3PP9A

1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
176
Chain Sequence
SLLIRELETNDLDNFPEIDDSFIVNARLMLSLSKVNRRIEYTVEDVPSYEKSYLELVYNEYINKPNQIIYIALLHNQIIGFIVLKKNWNNYAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNMTSDEVAIYWYLHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.6 Angstrom resolution crystal structure of putative streptothricin acetyltransferase from Bacillus anthracis str. Ames in complex with acetyl coenzyme A
rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Putative streptothricin acetyltransferase
total genus 39
structure length 176
sequence length 181
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pp9A00
2WPXA 4CRZB 3FXTA 2HQYA 2KCWA 2EUIA 3I9SA 1IB1E 2Q04A 4R9MA 1MJAA 2GANA 4PV6A 2Q4VA 4R3LA 2HUZA 1YX0A 1QSTA 2AJ6A 4PK2A 4OAEA 2R7HA 1LRZA 4MI4A 3TFYA 2B4DA 2J8RA 4B5OA 2Z11A 1GHEA 2BEIA 3GKRA 4KORA 5J8FA 3T90A 3R95A 1BOBA 4HNWB 2G3TA 4CAXA 4I49A 3ZZIA 1YGHA 4CS0B 4E0AA 4FD6A 4QC6A 2FCKA 3B8GA 1QSRA 2DXQA 1WK4A 2B58A 4LX9A 3JVNA 3DSBA 3S6KA 3TO7A 3IGRA 4H6UA 1L0CA 5JPHA 1QSMA 4RI1A 2OZUA 4J3GA 2P6GA 5IX3A 4XPLA 1Y9KA 2FIAA 1YVKA 4UA3A 1M44A 2R98A 2ARHA 2CNSA 1IICA 1K4JA 5F46A 4KOWA 3W6SA 4CRYB 3FRMA 4L8AA 2OZHA 3R96A 3P2FA 3G3SA 1V0CA 2G0BA 3R1KA 4QBJA 4UBRA 4ORFA 2PC1A 3F8KA 3PGPA 1VKCA 4RS2A 5DWMA 3DDDA 1NSLA 3FNCA 2PRBA 2Z10A 3SHPA 2ZW6A 4E8OA 2CNMA 3S6FA 3TO6A 3QB8A 4M85A 2R1IA 3MGDA 5C88A 2PSWA 3JUWA 4E2AA 1Z9UA 2BSWA 2Z0ZA 2FS5A 2OB0A 2ATRA 3TTHA 1I21A 4DNCA 5KTAA 2X7BA 1Y7RA 3V8IA 2VI7A 2D4OA 3S6HA 3CXSA 3VWDA 3R9EA 1QSNA 4KLWA 3G8WA 5ISVA 3EO4A 3DR8A 4GS4A 3E0KA 4K30A 4KOYA 3SXNA 2C27A 2F5IA 2VQYA 5E96A 4PSWA 4NXYA 3IWGA 1YLEA 1YR0A 4FD4A 2JDCA 3LD2A 4OADA 4JXRA 3D2PA 4PSXA 5F48A 5KTCA 4FD5A 5IB0A 2G3AA 2B3UA 1IYLA 2WPWA 4QB9A 2I00A 2FIWA 4KOSA 3BJ7A 4HNXB 1J4JA 4MHDA 2VEZA 3TE4A 4XNHC 2Q44A 1XEBA 2FL4A 1PUAA 4JXQA 4JWPA 5KTDA 2P6FA 4QVTA 2BUEA 1OZPA 3CXQA 2P0WA 1KUVA 1M4DA 3C26A 5CNPA 3KKWA 1IIDA 4KZTA 4IUSA 4AB7A 2ZW4A 4HNYB 1CM0A 3H4QA 5HH1A 1YK3A 1XE4A 1P0HA 2I79A 2B5GB 4KVXA 5GCNA 1S3ZA 1S7KA 4NF1A 3W6XA 1S5KA 1NE9A 4EVYA 1CJWA 3GY9A 4YFJA 2FE7A 4AG7A 4U5YA 5F47A 4AVAA 1N71A 4U9YA 3T9YA 4XPKA 5HMNA 3ZJ0A 2OH1A 1XIXA 2P6EA 3D8PA 2D4PA 4JLYA 2OZGA 1Q2YA 4M3SA 2AE6A 1U6MA 2A4NA 3RYOA 4LUAA 2JEVA 3EY5A 3TCVA 4H6ZA 4Y49C 3FBUA 4KLVA 4HKFA 1Z4EA 2J8MA 2JLMA 2BL1A 2Y0MA 2FSRA 2PDOA 5FVJA 4CAWA 3FYNA 3LODA 3EC4A 3R9GA 2B4BA 4KOTA 5I0CA 1ON0A 2QMLA 1WWZA 5EC4A 1S7FA 1S7NA 4IF5A 1MJ9A 3D2MA 1QSOA 3PZJA 4BMHA 4KUBA 1KZFA 4JJXA 4NEXA 4L89A 5DWNA 1NMTA 2ZW5A 2QIRA 4R57A 3I3GA 2FXFA 1IYKA 4KOUA 5F49A 1R57A 4B5PB 4R87A 2NMTA 2VBQA 5JQ4A 2ZW7A 4KUAA 3WR7A 3FB3A 5C82A 3BJ8A 1VHSA 4FD7A 4OLLA 1RXTA 5J8CA 1BO4A 2B5GA 3QAHA 4CAVA 4KOVA 4UWIA 1M4IA 3P2HA 2PQ8A 4XNHB 3N7ZA 1YREA 4YGOA 3FIXA 1M4GA 3BLNA 4AG9A 4YRHA 1SQHA 1MJBA 2VZZA 2ZPAA 2FT0A 2OU2A 2H5MA 2REEA 4JD6A 4PK3A 4X5KA 1RO5A 1KUXA 1Q2DA 2EVNA 4AVCA 4MJ8A 4XPDC 1UFHA 2REFA 3TOAA 2Q7BA 4NSQA 2VZYA 3F0AA 3R9FA 3F5BA 1PU9A 1XF8A 3SXOA 2GIVA 4MY0A 4QUSA 2O28A 2ZXVA 4B5PA 1FY7A 2VXKA 4MBUA 2PR8A 4NCZA 2GE3A 4II9A 2IL4A 4Y49B 1P4NA 3TT2A 4U9ZA 3S6GA 1TIQA 4MY3A 1S7LA 5EBVA 3W91A 1MK4A 4H89A 4ONUA 3PP9A 1S60A 2QECA 4KVME 3CXPA 1Y9WA 3DNSA 3TO9A 2B4DB 4ZBGA 5H86A 4F0YA 3GYAA 4KVOE 4F6AA 4KOXA 2Q4YA 1I1DA 2RC4A 3EFAA 2B3VA 4AVBA 2CY2A 1Q2CA 2R8VA 4UWJA 2HV2A 2CNTA 4XPDB 3VWEA 1B6BA 3DR6A 3NE7A 1XMTA 2J8NA 1I12A 1YVOA 3OWCA 3K9UA 4R3KA 1M1DA 2JDDA 3UY5A 5IV0A 2K5TA 3EXNA 1B87A 1KUYA 3TOBA 5H84A 2PR1A 2Q0YA 3D3SA 1Z4RA
chains in the Genus database with same CATH superfamily
1H8LA 4CGLA 1XOVA 3H8EA 4CGOA 3IC1A 2AFSA 2PRQA 3JTKA 5IB9A 1PYTB 2WPXA 4EFDA 2RFHA 3D7FA 2AFMA 4KSAA 5HXDA 4CRZB 1ZLIA 3FXTA 2XEGA 2HQYA 2KCWA 3B3WA 2EUIA 3I9SA 1ELMP 4A31A 4JYWA 1IB1E 4OC5A 2PIZA 4PXEA 2Q04A 4MCSA 1EE3P 1MJAA 4R9MA 2GANA 2XEIA 4CGMA 4KS9A 4PV6A 1BPNA 4A94A 2Q4VA 4R3LA 2HUZA 1YX0A 4P4IA 1QSTA 2EK9A 5G21A 2F8HA 4UIAA 2AJ6A 4PK2A 4P4EA 1Z8TA 4NGPA 2VL1A 2WYRA 2R7HA 4MMOA 4OAEA 4OC4A 1LRZA 4MI4A 4A32A 4CYOA 5BWAB 3TFYA 2B4DA 2J8RA 2ZOGA 4B5OA 2Z11A 1GHEA 2BEIA 2JBKA 3GKRA 4KORA 5J8FA 4TWEA 2CF4A 1KWMA 1PCAA 5DS0A 3R95A 3T90A 3IWWA 1BOBA 4HNWB 3KR5A 2G3TA 4CAXA 4I49A 2YNEA 1ZLHA 3ZZIA 1YGHA 4CS0B 2POKA 1IOIA 4E0AA 5AG4A 4FD6A 4QC6A 3FH4A 4CAFA 2FCKA 3B8GA 3NA6A 4ZYQA 1QSRA 2DXQA 5CBMA 1WK4A 4P44A 3H8FA 4RN7A 4CGPA 4NGSA 5I4MA 2B58A 4LX9A 3JVNA 3DSBA 2Z3OA 3LACA 4O23A 3S6KA 3T8WA 4CYPA 1YQEA 3TO7A 3IGRA 4H6UA 1L0CA 3QAYA 5JPHA 1QSMA 4RI1A 1NSAA 2OZUA 4J3GA 2EBJA 4OMEA 2P6GA 5IX3A 2RB7A 1LAPA 4XPLA 2ZEEA 1Y9KA 3B7IA 2FIAA 1YVKA 2PCUA 4UA3A 2GFQA 4FUUA 1YW6A 3PBEA 1M44A 2R98A 5K8OA 5JGFA 2ARHA 2NYQA 1ELLP 1LCPA 4MCPA 4DYOA 1AYEA 4CPAA 1Z8XA 2CNSA 1IICA 1K4JA 3IIBA 3HUVA 5F46A 4OIDA 4KOWA 4GM5A 4P4FA 3W6SA 4CRYB 3FECA 3FRMA 4L8AA 2OZHA 3R96A 3KHZA 3P2FA 3G3SA 2JEWA 4F0XA 2C6PA 4ZGYB 1V0CA 1R3NA 2G0BA 2Z3PA 3LWUA 3R1KA 4MFKA 2GREA 3BI1A 4FWUA 4NGMA 1XFOA 4QBJA 3MN8A 4UBRA 4NGNA 4MCQA 4CGNA 2AFOA 2GLFA 4UFXA 4ZI6A 2PE3A 4ORFA 1BLLE 2PC1A 2IMOA 3BI0A 3F8KA 3PGPA 1VKCA 4RS2A 5DWMA 2Q4ZA 3D7DA 3DDDA 1NSLA 4PPZA 3CPAA 3FNCA 2PRBA 2Z10A 3SHPA 3IWEA 2ZW6A 4E8OA 3NH5A 2CNMA 3S6FA 3TO6A 3QB8A 4R8FA 4M85A 2HC9A 2WSAA 2R1IA 1YMEA 2QYVA 3KI9A 3MGDA 5C88A 1JQGA 1TF9A 8CPAA 2PSWA 3JUWA 4E2AA 1CBXA 4Q38A 1Z9UA 2BSWA 2Z0ZA 1X10A 2FS5A 2ATRA 2OB0A 1I21A 3TTHA 3TX8A 3FVLA 4DNCA 3KASA 1AUGA 2X7BA 3H5ZA 1Y7RA 4ONWA 3V8IA 3D66A 5KTAA 2VI7A 4PQAA 4IK2A 4A33A 2NSMA 2D4OA 4NGRA 4MHYA 1QQ9A 3S6HA 3NFZA 3CXSA 4NJRA 3VWDA 3IU2A 3R9EA 3BXMA 2PJ1A 2CTCA 4TNUA 1QSNA 4KLWA 3G8WA 5ISVA 3EO4A 3DR8A 4GS4A 3E0KA 4K30A 2PIYA 1YSJA 3IO1A 4KOYA 3SXNA 2C27A 2F5IA 2VQYA 5E96A 4PSWA 4NXYA 3IWGA 4ZX9A 1YLEA 4A2ZA 1YR0A 4FD4A 2JDCA 3LD2A 4ZX8A 4GXHA 3IEHA 4OADA 2PJAA 3KGQA 4ZY2A 4JXRA 3D2PA 4MHNA 3B35A 3B3VA 4PSXA 4MFQA 5F48A 2YNDA 5KTCA 4FD5A 4A39A 4Q36A 3RO0A 4A30A 1LFWA 2G3AA 5IB0A 2B3UA 1IYLA 4X2TA 2PJ6A 2WPWA 4UF4A 4QB9A 4BD9A 2I00A 2FIWA 4KOSA 3PB6X 4CAEA 2EK8A 4MFJA 3BJ7A 4HNXB 3GIUA 1F2PA 1J4JA 3RAMA 2ZELA 4MHDA 1Q7LA 4PXBA 5HVHA 2VEZA 3TE4A 2AFUA 4XNHC 2Q44A 1XEBA 2FL4A 1PUAA 2ZEPA 4JXQA 4JWPA 5KTDA 2P6FA 4QVTA 2BUEA 3H8GA 1OZPA 3CXQA 2P0WA 3D68A 5JH9A 1KUVA 2ZEDA 4OC3A 1M4DA 3C26A 4MFPA 4FBEA 5CNPA 2AFZA 2Q43A 3D4UA 3ISXA 3KKWA 1IIDA 2V8VA 1TKJA 4KZTA 4IUSA 4G1PA 4JZ0A 2BOAA 2ZW4A 4AB7A 3PB4X 4HNYB 1CM0A 3H4QA 5HH1A 1YK3A 2AFXA 5G20A 1XE4A 4F8ZA 4RUHA 2QVPA 1P0HA 4UIBA 2I79A 2B5GB 4KVXA 2V8HA 5GCNA 3V7ZA 1S3ZA 1S7KA 1DE4C 4NF1A 1CX8A 4Z65A 3D7HA 3W6XA 5K8MA 1S5KA 4M6IA 4YWYA 1NE9A 5A27A 1TF8A 4EVYA 5K8PA 4NFRA 1CJWA 3GY9A 1Z5RA 1AMPA 2OR4A 4YFJA 2FE7A 1A2ZA 4U5YA 4AG7A 1ZG7A 4LQGA 5LRKA 5AG6A 1TXRA 5F47A 5LYIA 2DF5A 2PJ0A 4AVAA 3WC6A 4AXVA 2V8GA 1N71A 2HB6A 4U9YA 3T9YA 2WZNA 3PRTA 4XPKA 5HMNA 3ZJ0A 3PB9X 4HPSA 4P4BA 1YLOA 3KQXA 2OH1A 1XIXA 2P6EA 3D8PA 3TC8A 4C2ZA 2D4PA 1IY7A 3LMSA 4JLYA 3PB8X 2OZGA 1Q2YA 4KSIA 4M3SA 4Q7AA 4EMEA 2AE6A 1U6MA 2CIJA 3B2YA 2XEFA 3SJFA 4C2XA 2A4NA 3SJEA 4IHMA 4ZY1A 3JRUA 1M4LA 2Z3NA 4MFLA 3RYOA 4UEFA 4LUAA 3SJXA 2JEVA 1ARMA 3EY5A 4M6HA 3NH4A 3B3SA 3GUXA 3BHXA 4NJQA 1FNOA 4F9UA 5JM6A 4UCPA 4P4JA 3FJUA 3TCVA 4H6ZA 3L2NA 4Y49C 2Z3LA 3MRUA 3RBUA 4A37A 3SJGA 2PJ8A 4MXUA 4OIWA 2GLJA 3FBUA 4KLVA 4HKFA 1Z4EA 3SI0A 2PJ7A 3CZXA 2J8MA 2JLMA 2BL1A 2Y0MA 2FSRA 1UWYA 2BCOA 2C6CA 1JWQA 2PDOA 4CYQA 5FVJA 4P45A 1Y7EA 2JBJA 2ZEGA 4CAWA 3S9LA 2C1CA 4MHPA 3FYNA 2YGWA 1BPMA 3RZAA 4UEEA 5LYDA 3LODA 4LQ6A 2YNCC 4UEZA 2YNCA 3EC4A 1ARLA 3R9GA 3KHXA 2B4BA 4KOTA 1XJOA 1ON0A 1XRYA 1WWZA 2QMLA 3KZWA 3NH8A 4P4DA 5I0CA 3S9NA 5EC4A 1CP7A 2WUUA 1S7FA 4B13A 4MRIA 4OC2A 2V77A 4OC1A 1S7NA 4IF5A 1MJ9A 4H2KA 2G9DA 2ODFA 2DPTA 2PVWA 2Z3KA 3ISZA 3D2MA 3V38A 4C7HA 1QSOA 4NGTA 3K9TA 3PZJA 3WC7A 4A95A 4BMHA 4KUBA 4UFVA 5J1QA 4UFWA 1KZFA 4UCNA 1F57A 2FVGA 3CDXA 4JJXA 2EWBA 3DLJA 4NEXA 4NGQA 4B10A 4L89A 5HVFA 5DWNA 1NMTA 4P6YA 2ZW5A 2QIRA 7CPAA 2Q7SA 3A9LA 4MCRA 4R57A 1Z2LA 1RTQA 3I3GA 5K8NA 4OP4A 2FXFA 1IYKA 3PEIA 3KQZA 4KOUA 5F49A 1LANA 2PJ9A 2ANPA 1R57A 4YU9A 4B5PB 4R87A 3RNZA 2NMTA 2ZENA 2VBQA 4X8IA 2IJZA 3D7GA 1IGBA 5JQ4A 2ZW7A 4KUAA 5LRJA 3WR7A 3FB3A 5C82A 4ZY0A 5HVGA 3BJ8A 1VHSA 1Y0RA 2GU2A 5LYLA 4FD7A 4P10A 4KSFA 3WC5A 4OLLA 1RXTA 5J8CA 1BO4A 2B5GA 3QAHA 1VGYA 5CPAA 4KOVA 3VH9A 4CAVA 4M6GA 3IU1A 4UWIA 3PFOA 4F9VA 1M4IA 1VHEA 3P2HA 2PQ8A 4XNHB 3N7ZA 4BBHA 2PJ5A 1YREA 5AG7A 1HDUA 4YGOA 1GYTA 3B3CA 2DPSA 3FIXA 4X3RA 1M4GA 1BAVA 3N5FA 3VATA 3BLNA 4AG9A 4YRHA 1SQHA 1MJBA 2VZZA 2ZPAA 4OC0A 3FEEA 2FT0A 2OU2A 2H5MA 2REEA 4JD6A 4PK3A 4X5KA 1RO5A 2Q51A 1KUXA 1HDQA 1Q2DA 1IU8A 2EVNA 4B14A 6CPAA 4AVCA 4MJ8A 3NE8A 1CPSA 1CP6A 4BINA 4EWTA 4XPDC 1Z8WA 4C68A 1UFHA 2CTBA 1OBRA 3S9MA 2PVVA 1VIXA 1ZO0A 5AGEA 1Z8LA 2REFA 2ABZA 3TOAA 4FAIA 2ZOFA 1LAMA 2Q7BA 1XMBA 4NSQA 2VZYA 3F0AA 1LOKA 2DEAA 2XEJA 2OOTA 3R9FA 3SI1A 3F5BA 3CT9A 1F2OA 5THWA 4MFZA 2Z3MA 1PU9A 1XF8A 5ELYA 4C2YA 1ZG9A 3SXOA 5LYFA 2EO8A 1TKHA 2GIVA 3DGVA 3CPXA 3FMCA 4UCMA 5D29A 4IAVA 1X12A 4MY0A 4QUSA 2O28A 2ZXVA 2ZEFA 4B5PA 1FY7A 3FF3A 3IFEA 2VXKA 4MBUA 4PXCA 2PR8A 2PJ2A 2QJ8A 4NCZA 2PJCA 4MHZA 2GE3A 3WT4A 3PB7X 4II9A 4WJBA 1R43A 5F09A 1XBUA 2IL4A 1TKFA 4Y49B 1ZG8A 1P4NA 5LRGA 3TT2A 4A38A 3GLJA 4C7IA 5A28A 4U9ZA 3S6GA 3GB0A 2J9AA 4B6ZA 3IJ3A 1TIQA 5G1ZA 2C6GA 4MY3A 1S7LA 5EBVA 3W91A 1MK4A 4H89A 4ONUA 3PP9A 1S60A 2QECA 5EMIA 3D67A 4KVME 3CXPA 2V8DA 3K2KA 1Y9WA 3DNSA 3TO9A 2B4DB 4ZBGA 5H86A 1VHOA 4F0YA 3GYAA 4KVOE 4R76A 4F6AA 4KOXA 2Q4YA 1CG2A 4R6TA 2CXAA 1I1DA 1IOFA 4DJLA 2AFWA 2RC4A 3VARA 3EFAA 5AG5A 2B3VA 4AVBA 1CPXA 2O53A 3SI2A 3WABA 4B11A 1QMUA 2CY2A 2IQ6A 1Q2CA 2R8VA 4CYNA 4UWJA 2HV2A 2CNTA 3I1UA 1DTDA 4XPDB 3VWEA 1B6BA 3FEDA 3DR6A 3NE7A 3PBBA 4OKOA 1XMTA 2J8NA 4PXDA 1I12A 1YVOA 3OWCA 3K9UA 2PJ3A 5D8NA 2ZEMA 4R3KA 4R7MA 4DUKA 1HEEA 1M1DA 2JDDA 2PJBA 2K5TA 3KR4A 2PJ4A 4K3NA 3UY5A 2BO9A 5IV0A 3EXNA 4W9YA 3HLPA 1B87A 4B12A 3QNVA 1KUYA 3TOBA 2F7VA 2I3CA 2ZEOA 3PFEA 5H84A 2PR1A 1YW4A 1FT7A 2Q0YA 2O4HA 2ZEHA 5G22A 3B3TA 3D3SA 3KL9A 1Z4RA 3FX6A 4WWVA 1Y0YA
chains in the Genus database with same CATH topology
4CGLA 4CGOA 3JTKA 2WPXA 4KSAA 4CRZB 3FXTA 2HQYA 2KCWA 2EUIA 3I9SA 4A31A 1IB1E 2Q04A 4R9MA 1MJAA 2GANA 4CGMA 4KS9A 4PV6A 2Q4VA 4R3LA 2HUZA 1YX0A 1QSTA 5G21A 2AJ6A 4PK2A 4OAEA 2R7HA 4A32A 1LRZA 4MI4A 4CYOA 5BWAB 3TFYA 2B4DA 2J8RA 4B5OA 2Z11A 1GHEA 2BEIA 3GKRA 4KORA 5J8FA 3T90A 3R95A 1BOBA 4HNWB 2G3TA 4CAXA 4I49A 2YNEA 3ZZIA 1YGHA 4CS0B 4E0AA 5AG4A 4FD6A 4QC6A 4CAFA 2FCKA 3B8GA 1QSRA 2DXQA 1WK4A 4CGPA 2B58A 4LX9A 3JVNA 3DSBA 2Z3OA 3S6KA 4CYPA 3TO7A 3IGRA 4H6UA 1L0CA 5JPHA 1QSMA 4RI1A 2OZUA 4J3GA 2P6GA 5IX3A 4XPLA 1Y9KA 2FIAA 1YVKA 4UA3A 1M44A 2R98A 2ARHA 2CNSA 1IICA 1K4JA 5F46A 4KOWA 3W6SA 4CRYB 3FRMA 4L8AA 2OZHA 3R96A 3P2FA 3G3SA 4F0XA 4ZGYB 1V0CA 4MFKA 2G0BA 2Z3PA 3R1KA 4QBJA 4UBRA 4CGNA 4UFXA 4ORFA 2PC1A 3F8KA 3PGPA 1VKCA 4RS2A 5DWMA 3DDDA 1NSLA 3FNCA 2PRBA 2Z10A 3SHPA 3IWEA 2ZW6A 4E8OA 2CNMA 3S6FA 3TO6A 3QB8A 4M85A 2WSAA 2R1IA 3MGDA 5C88A 2PSWA 3JUWA 4E2AA 4Q38A 1Z9UA 2BSWA 2Z0ZA 2FS5A 2OB0A 2ATRA 3TTHA 1I21A 4DNCA 5KTAA 3H5ZA 2X7BA 1Y7RA 3V8IA 2VI7A 4A33A 2D4OA 3S6HA 3CXSA 3VWDA 3IU2A 3R9EA 1QSNA 4KLWA 3G8WA 5ISVA 3EO4A 3DR8A 4GS4A 3E0KA 4K30A 4KOYA 3SXNA 2C27A 2F5IA 2VQYA 5E96A 4PSWA 4NXYA 3IWGA 1YLEA 4A2ZA 1YR0A 4FD4A 2JDCA 3LD2A 4OADA 4JXRA 3D2PA 4PSXA 5F48A 4MFQA 2YNDA 5KTCA 4FD5A 4Q36A 4A30A 5IB0A 2G3AA 2B3UA 1IYLA 2WPWA 4QB9A 2I00A 2FIWA 4KOSA 4CAEA 4MFJA 3BJ7A 4HNXB 1J4JA 4MHDA 2VEZA 3TE4A 4XNHC 2Q44A 1XEBA 2FL4A 1PUAA 4JXQA 4JWPA 5KTDA 2P6FA 4QVTA 2BUEA 1OZPA 3CXQA 2P0WA 1KUVA 1M4DA 3C26A 4MFPA 5CNPA 3KKWA 1IIDA 4KZTA 4IUSA 4AB7A 2ZW4A 4HNYB 1CM0A 3H4QA 5HH1A 1YK3A 5G20A 1XE4A 1P0HA 2I79A 2B5GB 4KVXA 5GCNA 1S3ZA 1S7KA 4NF1A 3W6XA 1S5KA 1NE9A 5A27A 4EVYA 1CJWA 3GY9A 4YFJA 2FE7A 4AG7A 4U5YA 5AG6A 5F47A 4AVAA 1N71A 4U9YA 3T9YA 4XPKA 5HMNA 3ZJ0A 2OH1A 1XIXA 2P6EA 3D8PA 4C2ZA 2D4PA 4JLYA 2OZGA 1Q2YA 4M3SA 2AE6A 1U6MA 4C2XA 2A4NA 2Z3NA 4MFLA 3RYOA 4LUAA 2JEVA 3EY5A 4UCPA 3TCVA 4H6ZA 4Y49C 2Z3LA 3FBUA 4KLVA 4HKFA 1Z4EA 2J8MA 2JLMA 2BL1A 2Y0MA 2FSRA 2PDOA 4CYQA 5FVJA 4CAWA 3FYNA 2YGWA 3LODA 2YNCC 2YNCA 3EC4A 3R9GA 2B4BA 4KOTA 5I0CA 1ON0A 2QMLA 1WWZA 5EC4A 2WUUA 1S7FA 4B13A 1S7NA 4IF5A 1MJ9A 2DPTA 2Z3KA 3D2MA 4C7HA 1QSOA 3PZJA 4A95A 4BMHA 4KUBA 4UFVA 4UFWA 1KZFA 4UCNA 4JJXA 4NEXA 4B10A 4L89A 5DWNA 1NMTA 2ZW5A 2QIRA 3A9LA 4R57A 3I3GA 2FXFA 1IYKA 4KOUA 5F49A 1R57A 4B5PB 4R87A 2NMTA 2VBQA 5JQ4A 2ZW7A 4KUAA 3WR7A 3FB3A 5C82A 3BJ8A 1VHSA 4FD7A 4KSFA 4OLLA 1RXTA 5J8CA 1BO4A 2B5GA 3QAHA 4CAVA 4KOVA 3IU1A 4UWIA 1M4IA 3P2HA 2PQ8A 4XNHB 3N7ZA 4BBHA 1YREA 5AG7A 4YGOA 2DPSA 3FIXA 1M4GA 3BLNA 4AG9A 4YRHA 1SQHA 1MJBA 2VZZA 2ZPAA 2FT0A 2OU2A 2H5MA 2REEA 4JD6A 4PK3A 4X5KA 1RO5A 1KUXA 1Q2DA 2EVNA 4B14A 4AVCA 4MJ8A 4XPDC 4C68A 1UFHA 1ZO0A 5AGEA 2REFA 3TOAA 2Q7BA 4NSQA 2VZYA 3F0AA 3R9FA 3F5BA 4MFZA 2Z3MA 1PU9A 1XF8A 4C2YA 3SXOA 2GIVA 4UCMA 4MY0A 4QUSA 2O28A 2ZXVA 4B5PA 1FY7A 2VXKA 4MBUA 2PR8A 4NCZA 2GE3A 4II9A 2IL4A 4Y49B 1P4NA 3TT2A 4C7IA 5A28A 4U9ZA 3S6GA 1TIQA 5G1ZA 4MY3A 1S7LA 5EBVA 3W91A 1MK4A 4H89A 4ONUA 3PP9A 1S60A 2QECA 4KVME 3CXPA 1Y9WA 3DNSA 3TO9A 2B4DB 4ZBGA 5H86A 4F0YA 3GYAA 4KVOE 4F6AA 4KOXA 2Q4YA 2CXAA 1I1DA 2RC4A 3EFAA 5AG5A 2B3VA 4AVBA 4B11A 2CY2A 1Q2CA 2R8VA 4CYNA 4UWJA 2HV2A 2CNTA 4XPDB 3VWEA 1B6BA 3DR6A 3NE7A 1XMTA 2J8NA 1I12A 1YVOA 3OWCA 3K9UA 4R3KA 1M1DA 2JDDA 3UY5A 5IV0A 2K5TA 3EXNA 1B87A 4B12A 1KUYA 3TOBA 5H84A 2PR1A 2Q0YA 5G22A 3D3SA 1Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPX A;  4CRZ B;  3FXT A;  2HQY A;  2KCW A;  2EUI A;  3I9S A;  1IB1 E;  2Q04 A;  4R9M A;  1MJA A;  2GAN A;  4PV6 A;  2Q4V A;  4R3L A;  2HUZ A;  1YX0 A;  1QST A;  2AJ6 A;  4PK2 A;  4OAE A;  2R7H A;  1LRZ A;  4MI4 A;  3TFY A;  2B4D A;  2J8R A;  4B5O A;  2Z11 A;  1GHE A;  2BEI A;  3GKR A;  4KOR A;  5J8F A;  3T90 A;  3R95 A;  1BOB A;  4HNW B;  2G3T A;  4CAX A;  4I49 A;  3ZZI A;  1YGH A;  4CS0 B;  4E0A A;  4FD6 A;  4QC6 A;  2FCK A;  3B8G A;  1QSR A;  2DXQ A;  1WK4 A;  2B58 A;  4LX9 A;  3JVN A;  3DSB A;  3S6K A;  3TO7 A;  3IGR A;  4H6U A;  1L0C A;  5JPH A;  1QSM A;  4RI1 A;  2OZU A;  4J3G A;  2P6G A;  5IX3 A;  4XPL A;  1Y9K A;  2FIA A;  1YVK A;  4UA3 A;  1M44 A;  2R98 A;  2ARH A;  2CNS A;  1IIC A;  1K4J A;  5F46 A;  4KOW A;  3W6S A;  4CRY B;  3FRM A;  4L8A A;  2OZH A;  3R96 A;  3P2F A;  3G3S A;  1V0C A;  2G0B A;  3R1K A;  4QBJ A;  4UBR A;  4ORF A;  2PC1 A;  3F8K A;  3PGP A;  1VKC A;  4RS2 A;  5DWM A;  3DDD A;  1NSL A;  3FNC A;  2PRB A;  2Z10 A;  3SHP A;  2ZW6 A;  4E8O A;  2CNM A;  3S6F A;  3TO6 A;  3QB8 A;  4M85 A;  2R1I A;  3MGD A;  5C88 A;  2PSW A;  3JUW A;  4E2A A;  1Z9U A;  2BSW A;  2Z0Z A;  2FS5 A;  2OB0 A;  2ATR A;  3TTH A;  1I21 A;  4DNC A;  5KTA A;  2X7B A;  1Y7R A;  3V8I A;  2VI7 A;  2D4O A;  3S6H A;  3CXS A;  3VWD A;  3R9E A;  1QSN A;  4KLW A;  3G8W A;  5ISV A;  3EO4 A;  3DR8 A;  4GS4 A;  3E0K A;  4K30 A;  4KOY A;  3SXN A;  2C27 A;  2F5I A;  2VQY A;  5E96 A;  4PSW A;  4NXY A;  3IWG A;  1YLE A;  1YR0 A;  4FD4 A;  2JDC A;  3LD2 A;  4OAD A;  4JXR A;  3D2P A;  4PSX A;  5F48 A;  5KTC A;  4FD5 A;  5IB0 A;  2G3A A;  2B3U A;  1IYL A;  2WPW A;  4QB9 A;  2I00 A;  2FIW A;  4KOS A;  3BJ7 A;  4HNX B;  1J4J A;  4MHD A;  2VEZ A;  3TE4 A;  4XNH C;  2Q44 A;  1XEB A;  2FL4 A;  1PUA A;  4JXQ A;  4JWP A;  5KTD A;  2P6F A;  4QVT A;  2BUE A;  1OZP A;  3CXQ A;  2P0W A;  1KUV A;  1M4D A;  3C26 A;  5CNP A;  3KKW A;  1IID A;  4KZT A;  4IUS A;  4AB7 A;  2ZW4 A;  4HNY B;  1CM0 A;  3H4Q A;  5HH1 A;  1YK3 A;  1XE4 A;  1P0H A;  2I79 A;  2B5G B;  4KVX A;  5GCN A;  1S3Z A;  1S7K A;  4NF1 A;  3W6X A;  1S5K A;  1NE9 A;  4EVY A;  1CJW A;  3GY9 A;  4YFJ A;  2FE7 A;  4AG7 A;  4U5Y A;  5F47 A;  4AVA A;  1N71 A;  4U9Y A;  3T9Y A;  4XPK A;  5HMN A;  3ZJ0 A;  2OH1 A;  1XIX A;  2P6E A;  3D8P A;  2D4P A;  4JLY A;  2OZG A;  1Q2Y A;  4M3S A;  2AE6 A;  1U6M A;  2A4N A;  3RYO A;  4LUA A;  2JEV A;  3EY5 A;  3TCV A;  4H6Z A;  4Y49 C;  3FBU A;  4KLV A;  4HKF A;  1Z4E A;  2J8M A;  2JLM A;  2BL1 A;  2Y0M A;  2FSR A;  2PDO A;  5FVJ A;  4CAW A;  3FYN A;  3LOD A;  3EC4 A;  3R9G A;  2B4B A;  4KOT A;  5I0C A;  1ON0 A;  2QML A;  1WWZ A;  5EC4 A;  1S7F A;  1S7N A;  4IF5 A;  1MJ9 A;  3D2M A;  1QSO A;  3PZJ A;  4BMH A;  4KUB A;  1KZF A;  4JJX A;  4NEX A;  4L89 A;  5DWN A;  1NMT A;  2ZW5 A;  2QIR A;  4R57 A;  3I3G A;  2FXF A;  1IYK A;  4KOU A;  5F49 A;  1R57 A;  4B5P B;  4R87 A;  2NMT A;  2VBQ A;  5JQ4 A;  2ZW7 A;  4KUA A;  3WR7 A;  3FB3 A;  5C82 A;  3BJ8 A;  1VHS A;  4FD7 A;  4OLL A;  1RXT A;  5J8C A;  1BO4 A;  2B5G A;  3QAH A;  4CAV A;  4KOV A;  4UWI A;  1M4I A;  3P2H A;  2PQ8 A;  4XNH B;  3N7Z A;  1YRE A;  4YGO A;  3FIX A;  1M4G A;  3BLN A;  4AG9 A;  4YRH A;  1SQH A;  1MJB A;  2VZZ A;  2ZPA A;  2FT0 A;  2OU2 A;  2H5M A;  2REE A;  4JD6 A;  4PK3 A;  4X5K A;  1RO5 A;  1KUX A;  1Q2D A;  2EVN A;  4AVC A;  4MJ8 A;  4XPD C;  1UFH A;  2REF A;  3TOA A;  2Q7B A;  4NSQ A;  2VZY A;  3F0A A;  3R9F A;  3F5B A;  1PU9 A;  1XF8 A;  3SXO A;  2GIV A;  4MY0 A;  4QUS A;  2O28 A;  2ZXV A;  4B5P A;  1FY7 A;  2VXK A;  4MBU A;  2PR8 A;  4NCZ A;  2GE3 A;  4II9 A;  2IL4 A;  4Y49 B;  1P4N A;  3TT2 A;  4U9Z A;  3S6G A;  1TIQ A;  4MY3 A;  1S7L A;  5EBV A;  3W91 A;  1MK4 A;  4H89 A;  4ONU A;  3PP9 A;  1S60 A;  2QEC A;  4KVM E;  3CXP A;  1Y9W A;  3DNS A;  3TO9 A;  2B4D B;  4ZBG A;  5H86 A;  4F0Y A;  3GYA A;  4KVO E;  4F6A A;  4KOX A;  2Q4Y A;  1I1D A;  2RC4 A;  3EFA A;  2B3V A;  4AVB A;  2CY2 A;  1Q2C A;  2R8V A;  4UWJ A;  2HV2 A;  2CNT A;  4XPD B;  3VWE A;  1B6B A;  3DR6 A;  3NE7 A;  1XMT A;  2J8N A;  1I12 A;  1YVO A;  3OWC A;  3K9U A;  4R3K A;  1M1D A;  2JDD A;  3UY5 A;  5IV0 A;  2K5T A;  3EXN A;  1B87 A;  1KUY A;  3TOB A;  5H84 A;  2PR1 A;  2Q0Y A;  3D3S A;  1Z4R A; 
#chains in the Genus database with same CATH topology
 1H8L A;  4CGL A;  1XOV A;  3H8E A;  4CGO A;  3IC1 A;  2AFS A;  2PRQ A;  3JTK A;  5IB9 A;  1PYT B;  2WPX A;  4EFD A;  2RFH A;  3D7F A;  2AFM A;  4KSA A;  5HXD A;  4CRZ B;  1ZLI A;  3FXT A;  2XEG A;  2HQY A;  2KCW A;  3B3W A;  2EUI A;  3I9S A;  1ELM P;  4A31 A;  4JYW A;  1IB1 E;  4OC5 A;  2PIZ A;  4PXE A;  2Q04 A;  4MCS A;  1EE3 P;  1MJA A;  4R9M A;  2GAN A;  2XEI A;  4CGM A;  4KS9 A;  4PV6 A;  1BPN A;  4A94 A;  2Q4V A;  4R3L A;  2HUZ A;  1YX0 A;  4P4I A;  1QST A;  2EK9 A;  5G21 A;  2F8H A;  4UIA A;  2AJ6 A;  4PK2 A;  4P4E A;  1Z8T A;  4NGP A;  2VL1 A;  2WYR A;  2R7H A;  4MMO A;  4OAE A;  4OC4 A;  1LRZ A;  4MI4 A;  4A32 A;  4CYO A;  5BWA B;  3TFY A;  2B4D A;  2J8R A;  2ZOG A;  4B5O A;  2Z11 A;  1GHE A;  2BEI A;  2JBK A;  3GKR A;  4KOR A;  5J8F A;  4TWE A;  2CF4 A;  1KWM A;  1PCA A;  5DS0 A;  3R95 A;  3T90 A;  3IWW A;  1BOB A;  4HNW B;  3KR5 A;  2G3T A;  4CAX A;  4I49 A;  2YNE A;  1ZLH A;  3ZZI A;  1YGH A;  4CS0 B;  2POK A;  1IOI A;  4E0A A;  5AG4 A;  4FD6 A;  4QC6 A;  3FH4 A;  4CAF A;  2FCK A;  3B8G A;  3NA6 A;  4ZYQ A;  1QSR A;  2DXQ A;  5CBM A;  1WK4 A;  4P44 A;  3H8F A;  4RN7 A;  4CGP A;  4NGS A;  5I4M A;  2B58 A;  4LX9 A;  3JVN A;  3DSB A;  2Z3O A;  3LAC A;  4O23 A;  3S6K A;  3T8W A;  4CYP A;  1YQE A;  3TO7 A;  3IGR A;  4H6U A;  1L0C A;  3QAY A;  5JPH A;  1QSM A;  4RI1 A;  1NSA A;  2OZU A;  4J3G A;  2EBJ A;  4OME A;  2P6G A;  5IX3 A;  2RB7 A;  1LAP A;  4XPL A;  2ZEE A;  1Y9K A;  3B7I A;  2FIA A;  1YVK A;  2PCU A;  4UA3 A;  2GFQ A;  4FUU A;  1YW6 A;  3PBE A;  1M44 A;  2R98 A;  5K8O A;  5JGF A;  2ARH A;  2NYQ A;  1ELL P;  1LCP A;  4MCP A;  4DYO A;  1AYE A;  4CPA A;  1Z8X A;  2CNS A;  1IIC A;  1K4J A;  3IIB A;  3HUV A;  5F46 A;  4OID A;  4KOW A;  4GM5 A;  4P4F A;  3W6S A;  4CRY B;  3FEC A;  3FRM A;  4L8A A;  2OZH A;  3R96 A;  3KHZ A;  3P2F A;  3G3S A;  2JEW A;  4F0X A;  2C6P A;  4ZGY B;  1V0C A;  1R3N A;  2G0B A;  2Z3P A;  3LWU A;  3R1K A;  4MFK A;  2GRE A;  3BI1 A;  4FWU A;  4NGM A;  1XFO A;  4QBJ A;  3MN8 A;  4UBR A;  4NGN A;  4MCQ A;  4CGN A;  2AFO A;  2GLF A;  4UFX A;  4ZI6 A;  2PE3 A;  4ORF A;  1BLL E;  2PC1 A;  2IMO A;  3BI0 A;  3F8K A;  3PGP A;  1VKC A;  4RS2 A;  5DWM A;  2Q4Z A;  3D7D A;  3DDD A;  1NSL A;  4PPZ A;  3CPA A;  3FNC A;  2PRB A;  2Z10 A;  3SHP A;  3IWE A;  2ZW6 A;  4E8O A;  3NH5 A;  2CNM A;  3S6F A;  3TO6 A;  3QB8 A;  4R8F A;  4M85 A;  2HC9 A;  2WSA A;  2R1I A;  1YME A;  2QYV A;  3KI9 A;  3MGD A;  5C88 A;  1JQG A;  1TF9 A;  8CPA A;  2PSW A;  3JUW A;  4E2A A;  1CBX A;  4Q38 A;  1Z9U A;  2BSW A;  2Z0Z A;  1X10 A;  2FS5 A;  2ATR A;  2OB0 A;  1I21 A;  3TTH A;  3TX8 A;  3FVL A;  4DNC A;  3KAS A;  1AUG A;  2X7B A;  3H5Z A;  1Y7R A;  4ONW A;  3V8I A;  3D66 A;  5KTA A;  2VI7 A;  4PQA A;  4IK2 A;  4A33 A;  2NSM A;  2D4O A;  4NGR A;  4MHY A;  1QQ9 A;  3S6H A;  3NFZ A;  3CXS A;  4NJR A;  3VWD A;  3IU2 A;  3R9E A;  3BXM A;  2PJ1 A;  2CTC A;  4TNU A;  1QSN A;  4KLW A;  3G8W A;  5ISV A;  3EO4 A;  3DR8 A;  4GS4 A;  3E0K A;  4K30 A;  2PIY A;  1YSJ A;  3IO1 A;  4KOY A;  3SXN A;  2C27 A;  2F5I A;  2VQY A;  5E96 A;  4PSW A;  4NXY A;  3IWG A;  4ZX9 A;  1YLE A;  4A2Z A;  1YR0 A;  4FD4 A;  2JDC A;  3LD2 A;  4ZX8 A;  4GXH A;  3IEH A;  4OAD A;  2PJA A;  3KGQ A;  4ZY2 A;  4JXR A;  3D2P A;  4MHN A;  3B35 A;  3B3V A;  4PSX A;  4MFQ A;  5F48 A;  2YND A;  5KTC A;  4FD5 A;  4A39 A;  4Q36 A;  3RO0 A;  4A30 A;  1LFW A;  2G3A A;  5IB0 A;  2B3U A;  1IYL A;  4X2T A;  2PJ6 A;  2WPW A;  4UF4 A;  4QB9 A;  4BD9 A;  2I00 A;  2FIW A;  4KOS A;  3PB6 X;  4CAE A;  2EK8 A;  4MFJ A;  3BJ7 A;  4HNX B;  3GIU A;  1F2P A;  1J4J A;  3RAM A;  2ZEL A;  4MHD A;  1Q7L A;  4PXB A;  5HVH A;  2VEZ A;  3TE4 A;  2AFU A;  4XNH C;  2Q44 A;  1XEB A;  2FL4 A;  1PUA A;  2ZEP A;  4JXQ A;  4JWP A;  5KTD A;  2P6F A;  4QVT A;  2BUE A;  3H8G A;  1OZP A;  3CXQ A;  2P0W A;  3D68 A;  5JH9 A;  1KUV A;  2ZED A;  4OC3 A;  1M4D A;  3C26 A;  4MFP A;  4FBE A;  5CNP A;  2AFZ A;  2Q43 A;  3D4U A;  3ISX A;  3KKW A;  1IID A;  2V8V A;  1TKJ A;  4KZT A;  4IUS A;  4G1P A;  4JZ0 A;  2BOA A;  2ZW4 A;  4AB7 A;  3PB4 X;  4HNY B;  1CM0 A;  3H4Q A;  5HH1 A;  1YK3 A;  2AFX A;  5G20 A;  1XE4 A;  4F8Z A;  4RUH A;  2QVP A;  1P0H A;  4UIB A;  2I79 A;  2B5G B;  4KVX A;  2V8H A;  5GCN A;  3V7Z A;  1S3Z A;  1S7K A;  1DE4 C;  4NF1 A;  1CX8 A;  4Z65 A;  3D7H A;  3W6X A;  5K8M A;  1S5K A;  4M6I A;  4YWY A;  1NE9 A;  5A27 A;  1TF8 A;  4EVY A;  5K8P A;  4NFR A;  1CJW A;  3GY9 A;  1Z5R A;  1AMP A;  2OR4 A;  4YFJ A;  2FE7 A;  1A2Z A;  4U5Y A;  4AG7 A;  1ZG7 A;  4LQG A;  5LRK A;  5AG6 A;  1TXR A;  5F47 A;  5LYI A;  2DF5 A;  2PJ0 A;  4AVA A;  3WC6 A;  4AXV A;  2V8G A;  1N71 A;  2HB6 A;  4U9Y A;  3T9Y A;  2WZN A;  3PRT A;  4XPK A;  5HMN A;  3ZJ0 A;  3PB9 X;  4HPS A;  4P4B A;  1YLO A;  3KQX A;  2OH1 A;  1XIX A;  2P6E A;  3D8P A;  3TC8 A;  4C2Z A;  2D4P A;  1IY7 A;  3LMS A;  4JLY A;  3PB8 X;  2OZG A;  1Q2Y A;  4KSI A;  4M3S A;  4Q7A A;  4EME A;  2AE6 A;  1U6M A;  2CIJ A;  3B2Y A;  2XEF A;  3SJF A;  4C2X A;  2A4N A;  3SJE A;  4IHM A;  4ZY1 A;  3JRU A;  1M4L A;  2Z3N A;  4MFL A;  3RYO A;  4UEF A;  4LUA A;  3SJX A;  2JEV A;  1ARM A;  3EY5 A;  4M6H A;  3NH4 A;  3B3S A;  3GUX A;  3BHX A;  4NJQ A;  1FNO A;  4F9U A;  5JM6 A;  4UCP A;  4P4J A;  3FJU A;  3TCV A;  4H6Z A;  3L2N A;  4Y49 C;  2Z3L A;  3MRU A;  3RBU A;  4A37 A;  3SJG A;  2PJ8 A;  4MXU A;  4OIW A;  2GLJ A;  3FBU A;  4KLV A;  4HKF A;  1Z4E A;  3SI0 A;  2PJ7 A;  3CZX A;  2J8M A;  2JLM A;  2BL1 A;  2Y0M A;  2FSR A;  1UWY A;  2BCO A;  2C6C A;  1JWQ A;  2PDO A;  4CYQ A;  5FVJ A;  4P45 A;  1Y7E A;  2JBJ A;  2ZEG A;  4CAW A;  3S9L A;  2C1C A;  4MHP A;  3FYN A;  2YGW A;  1BPM A;  3RZA A;  4UEE A;  5LYD A;  3LOD A;  4LQ6 A;  2YNC C;  4UEZ A;  2YNC A;  3EC4 A;  1ARL A;  3R9G A;  3KHX A;  2B4B A;  4KOT A;  1XJO A;  1ON0 A;  1XRY A;  1WWZ A;  2QML A;  3KZW A;  3NH8 A;  4P4D A;  5I0C A;  3S9N A;  5EC4 A;  1CP7 A;  2WUU A;  1S7F A;  4B13 A;  4MRI A;  4OC2 A;  2V77 A;  4OC1 A;  1S7N A;  4IF5 A;  1MJ9 A;  4H2K A;  2G9D A;  2ODF A;  2DPT A;  2PVW A;  2Z3K A;  3ISZ A;  3D2M A;  3V38 A;  4C7H A;  1QSO A;  4NGT A;  3K9T A;  3PZJ A;  3WC7 A;  4A95 A;  4BMH A;  4KUB A;  4UFV A;  5J1Q A;  4UFW A;  1KZF A;  4UCN A;  1F57 A;  2FVG A;  3CDX A;  4JJX A;  2EWB A;  3DLJ A;  4NEX A;  4NGQ A;  4B10 A;  4L89 A;  5HVF A;  5DWN A;  1NMT A;  4P6Y A;  2ZW5 A;  2QIR A;  7CPA A;  2Q7S A;  3A9L A;  4MCR A;  4R57 A;  1Z2L A;  1RTQ A;  3I3G A;  5K8N A;  4OP4 A;  2FXF A;  1IYK A;  3PEI A;  3KQZ A;  4KOU A;  5F49 A;  1LAN A;  2PJ9 A;  2ANP A;  1R57 A;  4YU9 A;  4B5P B;  4R87 A;  3RNZ A;  2NMT A;  2ZEN A;  2VBQ A;  4X8I A;  2IJZ A;  3D7G A;  1IGB A;  5JQ4 A;  2ZW7 A;  4KUA A;  5LRJ A;  3WR7 A;  3FB3 A;  5C82 A;  4ZY0 A;  5HVG A;  3BJ8 A;  1VHS A;  1Y0R A;  2GU2 A;  5LYL A;  4FD7 A;  4P10 A;  4KSF A;  3WC5 A;  4OLL A;  1RXT A;  5J8C A;  1BO4 A;  2B5G A;  3QAH A;  1VGY A;  5CPA A;  4KOV A;  3VH9 A;  4CAV A;  4M6G A;  3IU1 A;  4UWI A;  3PFO A;  4F9V A;  1M4I A;  1VHE A;  3P2H A;  2PQ8 A;  4XNH B;  3N7Z A;  4BBH A;  2PJ5 A;  1YRE A;  5AG7 A;  1HDU A;  4YGO A;  1GYT A;  3B3C A;  2DPS A;  3FIX A;  4X3R A;  1M4G A;  1BAV A;  3N5F A;  3VAT A;  3BLN A;  4AG9 A;  4YRH A;  1SQH A;  1MJB A;  2VZZ A;  2ZPA A;  4OC0 A;  3FEE A;  2FT0 A;  2OU2 A;  2H5M A;  2REE A;  4JD6 A;  4PK3 A;  4X5K A;  1RO5 A;  2Q51 A;  1KUX A;  1HDQ A;  1Q2D A;  1IU8 A;  2EVN A;  4B14 A;  6CPA A;  4AVC A;  4MJ8 A;  3NE8 A;  1CPS A;  1CP6 A;  4BIN A;  4EWT A;  4XPD C;  1Z8W A;  4C68 A;  1UFH A;  2CTB A;  1OBR A;  3S9M A;  2PVV A;  1VIX A;  1ZO0 A;  5AGE A;  1Z8L A;  2REF A;  2ABZ A;  3TOA A;  4FAI A;  2ZOF A;  1LAM A;  2Q7B A;  1XMB A;  4NSQ A;  2VZY A;  3F0A A;  1LOK A;  2DEA A;  2XEJ A;  2OOT A;  3R9F A;  3SI1 A;  3F5B A;  3CT9 A;  1F2O A;  5THW A;  4MFZ A;  2Z3M A;  1PU9 A;  1XF8 A;  5ELY A;  4C2Y A;  1ZG9 A;  3SXO A;  5LYF A;  2EO8 A;  1TKH A;  2GIV A;  3DGV A;  3CPX A;  3FMC A;  4UCM A;  5D29 A;  4IAV A;  1X12 A;  4MY0 A;  4QUS A;  2O28 A;  2ZXV A;  2ZEF A;  4B5P A;  1FY7 A;  3FF3 A;  3IFE A;  2VXK A;  4MBU A;  4PXC A;  2PR8 A;  2PJ2 A;  2QJ8 A;  4NCZ A;  2PJC A;  4MHZ A;  2GE3 A;  3WT4 A;  3PB7 X;  4II9 A;  4WJB A;  1R43 A;  5F09 A;  1XBU A;  2IL4 A;  1TKF A;  4Y49 B;  1ZG8 A;  1P4N A;  5LRG A;  3TT2 A;  4A38 A;  3GLJ A;  4C7I A;  5A28 A;  4U9Z A;  3S6G A;  3GB0 A;  2J9A A;  4B6Z A;  3IJ3 A;  1TIQ A;  5G1Z A;  2C6G A;  4MY3 A;  1S7L A;  5EBV A;  3W91 A;  1MK4 A;  4H89 A;  4ONU A;  3PP9 A;  1S60 A;  2QEC A;  5EMI A;  3D67 A;  4KVM E;  3CXP A;  2V8D A;  3K2K A;  1Y9W A;  3DNS A;  3TO9 A;  2B4D B;  4ZBG A;  5H86 A;  1VHO A;  4F0Y A;  3GYA A;  4KVO E;  4R76 A;  4F6A A;  4KOX A;  2Q4Y A;  1CG2 A;  4R6T A;  2CXA A;  1I1D A;  1IOF A;  4DJL A;  2AFW A;  2RC4 A;  3VAR A;  3EFA A;  5AG5 A;  2B3V A;  4AVB A;  1CPX A;  2O53 A;  3SI2 A;  3WAB A;  4B11 A;  1QMU A;  2CY2 A;  2IQ6 A;  1Q2C A;  2R8V A;  4CYN A;  4UWJ A;  2HV2 A;  2CNT A;  3I1U A;  1DTD A;  4XPD B;  3VWE A;  1B6B A;  3FED A;  3DR6 A;  3NE7 A;  3PBB A;  4OKO A;  1XMT A;  2J8N A;  4PXD A;  1I12 A;  1YVO A;  3OWC A;  3K9U A;  2PJ3 A;  5D8N A;  2ZEM A;  4R3K A;  4R7M A;  4DUK A;  1HEE A;  1M1D A;  2JDD A;  2PJB A;  2K5T A;  3KR4 A;  2PJ4 A;  4K3N A;  3UY5 A;  2BO9 A;  5IV0 A;  3EXN A;  4W9Y A;  3HLP A;  1B87 A;  4B12 A;  3QNV A;  1KUY A;  3TOB A;  2F7V A;  2I3C A;  2ZEO A;  3PFE A;  5H84 A;  2PR1 A;  1YW4 A;  1FT7 A;  2Q0Y A;  2O4H A;  2ZEH A;  5G22 A;  3B3T A;  3D3S A;  3KL9 A;  1Z4R A;  3FX6 A;  4WWV A;  1Y0Y A; 
#chains in the Genus database with same CATH homology
 4CGL A;  4CGO A;  3JTK A;  2WPX A;  4KSA A;  4CRZ B;  3FXT A;  2HQY A;  2KCW A;  2EUI A;  3I9S A;  4A31 A;  1IB1 E;  2Q04 A;  4R9M A;  1MJA A;  2GAN A;  4CGM A;  4KS9 A;  4PV6 A;  2Q4V A;  4R3L A;  2HUZ A;  1YX0 A;  1QST A;  5G21 A;  2AJ6 A;  4PK2 A;  4OAE A;  2R7H A;  4A32 A;  1LRZ A;  4MI4 A;  4CYO A;  5BWA B;  3TFY A;  2B4D A;  2J8R A;  4B5O A;  2Z11 A;  1GHE A;  2BEI A;  3GKR A;  4KOR A;  5J8F A;  3T90 A;  3R95 A;  1BOB A;  4HNW B;  2G3T A;  4CAX A;  4I49 A;  2YNE A;  3ZZI A;  1YGH A;  4CS0 B;  4E0A A;  5AG4 A;  4FD6 A;  4QC6 A;  4CAF A;  2FCK A;  3B8G A;  1QSR A;  2DXQ A;  1WK4 A;  4CGP A;  2B58 A;  4LX9 A;  3JVN A;  3DSB A;  2Z3O A;  3S6K A;  4CYP A;  3TO7 A;  3IGR A;  4H6U A;  1L0C A;  5JPH A;  1QSM A;  4RI1 A;  2OZU A;  4J3G A;  2P6G A;  5IX3 A;  4XPL A;  1Y9K A;  2FIA A;  1YVK A;  4UA3 A;  1M44 A;  2R98 A;  2ARH A;  2CNS A;  1IIC A;  1K4J A;  5F46 A;  4KOW A;  3W6S A;  4CRY B;  3FRM A;  4L8A A;  2OZH A;  3R96 A;  3P2F A;  3G3S A;  4F0X A;  4ZGY B;  1V0C A;  4MFK A;  2G0B A;  2Z3P A;  3R1K A;  4QBJ A;  4UBR A;  4CGN A;  4UFX A;  4ORF A;  2PC1 A;  3F8K A;  3PGP A;  1VKC A;  4RS2 A;  5DWM A;  3DDD A;  1NSL A;  3FNC A;  2PRB A;  2Z10 A;  3SHP A;  3IWE A;  2ZW6 A;  4E8O A;  2CNM A;  3S6F A;  3TO6 A;  3QB8 A;  4M85 A;  2WSA A;  2R1I A;  3MGD A;  5C88 A;  2PSW A;  3JUW A;  4E2A A;  4Q38 A;  1Z9U A;  2BSW A;  2Z0Z A;  2FS5 A;  2OB0 A;  2ATR A;  3TTH A;  1I21 A;  4DNC A;  5KTA A;  3H5Z A;  2X7B A;  1Y7R A;  3V8I A;  2VI7 A;  4A33 A;  2D4O A;  3S6H A;  3CXS A;  3VWD A;  3IU2 A;  3R9E A;  1QSN A;  4KLW A;  3G8W A;  5ISV A;  3EO4 A;  3DR8 A;  4GS4 A;  3E0K A;  4K30 A;  4KOY A;  3SXN A;  2C27 A;  2F5I A;  2VQY A;  5E96 A;  4PSW A;  4NXY A;  3IWG A;  1YLE A;  4A2Z A;  1YR0 A;  4FD4 A;  2JDC A;  3LD2 A;  4OAD A;  4JXR A;  3D2P A;  4PSX A;  5F48 A;  4MFQ A;  2YND A;  5KTC A;  4FD5 A;  4Q36 A;  4A30 A;  5IB0 A;  2G3A A;  2B3U A;  1IYL A;  2WPW A;  4QB9 A;  2I00 A;  2FIW A;  4KOS A;  4CAE A;  4MFJ A;  3BJ7 A;  4HNX B;  1J4J A;  4MHD A;  2VEZ A;  3TE4 A;  4XNH C;  2Q44 A;  1XEB A;  2FL4 A;  1PUA A;  4JXQ A;  4JWP A;  5KTD A;  2P6F A;  4QVT A;  2BUE A;  1OZP A;  3CXQ A;  2P0W A;  1KUV A;  1M4D A;  3C26 A;  4MFP A;  5CNP A;  3KKW A;  1IID A;  4KZT A;  4IUS A;  4AB7 A;  2ZW4 A;  4HNY B;  1CM0 A;  3H4Q A;  5HH1 A;  1YK3 A;  5G20 A;  1XE4 A;  1P0H A;  2I79 A;  2B5G B;  4KVX A;  5GCN A;  1S3Z A;  1S7K A;  4NF1 A;  3W6X A;  1S5K A;  1NE9 A;  5A27 A;  4EVY A;  1CJW A;  3GY9 A;  4YFJ A;  2FE7 A;  4AG7 A;  4U5Y A;  5AG6 A;  5F47 A;  4AVA A;  1N71 A;  4U9Y A;  3T9Y A;  4XPK A;  5HMN A;  3ZJ0 A;  2OH1 A;  1XIX A;  2P6E A;  3D8P A;  4C2Z A;  2D4P A;  4JLY A;  2OZG A;  1Q2Y A;  4M3S A;  2AE6 A;  1U6M A;  4C2X A;  2A4N A;  2Z3N A;  4MFL A;  3RYO A;  4LUA A;  2JEV A;  3EY5 A;  4UCP A;  3TCV A;  4H6Z A;  4Y49 C;  2Z3L A;  3FBU A;  4KLV A;  4HKF A;  1Z4E A;  2J8M A;  2JLM A;  2BL1 A;  2Y0M A;  2FSR A;  2PDO A;  4CYQ A;  5FVJ A;  4CAW A;  3FYN A;  2YGW A;  3LOD A;  2YNC C;  2YNC A;  3EC4 A;  3R9G A;  2B4B A;  4KOT A;  5I0C A;  1ON0 A;  2QML A;  1WWZ A;  5EC4 A;  2WUU A;  1S7F A;  4B13 A;  1S7N A;  4IF5 A;  1MJ9 A;  2DPT A;  2Z3K A;  3D2M A;  4C7H A;  1QSO A;  3PZJ A;  4A95 A;  4BMH A;  4KUB A;  4UFV A;  4UFW A;  1KZF A;  4UCN A;  4JJX A;  4NEX A;  4B10 A;  4L89 A;  5DWN A;  1NMT A;  2ZW5 A;  2QIR A;  3A9L A;  4R57 A;  3I3G A;  2FXF A;  1IYK A;  4KOU A;  5F49 A;  1R57 A;  4B5P B;  4R87 A;  2NMT A;  2VBQ A;  5JQ4 A;  2ZW7 A;  4KUA A;  3WR7 A;  3FB3 A;  5C82 A;  3BJ8 A;  1VHS A;  4FD7 A;  4KSF A;  4OLL A;  1RXT A;  5J8C A;  1BO4 A;  2B5G A;  3QAH A;  4CAV A;  4KOV A;  3IU1 A;  4UWI A;  1M4I A;  3P2H A;  2PQ8 A;  4XNH B;  3N7Z A;  4BBH A;  1YRE A;  5AG7 A;  4YGO A;  2DPS A;  3FIX A;  1M4G A;  3BLN A;  4AG9 A;  4YRH A;  1SQH A;  1MJB A;  2VZZ A;  2ZPA A;  2FT0 A;  2OU2 A;  2H5M A;  2REE A;  4JD6 A;  4PK3 A;  4X5K A;  1RO5 A;  1KUX A;  1Q2D A;  2EVN A;  4B14 A;  4AVC A;  4MJ8 A;  4XPD C;  4C68 A;  1UFH A;  1ZO0 A;  5AGE A;  2REF A;  3TOA A;  2Q7B A;  4NSQ A;  2VZY A;  3F0A A;  3R9F A;  3F5B A;  4MFZ A;  2Z3M A;  1PU9 A;  1XF8 A;  4C2Y A;  3SXO A;  2GIV A;  4UCM A;  4MY0 A;  4QUS A;  2O28 A;  2ZXV A;  4B5P A;  1FY7 A;  2VXK A;  4MBU A;  2PR8 A;  4NCZ A;  2GE3 A;  4II9 A;  2IL4 A;  4Y49 B;  1P4N A;  3TT2 A;  4C7I A;  5A28 A;  4U9Z A;  3S6G A;  1TIQ A;  5G1Z A;  4MY3 A;  1S7L A;  5EBV A;  3W91 A;  1MK4 A;  4H89 A;  4ONU A;  3PP9 A;  1S60 A;  2QEC A;  4KVM E;  3CXP A;  1Y9W A;  3DNS A;  3TO9 A;  2B4D B;  4ZBG A;  5H86 A;  4F0Y A;  3GYA A;  4KVO E;  4F6A A;  4KOX A;  2Q4Y A;  2CXA A;  1I1D A;  2RC4 A;  3EFA A;  5AG5 A;  2B3V A;  4AVB A;  4B11 A;  2CY2 A;  1Q2C A;  2R8V A;  4CYN A;  4UWJ A;  2HV2 A;  2CNT A;  4XPD B;  3VWE A;  1B6B A;  3DR6 A;  3NE7 A;  1XMT A;  2J8N A;  1I12 A;  1YVO A;  3OWC A;  3K9U A;  4R3K A;  1M1D A;  2JDD A;  3UY5 A;  5IV0 A;  2K5T A;  3EXN A;  1B87 A;  4B12 A;  1KUY A;  3TOB A;  5H84 A;  2PR1 A;  2Q0Y A;  5G22 A;  3D3S A;  1Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...