3PP2A

Crystal structure of the pleckstrin homology domain of arhgap27
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
112
Chain Sequence
b'DKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 27
publication title Crystal structure of the pleckstrin homology domain of ArhGAP27
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 32
structure length 112
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3pp2A00
2ELAA 2D4QA 2OQBA 1V89A 1X1GA 3CIKA 4DXAB 1PLSA 2KCJA 2RVBB 1P3RA 1GG3A 3DXCA 3PP2A 4CYEA 1WJMA 1BWNA 3OANA 2D9VA 5D3WA 3FSSA 4HAUB 4KHOA 2DX1A 3SNHA 1UNQA 4L6EA 1V61A 1Q67A 1K5DB 5HE0A 4ZRIA 4MY6A 5EFXA 5D3YA 3M1IB 1WI1A 4WVFB 1DDVA 4HB3B 5D3XA 1W1HA 2DTCA 3PZDA 1V5UA 5L81A 1MK7B 1Z87A 1P5TA 1W1DA 4HAXB 2H7DA 2MWNB 5HE2A 4K2OA 2AEHA 1Y19B 2COFA 1MKEA 1DDWA 2N23A 2LOZA 3BINA 1IRSA 1NU2A 4K2PA 2DHIA 3A8QA 2J59M 1KZGA 2ZPYA 2K00A 3F0WA 1XCGA 2MDXA 3F5RA 1DBHA 2J0JA 5DH9B 1ZSQA 1NI2A 1SHCA 2YS5A 4NY0A 4HB0B 4WJ7A 5DHAB 4DX90 1WG7A 3A98B 1X86A 3DXDA 3X23A 2R09A 2RSGA 4DBBA 5LOPB 1V5PA 3HW2B 1UNPA 4YONA 4CHMA 3QWMA 4EMOA 3MDBC 1FAOA 1XX0A 2I5FA 2EMTA 2OTXA 3ODWA 1B55A 3LJUX 2UZRA 2KGXB 5DI9B 2CY5A 1UPQA 1XKEA 2LULA 3T06A 5DHFB 4WSFA 2MFQA 2YT0A 3ZDTA 3KSYA 5JP4A 4C0AA 1TJ6A 2P0HA 2VSZA 3MPXA 2GCJA 4KVGB 1MIXA 1U5DA 3KRXA 5J3YA 2ELBA 3PSCA 2Y8FA 3PVWA 2BCJA 1OQNA 1EGXA 3O96A 4A6FA 1I7AA 3GYOA 5JLJB 1FOEA 3HK0A 3SO6A 3SUZA 2VRWB 4HB2B 2D9ZA 2Y7BA 2CY4A 3P7ZA 4BBKA 1LB1A 1U5FA 2YRYA 1EAZA 3PEGA 4HAZB 3N7CA 5LONB 2M38A 3U8ZA 1MPHA 2R0DA 1WVHA 3RCPA 2QKMA 2K2UA 4ZRJA 3TO1A 5J3QA 4EKUA 2D9XA 2KUPA 2CAYA 2LKOA 1K5GB 4KHAA 5JHGA 5DIFB 3G9WA 4PQ0A 4IAPA 5KCVA 4K17A 2D11A 1MK9B 1FB8A 2D9WA 2N0YA 2P0FA 3V5WA 4YL8A 3P6AA 1NTYA 4CHJA 3TVVA 4TKNA 1UNRA 1W1GA 5C5BB 2IFSA 1FGYA 3KRWA 3VIAA 4NSWA 4HAWB 1PFJA 1I2HA 2EJ8A 2DLWA 2DX5A 5C6RA 1U5EA 4HDOA 4F7GA 1XODA 1OMWA 1ZM0A 2M14A 2JP2A 3SV1A 3WYFB 2DHJA 2LYDA 4PNKA 3CXBB 1TQZA 2COCA 1X11A 3TFMA 1BAKA 2YVCA 3AJ4A 1H4RA 1ZVRA 2Q13A 2YS1A 2YS3A 3QIJA 3U7DA 2HTHB 2CODA 2DYQA 4GMXB 1PMSA 2IYBA 1XD4A 3A8PA 4P7IA 5KQ4A 1NTVA 4DX8A 1U2BA 4B6HA 2HE7A 4MK0A 3BJIA 4Z2MB 2I5CA 1EF1A 1V88A 4EJNA 2RGNB 2GS0A 3FM8C 2D9YA 4GN1A 4F7UP 1ZC3B 2COAA 2LOXA 4H8SA 3PVLA 1J0WA 4GZUA 1DROA 2EC1A 1MAIA 2D10A 2GJYA 2DKQA 3SYXA 5HE1A 1M7RA 2DKPA 2GCLA 5KQ1A 4HATB 1E5WA 1U5GA 2J0MA 2RNRB 4D0NB 1TXDA 3UZTA 1KI1B 4HAYB 3AU5A 3ZVRA 2UVMA 3TCAA 4GMVA 1QC6A 3QBVB 5GOWB 5C79A 1BTNA 1SGHA 2W2XD 2NZ8B 2XQNM 1M7EA 3D8FA 2DA0A 2H7EA 2RLOA 1GC7A 1BTKA 2DN6A 1FGZA 3PVUA 3ULBA 1X1FA 4IOYX 1H10A 5C16A 2YT1A 4GXBA 1AQCA 1FHOA 2DYNA 4KHBB 2YF0A 3PG7A 5FI1A 2NMBA 1LW3A 4HDQA 1XR0B 1DYNA 3ODOA 2Z0OA 4IFSA 2EMSA 2L2IA 1UEFA 2UZSA 2DFKA 1Y5OA 1MIZB 3WA0A 3ML4A 2K2JA 1U27A 1AWEA 2ROVA 2AL6A 4Y94A 4A6FB 1FHXA 2Z0QA 3NSUA 2FJLA 3ULCA 2LG1A 2ROZB 5D3VA 4A6KA 1DDMA 1RRPB 3D8DA 2I1JA 3KY9A 3ODXA 2E2XA 2G35A 2P0DA 2D2QA 4HB4B 2Z0PA 1WGQA 1P6SA 2YSZA 1WGUA 2J0KA 3AU4A 2MKRA 3KZ1A 1OY2A 4A6HA 5CLLB 1N3HA 1UPRA 4K81A 4TYZA 2RUKB 2QKLA 2CRFA 5JHHA 1GC6A 1ZC4B 2W2XC 1V5MA 1U29A 2I1KA 1FHWA 5FI0A 3GYPA 2V76A 4A5KA 5CLQB 3FEHA 2ADZA 3VOQA 4GPTB 5HE3A 1WJ1A 4KAXB 1RJ2A 4XWXA 5D27A 5C5BA 2DHKA 3DXEA 2PZ1A 1KZ7A 1EVHA 4Z2NA 1J19A 2P8VA 4HHVA 4MT7A 2Y8GA 3D8EA 3HQCA 2L1CA 4F7HA 1QQGA 2X18A 5J3TA 2W2WA 2VKIA 4HAVB 3TW1A 4ZRKA 1X05A 1ISNA 3IVFA
chains in the Genus database with same CATH superfamily
2ELAA 2D4QA 2OQBA 1V89A 1X1GA 3CIKA 4DXAB 1PLSA 2KCJA 2RVBB 1P3RA 1GG3A 3DXCA 3PP2A 4CYEA 1WJMA 1BWNA 2NBVA 3OANA 2D9VA 5D3WA 3FSSA 4HAUB 4KHOA 2DX1A 3SNHA 1UNQA 4L6EA 1V61A 1Q67A 1K5DB 5HE0A 4ZRIA 2K49A 4MY6A 5EFXA 5D3YA 3M1IB 1WI1A 4WVFB 1DDVA 4HB3B 5D3XA 1W1HA 2DTCA 3PZDA 1V5UA 3DCXA 5L81A 1MK7B 2KIGA 1Z87A 1P5TA 1W1DA 4HAXB 2H7DA 2MWNB 5HE2A 4K2OA 2AEHA 1Y19B 2COFA 1MKEA 1DDWA 2N23A 4D6WA 2LOZA 3BINA 1IRSA 1NU2A 5I2SA 2KR0A 4K2PA 2DHIA 3B77A 3A8QA 4GNKB 2J59M 1KZGA 2ZPYA 2K00A 3F0WA 1XCGA 2MDXA 3F5RA 1DBHA 2J0JA 5DH9B 1ZSQA 1NI2A 3HIEA 1SHCA 2YS5A 4NY0A 4HB0B 4WJ7A 5DHAB 4DX90 1WG7A 3A98B 1X86A 3DXDA 3X23A 2R09A 2RSGA 4OSNA 4DBBA 5LOPB 1V5PA 2KIEA 3HW2B 4KHBA 1UNPA 4YONA 4CHMA 3A58A 3QWMA 4EMOA 3MDBC 1FAOA 1XX0A 2I5FA 2EMTA 2OTXA 3ODWA 1B55A 3LJUX 2UZRA 2KGXB 5DI9B 2CY5A 4GOUA 1UPQA 1XKEA 2LULA 3T06A 5DHFB 4WSFA 2MFQA 2YT0A 3ZDTA 3KSYA 5JP4A 4C0AA 1TJ6A 2P0HA 2VSZA 3MPXA 2GCJA 4KVGB 1MIXA 1U5DA 3KRXA 5J3YA 2ELBA 3PSCA 2Y8FA 3PVWA 2BCJA 1OQNA 1EGXA 3O96A 4A6FA 1I7AA 3GYOA 5JLJB 1FOEA 3HK0A 3SO6A 3SUZA 2VRWB 4HB2B 2D9ZA 2Y7BA 2CY4A 2Z14A 3P7ZA 4BBKA 1LB1A 4QJ3B 1U5FA 2YRYA 1EAZA 3PEGA 4HAZB 3N7CA 5LONB 2M38A 3U8ZA 1MPHA 2R0DA 1WVHA 3RCPA 2QKMA 2K2UA 4ZRJA 3TO1A 5J3QA 4EKUA 2D9XA 2KUPA 2CAYA 2LKOA 1K5GB 4KHAA 5JHGA 5DIFB 3G9WA 4PQ0A 4IAPA 5KCVA 4K17A 2D11A 1MK9B 1FB8A 2D9WA 2N0YA 3FVCA 2P0FA 3V5WA 4YL8A 3P6AA 1NTYA 4CHJA 3TVVA 4TKNA 1UNRA 1W1GA 5C5BB 2IFSA 1FGYA 3KRWA 5LG4B 2KUQA 3VIAA 4NSWA 4HAWB 1PFJA 1I2HA 3NWFA 2EJ8A 2DLWA 2DX5A 5I2MA 5C6RA 1U5EA 4HDOA 2Z4DA 4F7GA 1XODA 1OMWA 1ZM0A 2M14A 2JP2A 3SV1A 3WYFB 2DHJA 2LYDA 4PNKA 3CXBB 1TQZA 2COCA 1ZYIA 1X11A 3TFMA 2RRFA 1BAKA 2YVCA 3AJ4A 1H4RA 1ZVRA 2Q13A 2YS1A 2YS3A 3QIJA 3U7DA 2HTHB 2CODA 2DYQA 2ZKMX 4GMXB 1PMSA 2IYBA 1XD4A 3A8PA 4P7IA 5KQ4A 1NTVA 4DX8A 1U2BA 4B6HA 2HE7A 4MK0A 3BJIA 4Z2MB 2I5CA 1EF1A 1T77A 1V88A 4QXAB 4EJNA 2RGNB 2GS0A 3FM8C 2D9YA 4L1RA 4GN1A 4F7UP 1ZC3B 2COAA 2LOXA 4H8SA 3PVLA 1J0WA 4GZUA 1DROA 2EC1A 1MAIA 2D10A 2GJYA 2Z13A 2DKQA 3SYXA 5HE1A 1M7RA 2DKPA 2GCLA 5KQ1A 4HATB 1E5WA 1U5GA 5M4YB 1MI1A 2J0MA 2RNRB 4D0NB 1TXDA 3UZTA 1KI1B 4HAYB 3AU5A 3ZVRA 2UVMA 3TCAA 4GMVA 1QC6A 3QBVB 5GOWB 5C79A 1BTNA 1SGHA 2W2XD 2NZ8B 2XQNM 1M7EA 3D8FA 2DA0A 2H7EA 2RLOA 1GC7A 1BTKA 2DN6A 1FGZA 3PVUA 3ULBA 2FJUB 1X1FA 4IOYX 1H10A 5C16A 2YT1A 2YT2A 5IRSA 4GXBA 2GUMA 1AQCA 1FHOA 2DYNA 4KHBB 2YF0A 3PG7A 5FI1A 2NMBA 2Z59A 1LW3A 4HDQA 1XR0B 1DYNA 3ODOA 2Z0OA 4IFSA 2EMSA 2L2IA 1UEFA 2UZSA 3HSAA 2DFKA 1Y5OA 1MIZB 3WA0A 3ML4A 2K2JA 1U27A 1AWEA 2ROVA 2AL6A 4Y94A 4A6FB 1FHXA 3NWAA 2Z0QA 3OHMB 3NSUA 2FJLA 3ULCA 2LG1A 2ROZB 5D3VA 4A6KA 1DDMA 1RRPB 3D8DA 2I1JA 3KY9A 3ODXA 2E2XA 2G35A 2P0DA 2D2QA 4OT1A 4HB4B 2Z0PA 4DIXA 1WGQA 1P6SA 2YSZA 1WGUA 4CSQA 2J0KA 3AU4A 2MKRA 3KZ1A 1OY2A 4A6HA 5CLLB 1N3HA 1UPRA 4K81A 3NW8A 4TYZA 3U12A 2RUKB 2QKLA 2CRFA 5JHHA 1GC6A 1ZC4B 2W2XC 1V5MA 3NWDA 4QJ5B 1U29A 2I1KA 1FHWA 5FI0A 3GYPA 2V76A 4A5KA 5CLQB 3FEHA 4QJ4B 2ADZA 3VOQA 4GPTB 5HE3A 1WJ1A 4KAXB 1RJ2A 4XWXA 2K8EA 5D27A 5C5BA 2DHKA 3DXEA 2PZ1A 1KZ7A 1EVHA 4Z2NA 1J19A 2P8VA 4HHVA 4MT7A 2Y8GA 3D8EA 3HQCA 2L1CA 4F7HA 1QQGA 2X18A 5J3TA 4HSIA 2W2WA 2R2YA 2VKIA 4HAVB 3TW1A 4ZRKA 1X05A 1ISNA 3IVFA
chains in the Genus database with same CATH topology
2ELAA 2D4QA 2OQBA 1V89A 1X1GA 3CIKA 4DXAB 1PLSA 2KCJA 2RVBB 1P3RA 1GG3A 3DXCA 3PP2A 4CYEA 1WJMA 1BWNA 3OANA 2D9VA 5D3WA 3FSSA 4HAUB 4KHOA 2DX1A 3SNHA 1UNQA 4L6EA 1V61A 1Q67A 1K5DB 5HE0A 4ZRIA 4MY6A 5EFXA 5D3YA 3M1IB 1WI1A 4WVFB 1DDVA 4HB3B 5D3XA 1W1HA 2DTCA 3PZDA 1V5UA 5L81A 1MK7B 1Z87A 1P5TA 1W1DA 4HAXB 2H7DA 2MWNB 5HE2A 4K2OA 2AEHA 1Y19B 2COFA 1MKEA 1DDWA 2N23A 2LOZA 3BINA 1IRSA 1NU2A 4K2PA 2DHIA 3A8QA 2J59M 1KZGA 2ZPYA 2K00A 3F0WA 1XCGA 2MDXA 3F5RA 1DBHA 2J0JA 5DH9B 1ZSQA 1NI2A 1SHCA 2YS5A 4NY0A 4HB0B 4WJ7A 5DHAB 4DX90 1WG7A 3A98B 1X86A 3DXDA 3X23A 2R09A 2RSGA 4DBBA 5LOPB 1V5PA 3HW2B 1UNPA 4YONA 4CHMA 3QWMA 4EMOA 3MDBC 1FAOA 1XX0A 2I5FA 2EMTA 2OTXA 3ODWA 1B55A 3LJUX 2UZRA 2KGXB 5DI9B 2CY5A 1UPQA 1XKEA 2LULA 3T06A 5DHFB 4WSFA 2MFQA 2YT0A 3ZDTA 3KSYA 5JP4A 4C0AA 1TJ6A 2P0HA 2VSZA 3MPXA 2GCJA 4KVGB 1MIXA 1U5DA 3KRXA 5J3YA 2ELBA 3PSCA 2Y8FA 3PVWA 2BCJA 1OQNA 1EGXA 3O96A 4A6FA 1I7AA 3GYOA 5JLJB 1FOEA 3HK0A 3SO6A 3SUZA 2VRWB 4HB2B 2D9ZA 2Y7BA 2CY4A 3P7ZA 4BBKA 1LB1A 1U5FA 2YRYA 1EAZA 3PEGA 4HAZB 3N7CA 5LONB 2M38A 3U8ZA 1MPHA 2R0DA 1WVHA 3RCPA 2QKMA 2K2UA 4ZRJA 3TO1A 5J3QA 4EKUA 2D9XA 2KUPA 2CAYA 2LKOA 1K5GB 4KHAA 5JHGA 5DIFB 3G9WA 4PQ0A 4IAPA 5KCVA 4K17A 2D11A 1MK9B 1FB8A 2D9WA 2N0YA 2P0FA 3V5WA 4YL8A 3P6AA 1NTYA 4CHJA 3TVVA 4TKNA 1UNRA 1W1GA 5C5BB 2IFSA 1FGYA 3KRWA 3VIAA 4NSWA 4HAWB 1PFJA 1I2HA 2EJ8A 2DLWA 2DX5A 5C6RA 1U5EA 4HDOA 4F7GA 1XODA 1OMWA 1ZM0A 2M14A 2JP2A 3SV1A 3WYFB 2DHJA 2LYDA 4PNKA 3CXBB 1TQZA 2COCA 1X11A 3TFMA 1BAKA 2YVCA 3AJ4A 1H4RA 1ZVRA 2Q13A 2YS1A 2YS3A 3QIJA 3U7DA 2HTHB 2CODA 2DYQA 4GMXB 1PMSA 2IYBA 1XD4A 3A8PA 4P7IA 5KQ4A 1NTVA 4DX8A 1U2BA 4B6HA 2HE7A 4MK0A 3BJIA 4Z2MB 2I5CA 1EF1A 1V88A 4EJNA 2RGNB 2GS0A 3FM8C 2D9YA 4GN1A 4F7UP 1ZC3B 2COAA 2LOXA 4H8SA 3PVLA 1J0WA 4GZUA 1DROA 2EC1A 1MAIA 2D10A 2GJYA 2DKQA 3SYXA 5HE1A 1M7RA 2DKPA 2GCLA 5KQ1A 4HATB 1E5WA 1U5GA 2J0MA 2RNRB 4D0NB 1TXDA 3UZTA 1KI1B 4HAYB 3AU5A 3ZVRA 2UVMA 3TCAA 4GMVA 1QC6A 3QBVB 5GOWB 5C79A 1BTNA 1SGHA 2W2XD 2NZ8B 2XQNM 1M7EA 3D8FA 2DA0A 2H7EA 2RLOA 1GC7A 1BTKA 2DN6A 1FGZA 3PVUA 3ULBA 1X1FA 4IOYX 1H10A 5C16A 2YT1A 4GXBA 1AQCA 1FHOA 2DYNA 4KHBB 2YF0A 3PG7A 5FI1A 2NMBA 1LW3A 4HDQA 1XR0B 1DYNA 3ODOA 2Z0OA 4IFSA 2EMSA 2L2IA 1UEFA 2UZSA 2DFKA 1Y5OA 1MIZB 3WA0A 3ML4A 2K2JA 1U27A 1AWEA 2ROVA 2AL6A 4Y94A 4A6FB 1FHXA 2Z0QA 3NSUA 2FJLA 3ULCA 2LG1A 2ROZB 5D3VA 4A6KA 1DDMA 1RRPB 3D8DA 2I1JA 3KY9A 3ODXA 2E2XA 2G35A 2P0DA 2D2QA 4HB4B 2Z0PA 1WGQA 1P6SA 2YSZA 1WGUA 2J0KA 3AU4A 2MKRA 3KZ1A 1OY2A 4A6HA 5CLLB 1N3HA 1UPRA 4K81A 4TYZA 2RUKB 2QKLA 2CRFA 5JHHA 1GC6A 1ZC4B 2W2XC 1V5MA 1U29A 2I1KA 1FHWA 5FI0A 3GYPA 2V76A 4A5KA 5CLQB 3FEHA 2ADZA 3VOQA 4GPTB 5HE3A 1WJ1A 4KAXB 1RJ2A 4XWXA 5D27A 5C5BA 2DHKA 3DXEA 2PZ1A 1KZ7A 1EVHA 4Z2NA 1J19A 2P8VA 4HHVA 4MT7A 2Y8GA 3D8EA 3HQCA 2L1CA 4F7HA 1QQGA 2X18A 5J3TA 2W2WA 2VKIA 4HAVB 3TW1A 4ZRKA 1X05A 1ISNA 3IVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELA A;  2D4Q A;  2OQB A;  1V89 A;  1X1G A;  3CIK A;  4DXA B;  1PLS A;  2KCJ A;  2RVB B;  1P3R A;  1GG3 A;  3DXC A;  3PP2 A;  4CYE A;  1WJM A;  1BWN A;  3OAN A;  2D9V A;  5D3W A;  3FSS A;  4HAU B;  4KHO A;  2DX1 A;  3SNH A;  1UNQ A;  4L6E A;  1V61 A;  1Q67 A;  1K5D B;  5HE0 A;  4ZRI A;  4MY6 A;  5EFX A;  5D3Y A;  3M1I B;  1WI1 A;  4WVF B;  1DDV A;  4HB3 B;  5D3X A;  1W1H A;  2DTC A;  3PZD A;  1V5U A;  5L81 A;  1MK7 B;  1Z87 A;  1P5T A;  1W1D A;  4HAX B;  2H7D A;  2MWN B;  5HE2 A;  4K2O A;  2AEH A;  1Y19 B;  2COF A;  1MKE A;  1DDW A;  2N23 A;  2LOZ A;  3BIN A;  1IRS A;  1NU2 A;  4K2P A;  2DHI A;  3A8Q A;  2J59 M;  1KZG A;  2ZPY A;  2K00 A;  3F0W A;  1XCG A;  2MDX A;  3F5R A;  1DBH A;  2J0J A;  5DH9 B;  1ZSQ A;  1NI2 A;  1SHC A;  2YS5 A;  4NY0 A;  4HB0 B;  4WJ7 A;  5DHA B;  4DX9 0;  1WG7 A;  3A98 B;  1X86 A;  3DXD A;  3X23 A;  2R09 A;  2RSG A;  4DBB A;  5LOP B;  1V5P A;  3HW2 B;  1UNP A;  4YON A;  4CHM A;  3QWM A;  4EMO A;  3MDB C;  1FAO A;  1XX0 A;  2I5F A;  2EMT A;  2OTX A;  3ODW A;  1B55 A;  3LJU X;  2UZR A;  2KGX B;  5DI9 B;  2CY5 A;  1UPQ A;  1XKE A;  2LUL A;  3T06 A;  5DHF B;  4WSF A;  2MFQ A;  2YT0 A;  3ZDT A;  3KSY A;  5JP4 A;  4C0A A;  1TJ6 A;  2P0H A;  2VSZ A;  3MPX A;  2GCJ A;  4KVG B;  1MIX A;  1U5D A;  3KRX A;  5J3Y A;  2ELB A;  3PSC A;  2Y8F A;  3PVW A;  2BCJ A;  1OQN A;  1EGX A;  3O96 A;  4A6F A;  1I7A A;  3GYO A;  5JLJ B;  1FOE A;  3HK0 A;  3SO6 A;  3SUZ A;  2VRW B;  4HB2 B;  2D9Z A;  2Y7B A;  2CY4 A;  3P7Z A;  4BBK A;  1LB1 A;  1U5F A;  2YRY A;  1EAZ A;  3PEG A;  4HAZ B;  3N7C A;  5LON B;  2M38 A;  3U8Z A;  1MPH A;  2R0D A;  1WVH A;  3RCP A;  2QKM A;  2K2U A;  4ZRJ A;  3TO1 A;  5J3Q A;  4EKU A;  2D9X A;  2KUP A;  2CAY A;  2LKO A;  1K5G B;  4KHA A;  5JHG A;  5DIF B;  3G9W A;  4PQ0 A;  4IAP A;  5KCV A;  4K17 A;  2D11 A;  1MK9 B;  1FB8 A;  2D9W A;  2N0Y A;  2P0F A;  3V5W A;  4YL8 A;  3P6A A;  1NTY A;  4CHJ A;  3TVV A;  4TKN A;  1UNR A;  1W1G A;  5C5B B;  2IFS A;  1FGY A;  3KRW A;  3VIA A;  4NSW A;  4HAW B;  1PFJ A;  1I2H A;  2EJ8 A;  2DLW A;  2DX5 A;  5C6R A;  1U5E A;  4HDO A;  4F7G A;  1XOD A;  1OMW A;  1ZM0 A;  2M14 A;  2JP2 A;  3SV1 A;  3WYF B;  2DHJ A;  2LYD A;  4PNK A;  3CXB B;  1TQZ A;  2COC A;  1X11 A;  3TFM A;  1BAK A;  2YVC A;  3AJ4 A;  1H4R A;  1ZVR A;  2Q13 A;  2YS1 A;  2YS3 A;  3QIJ A;  3U7D A;  2HTH B;  2COD A;  2DYQ A;  4GMX B;  1PMS A;  2IYB A;  1XD4 A;  3A8P A;  4P7I A;  5KQ4 A;  1NTV A;  4DX8 A;  1U2B A;  4B6H A;  2HE7 A;  4MK0 A;  3BJI A;  4Z2M B;  2I5C A;  1EF1 A;  1V88 A;  4EJN A;  2RGN B;  2GS0 A;  3FM8 C;  2D9Y A;  4GN1 A;  4F7U P;  1ZC3 B;  2COA A;  2LOX A;  4H8S A;  3PVL A;  1J0W A;  4GZU A;  1DRO A;  2EC1 A;  1MAI A;  2D10 A;  2GJY A;  2DKQ A;  3SYX A;  5HE1 A;  1M7R A;  2DKP A;  2GCL A;  5KQ1 A;  4HAT B;  1E5W A;  1U5G A;  2J0M A;  2RNR B;  4D0N B;  1TXD A;  3UZT A;  1KI1 B;  4HAY B;  3AU5 A;  3ZVR A;  2UVM A;  3TCA A;  4GMV A;  1QC6 A;  3QBV B;  5GOW B;  5C79 A;  1BTN A;  1SGH A;  2W2X D;  2NZ8 B;  2XQN M;  1M7E A;  3D8F A;  2DA0 A;  2H7E A;  2RLO A;  1GC7 A;  1BTK A;  2DN6 A;  1FGZ A;  3PVU A;  3ULB A;  1X1F A;  4IOY X;  1H10 A;  5C16 A;  2YT1 A;  4GXB A;  1AQC A;  1FHO A;  2DYN A;  4KHB B;  2YF0 A;  3PG7 A;  5FI1 A;  2NMB A;  1LW3 A;  4HDQ A;  1XR0 B;  1DYN A;  3ODO A;  2Z0O A;  4IFS A;  2EMS A;  2L2I A;  1UEF A;  2UZS A;  2DFK A;  1Y5O A;  1MIZ B;  3WA0 A;  3ML4 A;  2K2J A;  1U27 A;  1AWE A;  2ROV A;  2AL6 A;  4Y94 A;  4A6F B;  1FHX A;  2Z0Q A;  3NSU A;  2FJL A;  3ULC A;  2LG1 A;  2ROZ B;  5D3V A;  4A6K A;  1DDM A;  1RRP B;  3D8D A;  2I1J A;  3KY9 A;  3ODX A;  2E2X A;  2G35 A;  2P0D A;  2D2Q A;  4HB4 B;  2Z0P A;  1WGQ A;  1P6S A;  2YSZ A;  1WGU A;  2J0K A;  3AU4 A;  2MKR A;  3KZ1 A;  1OY2 A;  4A6H A;  5CLL B;  1N3H A;  1UPR A;  4K81 A;  4TYZ A;  2RUK B;  2QKL A;  2CRF A;  5JHH A;  1GC6 A;  1ZC4 B;  2W2X C;  1V5M A;  1U29 A;  2I1K A;  1FHW A;  5FI0 A;  3GYP A;  2V76 A;  4A5K A;  5CLQ B;  3FEH A;  2ADZ A;  3VOQ A;  4GPT B;  5HE3 A;  1WJ1 A;  4KAX B;  1RJ2 A;  4XWX A;  5D27 A;  5C5B A;  2DHK A;  3DXE A;  2PZ1 A;  1KZ7 A;  1EVH A;  4Z2N A;  1J19 A;  2P8V A;  4HHV A;  4MT7 A;  2Y8G A;  3D8E A;  3HQC A;  2L1C A;  4F7H A;  1QQG A;  2X18 A;  5J3T A;  2W2W A;  2VKI A;  4HAV B;  3TW1 A;  4ZRK A;  1X05 A;  1ISN A;  3IVF A; 
#chains in the Genus database with same CATH topology
 2ELA A;  2D4Q A;  2OQB A;  1V89 A;  1X1G A;  3CIK A;  4DXA B;  1PLS A;  2KCJ A;  2RVB B;  1P3R A;  1GG3 A;  3DXC A;  3PP2 A;  4CYE A;  1WJM A;  1BWN A;  2NBV A;  3OAN A;  2D9V A;  5D3W A;  3FSS A;  4HAU B;  4KHO A;  2DX1 A;  3SNH A;  1UNQ A;  4L6E A;  1V61 A;  1Q67 A;  1K5D B;  5HE0 A;  4ZRI A;  2K49 A;  4MY6 A;  5EFX A;  5D3Y A;  3M1I B;  1WI1 A;  4WVF B;  1DDV A;  4HB3 B;  5D3X A;  1W1H A;  2DTC A;  3PZD A;  1V5U A;  3DCX A;  5L81 A;  1MK7 B;  2KIG A;  1Z87 A;  1P5T A;  1W1D A;  4HAX B;  2H7D A;  2MWN B;  5HE2 A;  4K2O A;  2AEH A;  1Y19 B;  2COF A;  1MKE A;  1DDW A;  2N23 A;  4D6W A;  2LOZ A;  3BIN A;  1IRS A;  1NU2 A;  5I2S A;  2KR0 A;  4K2P A;  2DHI A;  3B77 A;  3A8Q A;  4GNK B;  2J59 M;  1KZG A;  2ZPY A;  2K00 A;  3F0W A;  1XCG A;  2MDX A;  3F5R A;  1DBH A;  2J0J A;  5DH9 B;  1ZSQ A;  1NI2 A;  3HIE A;  1SHC A;  2YS5 A;  4NY0 A;  4HB0 B;  4WJ7 A;  5DHA B;  4DX9 0;  1WG7 A;  3A98 B;  1X86 A;  3DXD A;  3X23 A;  2R09 A;  2RSG A;  4OSN A;  4DBB A;  5LOP B;  1V5P A;  2KIE A;  3HW2 B;  4KHB A;  1UNP A;  4YON A;  4CHM A;  3A58 A;  3QWM A;  4EMO A;  3MDB C;  1FAO A;  1XX0 A;  2I5F A;  2EMT A;  2OTX A;  3ODW A;  1B55 A;  3LJU X;  2UZR A;  2KGX B;  5DI9 B;  2CY5 A;  4GOU A;  1UPQ A;  1XKE A;  2LUL A;  3T06 A;  5DHF B;  4WSF A;  2MFQ A;  2YT0 A;  3ZDT A;  3KSY A;  5JP4 A;  4C0A A;  1TJ6 A;  2P0H A;  2VSZ A;  3MPX A;  2GCJ A;  4KVG B;  1MIX A;  1U5D A;  3KRX A;  5J3Y A;  2ELB A;  3PSC A;  2Y8F A;  3PVW A;  2BCJ A;  1OQN A;  1EGX A;  3O96 A;  4A6F A;  1I7A A;  3GYO A;  5JLJ B;  1FOE A;  3HK0 A;  3SO6 A;  3SUZ A;  2VRW B;  4HB2 B;  2D9Z A;  2Y7B A;  2CY4 A;  2Z14 A;  3P7Z A;  4BBK A;  1LB1 A;  4QJ3 B;  1U5F A;  2YRY A;  1EAZ A;  3PEG A;  4HAZ B;  3N7C A;  5LON B;  2M38 A;  3U8Z A;  1MPH A;  2R0D A;  1WVH A;  3RCP A;  2QKM A;  2K2U A;  4ZRJ A;  3TO1 A;  5J3Q A;  4EKU A;  2D9X A;  2KUP A;  2CAY A;  2LKO A;  1K5G B;  4KHA A;  5JHG A;  5DIF B;  3G9W A;  4PQ0 A;  4IAP A;  5KCV A;  4K17 A;  2D11 A;  1MK9 B;  1FB8 A;  2D9W A;  2N0Y A;  3FVC A;  2P0F A;  3V5W A;  4YL8 A;  3P6A A;  1NTY A;  4CHJ A;  3TVV A;  4TKN A;  1UNR A;  1W1G A;  5C5B B;  2IFS A;  1FGY A;  3KRW A;  5LG4 B;  2KUQ A;  3VIA A;  4NSW A;  4HAW B;  1PFJ A;  1I2H A;  3NWF A;  2EJ8 A;  2DLW A;  2DX5 A;  5I2M A;  5C6R A;  1U5E A;  4HDO A;  2Z4D A;  4F7G A;  1XOD A;  1OMW A;  1ZM0 A;  2M14 A;  2JP2 A;  3SV1 A;  3WYF B;  2DHJ A;  2LYD A;  4PNK A;  3CXB B;  1TQZ A;  2COC A;  1ZYI A;  1X11 A;  3TFM A;  2RRF A;  1BAK A;  2YVC A;  3AJ4 A;  1H4R A;  1ZVR A;  2Q13 A;  2YS1 A;  2YS3 A;  3QIJ A;  3U7D A;  2HTH B;  2COD A;  2DYQ A;  2ZKM X;  4GMX B;  1PMS A;  2IYB A;  1XD4 A;  3A8P A;  4P7I A;  5KQ4 A;  1NTV A;  4DX8 A;  1U2B A;  4B6H A;  2HE7 A;  4MK0 A;  3BJI A;  4Z2M B;  2I5C A;  1EF1 A;  1T77 A;  1V88 A;  4QXA B;  4EJN A;  2RGN B;  2GS0 A;  3FM8 C;  2D9Y A;  4L1R A;  4GN1 A;  4F7U P;  1ZC3 B;  2COA A;  2LOX A;  4H8S A;  3PVL A;  1J0W A;  4GZU A;  1DRO A;  2EC1 A;  1MAI A;  2D10 A;  2GJY A;  2Z13 A;  2DKQ A;  3SYX A;  5HE1 A;  1M7R A;  2DKP A;  2GCL A;  5KQ1 A;  4HAT B;  1E5W A;  1U5G A;  5M4Y B;  1MI1 A;  2J0M A;  2RNR B;  4D0N B;  1TXD A;  3UZT A;  1KI1 B;  4HAY B;  3AU5 A;  3ZVR A;  2UVM A;  3TCA A;  4GMV A;  1QC6 A;  3QBV B;  5GOW B;  5C79 A;  1BTN A;  1SGH A;  2W2X D;  2NZ8 B;  2XQN M;  1M7E A;  3D8F A;  2DA0 A;  2H7E A;  2RLO A;  1GC7 A;  1BTK A;  2DN6 A;  1FGZ A;  3PVU A;  3ULB A;  2FJU B;  1X1F A;  4IOY X;  1H10 A;  5C16 A;  2YT1 A;  2YT2 A;  5IRS A;  4GXB A;  2GUM A;  1AQC A;  1FHO A;  2DYN A;  4KHB B;  2YF0 A;  3PG7 A;  5FI1 A;  2NMB A;  2Z59 A;  1LW3 A;  4HDQ A;  1XR0 B;  1DYN A;  3ODO A;  2Z0O A;  4IFS A;  2EMS A;  2L2I A;  1UEF A;  2UZS A;  3HSA A;  2DFK A;  1Y5O A;  1MIZ B;  3WA0 A;  3ML4 A;  2K2J A;  1U27 A;  1AWE A;  2ROV A;  2AL6 A;  4Y94 A;  4A6F B;  1FHX A;  3NWA A;  2Z0Q A;  3OHM B;  3NSU A;  2FJL A;  3ULC A;  2LG1 A;  2ROZ B;  5D3V A;  4A6K A;  1DDM A;  1RRP B;  3D8D A;  2I1J A;  3KY9 A;  3ODX A;  2E2X A;  2G35 A;  2P0D A;  2D2Q A;  4OT1 A;  4HB4 B;  2Z0P A;  4DIX A;  1WGQ A;  1P6S A;  2YSZ A;  1WGU A;  4CSQ A;  2J0K A;  3AU4 A;  2MKR A;  3KZ1 A;  1OY2 A;  4A6H A;  5CLL B;  1N3H A;  1UPR A;  4K81 A;  3NW8 A;  4TYZ A;  3U12 A;  2RUK B;  2QKL A;  2CRF A;  5JHH A;  1GC6 A;  1ZC4 B;  2W2X C;  1V5M A;  3NWD A;  4QJ5 B;  1U29 A;  2I1K A;  1FHW A;  5FI0 A;  3GYP A;  2V76 A;  4A5K A;  5CLQ B;  3FEH A;  4QJ4 B;  2ADZ A;  3VOQ A;  4GPT B;  5HE3 A;  1WJ1 A;  4KAX B;  1RJ2 A;  4XWX A;  2K8E A;  5D27 A;  5C5B A;  2DHK A;  3DXE A;  2PZ1 A;  1KZ7 A;  1EVH A;  4Z2N A;  1J19 A;  2P8V A;  4HHV A;  4MT7 A;  2Y8G A;  3D8E A;  3HQC A;  2L1C A;  4F7H A;  1QQG A;  2X18 A;  5J3T A;  4HSI A;  2W2W A;  2R2Y A;  2VKI A;  4HAV B;  3TW1 A;  4ZRK A;  1X05 A;  1ISN A;  3IVF A; 
#chains in the Genus database with same CATH homology
 2ELA A;  2D4Q A;  2OQB A;  1V89 A;  1X1G A;  3CIK A;  4DXA B;  1PLS A;  2KCJ A;  2RVB B;  1P3R A;  1GG3 A;  3DXC A;  3PP2 A;  4CYE A;  1WJM A;  1BWN A;  3OAN A;  2D9V A;  5D3W A;  3FSS A;  4HAU B;  4KHO A;  2DX1 A;  3SNH A;  1UNQ A;  4L6E A;  1V61 A;  1Q67 A;  1K5D B;  5HE0 A;  4ZRI A;  4MY6 A;  5EFX A;  5D3Y A;  3M1I B;  1WI1 A;  4WVF B;  1DDV A;  4HB3 B;  5D3X A;  1W1H A;  2DTC A;  3PZD A;  1V5U A;  5L81 A;  1MK7 B;  1Z87 A;  1P5T A;  1W1D A;  4HAX B;  2H7D A;  2MWN B;  5HE2 A;  4K2O A;  2AEH A;  1Y19 B;  2COF A;  1MKE A;  1DDW A;  2N23 A;  2LOZ A;  3BIN A;  1IRS A;  1NU2 A;  4K2P A;  2DHI A;  3A8Q A;  2J59 M;  1KZG A;  2ZPY A;  2K00 A;  3F0W A;  1XCG A;  2MDX A;  3F5R A;  1DBH A;  2J0J A;  5DH9 B;  1ZSQ A;  1NI2 A;  1SHC A;  2YS5 A;  4NY0 A;  4HB0 B;  4WJ7 A;  5DHA B;  4DX9 0;  1WG7 A;  3A98 B;  1X86 A;  3DXD A;  3X23 A;  2R09 A;  2RSG A;  4DBB A;  5LOP B;  1V5P A;  3HW2 B;  1UNP A;  4YON A;  4CHM A;  3QWM A;  4EMO A;  3MDB C;  1FAO A;  1XX0 A;  2I5F A;  2EMT A;  2OTX A;  3ODW A;  1B55 A;  3LJU X;  2UZR A;  2KGX B;  5DI9 B;  2CY5 A;  1UPQ A;  1XKE A;  2LUL A;  3T06 A;  5DHF B;  4WSF A;  2MFQ A;  2YT0 A;  3ZDT A;  3KSY A;  5JP4 A;  4C0A A;  1TJ6 A;  2P0H A;  2VSZ A;  3MPX A;  2GCJ A;  4KVG B;  1MIX A;  1U5D A;  3KRX A;  5J3Y A;  2ELB A;  3PSC A;  2Y8F A;  3PVW A;  2BCJ A;  1OQN A;  1EGX A;  3O96 A;  4A6F A;  1I7A A;  3GYO A;  5JLJ B;  1FOE A;  3HK0 A;  3SO6 A;  3SUZ A;  2VRW B;  4HB2 B;  2D9Z A;  2Y7B A;  2CY4 A;  3P7Z A;  4BBK A;  1LB1 A;  1U5F A;  2YRY A;  1EAZ A;  3PEG A;  4HAZ B;  3N7C A;  5LON B;  2M38 A;  3U8Z A;  1MPH A;  2R0D A;  1WVH A;  3RCP A;  2QKM A;  2K2U A;  4ZRJ A;  3TO1 A;  5J3Q A;  4EKU A;  2D9X A;  2KUP A;  2CAY A;  2LKO A;  1K5G B;  4KHA A;  5JHG A;  5DIF B;  3G9W A;  4PQ0 A;  4IAP A;  5KCV A;  4K17 A;  2D11 A;  1MK9 B;  1FB8 A;  2D9W A;  2N0Y A;  2P0F A;  3V5W A;  4YL8 A;  3P6A A;  1NTY A;  4CHJ A;  3TVV A;  4TKN A;  1UNR A;  1W1G A;  5C5B B;  2IFS A;  1FGY A;  3KRW A;  3VIA A;  4NSW A;  4HAW B;  1PFJ A;  1I2H A;  2EJ8 A;  2DLW A;  2DX5 A;  5C6R A;  1U5E A;  4HDO A;  4F7G A;  1XOD A;  1OMW A;  1ZM0 A;  2M14 A;  2JP2 A;  3SV1 A;  3WYF B;  2DHJ A;  2LYD A;  4PNK A;  3CXB B;  1TQZ A;  2COC A;  1X11 A;  3TFM A;  1BAK A;  2YVC A;  3AJ4 A;  1H4R A;  1ZVR A;  2Q13 A;  2YS1 A;  2YS3 A;  3QIJ A;  3U7D A;  2HTH B;  2COD A;  2DYQ A;  4GMX B;  1PMS A;  2IYB A;  1XD4 A;  3A8P A;  4P7I A;  5KQ4 A;  1NTV A;  4DX8 A;  1U2B A;  4B6H A;  2HE7 A;  4MK0 A;  3BJI A;  4Z2M B;  2I5C A;  1EF1 A;  1V88 A;  4EJN A;  2RGN B;  2GS0 A;  3FM8 C;  2D9Y A;  4GN1 A;  4F7U P;  1ZC3 B;  2COA A;  2LOX A;  4H8S A;  3PVL A;  1J0W A;  4GZU A;  1DRO A;  2EC1 A;  1MAI A;  2D10 A;  2GJY A;  2DKQ A;  3SYX A;  5HE1 A;  1M7R A;  2DKP A;  2GCL A;  5KQ1 A;  4HAT B;  1E5W A;  1U5G A;  2J0M A;  2RNR B;  4D0N B;  1TXD A;  3UZT A;  1KI1 B;  4HAY B;  3AU5 A;  3ZVR A;  2UVM A;  3TCA A;  4GMV A;  1QC6 A;  3QBV B;  5GOW B;  5C79 A;  1BTN A;  1SGH A;  2W2X D;  2NZ8 B;  2XQN M;  1M7E A;  3D8F A;  2DA0 A;  2H7E A;  2RLO A;  1GC7 A;  1BTK A;  2DN6 A;  1FGZ A;  3PVU A;  3ULB A;  1X1F A;  4IOY X;  1H10 A;  5C16 A;  2YT1 A;  4GXB A;  1AQC A;  1FHO A;  2DYN A;  4KHB B;  2YF0 A;  3PG7 A;  5FI1 A;  2NMB A;  1LW3 A;  4HDQ A;  1XR0 B;  1DYN A;  3ODO A;  2Z0O A;  4IFS A;  2EMS A;  2L2I A;  1UEF A;  2UZS A;  2DFK A;  1Y5O A;  1MIZ B;  3WA0 A;  3ML4 A;  2K2J A;  1U27 A;  1AWE A;  2ROV A;  2AL6 A;  4Y94 A;  4A6F B;  1FHX A;  2Z0Q A;  3NSU A;  2FJL A;  3ULC A;  2LG1 A;  2ROZ B;  5D3V A;  4A6K A;  1DDM A;  1RRP B;  3D8D A;  2I1J A;  3KY9 A;  3ODX A;  2E2X A;  2G35 A;  2P0D A;  2D2Q A;  4HB4 B;  2Z0P A;  1WGQ A;  1P6S A;  2YSZ A;  1WGU A;  2J0K A;  3AU4 A;  2MKR A;  3KZ1 A;  1OY2 A;  4A6H A;  5CLL B;  1N3H A;  1UPR A;  4K81 A;  4TYZ A;  2RUK B;  2QKL A;  2CRF A;  5JHH A;  1GC6 A;  1ZC4 B;  2W2X C;  1V5M A;  1U29 A;  2I1K A;  1FHW A;  5FI0 A;  3GYP A;  2V76 A;  4A5K A;  5CLQ B;  3FEH A;  2ADZ A;  3VOQ A;  4GPT B;  5HE3 A;  1WJ1 A;  4KAX B;  1RJ2 A;  4XWX A;  5D27 A;  5C5B A;  2DHK A;  3DXE A;  2PZ1 A;  1KZ7 A;  1EVH A;  4Z2N A;  1J19 A;  2P8V A;  4HHV A;  4MT7 A;  2Y8G A;  3D8E A;  3HQC A;  2L1C A;  4F7H A;  1QQG A;  2X18 A;  5J3T A;  2W2W A;  2VKI A;  4HAV B;  3TW1 A;  4ZRK A;  1X05 A;  1ISN A;  3IVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...