3POWA

Crystal structure of the globular domain of human calreticulin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
251
Chain Sequence
GREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the human calreticulin globular domain reveals a Peptide-binding area and suggests a multi-molecular mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords calreticulin
total genus 76
structure length 251
sequence length 258
ec nomenclature
pdb deposition date 2010-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3powA01
1W6NB 1G9DA 3GALA 1V6JA 1APNA 1BYHA 1LEMA 1MS4A 1JYCA 2AUYA 2SBAA 3AYAA 5JDBA 1GZCA 2P3KA 5SV8A 3WDUA 4U2AA 4ITCA 4YZ1A 2A6YA 2V5YA 5KXDA 3NV4A 1O4ZA 1JYIA 1NXD1 2GNTA 1CPNA 1GZWA 1QOTA 2C9AA 1CJPA 1IS5A 4Y22A 5T50A 1J1TA 1KJLA 1Q8OA 5KXBA 2D6NA 3M3QA 4K20A 4YZ3A 2EXIA 3M3CA 1URXA 2VW2A 1ULCA 4YGEA 1V00A 1DFQA 5DG2A 5GLUA 3ZVXA 4Q2FA 1FNYA 1WUVA 1MZ6A 3BOPA 3PMEA 1VIWB 1LHVA 2TEPA 1MVEA 2VW1A 2ZGMA 2ZHLA 1U0AA 4ATEA 4UW5A 4HL0A 5IK5A 4FOWA 1AXKA 4P14A 1D2SA 4XIOA 2WKKA 5GALA 3O0VA 4DPNA 1KRIA 1QDOA 2DU1A 1CPMA 2PHTA 3B00A 1HLCA 3RSJA 4BM8A 2AYHA 3AZYA 3M2MA 5T54A 4YZ5A 4AGRA 2CWMA 1AVBA 1YI7A 2VY0A 5DXDA 1IS3A 4Y20A 4TZDA 5DUXA 1VLNA 2LTNA 2NYYA 4BPZA 3WUCA 3ZXJA 3OJBA 5HCBA 2CY6A 1IKPA 3A0NA 1MS9A 4GWMA 4U36A 3SLIA 1VALA 3N7LA 4FPEA 1WW7A 2UU8A 2AREA 1C1LA 2GN3A 1GNZA 2R0FA 4PBPA 3ZXFA 3SISA 2D6OX 5GLZA 4K1YA 3I8TA 5EYXA 5IUQA 4Q8LA 1MR5A 3DUIA 4AGGA 2WLQA 3BTAA 1QGLA 1Z78A 2A7AA 1CQ9A 1YRZA 1WW6A 4M01A 2A75A 2PHRA 4I30A 3OYWB 3WV6A 2YZ4A 2W68A 5DUVA 3WG4A 3VKFC 1LGCA 4LBQD 4FQ4A 5T5OA 1C57A 3USUA 4XYXA 2AH2A 1SBDA 3SNMA 3WCRA 1Y7BA 3WDVA 3RMYA 4YW2A 3MW2A 1Z0HA 1LJ7A 3FBYA 3OY8A 1S0CA 1AZDA 2JD4A 3QLQA 4AGVA 4Q8KA 1GKBA 2GDFA 2ZHKA 4YG0A 1IKQA 5EWSA 5T5JA 2LALA 1G9FA 1N3OA 2GMMA 2D3SA 2JKBA 2EXHA 4FPYA 3HMYA 2B7YA 1V6OA 1G9AA 4XHXA 1FNZA 1W6MA 2D6LX 3R4UA 1O4YA 2EXKA 3AP6A 3M1HA 2KM2A 1BXHA 2R49A 4FP3A 1WW5A 4M3CF 1SLBA 4YGCA 5CA6A 1WBFA 2GNDA 1G7YA 4BLIA 3RQ0A 1UZYA 1AJKA 3ENRA 3AJYA 2W52A 1CESA 1S0EA 3AXEA 1QDCA 5T5LA 2ZKNA 1C1FA 3AZVA 4DFSA 3ZSLA 1LOFC 3N3HA 3USUB 2DVBA 1N47A 4BQ1A 2P2KA 4XILA 1S0JA 2VUAA 3D6EA 4DQAA 1UPSA 1DLLA 3VKLA 3RRDA 4BOWA 4K1ZA 3V0AB 2NP0A 2WSUA 1LU1A 1Q8SA 1CONA 2A6XA 2GNBA 4FOQA 5H9RA 2R0HA 3O5SA 4LBQA 4XJ8A 4MYEA 3ZPYA 1D0HA 1G9BA 1GICA 2BQPA 3KQRA 2DVFA 2DUPA 3CNAA 4GALA 3MEPA 4LBNA 4Y1XA 2D3PA 4FPLA 3VUOA 2ZA9A 1LCLA 2ZGPA 1Q8VA 1V6IA 2ZBJA 3GNEA 3SH4A 1N1TA 2E7TA 5IK4A 1QF3A 3V64A 4ISQA 1YO8A 2DYCA 4AVVA 1AX2A 1MACA 1S0IA 4P9XA 4XTMA 2R1BA 4LBLA 3AYCA 5T5PA 2ZGSA 1GANA 3WLUA 4DS0A 5JLVA 2WT0A 1S0FA 2NZ9A 3D5OA 5GLTA 1MS8A 3HN1A 1JHNA 1FATA 2A3XA 2ZABA 4K21A 5DG1A 1RINA 5E88A 3AFKA 1YXWA 2A6VA 2DVDA 1WCSA 1MS1A 5F9TA 2E51A 3C2UA 1KDMA 2ZGOA 3WVJA 3V0BB 1DQ1A 1ENQA 3RG0A 1LHUA 2JE7A 3NV2A 4FPJA 1CVNA 4LBMA 1H9WA 2EF6A 3NV3A 4Q1PA 1LOEA 2A71A 4XXPA 3TB0A 5LK5A 1A78A 2P3IA 4R9DA 1LGBA 4YZ2A 2EIGA 3AZWA 3OGGA 4R9CA 5JOWA 1UL9A 1WW4A 2EAKA 5DUWA 4D69A 1VAVA 1DYPA 5FRAA 3WDXA 4AWDA 4CZSA 4YW4A 2W08A 3VKMA 3ATGA 1NLSA 4R9BA 5JOYA 2CL2A 4WVVA 1FV2A 1TEIA 2NM1A 2ZGLA 4Y1ZA 3N7MA 4YW5A 2JE9A 3UJQA 2Q5TA 1I3HA 4TYSA 2FMDA 3PJQA 5GLVA 3HR9A 4FPOB 5GZFA 5JOXA 1SLTA 1IOAA 1SLIA 1H9PA 1DBNA 2E7QA 4ISRA 2E6VA 2Z42A 3ASIA 4YM2A 1QOOA 4XXAA 5GLWA 3UK9A 2DU0A 3WNXA 1LOAA 1CR7A 2NMNA 5CBLA 1LHNA 1W6QA 1S0BA 4Z8BA 2ZMKA 3V0BA 5DZEA 4RL7A 3B01A 4DRVA 1H30A 1AF9A 4GA9A 5DZFA 3ZSJA 4FPCA 1QOSA 1LGNA 4YG6A 4XBQA 2ZGQA 4LBOA 2PHFA 4PBOA 2OW4A 2NMOA 1N3PA 2YMZA 5E89A 2UWAA 1S0GA 4ATFA 2CTVA 1SLLA 5EXOA 4Y24A 1FX5A 2ENRA 4GKXA 2DWRA 1KITA 1WLCA 3WG1A 4GXLA 1JBCA 2ZGTA 3I4IA 2DUQA 4M3CB 3IPVB 2D43A 3AZXA 3INAA 1UZZA 1IS4A 4XMIA 5KXEA 3B9CA 4IQPA 4RA0A 3WHTA 5T52A 4XE9A 4ZXKA 1W6OB 1ULDA 2P3JA 4Q26A 3KM5A 1LHOA 2AR6A 4Y1VA 3V65A 4WZFA 2R16A 2YV8A 4C1XA 2A5ZA 2VH9A 1MS3A 1CIWA 1IS6A 3M3OA 4AVSA 1LESA 3O0WA 2ARBA 4UW3A 1LEDA 2OUJA 1DQ4A 1KJRA 4XJUA 3OPZA 1G9CA 4YZ4A 5DZGA 1GNHA 1EPWA 4BMEA 4C1WA 3NV1A 4P9YA 1ULEA 1SACA 4BLJA 4Y1UA 1DQ0A 1HKDA 4YW1A 1WBLA 1WLDA 2YROA 4WVWA 4SLIA 1N1YA 3WUDA 1N3QA 1WD4A 2A3WA 2JJ6A 3IMNA 4YM3A 1S1AA 3MW3A 3ZSMA 1ENRA 1V6MA 3PVEA 5L73A 4ASMB 3UL2A 1MS0A 2FHRA 1SCSA 2GALA 2XB6C 2ZHNA 2ZMNA 4UW6A 2A6ZA 3O0XA 3BIWE 1GV9A 4FP2A 2I2SA 5GZEA 1OFSA 2SLIA 4FVVA 4AYUA 5GM0A 2DTYA 5GZGA 2A6WA 1AXZA 2C5DA 3N7JA 1LOFA 1GZ9A 1OQ1A 2YY1A 1ZA4A 5JMCA 3WCSA 2WJSA 1RIRA 4YLZA 1AX1A 2W39A 1DYKA 2P37A 2UURA 4YM1A 1OKQA 2GN7A 5CB7A 1YIFA 1BQPA 1KQRA 1Q8PA 1ULGA 3SH5A 4AVTA 2AGSA 2WT1A 1JXNA 1QNWA 4XJ9A 1LTEA 1LOCA 1AJOA 4XHBA 2UWCA 5HCFA 4M3CA 3IM0A 1UAIA 1V6LA 1WLWA 2G4IA 3LSDA 2NN8A 4XOGA 3T1MA 3T2TA 4FOVA 4ZKTB 5HCAA 1UKGA 1W6QB 1FYUA 4H55A 2UWBA 4PCRA 3AXDA 1W6NA 3OBTA 1A8DA 1F9KA 1QU0A 1C4RA 1GSLA 3OY8B 4YGBA 5H9QA 3RS6A 3W58A 1N1VA 3POWA 4YFWA 1W6PB 2H0BA 3NWKA 2WT2A 5FREA 1FV3A 1DQ2A 3APBA 1LOGA 5BYNA 4Q27A 1W0OA 3PVNA 3FUOA 1LECA 4Y1YA 3BODA 5H9PA 2P34A 3QCWA 1DHKB 3O12A 3WDYA 1F31A 3ZYPA 3IPVA 2WNEA 3N36A 1F5FA 2JDZA 2GNMA 4XZPA 5GZDA 4FPGA 3T1LA 1V6NA 1PZ8A 3AYEA 4JCKA 2ZGRA 5IT6A 3PVOA 1Q56A 3MPPG 2ZZJA 3VKNA 3SITA 1SLCA 1ENSA 2CYFA 4FOYA 4GWNA 2ES3A 4JRAA 3ZSKA 1DZQA 4XMAA 1DQ6A 3AX4A 2DV9A 2WQZC 2ZGKA 3WDWA 1VAMA 4FPHA 4L8QA 1MVQA 4M3CE 5IK7A 3M3EA 2YXSA 1N1SA 4GKYA 1JUIA 2PHWA 2RHPA 5T55A 4HANA 1RITA 1W6MB 3LSEA 3AK0A 4W65A 2OVUA 4LBKA 4OZXA 4FQZA 3FFZA 4BMBA 3WG2A 3L2YA 5F5QA 5DUUA 3FLTA 1SBEA 4XDQA 4KBBA 2D3RA 5GZCA 3AJZA 2ZAAA 1LHWA 2PELA 3H0OA 3LCPA 4WV8A 5JVVA 2R1DA 3FLRA 2JECA 3A4UA 1HQLA 1ONAA 2WSVA 3ILRA 2PHXA 1ULFA 2HYKA 3N7KA 1WD3A 4LBJA 1LULA 5CAZA 3U4XA 1QMJA 3V0AA 2VU9A 1SFYA 3VKOA 2OUHA 2GMEA 2PHUA 4YFZA 1BJQA 1HQWA 1YYNA 1SCRA 2D6KA 2ZACA 2ZGNA 4NOTA 3N35A 1QKQA 3RMXA 4XJWA 4Y26A 4JC1A 3AP9A 2EALA 4DRRA 1GBGA 3A0KA 3B3QE 3AP5A 3IN9A 3FLPA 1AXYA 3TAYA 4XIKA 1AX0A 1BZWA 1UMZA 5EYYA 3Q9OA 3AP7A 2D6MA 1JOJA 1LODA 1GZWB 1MS5A 1UN1A 1ZM1A 4XTPA 3WDTA 3WZ1A 4LBQB 4XBNA 1PZ7A 5JOZA 1GLHA 1V6KA 1G8WA 4YG3A 3ILNA 3FUQA 2A3YA 1A3KA 2ZHMA 5H9SA 3VV1A 4M00A 4P9WA 2CWSA 3ILFA 4XJAA 2AENA 1HDKA 4UW4A 1W0PA 4XJZA 3SH3A 4NO4A 3DGTA 1W6PA 5CNAA 4YGDA 4F83A 1KDKA 3JU9A 1DGLA 4XBLA 1R1ZA 5E8AA 2EXJA 4PF5A 3JUUA 3ZXKA 2ARXA 1W6OA 1LU2A 3POSA 2DVGA 2ERFA 3D4KA 3ZXLA 2D7FA 3WHUA 2DURA 3OBRA 2V73A 3B69A 1SLAA 3ZXEA 3WG3A 1LOBA 3UJOA 4CTEA 1JW6A 4Y20B 1DQ5A 2DVAA 2ZGUA 3AZZA 4Q1RA 4Y22B 1MZ5A 1GYKA 4R9AA 4YM0A 4YW3A 1LENA 3W59A 3ZYRA 4FPKA 2GMPA 5GJ6A 1DIWA 3MW4A 2E53A 4FPFA 1SBFA 1I1EA 1G86A 4PQ9A 1QNYA 3POYA 5KXCA 2A70A 2ZMLA 2D6PA 4CRQA 2VW0A 1S0DA 1FAYA 1JN2P 2CNAA 2XG3A 2D44A 3AYDA 3R4SA 3R05A 1B09A 2DUOA 1BKZA 1Q8QA 1X50A 5AVAA 3WOGA 5IK8A 1PZ9A 3IKWA 1CN1A 2DTWA 3OYWA 3AP4A 1XQNA 2VXRA 1UX6A
chains in the Genus database with same CATH superfamily
1W6NB 4OI1A 5E6HA 4PF1A 4RFRB 1Q3EA 2W1UA 1LEMA 4KG0A 4LHKA 3KS7A 2F17A 5DAVA 3SXWA 2RR12 4CVUA 3JCIA 2QQPA 1CX1A 2A6YA 2V5YA 2Z5WA 4COZA 1KD7A 3H3UA 1OD3A 3J7MA 4B4QA 4NRQA 3HPNA 3I2GA 5JMOA 1O4TA 2XVLA 5LY1A 1QJEA 2C0ZA 1H8TA 3H50A 1Q8OA 4HMZA 5FY5A 4K20A 1CX4A 4GJZA 4JDOA 1WMFA 3NMBA 1POV3 2WZR1 1NCRA 2VL4A 2FDFA 2OQ7A 3H1WA 4MXWB 1AYN2 1W8TA 1ASJ1 4QX2A 5C8CA 5FPLA 2YFUA 5FOBB 1REFA 4Q2FA 1FNYA 1WUVA 2Q1ZB 1VIWB 2ZHLA 1U0AA 5FXVA 5JPNB 1VBA2 3H42B 5FY9A 5FPXA 1D2SA 3AMQA 3O0VA 4XPVA 5JWPA 3B00A 4NWWA 1NXMA 4GB32 4C0HA 1XSRA 1OQDA 3AZYA 5FZCA 5T54A 3QH7A 1H8VA 1BVP1 4GZ9A 3NRUA 4EZ4A 2OPKA 2CGOA 1FMD1 3LEIA 5ABJB 4LE4A 4BPZA 5A6YA 1K5MC 5HCBA 2RS12 3NQHA 4OMDA 4BA6A 1MS9A 3CZUA 3Q8AA 1PO21 1VALA 4JX0A 1X36A 3UGFA 4BU2A 2WYFA 1NY72 2AREA 2GN3A 3WQBA 4P9LA 4UF0B 1JZ3A 3CZJA 3VBHB 4NPLA 1UD1A 2IC1A 2E33A 3A23A 1L7LA 1V9U2 2BVBA 4Q8LA 2WLQA 2CAVA 1Z78A 4A6OA 5IFTA 1WW6A 2WQ8A 1SZBA 4IETA 3BCWA 4I30A 4O9GA 5LASA 1EP0A 2N7GA 3K75B 1CWPA 3ACLA 1UU5A 4H2AA 1OA2A 4XDOA 3NNLA 4W6XA 3HVDA 4J1XA 4FQ4A 1NKGA 2IXKA 2R072 4WM7C 3ZDVA 4BH9A 5C4WC 1SBDA 3S5QA 5DMYA 4OI0A 4EN8B 1TG7A 3GZAA 3MW2A 3QOPA 1NCRC 3JXSA 1E5HA 3OY8A 3U4SA 1QJFA 1XJAA 1AHSA 2XR4A 3SHRA 3VZMA 5C6CA 3ACHA 3VBRA 1GKBA 2GDFA 2ZHKA 1AR62 1DGWA 1NUKA 3R4DB 1BMV1 1WA6X 4QB1A 1C5IA 1QJU1 2JKBA 2WL1A 3BTXA 3VBUA 2ZX3A 1B35A 1W28A 4QPWA 1W6MA 2D6LX 3AMNA 5FPVA 2BNNA 3M1HA 4NPMA 4Z2WA 4LJHA 1WW5A 3LFMA 4M3CF 2HKXA 3TN92 4JDMA 4BLIA 2FD8A 1OPOA 1AJKA 3P5BA 3K46A 1CESA 3LA7A 1QXPA 4BJ0A 3I54A 3AZVA 3D82A 4I01A 4AK3A 1K45A 5F39A 2BU9A 4GULA 4BQ1A 1UXZA 1S0JA 4MG2A 4DQAA 5LEJA 4Q29A 3LEMA 2R043 3V0AB 3U10A 5ANQA 2R041 2VXJA 5H9RA 2ARCA 5KR7A 1GR3A 2JG9B 1GOHA 4LQRA 4LULA 2OA2A 2WAOA 3OG2A 2Y6LA 4DO0A 2D3PA 3RZZA 3VUOA 1LCLA 2ZGPA 1UF2C 1Q8VA 3O1MA 1COV1 2BGOA 2BVVA 2RDNA 4M0HA 2E7TA 2FDKA 2XJTA 2WFF3 5DDJ3 3V64A 2MEV1 3I2FA 3IDAA 3MIBA 1ND3B 3TOJA 1MACA 2VQTA 3RI8A 3J8F2 3DKQA 2R1BA 4AW7A 5IVBA 2A1XA 4LBLA 1O7FA 1GANA 5JLVA 4CEWA 3D5OA 2VZRA 3PUIA 4OYUA 1K12A 5A6ZA 1J83A 5C8CB 5FY8A 4LE3A 4C8DA 3POIA 4QHBA 3C2UA 1KDMA 1AR72 1HIXA 1RUE2 1VMHA 1XU1A 3J7NA 2Q8EA 3RYRA 1OURA 3LDRA 1X33A 5LBCA 1VPHA 2VZUA 2ZCWA 2WO2A 1AL23 1QJU2 3GZEA 5FPZA 3BTZA 3RFRA 1S2KA 1H9WA 5F7UA 4UFKA 4CDXB 2RV9A 3TB0A 5LK5A 2ZX1A 2WWJA 5BV6A 2XQXA 4AEJA 1UYXA 4Q0UA 3A21A 2VZPA 1QJY1 4XEZA 3OEAA 1UIKA 2XBO2 4RSUA 4NIIA 5JOWA 1W2NA 1RUJ1 1WW4A 4EWAA 3B5LB 4UWDA 1W2UA 4P9GA 3LWCA 1J3PA 1YIPA 4A42A 4HKWA 5C3OA 2FZ2A 2OZJA 4CZSA 4GMP0 3VKMA 1H8TC 3ATGA 5JOYA 2CL2A 3LAGA 1H4GA 4Y1ZA 3N7MA 5GKAC 1PIV1 2JE9A 1FPN3 2Q5TA 1WWYA 5LATA 4BQXA 3PJQA 3NNMA 5GZFA 5F3IA 2D5HA 1FPN1 3S7IA 5C71A 1IOAA 3I2KA 3LZZA 4AFAA 1RUF1 2GH2A 2QCSB 2WABA 3UK9A 2YUEA 3MLLA 3UT0A 3ZIXA 1LR5A 3C7FA 1S0BA 2JG8C 2VCCA 4ES8A 4Z8BA 4RL7A 2EICA 3B01A 3OGVA 1QQP3 4DRVA 3ZR5A 4XFFA 3HNMA 3RZHA 4YG6A 4XBQA 1X9PA 4LBOA 2HWC2 1N3PA 1SFPA 1S0GA 3VBUC 2DBIA 2CTVA 1SLLA 3GYDA 4D6QA 4BE3A 2ENRA 1QXJA 4ZS2A 3ZLIA 4GXLA 1JBCA 3H9AA 4LHLA 1XBFA 1RJ7A 4PDWA 4YWAA 5FOJB 2QQJA 4MV2A 4AAPA 4HN0A 3G6JB 4J25A 2Y6JA 4IQPA 1OUXA 5FMOS 1X8MA 2WAAA 3SEEA 4CXXA 2HEWF 4HLTA 4RA0A 2RS33 2P3JA 4YVWA 2WZR2 3I3BA 4Y1VA 4LXLA 3WW2A 4O61A 3ZXAC 2R073 2TNFA 4LA3A 2WA3A 3V65A 3FZ3A 1PM4A 5BNPB 2OX0A 4CDQA 1TZOA 2RJKA 1NZCA 4FT8A 5A3PA 3FWEA 3MLJA 2D97A 3KD4A 3O0WA 4UW3A 4L11A 4HFSA 3I59A 4X8PA 3KT4A 2HLEA 1HV0A 1DCSA 1KJRA 4AQ2A 1ZBE2 1I5PA 3IIIA 1ULOA 2GAUA 4QXBA 4YZ4A 4XF0A 4Z2AA 1IG3A 5D2AA 2HEVF 4P9YA 4P9IA 3K3NA 5A33A 3ZOIA 5BPXA 1NE4A 4HSJA 2RS13 2FDHA 1N1YA 4OQ9A 1WD4A 2RS11 4YM3A 1S1AA 4RR3B 1OXCA 2HWE1 2ZPXA 3EHKA 3B9IA 3PVEA 1UZVA 2BTVC 4HOOA 5L73A 2W1SA 4ASMB 5BNNB 2XXZA 4CYDA 4Q4V3 2JIGA 4FP2A 1XNBA 5FZOB 3N9QA 4UT5A 5GZEA 2VCAA 3U14A 1H1MA 3LA2A 5A1FA 1SFNA 4QX3A 2FQPA 3POEA 5C3RA 5GZGA 3N9PA 3N7JA 1UOFA 5IW0A 1GZ9A 2YY1A 2RDQA 3WCSA 4XACA 3GDBA 2WJSA 1REEA 2RE9A 2W39A 2ZXQA 2ZZQA 4XFCA 2TUNA 1VBB2 1VRH1 2CGPA 3BYWA 2GN7A 2PFWA 1YIFA 1VRH3 4HZFA 3PHMA 2QZ3A 2WT1A 1QNWA 4XHBA 1AJOA 4ARYA 2UWCA 5HCFA 4M3CA 4Q4W2 4XQDA 4HT1T 4AL9A 1S2BA 3T2TA 1WLWA 5FZ8A 5IATA 3OUHA 4XOGA 5HCAA 1REDA 4ZKTB 1AR63 1FYUA 4H55A 3ZYIB 3OY8B 1W6NA 4UF0A 1GNYA 1F9KA 4LIUA 2J1RA 2WC2A 3FL7A 3NAPA 3W58A 5C7GA 5AC92 1HRV1 4YFWA 4LPLA 4KL1A 4QPIA 1DQ2A 1U5ZA 5FYIA 4AEKA 3VBFB 1HJGA 5LY2A 2RS52 4KQ7A 1DHKB 4QXCA 1O3SA 3ZX7A 4CEWC 2QFEA 4LO8A 1XNKA 3KVBA 4N53B 3T4VA 1VBC2 2BBVA 3N36A 1F5FA 5FP7A 5BUVA 4I02A 4YPJA 3VBOB 4FPGA 5FZ3A 5I0RA 2X5IC 2ZGRA 1RVF3 2XQRA 1Q56A 5IT6A 4ZY9A 2UYBA 2ZX2A 4MGIE 2CYFA 2FDJA 4FOYA 1W90A 2IFRA 3GHNA 2KR2A 4XC9A 2ZEWA 2HWE2 1MQTC 2WNVB 3DEMA 3AX4A 4AI1A 4IEZA 2B9UA 3WNOA 1VAMA 4COWA 4NHLA 1YFUA 3ZMNA 5FMDA 2RHPA 1S2EA 4PLMA 2FCUA 3J9SA 1D4M2 4HANA 3J4UH 1O3QA 1W6MB 3AK0A 1W8ZA 1NLRA 3WX5A 3POFA 4KGQA 4QAWA 4LLOA 2ZOEB 2W94A 3POJA 3GZTB 1NE6A 3KWVA 5DPNA 1SBEA 3RWKX 1RUD2 1YQ8A 4UFMA 4YNIA 2GSYA 4KMQA 2W92A 4NRPA 2PELA 1QY4A 3LCPA 2XLGA 4WV8A 1VBB3 4AXOA 2XVKA 2W5FA 2WINB 3C7HA 2OT7A 4UBGA 5CAZA 3SC7X 1YQ5A 1OKOA 5L7OC 1O59A 1OSGA 1SFYA 2GMEA 1R1A3 1AR71 5JIUA 5FO7B 4YFZA 1R1A1 3G7DA 2VMGA 2XPJA 1QXRA 2D6KA 3NJZA 1POV0 1C3HA 3FFQA 3N35A 5IAVA 4LLFA 5ERLA 4Y26A 4LITA 4JC1A 4IDZA 5CFCA 3WQ0A 4NHKA 4QX0A 3Q8BA 1BK1A 3WNLA 1GBGA 3OBZA 4QKNA 5DQ0A 1W39A 3ZR6A 3RJ2X 4IEYA 4CXWA 3C7GA 2OS2A 1R092 5B4XA 4E4DX 4EROA 3JB4C 3HN3A 1AX0A 5D8AA 1BEV2 4CDQB 3FHAA 5BXXA 1CIYA 1JOJA 1MS5A 5IJRA 3IWZA 3ME2A 2B4KA 3W20A 1GLHA 3CL1A 4QKBA 2WYSA 5IVEA 3FUQA 4IXLA 5H9SA 2FDIA 1ENXA 5BNOC 4J1WA 3ILFA 1HQNA 1B35B 1J58A 3IZOA 4QX5A 3VZJA 1HDKA 5BNQA 1GUIA 4K40A 1UCXA 3IAPA 5ABJC 2HBUA 4DUWA 1OOPB 3AKRA 5F6KA 1FMD3 5E8AA 2EXJA 3BALA 4LIVA 4OMCA 4E4HA 4AI8A 4RR3A 3ACGA 2XWBB 5KWRA 4WM7A 3DXTA 2DVGA 2ERFA 2HWC1 1UX7A 3D4KA 1C28A 4B4RA 3ELNA 2W47A 4QPGA 4I09A 1LOBA 3OGRA 4DIQA 4CTEA 5DN2A 1DQ5A 4HVRA 2ZEZA 3VBRC 2DVAA 3ROUA 1JZ5A 4MO3M 2R32A 1GYKA 4R9AA 4YM0A 4OI4A 5GJ6A 5C70A 5AFEA 4PDWB 1OD5A 4EYUA 1HW5A 4RHV1 5FZEA 2WNUB 3AL6A 4NAMA 4GAZA 5LEKA 5HCHA 3POYA 4IV1B 1K5MA 5LBFA 2ZMLA 2JXAA 2D6PA 3BB6A 5FYYA 3AYDA 1FAYA 1JN2P 1J3RA 2XG3A 3KZ4C 3R4SA 3WD5A 4GWIA 2RDSA 3R6SA 4COYA 3JD71 3NNFA 4QPYA 3ZYHA 4RFT0 1PZ9A 4OHYA 1NG0A 1OQEA 3ZN6A 1CN1A 2XJQA 3U0ZA 2HWB3 2DTWA 3OYWA 3P3PA 1RC6A 3WXPA 2JDAA 2HWB1 3LIHA 5HV4A 3W5MA 2PLV2 3HQRA 4PDWC 2I07B 3LE0A 1YLLA 4I0BA 1BEV1 1BYHA 3HQUA 3AMHA 1BEV3 1JYCA 2XUMA 4QPGB 1JYVA 3N4MA 5SV8A 3K4DA 4CSWA 4ITCA 3MF9A 4LOTA 1EAH2 4LA2A 2JIJA 1CPNA 1CJPA 4IERA 1J1TA 1BBT3 5KXBA 4OI2A 1QH7A 2JB8A 4URAA 1TVGA 2WA4A 4QQLA 3BU7A 3M3CA 3KVAA 3IMMA 4LORA 4PLNA 2VUDA 5BNPA 2AEZA 3NJVA 4Q4V2 1V00A 1HN1A 2WS93 4QHZA 2BBAA 4CEYA 2VQ0A 4N43B 1MZ6A 3M70A 4G4FA 4JKKA 1VBD1 2E32A 3KV4A 5IAXA 5EP9A 3U11A 1YHFA 5IK5A 4LO5B 1TE1B 3MYXA 4AOCA 4RQPC 4M0NA 1GWKA 4QKFA 2JG9C 3IB3A 2PHTA 3RSJA 5JSOA 5CIRA 2AYHA 3LB9A 3M2MA 3E5UA 1XXNA 5FK7A 1U5XA 3LF7A 1POQA 5DXDA 4TZDA 5DUXA 2VNOA 3FX3A 5FLIA 4A3XA 3S0MA 5LA9A 4FFGA 3WUCA 2R062 4XZUG 4FFHA 3SCHA 4RHV2 3ZMOA 3OJBA 2Y38A 4N8MA 3A0NA 3SLIA 4FPEA 3AC0A 1AL0G 1WLTA 2RMU2 4W8JA 2HH9A 2R0FA 3S30A 5AC93 1AUYA 3ZXFA 2VQAA 2BJSA 4I0AA 5AC91 1HRV2 1YUDA 2VOVA 4XURA 3TWIA 4OUSA 1CAVB 4MXWA 3VBOC 3Q8FA 2D6OX 3WQ7A 3JBG2 5J1XA 1ULPA 2YBPA 4LK6A 4N43A 2DFBA 5C3SA 3DL3A 4AGGA 2PHDA 4B8EA 3BTAA 3ZXDA 1QGLA 3LIGA 3NL1A 5FP8A 2WZPP 1EV12 5C4WA 2VZ1A 2A75A 1HB2A 1XE0A 1YEWA 3WSOA 3D3AA 5A3MA 4L92A 2PAEA 3VBHA 3WG4A 4NUBA 2X05A 3VKFC 3VDAA 1LGCA 4PLOA 5FBJA 4W6YA 5K7PA 3CO2A 3USUA 4K3UA 3POGA 4NR1A 3T30A 3J26N 3SNMA 1O5UA 4OFGA 3WDVA 3RMYA 4YW2A 4AQTA 1US2A 4D94A 5F3CA 1Z0HA 4NIHA 1ZNPA 2WO1A 1S0CA 4SBVA 5FQ0B 4FAGA 1AZDA 5LW9A 2V09A 2UYAA 4AGVA 4Q4X1 2TBVA 3HT2A 3OD4A 5DAWA 5JR7B 4CXYA 4WZCA 2KA3A 3F2ZA 1KFUL 3N9OA 4NE9A 2RM23 1HRI1 5A7OA 5T5JA 5J7MA 1N3OA 4QM9A 3ITQA 1KGYA 4O65A 3KMHA 2D40A 2W95A 3HMYA 2D98A 1JTZX 4N90A 5A3OA 5K0UB 1V6OA 5FY4A 4CCLA 2G9GA 5FYVA 4ARXA 3KGZA 1R64A 1O4YA 5FMBA 1O6UA 1Q43A 3C7OA 1XPWA 2KM2A 2XUEA 1SLBA 1ZVFA 4ZZ8A 1SMVA 1G7YA 2GNDA 1UZYA 1ZZBA 4G9SB 3AJYA 5EIYB 2W52A 3U07A 1Y3TA 4K8FA 1S0EA 2VMEA 4QD2A 2ZJCA 1C1FA 2BOIA 4Z92B 3LD8A 1HXS2 3CQOA 1LOFC 2Z4FA 3N3HA 4LUMA 3SKJE 1PNFA 2V4VA 2G19A 2EA7A 2VUAA 1DLLA 3VKLA 3FE5A 5ABJA 1XE7A 2XJSA 4IEQA 2VTFA 1LU1A 3MIHA 2JKXA 2QQUA 1D0HA 1J3QA 2R7EB 3AKPA 4D0QA 1EUTA 3CNAA 4Y1XA 2V5DA 4FPLA 2WNOA 2ZA9A 1YQ2A 4AAXA 4IE0A 5A3UA 1V6IA 4CCCA 4LO7A 1H2LA 3GCWA 5IK4A 1QF3A 1RUI3 4O7XA 3I2HA 1AX2A 3WW4A 4MXVA 2OKXA 4D3WA 2Q8DA 3ZXGA 1H2MA 1ZBA1 2VBBA 4IUGA 5T5PA 2ZGSA 1ZRDA 1IQAA 2J22A 4KG8A 2WT0A 4J6GA 4LKEA 3CLPA 2MHFA 5D8AC 2C9KA 4XCBA 1FATA 5DG1A 5E88A 4GH4A 5FYCA 1PGW2 3KCXA 4QPIB 4QM8A 5M0TA 1MEC1 5FP4A 2Y33A 4GWJA 4DEQA 1WMDA 4Z07A 4N7IA 5CFCC 2BYVE 2IXJA 1PVC3 3WW3A 5L36A 1ENQA 1PHMA 3B93A 1PIV3 4S2FA 2RVAA 1JZ6A 5L9VA 1ZRCA 4LEJA 5EZWA 2W1QA 1CVNA 5LA1A 2PHLA 3NV3A 2DCTA 4ZONA 4QQPA 4XXPA 4Y5SA 1I9RA 3H1YA 4OHWA 3GM8A 5C9AA 4K7JA 4DUXA 3AZWA 1D0GA 1RUNA 4R9CA 1NA1A 4IW3A 4O9EA 4ZS3A 1UL9A 5JCTA 5FMCA 3ETQA 4IL7A 5FP3A 4CEYB 2WS92 2I74A 2VNRA 3HEIA 3WEZA 3WDXA 4AWDA 3KGLA 4K8RB 4CDUC 2QKDA 2QQIA 1EY2A 4WVVA 2C6SA 1F15A 2NM1A 2ZGLA 4YW5A 4ET7A 4MGYE 2B45X 1GP4A 1NLQA 2RJ2A 2FMDA 5GLVA 3ZDSA 1HB3A 3HR9A 5JOXA 2Q0AA 1SLTA 2B8MA 1ALYA 2XL7A 1SLIA 5L9RA 4ISRA 4CPBD 1GQGA 2E6VA 4YM2A 2HJIA 2YU2A 4XXAA 5I0DA 3WNXA 3PTYA 1CR7A 3FJSA 1ZZ7A 1W6QA 2B42B 2ZMKA 4AHYA 5C5TA 2VZVA 4TSVA 2VECA 2PA7A 3JD72 1RUE3 3ZYFA 1RUC1 1QEXA 4GA9A 3T2OA 4E4ZA 4AFMA 1C8NA 1QOSA 1XOYA 2ZEYA 3SCGA 1IQDC 3H3LA 1LGNA 4JHTA 2ZGQA 5FJKA 3IAQA 3MLKA 1AYM1 2QDNA 4PIXA 2CDPA 4GKXA 1UY1A 2DWRA 3WG1A 1UQXA 2V4AA 5FZ4A 3OUIA 3PU8A 3QACA 5K4LA 2DUQA 4H7LA 3IPVB 4GMP1 4X6QB 2O8OA 2ZX4A 3DYPA 1UZZA 1IS4A 5FYMA 3VDDA 3WP6A 1O3RA 2XONA 4W6WA 3B9CA 4AF9A 5A7PA 1EV13 4XFHA 5K0UA 3WHTA 1U5IA 4Q26A 1O8SA 3TEXA 1JYIA 5F6LB 1PVC2 2Y26A 1Z7S2 4E8DA 4WM8A 4C1XA 3ZN5A 3M3OA 1IS6A 4CCDA 1LESA 4CE8A 2ARBA 3DPRA 4FO9A 1H4HA 1WCQA 5FY1A 5FXXA 1DQ4A 5A3LA 1UWWA 3WT3A 2VCBA 4AE2A 5FPUA 5I0SA 1JYNA 4YVSB 1CJDA 4HONA 3O1VA 3O1UA 2K0GA 4C1WA 3NV1A 3E6CC 4RQPA 4BLJA 4Y1UA 4QWNA 2YC2A 4B4PA 1DQ0A 5KHKA 1HKDA 5FPBA 4KGGA 2YROA 3RYKA 1PO12 4A7ZA 2R30A 3F95A 3VDDB 4SLIA 1HX6A 2XJUA 4XETA 3KHCA 1N3QA 1YQCA 2EIBA 2X5IA 2KXLA 4K6BA 4QQOA 4IV3C 4N9HA 1W9SA 2RMU3 3MW3A 3VBFC 4NHXA 2RMU1 4MHUA 4Y4YA 5IYYA 4BZ4A 4JV4A 3PMSA 1OF4A 1POV1 3ZFGB 2A6ZA 3K77A 4JVAA 3ZM8A 2ADEA 3QBQA 4PIZA 3SQOA 2EVXA 4CDWA 4EJRA 1H1IA 3I2OA 1H6XA 1OFSA 4AYUA 4XFAA 1QH6A 4Q0VA 2A6WA 1OVPA 2C5DA 4ZPIA 2YB7A 5FKBA 3WF1A 1T6GC 4BISA 3JB8A 4XFGA 2BGPA 1W2TA 2WNUA 3SKVA 3HBKA 1DYKA 4YM1A 4XVHA 5KHGA 1TMF2 4Y5Z0 1OKQA 1O91A 2KD7A 1BQPA 1Q8PA 5FDBA 4MSVA 4AVTA 5K0UC 2RS53 5FPAA 3K3OA 1OHFA 1UOJA 3IM0A 5JI7A 3T1MA 4CDQC 1VBE1 2NN8A 3DF0A 3AMPA 1E5IA 4IEUA 1C8M1 1YFYA 4PCRA 2UWBA 4XTPA 4XF3A 3LFIA 1VBC3 2QVSB 1QU0A 3AKTA 1C4RA 4MZUA 4CUBA 3KLSA 1H2KA 4DZGA 4CU6A 1N1VA 2B46X 3POWA 1DZTA 4BQYA 1W6PB 5FREA 3HNYM 3O7OA 4D7YA 5LCWL 3EXUA 3APBA 5CG8A 1W0OA 4Y1YA 2P34A 3A22A 2YPJA 4QX8A 1RHI1 3O12A 4WVZA 3VZKA 1UIJA 2ID4A 5F3EA 1F31A 3WDYA 2GC2A 3ZYPA 1RMU1 4XFBA 1JUHA 2BWAA 3VD4A 1RMU3 1W05A 5L7OB 1WKYA 3P1IA 5C8WA 3URFA 3DV8A 3VBFA 1MQTA 5FZBA 2QQLA 3MPPG 4IE6A 3SITA 1SLCA 5A33B 2J1AA 1O8PA 4GWNA 1E57A 2WN2A 1W9YA 4GD4A 3VN4A 4A45A 1DZQA 2OYZA 2BERA 3CF6E 2WZEA 3HBZA 1PMIA 2ZGKA 4OHZA 3BKZA 4FPHA 4M3CE 1VE0A 2YXSA 4AEDA 1BMV2 3AL5A 3TNQA 4DXRA 4QMAA 5E16A 1OH3A 1HJFA 2CHHA 4A3ZA 4W65A 2QJVA 3PUSA 3KV5A 4OZXA 2Y34A 1QJX2 3UYJA 4AI9A 2ZTNA 4LNVA 4FAHA 5FZDA 3L2YA 1O3TA 2JB4A 1A6CA 2BV4A 2HWF3 3TN91 3BVCA 1STMA 3PL0A 4XDQA 2DCJA 3NO8A 5JXJA 4X8NA 3T2QA 3AJZA 2BW8A 4AR2A 1BBT1 3MUZ1 3VZOA 3ZFFC 1CZSA 2R1DA 5BNPC 3RZJA 4CUCA 1HQLA 1PGL1 1D4M3 3N7KA 1XRUA 1WD3A 1PGW1 4LBJA 1OOPC 1R093 5FZ7A 2IVJA 2VU9A 4L0PA 1QJZA 2JG8A 4V1PA 3UGHA 1IGOA 3RZLA 5BNNA 4GQ7A 2WFF1 5FZ6A 1C8M2 1BJQA 4CEYC 4PI0A 2XHKA 4NOTA 1SCRA 4S2HA 2ZACA 5ACA1 4CDUB 2OQ6A 3IBMA 1QKQA 5KC6A 4XJWA 2EIDA 3JQWA 1OT5A 3POBA 3K2OA 2VCMA 5T3NA 1WA4A 4DRRA 1RXFA 1F2NA 2ETEA 1DG6A 4QQ2A 3LPFA 1COV2 1Y9MA 3GBGA 3OGJA 1YI9A 1AXYA 5TSWA 2OZ6A 3E5QA 4DY5A 2BNOA 1BZWA 1UY3A 3ALQA 4XUOA 3AM2A 3Q9OA 4GH4C 3AP7A 1LODA 1ZM1A 1VR3A 4IEVA 4QXHA 3RZGA 3WDTA 4UFJA 4F8AA 2HWC3 1RUD3 3BN6A 4OHVA 1EPZA 2Y0IA 1OUSA 5FYZA 1U12A 2VBDA 5J48A 3PIGA 4XABA 4M00A 4UFLA 4P9WA 4YVSA 2CWSA 1Y9GA 4XJAA 4BCUA 3BIEA 2AENA 4OQ8A 4BWOA 1GOGA 4FTBA 1OF3A 4CCNA 1AYN1 1DGLA 2WRAA 1ASJ2 2YBKA 1RUC2 4PF5A 5FY0A 1JU4A 3V56A 1UZWA 3GBWA 4QPGC 4X6RB 1NA1B 1VBA3 2ARAA 5EPAA 1JODA 3LEGA 1UOGA 1BCXA 2D7FA 2VZ3A 2C26A 2V73A 3B69A 1SLAA 3PUQA 4JGZC 3ZXEA 1RUJ2 1JZ7A 1LAJA 2XGXA 1W9TA 3WG3A 3UJOA 1JW6A 4Y20B 1RUH2 1W04A 4R4ZA 5DABA 1DGRN 3N9LA 1YFWA 5FBZA 1XSQA 3WR0A 1UZ0A 4Y22B 1QQP1 1CGPA 1PIV2 3ES4A 1FPN2 1MZFA 1SBFA 1W8HA 3MIGA 4FPFA 4LKDA 2H6CA 4PQ9A 5KHHA 2VMIA 5HPOA 1Z7S3 4TWTA 1NY71 4XAEA 1RUF3 2XH6A 2VW0A 4QU1A 4AQ6A 4FFFA 2EAAA 3CJIC 5FTTC 3T0BA 2E63A 1X50A 3ON7A 4C90A 1AR81 5FO8B 1BK0A 2X5IB 3E6BA 3IKWA 2X09A 1VJ2A 3LQCA 5H9QA 1XQNA 1UX6A 2VR4A 2RJLA 4BDVB 3I49A 1FXZA 5EJZB 4I3PA 4E2GA 5DDJ1 3GALA 1PVXA 1APNA 2XHNA 4ZHNA 1M4WA 2AUYA 5IHRA 1GZCA 2R071 3WDUA 5JDBA 5CZKA 3O1PA 3NV4A 1O4ZA 3O14A 5FYUA 1NXD1 2ATFA 1GZWA 2GNTA 3CJIB 2C9AA 3NAPC 4RN5A 4W4ZA 5T50A 2W2IA 4EN7B 5FR3A 2D6NA 2BZDA 4YZ3A 2PAMA 5FYBA 1URXA 1WCUA 2VAUA 3D8CA 2YBSA 1ULCA 3SMHA 4BQ5A 4YGEA 2RS31 3CKHA 4I2OA 5FLHA 3HD8B 1HB4A 2IUWA 1ZZ9A 3U1XA 1PX4A 3ZVXA 3BOPA 3MIFA 3PMEA 4QHOA 1ZBA3 2VW1A 5E1RA 1X9TA 4B3NA 2YHJA 4HG6B 4HL0A 3ST7A 4ATEA 4P02B 1AXKA 5JXHA 4XIOA 2WKKA 5GALA 4BXFA 1KRIA 2JG8B 1HLCA 4XFIA 1Y43B 4YZ5A 4AGRA 1AVBA 1A8MA 2GP5A 1IS3A 3DCQA 4FI9A 2LTNA 2NYYA 4AFBA 3U75A 4MX3A 2QQVA 1IKPA 3BGAA 4OULA 4U36A 1D4VB 3N7LA 1WW7A 3M7AA 1W03A 4RGAA 4XUPA 3TYJA 2UU8A 1C1LA 3D0SA 3OPTA 1JZ4A 1GNZA 1H1AA 5D8AB 1IZ3A 2VQUA 4FTEA 3SISA 4PT6A 3BOWA 2XJRA 4HPKB 2FBEA 2XOMA 3GJAA 3N9MA 3WP3A 4QGMA 3I8TA 5EYXA 5IUQA 4Q4X3 5SV5A 3UKNA 2BFUL 3DUIA 1RHI2 4BIFA 4EN9B 2Y64A 4JDNA 3NKGA 2MEV2 1HRI3 1RMU2 2PHRA 3OSDA 3WV6A 1JYXA 4MUVA 4QX1A 4AI0A 1CZVA 3I2IA 4MH0E 4XQWA 5DUVA 2Q30A 5J98B 2J1UA 4LBQD 2XLFA 4QU2A 4XYXA 1GMMA 2AH2A 3THCA 3FHIB 2LS6A 4HXCA 4XF1A 2VM9A 1TQ5A 2B9VA 2Y6FA 4OLLA 3QH6A 2RDRA 3EBRA 5FZHA 1LJ7A 4Q4W1 4E2QA 2WQ4A 2QQNA 4I3GA 5F2SA 4WM7B 2IVIB 3QLQA 5F32A 3ZKYA 4Q8KA 1RUE1 2R063 1ZBE3 1V70A 3GHMA 3I3EA 2YG0A 2Z2SB 5DAQA 1IKQA 1X8EA 2RS32 2VZSA 5EWSA 3THPA 1G9FA 3MBWA 3VD7A 3WF4A 2GMMA 2CU5A 3KV9A 1RUI2 2EXHA 2OPWA 4AEDB 4L9BA 1CAVA 2B7YA 3T09A 5F1RA 3PUAA 1ZYBA 4XHXA 4COUA 3R4UA 2XL9A 2EXKA 3AP6A 1W9FA 5FXZA 4A4AA 2XBO1 2R49A 5LA0A 2LROA 3MGUA 4ZXEA 2YU1A 5FUPA 2I45A 1WBFA 3VL8A 4IV1C 4GB31 4PI2A 5F2WA 5CA6A 1ZZCA 5FZ9A 5A7QA 3RQ0A 1NA1C 4GB33 3NJXA 4HK8A 1OVSA 1QDCA 2VPVA 3AXEA 2ZKNA 1SQ4A 5T5LA 4DFSA 2FCTA 3ZSLA 4ZU7A 3C3VA 3USUB 1GP6A 1N47A 2P17A 2P2KA 2D93A 1UU6A 4BB3A 5IFPA 4WM8C 5HV0A 1PO22 4BOWA 4EV0A 1OFNA 3PUHA 4A41A 1GQHA 1RUH3 2A6XA 1CONA 2GNBA 2DDUA 3B02A 3BPZA 3O5SA 4FOQA 4LK7A 4XJ8A 4MYEA 5LA2A 3U78A 4Z82A 2ET7A 4NAOA 2R6QA 3KQRA 1IPKA 2PAKA 4DXZA 3NVCA 4GALA 3MEPA 5D21A 1SPPA 3T0DA 1V9U1 3GNEA 1DLCA 1HXS3 2IXHA 4DOUA 1N1TA 1V9U3 2PTMA 1YO8A 4AVVA 4LKFA 2RR13 2DBNA 2IFWA 1S0IA 4XTMA 3AVRA 2ILMA 3ES1A 1RJ8A 1K42A 1OOPA 3T08A 4IV3A 3AYCA 1ND2B 4F7ZA 3PNAA 3WLUA 2JE8A 4B7EA 4MADA 5B2GB 1NCQC 2F4PA 4HN1A 5CVRA 4EWDA 2J1VA 4QGLA 1MS8A 1JHNA 2QQKA 2A3XA 4K21A 5FV3A 1RINA 2O0OA 4CP0A 3AFKA 3VHPA 4NHYA 4E2SA 1H0BA 2DVDA 2UY8A 2VVFA 1MS1A 5F9TA 2E51A 2ZGOA 3CEWA 4AI3A 2X53S 3V0BB 5J09A 1AR61 3HIFA 4ES9A 3NV2A 3PURA 5AVPA 3UESA 2W9XA 1TME1 4HBNA 3ACFA 4LBMA 3KCCA 2EF6A 4MVTA 1UW8A 2A71A 4TLGA 5FAXA 2BRTA 5EHDA 1A78A 2VULA 4LO4B 2WO7A 1MQTB 4ONUA 1LGBA 2QQWA 2WN3A 3OGGA 1ZRRA 4QB6A 4KBZA 4KU8A 2EAKA 4OCTA 2CSGA 5DUWA 4D69A 4OHXA 4S2DA 1W06A 1VBE3 5FRAA 3PVBB 1C8M3 1NLSA 1FV2A 2F6BA 2VJXA 3UJQA 3SCFA 5KHIA 4LT5A 4RYDA 5FYSA 1AYM3 4FPOB 4CU9A 3HQXA 4YRDA 3RYPA 1AR91 1H9PA 4L99A 2ZKLA 1RVF2 2AEYA 1QOOA 4Y5TA 3L2HA 3ETPA 2JEMA 1KS4A 2DU0A 3VBSA 2R042 1QHDA 1DYOA 4GMP3 2NMNA 5LBEA 1BHGA 1R081 3V0BA 5I8YA 3VBUB 5FCCA 1H30A 5DZFA 3NAPB 4AFDA 1F5JA 2JG9A 2CV6A 3OOXA 4FPCA 4YW7A 3W9AA 1PMHX 1QWRA 3ZN4A 4LTAA 2QDRA 2NMOA 3RJRA 3LEKA 2UWAA 2F4LA 1UXXX 5DDJ2 5EXOA 4Y24A 3I2DA 3MIEA 2JDPA 2YPDA 4FFIA 5A80A 5CADA 4MHRA 1KITA 4YVWB 3ABZA 3THDA 1W8OA 3I4IA 4Y33A 3AZXA 3INAA 4JKLA 1UMIA 5LZ6A 4JTOA 3LOIA 4QGNA 3L9JT 1VMJA 2NPIA 3CJIA 4XE9A 4ZXKA 1W6OB 2K9ZA 1ULDA 3ZSEA 2RG4A 1GWMA 3HOBA 3KM5A 1LHOA 2AR6A 3X29B 2LRPA 1UY0A 4A7YA 2GU9A 2BGCA 3KSCA 1UNBA 1JOBA 2VH9A 2B39A 5BNOB 4AVSA 2HWF1 1L7QA 4FSJA 3TEZA 1LEDA 2OUJA 1QJY2 4LMFA 3BI3A 4F3JA 3IT8A 1O5LA 4N53A 1RUOA 2HWD2 4XJUA 4BQWA 2XMLA 3TNPB 4L2NA 5DZGA 1GNHA 2FZ1A 5JR2A 2ZX0A 4AI2A 3I3MA 5EJ3A 1ULEA 1UPIA 5A32A 1DDLA 1EAH1 5I93A 1PO23 5L9BA 2X8KA 1WLDA 5JI9A 1RYYA 4OZOA 1BVVA 4WVWA 4TLFA 5FZOA 5CISA 1SPPB 1SG3A 2A3WA 2JJ6A 5LWBA 5ACA3 1LRHA 4JZRA 1XU2A 2VVEA 3IDCB 3KCYA 4CDWC 1ENRA 4RS5A 1JHJA 2J7MA 4D8MA 5JZGA 4FCAA 3ZFFB 3K48A 5A7SA 1MS0A 2GALA 2XB6C 2ZMNA 3PU3A 5CYYA 3RGBA 4DB5A 1UYZA 4D7SA 3BIWE 1D4M1 2I2SA 3LDBA 3PLQA 1UU4A 2SLIA 2VZTA 1GU3A 2WNUC 3I3DA 4UOJA 2MEV3 1I6XA 2OXBA 1OQ1A 2IXIA 4ORFA 1FOD1 4UAPA 5JMCA 3CDZB 3E97A 4YLZA 1RUD1 4Y4RA 4Z1VA 4Q5OA 3HWJA 2P37A 3MFCA 2PYTA 3CMGA 5CB7A 4QQHA 3UV9A 1KQRA 2LW8A 3SH5A 1ULGA 1YC61 2AGSA 3J7HA 1V0AA 2BDRA 4XJ9A 1LTEA 2WWUA 1JZ8A 1UAIA 1V6LA 2G4IA 2WLPA 4FOVA 4KWLA 2VGDA 5JXGA 1UKGA 1W6QB 3AXDA 3BTYA 3B7MA 1GSLA 5D1IA 3NWKA 2WT2A 2ORXA 1FV3A 3JBG1 1LOGA 3BU0A 4Q27A 3PVNA 2B5HA 1K3IA 1H6YA 1PK6A 2HWF2 3BODA 3JBG3 4WM8B 2HBTA 3SEPA 3O1RA 3MDPA 2GC1A 4MGTA 2FMYA 1OC1A 4NVPA 1SDDB 2HWD1 5A3TA 1JS9A 1DP0A 1SEFA 1KFXL 5JAXA 1W2AX 3HAGA 3CIHA 4ASLA 2WNVA 2PLV3 2JDZA 5GZDA 5I0TA 1V6NA 4E4SA 4JCKA 1W8FA 3NJYA 1W0NA 3PVOA 4H3WA 2ZZJA 5CKNA 4CDXC 4RQPB 4JRAA 3UKVA 2CGNA 1UYPA 4H7MA 2E7AA 3J7LA 1DQ6A 4IGOA 3EQEA 1ZZ6A 2IXLA 2PMWB 2J1SA 3ZYBA 2DV9A 2WQZC 5JSRA 3VD9A 3WDWA 3KV6A 1NAEA 2MNGA 4HKOA 4L8QA 1AR83 5A6QA 1ND2C 3M3EA 3RDIA 5JIAA 4C91A 4GKYA 1COV3 2JX9A 2WZ8A 2J42A 1GWLA 4BK4A 1H2NA 1RITA 1H8TB 4GH4B 4NJ4A 4ZU5A 5LK7B 2OVUA 4LKSA 3I59B 4HETA 4TTGA 4BMBA 4DINB 3ZN6B 3VZNA 5F5QA 3ECQA 1VB4A 5JSPA 3FLTA 4IE7A 2WBKA 4KBBA 3CU7A 3GBFA 1CAWB 3D0JA 2Q1FA 4V2VA 4EN6B 2OIIA 3I97A 4B7KA 2JECA 3A4UA 3ILRA 1ONAA 2XVGA 3OEBA 2PHXA 1ULFA 5F3GA 2P6CA 1SHWB 1QMJA 3VKOA 2AZ5A 5EQUA 2PHUA 4JAAA 4TXWA 3VLBB 2VTXA 3WF2A 4BIOA 3OPWA 5EV7A 5FK8A 3RZKA 4AG4A 3KB5A 3S7EA 3H8RA 3ACIA 1HQWA 5FZLA 2VUCA 1TME2 1XYNA 2EIEA 5IVJA 2JDKA 4P5HA 1QJY3 1KXGA 5I91A 3PTRB 4P00B 2QQMA 3A0KA 3AP5A 3B3QE 3Q8CA 5C5UA 3VDDC 4DXTA 3FLPA 4YARA 3TAYA 1M06G 4IV3B 4NHMA 1UMZA 5EYYA 4EZHA 2FCVA 3MIDA 2D6MA 1UN1A 4OUMA 1ZBA2 4XF9A 1B35C 3ZFGC 5J3UA 4LBQB 5JOZA 1PZ7A 1G8WA 5F37A 1ACCA 4RGKA 4EE2A 2BPA2 4Y3OA 3ILNA 4YG3A 1YWKA 4KWJA 1A3KA 2ZHMA 1RUF2 3LGRA 2BWCA 1VAKA 4FXGB 3I2JA 1JYTA 4XJZA 4OUEA 1W0PA 3H1MA 4UW4A 3SH3A 4NO4A 4MOAA 4YGDA 5J96B 4Q4V1 3VGIA 1KDKA 3JU9A 2XLAA 5EFUA 2W91A 5FKCA 1R1ZA 3ZFEA 2VMFA 3MHZA 4COVA 3ZXKA 1RGSA 4N9IA 3POSA 3VBRB 3VHOA 5CEHA 5CG9A 2VZOA 4AFCA 4CCEA 4XUTA 2YGMA 3ZXLA 2W87A 3WHUA 3OBRA 4V2WA 3HNBM 2DCZA 4LR4A 1W99A 5FLJA 1OBNA 3UKTA 1OH4A 4JQRA 2ZGUA 1OMIA 3AZZA 1NOVA 1MZ5A 4PHZA 5FFOC 4FPKA 1RUC3 2VOKA 1NYWA 2R061 1UYYA 1I1EA 1G86A 1X82A 1QNYA 1YNAA 3K4AA 4KH9A 1S55A 2VO5A 1R1A2 2A70A 3WNPA 1S0DA 2CNAA 2XBO3 4RGGA 2VG9A 2DUOA 3ORJA 1JI6A 2K46A 2NLRA 1IG0A 5FZGA 2BNMA 3WOGA 2JDHA 5IK8A 2IZWA 2VD7A 3AP4A 3S5AA 4IV1A 1XE8A 3T4HB 5CFDB 5CFCB 2GC0A 5JPMB 1G9DA 1EV11 2BEOA 1ZBE1 3OTFA 4AVAA 1MZEA 1NQJA 4CCMA 1V6JA 3DXUA 1AYM2 4IGPA 1MS4A 3ZFGA 4BXSV 3M4FA 2SBAA 5CKMA 2K2SA 3AYAA 2P3KA 3EJKA 4U2AA 4YZ1A 5FZ1A 2GP3A 4EQVA 3HT1A 4XAAA 1QOTA 3E6DA 1RUG1 1IS5A 3WF3A 4Y22A 4MGZE 4D6RA 1RUG3 1KJLA 2GH8A 5F5AA 4NPRA 3M3QA 1ND3C 1JH5A 1XB9A 2DF7A 5HXMA 2VZQA 1TMF3 2JDUA 2EXIA 4IEXA 4IE4A 1RL3A 2J1EA 2VW2A 5DAXA 3VD5A 4CDUA 5I0UA 4A44A 1PVC1 2XWJB 1DFQA 1WCKA 3ZIWA 5JZGB 5GLUA 4L97A 3TBDA 4CCKA 5G05L 4EWEA 2VMCA 4KWKA 3MFAA 1ZX5A 1LHVA 2TEPA 1MVEA 2ZGMA 1UY2A 2O8QA 4UW5A 3UGGA 4FOWA 1FOD2 5IVVA 4QKDA 4P14A 3RNSA 2HYXA 4DPNA 5F5IA 3RPQA 1QDOA 2DU1A 3MV11 1CPMA 2H6BA 4NIGA 4CU8A 4BM8A 4DMIA 1XYPA 2YGLA 3ZYJB 1VBB1 1VRH2 4WVMA 2CWMA 1YI7A 2VY0A 2WUHA 2W3JA 1S4CA 4Y20A 1HXS1 5JZGC 5KBFA 4NIDA 1VLNA 2XKPA 2Y8KA 2XKOA 1GQPA 4IEWA 4R4XA 1ASJ3 3ZXJA 4MGQA 4RS5B 2CY6A 1EYBA 5ANNA 4GWMA 5ACA2 4PBPA 1W9WA 3LA3A 1WMEA 5GLZA 1NX9A 2X29A 4BQ3A 3T2PA 1FT9A 4K1YA 4YYOA 3GJBA 1MR5A 2RS51 2HWB2 4AQSA 3H7YA 1YQ6A 2A7AA 1CQ9A 1YRZA 4PIYA 4M01A 2G1MA 5FZAA 5A7WB 4D7TA 3OYWB 3W5NA 2YZ4A 4FTSA 2W68A 4CP9A 3PJYA 4HPKA 1TME3 1VBC1 3DYOA 5IVYA 4NN0A 3T3YA 4QDRA 5T5OA 1C57A 3VBSC 1W8NA 3MICA 2QUOA 4XCAA 3WCRA 1Y7BA 3MPBA 4LHNA 4Q0SA 4XQ4A 1JU3A 1UO9A 3FBYA 3NSTA 1JZ2A 1VBE2 2G9ZA 3MI8A 2JD4A 2BUKA 3CHXA 3GCXA 4NRMA 4PJYA 1T6BX 2W1WA 4YG0A 2LALA 4Q4Y2 4BQ2A 2D3SA 4K9SA 4FPYA 2O1QA 2GC3A 4JGYB 4ASKA 3AVSA 4KI5M 1G9AA 1NCQB 1FNZA 3LOBA 3M8LA 5A70A 1OPMA 2WIIB 2VC9A 4FP3A 1BXHA 4META 3WP5A 5KC5A 2P1BA 2QE3A 4YGCA 1RHI3 4HK9A 3WNKA 3ENRA 5A6XA 2PXJA 2IWGB 3A7QA 3TRSB 4CUGA 1YJKA 2BOJA 2G9FA 5BY5A 1GOFA 2WO3A 1AR73 2DVBA 4DXSA 4A2UA 4XILA 5FZ0A 3D6EA 5HXVA 1UPSA 4FXKB 2QQOA 3FMGA 3N9NA 3RRDA 4K1ZA 1ODNA 2NP0A 2WSUA 1Q8SA 4I0WB 5FZIA 2R0HA 4LBQA 3ZPYA 3TN93 2YC0A 5C3QA 3JD73 4E8CA 1G9BA 4AZZA 1GICA 2BQPA 4IGQA 5AFBA 2DVFA 2DUPA 2JDMA 4WBBA 1WGPA 4LBNA 2Y6GA 4JTNA 4ZU4A 1J59A 2WZR3 2ZBJA 3SH4A 5HI0A 4R52A 1UMHA 3MV01 5F5CA 1R091 4ISQA 4YSFA 2DYCA 3T0AA 5FWEA 1CAWA 1E5SA 4P9XA 3K51A 1OA3A 4QPIC 3TEWA 3GF6A 4XW3A 5FUIA 4DS0A 1BBT2 2WFPA 1S0FA 2PN5A 2NZ9A 4IESA 1Y4WA 2NQYA 5GLTA 2Q1MA 5APAA 3DYMA 3HN1A 5FYHA 2ZABA 1T2XA 1P8JA 1DGWX 1YXWA 2A6VA 1DZRA 3O1OA 3H8XA 1WCSA 2WR9A 3AFGA 1IPSA 4Q4X2 3WVJA 1DQ1A 5C9AB 3RG0A 5IVFA 1OI6A 2E31A 2H0VA 3KQ4B 1LHUA 2A73B 2JE7A 1HRI2 5FXWA 4CCOA 4P5YA 4Q4Y1 4FPJA 1EAH3 3Q8EA 1VRBA 4Q4Y3 1AR93 1VBD3 2VTXJ 3DPRB 4TN7A 4Q1PA 1FOD3 1LOEA 4YVWC 4LO6B 3KF5A 4R8HA 1NZIA 4CA9A 5C4WB 4CDWB 2P3IA 4JKMA 4G3YC 4H14A 4QDSA 4R9DA 4YZ2A 2EIGA 1NT0A 4MGKE 3K4ZA 3BPSA 1R083 5J37A 3ZFEC 3H8UA 4CPBA 3JZVA 1VAVA 3OCPA 1DYPA 1JOPA 4NWVA 3E1F1 3M3IA 2PQQA 4YW4A 1HN0A 2W08A 1DF0A 3AKSA 5C9AC 4R9BA 4NMIA 4RHV3 1TEIA 3FHQA 4BQ4A 5LBBA 2Y0OA 1QJU3 1QIQA 1I3HA 4TYSA 5FQ0A 1F35A 1PM7A 5CFDC 2P6HA 5F8PA 1C5HA 1DBNA 2E7QA 4IE5A 2Z42A 3ASIA 5GLWA 3LDKA 1D2QA 1KEXA 1LOAA 5DAPA 2W0XA 4GJYA 5A7WA 4M4PA 3ZFEB 5A1LA 3S57A 5CBLA 2JDYA 1LHNA 4QT6A 3IIAA 5DZEA 4CP9B 1Y9QA 4RS5C 1CAUA 3FN9A 1AF9A 3ZSJA 2HWD3 1W3XA 4UFIA 1OLRA 1XNAA 2VMDA 1AL22 2PHFA 4PBOA 2OW4A 2GZWA 1OLQA 2PLV1 4S2GA 1DU3D 5HBAA 2YMZA 5E89A 2Q8CA 3AKQA 4ATFA 4QDQA 1FX5A 2QBXA 5JXIA 3TEYA 2DCKA 3WY6A 3O1TA 1J84A 2P3YA 3B94A 5K9YA 1WLCA 2P4EA 2ZGTA 4KU7A 4JQTA 3E5XA 2C24A 3H3ZA 3NW4A 4M3CB 2D43A 3RVHA 5K8SA 1JYWA 1ND2A 1QQP2 1RUG2 4AEDC 3GXUA 4XMIA 3VBOA 5KXEA 2VBPA 1ZA7A 2YFZA 3KT7A 5FY7A 1IPJA 4JGYA 5T52A 3WQ1A 5ISLA 3ZPOA 3VHNA 4BYYA 3VB9A 2RM22 4BK5A 5G04L 3I3QA 1KS5A 5IVCA 1US3A 4WZFA 5FJHA 2R16A 3FC0A 1UY4A 2YV8A 5LB6A 3VHRA 1JMUB 4BHPA 3IDEA 1CZTA 4CCJA 1VBD2 2A5ZA 1LB2A 1MS3A 1CIWA 3LKJA 3OGSA 2VNGA 4B1MA 1D7PM 5C8CC 3P3NA 2HEYF 2VOWA 4UYBA 1TNFA 3OPZA 4A6SA 2WS91 1G9CA 4AVCA 2PQSA 3VL9A 3WW1A 1K5JA 1EPWA 4BMEA 4JHZA 2Y6HA 1LNSA 3WP4A 1SACA 2CAUA 4Q0PA 1SDWA 2C4XA 3P6BA 4YW1A 1WBLA 2P5BA 3WUDA 5I8SA 3VD3A 3JQXA 3IMNA 3KT1A 2JICA 2D5FA 1RB8G 1MPXA 3ZSMA 2MPFA 1V6MA 4NROA 3UETA 1RUJ3 4LHSA 1HV1A 3UL2A 2FHRA 2ZHNA 1SCSA 4DUVA 4UW6A 3WNMA 3VBSB 3R0RA 1IHMA 3HJRA 3O0XA 1AYN3 2C1FA 2FDGA 1GV9A 4HSLA 3WNNA 3S6PA 4NIAA 2XJVA 3C8XA 4FVVA 4XF4A 1QJX3 3MUY1 3NNJA 4PQQA 5GM0A 2DTYA 1QJX1 1AL21 4LUKA 4URTA 1AXZA 4B1LA 3THTA 1VBA1 1LOFA 2L9LA 3DN7A 3DECA 5FYTA 1ZA4A 2WWSA 3IDBB 4WVMB 1PNGA 1RIRA 3USSA 1AX1A 2UY9A 5I8TA 2IXCA 3EMRA 4OVEA 2UURA 3VDCA 3RI9A 4C0BA 5KXDA 3GGLA 3MO4A 2YYOA 4JGYC 1JXNA 1LOCA 1MEC3 4KWUA 1LKNA 5A32B 5CU1A 2JWPA 3V0AA 3LSDA 4ZZ5A 1E5RA 2V72A 2J1TA 2RM21 5FMOL 1G6NA 5DG2A 2XJPA 1OLME 3OBTA 5CFDA 1A8DA 4M4RA 4YGBA 3RS6A 4IEOA 1PK6C 1Z7S1 2JD9A 5A7NA 2AC1A 2E9QA 1Q5OA 4JGZA 4UBHA 2H0BA 5L7OA 1XYOA 3W21A 5BYNA 1A34A 3FUOA 1LECA 5H9PA 3QCWA 2VOXA 1K5MB 4YW6A 4UFHA 1VP6A 1NCQA 2ORZA 1CAXB 3EYPA 3NKTA 3IPVA 4CDXA 5LRRA 2WNEA 1ODMA 5C33A 3AMMA 4XZPA 1PK6B 2GNMA 1GP5A 3T1LA 1PZ8A 3AYEA 1VB2A 5L19A 3VKNA 1PO11 1ZRFA 1ENSA 4HVOA 2LM3A 1HRV3 4QXKA 4CP1A 1PO13 2ES3A 2VE1A 4XMAA 3WINE 1HB1A 3OB8A 3AB0A 5FZFA 1FI2A 2Q8OA 1UOBA 1F8VA 1PGSA 4Q4W3 1EUUA 1MVQA 4B29A 1ST8A 5IK7A 2Y60A 1N1SA 2ZS6B 4GIQA 2CDOA 1RTVA 1JUIA 2PHWA 5FZMA 4MGSA 2VOTA 5T55A 5JUVA 5BNOA 1CD3G 1OLMA 5C3PA 1RUI1 3LSEA 1WMXA 5IWFA 4AHWA 4LBKA 3BUCA 4FQZA 3FFZA 3C7EA 2ET1A 3WG2A 1NCRB 4AHXA 2YC4A 5DUUA 1GFF2 2VUJA 5FP9A 2X10A 1CAUB 3RWNA 4RR3C 1RUH1 2D3RA 5GZCA 3FBMA 2ZAAA 3ZYGA 1NQDA 1LHWA 1TMF1 2QZ2A 3H0OA 4N43C 4Q0QA 4UI9L 3DPRC 4P08A 5JVVA 5BNNC 3FLRA 1XNCA 3DKWA 2WSVA 1WZXA 4N7UA 5A3WA 2HYKA 1LULA 4QB2A 1J1LA 4CEWB 1MEC2 3U4XA 2JDNA 1ZRIA 3OF1A 2WDBA 3VBHC 2OUHA 5LRSA 3ZFFA 4AVBA 1OA4A 3PDQA 4AHZA 1PX3A 3EO6A 4D6SA 1YYNA 2QTWB 5CKQA 2ZGNA 1XNTA 2HWE3 4CUAA 5J36A 3RMXA 2JENA 2W46A 2AACA 5FUNA 4DEVA 3AP9A 2EALA 5FWJA 1ZZ8A 1AR82 2WNVC 4RD7A 5FO9B 3O1SA 4IEPA 3ZKUA 1W8UA 3IN9A 4W50A 3LPGA 2ADDA 5FZKA 1W2OA 3EB7A 5EJ1B 4UXAA 4XIKA 1W8WA 1I5ZA 3J8F1 3U37A 1RXGA 2ZEXA 3J8F3 1GZWB 3NNGA 2BP6A 2RR11 3ZO0B 3VDBA 3WZ1A 4XBNA 1UKRA 4XDPA 1F4AA 1V6KA 5KHJA 5FIXA 4CP2A 2QNKA 2A3YA 3VV1A 3GZUC 3KHBA 4HKLA 3VZLA 3CJXA 4P9JA 1YJLA 1YFXA 2YDEA 5A1AA 4DY3A 1ND3A 1W6PA 3DGTA 4LOSA 5CNAA 3OUJA 4F83A 1ZREA 2Q4SA 1L7RA 4XBLA 2Z69A 4YVSC 1GZTA 1VMFA 2ZAHA 4A7KA 1X7NA 4CU7A 4EN0A 2VNVA 4N53C 3JUUA 4XUQA 1WCDJ 3KF3A 3RZMA 2O14A 2ARXA 1W6OA 1DGRA 1LU2A 1XNDA 2DFCA 1F4HA 3PIJA 2DURA 4E27A 5A3NA 2BFUS 1TNRA 3OD0A 4XUNA 1PMJX 1BLZA 2VMHA 4DNYA 4KNCA 2XDVA 3UNPA 1XC6A 4Q1RA 4AEMA 3W59A 3ZYRA 4YW3A 4E9KA 1LENA 4JGZB 1FMD2 2GMPA 1DIWA 1U5YA 2E26A 4MLOA 1PGL2 3MW4A 1YCIA 2E53A 3I7DA 2Y6KA 2VVDA 3H7JA 3QD6A 4FBFA 1AR92 3MZHA 2LUWA 4HVQA 2DCYA 2WFF2 1RVF1 3WF0A 3OBAA 5KXCA 1L3JA 1W3VA 4CRQA 4JRLA 1R082 1CAXA 2D44A 3R05A 3MF6A 4QX7A 1B09A 4INDA 3H8OA 1BKZA 1Q8QA 3CBNA 5AVAA 5B4NA 2Z79A 3ZSKA 2VXRA
chains in the Genus database with same CATH topology
1W6NB 4OI1A 1Q3EA 1LEMA 4KG0A 4LHKA 3KS7A 3SXWA 2RR12 3JCIA 2QQPA 2A6YA 2V5YA 2Z5WA 4COZA 1KD7A 3H3UA 4B4QA 5KXDA 1JYIA 1O4TA 2XVLA 2C0ZA 3H50A 1H8TA 1Q8OA 4HMZA 4K20A 1CX4A 4JDOA 1WMFA 1POV3 2WZR1 1NCRA 3H1WA 4MXWB 1AYN2 1ASJ1 5C8CA 5FOBB 1REFA 4Q2FA 1FNYA 1WUVA 2Q1ZB 1VIWB 2ZHLA 1U0AA 5JPNB 1VBA2 5FPXA 1D2SA 3AMQA 3O0VA 4XPVA 5JWPA 3B00A 4NWWA 1NXMA 4GB32 4C0HA 3AZYA 1OQDA 5T54A 3QH7A 1H8VA 1BVP1 2OPKA 2CGOA 1FMD1 5ABJB 4LE4A 4BPZA 1K5MC 5HCBA 2RS12 4BA6A 1MS9A 1PO21 1VALA 1X36A 1NY72 2AREA 2GN3A 4P9LA 3VBHB 1UD1A 2IC1A 1V9U2 2BVBA 4Q8LA 2WLQA 2CAVA 1Z78A 1WW6A 4IETA 3BCWA 4I30A 4O9GA 1EP0A 2N7GA 3ACLA 1UU5A 1OA2A 4W6XA 4J1XA 4FQ4A 2IXKA 2R072 4WM7C 4BH9A 5C4WC 1SBDA 4OI0A 4EN8B 3GZAA 3MW2A 3QOPA 1NCRC 3OY8A 3VZMA 3SHRA 1AHSA 5C6CA 3VBRA 1GKBA 2GDFA 2ZHKA 1AR62 1DGWA 3R4DB 1BMV1 1C5IA 1QJU1 2JKBA 2WL1A 3VBUA 2ZX3A 1B35A 1W6MA 2D6LX 3AMNA 2BNNA 3M1HA 4Z2WA 1WW5A 4M3CF 2HKXA 3TN92 4JDMA 4BLIA 1OPOA 1AJKA 1CESA 3LA7A 1QXPA 3I54A 3AZVA 3D82A 4I01A 4AK3A 4BQ1A 4GULA 1S0JA 4DQAA 5LEJA 4Q29A 2R043 3V0AB 3U10A 2R041 5H9RA 1GR3A 2JG9B 4LULA 2OA2A 2D3PA 3RZZA 3VUOA 1LCLA 2ZGPA 1UF2C 1Q8VA 1COV1 4M0HA 2BVVA 2E7TA 2XJTA 2WFF3 5DDJ3 3V64A 2MEV1 3MIBA 1ND3B 3TOJA 1MACA 3RI8A 3J8F2 2R1BA 4AW7A 4LBLA 1O7FA 1GANA 5JLVA 4CEWA 3D5OA 5C8CB 4LE3A 4QHBA 3C2UA 1KDMA 1AR72 1HIXA 1RUE2 1XU1A 3RYRA 1X33A 2ZCWA 1AL23 1QJU2 5FPZA 1S2KA 1H9WA 4CDXB 3TB0A 5LK5A 2ZX1A 5BV6A 4AEJA 4Q0UA 4XEZA 1QJY1 1UIKA 2XBO2 4RSUA 5JOWA 1RUJ1 1WW4A 4EWAA 3B5LB 1W2UA 4P9GA 3LWCA 1J3PA 1YIPA 2FZ2A 4HKWA 2OZJA 4CZSA 4GMP0 3VKMA 1H8TC 3ATGA 5JOYA 2CL2A 3LAGA 1H4GA 4Y1ZA 3N7MA 5GKAC 1PIV1 2JE9A 1FPN3 2Q5TA 3PJQA 5GZFA 2D5HA 1FPN1 3S7IA 1IOAA 3LZZA 4AFAA 1RUF1 2GH2A 2QCSB 3UK9A 2YUEA 3MLLA 3ZIXA 1LR5A 1S0BA 2JG8C 4ES8A 4Z8BA 4RL7A 3B01A 4DRVA 1QQP3 4XFFA 4YG6A 4XBQA 4LBOA 2HWC2 1N3PA 1S0GA 3VBUC 3GYDA 2CTVA 1SLLA 4BE3A 2ENRA 1QXJA 4GXLA 1JBCA 3H9AA 4LHLA 1RJ7A 4PDWA 5FOJB 4MV2A 4HN0A 3G6JB 4IQPA 5FMOS 1X8MA 2HEWF 4HLTA 4RA0A 2RS33 2P3JA 4YVWA 2WZR2 4Y1VA 3WW2A 3ZXAC 2R073 2TNFA 4LA3A 2WA3A 3V65A 3FZ3A 5BNPB 4CDQA 2RJKA 1NZCA 4FT8A 3FWEA 3MLJA 2D97A 3KD4A 3O0WA 4UW3A 4L11A 4HFSA 3I59A 4X8PA 3KT4A 1HV0A 1KJRA 4AQ2A 1ZBE2 2GAUA 4YZ4A 4XF0A 2HEVF 4P9YA 4P9IA 5A33A 5BPXA 1NE4A 4HSJA 2RS13 1N1YA 1WD4A 2RS11 4YM3A 1S1AA 4RR3B 2HWE1 2ZPXA 3EHKA 3B9IA 3PVEA 2BTVC 5L73A 4ASMB 5BNNB 4CYDA 4Q4V3 4FP2A 1XNBA 5GZEA 1H1MA 3LA2A 1SFNA 2FQPA 5GZGA 3N7JA 1GZ9A 2YY1A 3WCSA 2WJSA 1REEA 2RE9A 2W39A 4XFCA 2ZZQA 2TUNA 1VBB2 1VRH1 2CGPA 2GN7A 2PFWA 1YIFA 1VRH3 4HZFA 3PHMA 2QZ3A 2WT1A 1QNWA 4XHBA 1AJOA 2UWCA 5HCFA 4M3CA 4Q4W2 4XQDA 4HT1T 1S2BA 3T2TA 1WLWA 4XOGA 5HCAA 1REDA 4ZKTB 1AR63 1FYUA 4H55A 3ZYIB 3OY8B 1W6NA 1F9KA 2WC2A 3NAPA 3W58A 5AC92 1HRV1 4YFWA 4KL1A 4QPIA 1DQ2A 1U5ZA 4AEKA 3VBFB 2RS52 4KQ7A 1DHKB 1O3SA 3ZX7A 4CEWC 2QFEA 4LO8A 1XNKA 4N53B 1VBC2 2BBVA 3N36A 1F5FA 5BUVA 4I02A 3VBOB 4FPGA 5I0RA 2X5IC 2ZGRA 1RVF3 5IT6A 1Q56A 2UYBA 2ZX2A 4MGIE 2CYFA 4FOYA 2IFRA 3GHNA 2HWE2 1MQTC 2WNVB 3AX4A 4AI1A 4IEZA 2B9UA 1VAMA 4COWA 4NHLA 1YFUA 3ZMNA 2RHPA 4PLMA 3J9SA 1D4M2 4HANA 3J4UH 1O3QA 1W6MB 3AK0A 1NLRA 3WX5A 4KGQA 4LLOA 2ZOEB 3GZTB 1NE6A 1SBEA 1RUD2 4YNIA 2GSYA 2PELA 1QY4A 3LCPA 2XLGA 4WV8A 1VBB3 4AXOA 2XVKA 2WINB 4UBGA 5CAZA 5L7OC 1OSGA 1SFYA 2GMEA 1R1A3 1AR71 5JIUA 5FO7B 4YFZA 1R1A1 3G7DA 2VMGA 2XPJA 1QXRA 2D6KA 3NJZA 1POV0 1C3HA 3FFQA 3N35A 4LLFA 4Y26A 4JC1A 5CFCA 3WQ0A 4NHKA 1BK1A 1GBGA 1W39A 3RJ2X 4IEYA 4EROA 1R092 4E4DX 3JB4C 5D8AA 1AX0A 1BEV2 4CDQB 5BXXA 1JOJA 1MS5A 3IWZA 3ME2A 1GLHA 3CL1A 3FUQA 4IXLA 5H9SA 1ENXA 5BNOC 4J1WA 3ILFA 1HQNA 1B35B 1J58A 4QX5A 3VZJA 1HDKA 5BNQA 4K40A 1UCXA 5ABJC 1OOPB 3AKRA 5F6KA 1FMD3 5E8AA 2EXJA 3BALA 4AI8A 4RR3A 2XWBB 5KWRA 4WM7A 2DVGA 2ERFA 2HWC1 3D4KA 1C28A 4B4RA 3ELNA 4QPGA 4I09A 1LOBA 4CTEA 1DQ5A 4HVRA 3VBRC 2DVAA 3ROUA 2R32A 1GYKA 4R9AA 4YM0A 4OI4A 5GJ6A 5AFEA 4PDWB 1OD5A 1HW5A 4RHV1 2WNUB 5LEKA 3POYA 4IV1B 1K5MA 2ZMLA 2JXAA 2D6PA 3BB6A 3AYDA 1FAYA 1JN2P 1J3RA 2XG3A 3KZ4C 3R4SA 3WD5A 3R6SA 4COYA 3JD71 4QPYA 4RFT0 1PZ9A 4OHYA 1NG0A 1OQEA 3ZN6A 1CN1A 2XJQA 3U0ZA 2HWB3 2DTWA 3OYWA 3P3PA 1RC6A 3WXPA 2HWB1 2PLV2 4PDWC 2I07B 1YLLA 4I0BA 1BEV1 1BYHA 3AMHA 1BEV3 1JYCA 2XUMA 4QPGB 3N4MA 5SV8A 4ITCA 3MF9A 1EAH2 4LA2A 1CPNA 1CJPA 4IERA 1J1TA 1BBT3 5KXBA 4OI2A 1QH7A 2WA4A 4QQLA 3BU7A 3M3CA 4PLNA 5BNPA 4Q4V2 1V00A 2WS93 4CEYA 2VQ0A 4N43B 1MZ6A 3M70A 4G4FA 1VBD1 3U11A 5IK5A 1YHFA 4LO5B 1TE1B 3MYXA 4RQPC 4M0NA 2JG9C 2PHTA 3RSJA 5JSOA 5CIRA 2AYHA 3LB9A 3M2MA 3E5UA 1XXNA 1U5XA 5DXDA 4TZDA 5DUXA 2VNOA 3FX3A 5FLIA 4A3XA 3S0MA 3WUCA 2R062 3SCHA 4RHV2 3ZMOA 3OJBA 2Y38A 3A0NA 3SLIA 4FPEA 1AL0G 1WLTA 2RMU2 2R0FA 3S30A 5AC93 1AUYA 3ZXFA 2VQAA 5AC91 4I0AA 1HRV2 1YUDA 2VOVA 3TWIA 3VBOC 4OUSA 1CAVB 4MXWA 2D6OX 3WQ7A 3JBG2 4N43A 2DFBA 3DL3A 4AGGA 2PHDA 4B8EA 3BTAA 3ZXDA 1QGLA 3NL1A 2WZPP 1EV12 5C4WA 2A75A 5A3MA 4L92A 2PAEA 3VBHA 3WG4A 3VKFC 1LGCA 4PLOA 4W6YA 5K7PA 3CO2A 3USUA 4K3UA 4NR1A 3J26N 3SNMA 1O5UA 4OFGA 3WDVA 3RMYA 4YW2A 4AQTA 4D94A 1Z0HA 1ZNPA 1S0CA 4SBVA 5FQ0B 4FAGA 1AZDA 2V09A 2UYAA 4AGVA 4Q4X1 2TBVA 3HT2A 3OD4A 5JR7B 4WZCA 2KA3A 1KFUL 5T5JA 2RM23 1HRI1 5J7MA 1N3OA 4QM9A 3KMHA 2D40A 3HMYA 2D98A 1JTZX 4N90A 5K0UB 1V6OA 2G9GA 3KGZA 1O4YA 1Q43A 2KM2A 1SLBA 1ZVFA 1SMVA 1G7YA 2GNDA 1UZYA 1ZZBA 4G9SB 3AJYA 2W52A 3U07A 1Y3TA 4K8FA 1S0EA 4QD2A 2ZJCA 1C1FA 4Z92B 1HXS2 1LOFC 3N3HA 4LUMA 1PNFA 2EA7A 2VUAA 1DLLA 3VKLA 3FE5A 5ABJA 1XE7A 2XJSA 4IEQA 1LU1A 3MIHA 1D0HA 1J3QA 3AKPA 3CNAA 4Y1XA 4FPLA 2ZA9A 1V6IA 4LO7A 1H2LA 5IK4A 1QF3A 1RUI3 1AX2A 3WW4A 4MXVA 4D3WA 1ZRDA 3ZXGA 1H2MA 1ZBA1 5T5PA 2ZGSA 1IQAA 4KG8A 2WT0A 4J6GA 3CLPA 2MHFA 5D8AC 1FATA 5DG1A 5E88A 4GH4A 1PGW2 3KCXA 4QPIB 4QM8A 1MEC1 1WMDA 4Z07A 4N7IA 5CFCC 2BYVE 2IXJA 1PVC3 3WW3A 5L36A 1ENQA 1PHMA 3B93A 1PIV3 4S2FA 1ZRCA 4LEJA 5EZWA 1CVNA 2PHLA 3NV3A 2DCTA 4QQPA 4XXPA 1I9RA 3H1YA 4OHWA 5C9AA 4K7JA 3AZWA 1D0GA 1RUNA 4R9CA 1NA1A 4O9EA 5JCTA 1UL9A 3ETQA 4IL7A 4CEYB 2WS92 2I74A 2VNRA 3WDXA 4AWDA 3KGLA 4CDUC 2QKDA 1EY2A 4WVVA 2NM1A 2ZGLA 4YW5A 4MGYE 2B45X 2FMDA 5GLVA 3ZDSA 3HR9A 5JOXA 2Q0AA 1SLTA 2XL7A 2B8MA 1ALYA 1SLIA 4ISRA 1GQGA 2E6VA 4YM2A 2HJIA 4XXAA 3WNXA 3PTYA 1CR7A 3FJSA 1ZZ7A 1W6QA 2B42B 2ZMKA 4AHYA 4TSVA 2VECA 2PA7A 3JD72 1RUE3 1RUC1 4GA9A 4E4ZA 4AFMA 1C8NA 1QOSA 3SCGA 1LGNA 2ZGQA 3MLKA 1AYM1 2QDNA 4PIXA 4GKXA 2DWRA 3WG1A 3QACA 2DUQA 4H7LA 3IPVB 4GMP1 4X6QB 2O8OA 2ZX4A 3VDDA 1UZZA 1IS4A 3WP6A 1O3RA 4W6WA 3B9CA 4AF9A 1EV13 4XFHA 5K0UA 3WHTA 1U5IA 4Q26A 5F6LB 1PVC2 2Y26A 1Z7S2 4WM8A 4C1XA 3ZN5A 3M3OA 1IS6A 1LESA 2ARBA 3DPRA 4FO9A 1H4HA 5A3LA 1DQ4A 3WT3A 4AE2A 5I0SA 4YVSB 1CJDA 2K0GA 4C1WA 3NV1A 3E6CC 4RQPA 4BLJA 4Y1UA 4B4PA 5KHKA 1DQ0A 1HKDA 4KGGA 2YROA 3RYKA 1PO12 4A7ZA 2R30A 3VDDB 4SLIA 1HX6A 2XJUA 4XETA 1N3QA 2X5IA 4K6BA 2KXLA 4QQOA 4IV3C 4N9HA 2RMU3 3MW3A 3VBFC 2RMU1 4Y4YA 4BZ4A 4JV4A 3PMSA 1POV1 3ZFGB 2A6ZA 4JVAA 3QBQA 4PIZA 4CDWA 4EJRA 2EVXA 1H1IA 1OFSA 4AYUA 4XFAA 1QH6A 4Q0VA 2A6WA 2C5DA 1T6GC 3JB8A 4XFGA 2WNUA 1DYKA 4YM1A 5KHGA 1TMF2 4Y5Z0 1OKQA 1O91A 1BQPA 1Q8PA 5FDBA 4MSVA 4AVTA 5K0UC 2RS53 1OHFA 3IM0A 5JI7A 3T1MA 4CDQC 1VBE1 2NN8A 3DF0A 3AMPA 4IEUA 1C8M1 1YFYA 4PCRA 2UWBA 4XTPA 4XF3A 1VBC3 2QVSB 1QU0A 3AKTA 1C4RA 4MZUA 3KLSA 1H2KA 4DZGA 1N1VA 2B46X 3POWA 1DZTA 1W6PB 5FREA 3O7OA 4D7YA 3EXUA 3APBA 5CG8A 1W0OA 4Y1YA 2P34A 2YPJA 1RHI1 3O12A 4WVZA 3VZKA 1UIJA 3WDYA 1F31A 2GC2A 3ZYPA 1RMU1 4XFBA 1JUHA 2BWAA 1RMU3 5L7OB 5C8WA 3URFA 3DV8A 3VBFA 1MQTA 3MPPG 3SITA 1SLCA 5A33B 4GWNA 1E57A 3VN4A 1DZQA 2OYZA 3HBZA 3CF6E 1PMIA 2ZGKA 4OHZA 4FPHA 4M3CE 2YXSA 4AEDA 1BMV2 3TNQA 4QMAA 5E16A 4W65A 2QJVA 4OZXA 1QJX2 2ZTNA 4LNVA 4FAHA 3L2YA 1O3TA 1A6CA 2HWF3 3TN91 4XDQA 2DCJA 3NO8A 4X8NA 3AJZA 2BW8A 1BBT1 3VZOA 3ZFFC 2R1DA