3PP2A

Crystal structure of the pleckstrin homology domain of arhgap27
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
112
Chain Sequence
DKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSGLRQPSKFSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the pleckstrin homology domain of ArhGAP27
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords Rho GTPase-activating protein 27
total genus 32
structure length 112
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3pp2A00
4MK0A 2DHKA 3ODWA 1EF1A 1BTNA 2EC1A 2R0DA 2W2WA 2LULA 2PZ1A 1B55A 3HK0A 4A6FB 1FAOA 4EKUA 4CHMA 3PVUA 1XD4A 2COCA 3A8PA 2YS3A 1FGYA 3O96A 2I1JA 4KHBB 2G35A 1X86A 3CXBB 3FSSA 2H7EA 2OTXA 4D0NB 2FJLA 3KZ1A 2V76A 1TJ6A 1DDMA 1NTYA 4KHAA 2MFQA 4YONA 2KUPA 2D11A 1QQGA 3WA0A 2LKOA 1MIZB 3DXEA 2RSGA 2D9WA 2ELBA 2J0JA 4A5KA 3P7ZA 4TYZA 3M1IB 1WI1A 1FGZA 3TFMA 1GG3A 1NU2A 1K5GB 2RNRB 3G9WA 1I2HA 3FEHA 1WJ1A 1KZGA 1XKEA 2COAA 2DLWA 4HAZB 5J3QA 3PG7A 1I7AA 2LOXA 5J3YA 2ROVA 1V5PA 2D2QA 1GC7A 1WVHA 2KGXB 3LJUX 1U5FA 2UZSA 4K2PA 3PEGA 2N23A 5CLLB 4PNKA 2J0KA 2IYBA 5KQ4A 2DHJA 3SNHA 2Y7BA 2JP2A 3GYOA 4HAXB 1MKEA 1M7RA 4EMOA 4GN1A 3DXCA 3ULBA 2I5FA 2GCLA 2EMTA 5DH9B 4K81A 1Y5OA 4ZRKA 3ML4A 4CHJA 1BWNA 5HE1A 3F5RA 2ELAA 3FM8C 4ZRJA 3MDBC 1UPQA 4F7HA 5LONB 1N3HA 1AWEA 2EMSA 3PVWA 1ZVRA 1J0WA 1V88A 1H4RA 4BBKA 2P0FA 4A6KA 3RCPA 5FI0A 4HB3B 4DXAB 4B6HA 3OANA 1FHOA 2COFA 3QBVB 3HW2B 1ZM0A 2ADZA 1PFJA 1TXDA 4HHVA 1UEFA 3ODOA 1TQZA 4KAXB 3U7DA 1X05A 2HE7A 4Z2MB 1U2BA 4L6EA 2P8VA 2R09A 4A6HA 1MK9B 4H8SA 4IFSA 1EGXA 1NI2A 1RJ2A 4HB4B 4DX90 2YT0A 4HDOA 1GC6A 5FI1A 1EVHA 1P5TA 1FB8A 1WJMA 4HAUB 1UNPA 5D3VA 2X18A 2DKQA 1J19A 5DIFB 4EJNA 1EAZA 3SO6A 2K00A 3N7CA 5D3XA 4ZRIA 3P6AA 4NY0A 2UZRA 3TCAA 3HQCA 4GPTB 1SGHA 2P0HA 4CYEA 4HB0B 2DFKA 3TO1A 5C5BA 4KVGB 1ZC4B 1U27A 3F0WA 1NTVA 2Z0OA 3VIAA 2I1KA 2QKMA 3TW1A 1W1HA 1LW3A 2M14A 1P6SA 5EFXA 1V61A 2YSZA 2LYDA 4MT7A 3SV1A 1U5GA 3BJIA 3ZDTA 2K2UA 2EJ8A 1W1GA 5C6RA 2OQBA 1ZC3B 1UNQA 2DX5A 2CAYA 3V5WA 2W2XD 5D3WA 2J59M 2DA0A 2DN6A 5DI9B 5L81A 1U29A 2Y8FA 3PSCA 2I5CA 5JLJB 1PMSA 4WSFA 1BAKA 2YF0A 4YL8A 2N0YA 4Z2NA 3T06A 1XODA 2RUKB 2GCJA 1V89A 1ZSQA 1WG7A 2MDXA 3A98B 2ROZB 4HAWB 4HAVB 3D8DA 2DX1A 4GMVA 1U5DA 2MWNB 5C5BB 3CIKA 4K17A 1ISNA 2D9XA 1OQNA 1DYNA 2L2IA 2RVBB 3VOQA 4MY6A 1FOEA 5JHHA 4TKNA 5DHAB 5HE2A 1W1DA 2D9VA 2YT1A 1Q67A 1M7EA 2GS0A 3A8QA 5DHFB 2MKRA 4C0AA 3D8FA 2ZPYA 2M38A 2D10A 1FHWA 1RRPB 1MAIA 5J3TA 4XWXA 5JHGA 3QIJA 2L1CA 2YS1A 1DROA 5HE0A 4GXBA 3ULCA 2VRWB 1P3RA 4HAYB 1SHCA 2D9ZA 2LOZA 1KI1B 1WGQA 3KSYA 3AU5A 3AJ4A 5HE3A 3KRWA 3PVLA 2D9YA 1Z87A 5GOWB 1AQCA 3NSUA 4WJ7A 2UVMA 2W2XC 3ZVRA 1Y19B 4Y94A 2DYQA 5KCVA 1PLSA 4WVFB 3U8ZA 2DHIA 4IAPA 1QC6A 3MPXA 3DXDA 3KRXA 1DDVA 2CODA 2H7DA 3KY9A 3WYFB 1OY2A 3SUZA 3AU4A 2NMBA 2VKIA 1WGUA 5C16A 5JP4A 3D8EA 3SYXA 2K2JA 5D3YA 3BINA 1V5MA 2D4QA 4DX8A 1XR0B 2Y8GA 2P0DA 1KZ7A 2CY4A 2DTCA 2CY5A 1OMWA 1X11A 2E2XA 1K5DB 1X1FA 4P7IA 4DBBA 4HB2B 1E5WA 2HTHB 2RLOA 2NZ8B 1DBHA 2AL6A 2J0MA 2RGNB 3TVVA 5LOPB 4GZUA 2GJYA 5CLQB 3PP2A 4PQ0A 2DYNA 4KHOA 3X23A 3IVFA 1UNRA 5C79A 2Z0PA 1IRSA 1FHXA 2Z0QA 2KCJA 1DDWA 2AEHA 3QWMA 4F7UP 4A6FA 4K2OA 5KQ1A 4NSWA 4HDQA 4GMXB 2LG1A 1U5EA 1MK7B 1V5UA 1LB1A 4F7GA 3ODXA 3UZTA 3GYPA 1MPHA 2YVCA 2QKLA 2DKPA 2VSZA 2XQNM 2IFSA 4IOYX 1H10A 2BCJA 1MIXA 2CRFA 1X1GA 3PZDA 1BTKA 2YS5A 4HATB 2Q13A 1XCGA 1UPRA 5D27A 1XX0A 2YRYA
chains in the Genus database with same CATH superfamily
4MK0A 2DHKA 3ODWA 2FJUB 1EF1A 1BTNA 2EC1A 2R0DA 2W2WA 2LULA 2PZ1A 1B55A 3HK0A 4A6FB 1FAOA 4EKUA 4CHMA 4GOUA 3PVUA 1XD4A 2COCA 3A8PA 2YS3A 1FGYA 3B77A 3O96A 2I1JA 4KHBB 2G35A 1X86A 3CXBB 3FSSA 2H7EA 2OTXA 4D0NB 2FJLA 3KZ1A 2V76A 1TJ6A 4CSQA 1DDMA 1NTYA 4KHAA 2MFQA 4YONA 2RRFA 2KUPA 2D11A 1QQGA 3WA0A 2LKOA 1MIZB 3DXEA 2RSGA 2D9WA 2ELBA 2J0JA 4A5KA 3P7ZA 4TYZA 3M1IB 1WI1A 1FGZA 3TFMA 1GG3A 1NU2A 1K5GB 2RNRB 4GNKB 3G9WA 1I2HA 3FEHA 1WJ1A 1KZGA 1XKEA 2COAA 2DLWA 4HAZB 5J3QA 3HIEA 3PG7A 1I7AA 2LOXA 5J3YA 2ROVA 1V5PA 2D2QA 1GC7A 1WVHA 2KGXB 3LJUX 1U5FA 2UZSA 4K2PA 3PEGA 2N23A 5CLLB 4PNKA 2J0KA 2IYBA 5KQ4A 2DHJA 3SNHA 2Y7BA 2JP2A 3GYOA 4HAXB 1MKEA 1M7RA 4EMOA 4GN1A 3DXCA 3ULBA 2I5FA 2GCLA 2YT2A 2EMTA 2K49A 5DH9B 4K81A 1Y5OA 4ZRKA 3ML4A 4CHJA 4QJ3B 1BWNA 5HE1A 3F5RA 2ELAA 3FM8C 4ZRJA 3MDBC 1UPQA 4F7HA 5LONB 1N3HA 1AWEA 2EMSA 3PVWA 1ZVRA 4OT1A 1J0WA 3NWDA 5IRSA 1V88A 1H4RA 4BBKA 2P0FA 4A6KA 3RCPA 4L1RA 4HB3B 5FI0A 4B6HA 4DXAB 3OANA 1FHOA 2COFA 3QBVB 3HW2B 1ZM0A 2ADZA 1PFJA 1TXDA 4HHVA 1UEFA 3ODOA 1TQZA 4KAXB 3U7DA 1X05A 2HE7A 4Z2MB 1U2BA 4L6EA 2P8VA 2R09A 4A6HA 1MK9B 4H8SA 4IFSA 1EGXA 3NWAA 1NI2A 1RJ2A 4HB4B 4DX90 2YT0A 4HDOA 1GC6A 5FI1A 1EVHA 1P5TA 1FB8A 1WJMA 4HAUB 1UNPA 5D3VA 2X18A 2DKQA 1J19A 5DIFB 4EJNA 1EAZA 3SO6A 2K00A 3N7CA 5D3XA 4ZRIA 3P6AA 4NY0A 2UZRA 3TCAA 3HQCA 4GPTB 1SGHA 2P0HA 4CYEA 4HB0B 2GUMA 2DFKA 3TO1A 5C5BA 4KVGB 1ZC4B 1U27A 3F0WA 1NTVA 2Z0OA 3VIAA 2I1KA 2QKMA 3TW1A 1W1HA 1LW3A 2M14A 1P6SA 5EFXA 1V61A 2YSZA 2LYDA 3NWFA 4MT7A 3SV1A 4QJ4B 1U5GA 3BJIA 3ZDTA 2K2UA 2EJ8A 1W1GA 5C6RA 2OQBA 1ZC3B 2R2YA 1UNQA 2DX5A 2CAYA 3V5WA 2W2XD 5D3WA 2J59M 2DA0A 2DN6A 5DI9B 5L81A 1U29A 2Y8FA 3PSCA 2I5CA 5JLJB 2ZKMX 1PMSA 3DCXA 4WSFA 3FVCA 1BAKA 2YF0A 5LG4B 4YL8A 2N0YA 4Z2NA 3T06A 1XODA 2RUKB 2GCJA 1V89A 1ZSQA 1WG7A 2MDXA 3A98B 2ROZB 4HAWB 4HAVB 3D8DA 2DX1A 4GMVA 1U5DA 2MWNB 5C5BB 3CIKA 4K17A 1ISNA 2D9XA 1OQNA 1DYNA 2L2IA 2RVBB 3VOQA 4MY6A 1FOEA 5JHHA 4TKNA 5DHAB 5HE2A 1W1DA 2D9VA 2YT1A 1Q67A 1M7EA 2GS0A 2KIGA 3A8QA 5DHFB 2MKRA 4KHBA 4C0AA 3D8FA 2ZPYA 2M38A 1ZYIA 2D10A 1FHWA 1RRPB 1MAIA 1T77A 5J3TA 4XWXA 5JHGA 3QIJA 2L1CA 2YS1A 1DROA 5HE0A 4GXBA 3ULCA 2VRWB 4OSNA 1P3RA 4HAYB 1SHCA 2D9ZA 2LOZA 1KI1B 1WGQA 3KSYA 3AU5A 3AJ4A 5HE3A 3KRWA 3PVLA 2D9YA 1Z87A 5GOWB 1AQCA 3NSUA 4WJ7A 3HSAA 2KIEA 2UVMA 2W2XC 3ZVRA 1Y19B 4Y94A 2DYQA 5M4YB 5KCVA 1PLSA 4WVFB 3U8ZA 2DHIA 4IAPA 1QC6A 3MPXA 3DXDA 3KRXA 1DDVA 2CODA 2H7DA 3KY9A 3WYFB 2Z14A 1OY2A 3AU4A 3SUZA 2NMBA 2VKIA 1WGUA 2KR0A 5C16A 2Z4DA 5JP4A 3D8EA 1MI1A 3SYXA 2K2JA 5D3YA 3U12A 3BINA 1V5MA 2D4QA 4DX8A 1XR0B 2Y8GA 2P0DA 1KZ7A 2CY4A 2DTCA 2CY5A 1OMWA 1X11A 2E2XA 1K5DB 1X1FA 3OHMB 3A58A 4P7IA 4DBBA 5I2SA 4HB2B 1E5WA 2HTHB 2RLOA 2NZ8B 1DBHA 2AL6A 2J0MA 4QJ5B 2RGNB 3TVVA 5LOPB 4GZUA 2GJYA 5CLQB 3PP2A 4PQ0A 2DYNA 5I2MA 4KHOA 3X23A 3IVFA 1UNRA 2NBVA 5C79A 2Z0PA 1IRSA 1FHXA 2Z0QA 2KCJA 1DDWA 2AEHA 3QWMA 4F7UP 4A6FA 4K2OA 5KQ1A 4NSWA 4HDQA 4GMXB 2LG1A 4DIXA 1U5EA 1MK7B 2KUQA 1V5UA 1LB1A 4F7GA 3ODXA 3UZTA 3GYPA 1MPHA 4HSIA 2YVCA 2QKLA 2DKPA 2VSZA 2XQNM 2IFSA 4IOYX 3NW8A 4D6WA 1H10A 2BCJA 1MIXA 2CRFA 1X1GA 3PZDA 2Z13A 4QXAB 1BTKA 2YS5A 2Z59A 4HATB 2Q13A 1XCGA 2K8EA 1UPRA 5D27A 1XX0A 2YRYA
chains in the Genus database with same CATH topology
4MK0A 2DHKA 3ODWA 1EF1A 1BTNA 2EC1A 2R0DA 2W2WA 2LULA 2PZ1A 1B55A 3HK0A 4A6FB 1FAOA 4EKUA 4CHMA 3PVUA 1XD4A 2COCA 3A8PA 2YS3A 1FGYA 3O96A 2I1JA 4KHBB 2G35A 1X86A 3CXBB 3FSSA 2H7EA 2OTXA 4D0NB 2FJLA 3KZ1A 2V76A 1TJ6A 1DDMA 1NTYA 4KHAA 2MFQA 4YONA 2KUPA 2D11A 1QQGA 3WA0A 2LKOA 1MIZB 3DXEA 2RSGA 2D9WA 2ELBA 2J0JA 4A5KA 3P7ZA 4TYZA 3M1IB 1WI1A 1FGZA 3TFMA 1GG3A 1NU2A 1K5GB 2RNRB 3G9WA 1I2HA 3FEHA 1WJ1A 1KZGA 1XKEA 2COAA 2DLWA 4HAZB 5J3QA 3PG7A 1I7AA 2LOXA 5J3YA 2ROVA 1V5PA 2D2QA 1GC7A 1WVHA 2KGXB 3LJUX 1U5FA 2UZSA 4K2PA 3PEGA 2N23A 5CLLB 4PNKA 2J0KA 2IYBA 5KQ4A 2DHJA 3SNHA 2Y7BA 2JP2A 3GYOA 4HAXB 1MKEA 1M7RA 4EMOA 4GN1A 3DXCA 3ULBA 2I5FA 2GCLA 2EMTA 5DH9B 4K81A 1Y5OA 4ZRKA 3ML4A 4CHJA 1BWNA 5HE1A 3F5RA 2ELAA 3FM8C 4ZRJA 3MDBC 1UPQA 4F7HA 5LONB 1N3HA 1AWEA 2EMSA 3PVWA 1ZVRA 1J0WA 1V88A 1H4RA 4BBKA 2P0FA 4A6KA 3RCPA 5FI0A 4HB3B 4DXAB 4B6HA 3OANA 1FHOA 2COFA 3QBVB 3HW2B 1ZM0A 2ADZA 1PFJA 1TXDA 4HHVA 1UEFA 3ODOA 1TQZA 4KAXB 3U7DA 1X05A 2HE7A 4Z2MB 1U2BA 4L6EA 2P8VA 2R09A 4A6HA 1MK9B 4H8SA 4IFSA 1EGXA 1NI2A 1RJ2A 4HB4B 4DX90 2YT0A 4HDOA 1GC6A 5FI1A 1EVHA 1P5TA 1FB8A 1WJMA 4HAUB 1UNPA 5D3VA 2X18A 2DKQA 1J19A 5DIFB 4EJNA 1EAZA 3SO6A 2K00A 3N7CA 5D3XA 4ZRIA 3P6AA 4NY0A 2UZRA 3TCAA 3HQCA 4GPTB 1SGHA 2P0HA 4CYEA 4HB0B 2DFKA 3TO1A 5C5BA 4KVGB 1ZC4B 1U27A 3F0WA 1NTVA 2Z0OA 3VIAA 2I1KA 2QKMA 3TW1A 1W1HA 1LW3A 2M14A 1P6SA 5EFXA 1V61A 2YSZA 2LYDA 4MT7A 3SV1A 1U5GA 3BJIA 3ZDTA 2K2UA 2EJ8A 1W1GA 5C6RA 2OQBA 1ZC3B 1UNQA 2DX5A 2CAYA 3V5WA 2W2XD 5D3WA 2J59M 2DA0A 2DN6A 5DI9B 5L81A 1U29A 2Y8FA 3PSCA 2I5CA 5JLJB 1PMSA 4WSFA 1BAKA 2YF0A 4YL8A 2N0YA 4Z2NA 3T06A 1XODA 2RUKB 2GCJA 1V89A 1ZSQA 1WG7A 2MDXA 3A98B 2ROZB 4HAWB 4HAVB 3D8DA 2DX1A 4GMVA 1U5DA 2MWNB 5C5BB 3CIKA 4K17A 1ISNA 2D9XA 1OQNA 1DYNA 2L2IA 2RVBB 3VOQA 4MY6A 1FOEA 5JHHA 4TKNA 5DHAB 5HE2A 1W1DA 2D9VA 2YT1A 1Q67A 1M7EA 2GS0A 3A8QA 5DHFB 2MKRA 4C0AA 3D8FA 2ZPYA 2M38A 2D10A 1FHWA 1RRPB 1MAIA 5J3TA 4XWXA 5JHGA 3QIJA 2L1CA 2YS1A 1DROA 5HE0A 4GXBA 3ULCA 2VRWB 1P3RA 4HAYB 1SHCA 2D9ZA 2LOZA 1KI1B 1WGQA 3KSYA 3AU5A 3AJ4A 5HE3A 3KRWA 3PVLA 2D9YA 1Z87A 5GOWB 1AQCA 3NSUA 4WJ7A 2UVMA 2W2XC 3ZVRA 1Y19B 4Y94A 2DYQA 5KCVA 1PLSA 4WVFB 3U8ZA 2DHIA 4IAPA 1QC6A 3MPXA 3DXDA 3KRXA 1DDVA 2CODA 2H7DA 3KY9A 3WYFB 1OY2A 3SUZA 3AU4A 2NMBA 2VKIA 1WGUA 5C16A 5JP4A 3D8EA 3SYXA 2K2JA 5D3YA 3BINA 1V5MA 2D4QA 4DX8A 1XR0B 2Y8GA 2P0DA 1KZ7A 2CY4A 2DTCA 2CY5A 1OMWA 1X11A 2E2XA 1K5DB 1X1FA 4P7IA 4DBBA 4HB2B 1E5WA 2HTHB 2RLOA 2NZ8B 1DBHA 2AL6A 2J0MA 2RGNB 3TVVA 5LOPB 4GZUA 2GJYA 5CLQB 3PP2A 4PQ0A 2DYNA 4KHOA 3X23A 3IVFA 1UNRA 5C79A 2Z0PA 1IRSA 1FHXA 2Z0QA 2KCJA 1DDWA 2AEHA 3QWMA 4F7UP 4A6FA 4K2OA 5KQ1A 4NSWA 4HDQA 4GMXB 2LG1A 1U5EA 1MK7B 1V5UA 1LB1A 4F7GA 3ODXA 3UZTA 3GYPA 1MPHA 2YVCA 2QKLA 2DKPA 2VSZA 2XQNM 2IFSA 4IOYX 1H10A 2BCJA 1MIXA 2CRFA 1X1GA 3PZDA 1BTKA 2YS5A 4HATB 2Q13A 1XCGA 1UPRA 5D27A 1XX0A 2YRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MK0 A;  2DHK A;  3ODW A;  1EF1 A;  1BTN A;  2EC1 A;  2R0D A;  2W2W A;  2LUL A;  2PZ1 A;  1B55 A;  3HK0 A;  4A6F B;  1FAO A;  4EKU A;  4CHM A;  3PVU A;  1XD4 A;  2COC A;  3A8P A;  2YS3 A;  1FGY A;  3O96 A;  2I1J A;  4KHB B;  2G35 A;  1X86 A;  3CXB B;  3FSS A;  2H7E A;  2OTX A;  4D0N B;  2FJL A;  3KZ1 A;  2V76 A;  1TJ6 A;  1DDM A;  1NTY A;  4KHA A;  2MFQ A;  4YON A;  2KUP A;  2D11 A;  1QQG A;  3WA0 A;  2LKO A;  1MIZ B;  3DXE A;  2RSG A;  2D9W A;  2ELB A;  2J0J A;  4A5K A;  3P7Z A;  4TYZ A;  3M1I B;  1WI1 A;  1FGZ A;  3TFM A;  1GG3 A;  1NU2 A;  1K5G B;  2RNR B;  3G9W A;  1I2H A;  3FEH A;  1WJ1 A;  1KZG A;  1XKE A;  2COA A;  2DLW A;  4HAZ B;  5J3Q A;  3PG7 A;  1I7A A;  2LOX A;  5J3Y A;  2ROV A;  1V5P A;  2D2Q A;  1GC7 A;  1WVH A;  2KGX B;  3LJU X;  1U5F A;  2UZS A;  4K2P A;  3PEG A;  2N23 A;  5CLL B;  4PNK A;  2J0K A;  2IYB A;  5KQ4 A;  2DHJ A;  3SNH A;  2Y7B A;  2JP2 A;  3GYO A;  4HAX B;  1MKE A;  1M7R A;  4EMO A;  4GN1 A;  3DXC A;  3ULB A;  2I5F A;  2GCL A;  2EMT A;  5DH9 B;  4K81 A;  1Y5O A;  4ZRK A;  3ML4 A;  4CHJ A;  1BWN A;  5HE1 A;  3F5R A;  2ELA A;  3FM8 C;  4ZRJ A;  3MDB C;  1UPQ A;  4F7H A;  5LON B;  1N3H A;  1AWE A;  2EMS A;  3PVW A;  1ZVR A;  1J0W A;  1V88 A;  1H4R A;  4BBK A;  2P0F A;  4A6K A;  3RCP A;  5FI0 A;  4HB3 B;  4DXA B;  4B6H A;  3OAN A;  1FHO A;  2COF A;  3QBV B;  3HW2 B;  1ZM0 A;  2ADZ A;  1PFJ A;  1TXD A;  4HHV A;  1UEF A;  3ODO A;  1TQZ A;  4KAX B;  3U7D A;  1X05 A;  2HE7 A;  4Z2M B;  1U2B A;  4L6E A;  2P8V A;  2R09 A;  4A6H A;  1MK9 B;  4H8S A;  4IFS A;  1EGX A;  1NI2 A;  1RJ2 A;  4HB4 B;  4DX9 0;  2YT0 A;  4HDO A;  1GC6 A;  5FI1 A;  1EVH A;  1P5T A;  1FB8 A;  1WJM A;  4HAU B;  1UNP A;  5D3V A;  2X18 A;  2DKQ A;  1J19 A;  5DIF B;  4EJN A;  1EAZ A;  3SO6 A;  2K00 A;  3N7C A;  5D3X A;  4ZRI A;  3P6A A;  4NY0 A;  2UZR A;  3TCA A;  3HQC A;  4GPT B;  1SGH A;  2P0H A;  4CYE A;  4HB0 B;  2DFK A;  3TO1 A;  5C5B A;  4KVG B;  1ZC4 B;  1U27 A;  3F0W A;  1NTV A;  2Z0O A;  3VIA A;  2I1K A;  2QKM A;  3TW1 A;  1W1H A;  1LW3 A;  2M14 A;  1P6S A;  5EFX A;  1V61 A;  2YSZ A;  2LYD A;  4MT7 A;  3SV1 A;  1U5G A;  3BJI A;  3ZDT A;  2K2U A;  2EJ8 A;  1W1G A;  5C6R A;  2OQB A;  1ZC3 B;  1UNQ A;  2DX5 A;  2CAY A;  3V5W A;  2W2X D;  5D3W A;  2J59 M;  2DA0 A;  2DN6 A;  5DI9 B;  5L81 A;  1U29 A;  2Y8F A;  3PSC A;  2I5C A;  5JLJ B;  1PMS A;  4WSF A;  1BAK A;  2YF0 A;  4YL8 A;  2N0Y A;  4Z2N A;  3T06 A;  1XOD A;  2RUK B;  2GCJ A;  1V89 A;  1ZSQ A;  1WG7 A;  2MDX A;  3A98 B;  2ROZ B;  4HAW B;  4HAV B;  3D8D A;  2DX1 A;  4GMV A;  1U5D A;  2MWN B;  5C5B B;  3CIK A;  4K17 A;  1ISN A;  2D9X A;  1OQN A;  1DYN A;  2L2I A;  2RVB B;  3VOQ A;  4MY6 A;  1FOE A;  5JHH A;  4TKN A;  5DHA B;  5HE2 A;  1W1D A;  2D9V A;  2YT1 A;  1Q67 A;  1M7E A;  2GS0 A;  3A8Q A;  5DHF B;  2MKR A;  4C0A A;  3D8F A;  2ZPY A;  2M38 A;  2D10 A;  1FHW A;  1RRP B;  1MAI A;  5J3T A;  4XWX A;  5JHG A;  3QIJ A;  2L1C A;  2YS1 A;  1DRO A;  5HE0 A;  4GXB A;  3ULC A;  2VRW B;  1P3R A;  4HAY B;  1SHC A;  2D9Z A;  2LOZ A;  1KI1 B;  1WGQ A;  3KSY A;  3AU5 A;  3AJ4 A;  5HE3 A;  3KRW A;  3PVL A;  2D9Y A;  1Z87 A;  5GOW B;  1AQC A;  3NSU A;  4WJ7 A;  2UVM A;  2W2X C;  3ZVR A;  1Y19 B;  4Y94 A;  2DYQ A;  5KCV A;  1PLS A;  4WVF B;  3U8Z A;  2DHI A;  4IAP A;  1QC6 A;  3MPX A;  3DXD A;  3KRX A;  1DDV A;  2COD A;  2H7D A;  3KY9 A;  3WYF B;  1OY2 A;  3SUZ A;  3AU4 A;  2NMB A;  2VKI A;  1WGU A;  5C16 A;  5JP4 A;  3D8E A;  3SYX A;  2K2J A;  5D3Y A;  3BIN A;  1V5M A;  2D4Q A;  4DX8 A;  1XR0 B;  2Y8G A;  2P0D A;  1KZ7 A;  2CY4 A;  2DTC A;  2CY5 A;  1OMW A;  1X11 A;  2E2X A;  1K5D B;  1X1F A;  4P7I A;  4DBB A;  4HB2 B;  1E5W A;  2HTH B;  2RLO A;  2NZ8 B;  1DBH A;  2AL6 A;  2J0M A;  2RGN B;  3TVV A;  5LOP B;  4GZU A;  2GJY A;  5CLQ B;  3PP2 A;  4PQ0 A;  2DYN A;  4KHO A;  3X23 A;  3IVF A;  1UNR A;  5C79 A;  2Z0P A;  1IRS A;  1FHX A;  2Z0Q A;  2KCJ A;  1DDW A;  2AEH A;  3QWM A;  4F7U P;  4A6F A;  4K2O A;  5KQ1 A;  4NSW A;  4HDQ A;  4GMX B;  2LG1 A;  1U5E A;  1MK7 B;  1V5U A;  1LB1 A;  4F7G A;  3ODX A;  3UZT A;  3GYP A;  1MPH A;  2YVC A;  2QKL A;  2DKP A;  2VSZ A;  2XQN M;  2IFS A;  4IOY X;  1H10 A;  2BCJ A;  1MIX A;  2CRF A;  1X1G A;  3PZD A;  1BTK A;  2YS5 A;  4HAT B;  2Q13 A;  1XCG A;  1UPR A;  5D27 A;  1XX0 A;  2YRY A; 
#chains in the Genus database with same CATH topology
 4MK0 A;  2DHK A;  3ODW A;  2FJU B;  1EF1 A;  1BTN A;  2EC1 A;  2R0D A;  2W2W A;  2LUL A;  2PZ1 A;  1B55 A;  3HK0 A;  4A6F B;  1FAO A;  4EKU A;  4CHM A;  4GOU A;  3PVU A;  1XD4 A;  2COC A;  3A8P A;  2YS3 A;  1FGY A;  3B77 A;  3O96 A;  2I1J A;  4KHB B;  2G35 A;  1X86 A;  3CXB B;  3FSS A;  2H7E A;  2OTX A;  4D0N B;  2FJL A;  3KZ1 A;  2V76 A;  1TJ6 A;  4CSQ A;  1DDM A;  1NTY A;  4KHA A;  2MFQ A;  4YON A;  2RRF A;  2KUP A;  2D11 A;  1QQG A;  3WA0 A;  2LKO A;  1MIZ B;  3DXE A;  2RSG A;  2D9W A;  2ELB A;  2J0J A;  4A5K A;  3P7Z A;  4TYZ A;  3M1I B;  1WI1 A;  1FGZ A;  3TFM A;  1GG3 A;  1NU2 A;  1K5G B;  2RNR B;  4GNK B;  3G9W A;  1I2H A;  3FEH A;  1WJ1 A;  1KZG A;  1XKE A;  2COA A;  2DLW A;  4HAZ B;  5J3Q A;  3HIE A;  3PG7 A;  1I7A A;  2LOX A;  5J3Y A;  2ROV A;  1V5P A;  2D2Q A;  1GC7 A;  1WVH A;  2KGX B;  3LJU X;  1U5F A;  2UZS A;  4K2P A;  3PEG A;  2N23 A;  5CLL B;  4PNK A;  2J0K A;  2IYB A;  5KQ4 A;  2DHJ A;  3SNH A;  2Y7B A;  2JP2 A;  3GYO A;  4HAX B;  1MKE A;  1M7R A;  4EMO A;  4GN1 A;  3DXC A;  3ULB A;  2I5F A;  2GCL A;  2YT2 A;  2EMT A;  2K49 A;  5DH9 B;  4K81 A;  1Y5O A;  4ZRK A;  3ML4 A;  4CHJ A;  4QJ3 B;  1BWN A;  5HE1 A;  3F5R A;  2ELA A;  3FM8 C;  4ZRJ A;  3MDB C;  1UPQ A;  4F7H A;  5LON B;  1N3H A;  1AWE A;  2EMS A;  3PVW A;  1ZVR A;  4OT1 A;  1J0W A;  3NWD A;  5IRS A;  1V88 A;  1H4R A;  4BBK A;  2P0F A;  4A6K A;  3RCP A;  4L1R A;  4HB3 B;  5FI0 A;  4B6H A;  4DXA B;  3OAN A;  1FHO A;  2COF A;  3QBV B;  3HW2 B;  1ZM0 A;  2ADZ A;  1PFJ A;  1TXD A;  4HHV A;  1UEF A;  3ODO A;  1TQZ A;  4KAX B;  3U7D A;  1X05 A;  2HE7 A;  4Z2M B;  1U2B A;  4L6E A;  2P8V A;  2R09 A;  4A6H A;  1MK9 B;  4H8S A;  4IFS A;  1EGX A;  3NWA A;  1NI2 A;  1RJ2 A;  4HB4 B;  4DX9 0;  2YT0 A;  4HDO A;  1GC6 A;  5FI1 A;  1EVH A;  1P5T A;  1FB8 A;  1WJM A;  4HAU B;  1UNP A;  5D3V A;  2X18 A;  2DKQ A;  1J19 A;  5DIF B;  4EJN A;  1EAZ A;  3SO6 A;  2K00 A;  3N7C A;  5D3X A;  4ZRI A;  3P6A A;  4NY0 A;  2UZR A;  3TCA A;  3HQC A;  4GPT B;  1SGH A;  2P0H A;  4CYE A;  4HB0 B;  2GUM A;  2DFK A;  3TO1 A;  5C5B A;  4KVG B;  1ZC4 B;  1U27 A;  3F0W A;  1NTV A;  2Z0O A;  3VIA A;  2I1K A;  2QKM A;  3TW1 A;  1W1H A;  1LW3 A;  2M14 A;  1P6S A;  5EFX A;  1V61 A;  2YSZ A;  2LYD A;  3NWF A;  4MT7 A;  3SV1 A;  4QJ4 B;  1U5G A;  3BJI A;  3ZDT A;  2K2U A;  2EJ8 A;  1W1G A;  5C6R A;  2OQB A;  1ZC3 B;  2R2Y A;  1UNQ A;  2DX5 A;  2CAY A;  3V5W A;  2W2X D;  5D3W A;  2J59 M;  2DA0 A;  2DN6 A;  5DI9 B;  5L81 A;  1U29 A;  2Y8F A;  3PSC A;  2I5C A;  5JLJ B;  2ZKM X;  1PMS A;  3DCX A;  4WSF A;  3FVC A;  1BAK A;  2YF0 A;  5LG4 B;  4YL8 A;  2N0Y A;  4Z2N A;  3T06 A;  1XOD A;  2RUK B;  2GCJ A;  1V89 A;  1ZSQ A;  1WG7 A;  2MDX A;  3A98 B;  2ROZ B;  4HAW B;  4HAV B;  3D8D A;  2DX1 A;  4GMV A;  1U5D A;  2MWN B;  5C5B B;  3CIK A;  4K17 A;  1ISN A;  2D9X A;  1OQN A;  1DYN A;  2L2I A;  2RVB B;  3VOQ A;  4MY6 A;  1FOE A;  5JHH A;  4TKN A;  5DHA B;  5HE2 A;  1W1D A;  2D9V A;  2YT1 A;  1Q67 A;  1M7E A;  2GS0 A;  2KIG A;  3A8Q A;  5DHF B;  2MKR A;  4KHB A;  4C0A A;  3D8F A;  2ZPY A;  2M38 A;  1ZYI A;  2D10 A;  1FHW A;  1RRP B;  1MAI A;  1T77 A;  5J3T A;  4XWX A;  5JHG A;  3QIJ A;  2L1C A;  2YS1 A;  1DRO A;  5HE0 A;  4GXB A;  3ULC A;  2VRW B;  4OSN A;  1P3R A;  4HAY B;  1SHC A;  2D9Z A;  2LOZ A;  1KI1 B;  1WGQ A;  3KSY A;  3AU5 A;  3AJ4 A;  5HE3 A;  3KRW A;  3PVL A;  2D9Y A;  1Z87 A;  5GOW B;  1AQC A;  3NSU A;  4WJ7 A;  3HSA A;  2KIE A;  2UVM A;  2W2X C;  3ZVR A;  1Y19 B;  4Y94 A;  2DYQ A;  5M4Y B;  5KCV A;  1PLS A;  4WVF B;  3U8Z A;  2DHI A;  4IAP A;  1QC6 A;  3MPX A;  3DXD A;  3KRX A;  1DDV A;  2COD A;  2H7D A;  3KY9 A;  3WYF B;  2Z14 A;  1OY2 A;  3AU4 A;  3SUZ A;  2NMB A;  2VKI A;  1WGU A;  2KR0 A;  5C16 A;  2Z4D A;  5JP4 A;  3D8E A;  1MI1 A;  3SYX A;  2K2J A;  5D3Y A;  3U12 A;  3BIN A;  1V5M A;  2D4Q A;  4DX8 A;  1XR0 B;  2Y8G A;  2P0D A;  1KZ7 A;  2CY4 A;  2DTC A;  2CY5 A;  1OMW A;  1X11 A;  2E2X A;  1K5D B;  1X1F A;  3OHM B;  3A58 A;  4P7I A;  4DBB A;  5I2S A;  4HB2 B;  1E5W A;  2HTH B;  2RLO A;  2NZ8 B;  1DBH A;  2AL6 A;  2J0M A;  4QJ5 B;  2RGN B;  3TVV A;  5LOP B;  4GZU A;  2GJY A;  5CLQ B;  3PP2 A;  4PQ0 A;  2DYN A;  5I2M A;  4KHO A;  3X23 A;  3IVF A;  1UNR A;  2NBV A;  5C79 A;  2Z0P A;  1IRS A;  1FHX A;  2Z0Q A;  2KCJ A;  1DDW A;  2AEH A;  3QWM A;  4F7U P;  4A6F A;  4K2O A;  5KQ1 A;  4NSW A;  4HDQ A;  4GMX B;  2LG1 A;  4DIX A;  1U5E A;  1MK7 B;  2KUQ A;  1V5U A;  1LB1 A;  4F7G A;  3ODX A;  3UZT A;  3GYP A;  1MPH A;  4HSI A;  2YVC A;  2QKL A;  2DKP A;  2VSZ A;  2XQN M;  2IFS A;  4IOY X;  3NW8 A;  4D6W A;  1H10 A;  2BCJ A;  1MIX A;  2CRF A;  1X1G A;  3PZD A;  2Z13 A;  4QXA B;  1BTK A;  2YS5 A;  2Z59 A;  4HAT B;  2Q13 A;  1XCG A;  2K8E A;  1UPR A;  5D27 A;  1XX0 A;  2YRY A; 
#chains in the Genus database with same CATH homology
 4MK0 A;  2DHK A;  3ODW A;  1EF1 A;  1BTN A;  2EC1 A;  2R0D A;  2W2W A;  2LUL A;  2PZ1 A;  1B55 A;  3HK0 A;  4A6F B;  1FAO A;  4EKU A;  4CHM A;  3PVU A;  1XD4 A;  2COC A;  3A8P A;  2YS3 A;  1FGY A;  3O96 A;  2I1J A;  4KHB B;  2G35 A;  1X86 A;  3CXB B;  3FSS A;  2H7E A;  2OTX A;  4D0N B;  2FJL A;  3KZ1 A;  2V76 A;  1TJ6 A;  1DDM A;  1NTY A;  4KHA A;  2MFQ A;  4YON A;  2KUP A;  2D11 A;  1QQG A;  3WA0 A;  2LKO A;  1MIZ B;  3DXE A;  2RSG A;  2D9W A;  2ELB A;  2J0J A;  4A5K A;  3P7Z A;  4TYZ A;  3M1I B;  1WI1 A;  1FGZ A;  3TFM A;  1GG3 A;  1NU2 A;  1K5G B;  2RNR B;  3G9W A;  1I2H A;  3FEH A;  1WJ1 A;  1KZG A;  1XKE A;  2COA A;  2DLW A;  4HAZ B;  5J3Q A;  3PG7 A;  1I7A A;  2LOX A;  5J3Y A;  2ROV A;  1V5P A;  2D2Q A;  1GC7 A;  1WVH A;  2KGX B;  3LJU X;  1U5F A;  2UZS A;  4K2P A;  3PEG A;  2N23 A;  5CLL B;  4PNK A;  2J0K A;  2IYB A;  5KQ4 A;  2DHJ A;  3SNH A;  2Y7B A;  2JP2 A;  3GYO A;  4HAX B;  1MKE A;  1M7R A;  4EMO A;  4GN1 A;  3DXC A;  3ULB A;  2I5F A;  2GCL A;  2EMT A;  5DH9 B;  4K81 A;  1Y5O A;  4ZRK A;  3ML4 A;  4CHJ A;  1BWN A;  5HE1 A;  3F5R A;  2ELA A;  3FM8 C;  4ZRJ A;  3MDB C;  1UPQ A;  4F7H A;  5LON B;  1N3H A;  1AWE A;  2EMS A;  3PVW A;  1ZVR A;  1J0W A;  1V88 A;  1H4R A;  4BBK A;  2P0F A;  4A6K A;  3RCP A;  5FI0 A;  4HB3 B;  4DXA B;  4B6H A;  3OAN A;  1FHO A;  2COF A;  3QBV B;  3HW2 B;  1ZM0 A;  2ADZ A;  1PFJ A;  1TXD A;  4HHV A;  1UEF A;  3ODO A;  1TQZ A;  4KAX B;  3U7D A;  1X05 A;  2HE7 A;  4Z2M B;  1U2B A;  4L6E A;  2P8V A;  2R09 A;  4A6H A;  1MK9 B;  4H8S A;  4IFS A;  1EGX A;  1NI2 A;  1RJ2 A;  4HB4 B;  4DX9 0;  2YT0 A;  4HDO A;  1GC6 A;  5FI1 A;  1EVH A;  1P5T A;  1FB8 A;  1WJM A;  4HAU B;  1UNP A;  5D3V A;  2X18 A;  2DKQ A;  1J19 A;  5DIF B;  4EJN A;  1EAZ A;  3SO6 A;  2K00 A;  3N7C A;  5D3X A;  4ZRI A;  3P6A A;  4NY0 A;  2UZR A;  3TCA A;  3HQC A;  4GPT B;  1SGH A;  2P0H A;  4CYE A;  4HB0 B;  2DFK A;  3TO1 A;  5C5B A;  4KVG B;  1ZC4 B;  1U27 A;  3F0W A;  1NTV A;  2Z0O A;  3VIA A;  2I1K A;  2QKM A;  3TW1 A;  1W1H A;  1LW3 A;  2M14 A;  1P6S A;  5EFX A;  1V61 A;  2YSZ A;  2LYD A;  4MT7 A;  3SV1 A;  1U5G A;  3BJI A;  3ZDT A;  2K2U A;  2EJ8 A;  1W1G A;  5C6R A;  2OQB A;  1ZC3 B;  1UNQ A;  2DX5 A;  2CAY A;  3V5W A;  2W2X D;  5D3W A;  2J59 M;  2DA0 A;  2DN6 A;  5DI9 B;  5L81 A;  1U29 A;  2Y8F A;  3PSC A;  2I5C A;  5JLJ B;  1PMS A;  4WSF A;  1BAK A;  2YF0 A;  4YL8 A;  2N0Y A;  4Z2N A;  3T06 A;  1XOD A;  2RUK B;  2GCJ A;  1V89 A;  1ZSQ A;  1WG7 A;  2MDX A;  3A98 B;  2ROZ B;  4HAW B;  4HAV B;  3D8D A;  2DX1 A;  4GMV A;  1U5D A;  2MWN B;  5C5B B;  3CIK A;  4K17 A;  1ISN A;  2D9X A;  1OQN A;  1DYN A;  2L2I A;  2RVB B;  3VOQ A;  4MY6 A;  1FOE A;  5JHH A;  4TKN A;  5DHA B;  5HE2 A;  1W1D A;  2D9V A;  2YT1 A;  1Q67 A;  1M7E A;  2GS0 A;  3A8Q A;  5DHF B;  2MKR A;  4C0A A;  3D8F A;  2ZPY A;  2M38 A;  2D10 A;  1FHW A;  1RRP B;  1MAI A;  5J3T A;  4XWX A;  5JHG A;  3QIJ A;  2L1C A;  2YS1 A;  1DRO A;  5HE0 A;  4GXB A;  3ULC A;  2VRW B;  1P3R A;  4HAY B;  1SHC A;  2D9Z A;  2LOZ A;  1KI1 B;  1WGQ A;  3KSY A;  3AU5 A;  3AJ4 A;  5HE3 A;  3KRW A;  3PVL A;  2D9Y A;  1Z87 A;  5GOW B;  1AQC A;  3NSU A;  4WJ7 A;  2UVM A;  2W2X C;  3ZVR A;  1Y19 B;  4Y94 A;  2DYQ A;  5KCV A;  1PLS A;  4WVF B;  3U8Z A;  2DHI A;  4IAP A;  1QC6 A;  3MPX A;  3DXD A;  3KRX A;  1DDV A;  2COD A;  2H7D A;  3KY9 A;  3WYF B;  1OY2 A;  3SUZ A;  3AU4 A;  2NMB A;  2VKI A;  1WGU A;  5C16 A;  5JP4 A;  3D8E A;  3SYX A;  2K2J A;  5D3Y A;  3BIN A;  1V5M A;  2D4Q A;  4DX8 A;  1XR0 B;  2Y8G A;  2P0D A;  1KZ7 A;  2CY4 A;  2DTC A;  2CY5 A;  1OMW A;  1X11 A;  2E2X A;  1K5D B;  1X1F A;  4P7I A;  4DBB A;  4HB2 B;  1E5W A;  2HTH B;  2RLO A;  2NZ8 B;  1DBH A;  2AL6 A;  2J0M A;  2RGN B;  3TVV A;  5LOP B;  4GZU A;  2GJY A;  5CLQ B;  3PP2 A;  4PQ0 A;  2DYN A;  4KHO A;  3X23 A;  3IVF A;  1UNR A;  5C79 A;  2Z0P A;  1IRS A;  1FHX A;  2Z0Q A;  2KCJ A;  1DDW A;  2AEH A;  3QWM A;  4F7U P;  4A6F A;  4K2O A;  5KQ1 A;  4NSW A;  4HDQ A;  4GMX B;  2LG1 A;  1U5E A;  1MK7 B;  1V5U A;  1LB1 A;  4F7G A;  3ODX A;  3UZT A;  3GYP A;  1MPH A;  2YVC A;  2QKL A;  2DKP A;  2VSZ A;  2XQN M;  2IFS A;  4IOY X;  1H10 A;  2BCJ A;  1MIX A;  2CRF A;  1X1G A;  3PZD A;  1BTK A;  2YS5 A;  4HAT B;  2Q13 A;  1XCG A;  1UPR A;  5D27 A;  1XX0 A;  2YRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...