3POWA

Crystal structure of the globular domain of human calreticulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
251
Chain Sequence
GREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the human calreticulin globular domain reveals a Peptide-binding area and suggests a multi-molecular mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords calreticulin
total genus 76
structure length 251
sequence length 258
ec nomenclature
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3powA01
3WV6A 4Y1ZA 1YO8A 2ZABA 2AUYA 4M3CA 2EXJA 4FPJA 3V65A 2PELA 3A0NA 3AP5A 4YGBA 3ZXFA 4YZ2A 2VW1A 4NO4A 3OJBA 1UZZA 4XBNA 4DQAA 3LCPA 4FPCA 4YFZA 4XJ9A 2A3WA 2EIGA 4YZ5A 1Q8VA 4KBBA 3O0WA 5LK5A 1A8DA 5T5JA 2A6VA 1LJ7A 5H9SA 1DQ6A 1G86A 1YIFA 1ZM1A 3O5SA 4WZFA 1UKGA 1DYPA 2EALA 5SV8A 1DQ4A 2DYCA 4SLIA 4CTEA 1JOJA 2P34A 2B7YA 1WBFA 2ES3A 1LEDA 2ZGMA 3N7KA 1UN1A 5GZFA 4XJ8A 3WDVA 5DUWA 5FRAA 2GNDA 4LBMA 3U4XA 1KJRA 4XIKA 2ARXA 1PZ8A 3OY8B 4FVVA 4DS0A 5JOZA 2VXRA 4Y24A 3RMXA 1LU1A 4R9CA 1QDOA 3JUUA 3KM5A 3VKFC 2YY1A 2EXKA 4ISQA 1JUIA 4FPLA 4Q1RA 4RL7A 3INAA 2E53A 2GMEA 2HYKA 3WDXA 1S0CA 3N7JA 3OBTA 2D6LX 4YGEA 4AYUA 1AXKA 4GKYA 4YG0A 3A4UA 3C2UA 3N35A 4ITCA 2D6NA 1Q8PA 3MPPG 1S0IA 2OUHA 2ZHMA 3OBRA 2D6OX 2ZA9A 4H55A 5CBLA 1DBNA 1LOBA 4C1XA 4XTPA 4M3CB 3HR9A 3FLPA 4LBLA 1BZWA 1FV3A 5T55A 2JE9A 5FREA 2PHXA 4BQ1A 3M3OA 1AVBA 1JYCA 3ZSKA 1S0DA 4XILA 4XXAA 4Y20A 1SFYA 2PHFA 2DVFA 3ZYPA 2UWCA 3R05A 5GZCA 1BJQA 2P3KA 4P9WA 1CQ9A 4AVTA 3MW4A 1QMJA 2CY6A 4GKXA 4YM3A 3Q9OA 2AENA 2YROA 2ENRA 2ZGPA 3WG2A 3WNXA 3ZYRA 2KM2A 4HANA 1DQ0A 1LOCA 3POWA 3ZSMA 1KRIA 4R9AA 2WKKA 1QGLA 3ZSLA 1QOTA 5CA6A 1AF9A 4R9DA 3USUA 1N3PA 1JW6A 2DWRA 1GNZA 3APBA 1SLTA 5GZEA 1ENRA 1WLCA 2AH2A 2CTVA 3WDUA 4K21A 5KXDA 1S0GA 1WCSA 1ENQA 4BLIA 1LTEA 2GMMA 2ZHLA 3BODA 5HCBA 3UK9A 1GKBA 3BTAA 4P9XA 3W59A 2P3IA 3NV1A 3ZSJA 5IK5A 2CWMA 1RIRA 3RG0A 2R0FA 1AJOA 2WSVA 2YMZA 3ILNA 1QOOA 3AYCA 1QU0A 1YI7A 2A6XA 2EF6A 2JD4A 1W6QA 2EXIA 2VW2A 3ZXLA 2DVDA 3KQRA 1F9KA 1Y7BA 4Y22A 2AREA 1S0BA 4K1ZA 4AGGA 1ULEA 4XOGA 4YM0A 3IKWA 1N3QA 1HLCA 1SCRA 5IUQA 1MS8A 3BOPA 3TAYA 1W6PA 5DG2A 3AXDA 4Y1VA 1C4RA 1MS3A 4YW5A 1W6OA 4JCKA 1MS9A 3T1MA 2JKBA 2DU1A 4GALA 4UW3A 4Y1UA 3UL2A 1MACA 2ZACA 4FP3A 1G7YA 3OY8A 3OYWA 3PVNA 3POSA 3AYEA 4YG6A 5DUXA 2NP0A 3V0AB 2D6MA 2TEPA 4D69A 3H0OA 5E88A 3AP4A 1IKQA 4Q8LA 1ULGA 1BQPA 4DRRA 1C1FA 1N47A 5F9TA 1S0FA 1QNYA 1FATA 4XXPA 5E89A 2XG3A 3AYAA 5JMCA 2Q5TA 2EXHA 2ZGTA 2NMOA 4OZXA 3USUB 1N3OA 4AWDA 1A78A 2PHUA 3B00A 4FPGA 3N36A 3M3CA 3N7LA 1LOEA 4FPYA 1LECA 4YFWA 4C1WA 1SBFA 3B69A 4Q26A 2DV9A 4ZKTB 3UJQA 1H9WA 4WV8A 5GM0A 2PHWA 1Q8OA 2ZGQA 2ZGNA 4AVVA 1DQ1A 3LSEA 4WVVA 1WD4A 2A3YA 2WJSA 1A3KA 1B09A 2AGSA 1MZ6A 2D43A 1Z0HA 3RRDA 2D6KA 1LGNA 1LENA 2WT2A 1WW6A 4RA0A 5CB7A 2ZMNA 3IN9A 2FMDA 2D7FA 1C1LA 1G9BA 3MW2A 3WG3A 4TYSA 4Y26A 2DVAA 2ZZJA 2WT1A 1DHKB 2ZGRA 4Y1YA 1AX2A 1TEIA 3V0BA 1GV9A 3PMEA 4CRQA 1LOFA 3CNAA 2JE7A 1G9AA 3ZPYA 4ATEA 2D3SA 3JU9A 4YGCA 3MW3A 3NV2A 2JECA 4NOTA 5GALA 2I2SA 1GZWA 2ZHKA 4GXLA 2A70A 3WUDA 1LHVA 3WHUA 3AJZA 2WNEA 1DGLA 1W0PA 2CYFA 1WW7A 1LOAA 1LU2A 1SLBA 3M2MA 1BYHA 4PQ9A 3RMYA 1S1AA 2GDFA 1JYIA 1APNA 3W58A 1LODA 3ZXKA 4U36A 5L73A 3I4IA 4LBKA 1BXHA 1ENSA 4XJZA 3AZXA 1EPWA 1WBLA 1WLDA 4YLZA 1GZ9A 1N1YA 1URXA 4PBPA 2GNTA 3WCSA 4BPZA 4XBLA 3IPVA 4I30A 5EYXA 2NN8A 3FUQA 5DXDA 4FOWA 2A71A 1YRZA 1KDKA 2NMNA 1DZQA 3ASIA 3AZYA 2OW4A 5GJ6A 5T50A 2YZ4A 3A0KA 3M3QA 2A6WA 4BMEA 1GNHA 1WUVA 3B01A 1V6LA 1LHUA 1IS4A 3AJYA 5H9QA 1D2SA 3O0VA 1XQNA 4BOWA 4DFSA 3OYWB 1IKPA 3R4UA 3IMNA 4JRAA 5DUVA 4Q27A 4XZPA 5E8AA 1NXD1 2JJ6A 1BKZA 4K20A 4FP2A 1LHNA 4XMIA 2PHRA 3NWKA 2DTYA 5DG1A 4YW2A 4Q1PA 1N1SA 2R1BA 2ZKNA 4UW6A 1PZ7A 2GALA 1YYNA 1Q56A 3ILRA 1W6MB 2Z42A 5H9RA 5IK7A 5EXOA 2NM1A 3M1HA 1GSLA 1I1EA 3VKOA 4Y1XA 1KITA 4LBQD 4F83A 1VAVA 1CESA 2H0BA 4FQ4A 2ZAAA 3ZXJA 2WSUA 4XJAA 1QF3A 4W65A 4FPHA 3HMYA 3WUCA 1C57A 1G9FA 2GN7A 5IK4A 3WDYA 3GALA 2AR6A 2CWSA 3SISA 3LSDA 4CZSA 4MYEA 1U0AA 1H9PA 5T5LA 5HCAA 1SBEA 1IS5A 1RINA 1IS3A 1ULCA 4LBQB 1MZ5A 4XTMA 1DQ5A 4DRVA 3AX4A 1R1ZA 1W6NB 2ZMKA 2ZMLA 3DGTA 1JXNA 1FAYA 1OFSA 4PF5A 1SACA 3B3QE 1UPSA 2A3XA 2SBAA 1SLCA 2GN3A 4GWMA 1F5FA 2ZGOA 4LBJA 1LGCA 2VU9A 5BYNA 1N1TA 3L2YA 1LGBA 5JOXA 2ZGUA 3B9CA 5CAZA 4FPFA 1LHOA 2JDZA 3ENRA 2BQPA 2NZ9A 5GLZA 3V0BB 2E6VA 1DYKA 4FQZA 3T2TA 2NYYA 2DTWA 1QNWA 1GZCA 1QKQA 1FNYA 1S0JA 1WD3A 2DU0A 1UZYA 1W6MA 1HDKA 3D5OA 2OVUA 3FBYA 1CN1A 4JC1A 1CIWA 1UX6A 3ILFA 4YW1A 1JBCA 3IM0A 3WDTA 1IS6A 2DUOA 1V6NA 3NV4A 5KXCA 3OPZA 4WVWA 4M01A 5AVAA 5JDBA 1UAIA 5GLVA 1SLIA 2P37A 1NLSA 5CNAA 3QLQA 1KQRA 1CPNA 2C9AA 2DURA 1N1VA 1GANA 4Y22B 1MR5A 4K1YA 4TZDA 1MVEA 3HN1A 3NV3A 1Z78A 2YV8A 4AGRA 4BMBA 3POYA 5JVVA 4ZXKA 2VUAA 4ISRA 1GLHA 1LESA 4XJUA 2ZGKA 4XE9A 2W08A 1MS4A 1MS1A 4Q8KA 1OQ1A 3PVOA 2ERFA 1FYUA 1DQ2A 1F31A 4FPEA 1CONA 1AXZA 5T5OA 2E7QA 4L8QA 3V0AA 3IPVB 2R49A 2D44A 1HQWA 3BIWE 3D4KA 4R9BA 1ZA4A 3SNMA 5KXBA 1SBDA 3AK0A 4DPNA 1UL9A 4U2AA 1G8WA 1VALA 1W6NA 3FLRA 4GA9A 4M00A 2R16A 5T54A 1MVQA 3TB0A 2D6PA 4AVSA 4XJWA 2R1DA 3DUIA 3GNEA 2SLIA 1VLNA 1V6OA 2VH9A 3I8TA 2YXSA 5F5QA 1IOAA 3FLTA 4UW4A 1LULA 5JOYA 4ASMB 5T5PA 3VUOA 2DUQA 3SLIA 1W6QB 2ZHNA 3SH5A 1FX5A 1AZDA 3WG1A 3AZVA 4Y20B 3RSJA 2OUJA 5DZGA 3RQ0A 1QDCA 1WW4A 3AYDA 1YXWA 4YZ4A 1G9CA 4YM1A 1CR7A 4UW5A 2W68A 2ZGLA 2CNAA 1FV2A 3VKLA 5GLWA 1JHNA 1DFQA 1O4ZA 3T1LA 2GMPA 3WHTA 4Q2FA 5T52A 2A75A 2UURA 4FPOB 2WT0A 1MS0A 3AZZA 3WG4A 4IQPA 3WDWA 3WLUA 3WZ1A 3R4SA 1UMZA 3AXEA 4ATFA 4YZ1A 3PVEA 4LBQA 2E51A 3RS6A 1Q8QA 4XYXA 3PJQA 3VKMA 1MS5A 1LHWA 5KXEA 1D0HA 5HCFA 4LBNA 2A7AA 2ZBJA 3N7MA 1O4YA 3AZWA 2UWAA 1H30A 1VAMA 1S0EA 1G9DA 1I3HA 2D3RA 2V73A 4XIOA 3AP6A 1W0OA 1WW5A 1GICA 1Q8SA 2AYHA 4M3CE 4P14A 4PBOA 5GZDA 1LOFC 2A6YA 2W39A 2EAKA 3OGGA 2WLQA 5DUUA 1V6MA 3ATGA 3WCRA 2W52A 3V64A 2VW0A 3D6EA 3O12A 3FFZA 5GZGA 3AFKA 4LBOA 4FOYA 1GBGA 3M3EA 3UJOA 1V6KA 1W6OB 3FUOA 3N3HA 5EWSA 3SITA 1SLAA 2DVGA 2RHPA 1CJPA 2A6ZA 1WLWA 1W6PB 2DVBA 5GLUA 1ULDA 2CL2A 1V6JA 4XHBA 2PHTA 1GYKA 1KDMA 5DZFA 4M3CF 2LALA 4XHXA 5EYYA 3SH3A 5IK8A 1AX1A 1RITA 1GZWB 1AJKA 1LEMA 3O0XA 1CVNA 2GNMA 1DIWA 2V5YA 4YZ3A 1FNZA 4YW4A 2FHRA 1QOSA 1DLLA 1V6IA 5JLVA 5GLTA 4PCRA 4FOVA 1SLLA 2VY0A 3AP7A 2C5DA 4YG3A 4GWNA 1SCSA 2XB6C 1V00A 3SH4A 1HKDA 2P2KA 1ONAA 4XBQA 1VIWB 3ZVXA 1PZ9A 2LTNA 1AXYA 4FPKA 4YGDA 1X50A 4P9YA 1J1TA 2A5ZA 1ULFA 2P3JA 2D3PA 2G4IA 1LOGA 2R0HA 3WVJA 2UU8A 3ZXEA 2GNBA 5JOWA 3QCWA 1HQLA 1CPMA 4XDQA 3VV1A 4Z8BA 1OKQA 4AGVA 2ZGSA 2WQZC 4YW3A 1LCLA 4XMAA 4BM8A 5DZEA 2E7TA 3WOGA 5H9PA 2DUPA 4FOQA 3AP9A 4HL0A 4YM2A 5IT6A 3MEPA 3VKNA 2ARBA 1KJLA 1AX0A 2UWBA 1JN2P 4BLJA
chains in the Genus database with same CATH superfamily
2QTWB 4HT1T 3LFMA 4Y1ZA 2R043 1DGRA 3D82A 5JSRA 4M3CA 3UGFA 1NQDA 2EXJA 2VPVA 1E5SA 1KFUL 1UW8A 3BALA 3V65A 3WP6A 4EYUA 5IVCA 4UF0B 5TSWA 3DXTA 3KV9A 4OUMA 1W9YA 1X8MA 1XE8A 3Q8CA 5C8CA 4HSJA 3AFGA 1FMD1 2J22A 2W91A 2WN3A 4XFIA 4XJ9A 2EIGA 1OMIA 4IW3A 1Q8VA 5DAVA 1CAXB 4YVSA 3A22A 4QHOA 5T5JA 1LJ7A 5H9SA 5F8PA 1S2EA 1YIFA 1UOBA 5FMBA 3O5SA 1UKGA 5FYHA 3KCYA 5D8AA 1DYPA 5SV8A 2AC1A 1V9U2 1DQ4A 3F2ZA 3WD5A 2J42A 3CEWA 3Q8AA 1JOJA 2P34A 3JB8A 5FBZA 4CTEA 2QQNA 2XVLA 1WBFA 1NY72 2WNVA 5FO9B 5DUWA 5FRAA 2P3YA 3CO2A 3USSA 1KJRA 2QUOA 4I0WB 1HRV2 2Q1FA 4W8JA 3OY8B 3AKTA 3ZFFC 1OD3A 5EQUA 4D7SA 2WAAA 3QH6A 2OQ7A 5A7WB 1QDOA 1RUI1 2G9FA 1DZTA 3M3IA 2W1SA 3ORJA 5AVPA 3VKFC 1L7RA 4E27A 4NMIA 4Q1RA 4CCCA 1V9U3 4IEOA 2JIGA 4CCOA 3GHNA 4KBZA 4H7LA 3WDXA 1S0CA 4CUCA 3N7JA 3OBTA 3U1XA 2R32A 4IERA 3MIFA 4AYUA 4RQPC 4YG0A 4WBBA 3I3MA 3BUCA 2JKXA 1QJFA 2E63A 1OI6A 3O14A 3WXPA 4ITCA 5C8CB 4R4XA 2JXAA 1RGSA 3WF0A 4FSJA 1JHJA 2VBDA 4ASLA 5CBLA 3LA2A 2HLEA 3DECA 4C1XA 4WM8A 2ZX3A 4QKBA 5IFPA 1QQP2 3AC0A 1BMV2 4RS5B 2AZ5A 3VHPA 4LBLA 1BZWA 1HRV3 1EY2A 4XZUG 2J1EA 5FZ1A 3A23A 3RJRA 2J1AA 1RUD2 1B35C 5DAQA 5FQ0B 3W5MA 1RUH2 2XPJA 1OA4A 1W8NA 1SFYA 2PHFA 4QB2A 4XXAA 5DABA 5IFTA 3ZYPA 4CXXA 3NAPC 4XFBA 4KH9A 2VVFA 4QX2A 1XU1A 3LA7A 4AL9A 4B3NA 1BJQA 3PIGA 3PMSA 2Q8EA 1XC6A 3HAGA 1VBD1 1QH7A 3ABZA 3K3OA 4DY3A 3NNGA 1GUIA 1BMV1 2VC9A 2ENRA 2YROA 1OF4A 3UESA 2LROA 2KM2A 1W2TA 4YVWC 4HANA 4YYOA 3VDDC 1LOCA 2K0GA 2WN2A 5F5AA 2VO5A 1QGLA 2ZOEB 3P3NA 3OGRA 4LTAA 1YFWA 4R9DA 5JAXA 4M0HA 4QQOA 3HPNA 4GZ9A 5BUVA 1SLTA 2VZOA 4UAPA 1ENRA 3UKTA 2AH2A 2D40A 4TTGA 4Z07A 3WDUA 2IFRA 4AF9A 4K21A 4GQ7A 1S0GA 4BLIA 1ENQA 3B02A 1LTEA 3UK9A 4H14A 5C3QA 5F7UA 4AI8A 4P9XA 1REDA 5FMCA 2R0FA 1AJOA 4OQ8A 3ILNA 2OXBA 5JR7B 3VBOB 2VCCA 1RHI1 1MQTA 2W1UA 2WUHA 4CCMA 1W6QA 5CFDC 4HLTA 1HX6A 3KQRA 2XL9A 1JU4A 4WVMA 4PHZA 1ULEA 4OULA 2WZR2 1CAWA 1N3QA 2GSYA 4QGNA 4AFMA 2VNRA 1CAUA 1MS8A 2ZAHA 5DG2A 2RDQA 3AXDA 4Y1VA 1FPN3 1JZ2A 3T1MA 4GALA 1PO23 2RJ2A 4FFGA 4FP3A 2NP0A 3POSA 3H1MA 4F7ZA 2FBEA 2J1UA 1POQA 4MGIE 4MXWB 2TEPA 1UIJA 5JSPA 4EE2A 3G7DA 5CEHA 1SZBA 4DRRA 3K51A 1N47A 4X8NA 5E89A 1PX4A 4J6GA 3QACA 2Q5TA 4E4SA 1OQEA 1A78A 1TE1B 2PHUA 2X09A 2FCUA 3B00A 3N36A 3ZDSA 4BQYA 4QMAA 5FP8A 2IVJA 3OUHA 4RGAA 1SBFA 4Q26A 4C1WA 5FZBA 3CZJA 3T0BA 5GM0A 5DMYA 1PGW2 3LSEA 2VZ3A 4MHRA 4AHYA 3ZOIA 1W8FA 2FZ2A 2AGSA 2B5HA 1MZ6A 1AYN3 2DF7A 4BE3A 4CDXC 4ORFA 2WT2A 4RA0A 3VBRC 1J58A 2EIBA 2FMDA 4NAMA 2D7FA 3IAQA 1C1LA 1G9BA 3TEYA 5FQ0A 1W8ZA 3KCXA 1PIV2 4G9SB 4QPIA 4TYSA 3S6PA 2KR2A 5FKCA 1H8TA 2WT1A 4Y1YA 3RFRA 1TEIA 1GV9A 2LS6A 3ITQA 3VBOC 3MICA 4XFFA 1G9AA 2BP6A 4PIZA 4URTA 2D3SA 2WAOA 3JU9A 4YGCA 3MW3A 4BJ0A 4P9LA 4NOTA 1OXCA 2E33A 4M4RA 1O8PA 1QJX1 3WUDA 3VDBA 1QXRA 1W0PA 2VMDA 4FBFA 5FZCA 1RUOA 3AMQA 1WW7A 1VBA2 1LAJA 2GDFA 3CBNA 2HWF3 2HWD1 3ZXKA 1LODA 1XNBA 3DPRB 4TN7A 3I4IA 2XONA 4D3WA 1JYNA 3KF5A 4LO7A 1WBLA 4NPMA 2PLV1 1URXA 1N1YA 1PNFA 2B39A 4PBPA 5JMOA 3WCSA 3KS7A 5FYTA 2YBPA 1VP6A 1GOFA 5C3PA 5HI0A 2NN8A 1UNBA 2WWJA 4NE9A 3FUQA 4P9GA 4ES8A 3EXUA 5FLIA 2BDRA 5T50A 1O7FA 5F3EA 1HB3A 2Y0OA 1MEC3 4BMEA 1UMIA 1W2AX 4OCTA 3B01A 4WM8C 3MIEA 3MO4A 1ASJ3 4PDWB 5LW9A 4LE4A 4LNVA 1D2SA 3O0VA 4CPBD 1EUUA 5LCWL 3IMNA 4K8RB 5JXJA 2GU9A 3POIA 2D98A 5ANNA 5EV7A 4NPLA 3WF1A 1NXD1 4Y5TA 5FYCA 2ZZQA 2EIDA 2PHRA 3NWKA 4O65A 4S2GA 2VOVA 3SC7X 2XGXA 4XF0A 2VUCA 3CU7A 4MGZE 4CEYB 1W9TA 1PZ7A 2GC0A 1YYNA 2WZPP 1Q56A 3OB8A 3KVBA 5IW0A 3WY6A 4W6YA 4B4QA 4AI2A 5H9RA 4E2SA 4HPKB 4CUAA 1Y9MA 5EXOA 2PXJA 4Z2WA 3VKOA 4Y1XA 2F17A 4BYYA 2R042 1HB4A 1A6CA 1CESA 2H0BA 3ZXJA 5HV0A 2WSUA 3PUAA 1KXGA 1T2XA 2A73B 2OX0A 5A70A 2YC2A 3RI9A 5KBFA 2CWSA 3TN93 4HXCA 3CLPA 3NAPA 5T5LA 3ZO0B 1PMJX 4XW3A 1QJY3 1ULCA 1IS3A 4Y4RA 4XABA 1UY0A 4XF9A 1EYBA 2UYBA 1DU3D 4QX1A 4KG8A 3U78A 1FAYA 1ODMA 1K5MB 2Y6JA 1EAH3 1R083 3LAGA 1JYWA 1ND3A 1MZFA 4GWMA 3J8F2 4XETA 2EICA 2QQVA 3GZTB 3CQOA 4QHBA 5FY9A 1WA4A 1UF2C 4EROA 5I93A 2WYFA 3B9CA 1W2UA 4D6SA 4DEQA 1EV13 2ZEWA 4FPFA 3ENRA 4QQPA 2YGLA 1PO12 2Y6GA 2UY9A 5GLZA 3T2PA 4AHXA 2EAAA 1GQPA 1OSGA 1QKQA 2VOTA 3POGA 2GP5A 4GWIA 3VDCA 1W6MA 2VOXA 1PVC2 2BNMA 2WZR1 1O8SA 3FBYA 1MQTC 4HK9A 4JC1A 5FYZA 5C71A 4BCUA 1RUC1 1JBCA 3WDTA 1S4CA 1IS6A 3LEMA 4AEDC 4HKWA 4Q0UA 1HXS2 1PK6A 1UYXA 2F4PA 3OSDA 2FQPA 4KWLA 4NHXA 3LQCA 2AEYA 3RJ2X 5JDBA 1TME3 2BZDA 4RHV2 5CKNA 4XCBA 2XWJB 5CNAA 1KQRA 2E7AA 4I0AA 3ZFGB 4MGYE 2DURA 4N43A 5J37A 1UOGA 4ZZ8A 2DFCA 1MVEA 1W8UA 3EHKA 3HEIA 3NV3A 2YV8A 4PDWA 1BCXA 4AFBA 4AGRA 3NNFA 1AL23 2HBTA 4BMBA 3BI3A 4Q0SA 2VUAA 4ZXKA 4AI9A 4DINB 1LKNA 4XJUA 2XJTA 2ZGKA 4F8AA 5A1FA 5CG8A 1MS4A 5FR3A 4Q8KA 4NIGA 1OKOA 4FPEA 5JI7A 1CONA 2CSGA 1AXZA 4CA9A 5AC92 5FYYA 4TWTA 5FYMA 2J1VA 2Q8OA 3GZEA 3NL1A 1NY71 3D4KA 4E4HA 1RUC2 1SBDA 1POV3 4MV2A 2HYXA 1W90A 3O1UA 1OUSA 4U2AA 1G8WA 3TBDA 1W6NA 3CJXA 1ZBE2 4M00A 2R16A 3ETPA 5T54A 3U75A 5EIYB 5C4WA 4CP2A 3VBHB 4A45A 4NHYA 1RUD1 3I8TA 5LA2A 2XVKA 2XMLA 4L9BA 3H3LA 3FLTA 5APAA 5FZLA 1VRH2 2JDUA 2OA2A 3VUOA 3ZN6B 4JAAA 4AVCA 4XUPA 2QJVA 4NVPA 4L0PA 1NA1C 3WP5A 1CX4A 1V70A 3I54A 4DB5A 2RJLA 5DZGA 3K75B 3D3AA 2P17A 1B35A 1WW4A 1YXWA 3EO6A 3LEIA 5FK8A 1CR7A 1QJX2 3GBWA 1YLLA 4GMP3 4DZGA 2RS31 3CMGA 5A3MA 4UW5A 1ZZBA 1FV2A 1D7PM 2JX9A 2PHDA 2RR13 1UWWA 1DFQA 1NLRA 2JIJA 3HVDA 5GLWA 2XVGA 2VUDA 2G1MA 5T52A 3VBFC 2A75A 4FPOB 3WG4A 4YW6A 2JDHA 3AZZA 2RE9A 4E2QA 2NQYA 2OYZA 4YZ1A 1NCRC 1D4M3 4LBQA 2RS51 1Q8QA 2VG9A 3PJQA 4B7KA 5HXMA 5FDBA 4GH4C 1HRV1 3FJSA 4GH4B 4HOOA 2FCTA 1Z7S1 3WQ0A 2DBIA 4KGQA 2HWE2 1NAEA 4LBNA 5F3IA 5LRSA 4UFJA 4C0HA 3AZWA 2X5IA 3POJA 2Y6LA 2Q1ZB 1W28A 3I59A 1S0EA 1G9DA 3E1F1 2VVEA 5B2GB 3MPBA 4UFMA 3AP6A 2BNNA 2MPFA 1MEC2 2VNGA 4M3CE 4PBOA 5GZDA 1LOFC 2IXKA 1W9SA 2EAKA 5FFOC 3R6SA 3WX5A 2WLQA 3P1IA 2HWD3 4S2DA 2QQUA 1AR72 5DUUA 5FYUA 5JR2A 4XCAA 4C0BA 3D6EA 4OHXA 5FZ6A 4LBOA 5L7OA 1Q43A 3N3HA 3ZFGC 5EJ3A 5C5TA 3SITA 1W6PB 4E4DX 1YWKA 3NRUA 4RFRB 1V6JA 1O4TA 1HXS3 5LBEA 5JXHA 4M3CF 1R64A 1ULOA 1YQCA 5EYYA 3JXSA 4M4PA 3I49A 1AX1A 1ZZ9A 3GDBA 3MYXA 3SKJE 2GNMA 2D97A 5F2SA 3THTA 2BU9A 2V5YA 1FNZA 3ES4A 5D1IA 1DLLA 3M8LA 5I0SA 2QQWA 4ONUA 2VY0A 4UBHA 3RPQA 5L9BA 1SCSA 5I8TA 2ARCA 3M4FA 2BOIA 3KZ4C 4CDXB 3RZKA 1JZ4A 1SHWB 2GZWA 1YQ2A 1C3HA 2EVXA 3KV6A 1Q3EA 1VIWB 5LY2A 3ZVXA 2WWUA 5K9YA 4TLFA 1VBE3 3TNQA 2E26A 1H2KA 3UGGA 4LO8A 2R0HA 2ADDA 3NNLA 5BNPC 2HWB2 2BVBA 3C8XA 1DGWA 3ZXEA 3EMRA 3AMHA 5E1RA 5C4WC 5DDJ3 3PUIA 1OKQA 2JG8B 2PTMA 4A6SA 3RZHA 2ZGSA 4OHWA 2WQZC 3ZYIB 2VAUA 1LCLA 1E57A 2E7TA 5JI9A 3AP9A 1SFPA 3KT7A 3J26N 1RUD3 3MEPA 3ZIXA 5FMOS 2ARBA 3AM2A 3MFAA 4HK8A 3AMNA 3DF0A 1UXXX 4BIOA 2A1XA 1WCQA 1NCQC 2JDAA 1OH3A 2Y6KA 4R4ZA 3MBWA 3WV6A 1XNCA 4CDQC 3ZKYA 1ZZ6A 1TME1 3OD0A 4V1PA 4IEXA 1YO8A 3VBUB 3VBSA 5IVVA 5FUIA 2ZABA 3KLSA 4FPJA 4P9IA 2PELA 3S57A 2WO2A 2WS92 4LE3A 3A0NA 1UU4A 3TWIA 4YZ2A 1RUI2 2VW1A 1I9RA 3OJBA 1YQ8A 1UZZA 4CP9A 3LCPA 3IDEA 4FPCA 3MV01 4UFHA 1AHSA 5FZIA 1JMUB 4IESA 4LT5A 1AL22 5FWJA 4AHZA 4PJYA 2IXIA 2XOMA 5ACA1 4N9HA 2A6VA 5A3NA 1KGYA 1OLMA 1ZM1A 2R061 2W1WA 2Y0IA 1EV11 3CJIB 3PUHA 3FMGA 3TEWA 4HKLA 3ZN4A 1WA6X 1YEWA 5FPZA 3ZMOA 5FY8A 3VZJA 5F2WA 5BNPB 1PMHX 4NN0A 3VZKA 3VD3A 2ZGMA 2ES3A 1LEDA 2JG9B 4BH9A 1J3QA 3ACLA 2WNVB 2WS93 2YU1A 4JGYB 3WDVA 2RVAA 2J1RA 2GNDA 5C9AA 4LBMA 2ETEA 2BGCA 2R062 3LA3A 3U4XA 3IZOA 2ARXA 1PZ8A 4CEWB 3WP3A 2WA3A 1LU1A 2XHNA 3I59B 3O1TA 2IXHA 3KM5A 4ARXA 4RFT0 2YY1A 2CAUA 4PLOA 1CIYA 2Q1MA 3OGJA 3VGIA 2XKPA 2VCMA 2E53A 1LR5A 4XQ4A 4OUEA 4KGGA 3LPGA 2BWAA 3GBGA 1VBA3 5LBCA 1H6XA 1IHMA 3JZVA 1JOBA 4QDRA 2RDSA 2XUMA 4SBVA 4XDPA 2DCTA 5E6HA 3RDIA 2JB8A 4DXZA 3OBRA 5K0UA 3PIJA 3I3QA 4XQWA 1LOBA 1EPZA 4XTPA 3EYPA 4LLOA 4M3CB 3HR9A 5LA1A 3ON7A 2DCJA 2JE9A 2QDNA 2PHXA 3E6BA 5FREA 4BQ1A 5KHKA 2QQPA 2YYOA 1QY4A 1JU3A 5FYIA 5LB6A 3GZAA 4JGZB 4ZHNA 2FDJA 1UZWA 2DVFA 4HKOA 3PLQA 4A42A 5LA0A 5IAVA 5LRRA 1CX1A 3H7YA 2JG8A 4GKXA 3Q9OA 2AENA 5FZOA 2ZGPA 1O59A 3WG2A 3ZYRA 1DCSA 3EBRA 1DQ0A 1X33A 4QHZA 1KRIA 4I02A 3IBMA 1NE6A 4O9GA 5LA9A 1AR92 1TG7A 1AF9A 3HT2A 3RYKA 3USUA 1N3PA 1VBB1 4A7YA 4AZZA 2HWD2 3APBA 1PGW1 3I2JA 3PL0A 4MUVA 1HIXA 1TMF3 3IWZA 4QU2A 1OLRA 2W2IA 2Q4SA 5FKBA 4Q0QA 5FXXA 1J3PA 4B7EA 4MXVA 1WCSA 2ZHLA 1UOFA 3BODA 4QXKA 3VD9A 1GKBA 3KHBA 3W59A 3ZSJA 5IK5A 1UMHA 5BNPA 1RIRA 3H3ZA 4KU8A 3L9JT 5FYBA 3VZOA 5FY4A 3WNKA 4ASKA 1YI7A 5L7OC 2A6XA 1I5ZA 4MZUA 2EXIA 3VL8A 1HV1A 2VW2A 4LHSA 4CXYA 2JDNA 1F9KA 4RQPA 2PA7A 2WYSA 4Q4X2 2AREA 1S0BA 4AGGA 1TZOA 4YM0A 3IKWA 1HLCA 5IUQA 3I2GA 1IPJA 1VE0A 4RR3B 4QT6A 3WP4A 1JYVA 2B46X 4UFIA 4IV3B 2GP3A 2ZACA 4INDA 5A7NA 2LRPA 4YG6A 3FL7A 2NLRA 3PVNA 5DUXA 1F4HA 2RR12 3IT8A 3IB3A 4IDZA 1IPSA 4AE2A 4COYA 5HV4A 5C9AC 5I0TA 4Q8LA 1ULGA 2W95A 1BQPA 4IE6A 1JYXA 2FDGA 4YWAA 1QNYA 4XXPA 5JMCA 2XG3A 2IXLA 2ZGTA 4N53C 4OZXA 4QX8A 4AWDA 2R7EB 3MLLA 1QHDA 3M3CA 5T3NA 3RWKX 5C3SA 1ND3B 1GZTA 2IXJA 4YFWA 1ZRCA 3LPFA 3B69A 3CIHA 2DV9A 3VZNA 1UY1A 4I01A 4JRLA 4WV8A 1DZRA 2PHWA 1HW5A 5CA6A 4UFKA 3OPWA 3FX3A 2UY8A 4WVVA 4GJYA 1VJ2A 1HN0A 1H1MA 3DEMA 5ABJC 2D6KA 4G3YC 1LGNA 1LENA 1AYM3 1W2NA 3NJYA 2QQJA 3T08A 3MIBA 3IN9A 4OMCA 4PIXA 3S7IA 4LORA 2I74A 4X6RB 3WG3A 2B8MA 4Y26A 3IMMA 1SG3A 1POV1 4HETA 2WINB 1AX2A 3V0BA 3D8CA 4MSVA 2BFUL 1RMU2 2JE7A 3FZ3A 2OS2A 2HJIA 4MLOA 5I8YA 4BK5A 1H0BA 1U5YA 2O14A 3VBFA 4CCEA 1MZEA 2I2SA 2ZHKA 3W21A 2RMU3 4GXLA 5ISLA 4AVBA 3AJZA 1E5RA 3N9QA 2WNEA 2FD8A 2DBNA 3WF3A 2JE8A 2JWPA 2VE1A 5C4WB 1OC1A 4U36A 4AHWA 1BXHA 1ENSA 4JHTA 1K5MC 3AZXA 5A7SA 4CDUB 1EPWA 4YVWB 3VDDB 5A33A 4N7UA 1WLDA 4DNYA 1GZ9A 1CWPA 5EJZB 2BGOA 3EJKA 4BPZA 4COWA 1CJDA 3IPVA 5EYXA 1PM4A 2W94A 5A3WA 1QWRA 2VCBA 4HVOA 2NMNA 3HBKA 5I0RA 2YZ4A 2YPDA 3Q8EA 4WZCA 1RUG1 3J8F3 4NIDA 3WF4A 5C8WA 1J1LA 3GF6A 3U0ZA 1DDLA 1RTVA 1XQNA 5G04L 4BOWA 4DFSA 1IKPA 3F95A 4RHV1 4JRAA 4XFHA 1RUF3 3WW2A 1NZCA 4A7KA 5LWBA 5DUVA 4LPLA 4Q27A 4YVWA 3VDDA 2JJ6A 4K20A 4FP2A 5EP9A 3SEEA 1L7QA 1ST8A 5CFCC 3TEZA 2R073 1W8OA 4IE5A 2VD7A 2XJPA 2E31A 5LEJA 3RZGA 2DTYA 5DG1A 1N1SA 1D4M2 2C24A 3POFA 2BW8A 4UYBA 1XSQA 2OIIA 3HOBA 4GULA 2WC2A 1H4GA 5JZGB 4B4PA 3KV5A 3GZUC 3SKVA 3ILRA 5FZ0A 4QPYA 2Z42A 1XB9A 2NM1A 3LFIA 4E2GA 3CKHA 1GSLA 2MEV1 1I1EA 4KI5M 2ZCWA 2Q8CA 1KITA 2V5DA 1VAVA 4I3GA 4W6WA 2ZAAA 2P6CA 5BV6A 4CEWC 5J3UA 1G9FA 2C0ZA 4N53A 4IEPA 5EFUA 5BNNC 5D21A 3GALA 2AR6A 5L9VA 4FAGA 3GM8A 3ACFA 1H1IA 1U0AA 5I0UA 3RZZA 3CL1A 2MEV2 4CP1A 4XTMA 1VBB2 3AX4A 1W6NB 2O8OA 2ZMKA 3B94A 3DGTA 5K8SA 4IEWA 1OFSA 1LNSA 1H1AA 1SACA 1UPSA 3LE0A 1ND3C 3NMBA 2YGMA 1F5FA 2ZGOA 4N53B 1U12A 5ACA3 1D0GA 3L2YA 2LUWA 3E5QA 4AVAA 1CD3G 2JDZA 2VBPA 1WMFA 4TXWA 5A3TA 3V0BB 4CUGA 5F3CA 1DYKA 1TNRA 1NE4A 4V2WA 5FZGA 1US2A 1WD3A 2FMYA 1FNYA 3T0AA 2F4LA 1UZYA 1HDKA 4QKNA 2OVUA 5F6KA 1CN1A 1XBFA 1VBC1 1FOD2 4YW1A 3IM0A 1VBB3 4IE7A 1FMD2 1V6NA 4IV3A 3NV4A 4IEUA 5KXCA 4RN5A 4MGTA 4M01A 1FXZA 3K4AA 3E5UA 5AVAA 1PK6B 1S2BA 3PNAA 2BNOA 1UAIA 4IUGA 2R041 4C91A 3BIEA 2JD9A 2QKDA 2FCVA 3ME2A 5A7PA 2WABA 3X29B 3DKQA 2XJSA 1EUTA 1N1VA 2Z79A 4WVMB 2FZ1A 1MR5A 4TZDA 1POV0 4PT6A 2VR4A 1PX3A 4MHUA 5IVFA 3CF6E 5JVVA 3VBOA 4LR4A 3H8RA 2PHLA 4NIIA 1O6UA 1MS1A 4Z92B 2VMHA 3PVOA 2HWE1 2KD7A 2ERFA 1FYUA 2PAEA 3KCCA 5IVJA 2VGDA 3UKVA 5T5OA 2RM21 4EWAA 3GJAA 2D44A 3WW1A 5JCTA 5CISA 2B9VA 4R9BA 4N43B 1VBD3 3FBMA 3SNMA 2VXJA 4DO0A 3GBFA 1NUKA 1W3VA 1PVXA 3FLRA 4AVSA 2HEVF 4QAWA 2R1DA 1D4VB 3ZKUA 3DUIA 3GNEA 2SLIA 1DGRN 3VD4A 1GU3A 1V6OA 2P5BA 3OEAA 4IV3C 2ZS6B 1BEV2 5F5QA 2XQXA 4UW4A 1LULA 3H7JA 1IG0A 5T5PA 1REFA 3ZPOA 3OG2A 5FLJA 1W6QB 3VLBB 1FPN1 4CU9A 4JV4A 1PIV1 1W8WA 3WNLA 4AR2A 3POEA 1RB8G 2ZEXA 1UPIA 3WG1A 2N7GA 2OUJA 1Y9QA 3AMMA 4IEZA 2BEOA 2JENA 3DKWA 1QDCA 3S7EA 3AYDA 1R091 2BTVC 1VB2A 2WIIB 3K46A 3LDBA 2ZGLA 5FCCA 1YC61 4PF1A 2BFUS 4AEDA 5A6XA 1O4ZA 1TME2 5K0UB 1WCKA 3T2OA 3WLUA 1AYM1 2WT0A 1W03A 4UWDA 4IXLA 1UOJA 1NQJA 1UMZA 2VZTA 3KSCA 3WF2A 4ATFA 5L36A 4XYXA 1PHMA 4LOSA 1PVC3 1OUXA 2VECA 3HNYM 2R6QA 2PAMA 1KD7A 1MS5A 3IDCB 1LHWA 2B4KA 5F5IA 4JX0A 1D0HA 3H3UA 4LKEA 4RGKA 1HJFA 4GWJA 2VMGA 2VZPA 2XHKA 1WMDA 2ZBJA 5JIUA 3LIGA 1H30A 3W5NA 2GH8A 5JPMB 1OD5A 3FE5A 1GICA 4HVRA 2AYHA 1VBC2 2IXCA 3Q8FA 3U37A 1NKGA 2W39A 1ODNA 5K7PA 1OLQA 1W39A 3DPRC 1GMMA 5F39A 2W52A 1BK0A 3O12A 1J83A 3WCRA 2BOJA 2OZJA 4FOYA 4J1WA 3BGAA 1W6OB 2HWC3 4O9EA 1ZBE3 4QQLA 5EWSA 3WNOA 3I3DA 1SLAA 3DPRA 1COV2 2JB4A 1GOGA 3KQ4B 2DVBA 5D8AB 1WWYA 4IEQA 5FZHA 5GLUA 1ULDA 3V56A 4CUBA 1JZ3A 1VRBA 4YVSC 4XHBA 2PHTA 4Q4Y3 1O3QA 2Y6HA 1D2QA 1GYKA 1KDMA 4BXSV 4COVA 5FOJB 2QCSB 3FWEA 2LALA 4JTOA 4LMFA 3THCA 5IHRA 3KGLA 3PHMA 4XDOA 5AC93 4OLLA 1MQTB 4CP9B 1DIWA 4EZHA 3JQXA 3OUJA 3K4ZA 2FHRA 1QOSA 2XJQA 2F6BA 4OUSA 3WNPA 1RYYA 4PCRA 4NIHA 4FOVA 4UF0A 1SLLA 3DV8A 4YG3A 1VB4A 4BHPA 3N9NA 4DY5A 4E8DA 3T0DA 2RG4A 1TVGA 5F5CA 1V00A 2Y26A 3SH4A 1R081 2ZJCA 3MUZ1 1AR61 4IV1B 1OVPA 4YGDA 4ZU5A 1RUG3 5FJKA 4P9YA 4F3JA 2A5ZA 1ULFA 1C5IA 2BVVA 2D3PA 2G4IA 2PQSA 2XLFA 3EQEA 3T09A 3U07A 3HIFA 2UU8A 5FZDA 2CAVA 5KWRA 4RHV3 2GNBA 3N9PA 3NJXA 4QKFA 5JOWA 1AYN2 4UT5A 3T4HB 1RMU1 4Z8BA 4A44A 2XXZA 3WEZA 2J7MA 2PLV3 3PTYA 1LRHA 4NHMA 1RUE1 3DL3A 4XMAA 3LF7A 5K4LA 5DZEA 1AR91 2H0VA 5H9PA 1RUC3 2YFUA 5K0UC 5CG9A 5IT6A 5J48A 4PIYA 5BPXA 1KJLA 3ZXGA 2HWC2 2YC0A 1BVP1 4UXAA 2O1QA 4L92A 1SDWA 2P6HA 2JDPA 3J7HA 1P8JA 2RS12 4AK3A 2AUYA 1ASJ1 3U4SA 1AR73 3VBUA 1A8MA 4BU2A 5EJ1B 3LB9A 4NIAA 2VBBA 3AP5A 4YGBA 4PI0A 3ZXFA 2HEYF 5AFBA 4N9IA 2G19A 5A7OA 3WINE 4XBNA 4C8DA 3MV11 3GYDA 2VMEA 2RV9A 3ZYHA 1NCQB 1K12A 4XFGA 3ZM8A 5FP9A 1CAUB 3O0WA 5LK5A 1OA3A 1GOHA 4FI9A 5FZKA 1A8DA 5FPLA 4DMIA 1DQ6A 1G86A 3JBG2 4FFFA 4K6BA 5FZFA 3J7NA 2EALA 1W99A 2JG8C 1JZ7A 1GR3A 1X7NA 5FBJA 1ZZ7A 3ALQA 3C7HA 4CU7A 4SLIA 2XBO1 4NRPA 1V0AA 5C70A 4CEWA 1JYTA 4CDXA 1VMFA 1UN1A 4OYUA 4QX3A 4X6QB 4XJ8A 5GZFA 5J98B 3VD5A 2W5FA 3AKPA 4IV1C 4AFDA 4BQ5A 4CU8A 4LK7A 4XIKA 3PUSA 4FVVA 1GFF2 5JOZA 4LLFA 3RMXA 1ZRIA 2QQMA 4FXGB 2XR4A 3N9MA 4AQ2A 1UYZA 4WM7C 1KFXL 2BGPA 2GC3A 3JB4C 5C3RA 4HFSA 3AVRA 2GMEA 2HYKA 4GH4A 2Z2SB 1CAXA 2H6BA 2D6LX 3UYJA 4YGEA 3P5BA 5CFCA 1ASJ2 4FO9A 3KV4A 4XQDA 3N35A 4H3WA 5FZEA 2HWB3 1ZBA1 2D6NA 3VBFB 1Q8PA 4D94A 3MPPG 5BY5A 3O1SA 1OOPC 1S0IA 1O5LA 4YFZA 2VUJA 3AL5A 1H6YA 1QJY2 5D8AC 1DBNA 3SMHA 4URAA 2W0XA 4FCAA 4ZONA 1AL21 3FLPA 1PVC1 5A32B 4Y4YA 3M3OA 3VBSB 1AVBA 3NJVA 1ZREA 5IVEA 2OZ6A 4Y20A 1PGL2 5I0DA 2WZEA 1NA1B 4JKMA 1ZZ8A 2CGNA 2UWCA 2D93A 4MVTA 2V4VA 2Y8KA 5GZCA 5CADA 3N4MA 4OHYA 2P3KA 2WWSA 4P9WA 4AVTA 1QMJA 1YUDA 5IAXA 2TBVA 1UCXA 4YM3A 1STMA 5FMOL 3HBZA 4LEJA 4CDWC 2PYTA 1ZVFA 3ZSMA 1RUG2 4R9AA 3LEKA 2DFBA 1GQGA 4AI1A 4COUA 1RMU3 3NKTA 3HJRA 4DXSA 5GZEA 5A1AA 2QQIA 2XJUA 1HB2A 2GH2A 5L9RA 5JIAA 5CYYA 3TN91 3VDAA 4JGYA 5HCBA 2HH9A 2JG9A 3BTAA 4ES9A 2P3IA 5F3GA 1SQ4A 2RS13 3RWNA 4DXRA 1D4M1 4HZFA 3RG0A 1PGL1 2YMZA 2WSVA 1XNDA 1PO13 3I97A 1QOOA 3E5XA 2IZWA 1QU0A 2JD4A 5BNOB 3T2QA 2DVDA 2GC1A 5E16A 3WQ7A 1ZRDA 2HWE3 1KS4A 4K1ZA 3VB9A 4IE4A 1JZ5A 2Q0AA 3ES1A 3BOPA 5LEKA 1C4RA 4YW5A 5HBAA 4JCKA 3WQBA 1MS9A 1NXMA 3GCWA 3U14A 2ET7A 4UW3A 4Y1UA 3UL2A 4QX0A 4XUQA 3VBHC 5F1RA 5L7OB 3O1PA 4IEYA 5FZ3A 1G7YA 3OY8A 1X82A 3OYWA 1OFNA 3AYEA 3H9AA 4XUNA 1GWMA 3BKZA 2D6MA 4D69A 1R1A1 2YU2A 2WNVC 5E88A 3AP4A 1IKQA 1RC6A 5FUPA 2Y60A 2QZ2A 5LY1A 3LKJA 1C1FA 5F9TA 1S0FA 2VNOA 4DOUA 2EXHA 1HXS1 5A80A 1VR3A 3I3BA 1N3OA 4WM7A 4P5YA 3USUB 1GWLA 4XUOA 5M0TA 4IL7A 3N7LA 1W0NA 2K2SA 3SQOA 4MOAA 3UNPA 1J59A 3HN3A 1LECA 1K3IA 3PDQA 4FPYA 4BB3A 5J7MA 3PU8A 4B29A 5FZOB 2ZGQA 2ZGNA 5FLHA 3MF9A 4AVVA 4JDNA 4BA6A 3KWVA 5CU1A 1TNFA 1WZXA 4CU6A 4AEJA 4OI2A 3LIHA 4IGPA 1U5XA 3PTRB 5CB7A 2WQ4A 1G6NA 4EN8B 3AL6A 3NAPB 4FAHA 4OHVA 4AEDB 4LKFA 2Y6FA 3OGSA 1O5UA 3ZXDA 3K3NA 4KQ7A 3PMEA 1CZTA 4LITA 3NNJA 1LOFA 3CNAA 4NHKA 1DYOA 4CRQA 1VBC3 1TMF2 2JECA 5FUNA 3AB0A 5ANQA 3TRSB 4YRDA 2A70A 2K9ZA 5C8CC 3VBRB 1AR93 3QD6A 4CYDA 3WQ1A 3GCXA 3LOIA 3SCFA 3M2MA 1LOAA 1LU2A 1SLBA 1BYHA 3RMYA 4A4AA 2QBXA 1APNA 1BEV3 1IG3A 3W58A 5DDJ1 1F15A 1ZBE1 4NROA 3S30A 4YLZA 3ZLIA 1S55A 4GB33 1KEXA 4I30A 4X8PA 1WCDJ 4OMDA 5FXVA 2OKXA 1U5ZA 5FO7B 5DXDA 1HJGA 1WGPA 2WNOA 2A71A 1YRZA 1KDKA 3AZYA 4FOWA 4LKSA 4LIUA 2OW4A 4QPGB 5GJ6A 2VM9A 5AC91 3A0KA 3M3QA 2RS53 4RSUA 3O1MA 3H8OA 1F5JA 1VBE1 2C1FA 1GNHA 1WUVA 1ZBA3 1AR62 3K48A 1LHUA 1IS4A 3AJYA 1R1A2 4A6OA 5CKQA 5JPNB 2CGPA 5KHIA 3C7EA 5G05L 1HV0A 1Y9GA 5KHGA 1UYPA 4K40A 4KWJA 4MG2A 5FY0A 1H8VA 4XZPA 4KWUA 4RR3C 5E8AA 1BKZA 3CDZB 1C8M3 1LHNA 1FMD3 4GIQA 2ID4A 4K8FA 4XMIA 1RUF2 2BBAA 1O3TA 4W4ZA 5A6QA 4JGZC 4Q1PA 5DN2A 1VPHA 2R063 4NJ4A 2VQAA 2WNUC 2JEMA 4MGKE 1SDDB 2CV6A 2VVDA 1YJLA 5FMDA 5HPOA 4TSVA 5IK7A 2HWC1 1UU5A 3VHOA 3R4DB 3ZFEA 2XBO3 1V9U1 5C6CA 1XJAA 1L3JA 2HEWF 4E8CA 3H42B 4F83A 4FQ4A 1ZNPA 2WS91 2ZKLA 4W65A 3WUCA 4FPHA 4QU1A 3O1RA 5IK4A 4QM8A 2PFWA 3TNPB 4XACA 2E32A 1FOD1 3SISA 3VL9A 2QQKA 5JSOA 1K42A 1H9PA 2WL1A 1SBEA 1IS5A 1RINA 1YFYA 3MLKA 4K7JA 4LBQB 4ZU4A 4IETA 4CCJA 3NJZA 3M70A 2JICA 1HRI3 2RJKA 1JXNA 4CDUC 5A3PA 4QQ2A 2ADEA 3B3QE 1XXNA 2A3XA 1AL0G 3C7GA 4NHLA 5FJHA 1UU6A 1QJEA 1SLCA 4OHZA 3UKNA 2YBKA 1AR63 1OVSA 1M4WA 2NPIA 5FPBA 4OI1A 2MNGA 1LGCA 4LBJA 4QX5A 4Q0VA 2YUEA 4AI3A 2VQ0A 2I45A 3PUQA 1ZRRA 4HN0A 4J1XA 1LGBA 1OA2A 2ZGUA 2OT7A 5CAZA 5FWEA 1LHOA 2V09A 2BQPA 2C6SA 3UETA 4LQRA 4JDMA 4JQTA 1PGSA 4LIVA 4FQZA 3GGLA 3HNMA 1BK1A 1UY4A 1S0JA 1GZCA 2ZX1A 5LK7B 2DU0A 3IDBB 5A3OA 1RUE3 2ZX2A 3MLJA 4B1LA 1CIWA 1UX6A 2Y38A 4EN6B 2VOKA 3OBZA 3OPTA 4Q4Y1 4NUBA 2DUOA 2QDRA 3VBHA 1VMJA 1COV1 3ZN5A 2VNVA 3PJYA 3OPZA 2W92A 3LWCA 4QX7A 3M7AA 2PN5A 4BK4A 1H2LA 1IQDC 1SLIA 2P37A 4JDOA 3QLQA 2WDBA 1GWKA 1GANA 1H2NA 2BV4A 1UQXA 4QXBA 4Y22B 5LATA 3SCGA 3HN1A 3OGVA 1Q5OA 5CFDB 1Z78A 3O1OA 3D0JA 1RVF2 2RS52 4A41A 4QDQA 5FY5A 4AOCA 4BWOA 2B45X 4ISRA 4CDWA 1GLHA 2P4EA 4Z1VA 2W08A 1NG0A 3POBA 1RVF1 3MIDA 2W87A 1F31A 2JG9C 2X5IB 4QGLA 1GP6A 1YIPA 4QPIC 4L8QA 4UFLA 3IPVB 1M06G 3BIWE 3Q8BA 1GP5A 3KT4A 4XAAA 4XFCA 1ZA4A 3THPA 5LZ6A 5KXBA 3P6BA 1MEC1 2ORZA 3ETQA 3ZIWA 4DPNA 4EN9B 4QGMA 1SEFA 1X9PA 1UL9A 1VALA 2CGOA 4LHLA 4NPRA 4KMQA 4GA9A 3PU3A 1MVQA 2WFPA 2D6PA 3HQRA 3P3PA 4CSWA 2C9KA 1OPMA 1ACCA 1NLQA 1UY3A 1X9TA 1PM7A 3KF3A 4NRQA 3ROUA 1VLNA 3J7LA 2ZX0A 2YXSA 4MGSA 1UD1A 4O7XA 5FZ4A 2WBKA 1IOAA 1UIKA 3AKRA 4MO3M 4Q5OA 5FO8B 5JOYA 2PMWB 1CZSA 2DUQA 3TYJA 2ZHNA 4KL1A 5FP4A 1ZZCA 3HNBM 3ZYBA 3AZVA 3OOXA 4XFAA 3VZLA 1F4AA 5JXGA 1QXJA 3RQ0A 3DYMA 2ZX4A 3J7MA 4QB6A 3CHXA 4BQ2A 2KXLA 1G9CA 4HPKA 3ST7A 2CHHA 4BXFA 1H8TB 1KS5A 2W68A 3D0SA 4HMZA 2CNAA 4EQVA 3O1VA 1JHNA 1QEXA 3T1LA 2GMPA 3C7OA 2D5FA 4JQRA 3I2DA 4Q2FA 5CVRA 2UURA 3WDWA 1MS0A 1W8TA 1OPOA 4BZ4A 2VZVA 3R4SA 4P00B 3KB5A 1XYNA 4PLNA 5A6ZA 2LM3A 5EPAA 4LKDA 2E51A 1K45A 3VKMA 4QPWA 4OVEA 4B1MA 5BNQA 1QJU3 3DN7A 4N7IA 3ZR6A 4AW7A 1DG6A 5BNNB 3OTFA 4WM7B 1UX7A 4XPVA 1AYN1 2A7AA 5FZ8A 4HG6B 2ZEYA 1O4YA 2XLGA 2CDOA 4Y5SA 5LBBA 1ZRFA 4LO5B 3OUIA 1QJX3 2D3RA 4RD7A 2IC1A 3ZFFB 3LDKA 1ZBA2 1RUJ3 1W0OA 2IFWA 3B93A 4P14A 4M0NA 4XC9A 3OGGA 1XYPA 3BU7A 1BEV1 1V6MA 1W9FA 3ATGA 3WW3A 3V64A 2PAKA 2VW0A 4DUWA 1O3RA 1DLCA 3ZFGA 1L7LA 1VRH3 3B7MA 2XWBB 3T3YA 2RHPA 1GP4A 4QXHA 1HN1A 3I3EA 3KMHA 3LEGA 4RR3A 5HCHA 4GJZA 1AUYA 1QIQA 1O91A 4Q4X3 4JKLA 5DZFA 1COV3 3BTZA 1WKYA 4H2AA 4RQPB 2DDUA 2C26A 2TNFA 3SH3A 1FOD3 1GZWB 1LEMA 3O0XA 2WNUA 5BNOA 1H2MA 3S0MA 4YZ3A 1US3A 3MIHA 3I2FA 1MPXA 4MGQA 2X29A 4QPGC 1A34A 4CXWA 3NW4A 1UZVA 1UO9A 2YFZA 2C5DA 2XQRA 3AP7A 3KGZA 3TEXA 1LB2A 3VBUC 3C7FA 3VHRA 2P2KA 4AAXA 2RMU1 4QPIB 4KWKA 4OZOA 3VHNA 4AQSA 4I2OA 4C90A 2LTNA 3JD72 1K5MA 1X50A 1PO21 2ZTNA 3URFA 2P3JA 1ZA7A 1OF3A 1W3XA 4JKKA 1LOGA 5FAXA 4D7TA 3WVJA 2VJXA 5J36A 1HRI2 5JWPA 4R8HA 3THDA 4XDQA 3VV1A 1ULPA 1UXZA 1S2KA 4Q4V2 2ZXQA 1OBNA 1TMF1 2WZR3 4BM8A 1ND2B 4LXLA 3OBAA 2J1SA 4XF3A 2PQQA 4ET7A 1NYWA 1NA1A 3VKNA 1E5HA 1XPWA 1AX0A 2UWBA 2HWF1 5HCAA 5J1XA 4Y5Z0 4META 3LDRA 4LHNA 4GB32 5CKMA 4AAPA 2RDNA 5A32A 1RHI3 3CZUA 3I2IA 3MFCA 4MXWA 4IGOA 3BYWA 5A3LA 1YFXA 4RS5A 4YPJA 4EJRA 4JTNA 4GB31 2VULA 3JD71 2FDIA 4NO4A 1NT0A 1T6BX 4CEYA 5C33A 4DQAA 3OCPA 4COZA 5ABJA 3NKGA 4BQ3A 1JH5A 1ND2A 5LASA 4AEMA 2R071 2A3WA 1OHFA 2L9LA 2RR11 2WLPA 5D2AA 4ZS3A 4YZ5A 2X8KA 4KBBA 3OF1A 4XF4A 3B9IA 1OQDA 2RM23 4AXOA 2W47A 1ND2C 2EA7A 4ZY9A 5BXXA 4WZFA 4LA2A 1XE7A 3IAPA 5A6YA 3AVSA 1IZ3A 2V4AA 3MHZA 4JZRA 3SXWA 2DYCA 4PDWC 1YNAA 1W04A 4EV0A 1X8EA 2W9XA 2B7YA 3ZX7A 1DF0A 2YC4A 2B9UA 2R30A 3N7KA 4L97A 1J84A 1WMEA 3HD8B 3BPZA 4OI4A 4DS0A 2VXRA 2TUNA 4Y24A 4CDWB 4R9CA 3T30A 3JUUA 3LZZA 2WO7A 3N9OA 2P1BA 4I09A 2EXKA 4ISQA 3DYOA 1JUIA 4FPLA 4RL7A 2WO3A 1AR81 3INAA 1T6GC 2C4XA 4LJHA 4CVUA 4E9KA 2BJSA 5JXIA 4A3XA 1NCRB 1AXKA 4GKYA 3S5QA 2W3JA 3A4UA 3C2UA 5DAXA 4CCKA 2BPA2 4NWVA 5FYVA 4L99A 5FZAA 5EZWA 4ZS2A 1YQ5A 2OUHA 2ZHMA 4V2VA 2D6OX 2ZA9A 4H55A 4W50A 3ZXAC 3GHMA 3RI8A 1BLZA 1RXFA 2D5HA 2QZ3A 3MGUA 2W1QA 2QVSB 2IWGB 5T55A 1FV3A 2G9ZA 4MADA 4HONA 4FTEA 3ZYFA 2RS32 4WM8B 1Z7S3 1JYCA 4QM9A 4ARYA 4CCLA 3E6CC 3BN6A 3OEBA 3ZSKA 1S0DA 3MDPA 4XILA 2K46A 5DPNA 4CEYC 5F37A 2Q8DA 3FC0A 3R05A 4HBNA 3SHRA 2OPKA 4Y3OA 1AYM2 4Q4V1 3NNMA 1CQ9A 4Q4Y2 4AQ6A 4E4ZA 3MW4A 3A7QA 1RUH1 2CY6A 3NVCA 2WFF1 4B4RA 3A21A 3WNXA 2MHFA 2MEV3 4RGGA 3VN4A 3POWA 5FK7A 2XUEA 1VBE2 5DDJ2 2JDYA 4D6RA 1F8VA 1IGOA 3ACHA 4Q29A 2WKKA 5GKAC 3RGBA 1QOTA 5F6LB 1VRH1 1YCIA 1JW6A 2DWRA 3AKSA 1GNZA 5ERLA 3J4UH 4N43C 4Q4W2 1WLCA 2CTVA 3UV9A 1QQP1 1AR82 1PIV3 2ORXA 5KXDA 3I2OA 2DCYA 2GMMA 4CCDA 4XF1A 5FZMA 4EZ4A 3H50A 1GQHA 3NV1A 1YI9A 3RNSA 5KC6A 4QWNA 1Y3TA 1H8TC 1RUJ2 2CWMA 3T4VA 3AYCA 2WNUB 5JZGC 2FDFA 4GMP1 1BBT3 2EF6A 1EAH1 3I2HA 3ZXLA 1I5PA 1Y7BA 5J96B 4Y22A 4G4FA 2WA4A 4XOGA 4CE8A 1CAWB 1SCRA 2YPJA 3W9AA 3ZYGA 4UI9L 1EAH2 3TAYA 5IYYA 2EIEA 3LGRA 5FTTC 1W6PA 2RM22 2YG0A 3QH7A 1RUJ1 1MS3A 5ABJB 1W6OA 3U10A 4LOTA 2JKBA 2DU1A 2VOWA 3BVCA 5FXZA 4FTBA 1MACA 3ACIA 5BNOC 1JODA 3K4DA 4EN0A 2X53S 1WLTA 4XVHA 3ZSEA 2VZSA 2IVIB 3DYPA 4LK6A 3V0AB 3MI8A 1CGPA 1SPPA 3H0OA 3MZHA 4XUTA 4KG0A 2Y33A 2X10A 1FATA 3AYAA 3RZMA 3E97A 2O8QA 2NMOA 2UYAA 5BNNA 3HT1A 3NO8A 4FPGA 1LOEA 3ZMNA 1R093 5A33B 4ZKTB 4CDUA 3UJQA 1H9WA 1JZ8A 3KHCA 3ACGA 1Q8OA 2E9QA 1UZ0A 1DQ1A 2XKOA 4S2FA 1IQAA 1WD4A 4D8MA 2A3YA 2WJSA 1A3KA 2WRAA 1B09A 2D43A 2XJRA 1Z0HA 3H8XA 3RRDA 3HQXA 2OPWA 1WW6A 2VMFA 2ZMNA 4DUXA 4A3ZA 2BBVA 1FI2A 2J1TA 3MW2A 2JDMA 5CZKA 4L2NA 2DVAA 2ZZJA 4XEZA 2ZGRA 1DHKB 2HWB1 2ZPXA 1WMXA 3VBSC 5C3OA 3NQHA 3ZR5A 2WZ8A 5AFEA 2XLAA 1W2OA 5IJRA 3B5LB 3ZPYA 4ATEA 5FY1A 3ZFEB 4KU7A 3NV2A 5J09A 3E6DA 3AKQA 5KHHA 2VTXJ 4IGQA 5GALA 1GZWA 2YHJA 2OQ6A 1LHVA 3WHUA 4OI0A 1DGLA 3RYPA 2CYFA 4EN7B 4PQ9A 4WVZA 3UGHA 3J9SA 4BQ4A 1XNAA 1S1AA 1QH6A 1JYIA 5LBFA 3SCHA 1H4HA 2VL4A 5L73A 2XL7A 5DAWA 4LBKA 1NZIA 4XJZA 1RUH3 5FIXA 1OOPA 4UBGA 1OT5A 2XH6A 3WNMA 4HN1A 2LW8A 5A7WA 1C28A 2VMCA 4LULA 2GNTA 4XURA 2WR9A 4XBLA 1ENXA 1VBD2 1REEA 2VMIA 2VZQA 4YNIA 1E5IA 1UY2A 1CAVB 4JGYC 1DZQA 3ASIA 5FZ7A 1F2NA 4QPGA 4LHKA 4R52A 2A6WA 1QQP3 4ZZ5A 3BPSA 1V6LA 4Q4W3 1AR71 4I0BA 5H9QA 1QJU1 5IATA 1HB1A 4FXKB 3OYWB 2RS11 3TOJA 1HQNA 3H1YA 3R4UA 3CJIA 3O7OA 4BIFA 3OD4A 4P5HA 5FPAA 5FP3A 5FY7A 4YVSB 4QDSA 1OOPB 1QJU2 3UT0A 4FT8A 2VQTA 3DXUA 4P02B 4DIQA 3BTYA 2VCAA 4YW2A 2R1BA 2CDPA 4A7ZA 3JCIA 3WW4A 2ZKNA 4UW6A 2GALA 1SMVA 3VBRA 5I91A 1TQ5A 1W6MB 2RS33 3M1HA 3ZFEC 5A3UA 3ZFFA 1Y43B 4LBQD 1CAVA 2WQ8A 4ZU7A 2FDKA 1CZVA 1QF3A 4XJAA 1W05A 3HMYA 1R082 3BOWA 1I6XA 1C57A 1W06A 4Z2AA 2GN7A 2QNKA 3WDYA 5ACA2 1RUNA 2W46A 2KA3A 2ARAA 2AEZA 3GJBA 3LSDA 4CZSA 4MYEA 2R072 4W6XA 5EHDA 2PLV2 5L19A 1MZ5A 3G6JB 1DQ5A 5FPVA 3RZLA 1PO22 4DRVA 5F32A 1DP0A 1R1ZA 2BWCA 2ZMLA 1NOVA 1DGWX 4PF5A 4AEKA 2BYVE 1OURA 4BISA 1RUE2 2SBAA 2X5IC 4H7MA 1VBA1 5FZ9A 4AG4A 3BB6A 2GN3A 5DAPA 2VU9A 2VZRA 5BYNA 2JDKA 3TN92 2I07B 1N1TA 5JOXA 3N9LA 4JGZA 3FN9A 2NZ9A 4LUMA 4PLMA 2E6VA 2WFF3 3KD4A 4CDQA 3T2TA 2NYYA 2DTWA 1QNWA 4QKDA 5JZGA 3CJIC 3HWJA 5CFDA 4FTSA 3D5OA 3PVBB 4YARA 3WNNA 1SFNA 2VTFA 3DCQA 3ILFA 4LA3A 3WR0A 4Q4X1 4RYDA 3FHQA 2YDEA 2BERA 3ELNA 3K2OA 1IPKA 4Q4V3 4WVWA 1UKRA 2CU5A 5C7GA 1JI6A 3IIAA 5GLVA 4P9JA 1NLSA 2XJVA 5FOBB 5KR7A 1XU2A 1CPNA 2RMU2 3JBG3 2C9AA 1XYOA 2VQUA 4D6QA 2ATFA 4K1YA 3VD7A 1RJ7A 4AQTA 1GNYA 1XE0A 2FDHA 3JD73 2BRTA 4IE0A 4ZXEA 3AMPA 5KHJA 4CDQB 3K77A 3POYA 2XBO2 3BCWA 2DCZA 1LESA 4XE9A 1OQ1A 1VAKA 1XNTA 2HBUA 1DQ2A 3ZYJB 1BVVA 1XSRA 4QQHA 2ET1A 2E7QA 3FHIB 1Z7S2 3RVHA 3V0AA 2R49A 3BTXA 1HQWA 3IDAA 1RHI2 4N8MA 2QFEA 4CP0A 2GAUA 4B8EA 2VZ1A 5HXVA 4A2UA 3AK0A 1ALYA 1X36A 2HWF2 3JQWA 2BUKA 1JUHA 1PK6C 1RL3A 3TB0A 4AFAA 4XJWA 2HKXA 2V72A 4BQXA 1OLME 2VH9A 1ZX5A 5FP7A 4D7YA 4NWWA 2GC2A 4BQWA 1BBT2 4QD2A 4DUVA 1C8M1 5I8SA 1YQ6A 4ASMB 1NCQA 1K5JA 4HSLA 3SLIA 4JHZA 3SH5A 1RUI3 2ILMA 5B4NA 1JTZX 1FX5A 1NX9A 3LOBA 1AZDA 1C8NA 4MH0E 2QQLA 4Y20B 3RSJA 1B35B 4BDVB 1OH4A 3FHAA 4OFGA 1AR83 4OQ9A 1QXPA 5FYSA 4YZ4A 5IWFA 4YM1A 3MUY1 2YBSA 3R0RA 1RJ8A 1Y4WA 4DXTA 1YHFA 3ZN6A 3VKLA 4LO4B 4ZPIA 4P08A 3WHTA 4EWDA 5A7QA 5IVBA 3WZ1A 4EWEA 4IQPA 1WCUA 4NAOA 4GMP0 4O61A 3AXEA 1F35A 3PVEA 4QB1A 5SV5A 3RS6A 4YSFA 3J8F1 1NCRA 1QJY1 1BBT1 4D0QA 4NRMA 3SEPA 1C8M2 3C3VA 2ZEZA 2RDRA 5KXEA 2IUWA 4MX3A 1PNGA 5HCFA 1HRI1 1RUF1 1XOYA 1XRUA 4N90A 3N7MA 4I3PA 2UWAA 4NR1A 4K3UA 1PMIA 1VAMA 4UOJA 3WSOA 1I3HA 1QJZA 2V73A 1YJKA 4GD4A 4XIOA 4PI2A 1WW5A 3ZSLA 1Q8SA 4TLGA 1SPPB 4Y33A 4PQQA 2WO1A 2A6YA 4Q0PA 4AI0A 3EB7A 1JZ6A 4AFCA 5JUVA 5C9AB 4LO6B 3BU0A 4FFHA 3HQUA 4Z82A 2XDVA 2Z4FA 3IIIA 3FFZA 5GZGA 1RXGA 3AFKA 3H1WA 1GBGA 3M3EA 3UJOA 4CPBA 1V6KA 3FUOA 4RS5C 1O3SA 3MIGA 1JS9A 5FPXA 2DVGA 2YB7A 1CJPA 2H6CA 2A6ZA 4QXCA 1WLWA 4IEVA 5C5UA 5FPUA 5KC5A 1XNKA 3S5AA 1FPN2 5CFCB 2CL2A 2DCKA 5IVYA 1VMHA 3I2KA 5DQ0A 3RYRA 4DEVA 5B4XA 4CCNA 4XHXA 4XAEA 1JOPA 3QBQA 1RITA 5IK8A 1BHGA 1R092 1AJKA 5FXWA 1CVNA 1PO11 2VZUA 2Z69A 4K9SA 3JBG1 4YW4A 5CIRA 3L2HA 3FFQA 1V6IA 5JLVA 5GLTA 3U11A 3MF6A 1ZYBA 1U5IA 3QOPA 4HVQA 4GWNA 1EV12 3ECQA 1EP0A 2VTXA 2XB6C 4JVAA 4GAZA 2QQOA 3H8UA 1HKDA 3GXUA 2B42B 5A1LA 1ONAA 3PURA 4XBQA 1UYYA 4KNCA 1PZ9A 1RVF3 1AXYA 1C5HA 4FPKA 1J1TA 4Q4W1 3W20A 2QE3A 2Q30A 2Z5WA 4S2HA 1J3RA 4YW7A 1YFUA 2O0OA 3QCWA 4J25A 1HQLA 1CPMA 3KVAA 3ZDVA 1R1A3 2G9GA 3NSTA 4L11A 2Y34A 1W8HA 2X05A 4AGVA 5FV3A 3I7DA 4YW3A 3VZMA 3WT3A 3KT1A 2Y64A 3WOGA 1W9WA 2WFF2 4FFIA 2DUPA 4FOQA 2AACA 4HL0A 4YM2A 3LD8A 3RZJA 1FT9A 4LUKA 4IV1A 1JN2P 4BLJA
chains in the Genus database with same CATH topology
4HT1T 4Y1ZA 2R043 1DGRA 3D82A 5JSRA 4M3CA 1NQDA 2EXJA 2VPVA 1UW8A 1KFUL 3V65A 3BALA 3WP6A 5TSWA 4OUMA 1X8MA 1XE8A 5C8CA 4HSJA 3AFGA 1FMD1 4XFIA 4XJ9A 2EIGA 1OMIA 1Q8VA 1CAXB 4YVSA 5T5JA 1LJ7A 5H9SA 1YIFA 3O5SA 1UKGA 3KCYA 5D8AA 1DYPA 5SV8A 1V9U2 1DQ4A 3WD5A 5FBZA 3CEWA 4CTEA 1JOJA 2P34A 3JB8A 2XVLA 1WBFA 1NY72 2WNVA 5FO9B 5DUWA 5FRAA 3USSA 3CO2A 1KJRA 2QUOA 4I0WB 1HRV2 3ZFFC 3OY8B 3AKTA 4D7SA 3QH6A 1QDOA 1RUI1 2G9FA 1DZTA 3M3IA 5AVPA 3VKFC 4E27A 4Q1RA 1V9U3 4IEOA 3GHNA 4H7LA 3WDXA 1S0CA 3N7JA 3OBTA 2R32A 4IERA 3MIFA 4AYUA 4RQPC 4YG0A 4WBBA 2E63A 1OI6A 3O14A 3WXPA 4ITCA 5C8CB 4R4XA 2JXAA 1RGSA 4FSJA 4ASLA 5CBLA 3LA2A 4C1XA 4WM8A 2ZX3A 1BMV2 1QQP2 4RS5B 2AZ5A 3VHPA 4LBLA 1BZWA 1HRV3 1EY2A 3RJRA 1RUD2 1B35C 5FQ0B 1RUH2 2XPJA 1OA4A 4XXAA 1SFYA 2PHFA 3ZYPA 3NAPC 4XFBA 4KH9A 2VVFA 1XU1A 3LA7A 4B3NA 1BJQA 3PMSA 3HAGA 1VBD1 1QH7A 1BMV1 4DY3A 2YROA 2ENRA 2KM2A 4YVWC 4YYOA 4HANA 3VDDC 1LOCA 2K0GA 1QGLA 2ZOEB 3P3NA 4LTAA 4R9DA 1YFWA 5JAXA 4M0HA 4QQOA 5BUVA 1SLTA 3UKTA 1ENRA 2AH2A 2D40A 4Z07A 3WDUA 2IFRA 4AF9A 4K21A 4GQ7A 1S0GA 4BLIA 1ENQA 3B02A 1LTEA 3UK9A 4H14A 4AI8A 4P9XA 1REDA 2R0FA 1AJOA 3ILNA 5JR7B 3VBOB 1RHI1 1MQTA 1W6QA 5CFDC 4HLTA 1HX6A 3KQRA 2XL9A 4WVMA 1ULEA 4OULA 2WZR2 1CAWA 1N3QA 2GSYA 4QGNA 4AFMA 2VNRA 1CAUA 1MS8A 2ZAHA 5DG2A 3AXDA 4Y1VA 1FPN3 3T1MA 4GALA 1PO23 4FP3A 2NP0A 3POSA 3H1MA 4F7ZA 2FBEA 4MGIE 4MXWB 2TEPA 1UIJA 5JSPA 3G7DA 4DRRA 3K51A 1N47A 4X8NA 5E89A 4J6GA 3QACA 2Q5TA 4E4SA 1OQEA 1A78A 1TE1B 2PHUA 3B00A 3ZDSA 3N36A 4QMAA 4C1WA 4RGAA 1SBFA 4Q26A 5GM0A 1PGW2 3LSEA 4AHYA 2FZ2A 2AGSA 2B5HA 1MZ6A 1AYN3 2DF7A 4BE3A 4CDXC 4ORFA 2WT2A 4RA0A 3VBRC 1J58A 2FMDA 2D7FA 1C1LA 1G9BA 5FQ0A 3S6PA 3KCXA 1PIV2 4G9SB 4QPIA 4TYSA 1H8TA 2WT1A 4Y1YA 1TEIA 1GV9A 3VBOC 3MICA 4XFFA 1G9AA 4PIZA 4URTA 2D3SA 3JU9A 4YGCA 3MW3A 4P9LA 4NOTA 1QJX1 3WUDA 1QXRA 1W0PA 4FBFA 1RUOA 3AMQA 1WW7A 1VBA2 2GDFA 2HWF3 2HWD1 3ZXKA 1LODA 1XNBA 3DPRB 3I4IA 4D3WA 4LO7A 1WBLA 2PLV1 1URXA 1N1YA 1PNFA 2B39A 4PBPA 3WCSA 3KS7A 1VP6A 5HI0A 2NN8A 4ES8A 3FUQA 4P9GA 3EXUA 5FLIA 5T50A 1O7FA 2Y0OA 1MEC3 4BMEA 3B01A 4WM8C 3MIEA 1ASJ3 4PDWB 4LE4A 4LNVA 1D2SA 3O0VA 3IMNA 2GU9A 2D98A 5EV7A 1NXD1 2ZZQA 2PHRA 3NWKA 4S2GA 2VOVA 2XGXA 4XF0A 4CEYB 3CU7A 4MGZE 1PZ7A 2GC0A 1YYNA 2WZPP 1Q56A 4B4QA 3WY6A 4W6YA 4AI2A 5H9RA 4E2SA 4HPKB 5EXOA 4Z2WA 3VKOA 4Y1XA 4BYYA 2R042 1A6CA 1CESA 2H0BA 3ZXJA 2WSUA 1KXGA 2A73B 3RI9A 5KBFA 2CWSA 3TN93 3CLPA 3NAPA 5T5LA 3ZO0B 4XW3A 1QJY3 1ULCA 1IS3A 4XF9A 1EYBA 2UYBA 1DU3D 4KG8A 1FAYA 1K5MB 1EAH3 1R083 3LAGA 1ND3A 1MZFA 4GWMA 3J8F2 4XETA 3GZTB 4QHBA 1WA4A 1UF2C 4EROA 5I93A 3B9CA 1W2UA 1EV13 4FPFA 3ENRA 4QQPA 2YGLA 1PO12 5GLZA 2UY9A 4AHXA 2EAAA 1OSGA 1QKQA 1W6MA 2VOXA 1PVC2 2WZR1 2BNMA 3FBYA 4HK9A 1MQTC 4JC1A 4BCUA 1RUC1 1JBCA 3WDTA 1IS6A 4AEDC 4HKWA 4Q0UA 1HXS2 1PK6A 2F4PA 3RJ2X 2FQPA 4KWLA 5JDBA 1TME3 4RHV2 2XWJB 5CNAA 1KQRA 2E7AA 4I0AA 3ZFGB 4MGYE 2DURA 4N43A 5J37A 2DFCA 1MVEA 3EHKA 3NV3A 4AFBA 2YV8A 4PDWA 1BCXA 4AGRA 1AL23 4BMBA 4Q0SA 2VUAA 4ZXKA 4DINB 4F8AA 1LKNA 4XJUA 2XJTA 2ZGKA 5CG8A 1MS4A 4Q8KA 4FPEA 5JI7A 1CONA 5AC92 1AXZA 4TWTA 2Q8OA 3NL1A 1NY71 3D4KA 1RUC2 1SBDA 1POV3 4MV2A 4U2AA 1G8WA 3TBDA 1W6NA 3CJXA 1ZBE2 4M00A 2R16A 5T54A 5C4WA 4CP2A 3VBHB 1RUD1 3I8TA 2XVKA 4L9BA 3FLTA 1VRH2 3VUOA 2OA2A 3ZN6B 4JAAA 4AVCA 2QJVA 4NVPA 1NA1C 3WP5A 1CX4A 1V70A 3I54A 4DB5A 2RJLA 5DZGA 2P17A 1B35A 1WW4A 1YXWA 3EO6A 1CR7A 1QJX2 3GBWA 1YLLA 4GMP3 4DZGA 2RS31 5A3MA 4UW5A 1ZZBA 1FV2A 2JX9A 2PHDA 5GLWA 2RR13 1DFQA 1NLRA 2XVGA 5T52A 3VBFC 2A75A 4FPOB 3WG4A 3AZZA 2RE9A 4E2QA 2NQYA 2OYZA 4YZ1A 1NCRC 1D4M3 4LBQA 2RS51 1Q8QA 2VG9A 3PJQA 4B7KA 5FDBA 4GH4C 1HRV1 3FJSA 4GH4B 1Z7S1 3WQ0A 4KGQA 2HWE2 4LBNA 5LRSA 4C0HA 3AZWA 2X5IA 2Q1ZB 3I59A 1S0EA 1G9DA 5B2GB 2VVEA 3MPBA 3AP6A 2BNNA 2MPFA 1MEC2 2VNGA 4M3CE 4PBOA 5GZDA 1LOFC 2IXKA 2EAKA 5FFOC 3R6SA 3WX5A 2WLQA 2HWD3 4S2DA 5DUUA 1AR72 4C0BA 3D6EA 4OHXA 4LBOA 5L7OA 1Q43A 3N3HA 3ZFGC 5EJ3A 3SITA 1W6PB 4E4DX 1YWKA 1V6JA 1O4TA 1HXS3 4M3CF 5EYYA 1AX1A 1ZZ9A 3MYXA 2GNMA 2D97A 3THTA 2V5YA 1FNZA 3ES4A 5D1IA 1DLLA 3M8LA 5I0SA 4ONUA 2VY0A 4UBHA 3RPQA 1SCSA 5I8TA 3M4FA 3KZ4C 4CDXB 2GZWA 1C3HA 2EVXA 1Q3EA 1VIWB 3ZVXA 5K9YA 4TLFA 1VBE3 3TNQA 1H2KA 4LO8A 2R0HA 5BNPC 2HWB2 2BVBA 3ZXEA 1DGWA 3AMHA 5E1RA 5C4WC 5DDJ3 1OKQA 2JG8B 2PTMA 2ZGSA 4OHWA 2WQZC 3ZYIB 1LCLA 1E57A 2E7TA 5JI9A 3AP9A 3KT7A 3J26N 1RUD3 3MEPA 3ZIXA 5FMOS 2ARBA 3AM2A 3MFAA 4HK8A 3AMNA 3DF0A 4BIOA 1NCQC 4R4ZA 3WV6A 1XNCA 4CDQC 1ZZ6A 1TME1 3OD0A 4V1PA 4IEXA 1YO8A 3VBUB 3VBSA 2ZABA 3KLSA 4FPJA 4P9IA 2PELA 2WS92 4LE3A 3A0NA 1UU4A 3TWIA 4YZ2A 1RUI2 2VW1A 1I9RA 3OJBA 1UZZA 3LCPA 3IDEA 4FPCA 1AHSA 4IESA 4LT5A 1AL22 4AHZA 4PJYA 2IXIA 5ACA1 4N9HA 2A6VA 1ZM1A 2R061 2Y0IA 3CJIB 1EV11 3FMGA 4HKLA 3ZN4A 5FPZA 3ZMOA 3VZJA 5BNPB 4NN0A 3VZKA 2ZGMA 2ES3A 1LEDA 2JG9B 4BH9A 1J3QA 3ACLA 2WNVB 2WS93 3WDVA 4JGYB 5C9AA 2GNDA 4LBMA 2ETEA 2BGCA 2R062 3LA3A 3U4XA 2ARXA 1PZ8A 4CEWB 3WP3A 2WA3A 1LU1A 3I59B 2IXHA 3KM5A 4RFT0 2YY1A 2CAUA 4PLOA 2Q1MA 3VGIA 3OGJA 2XKPA 2E53A 1LR5A 4XQ4A 4KGGA 2BWAA 3GBGA 1VBA3 1IHMA 3JZVA 2XUMA 4SBVA 2DCTA 3RDIA 4DXZA 3OBRA 5K0UA 4XQWA 1LOBA 1EPZA 4XTPA 4LLOA 4M3CB 3HR9A 2DCJA 2JE9A 2QDNA 2PHXA 3E6BA 5FREA 4BQ1A 5KHKA 2QQPA 2YYOA 1QY4A 3GZAA 4JGZB 2DVFA 4HKOA 3PLQA 5LRRA 3H7YA 2JG8A 4GKXA 3Q9OA 2AENA 3WG2A 2ZGPA 3ZYRA 3EBRA 1DQ0A 1X33A 1KRIA 4I02A 3IBMA 1NE6A 4O9GA 3ZSLA 1AR92 3HT2A 1AF9A 3USUA 3RYKA 5CA6A 1N3PA 1VBB1 4A7YA 2HWD2 3APBA 1PGW1 4MUVA 1HIXA 1TMF3 3IWZA 4QU2A 1OLRA 2Q4SA 4Q0QA 1J3PA 4B7EA 4MXVA 1WCSA 2ZHLA 3BODA 4QXKA 1GKBA 3W59A 3ZSJA 5IK5A 5BNPA 1RIRA 3H3ZA 4KU8A 3L9JT 3VZOA 1YI7A 5L7OC 2A6XA 1I5ZA 4MZUA 2EXIA 3VL8A 1HV1A 2VW2A 1F9KA 4RQPA 2PA7A 4Q4X2 2AREA 1S0BA 4AGGA 4YM0A 3IKWA 1HLCA 5IUQA 1IPJA 4RR3B 4QT6A 3WP4A 2B46X 4IV3B 2ZACA 4INDA 4YG6A 3PVNA 2NLRA 5DUXA 2RR12 3IT8A 4AE2A 4COYA 5C9AC 5I0TA 4Q8LA 1ULGA 1BQPA 1QNYA 4XXPA 5JMCA 2XG3A 2IXLA 2ZGTA 4N53C 4OZXA 4AWDA 3MLLA 1QHDA 3M3CA 5T3NA 1ND3B 2IXJA 4YFWA 1ZRCA 3B69A 2DV9A 3VZNA 4I01A 4JRLA 4WV8A 1DZRA 2PHWA 1HW5A 3FX3A 2UY8A 4WVVA 1VJ2A 1H1MA 5ABJC 2D6KA 4G3YC 1LGNA 1LENA 1AYM3 3MIBA 3IN9A 3S7IA 4PIXA 2I74A 4X6RB 3WG3A 2B8MA 4Y26A 1POV1 4HETA 2WINB 1AX2A 3V0BA 3D8CA 4MSVA 2BFUL 1RMU2 2JE7A 3FZ3A 2HJIA 4MLOA 5I8YA 1H0BA 1U5YA 3VBFA 1MZEA 2I2SA 2ZHKA 2RMU3 4GXLA 4AVBA 3AJZA 2WNEA 5C4WB 4U36A 4AHWA 1BXHA 1ENSA 1K5MC 3AZXA 4CDUB 1EPWA 4YVWB 3VDDB 5A33A 4N7UA 1WLDA 4DNYA 1GZ9A 3EJKA 4BPZA 4COWA 1CJDA 3IPVA 5EYXA 1QWRA 4HVOA 2NMNA 5I0RA 2YZ4A 4WZCA 1RUG1 3J8F3 5C8WA 1J1LA 3GF6A 3U0ZA 1RTVA 1XQNA 4BOWA 4DFSA 1IKPA 4RHV1 4JRAA 4XFHA 1RUF3 3WW2A 1NZCA 4A7KA 5DUVA 4Q27A 4YVWA 3VDDA 2JJ6A 4K20A 4FP2A 5CFCC 2R073 2XJPA 5LEJA 2DTYA 5DG1A 1N1SA 1D4M2 2BW8A 2OIIA 4GULA 2WC2A 1H4GA 5JZGB 4B4PA 3GZUC 3ILRA 4QPYA 2Z42A 2NM1A 4E2GA 1GSLA 2MEV1 1I1EA 2ZCWA 1KITA 1VAVA 4I3GA 4W6WA 2ZAAA 5BV6A 4CEWC 5J3UA 1G9FA 2C0ZA 4N53A 4IEPA 5EFUA 5BNNC 3GALA 2AR6A 4FAGA 1H1IA 1U0AA 5I0UA 3RZZA 3CL1A 2MEV2 4CP1A 4XTMA 3AX4A 1VBB2 1W6NB 2O8OA 3DGTA 2ZMKA 3B94A 5K8SA 4IEWA 1OFSA 1SACA 1H1AA 1UPSA 1ND3C 2YGMA 1F5FA 2ZGOA 4N53B 1U12A 5ACA3 1D0GA 3L2YA 2LUWA 3E5QA 4AVAA 1CD3G 2JDZA 1WMFA 3V0BB 1DYKA 1TNRA 1NE4A 1WD3A 2FMYA 1FNYA 1UZYA 1HDKA 2OVUA 5F6KA 1CN1A 1VBC1 1FOD2 4YW1A 3IM0A 1VBB3 1FMD2 1V6NA 4IV3A 3NV4A 4IEUA 5KXCA 4M01A 1FXZA 5AVAA 3E5UA 1PK6B 1S2BA 3PNAA 2BNOA 1UAIA 4C91A 2R041 2QKDA 3ME2A 3X29B 2XJSA 1N1VA 2Z79A 4WVMB 1MR5A 2FZ1A 4TZDA 1POV0 3CF6E 5JVVA 3VBOA 4LR4A 2PHLA 1MS1A 4Z92B 2VMHA 3PVOA 2HWE1 2ERFA 1FYUA 2PAEA 3KCCA 2VGDA 3UKVA 5T5OA 2RM21 4EWAA 2D44A 3WW1A 5JCTA 4R9BA 4N43B 1VBD3 3FBMA 3SNMA 3GBFA 1PVXA 3FLRA 4AVSA 2HEVF 2R1DA 1D4VB 3DUIA 3GNEA 2SLIA 1DGRN 1V6OA 4IV3C 2ZS6B 1BEV2 5F5QA 4UW4A 1LULA 3H7JA 5T5PA