3PP9A

1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
176
Chain Sequence
SLLIRELETNDLDNFPEIDDSFIVNARLMLSLSKVNRRIEYTVEDVPSYEKSYLELVYNEYINKPNQIIYIALLHNQIIGFIVLKKNWNNYAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNMTSDEVAIYWYLHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative streptothricin acetyltransferase
publication title 1.6 Angstrom resolution crystal structure of putative streptothricin acetyltransferase from Bacillus anthracis str. Ames in complex with acetyl coenzyme A
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 39
structure length 176
sequence length 181
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pp9A00
4HNYB 2P6FA 4KVME 1Z4EA 4AG7A 4AVCA 5KTAA 4H6ZA 3EC4A 3TTHA 4CRYB 1KUVA 1S7NA 2CNMA 2J8RA 3FYNA 3PGPA 4U9YA 2B3VA 2PRBA 2G3AA 5F47A 3CXSA 3E0KA 4XPLA 2J8NA 4XNHC 2FXFA 3FRMA 5J8CA 3VWDA 1M4IA 1XMTA 4FD4A 3R9EA 3DNSA 2REFA 2OH1A 4UA3A 3GYAA 2EUIA 5C82A 5KTDA 4IF5A 3LODA 1CM0A 1IB1E 4JJXA 2Z0ZA 2D4PA 3PP9A 5F46A 5JQ4A 2CNSA 2OZUA 1TIQA 5F49A 3EXNA 1B6BA 1M44A 1I21A 3DR6A 3IGRA 4XPDC 2Q04A 3G8WA 3P2HA 4CRZB 3KKWA 2OB0A 3PZJA 1YLEA 4MBUA 3S6FA 1YGHA 3TE4A 1KUXA 2F5IA 4ORFA 1CJWA 3S6HA 4KOYA 3W6SA 5C88A 4AVAA 2G0BA 4U5YA 2BUEA 1LRZA 4CAWA 4NF1A 4KORA 1XE4A 3BJ7A 2OU2A 5F48A 4YGOA 4NEXA 2I00A 2ZW4A 1BO4A 1S3ZA 3JUWA 3EFAA 1RXTA 1WK4A 2ZW5A 5IX3A 2VBQA 4UWJA 4CS0B 2QECA 4QC6A 4YRHA 3W91A 4KOVA 1QSOA 4KOXA 1YX0A 4L8AA 2B4DA 1YVKA 4M85A 4UWIA 3F8KA 4EVYA 4KOWA 1K4JA 3TO6A 2ZXVA 5I0CA 3FBUA 2WPWA 4BMHA 4MJ8A 2R1IA 3TO9A 4QB9A 4R57A 5H84A 1QSNA 2PQ8A 3G3SA 2J8MA 1Y9KA 4OADA 2EVNA 2JDDA 5KTCA 2I79A 4F0YA 3TFYA 4Y49B 1IIDA 3DR8A 3D2MA 2IL4A 5J8FA 2DXQA 1KZFA 1J4JA 4NXYA 4L89A 3TO7A 3SXOA 3CXQA 4AG9A 2GE3A 2D4OA 2K5TA 5HH1A 3TCVA 1XF8A 3F0AA 1M4GA 4J3GA 3OWCA 4E0AA 3SHPA 4M3SA 2HUZA 3FXTA 3R9FA 4ONUA 2B4DB 4AB7A 4ZBGA 4B5PA 4K30A 2P6EA 4JXRA 4KOTA 2ATRA 5IB0A 3R9GA 2PSWA 3S6GA 3DSBA 3DDDA 2ZW7A 5CNPA 2GANA 2Q4YA 2PDOA 4XNHB 2FT0A 3TOBA 3D2PA 1Z4RA 4KUAA 4JXQA 3W6XA 2FIWA 4KOSA 3TOAA 2ARHA 2OZHA 4UBRA 3D8PA 2A4NA 2JDCA 5JPHA 1N71A 2Z10A 1QSRA 2O28A 4GS4A 2Z11A 2BEIA 4X5KA 3F5BA 4NSQA 1KUYA 3I3GA 4XPDB 3UY5A 2G3TA 1WWZA 3R1KA 2R8VA 4I49A 2WPXA 3EY5A 3N7ZA 2RC4A 1MJBA 4KZTA 3V8IA 1BOBA 1NE9A 5E96A 4KVOE 4FD7A 2C27A 2JLMA 1P0HA 3B8GA 2NMTA 2Q0YA 4OLLA 1S7LA 3WR7A 3GY9A 4B5PB 4E2AA 4R87A 3FIXA 1FY7A 2VI7A 4CAVA 2R98A 2VEZA 3T90A 1IICA 4E8OA 4R3LA 5H86A 2Q44A 3LD2A 1Y9WA 1Q2DA 1MJ9A 1MJAA 1Y7RA 1M1DA 2VZYA 2P6GA 2VXKA 4MI4A 3JVNA 2Q7BA 2PR1A 1NSLA 5DWNA 4CAXA 2H5MA 4R9MA 2BSWA 3S6KA 3QB8A 4KVXA 2AE6A 3D3SA 4PK3A 4AVBA 2PR8A 4KLVA 3TT2A 1XEBA 2P0WA 2QMLA 4H6UA 1IYLA 1SQHA 5DWMA 3K9UA 1MK4A 1S7KA 3R95A 4II9A 4RI1A 2R7HA 1Q2CA 4PSXA 1XIXA 1B87A 3P2FA 3FNCA 4KLWA 1M4DA 2B58A 4IUSA 3CXPA 1NMTA 4QVTA 4F6AA 3RYOA 1R57A 5GCNA 2B5GA 2CY2A 3GKRA 1ON0A 3FB3A 4JD6A 2OZGA 4XPKA 1I1DA 2Y0MA 3H4QA 4MHDA 2FE7A 2REEA 3I9SA 3IWGA 1PUAA 4RS2A 1YK3A 1Z9UA 2FSRA 2Q4VA 4NCZA 4R3KA 1Q2YA 2FIAA 3VWEA 3C26A 1UFHA 1YR0A 2AJ6A 1IYKA 4U9ZA 5EBVA 2FS5A 1OZPA 2X7BA 2BL1A 4KUBA 4QUSA 2ZPAA 1S7FA 5FVJA 3BJ8A 2HQYA 1QSMA 2QIRA 4MY0A 5EC4A 1RO5A 2HV2A 4H89A 2B3UA 4HNWB 4HKFA 2PC1A 2VZZA 4JWPA 1S5KA 4PK2A 1YVOA 2B5GB 4FD5A 1I12A 3T9YA 2CNTA 3R96A 4JLYA 2FCKA 5IV0A 2GIVA 4YFJA 3MGDA 1P4NA 4B5OA 1QSTA 1V0CA 3QAHA 4MY3A 1L0CA 4PV6A 2VQYA 4LUAA 2FL4A 2B4BA 2JEVA 4OAEA 4PSWA 1U6MA 1YREA 3ZZIA 2KCWA 1VHSA 4KOUA 1PU9A 4FD6A 2ZW6A 4QBJA 1S60A 4DNCA 3BLNA 4LX9A 4Y49C 5HMNA 3NE7A 3SXNA 1GHEA 5ISVA 3ZJ0A 3EO4A 4HNXB 1VKCA
chains in the Genus database with same CATH superfamily
4HNYB 1AMPA 2P6FA 4PQAA 4ZY2A 1XRYA 1VHOA 5D29A 4KVME 1Z4EA 1CP6A 3SJGA 4AG7A 4H6ZA 4AVCA 5KTAA 4OMEA 3EC4A 3TTHA 4OC1A 2IJZA 2CTCA 5D8NA 2XEFA 1KUVA 1S7NA 2CNMA 2J8RA 3FYNA 4MCQA 3PGPA 4OC3A 4UF4A 4U9YA 2B3VA 3VARA 4DYOA 3WC5A 2PRBA 4PXEA 2BCOA 4R6TA 1TKFA 2G3AA 5F47A 3CXSA 2Q51A 2RB7A 1YSJA 1ELMP 5JGFA 2PJ8A 3FX6A 1TXRA 4M6IA 3NE8A 4KSIA 1PYTB 3A9LA 3E0KA 4XPLA 2AFZA 2J8NA 1TKHA 2FXFA 1H8LA 3FRMA 3HLPA 1M4IA 3QAYA 4XNHC 3VWDA 1XMTA 1YQEA 4NGQA 4A31A 5G22A 4W9YA 4FD4A 3R9EA 1XJOA 5LYIA 3DNSA 1VGYA 1ZG8A 3CZXA 2REFA 2OH1A 4UA3A 3GYAA 2EUIA 5C82A 5KTDA 2JBKA 3LODA 4IF5A 1CM0A 4B6ZA 3RZAA 1IB1E 4JJXA 4CPAA 5JM6A 2Z0ZA 2D4PA 3PP9A 5LRGA 5F46A 7CPAA 5JQ4A 1Z5RA 2CNSA 5AG6A 4BBHA 2OZUA 1BLLE 3T8WA 1TIQA 5F49A 4NGTA 4ZYQA 3PEIA 3EXNA 1ZO0A 1B6BA 1M44A 4A30A 2YNCC 1I21A 3DR6A 3IGRA 4IHMA 4XPDC 2Q04A 3G8WA 3SJXA 3P2HA 4Q38A 4OIDA 3PBEA 5ELYA 4DUKA 4Z65A 2ZEGA 4CRZB 3QNVA 4MMOA 3KKWA 2BO9A 2Z3MA 2PCUA 2OB0A 3PZJA 1YLEA 1RTQA 4MBUA 5J8CA 2HC9A 3S6FA 4TWEA 2PJ3A 1YGHA 2ZEEA 3TE4A 1KUXA 2F5IA 4ORFA 4OC4A 1CJWA 3S6HA 4UEEA 4MFPA 3DGVA 5BWAB 4KOYA 3W6SA 5C88A 4MFJA 3JRUA 3SI2A 2ZENA 2DPSA 4AVAA 2G0BA 1GYTA 2QJ8A 3SI1A 4U5YA 2BUEA 1LRZA 3SJFA 4NF1A 4CAWA 4KORA 1XE4A 2PJ0A 2OU2A 2QYVA 3BJ7A 3BI1A 4MCRA 2ZEPA 5F48A 4YGOA 4NEXA 1CG2A 4ZY1A 1ZLHA 3PB8X 2I00A 2ZW4A 4KS9A 5AGEA 1BO4A 1S3ZA 3PRTA 2CXAA 3TC8A 3KR5A 4NJRA 3JUWA 1IOIA 3GUXA 4C2ZA 3EFAA 4C68A 1RXTA 4F0XA 1WK4A 2ZW5A 3B3CA 5IX3A 1Q7LA 2VBQA 2Z3NA 3RNZA 4UWJA 4ZX9A 4CS0B 2EO8A 1ARLA 5HVGA 2QECA 3V38A 2YNEA 2XEIA 4QC6A 2AFMA 2CIJA 3WABA 4YRHA 3W91A 4KOVA 1QSOA 4KOXA 4MFQA 4A95A 1YX0A 4L8AA 1ELLP 1YVKA 2B4DA 3CT9A 4O23A 4ZX8A 3B2YA 4M85A 4UWIA 4UEZA 5JH9A 1EE3P 1CP7A 3L2NA 3F8KA 4EVYA 4KOWA 4MHYA 4EFDA 1K4JA 1QMUA 3TO6A 4B13A 4P44A 2WYRA 2ZXVA 3SI0A 4X8IA 5G20A 4B11A 5I0CA 3KZWA 4KSFA 3HUVA 2GLFA 3FBUA 2WPWA 2ABZA 3KI9A 4LQGA 4BMHA 2PJBA 4P4BA 3FVLA 2ZEOA 4HPSA 4MJ8A 2R1IA 3TO9A 4QB9A 1Y0RA 3MN8A 2Z3LA 4R57A 3H8GA 4IAVA 5H84A 1FT7A 1QSNA 2PQ8A 3CDXA 3D66A 1JQGA 3G3SA 2J8MA 1UWYA 1Y9KA 1F2PA 5K8NA 4OADA 2EVNA 4R7MA 2JDDA 4Q7AA 4MHZA 2I79A 3LWUA 3B3SA 5KTCA 2ZELA 1PCAA 4F0YA 3S9MA 3TFYA 4Y49B 3TX8A 3FMCA 1IIDA 3DR8A 2J9AA 2WUUA 3D2MA 5K8OA 5AG7A 5LRKA 2IL4A 5G21A 5J8FA 3PB7X 2DXQA 1KZFA 1J4JA 4MHNA 4NXYA 3JTKA 1VIXA 4L89A 5AG4A 4C7IA 2PJ2A 3K2KA 4NJQA 3TO7A 3IJ3A 3SXOA 2YNCA 3CXQA 4MXUA 4CAEA 3N5FA 3K9TA 4AG9A 2GE3A 3NH8A 4NGRA 2D4OA 2K5TA 5HH1A 3TCVA 3RO0A 2EWBA 1XF8A 3F0AA 1M4GA 2HB6A 4EWTA 1OBRA 4J3GA 3OWCA 4GXHA 1QQ9A 4NGMA 4E0AA 2PJ1A 4WJBA 3SHPA 3SJEA 4M3SA 1FNOA 2HUZA 3FXTA 2GREA 3R9FA 2Q43A 4ONUA 1X12A 3WC6A 2DEAA 2B4DB 4AB7A 3IO1A 4ZBGA 4B5PA 4K30A 2ODFA 2P6EA 4JXRA 4KOTA 4CYNA 2ATRA 4ZY0A 5K8PA 5IB0A 3R9GA 5A27A 4OC5A 3D68A 2PSWA 4FWUA 3S6GA 3DSBA 2V8DA 4P4EA 2PVVA 4B10A 4NGSA 3DDDA 1Z8XA 5THWA 4CGMA 2IQ6A 2ZW7A 5CNPA 1F2OA 2GANA 2ZEMA 2Q4YA 2PDOA 4XNHB 5AG5A 2FT0A 3TOBA 4RUHA 3D2PA 5LRJA 6CPAA 1Z4RA 4KUAA 4XPDB 2ZEFA 4JXQA 3W6XA 2FIWA 3IIBA 2XEJA 4KOSA 3MRUA 3CPAA 2NYQA 3TOAA 5DS0A 3GB0A 2ARHA 2OZHA 4UBRA 2JBJA 3D8PA 4UFWA 2A4NA 2JDCA 1YW6A 3BXMA 2PJ7A 4BINA 4IK2A 4CGNA 3ISXA 1N71A 4CGPA 2Z10A 5JPHA 1QSRA 2O28A 3BI0A 4GS4A 2Z11A 2BEIA 4X5KA 4OKOA 2F8HA 1TKJA 2AFWA 3F5BA 4NSQA 4YWYA 1KUYA 2V77A 1CPSA 3I3GA 4K3NA 3KL9A 4NGNA 2G3TA 1R43A 1WWZA 2EBJA 3D67A 3KASA 3UY5A 3R1KA 2R8VA 4I49A 2WPXA 2O4HA 4OP4A 3VH9A 3EY5A 3GIUA 3N7ZA 5LYLA 1LAMA 2RC4A 5LYFA 1MJBA 4CGLA 2QVPA 2Z3OA 4KZTA 4MRIA 3V8IA 4C2XA 1BOBA 1NE9A 5E96A 3BHXA 2GLJA 4NGPA 4KVOE 2Q7SA 4FD7A 3D7FA 3IWEA 4B14A 3PFOA 1YMEA 2C27A 2C6CA 1AYEA 2PJ5A 2JLMA 1P0HA 3B8GA 3D7GA 2NMTA 2Q0YA 3D7HA 4OLLA 1HDUA 1S7LA 3WR7A 2EK9A 4UCMA 1F57A 3GY9A 1YLOA 4B5PB 5CBMA 5EMIA 4E2AA 2PJAA 2C1CA 4R87A 2XEGA 3FIXA 4GM5A 1FY7A 2VI7A 4F9VA 4YU9A 3RAMA 4CAVA 2R98A 2VEZA 1X10A 4UCPA 2DPTA 3T90A 1ZG7A 1IICA 4E8OA 4PXBA 5G1ZA 3NFZA 4X3RA 3I1UA 4R3LA 5H86A 2CTBA 2Q44A 3LD2A 1Q2DA 1Y9WA 1MJ9A 1MJAA 2GU2A 5HXDA 5A28A 1Y7RA 1M1DA 2I3CA 2VZYA 2P6GA 3IC1A 2VXKA 4MI4A 2YGWA 3JVNA 4F8ZA 2Q7BA 4A32A 2PR1A 3WC7A 4M6GA 4A39A 1NSLA 5DWNA 3B3VA 4CAXA 2BOAA 2H5MA 2F7VA 2POKA 3IU1A 2AFOA 3FJUA 3DLJA 4R9MA 2BSWA 3S6KA 3QB8A 2ZOFA 4KVXA 4UIAA 2AE6A 3D3SA 4PK3A 4AVBA 4OC2A 4A2ZA 4H2KA 2PR8A 1Z2LA 4B12A 1ZLIA 4KLVA 3TT2A 2CF4A 1TF8A 5K8MA 5J1QA 1XEBA 2P0WA 1ZG9A 3NH5A 2QMLA 4H6UA 1IYLA 1SQHA 4OIWA 2PJ9A 4FUUA 1XFOA 4KSAA 1VHEA 3K9UA 1MK4A 4MCSA 3B35A 5DWMA 3WT4A 1S7KA 4CAFA 3R95A 4II9A 1IGBA 2JEWA 4RI1A 4JZ0A 2R7HA 1Q2CA 2ZEHA 1XIXA 4PSXA 1NSAA 3ISZA 1B87A 3P2FA 3B3TA 3FNCA 3KQXA 4ZI6A 4KLWA 1M4DA 1IY7A 2B58A 4IUSA 3CXPA 1NMTA 4QVTA 3IFEA 4F6AA 4CYQA 3RYOA 2Q4ZA 1R57A 3B3WA 5GCNA 3KQZA 4BD9A 2OOTA 1A2ZA 3KHXA 3NH4A 2B5GA 1LANA 2PJCA 1XBUA 2C6PA 4CYOA 2V8GA 2CY2A 1IU8A 1Z8TA 4CYPA 3GKRA 2C6GA 2ZOGA 1ON0A 3FB3A 3PFEA 2VL1A 2OZGA 4JD6A 4XPKA 1I1DA 2Y0MA 4A37A 4LQ6A 4A38A 3H4QA 4MHDA 4FAIA 2FE7A 3PBBA 5LYDA 4UFVA 4F9UA 1DE4C 2REEA 3I9SA 2V8HA 3IU2A 3IWGA 1BPNA 1PUAA 3D7DA 4P10A 4RS2A 1YK3A 1ARMA 1Z9UA 2FSRA 5I4MA 3FF3A 3KGQA 1XMBA 2Q4VA 1HEEA 4NCZA 4PPZA 1Q2YA 2FIAA 4R3KA 2IMOA 4WWVA 3C26A 3VWEA 4DJLA 4NFRA 1UFHA 1YR0A 4MCPA 2AJ6A 1IYKA 1M4LA 4U9ZA 1XOVA 5EBVA 2Z3PA 1AUGA 3LMSA 2WZNA 2FS5A 1OZPA 3CPXA 2NSMA 2Z3KA 3FEEA 3KR4A 8CPAA 2X7BA 2BL1A 4A33A 4KUBA 4P4DA 4QUSA 2ZPAA 1S7FA 4P4FA 5FVJA 3H8EA 3PB6X 3BJ8A 2HQYA 2G9DA 3S9LA 1QSMA 1LCPA 4PXDA 2PIYA 2QIRA 4MY0A 2PJ6A 1BAVA 4X2TA 5EC4A 4FBEA 1RO5A 1IOFA 4MFKA 1Z8WA 3IEHA 4CGOA 4UFXA 1LFWA 1TF9A 2HV2A 4H89A 2FVGA 1Y0YA 2B3UA 3FECA 4HNWB 1R3NA 4P45A 5F09A 4HKFA 2GFQA 2PC1A 4MFZA 1CBXA 1LOKA 2VZZA 4UIBA 4JWPA 3H5ZA 5HVFA 3LACA 3V7ZA 4C7HA 3NA6A 1S5KA 4PK2A 4EMEA 4ONWA 4TNUA 4JYWA 1YVOA 2B5GB 3FEDA 4FD5A 2EK8A 1YW4A 1I12A 3T9YA 2CNTA 3R96A 1HDQA 4JLYA 2PVWA 1CX8A 4P4JA 2FCKA 5IV0A 2GIVA 3S9NA 4OC0A 4R8FA 4YFJA 3MGDA 2YNDA 4P6YA 3RBUA 1P4NA 2AFXA 1QSTA 1V0CA 3PB4X 3QAHA 4UCNA 4B5OA 4C2YA 3PB9X 4CRYB 4MY3A 4ZGYB 1L0CA 4PV6A 4A94A 1JWQA 2AFUA 2O53A 2ZEDA 3IWWA 4MHPA 2VQYA 4AXVA 2ANPA 4LUAA 4UEFA 2FL4A 1LAPA 2B4BA 2JEVA 4OAEA 3H8FA 4RN7A 4PSWA 1U6MA 3VATA 2PIZA 1YREA 3ZZIA 2KCWA 3KHZA 1Y7EA 1VHSA 4KOUA 1PU9A 3FH4A 4FD6A 4M6HA 2RFHA 2ZW6A 4QBJA 5HVHA 1S60A 2V8VA 4R76A 4DNCA 3BLNA 1BPMA 4LX9A 4Q36A 4P4IA 2AFSA 1CPXA 4Y49C 5HMNA 5CPAA 1KWMA 1Z8LA 3B7IA 3NE7A 5IB9A 3GLJA 3SXNA 1GHEA 3D4UA 5ISVA 4MFLA 2PJ4A 2PRQA 4PXCA 3ZJ0A 1DTDA 2PE3A 2DF5A 2WSAA 3EO4A 4G1PA 2OR4A 4HNXB 1VKCA
chains in the Genus database with same CATH topology
4HNYB 2P6FA 4KVME 1Z4EA 4AG7A 4AVCA 5KTAA 4H6ZA 3EC4A 3TTHA 4CRYB 1KUVA 1S7NA 2CNMA 2J8RA 3FYNA 3PGPA 4U9YA 2B3VA 2PRBA 2G3AA 5F47A 3CXSA 3A9LA 3E0KA 4XPLA 2J8NA 4XNHC 2FXFA 3FRMA 5J8CA 3VWDA 1M4IA 1XMTA 4A31A 5G22A 4FD4A 3R9EA 3DNSA 2REFA 2OH1A 4UA3A 3GYAA 2EUIA 5C82A 5KTDA 4IF5A 3LODA 1CM0A 1IB1E 4JJXA 2Z0ZA 2D4PA 3PP9A 5F46A 5JQ4A 2CNSA 5AG6A 4BBHA 2OZUA 1TIQA 5F49A 3EXNA 1ZO0A 1B6BA 1M44A 4A30A 2YNCC 1I21A 3DR6A 3IGRA 4XPDC 2Q04A 3G8WA 3P2HA 4Q38A 4CRZB 3KKWA 2Z3MA 2OB0A 3PZJA 1YLEA 4MBUA 3S6FA 1YGHA 3TE4A 1KUXA 2F5IA 4ORFA 1CJWA 3S6HA 4MFPA 5BWAB 4KOYA 3W6SA 5C88A 4MFJA 2DPSA 4AVAA 2G0BA 4U5YA 2BUEA 1LRZA 4CAWA 4NF1A 4KORA 1XE4A 3BJ7A 2OU2A 5F48A 4YGOA 4NEXA 2I00A 2ZW4A 4KS9A 5AGEA 1BO4A 1S3ZA 2CXAA 3JUWA 4C2ZA 3EFAA 4C68A 1RXTA 4F0XA 1WK4A 2ZW5A 5IX3A 2VBQA 2Z3NA 4UWJA 4CS0B 2QECA 2YNEA 4QC6A 4YRHA 3W91A 4KOVA 1QSOA 4KOXA 4MFQA 4A95A 1YX0A 4L8AA 2B4DA 1YVKA 4M85A 4UWIA 3F8KA 4EVYA 4KOWA 1K4JA 3TO6A 4B13A 2ZXVA 5G20A 4B11A 5I0CA 4KSFA 3FBUA 2WPWA 4BMHA 4MJ8A 2R1IA 3TO9A 4QB9A 2Z3LA 4R57A 5H84A 1QSNA 2PQ8A 3G3SA 2J8MA 1Y9KA 4OADA 2EVNA 2JDDA 5KTCA 2I79A 4F0YA 3TFYA 4Y49B 1IIDA 3DR8A 2WUUA 3D2MA 5AG7A 2IL4A 5G21A 5J8FA 2DXQA 1KZFA 1J4JA 4NXYA 3JTKA 4L89A 5AG4A 4C7IA 3TO7A 3SXOA 2YNCA 3CXQA 4CAEA 4AG9A 2GE3A 2D4OA 2K5TA 5HH1A 3TCVA 1XF8A 3F0AA 1M4GA 4J3GA 3OWCA 4E0AA 3SHPA 4M3SA 2HUZA 3FXTA 3R9FA 4ONUA 2B4DB 4AB7A 4ZBGA 4B5PA 4K30A 2P6EA 4CYNA 4JXRA 4KOTA 2ATRA 5IB0A 3R9GA 5A27A 2PSWA 3S6GA 3DSBA 4B10A 3DDDA 4CGMA 2ZW7A 5CNPA 2GANA 2Q4YA 2PDOA 4XNHB 5AG5A 2FT0A 3TOBA 3D2PA 1Z4RA 4KUAA 4JXQA 3W6XA 2FIWA 4KOSA 3TOAA 2ARHA 2OZHA 4UBRA 3D8PA 4UFWA 2A4NA 2JDCA 4CGNA 5JPHA 1N71A 4CGPA 2Z10A 1QSRA 2O28A 4GS4A 2Z11A 2BEIA 4X5KA 3F5BA 4NSQA 1KUYA 3I3GA 4XPDB 3UY5A 2G3TA 1WWZA 3R1KA 2R8VA 4I49A 2WPXA 3EY5A 3N7ZA 2RC4A 1MJBA 4CGLA 2Z3OA 4KZTA 3V8IA 4C2XA 1BOBA 1NE9A 5E96A 4KVOE 4FD7A 3IWEA 4B14A 2C27A 2JLMA 1P0HA 3B8GA 2NMTA 2Q0YA 4OLLA 1S7LA 3WR7A 4UCMA 3GY9A 4B5PB 4E2AA 4R87A 3FIXA 1FY7A 2VI7A 4CAVA 2R98A 2VEZA 4UCPA 2DPTA 3T90A 1IICA 4E8OA 5G1ZA 4R3LA 5H86A 2Q44A 3LD2A 1Y9WA 1Q2DA 1MJ9A 1MJAA 5A28A 1Y7RA 1M1DA 2VZYA 2P6GA 2VXKA 4MI4A 2YGWA 3JVNA 2Q7BA 4A32A 2PR1A 1NSLA 5DWNA 4CAXA 2H5MA 3IU1A 4R9MA 2BSWA 3S6KA 3QB8A 4KVXA 2AE6A 3D3SA 4PK3A 4AVBA 4A2ZA 2PR8A 4B12A 4KLVA 3TT2A 1XEBA 2P0WA 2QMLA 4H6UA 1IYLA 1SQHA 4KSAA 5DWMA 3K9UA 1MK4A 4CAFA 1S7KA 3R95A 4II9A 4RI1A 2R7HA 1Q2CA 4PSXA 1XIXA 1B87A 3P2FA 3FNCA 4KLWA 1M4DA 2B58A 4IUSA 3CXPA 1NMTA 4QVTA 4F6AA 4CYQA 3RYOA 1R57A 5GCNA 2B5GA 4CYOA 2CY2A 4CYPA 3GKRA 1ON0A 3FB3A 4JD6A 2OZGA 4XPKA 1I1DA 2Y0MA 3H4QA 4MHDA 2FE7A 4UFVA 2REEA 3I9SA 3IWGA 3IU2A 1PUAA 4RS2A 1YK3A 1Z9UA 2FSRA 2Q4VA 4NCZA 4R3KA 1Q2YA 2FIAA 3VWEA 3C26A 1UFHA 1YR0A 2AJ6A 1IYKA 4U9ZA 5EBVA 2Z3PA 2FS5A 1OZPA 2Z3KA 2X7BA 2BL1A 4A33A 4KUBA 4QUSA 2ZPAA 1S7FA 5FVJA 3BJ8A 2HQYA 1QSMA 2QIRA 4MY0A 5EC4A 1RO5A 4MFKA 4CGOA 4UFXA 2HV2A 4H89A 2B3UA 4HNWB 4HKFA 2PC1A 4MFZA 2VZZA 4JWPA 3H5ZA 4C7HA 1S5KA 4PK2A 1YVOA 2B5GB 4FD5A 1I12A 3T9YA 2CNTA 3R96A 4JLYA 2FCKA 5IV0A 2GIVA 4YFJA 3MGDA 2YNDA 1P4NA 4UCNA 1QSTA 1V0CA 4B5OA 3QAHA 4C2YA 4MY3A 4ZGYB 1L0CA 4PV6A 2VQYA 4LUAA 2FL4A 2B4BA 2JEVA 4OAEA 4PSWA 1U6MA 1YREA 3ZZIA 2KCWA 1VHSA 4KOUA 1PU9A 4FD6A 2ZW6A 4QBJA 1S60A 4DNCA 3BLNA 4LX9A 4Q36A 4Y49C 5HMNA 3NE7A 3SXNA 1GHEA 5ISVA 4MFLA 3ZJ0A 2WSAA 3EO4A 4HNXB 1VKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNY B;  2P6F A;  4KVM E;  1Z4E A;  4AG7 A;  4AVC A;  5KTA A;  4H6Z A;  3EC4 A;  3TTH A;  4CRY B;  1KUV A;  1S7N A;  2CNM A;  2J8R A;  3FYN A;  3PGP A;  4U9Y A;  2B3V A;  2PRB A;  2G3A A;  5F47 A;  3CXS A;  3E0K A;  4XPL A;  2J8N A;  4XNH C;  2FXF A;  3FRM A;  5J8C A;  3VWD A;  1M4I A;  1XMT A;  4FD4 A;  3R9E A;  3DNS A;  2REF A;  2OH1 A;  4UA3 A;  3GYA A;  2EUI A;  5C82 A;  5KTD A;  4IF5 A;  3LOD A;  1CM0 A;  1IB1 E;  4JJX A;  2Z0Z A;  2D4P A;  3PP9 A;  5F46 A;  5JQ4 A;  2CNS A;  2OZU A;  1TIQ A;  5F49 A;  3EXN A;  1B6B A;  1M44 A;  1I21 A;  3DR6 A;  3IGR A;  4XPD C;  2Q04 A;  3G8W A;  3P2H A;  4CRZ B;  3KKW A;  2OB0 A;  3PZJ A;  1YLE A;  4MBU A;  3S6F A;  1YGH A;  3TE4 A;  1KUX A;  2F5I A;  4ORF A;  1CJW A;  3S6H A;  4KOY A;  3W6S A;  5C88 A;  4AVA A;  2G0B A;  4U5Y A;  2BUE A;  1LRZ A;  4CAW A;  4NF1 A;  4KOR A;  1XE4 A;  3BJ7 A;  2OU2 A;  5F48 A;  4YGO A;  4NEX A;  2I00 A;  2ZW4 A;  1BO4 A;  1S3Z A;  3JUW A;  3EFA A;  1RXT A;  1WK4 A;  2ZW5 A;  5IX3 A;  2VBQ A;  4UWJ A;  4CS0 B;  2QEC A;  4QC6 A;  4YRH A;  3W91 A;  4KOV A;  1QSO A;  4KOX A;  1YX0 A;  4L8A A;  2B4D A;  1YVK A;  4M85 A;  4UWI A;  3F8K A;  4EVY A;  4KOW A;  1K4J A;  3TO6 A;  2ZXV A;  5I0C A;  3FBU A;  2WPW A;  4BMH A;  4MJ8 A;  2R1I A;  3TO9 A;  4QB9 A;  4R57 A;  5H84 A;  1QSN A;  2PQ8 A;  3G3S A;  2J8M A;  1Y9K A;  4OAD A;  2EVN A;  2JDD A;  5KTC A;  2I79 A;  4F0Y A;  3TFY A;  4Y49 B;  1IID A;  3DR8 A;  3D2M A;  2IL4 A;  5J8F A;  2DXQ A;  1KZF A;  1J4J A;  4NXY A;  4L89 A;  3TO7 A;  3SXO A;  3CXQ A;  4AG9 A;  2GE3 A;  2D4O A;  2K5T A;  5HH1 A;  3TCV A;  1XF8 A;  3F0A A;  1M4G A;  4J3G A;  3OWC A;  4E0A A;  3SHP A;  4M3S A;  2HUZ A;  3FXT A;  3R9F A;  4ONU A;  2B4D B;  4AB7 A;  4ZBG A;  4B5P A;  4K30 A;  2P6E A;  4JXR A;  4KOT A;  2ATR A;  5IB0 A;  3R9G A;  2PSW A;  3S6G A;  3DSB A;  3DDD A;  2ZW7 A;  5CNP A;  2GAN A;  2Q4Y A;  2PDO A;  4XNH B;  2FT0 A;  3TOB A;  3D2P A;  1Z4R A;  4KUA A;  4JXQ A;  3W6X A;  2FIW A;  4KOS A;  3TOA A;  2ARH A;  2OZH A;  4UBR A;  3D8P A;  2A4N A;  2JDC A;  5JPH A;  1N71 A;  2Z10 A;  1QSR A;  2O28 A;  4GS4 A;  2Z11 A;  2BEI A;  4X5K A;  3F5B A;  4NSQ A;  1KUY A;  3I3G A;  4XPD B;  3UY5 A;  2G3T A;  1WWZ A;  3R1K A;  2R8V A;  4I49 A;  2WPX A;  3EY5 A;  3N7Z A;  2RC4 A;  1MJB A;  4KZT A;  3V8I A;  1BOB A;  1NE9 A;  5E96 A;  4KVO E;  4FD7 A;  2C27 A;  2JLM A;  1P0H A;  3B8G A;  2NMT A;  2Q0Y A;  4OLL A;  1S7L A;  3WR7 A;  3GY9 A;  4B5P B;  4E2A A;  4R87 A;  3FIX A;  1FY7 A;  2VI7 A;  4CAV A;  2R98 A;  2VEZ A;  3T90 A;  1IIC A;  4E8O A;  4R3L A;  5H86 A;  2Q44 A;  3LD2 A;  1Y9W A;  1Q2D A;  1MJ9 A;  1MJA A;  1Y7R A;  1M1D A;  2VZY A;  2P6G A;  2VXK A;  4MI4 A;  3JVN A;  2Q7B A;  2PR1 A;  1NSL A;  5DWN A;  4CAX A;  2H5M A;  4R9M A;  2BSW A;  3S6K A;  3QB8 A;  4KVX A;  2AE6 A;  3D3S A;  4PK3 A;  4AVB A;  2PR8 A;  4KLV A;  3TT2 A;  1XEB A;  2P0W A;  2QML A;  4H6U A;  1IYL A;  1SQH A;  5DWM A;  3K9U A;  1MK4 A;  1S7K A;  3R95 A;  4II9 A;  4RI1 A;  2R7H A;  1Q2C A;  4PSX A;  1XIX A;  1B87 A;  3P2F A;  3FNC A;  4KLW A;  1M4D A;  2B58 A;  4IUS A;  3CXP A;  1NMT A;  4QVT A;  4F6A A;  3RYO A;  1R57 A;  5GCN A;  2B5G A;  2CY2 A;  3GKR A;  1ON0 A;  3FB3 A;  4JD6 A;  2OZG A;  4XPK A;  1I1D A;  2Y0M A;  3H4Q A;  4MHD A;  2FE7 A;  2REE A;  3I9S A;  3IWG A;  1PUA A;  4RS2 A;  1YK3 A;  1Z9U A;  2FSR A;  2Q4V A;  4NCZ A;  4R3K A;  1Q2Y A;  2FIA A;  3VWE A;  3C26 A;  1UFH A;  1YR0 A;  2AJ6 A;  1IYK A;  4U9Z A;  5EBV A;  2FS5 A;  1OZP A;  2X7B A;  2BL1 A;  4KUB A;  4QUS A;  2ZPA A;  1S7F A;  5FVJ A;  3BJ8 A;  2HQY A;  1QSM A;  2QIR A;  4MY0 A;  5EC4 A;  1RO5 A;  2HV2 A;  4H89 A;  2B3U A;  4HNW B;  4HKF A;  2PC1 A;  2VZZ A;  4JWP A;  1S5K A;  4PK2 A;  1YVO A;  2B5G B;  4FD5 A;  1I12 A;  3T9Y A;  2CNT A;  3R96 A;  4JLY A;  2FCK A;  5IV0 A;  2GIV A;  4YFJ A;  3MGD A;  1P4N A;  4B5O A;  1QST A;  1V0C A;  3QAH A;  4MY3 A;  1L0C A;  4PV6 A;  2VQY A;  4LUA A;  2FL4 A;  2B4B A;  2JEV A;  4OAE A;  4PSW A;  1U6M A;  1YRE A;  3ZZI A;  2KCW A;  1VHS A;  4KOU A;  1PU9 A;  4FD6 A;  2ZW6 A;  4QBJ A;  1S60 A;  4DNC A;  3BLN A;  4LX9 A;  4Y49 C;  5HMN A;  3NE7 A;  3SXN A;  1GHE A;  5ISV A;  3ZJ0 A;  3EO4 A;  4HNX B;  1VKC A; 
#chains in the Genus database with same CATH topology
 4HNY B;  1AMP A;  2P6F A;  4PQA A;  4ZY2 A;  1XRY A;  1VHO A;  5D29 A;  4KVM E;  1Z4E A;  1CP6 A;  3SJG A;  4AG7 A;  4H6Z A;  4AVC A;  5KTA A;  4OME A;  3EC4 A;  3TTH A;  4OC1 A;  2IJZ A;  2CTC A;  5D8N A;  2XEF A;  1KUV A;  1S7N A;  2CNM A;  2J8R A;  3FYN A;  4MCQ A;  3PGP A;  4OC3 A;  4UF4 A;  4U9Y A;  2B3V A;  3VAR A;  4DYO A;  3WC5 A;  2PRB A;  4PXE A;  2BCO A;  4R6T A;  1TKF A;  2G3A A;  5F47 A;  3CXS A;  2Q51 A;  2RB7 A;  1YSJ A;  1ELM P;  5JGF A;  2PJ8 A;  3FX6 A;  1TXR A;  4M6I A;  3NE8 A;  4KSI A;  1PYT B;  3A9L A;  3E0K A;  4XPL A;  2AFZ A;  2J8N A;  1TKH A;  2FXF A;  1H8L A;  3FRM A;  3HLP A;  1M4I A;  3QAY A;  4XNH C;  3VWD A;  1XMT A;  1YQE A;  4NGQ A;  4A31 A;  5G22 A;  4W9Y A;  4FD4 A;  3R9E A;  1XJO A;  5LYI A;  3DNS A;  1VGY A;  1ZG8 A;  3CZX A;  2REF A;  2OH1 A;  4UA3 A;  3GYA A;  2EUI A;  5C82 A;  5KTD A;  2JBK A;  3LOD A;  4IF5 A;  1CM0 A;  4B6Z A;  3RZA A;  1IB1 E;  4JJX A;  4CPA A;  5JM6 A;  2Z0Z A;  2D4P A;  3PP9 A;  5LRG A;  5F46 A;  7CPA A;  5JQ4 A;  1Z5R A;  2CNS A;  5AG6 A;  4BBH A;  2OZU A;  1BLL E;  3T8W A;  1TIQ A;  5F49 A;  4NGT A;  4ZYQ A;  3PEI A;  3EXN A;  1ZO0 A;  1B6B A;  1M44 A;  4A30 A;  2YNC C;  1I21 A;  3DR6 A;  3IGR A;  4IHM A;  4XPD C;  2Q04 A;  3G8W A;  3SJX A;  3P2H A;  4Q38 A;  4OID A;  3PBE A;  5ELY A;  4DUK A;  4Z65 A;  2ZEG A;  4CRZ B;  3QNV A;  4MMO A;  3KKW A;  2BO9 A;  2Z3M A;  2PCU A;  2OB0 A;  3PZJ A;  1YLE A;  1RTQ A;  4MBU A;  5J8C A;  2HC9 A;  3S6F A;  4TWE A;  2PJ3 A;  1YGH A;  2ZEE A;  3TE4 A;  1KUX A;  2F5I A;  4ORF A;  4OC4 A;  1CJW A;  3S6H A;  4UEE A;  4MFP A;  3DGV A;  5BWA B;  4KOY A;  3W6S A;  5C88 A;  4MFJ A;  3JRU A;  3SI2 A;  2ZEN A;  2DPS A;  4AVA A;  2G0B A;  1GYT A;  2QJ8 A;  3SI1 A;  4U5Y A;  2BUE A;  1LRZ A;  3SJF A;  4NF1 A;  4CAW A;  4KOR A;  1XE4 A;  2PJ0 A;  2OU2 A;  2QYV A;  3BJ7 A;  3BI1 A;  4MCR A;  2ZEP A;  5F48 A;  4YGO A;  4NEX A;  1CG2 A;  4ZY1 A;  1ZLH A;  3PB8 X;  2I00 A;  2ZW4 A;  4KS9 A;  5AGE A;  1BO4 A;  1S3Z A;  3PRT A;  2CXA A;  3TC8 A;  3KR5 A;  4NJR A;  3JUW A;  1IOI A;  3GUX A;  4C2Z A;  3EFA A;  4C68 A;  1RXT A;  4F0X A;  1WK4 A;  2ZW5 A;  3B3C A;  5IX3 A;  1Q7L A;  2VBQ A;  2Z3N A;  3RNZ A;  4UWJ A;  4ZX9 A;  4CS0 B;  2EO8 A;  1ARL A;  5HVG A;  2QEC A;  3V38 A;  2YNE A;  2XEI A;  4QC6 A;  2AFM A;  2CIJ A;  3WAB A;  4YRH A;  3W91 A;  4KOV A;  1QSO A;  4KOX A;  4MFQ A;  4A95 A;  1YX0 A;  4L8A A;  1ELL P;  1YVK A;  2B4D A;  3CT9 A;  4O23 A;  4ZX8 A;  3B2Y A;  4M85 A;  4UWI A;  4UEZ A;  5JH9 A;  1EE3 P;  1CP7 A;  3L2N A;  3F8K A;  4EVY A;  4KOW A;  4MHY A;  4EFD A;  1K4J A;  1QMU A;  3TO6 A;  4B13 A;  4P44 A;  2WYR A;  2ZXV A;  3SI0 A;  4X8I A;  5G20 A;  4B11 A;  5I0C A;  3KZW A;  4KSF A;  3HUV A;  2GLF A;  3FBU A;  2WPW A;  2ABZ A;  3KI9 A;  4LQG A;  4BMH A;  2PJB A;  4P4B A;  3FVL A;  2ZEO A;  4HPS A;  4MJ8 A;  2R1I A;  3TO9 A;  4QB9 A;  1Y0R A;  3MN8 A;  2Z3L A;  4R57 A;  3H8G A;  4IAV A;  5H84 A;  1FT7 A;  1QSN A;  2PQ8 A;  3CDX A;  3D66 A;  1JQG A;  3G3S A;  2J8M A;  1UWY A;  1Y9K A;  1F2P A;  5K8N A;  4OAD A;  2EVN A;  4R7M A;  2JDD A;  4Q7A A;  4MHZ A;  2I79 A;  3LWU A;  3B3S A;  5KTC A;  2ZEL A;  1PCA A;  4F0Y A;  3S9M A;  3TFY A;  4Y49 B;  3TX8 A;  3FMC A;  1IID A;  3DR8 A;  2J9A A;  2WUU A;  3D2M A;  5K8O A;  5AG7 A;  5LRK A;  2IL4 A;  5G21 A;  5J8F A;  3PB7 X;  2DXQ A;  1KZF A;  1J4J A;  4MHN A;  4NXY A;  3JTK A;  1VIX A;  4L89 A;  5AG4 A;  4C7I A;  2PJ2 A;  3K2K A;  4NJQ A;  3TO7 A;  3IJ3 A;  3SXO A;  2YNC A;  3CXQ A;  4MXU A;  4CAE A;  3N5F A;  3K9T A;  4AG9 A;  2GE3 A;  3NH8 A;  4NGR A;  2D4O A;  2K5T A;  5HH1 A;  3TCV A;  3RO0 A;  2EWB A;  1XF8 A;  3F0A A;  1M4G A;  2HB6 A;  4EWT A;  1OBR A;  4J3G A;  3OWC A;  4GXH A;  1QQ9 A;  4NGM A;  4E0A A;  2PJ1 A;  4WJB A;  3SHP A;  3SJE A;  4M3S A;  1FNO A;  2HUZ A;  3FXT A;  2GRE A;  3R9F A;  2Q43 A;  4ONU A;  1X12 A;  3WC6 A;  2DEA A;  2B4D B;  4AB7 A;  3IO1 A;  4ZBG A;  4B5P A;  4K30 A;  2ODF A;  2P6E A;  4JXR A;  4KOT A;  4CYN A;  2ATR A;  4ZY0 A;  5K8P A;  5IB0 A;  3R9G A;  5A27 A;  4OC5 A;  3D68 A;  2PSW A;  4FWU A;  3S6G A;  3DSB A;  2V8D A;  4P4E A;  2PVV A;  4B10 A;  4NGS A;  3DDD A;  1Z8X A;  5THW A;  4CGM A;  2IQ6 A;  2ZW7 A;  5CNP A;  1F2O A;  2GAN A;  2ZEM A;  2Q4Y A;  2PDO A;  4XNH B;  5AG5 A;  2FT0 A;  3TOB A;  4RUH A;  3D2P A;  5LRJ A;  6CPA A;  1Z4R A;  4KUA A;  4XPD B;  2ZEF A;  4JXQ A;  3W6X A;  2FIW A;  3IIB A;  2XEJ A;  4KOS A;  3MRU A;  3CPA A;  2NYQ A;  3TOA A;  5DS0 A;  3GB0 A;  2ARH A;  2OZH A;  4UBR A;  2JBJ A;  3D8P A;  4UFW A;  2A4N A;  2JDC A;  1YW6 A;  3BXM A;  2PJ7 A;  4BIN A;  4IK2 A;  4CGN A;  3ISX A;  1N71 A;  4CGP A;  2Z10 A;  5JPH A;  1QSR A;  2O28 A;  3BI0 A;  4GS4 A;  2Z11 A;  2BEI A;  4X5K A;  4OKO A;  2F8H A;  1TKJ A;  2AFW A;  3F5B A;  4NSQ A;  4YWY A;  1KUY A;  2V77 A;  1CPS A;  3I3G A;  4K3N A;  3KL9 A;  4NGN A;  2G3T A;  1R43 A;  1WWZ A;  2EBJ A;  3D67 A;  3KAS A;  3UY5 A;  3R1K A;  2R8V A;  4I49 A;  2WPX A;  2O4H A;  4OP4 A;  3VH9 A;  3EY5 A;  3GIU A;  3N7Z A;  5LYL A;  1LAM A;  2RC4 A;  5LYF A;  1MJB A;  4CGL A;  2QVP A;  2Z3O A;  4KZT A;  4MRI A;  3V8I A;  4C2X A;  1BOB A;  1NE9 A;  5E96 A;  3BHX A;  2GLJ A;  4NGP A;  4KVO E;  2Q7S A;  4FD7 A;  3D7F A;  3IWE A;  4B14 A;  3PFO A;  1YME A;  2C27 A;  2C6C A;  1AYE A;  2PJ5 A;  2JLM A;  1P0H A;  3B8G A;  3D7G A;  2NMT A;  2Q0Y A;  3D7H A;  4OLL A;  1HDU A;  1S7L A;  3WR7 A;  2EK9 A;  4UCM A;  1F57 A;  3GY9 A;  1YLO A;  4B5P B;  5CBM A;  5EMI A;  4E2A A;  2PJA A;  2C1C A;  4R87 A;  2XEG A;  3FIX A;  4GM5 A;  1FY7 A;  2VI7 A;  4F9V A;  4YU9 A;  3RAM A;  4CAV A;  2R98 A;  2VEZ A;  1X10 A;  4UCP A;  2DPT A;  3T90 A;  1ZG7 A;  1IIC A;  4E8O A;  4PXB A;  5G1Z A;  3NFZ A;  4X3R A;  3I1U A;  4R3L A;  5H86 A;  2CTB A;  2Q44 A;  3LD2 A;  1Q2D A;  1Y9W A;  1MJ9 A;  1MJA A;  2GU2 A;  5HXD A;  5A28 A;  1Y7R A;  1M1D A;  2I3C A;  2VZY A;  2P6G A;  3IC1 A;  2VXK A;  4MI4 A;  2YGW A;  3JVN A;  4F8Z A;  2Q7B A;  4A32 A;  2PR1 A;  3WC7 A;  4M6G A;  4A39 A;  1NSL A;  5DWN A;  3B3V A;  4CAX A;  2BOA A;  2H5M A;  2F7V A;  2POK A;  3IU1 A;  2AFO A;  3FJU A;  3DLJ A;  4R9M A;  2BSW A;  3S6K A;  3QB8 A;  2ZOF A;  4KVX A;  4UIA A;  2AE6 A;  3D3S A;  4PK3 A;  4AVB A;  4OC2 A;  4A2Z A;  4H2K A;  2PR8 A;  1Z2L A;  4B12 A;  1ZLI A;  4KLV A;  3TT2 A;  2CF4 A;  1TF8 A;  5K8M A;  5J1Q A;  1XEB A;  2P0W A;  1ZG9 A;  3NH5 A;  2QML A;  4H6U A;  1IYL A;  1SQH A;  4OIW A;  2PJ9 A;  4FUU A;  1XFO A;  4KSA A;  1VHE A;  3K9U A;  1MK4 A;  4MCS A;  3B35 A;  5DWM A;  3WT4 A;  1S7K A;  4CAF A;  3R95 A;  4II9 A;  1IGB A;  2JEW A;  4RI1 A;  4JZ0 A;  2R7H A;  1Q2C A;  2ZEH A;  1XIX A;  4PSX A;  1NSA A;  3ISZ A;  1B87 A;  3P2F A;  3B3T A;  3FNC A;  3KQX A;  4ZI6 A;  4KLW A;  1M4D A;  1IY7 A;  2B58 A;  4IUS A;  3CXP A;  1NMT A;  4QVT A;  3IFE A;  4F6A A;  4CYQ A;  3RYO A;  2Q4Z A;  1R57 A;  3B3W A;  5GCN A;  3KQZ A;  4BD9 A;  2OOT A;  1A2Z A;  3KHX A;  3NH4 A;  2B5G A;  1LAN A;  2PJC A;  1XBU A;  2C6P A;  4CYO A;  2V8G A;  2CY2 A;  1IU8 A;  1Z8T A;  4CYP A;  3GKR A;  2C6G A;  2ZOG A;  1ON0 A;  3FB3 A;  3PFE A;  2VL1 A;  2OZG A;  4JD6 A;  4XPK A;  1I1D A;  2Y0M A;  4A37 A;  4LQ6 A;  4A38 A;  3H4Q A;  4MHD A;  4FAI A;  2FE7 A;  3PBB A;  5LYD A;  4UFV A;  4F9U A;  1DE4 C;  2REE A;  3I9S A;  2V8H A;  3IU2 A;  3IWG A;  1BPN A;  1PUA A;  3D7D A;  4P10 A;  4RS2 A;  1YK3 A;  1ARM A;  1Z9U A;  2FSR A;  5I4M A;  3FF3 A;  3KGQ A;  1XMB A;  2Q4V A;  1HEE A;  4NCZ A;  4PPZ A;  1Q2Y A;  2FIA A;  4R3K A;  2IMO A;  4WWV A;  3C26 A;  3VWE A;  4DJL A;  4NFR A;  1UFH A;  1YR0 A;  4MCP A;  2AJ6 A;  1IYK A;  1M4L A;  4U9Z A;  1XOV A;  5EBV A;  2Z3P A;  1AUG A;  3LMS A;  2WZN A;  2FS5 A;  1OZP A;  3CPX A;  2NSM A;  2Z3K A;  3FEE A;  3KR4 A;  8CPA A;  2X7B A;  2BL1 A;  4A33 A;  4KUB A;  4P4D A;  4QUS A;  2ZPA A;  1S7F A;  4P4F A;  5FVJ A;  3H8E A;  3PB6 X;  3BJ8 A;  2HQY A;  2G9D A;  3S9L A;  1QSM A;  1LCP A;  4PXD A;  2PIY A;  2QIR A;  4MY0 A;  2PJ6 A;  1BAV A;  4X2T A;  5EC4 A;  4FBE A;  1RO5 A;  1IOF A;  4MFK A;  1Z8W A;  3IEH A;  4CGO A;  4UFX A;  1LFW A;  1TF9 A;  2HV2 A;  4H89 A;  2FVG A;  1Y0Y A;  2B3U A;  3FEC A;  4HNW B;  1R3N A;  4P45 A;  5F09 A;  4HKF A;  2GFQ A;  2PC1 A;  4MFZ A;  1CBX A;  1LOK A;  2VZZ A;  4UIB A;  4JWP A;  3H5Z A;  5HVF A;  3LAC A;  3V7Z A;  4C7H A;  3NA6 A;  1S5K A;  4PK2 A;  4EME A;  4ONW A;  4TNU A;  4JYW A;  1YVO A;  2B5G B;  3FED A;  4FD5 A;  2EK8 A;  1YW4 A;  1I12 A;  3T9Y A;  2CNT A;  3R96 A;  1HDQ A;  4JLY A;  2PVW A;  1CX8 A;  4P4J A;  2FCK A;  5IV0 A;  2GIV A;  3S9N A;  4OC0 A;  4R8F A;  4YFJ A;  3MGD A;  2YND A;  4P6Y A;  3RBU A;  1P4N A;  2AFX A;  1QST A;  1V0C A;  3PB4 X;  3QAH A;  4UCN A;  4B5O A;  4C2Y A;  3PB9 X;  4CRY B;  4MY3 A;  4ZGY B;  1L0C A;  4PV6 A;  4A94 A;  1JWQ A;  2AFU A;  2O53 A;  2ZED A;  3IWW A;  4MHP A;  2VQY A;  4AXV A;  2ANP A;  4LUA A;  4UEF A;  2FL4 A;  1LAP A;  2B4B A;  2JEV A;  4OAE A;  3H8F A;  4RN7 A;  4PSW A;  1U6M A;  3VAT A;  2PIZ A;  1YRE A;  3ZZI A;  2KCW A;  3KHZ A;  1Y7E A;  1VHS A;  4KOU A;  1PU9 A;  3FH4 A;  4FD6 A;  4M6H A;  2RFH A;  2ZW6 A;  4QBJ A;  5HVH A;  1S60 A;  2V8V A;  4R76 A;  4DNC A;  3BLN A;  1BPM A;  4LX9 A;  4Q36 A;  4P4I A;  2AFS A;  1CPX A;  4Y49 C;  5HMN A;  5CPA A;  1KWM A;  1Z8L A;  3B7I A;  3NE7 A;  5IB9 A;  3GLJ A;  3SXN A;  1GHE A;  3D4U A;  5ISV A;  4MFL A;  2PJ4 A;  2PRQ A;  4PXC A;  3ZJ0 A;  1DTD A;  2PE3 A;  2DF5 A;  2WSA A;  3EO4 A;  4G1P A;  2OR4 A;  4HNX B;  1VKC A; 
#chains in the Genus database with same CATH homology
 4HNY B;  2P6F A;  4KVM E;  1Z4E A;  4AG7 A;  4AVC A;  5KTA A;  4H6Z A;  3EC4 A;  3TTH A;  4CRY B;  1KUV A;  1S7N A;  2CNM A;  2J8R A;  3FYN A;  3PGP A;  4U9Y A;  2B3V A;  2PRB A;  2G3A A;  5F47 A;  3CXS A;  3A9L A;  3E0K A;  4XPL A;  2J8N A;  4XNH C;  2FXF A;  3FRM A;  5J8C A;  3VWD A;  1M4I A;  1XMT A;  4A31 A;  5G22 A;  4FD4 A;  3R9E A;  3DNS A;  2REF A;  2OH1 A;  4UA3 A;  3GYA A;  2EUI A;  5C82 A;  5KTD A;  4IF5 A;  3LOD A;  1CM0 A;  1IB1 E;  4JJX A;  2Z0Z A;  2D4P A;  3PP9 A;  5F46 A;  5JQ4 A;  2CNS A;  5AG6 A;  4BBH A;  2OZU A;  1TIQ A;  5F49 A;  3EXN A;  1ZO0 A;  1B6B A;  1M44 A;  4A30 A;  2YNC C;  1I21 A;  3DR6 A;  3IGR A;  4XPD C;  2Q04 A;  3G8W A;  3P2H A;  4Q38 A;  4CRZ B;  3KKW A;  2Z3M A;  2OB0 A;  3PZJ A;  1YLE A;  4MBU A;  3S6F A;  1YGH A;  3TE4 A;  1KUX A;  2F5I A;  4ORF A;  1CJW A;  3S6H A;  4MFP A;  5BWA B;  4KOY A;  3W6S A;  5C88 A;  4MFJ A;  2DPS A;  4AVA A;  2G0B A;  4U5Y A;  2BUE A;  1LRZ A;  4CAW A;  4NF1 A;  4KOR A;  1XE4 A;  3BJ7 A;  2OU2 A;  5F48 A;  4YGO A;  4NEX A;  2I00 A;  2ZW4 A;  4KS9 A;  5AGE A;  1BO4 A;  1S3Z A;  2CXA A;  3JUW A;  4C2Z A;  3EFA A;  4C68 A;  1RXT A;  4F0X A;  1WK4 A;  2ZW5 A;  5IX3 A;  2VBQ A;  2Z3N A;  4UWJ A;  4CS0 B;  2QEC A;  2YNE A;  4QC6 A;  4YRH A;  3W91 A;  4KOV A;  1QSO A;  4KOX A;  4MFQ A;  4A95 A;  1YX0 A;  4L8A A;  2B4D A;  1YVK A;  4M85 A;  4UWI A;  3F8K A;  4EVY A;  4KOW A;  1K4J A;  3TO6 A;  4B13 A;  2ZXV A;  5G20 A;  4B11 A;  5I0C A;  4KSF A;  3FBU A;  2WPW A;  4BMH A;  4MJ8 A;  2R1I A;  3TO9 A;  4QB9 A;  2Z3L A;  4R57 A;  5H84 A;  1QSN A;  2PQ8 A;  3G3S A;  2J8M A;  1Y9K A;  4OAD A;  2EVN A;  2JDD A;  5KTC A;  2I79 A;  4F0Y A;  3TFY A;  4Y49 B;  1IID A;  3DR8 A;  2WUU A;  3D2M A;  5AG7 A;  2IL4 A;  5G21 A;  5J8F A;  2DXQ A;  1KZF A;  1J4J A;  4NXY A;  3JTK A;  4L89 A;  5AG4 A;  4C7I A;  3TO7 A;  3SXO A;  2YNC A;  3CXQ A;  4CAE A;  4AG9 A;  2GE3 A;  2D4O A;  2K5T A;  5HH1 A;  3TCV A;  1XF8 A;  3F0A A;  1M4G A;  4J3G A;  3OWC A;  4E0A A;  3SHP A;  4M3S A;  2HUZ A;  3FXT A;  3R9F A;  4ONU A;  2B4D B;  4AB7 A;  4ZBG A;  4B5P A;  4K30 A;  2P6E A;  4CYN A;  4JXR A;  4KOT A;  2ATR A;  5IB0 A;  3R9G A;  5A27 A;  2PSW A;  3S6G A;  3DSB A;  4B10 A;  3DDD A;  4CGM A;  2ZW7 A;  5CNP A;  2GAN A;  2Q4Y A;  2PDO A;  4XNH B;  5AG5 A;  2FT0 A;  3TOB A;  3D2P A;  1Z4R A;  4KUA A;  4JXQ A;  3W6X A;  2FIW A;  4KOS A;  3TOA A;  2ARH A;  2OZH A;  4UBR A;  3D8P A;  4UFW A;  2A4N A;  2JDC A;  4CGN A;  5JPH A;  1N71 A;  4CGP A;  2Z10 A;  1QSR A;  2O28 A;  4GS4 A;  2Z11 A;  2BEI A;  4X5K A;  3F5B A;  4NSQ A;  1KUY A;  3I3G A;  4XPD B;  3UY5 A;  2G3T A;  1WWZ A;  3R1K A;  2R8V A;  4I49 A;  2WPX A;  3EY5 A;  3N7Z A;  2RC4 A;  1MJB A;  4CGL A;  2Z3O A;  4KZT A;  3V8I A;  4C2X A;  1BOB A;  1NE9 A;  5E96 A;  4KVO E;  4FD7 A;  3IWE A;  4B14 A;  2C27 A;  2JLM A;  1P0H A;  3B8G A;  2NMT A;  2Q0Y A;  4OLL A;  1S7L A;  3WR7 A;  4UCM A;  3GY9 A;  4B5P B;  4E2A A;  4R87 A;  3FIX A;  1FY7 A;  2VI7 A;  4CAV A;  2R98 A;  2VEZ A;  4UCP A;  2DPT A;  3T90 A;  1IIC A;  4E8O A;  5G1Z A;  4R3L A;  5H86 A;  2Q44 A;  3LD2 A;  1Y9W A;  1Q2D A;  1MJ9 A;  1MJA A;  5A28 A;  1Y7R A;  1M1D A;  2VZY A;  2P6G A;  2VXK A;  4MI4 A;  2YGW A;  3JVN A;  2Q7B A;  4A32 A;  2PR1 A;  1NSL A;  5DWN A;  4CAX A;  2H5M A;  3IU1 A;  4R9M A;  2BSW A;  3S6K A;  3QB8 A;  4KVX A;  2AE6 A;  3D3S A;  4PK3 A;  4AVB A;  4A2Z A;  2PR8 A;  4B12 A;  4KLV A;  3TT2 A;  1XEB A;  2P0W A;  2QML A;  4H6U A;  1IYL A;  1SQH A;  4KSA A;  5DWM A;  3K9U A;  1MK4 A;  4CAF A;  1S7K A;  3R95 A;  4II9 A;  4RI1 A;  2R7H A;  1Q2C A;  4PSX A;  1XIX A;  1B87 A;  3P2F A;  3FNC A;  4KLW A;  1M4D A;  2B58 A;  4IUS A;  3CXP A;  1NMT A;  4QVT A;  4F6A A;  4CYQ A;  3RYO A;  1R57 A;  5GCN A;  2B5G A;  4CYO A;  2CY2 A;  4CYP A;  3GKR A;  1ON0 A;  3FB3 A;  4JD6 A;  2OZG A;  4XPK A;  1I1D A;  2Y0M A;  3H4Q A;  4MHD A;  2FE7 A;  4UFV A;  2REE A;  3I9S A;  3IWG A;  3IU2 A;  1PUA A;  4RS2 A;  1YK3 A;  1Z9U A;  2FSR A;  2Q4V A;  4NCZ A;  4R3K A;  1Q2Y A;  2FIA A;  3VWE A;  3C26 A;  1UFH A;  1YR0 A;  2AJ6 A;  1IYK A;  4U9Z A;  5EBV A;  2Z3P A;  2FS5 A;  1OZP A;  2Z3K A;  2X7B A;  2BL1 A;  4A33 A;  4KUB A;  4QUS A;  2ZPA A;  1S7F A;  5FVJ A;  3BJ8 A;  2HQY A;  1QSM A;  2QIR A;  4MY0 A;  5EC4 A;  1RO5 A;  4MFK A;  4CGO A;  4UFX A;  2HV2 A;  4H89 A;  2B3U A;  4HNW B;  4HKF A;  2PC1 A;  4MFZ A;  2VZZ A;  4JWP A;  3H5Z A;  4C7H A;  1S5K A;  4PK2 A;  1YVO A;  2B5G B;  4FD5 A;  1I12 A;  3T9Y A;  2CNT A;  3R96 A;  4JLY A;  2FCK A;  5IV0 A;  2GIV A;  4YFJ A;  3MGD A;  2YND A;  1P4N A;  4UCN A;  1QST A;  1V0C A;  4B5O A;  3QAH A;  4C2Y A;  4MY3 A;  4ZGY B;  1L0C A;  4PV6 A;  2VQY A;  4LUA A;  2FL4 A;  2B4B A;  2JEV A;  4OAE A;  4PSW A;  1U6M A;  1YRE A;  3ZZI A;  2KCW A;  1VHS A;  4KOU A;  1PU9 A;  4FD6 A;  2ZW6 A;  4QBJ A;  1S60 A;  4DNC A;  3BLN A;  4LX9 A;  4Q36 A;  4Y49 C;  5HMN A;  3NE7 A;  3SXN A;  1GHE A;  5ISV A;  4MFL A;  3ZJ0 A;  2WSA A;  3EO4 A;  4HNX B;  1VKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...