 2ZAAA 3LA7A 1MVQA 5DDJ1 4O9EA 2W52A 3FLRA 1ULGA 2RMU2 1KDKA 1GZWB 2QUOA 1D4M3 4WVMB 5JCTA 1MR5A 2MPFA 1CAVB 1AYM1 1SFNA 1QKQA 1VALA 5FCCA 2PFWA 4HZFA 5B2GB 3VBOA 3ZFEA 4AVSA 4F7ZA 1QQP2 3GZUC 4RD7A 1OI6A 2R071 5KHIA 4IV3A 5KXCA 5AFBA 2K2SA 3BIWE 4AGGA 4H7LA 1ZREA 4A3XA 5IK7A 4GMP1 3VN4A 5GLZA 3ASIA 4GH4A 4OVEA 1UX6A 1MEC1 3KT4A 2ZMKA 4Q4W1 4LLOA 1NCRC 4ASLA 3U10A 2RS33 4M0NA 4YGDA 1POV1 2A71A 2NMOA 2GZWA 4ITCA 1LOCA 5KC6A 2RS13 4P9LA 4AE2A 4Q8KA 3WNXA 3VBUB 2X8KA 4WVZA 3ECQA 4DRVA 1UF2C 2ZAHA 1GNZA 2CAVA 1OOPA 3M2MA 2IXKA 4AHYA 4YGCA 3ZXAC 4GB31 2YY1A 4G4FA 5FPXA 4QPGB 5BNNC 2EXJA 3SH5A 4BLJA 5C6CA 1KRIA 4XJAA 3ZN6A 4GKYA 1GKBA 4AWDA 3VBFB 4JGYC 1GBGA 3MIGA 5FDBA 2PAKA 2ZGSA 2ZHNA 3KM5A 4ES9A 5FTTC 2GC1A 3DUIA 5FO8B 4XEZA 5GZGA 3J8F3 2RS53 2HEWF 2D3RA 4B4RA 1IS4A 2PHRA 1YYNA 2VQ0A 3VUOA 3O7OA 2XJPA 2EAKA 2DV9A 1YI7A 1ZBE2 4LTAA 4Y24A 4KWLA 2QKDA 5DUUA 3R6SA 1FOD1 2IZWA 1JH5A 1H1AA 2P2KA 2WINB 1C8M1 2HWF2 4ES8A 3CEWA 2BPA2 4AFMA 1LEMA 1BBT1 5HXVA 3VBRB 1PO12 1B35A 1Q43A 3AK0A 2OPKA 1PVXA 5H9RA 4YW5A 4B7KA 3DL3A 1CAXA 1VBA1 4RS5B 1QJX3 1W2UA 1LESA 1RUH3 4URTA 1O3QA 2XVLA 4RSUA 3H8UA 4DB5A 1H2MA 5T3NA 4DXZA 5FMOL 1N3PA 4YVSB 3WW1A 1RITA 3CU7A 1NA1A 1XNKA 2GC3A 1VBD3 1ASJ2 4J1XA 3ZFFB 1OD5A 2DVFA 1JYIA 1DQ5A 4I30A 4LA2A 4FOYA 4Q1PA 4XFIA 4FQ4A 2FHRA 3VBUC 1VRH1 3BCWA 2Z2SB 3M3QA 1NE6A 2CWSA 2FZ2A 3SH4A 3TNPB 4QPGC 5ABJC 4QMAA 4R52A 2XWJB 1Y9QA 4OLLA 5I93A 1WCKA 1DG6A 3M7AA 1MQTA 3RWNA 3WHUA 2DF7A 3VBFC 2D5HA 1O4TA 2HYKA 3O12A 4M3CF 4MV2A 4S2HA 4OZXA 4ATEA 4HKLA 4P9YA 1PVC1 4A7ZA 2R0FA 1PZ9A 3FWEA 4OUSA 4D3WA 3BOWA 4ATFA 2XB6C 2ZX1A 2LALA 4XTMA 3WY6A 1Z7S3 3BPZA 1D4VB 4XQ4A 2RM23 2XJQA 2PHTA 2R6QA 4EN9B 2WS93 2HWB1 4GWMA 3U07A 2O1QA 3ILFA 1HRV1 4OULA 2PHUA 3VBRC 1NG0A 1PO21 2XBO1 1UW8A 3TYJA 4QQ2A 1CJPA 1RUJ3 3MPPG 3UKNA 3VBOC 4JAAA 5ACA1 1IPJA 4HKOA 4KWKA 4COWA 4RS5C 1SACA 1VB4A 1W6MA 4CZSA 4Z92B 1AXYA 3URFA 3VZOA 3GNEA 4XF3A 3V0AA 3OGGA 3E5QA 1S0DA 3IM0A 1RUF2 1SBEA 2WJSA 1JTZX 3WCSA 4NPRA 1KJLA 2XL9A 1D0HA 4YVSC 2TEPA 4LUKA 2DUOA 3RQ0A 1QXPA 4E2GA 3OD0A 3GBWA 4Q4Y1 4OHVA 1YIPA 3ZFFC 1H2KA 4WZCA 5A33B 1ENRA 1L3JA 3LA3A 4IEOA 3WT3A 3K51A 1AYN2 1TMF1 2SBAA 4N53B 5L7OA 2LM3A 1RMU2 3R05A 3OPZA 2GMEA 1ZZ7A 5C8CB 1UIKA 4YSFA 3VBSA 1XU2A 3USUB 5JDBA 5DUVA 4LHNA 4AI3A 2E63A 2Z69A 2DYCA 1JUIA 1RUG1 3FLPA 4EJRA 1F8VA 1CJDA 2R061 2NQYA 1ULCA 5LRSA 3WLUA 3AFKA 3ZIXA 1AR61 2AZ5A 4Q0QA 1EAH3 5KC5A 4EROA 1O3RA 1DZQA 3W59A 4BMEA 2NM1A 5EXOA 3P3NA 3VZKA 2QE3A 1MVEA 2ET1A 4P14A 5JZGB 3HT1A 1V9U3 1COV2 3VZJA 2DVGA 3EBRA 4Q0UA 3ES4A 2R072 1D4M1 1CAWA 1ND2B 4Y1ZA 1X36A 1Z78A 1YO8A 1UAIA 4BHPA 2DTWA 1CPMA 3H7JA 4YW2A 2BFUS 3SLIA 1B35C 1PMIA 3LZZA 4CP1A 3KQRA 5I0SA 2DVBA 4CDXB 1AR93 4C91A 2CAUA 3KD4A 2NP0A 2B46X 2CWMA 3AP4A 2XJUA 1X50A 3SCHA 4CEYA 1OQ1A 2CL2A 1U5ZA 3JBG1 2GMPA 4KL1A 1RUI2 5T5PA 4UBGA 1MS3A 5GJ6A 3LOIA 2NPIA 5A32B 2PAMA 4N43B 2VG9A 4YM0A 3WDWA 1IQAA 4XJZA 2RS11 1REEA 5GZCA 2ZZQA 3LCPA 1R1A2 4LBQD 1G8WA 5I8YA 4JVAA 2R042 5C8CC 5CFCB 3LOBA 5BNQA 4JDMA 4K20A 3A4UA 2YMZA 2IXIA 2Q30A 4Y1UA 4E4DX 2DCKA 5BV6A 1W6PB 3G7DA 3HMYA 1QY4A 4D69A 1QJU3 5CB7A 2GSYA 4C1XA 3J8F1 2RS51 3CJIB 5IK5A 1ONAA 3AKSA 4WZFA 4YZ5A 1PGW2 3KZ4C 1ZZ8A 3C3VA 4N9HA 4Q4X1 4AQ6A 3K48A 5JMCA 4MXWB 5AC91 3OGJA 4PQ9A 4ASMB 3MLLA 4AI8A 2Y38A 4UW3A 4CDUB 4XF9A 4QGLA 5JOXA 1LOEA 1N47A 4FPKA 3WG3A 3KGLA 4JCKA 3TB0A 4KBBA 3N7MA 1VJ2A 2OZ6A 3HAGA 3OYWA 1FV3A 5KHGA 2VPVA 3FLTA 3ZN5A 1H4HA 1ZRCA 3RMXA 2NZ9A 5I0UA 5LRRA 1V70A 1QJX1 4YW1A 4XIKA 3VKMA 2HWC3 4CEWB 4GMP3 4XILA 5BNOB 2GNTA 2WNUB 4RHV2 2ZGOA 4R9DA 1DF0A 3B93A 3UV9A 1IZ3A 2DUPA 1ND3A 4FOVA 2VUJA 5FRAA 3BU7A 1C4RA 1Q56A 2BQPA 2VMGA 4KG8A 1VBD1 3WV6A 5C9AA 1VBC3 1A78A 2PHDA 2EAAA 3HQXA 4RR3A 3WG4A 1UMZA 3ZYIB 1ZZ9A 3NJZA 5GLWA 1PGL1 3OJBA 1DIWA 2WNVB 4GB33 3VHRA 5CFCC 1UIJA 2KA3A 1LKNA 2BYVE 1UCXA 1YIFA 4A7KA 3VLBB 1J3RA 2BBVA 2XVGA 1CVNA 3IBMA 3TNQA 4OI0A 3IDEA 4FT8A 1HXS3 3PVOA 1S2KA 4L92A 3EQEA 4BCUA 3O14A 2XLAA 1DQ2A 4ORFA 2ARBA 3CJIC 1XU1A 1VBB1 3B02A 1C8NA 1TME2 1CAUB 2E9QA 4DNYA 2HWB2 1AUYA 1Y43B 1UL9A 1YFXA 2B39A 4NHKA 2ZKLA 1GQHA 4XJUA 5GZEA 2X53S 2WS91 4BWOA 4LBQB 5IT6A 4D7TA 1HV1A 3JQXA 1MS8A 2I74A 1BBT3 1O4YA 2XLGA 3RSJA 1FNZA 3HR9A 1XYPA 1UU4A 4FSJA 3V64A 1RUJ1 3M1HA 5DG2A 2A75A 5KBFA 3PLQA 3ZO0B 2D3PA 1OMIA 2B8MA 4AHXA 3LSDA 3WZ1A 5A3LA 3ZDSA 1YUDA 5JIUA 1BEV2 5BNOC 4OI1A 2WNUC 3QD6A 3DPRA 1YFWA 4Q0VA 4WBBA 1NOVA 3N3HA 3KCYA 3BB6A 1QNWA 4CTEA 2V09A 2ZZJA 4YZ2A 2WFF2 1V6IA 3ZPYA 3ZYPA 5F6KA 4YZ1A 2YROA 2GDFA 2RR12 4HPKA 4MXVA 4I3PA 4BIOA 3AP6A 3WUDA 1LU2A 4XHBA 3PJQA 2P37A 3NL1A 1W0PA 3TN92 4KU7A 1VRH3 4M00A 4QQPA 1A6CA 3CF6E 2ZGTA 1NY71 4MGIE 2D6KA 3MW3A 1QH7A 3EO6A 5CAZA 1UPIA 2Y0OA 2ZHMA 3EHKA 1KITA 2WNVC 2E51A 1AR73 3B9IA 4HMZA 1JBCA 1QDCA 2R062 2A6XA 3POSA 2UWCA 4Y26A 5LEJA 4JGYA 3MIHA 5FO7B 3WP5A 2W39A 2ZGQA 4WM7B 2Q4SA 2V5YA 4R4ZA 3B94A 3H7YA 2ILMA 4O9GA 3H9AA 1PVC3 2HWE1 1EAH1 2PYTA 5J09A 4XJWA 1RINA 3OBTA 2TBVA 3UJQA 4OI4A 1OQEA 1D4M2 2D44A 1AVBA 3I59B 4MYEA 1N1VA 1V9U1 3GF6A 1GZWA 4WVMA 1R1ZA 4DY5A 2BVBA 1CAVA 1RJ7A 2VW0A 5T5OA 2YGMA 1WD4A 4RGAA 4EV0A 2JEMA 1HRV3 1PK6C 1W6NB 1UPSA 1PO23 3THTA 4C0HA 2XPJA 4FPEA 1AJKA 2BFUL 2DCTA 4OHXA 1S0JA 4JTOA 5ACA3 2ZGUA 1BZWA 5KXDA 1SLTA 2VMIA 1AR91 1PNFA 2BVVA 4PCRA 1HV0A 2AYHA 3AKPA 4EN8B 2RS32 3RNSA 2XJRA 4IL7A 3LWCA 1GLHA 3ZSMA 3AXDA 2AENA 2VW2A 3J4UH 4WVVA 1POV0 1IS6A 3JB8A 4Q4Y3 3LB9A 3TRSB 5CG8A 1RHI2 1G86A 2D6NA 4AVTA 3E5XA 4PIXA 2WQ4A 1S0CA 3VBUA 3A0NA 4PIYA 1S0FA 3LA2A 5HCFA 3AB0A 2YUEA 1TMF3 4OHZA 3GYDA 4QPGA 3TAYA 4QPIB 3SHRA 5ABJA 1LOFA 2P34A 4QGMA 5AVAA 4CDXC 3WVJA 1ZRRA 1OSGA 4I01A 4BIFA 1YCIA 3KB5A 4MGKE 4WM8C 3VBFA 1VIWB 1RUG3 4YM1A 5EV7A 4GULA 5C4WB 4XPVA 1RUC3 3SITA 4AFAA 2QDRA 4HETA 1SCRA 1QJU