3PP9A

1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
181
structure length
176
Chain Sequence
b'SLLIRELETNDLDNFPEIDDSFIVNARLMLSLSKVNRRIEYTVEDVPSYEKSYLELVYNEYINKPNQIIYIALLHNQIIGFIVLKKNWNNYAYIEDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNMTSDEVAIYWYLHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative streptothricin acetyltransferase
publication title 1.6 Angstrom resolution crystal structure of putative streptothricin acetyltransferase from Bacillus anthracis str. Ames in complex with acetyl coenzyme A
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 39
structure length 176
sequence length 181
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pp9A00
3EY5A 2O28A 2HQYA 4CRZB 1RO5A 1P4NA 1S7KA 4KORA 4F6AA 4R3LA 2OZHA 2FSRA 4JXQA 3I9SA 4KUBA 4B5PB 4JJXA 2X7BA 3BJ7A 4XNHB 4JD6A 2B4DB 2DXQA 1IYKA 2QMLA 4HNYB 3SHPA 2B3VA 2ZW7A 1M4IA 4ZBGA 1KUVA 3EFAA 3NE7A 4NSQA 1S60A 1S7LA 1L0CA 4Y49C 2PR1A 3JUWA 3RYOA 3DDDA 2VEZA 3TE4A 3K9UA 4PSWA 5F47A 1YVKA 2HV2A 2NMTA 4UBRA 3S6KA 1B6BA 4H6ZA 1V0CA 1XF8A 2RC4A 4MY3A 2PRBA 4MI4A 1MJBA 3FIXA 4KVME 2Q7BA 2BEIA 2AE6A 1N71A 1QSRA 2J8MA 2P6GA 5EBVA 4OLLA 2G0BA 3BJ8A 1VHSA 4M3SA 3EC4A 1KUYA 4Y49B 1QSOA 5IB0A 3FXTA 4UA3A 1I21A 1IICA 3TO9A 4XPLA 3S6FA 4E2AA 4XPDC 1NE9A 4R3KA 1CJWA 5F49A 5F48A 3PP9A 2PR8A 3G8WA 3KKWA 4FD7A 2BUEA 4QB9A 4MHDA 1RXTA 5EC4A 2EUIA 2Y0MA 1XIXA 4MBUA 1SQHA 4MJ8A 4KZTA 3V8IA 2JDDA 3SXNA 1I1DA 5H86A 5ISVA 3E0KA 3DR6A 4RI1A 3W6XA 4L8AA 2GIVA 3B8GA 2Q44A 5IX3A 4U5YA 3F8KA 4XPDB 1M4GA 4FD4A 3VWDA 5DWMA 2A4NA 3F5BA 3R1KA 4JWPA 3R9FA 1B87A 4E8OA 2ZW6A 2R8VA 5GCNA 1S7NA 1WK4A 4YFJA 2VQYA 4PSXA 2REEA 4F0YA 2Z10A 3WR7A 4UWJA 1M1DA 2Q0YA 3TO6A 1YK3A 5CNPA 1LRZA 2HUZA 4E0AA 2B5GB 2ZW5A 4CS0B 2C27A 4M85A 1YR0A 1VKCA 1Z4RA 4GS4A 2ATRA 2WPXA 4U9YA 2WPWA 1YGHA 1U6MA 4NXYA 1P0HA 2CNSA 2D4OA 3S6HA 3IGRA 5F46A 4I49A 1S7FA 3DNSA 5KTAA 1OZPA 1Z9UA 2VZYA 3GKRA 2AJ6A 4AVCA 2CNTA 3FB3A 2KCWA 4YRHA 5KTCA 3R9EA 2Q04A 4AG9A 4B5OA 1IB1E 2JEVA 4H6UA 4R9MA 5I0CA 3TFYA 4KUAA 4FD5A 1IIDA 5C88A 2OH1A 2FIAA 1YREA 2R98A 2G3AA 3EO4A 4KOXA 1FY7A 1Y9KA 2K5TA 3P2HA 4PV6A 3CXPA 1NMTA 2FL4A 3TTHA 3ZZIA 2VBQA 4K30A 2R1IA 2PC1A 3UY5A 1MK4A 4KOUA 2VI7A 3TT2A 4FD6A 4NCZA 4YGOA 3D8PA 1GHEA 3TOAA 3IWGA 1M44A 4X5KA 4H89A 4KOTA 2ZXVA 3C26A 2ZW4A 3QB8A 4PK2A 3W91A 2ZPAA 2JLMA 3SXOA 4HNXB 2P0WA 3QAHA 1Y7RA 2Z0ZA 4LX9A 4BMHA 2FIWA 3R9GA 3T9YA 4II9A 2EVNA 3D2PA 3DR8A 3W6SA 4AB7A 1XEBA 4B5PA 2OU2A 2VZZA 2B4DA 1QSNA 2REFA 3I3GA 3P2FA 5C82A 1QSTA 2FCKA 2OB0A 5FVJA 4EVYA 2BSWA 2Q4YA 4KVXA 1IYLA 3TOBA 4JXRA 1QSMA 3FBUA 4XPKA 1MJAA 4AVAA 3GY9A 2J8RA 2I00A 4LUAA 3FYNA 2D4PA 2CY2A 2VXKA 3S6GA 5J8CA 3CXSA 1ON0A 3LD2A 1NSLA 3TO7A 4U9ZA 1CM0A 2G3TA 2J8NA 4L89A 4KVOE 1I12A 1BO4A 2FXFA 4KOYA 4NF1A 4R87A 4CAXA 3FRMA 1KZFA 1YX0A 3GYAA 1XE4A 4QUSA 2GANA 1R57A 2PQ8A 2R7HA 1WWZA 3G3SA 2IL4A 3PGPA 3PZJA 2B4BA 1M4DA 1PUAA 4ONUA 5KTDA 5HH1A 3EXNA 4DNCA 4R57A 3DSBA 2P6EA 5JQ4A 4KLVA 1YVOA 4PK3A 5IV0A 2P6FA 4J3GA 5E96A 2FT0A 1Q2YA 1BOBA 3H4QA 4HNWB 4QVTA 2H5MA 3JVNA 1MJ9A 2B3UA 2F5IA 2PDOA 4KOVA 1TIQA 4AVBA 1KUXA 1XMTA 4KLWA 4IF5A 4JLYA 4KOWA 3R96A 3CXQA 2BL1A 3D3SA 3TCVA 1Z4EA 2JDCA 2Q4VA 3T90A 1S3ZA 4HKFA 4CAVA 4KOSA 3F0AA 2GE3A 4MY0A 3BLNA 2QIRA 4AG7A 2Z11A 3ZJ0A 2B5GA 4RS2A 3OWCA 3D2MA 3VWEA 1J4JA 2CNMA 2FS5A 5HMNA 4QBJA 2I79A 4QC6A 5DWNA 1K4JA 2B58A 3FNCA 4UWIA 1Y9WA 3N7ZA 1PU9A 4OAEA 1Q2CA 4OADA 2OZUA 2PSWA 5J8FA 4ORFA 2QECA 3LODA 2ARHA 1Q2DA 5JPHA 2FE7A 2OZGA 4NEXA 4CAWA 4IUSA 4XNHC 5H84A 1S5KA 1UFHA 4CRYB 3R95A 1YLEA 3MGDA
chains in the Genus database with same CATH superfamily
3EY5A 2O28A 4NGPA 2HQYA 4CRZB 1RO5A 2ZENA 4ZY0A 1P4NA 3FF3A 1S7KA 1TKJA 2JBJA 4KORA 4F6AA 5I4MA 3D7GA 4R3LA 2OZHA 1CPXA 5BWAB 1IOFA 2FSRA 4JXQA 3I9SA 4FBEA 4GM5A 4YU9A 1IOIA 2G9DA 4KUBA 4A38A 4KS9A 1Z8WA 2ZEPA 1YLOA 4B5PB 4JJXA 2X7BA 4EWTA 3BJ7A 4R7MA 1GYTA 4JD6A 2B4DB 1PCAA 3D7DA 4XNHB 1BPNA 4P6YA 2DXQA 3FX6A 3B3CA 1IYKA 2QMLA 4HNYB 3SHPA 4F9VA 4EFDA 2B3VA 2ZW7A 3FEEA 3D7HA 3FH4A 1M4IA 1Z8TA 1KUVA 4ZBGA 1ZLHA 3EFAA 3NE7A 1CBXA 2RB7A 2V8DA 4NSQA 5G21A 1S60A 1S7LA 1L0CA 3N5FA 4OC3A 3WABA 3QAYA 1IY7A 4M6GA 2PR1A 4Y49C 2PCUA 4A95A 1AYEA 3KQXA 3JUWA 2ANPA 3RYOA 3DDDA 2VEZA 3TE4A 2PJAA 7CPAA 3K9UA 1F2PA 2CTBA 4PSWA 4P4JA 1YVKA 5F47A 2HV2A 2NMTA 4UBRA 3S6KA 1B6BA 4H6ZA 4GXHA 4UF4A 1H8LA 3KQZA 1V0CA 1XF8A 2RC4A 3FVLA 2Z3KA 4UCPA 3RO0A 2BO9A 2F8HA 4MY3A 2PRBA 4P44A 1TF9A 4MI4A 5K8OA 2CF4A 4RN7A 1TKFA 1MJBA 2V8VA 3FIXA 3I1UA 3MN8A 4IAVA 4KVME 5JGFA 2Q7BA 2BEIA 3D7FA 2AE6A 1FT7A 3CT9A 1N71A 1QMUA 1QSRA 2NSMA 3B3SA 2WYRA 4X8IA 4OKOA 1YW4A 4UCNA 2J8MA 3SJGA 2P6GA 3WC5A 5EBVA 2CIJA 1ELLP 4OLLA 2G0BA 3BJ8A 1VHSA 4M3SA 2YNDA 1CX8A 2QJ8A 1KUYA 3EC4A 4MFLA 4Y49B 5EMIA 3GUXA 4A32A 1QSOA 5IB0A 3FXTA 4UA3A 1I21A 1IICA 2ZEOA 2IMOA 1DE4C 3H5ZA 3TO9A 4XPLA 4C2XA 3S6FA 4C2YA 4E2AA 3B2YA 4XPDC 4ONWA 2PJBA 1NE9A 5LRGA 1YSJA 4P4BA 4MHZA 4MMOA 1HDUA 4R3KA 1QQ9A 1VHEA 1CJWA 5A28A 2ZOGA 5F49A 5F48A 3PP9A 2PR8A 1EE3P 2IQ6A 3G8WA 3KKWA 2BUEA 4FD7A 4QB9A 4MHDA 1RXTA 4R76A 5D29A 1Y0RA 5EC4A 1XFOA 2EUIA 2DEAA 1TXRA 2Y0MA 1XIXA 1BAVA 4MBUA 1SQHA 4UIAA 5HXDA 4MJ8A 4KZTA 3V8IA 4CGPA 2JDDA 3DLJA 4ZX8A 3FMCA 3PBBA 1I1DA 2ZEFA 3SXNA 5H86A 3KL9A 1Y7EA 5ISVA 5AG4A 3DR6A 3E0KA 3KI9A 4RI1A 5G1ZA 2NYQA 2WZNA 5LYDA 3W6XA 4L8AA 2GIVA 4B11A 3D4UA 1IU8A 3SI2A 2PVWA 3B8GA 2Q44A 1ZG8A 5IX3A 4U5YA 3F8KA 4F0XA 4XPDB 1M4GA 4MCPA 4UIBA 4FD4A 3PFEA 3VWDA 5DWMA 2A4NA 3F5BA 3R1KA 4HPSA 4JWPA 3R9FA 1B87A 3WC7A 4OMEA 4E8OA 4P4EA 2YNCA 2ZW6A 2R8VA 5GCNA 1S7NA 1WK4A 4YFJA 2VQYA 3B35A 4PSXA 2REEA 2PJ5A 4F0YA 1YW6A 4LQ6A 4A39A 4CYNA 3ISZA 2Z10A 3WR7A 4UWJA 1M1DA 3WT4A 5LYIA 1DTDA 2Q0YA 3TO6A 4K3NA 1YK3A 3SJEA 5CNPA 3DGVA 1LRZA 2HUZA 3PRTA 4E0AA 2B5GB 2ZW5A 3KHXA 5JH9A 4CS0B 2C27A 4M85A 2DPSA 1YR0A 1VKCA 1Z4RA 3H8EA 2ATRA 4GS4A 4A37A 4BD9A 4BBHA 1ZG9A 3SJFA 2O4HA 2EK9A 2WPXA 4U9YA 3K9TA 2WPWA 4R8FA 1YGHA 4Q7AA 4CGNA 5CBMA 1R3NA 3GLJA 4FUUA 1U6MA 2V8GA 4NXYA 1P0HA 4DJLA 4CGLA 5K8PA 2CNSA 2AFXA 2D4OA 3BI1A 3FJUA 3CZXA 3PEIA 4DYOA 1PYTB 3S6HA 2EK8A 2YNEA 3IGRA 4OC5A 3RNZA 4M6HA 1LAMA 4NGTA 5F46A 3NH5A 3KASA 4I49A 2PJ3A 1S7FA 3DNSA 5KTAA 2GU2A 2PJ1A 1Z2LA 1OZPA 3VARA 1Z9UA 2VZYA 2OOTA 3PB8X 4UEFA 1YMEA 2WSAA 3GKRA 2AJ6A 4AVCA 3L2NA 2PRQA 4A31A 2CNTA 5HVHA 2AFZA 3FB3A 2KCWA 4YRHA 2Q4ZA 3PBEA 4ZYQA 1XJOA 5KTCA 2PE3A 3R9EA 2Q04A 4X3RA 5A27A 4ZGYB 3PB6X 2DPTA 4AG9A 4B5OA 1IB1E 2Z3OA 2JEVA 2Q43A 1AUGA 2C6GA 3B3WA 2PVVA 3IO1A 4H6UA 4LQGA 4R9MA 4WWVA 5CPAA 5ELYA 4KUAA 3HUVA 5I0CA 3TFYA 4OIWA 4MXUA 2C6CA 4MFJA 1XBUA 4ZY1A 1KWMA 2EBJA 1ARMA 4FD5A 1XRYA 3SI0A 1IIDA 3KHZA 5C88A 4P45A 2OH1A 2FIAA 4H2KA 2XEGA 4G1PA 1YREA 2R98A 3IEHA 3MRUA 2G3AA 3EO4A 4KOXA 4F9UA 1FY7A 2C6PA 3SI1A 4OIDA 1Y9KA 2K5TA 3BXMA 3P2HA 4CGMA 2ZEHA 4EMEA 2Z3PA 1Z5RA 3LMSA 4PV6A 3CXPA 1NMTA 2FL4A 3IWEA 3KZWA 3TTHA 3ZZIA 5C82A 4MFQA 4JZ0A 4MFZA 5AG7A 2VBQA 4K30A 2R1IA 2PC1A 3UY5A 4II9A 1MK4A 4UFVA 4A2ZA 3IFEA 4B6ZA 1CG2A 4KOUA 2Q51A 3IWWA 2VI7A 4OC1A 3TT2A 4FD6A 4NCZA 4YGOA 3D8PA 1GHEA 3TOAA 4PXCA 3IWGA 1M44A 2ABZA 1CP7A 2OR4A 4PXDA 4X5KA 4C2ZA 4H89A 4KOTA 2Z3NA 1TKHA 2ZELA 2AFMA 2ZXVA 1LCPA 3SJXA 2QYVA 4CYPA 2GREA 3C26A 2ZW4A 3QB8A 4MHYA 4PK2A 4ZX9A 3W91A 2ZPAA 2JLMA 4MHNA 3SXOA 4HNXB 2WUUA 2P0WA 3QAHA 1Y7RA 2BOAA 3S9NA 4ZI6A 2Z0ZA 2XEFA 4LX9A 4NGNA 3WC6A 2FIWA 2Q7SA 3PB4X 3R9GA 2EVNA 3D2PA 3B7IA 3DR8A 3T9YA 3H8GA 3W6SA 1XOVA 4DUKA 4Q38A 2EO8A 4AB7A 4BMHA 4PQAA 1XEBA 4B5PA 4P4FA 2OU2A 2VZZA 2B4DA 3B3VA 1QSNA 1M4LA 2HC9A 2REFA 3I3GA 3P2FA 1LFWA 1QSTA 2FCKA 2OB0A 4MFKA 4UCMA 4UFWA 5DS0A 3D66A 5FVJA 4EVYA 2ZOFA 2BSWA 2Q4YA 3KR5A 4KVXA 1IYLA 4A30A 3TOBA 3S9LA 4JXRA 3TC8A 1QSMA 1XMBA 1Z8LA 4CAEA 4OC0A 1TF8A 3FBUA 4XPKA 1MJAA 1CP6A 2XEJA 2POKA 1ELMP 2J9AA 1NSAA 1R43A 4IHMA 4AVAA 4UFXA 3GY9A 2J8RA 2YNCC 1HDQA 2PJ2A 2I00A 4CGOA 4LUAA 5D8NA 5HVFA 4P4DA 3FYNA 2D4PA 5HVGA 3RZAA 2CY2A 3HLPA 2VXKA 4O23A 5G22A 3S6GA 2AFSA 2DF5A 4CYOA 5J8CA 3GIUA 2ZEEA 4FWUA 1FNOA 3B3TA 3CXSA 1ON0A 3LD2A 1NSLA 3A9LA 3TO7A 4CAFA 1A2ZA 4U9ZA 4BINA 1CM0A 5AGEA 4A94A 2G3TA 2J8NA 4L89A 4NGRA 3CPXA 4KVOE 1I12A 5K8NA 1HEEA 3LACA 1BO4A 5LYFA 3FEDA 2FXFA 4KOYA 1VHOA 4NF1A 3CDXA 2QVPA 1JQGA 4WJBA 4R87A 1F57A 3V7ZA 4KSIA 4CAXA 3FRMA 1KZFA 2ODFA 4W9YA 2YGWA 5AG5A 1YX0A 3GYAA 1XE4A 4QUSA 4C7IA 2GANA 3T8WA 1R57A 2PQ8A 2R7HA 4NJRA 1WWZA 3JTKA 1ARLA 4JYWA 4P4IA 1ZG7A 3G3SA 1OBRA 2IL4A 3PGPA 3PZJA 3S9MA 2B4BA 5J1QA 3BHXA 4PPZA 4IK2A 4B12A 4MRIA 3JRUA 1M4DA 2PJ9A 4UEEA 4NGSA 4TWEA 2ZEGA 3NH8A 4A33A 4MHPA 2GLJA 5LRJA 1AMPA 2PJ6A 1PUAA 4C68A 3RBUA 1CPSA 4ONUA 3NFZA 2Z3MA 2O53A 4B13A 5KTDA 5HH1A 3EXNA 1LAPA 4DNCA 4R57A 3DSBA 1BLLE 1LOKA 2P6EA 5JQ4A 4KLVA 2EWBA 4PXEA 1YVOA 4MCRA 4PK3A 1RTQA 2AFOA 2FVGA 5IV0A 1ZLIA 2C1CA 2CTCA 1YQEA 2P6FA 4J3GA 1Q7LA 5E96A 2FT0A 5K8MA 3KGQA 1Q2YA 2PIYA 5AG6A 2I3CA 1BOBA 4PXBA 5LYLA 4Z65A 4B10A 2XEIA 2V77A 2PJ8A 3H4QA 3K2KA 3BI0A 4HNWB 4QVTA 4AXVA 2H5MA 4ZY2A 3JVNA 1MJ9A 5IB9A 4R6TA 3RAMA 2ZEMA 4M6IA 3KR4A 1JWQA 4OC4A 2B3UA 2F5IA 3PB9X 2PDOA 4KSFA 4MFPA 5F09A 1ZO0A 4KOVA 4UEZA 2PJ4A 1TIQA 3FECA 4AVBA 1KUXA 3PFOA 1XMTA 5LRKA 4KLWA 2PJ0A 4IF5A 4JLYA 4KOWA 3R96A 4F8ZA 1X12A 3CXQA 2JBKA 2BL1A 3IIBA 3CPAA 2Z3LA 3D3SA 3TCVA 4NJQA 1Z4EA 2JDCA 2Q4VA 3T90A 2PJ7A 1S3ZA 2GFQA 4HKFA 1Z8XA 2F7VA 3NH4A 4B14A 4KOSA 4CAVA 3VATA 1IGBA 3F0AA 2GE3A 4MY0A 5THWA 4TNUA 8CPAA 3BLNA 2AFWA 2QIRA 3H8FA 4AG7A 2Z11A 3ZJ0A 2B5GA 4RS2A 4CPAA 6CPAA 3NE8A 4YWYA 3OWCA 5JM6A 1UWYA 3D2MA 4OP4A 3VWEA 2GLFA 1LANA 2PIZA 3D68A 1J4JA 2CNMA 2FS5A 5HMNA 4QBJA 2I79A 2CXAA 4QC6A 4NFRA 5DWNA 3TX8A 4P10A 2RFHA 3GB0A 1K4JA 2B58A 2AFUA 3FNCA 4UWIA 4NGQA 3PB7X 1Y9WA 4RUHA 2HB6A 3N7ZA 1PU9A 3QNVA 3D67A 4X2TA 4CYQA 4OAEA 1Q2CA 4Q36A 4NGMA 4OADA 2PJCA 2OZUA 2PSWA 3IU1A 5G20A 5J8FA 3ISXA 4ORFA 3NA6A 2QECA 3LODA 4KSAA 1BPMA 2ARHA 2JEWA 1Q2DA 2BCOA 5JPHA 2FE7A 2OZGA 4NEXA 3IU2A 2V8HA 1Y0YA 3IJ3A 1VGYA 4CAWA 4IUSA 4XNHC 4OC2A 1S5KA 5H84A 4FAIA 1UFHA 1VIXA 3V38A 3VH9A 4C7HA 4MCQA 3IC1A 4CRYB 1F2OA 3LWUA 3R95A 2IJZA 1YLEA 2VL1A 1X10A 2ZEDA 3MGDA 4MCSA
chains in the Genus database with same CATH topology
3EY5A 2O28A 2HQYA 4CRZB 1RO5A 1P4NA 1S7KA 4KORA 4F6AA 4R3LA 2OZHA 5BWAB 2FSRA 4JXQA 3I9SA 4KUBA 4KS9A 4B5PB 4JJXA 2X7BA 3BJ7A 4XNHB 4JD6A 2B4DB 2DXQA 1IYKA 2QMLA 4HNYB 3SHPA 2B3VA 2ZW7A 1M4IA 4ZBGA 1KUVA 3EFAA 3NE7A 4NSQA 5G21A 1S60A 1S7LA 1L0CA 4Y49C 2PR1A 4A95A 3JUWA 3RYOA 3DDDA 2VEZA 3TE4A 3K9UA 4PSWA 5F47A 1YVKA 2HV2A 2NMTA 4UBRA 3S6KA 1B6BA 4H6ZA 1V0CA 1XF8A 2RC4A 2Z3KA 4UCPA 4MY3A 2PRBA 4MI4A 1MJBA 3FIXA 4KVME 2Q7BA 2BEIA 2AE6A 1N71A 1QSRA 4UCNA 2J8MA 2P6GA 5EBVA 4OLLA 2G0BA 3BJ8A 1VHSA 4M3SA 2YNDA 3EC4A 1KUYA 4MFLA 4Y49B 4A32A 1QSOA 5IB0A 3FXTA 4UA3A 1I21A 1IICA 3TO9A 3H5ZA 4XPLA 4C2XA 3S6FA 4C2YA 4E2AA 4XPDC 1NE9A 4R3KA 1CJWA 5A28A 5F49A 5F48A 3PP9A 2PR8A 3G8WA 3KKWA 4FD7A 2BUEA 4QB9A 4MHDA 1RXTA 5EC4A 2EUIA 2Y0MA 1XIXA 4MBUA 1SQHA 4MJ8A 4KZTA 3V8IA 4CGPA 2JDDA 3SXNA 1I1DA 5H86A 5ISVA 5AG4A 3E0KA 3DR6A 4RI1A 5G1ZA 3W6XA 4L8AA 2GIVA 4B11A 3B8GA 2Q44A 5IX3A 4U5YA 3F8KA 4F0XA 4XPDB 1M4GA 4FD4A 3VWDA 5DWMA 2A4NA 3F5BA 3R1KA 4JWPA 3R9FA 1B87A 4E8OA 2YNCA 2ZW6A 2R8VA 5GCNA 1S7NA 1WK4A 4YFJA 2VQYA 4PSXA 2REEA 4F0YA 4CYNA 2Z10A 3WR7A 4UWJA 1M1DA 2Q0YA 3TO6A 1YK3A 5CNPA 1LRZA 2HUZA 4E0AA 2B5GB 2ZW5A 4CS0B 2C27A 4M85A 2DPSA 1YR0A 1VKCA 1Z4RA 4GS4A 2ATRA 4BBHA 2WPXA 4U9YA 2WPWA 1YGHA 4CGNA 1U6MA 4NXYA 1P0HA 4CGLA 2CNSA 2D4OA 3S6HA 2YNEA 3IGRA 5F46A 4I49A 1S7FA 3DNSA 5KTAA 1OZPA 1Z9UA 2VZYA 2WSAA 3GKRA 2AJ6A 4AVCA 4A31A 2CNTA 3FB3A 2KCWA 4YRHA 5KTCA 3R9EA 5A27A 2Q04A 4ZGYB 2DPTA 4AG9A 4B5OA 1IB1E 2Z3OA 2JEVA 4H6UA 4R9MA 5I0CA 3TFYA 4KUAA 4MFJA 4FD5A 1IIDA 5C88A 2OH1A 2FIAA 1YREA 2R98A 2G3AA 3EO4A 4KOXA 1FY7A 1Y9KA 2K5TA 3P2HA 4CGMA 2Z3PA 4PV6A 3CXPA 1NMTA 2FL4A 3IWEA 3TTHA 3ZZIA 4MFQA 4MFZA 5AG7A 2VBQA 4K30A 2R1IA 2PC1A 3UY5A 1MK4A 4UFVA 4A2ZA 4KOUA 2VI7A 3TT2A 4FD6A 4NCZA 4YGOA 3D8PA 1GHEA 3TOAA 3IWGA 1M44A 4X5KA 4C2ZA 4H89A 4KOTA 2Z3NA 2ZXVA 4CYPA 3C26A 2ZW4A 3QB8A 4PK2A 3W91A 2ZPAA 2JLMA 3SXOA 4HNXB 2WUUA 2P0WA 3QAHA 1Y7RA 2Z0ZA 4LX9A 4BMHA 2FIWA 3R9GA 3T9YA 4II9A 2EVNA 3D2PA 3DR8A 3W6SA 4Q38A 4AB7A 1XEBA 4B5PA 2OU2A 2VZZA 2B4DA 1QSNA 2REFA 3I3GA 3P2FA 4MFKA 1QSTA 2FCKA 2OB0A 4UFWA 4UCMA 5C82A 5FVJA 4EVYA 2BSWA 2Q4YA 4KVXA 1IYLA 4A30A 3TOBA 4JXRA 1QSMA 4CAEA 3FBUA 4XPKA 1MJAA 4AVAA 4UFXA 3GY9A 2J8RA 2YNCC 2I00A 4CGOA 4LUAA 3FYNA 2D4PA 2CY2A 2VXKA 5G22A 3S6GA 4CYOA 5J8CA 3CXSA 1ON0A 3LD2A 1NSLA 3A9LA 3TO7A 4CAFA 4U9ZA 1CM0A 5AGEA 2G3TA 2J8NA 4L89A 4KVOE 1I12A 1BO4A 2FXFA 4KOYA 4NF1A 4R87A 4CAXA 3FRMA 1KZFA 5AG5A 2YGWA 1YX0A 3GYAA 1XE4A 4QUSA 4C7IA 2GANA 1R57A 2PQ8A 2R7HA 1WWZA 3JTKA 3G3SA 2IL4A 3PGPA 3PZJA 2B4BA 4B12A 1M4DA 4A33A 4C68A 1PUAA 4ONUA 2Z3MA 4B13A 5KTDA 5HH1A 3EXNA 4DNCA 4R57A 3DSBA 2P6EA 5JQ4A 4KLVA 1YVOA 4PK3A 5IV0A 2P6FA 4J3GA 5E96A 2FT0A 1Q2YA 5AG6A 1BOBA 4B10A 3H4QA 4HNWB 4QVTA 2H5MA 3JVNA 1MJ9A 2B3UA 2F5IA 4KSFA 2PDOA 4MFPA 1ZO0A 4KOVA 1TIQA 4AVBA 1KUXA 1XMTA 4KLWA 4IF5A 4JLYA 4KOWA 3R96A 3CXQA 2BL1A 2Z3LA 3D3SA 3TCVA 1Z4EA 2JDCA 2Q4VA 3T90A 4B14A 1S3ZA 4HKFA 4CAVA 4KOSA 3F0AA 2GE3A 4MY0A 3BLNA 2QIRA 4AG7A 2Z11A 3ZJ0A 2B5GA 4RS2A 3OWCA 3D2MA 3VWEA 1J4JA 2CNMA 2FS5A 5HMNA 4QBJA 2I79A 2CXAA 4QC6A 5DWNA 1K4JA 2B58A 3FNCA 4UWIA 1Y9WA 3N7ZA 1PU9A 4CYQA 4OAEA 1Q2CA 4Q36A 4OADA 2OZUA 2PSWA 3IU1A 5G20A 5J8FA 4ORFA 2QECA 3LODA 4KSAA 2ARHA 1Q2DA 5JPHA 2FE7A 2OZGA 4NEXA 3IU2A 4CAWA 4IUSA 4XNHC 5H84A 1S5KA 1UFHA 4C7HA 4CRYB 3R95A 1YLEA 3MGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY5 A;  2O28 A;  2HQY A;  4CRZ B;  1RO5 A;  1P4N A;  1S7K A;  4KOR A;  4F6A A;  4R3L A;  2OZH A;  2FSR A;  4JXQ A;  3I9S A;  4KUB A;  4B5P B;  4JJX A;  2X7B A;  3BJ7 A;  4XNH B;  4JD6 A;  2B4D B;  2DXQ A;  1IYK A;  2QML A;  4HNY B;  3SHP A;  2B3V A;  2ZW7 A;  1M4I A;  4ZBG A;  1KUV A;  3EFA A;  3NE7 A;  4NSQ A;  1S60 A;  1S7L A;  1L0C A;  4Y49 C;  2PR1 A;  3JUW A;  3RYO A;  3DDD A;  2VEZ A;  3TE4 A;  3K9U A;  4PSW A;  5F47 A;  1YVK A;  2HV2 A;  2NMT A;  4UBR A;  3S6K A;  1B6B A;  4H6Z A;  1V0C A;  1XF8 A;  2RC4 A;  4MY3 A;  2PRB A;  4MI4 A;  1MJB A;  3FIX A;  4KVM E;  2Q7B A;  2BEI A;  2AE6 A;  1N71 A;  1QSR A;  2J8M A;  2P6G A;  5EBV A;  4OLL A;  2G0B A;  3BJ8 A;  1VHS A;  4M3S A;  3EC4 A;  1KUY A;  4Y49 B;  1QSO A;  5IB0 A;  3FXT A;  4UA3 A;  1I21 A;  1IIC A;  3TO9 A;  4XPL A;  3S6F A;  4E2A A;  4XPD C;  1NE9 A;  4R3K A;  1CJW A;  5F49 A;  5F48 A;  3PP9 A;  2PR8 A;  3G8W A;  3KKW A;  4FD7 A;  2BUE A;  4QB9 A;  4MHD A;  1RXT A;  5EC4 A;  2EUI A;  2Y0M A;  1XIX A;  4MBU A;  1SQH A;  4MJ8 A;  4KZT A;  3V8I A;  2JDD A;  3SXN A;  1I1D A;  5H86 A;  5ISV A;  3E0K A;  3DR6 A;  4RI1 A;  3W6X A;  4L8A A;  2GIV A;  3B8G A;  2Q44 A;  5IX3 A;  4U5Y A;  3F8K A;  4XPD B;  1M4G A;  4FD4 A;  3VWD A;  5DWM A;  2A4N A;  3F5B A;  3R1K A;  4JWP A;  3R9F A;  1B87 A;  4E8O A;  2ZW6 A;  2R8V A;  5GCN A;  1S7N A;  1WK4 A;  4YFJ A;  2VQY A;  4PSX A;  2REE A;  4F0Y A;  2Z10 A;  3WR7 A;  4UWJ A;  1M1D A;  2Q0Y A;  3TO6 A;  1YK3 A;  5CNP A;  1LRZ A;  2HUZ A;  4E0A A;  2B5G B;  2ZW5 A;  4CS0 B;  2C27 A;  4M85 A;  1YR0 A;  1VKC A;  1Z4R A;  4GS4 A;  2ATR A;  2WPX A;  4U9Y A;  2WPW A;  1YGH A;  1U6M A;  4NXY A;  1P0H A;  2CNS A;  2D4O A;  3S6H A;  3IGR A;  5F46 A;  4I49 A;  1S7F A;  3DNS A;  5KTA A;  1OZP A;  1Z9U A;  2VZY A;  3GKR A;  2AJ6 A;  4AVC A;  2CNT A;  3FB3 A;  2KCW A;  4YRH A;  5KTC A;  3R9E A;  2Q04 A;  4AG9 A;  4B5O A;  1IB1 E;  2JEV A;  4H6U A;  4R9M A;  5I0C A;  3TFY A;  4KUA A;  4FD5 A;  1IID A;  5C88 A;  2OH1 A;  2FIA A;  1YRE A;  2R98 A;  2G3A A;  3EO4 A;  4KOX A;  1FY7 A;  1Y9K A;  2K5T A;  3P2H A;  4PV6 A;  3CXP A;  1NMT A;  2FL4 A;  3TTH A;  3ZZI A;  2VBQ A;  4K30 A;  2R1I A;  2PC1 A;  3UY5 A;  1MK4 A;  4KOU A;  2VI7 A;  3TT2 A;  4FD6 A;  4NCZ A;  4YGO A;  3D8P A;  1GHE A;  3TOA A;  3IWG A;  1M44 A;  4X5K A;  4H89 A;  4KOT A;  2ZXV A;  3C26 A;  2ZW4 A;  3QB8 A;  4PK2 A;  3W91 A;  2ZPA A;  2JLM A;  3SXO A;  4HNX B;  2P0W A;  3QAH A;  1Y7R A;  2Z0Z A;  4LX9 A;  4BMH A;  2FIW A;  3R9G A;  3T9Y A;  4II9 A;  2EVN A;  3D2P A;  3DR8 A;  3W6S A;  4AB7 A;  1XEB A;  4B5P A;  2OU2 A;  2VZZ A;  2B4D A;  1QSN A;  2REF A;  3I3G A;  3P2F A;  5C82 A;  1QST A;  2FCK A;  2OB0 A;  5FVJ A;  4EVY A;  2BSW A;  2Q4Y A;  4KVX A;  1IYL A;  3TOB A;  4JXR A;  1QSM A;  3FBU A;  4XPK A;  1MJA A;  4AVA A;  3GY9 A;  2J8R A;  2I00 A;  4LUA A;  3FYN A;  2D4P A;  2CY2 A;  2VXK A;  3S6G A;  5J8C A;  3CXS A;  1ON0 A;  3LD2 A;  1NSL A;  3TO7 A;  4U9Z A;  1CM0 A;  2G3T A;  2J8N A;  4L89 A;  4KVO E;  1I12 A;  1BO4 A;  2FXF A;  4KOY A;  4NF1 A;  4R87 A;  4CAX A;  3FRM A;  1KZF A;  1YX0 A;  3GYA A;  1XE4 A;  4QUS A;  2GAN A;  1R57 A;  2PQ8 A;  2R7H A;  1WWZ A;  3G3S A;  2IL4 A;  3PGP A;  3PZJ A;  2B4B A;  1M4D A;  1PUA A;  4ONU A;  5KTD A;  5HH1 A;  3EXN A;  4DNC A;  4R57 A;  3DSB A;  2P6E A;  5JQ4 A;  4KLV A;  1YVO A;  4PK3 A;  5IV0 A;  2P6F A;  4J3G A;  5E96 A;  2FT0 A;  1Q2Y A;  1BOB A;  3H4Q A;  4HNW B;  4QVT A;  2H5M A;  3JVN A;  1MJ9 A;  2B3U A;  2F5I A;  2PDO A;  4KOV A;  1TIQ A;  4AVB A;  1KUX A;  1XMT A;  4KLW A;  4IF5 A;  4JLY A;  4KOW A;  3R96 A;  3CXQ A;  2BL1 A;  3D3S A;  3TCV A;  1Z4E A;  2JDC A;  2Q4V A;  3T90 A;  1S3Z A;  4HKF A;  4CAV A;  4KOS A;  3F0A A;  2GE3 A;  4MY0 A;  3BLN A;  2QIR A;  4AG7 A;  2Z11 A;  3ZJ0 A;  2B5G A;  4RS2 A;  3OWC A;  3D2M A;  3VWE A;  1J4J A;  2CNM A;  2FS5 A;  5HMN A;  4QBJ A;  2I79 A;  4QC6 A;  5DWN A;  1K4J A;  2B58 A;  3FNC A;  4UWI A;  1Y9W A;  3N7Z A;  1PU9 A;  4OAE A;  1Q2C A;  4OAD A;  2OZU A;  2PSW A;  5J8F A;  4ORF A;  2QEC A;  3LOD A;  2ARH A;  1Q2D A;  5JPH A;  2FE7 A;  2OZG A;  4NEX A;  4CAW A;  4IUS A;  4XNH C;  5H84 A;  1S5K A;  1UFH A;  4CRY B;  3R95 A;  1YLE A;  3MGD A; 
#chains in the Genus database with same CATH topology
 3EY5 A;  2O28 A;  4NGP A;  2HQY A;  4CRZ B;  1RO5 A;  2ZEN A;  4ZY0 A;  1P4N A;  3FF3 A;  1S7K A;  1TKJ A;  2JBJ A;  4KOR A;  4F6A A;  5I4M A;  3D7G A;  4R3L A;  2OZH A;  1CPX A;  5BWA B;  1IOF A;  2FSR A;  4JXQ A;  3I9S A;  4FBE A;  4GM5 A;  4YU9 A;  1IOI A;  2G9D A;  4KUB A;  4A38 A;  4KS9 A;  1Z8W A;  2ZEP A;  1YLO A;  4B5P B;  4JJX A;  2X7B A;  4EWT A;  3BJ7 A;  4R7M A;  1GYT A;  4JD6 A;  2B4D B;  1PCA A;  3D7D A;  4XNH B;  1BPN A;  4P6Y A;  2DXQ A;  3FX6 A;  3B3C A;  1IYK A;  2QML A;  4HNY B;  3SHP A;  4F9V A;  4EFD A;  2B3V A;  2ZW7 A;  3FEE A;  3D7H A;  3FH4 A;  1M4I A;  1Z8T A;  1KUV A;  4ZBG A;  1ZLH A;  3EFA A;  3NE7 A;  1CBX A;  2RB7 A;  2V8D A;  4NSQ A;  5G21 A;  1S60 A;  1S7L A;  1L0C A;  3N5F A;  4OC3 A;  3WAB A;  3QAY A;  1IY7 A;  4M6G A;  2PR1 A;  4Y49 C;  2PCU A;  4A95 A;  1AYE A;  3KQX A;  3JUW A;  2ANP A;  3RYO A;  3DDD A;  2VEZ A;  3TE4 A;  2PJA A;  7CPA A;  3K9U A;  1F2P A;  2CTB A;  4PSW A;  4P4J A;  1YVK A;  5F47 A;  2HV2 A;  2NMT A;  4UBR A;  3S6K A;  1B6B A;  4H6Z A;  4GXH A;  4UF4 A;  1H8L A;  3KQZ A;  1V0C A;  1XF8 A;  2RC4 A;  3FVL A;  2Z3K A;  4UCP A;  3RO0 A;  2BO9 A;  2F8H A;  4MY3 A;  2PRB A;  4P44 A;  1TF9 A;  4MI4 A;  5K8O A;  2CF4 A;  4RN7 A;  1TKF A;  1MJB A;  2V8V A;  3FIX A;  3I1U A;  3MN8 A;  4IAV A;  4KVM E;  5JGF A;  2Q7B A;  2BEI A;  3D7F A;  2AE6 A;  1FT7 A;  3CT9 A;  1N71 A;  1QMU A;  1QSR A;  2NSM A;  3B3S A;  2WYR A;  4X8I A;  4OKO A;  1YW4 A;  4UCN A;  2J8M A;  3SJG A;  2P6G A;  3WC5 A;  5EBV A;  2CIJ A;  1ELL P;  4OLL A;  2G0B A;  3BJ8 A;  1VHS A;  4M3S A;  2YND A;  1CX8 A;  2QJ8 A;  1KUY A;  3EC4 A;  4MFL A;  4Y49 B;  5EMI A;  3GUX A;  4A32 A;  1QSO A;  5IB0 A;  3FXT A;  4UA3 A;  1I21 A;  1IIC A;  2ZEO A;  2IMO A;  1DE4 C;  3H5Z A;  3TO9 A;  4XPL A;  4C2X A;  3S6F A;  4C2Y A;  4E2A A;  3B2Y A;  4XPD C;  4ONW A;  2PJB A;  1NE9 A;  5LRG A;  1YSJ A;  4P4B A;  4MHZ A;  4MMO A;  1HDU A;  4R3K A;  1QQ9 A;  1VHE A;  1CJW A;  5A28 A;  2ZOG A;  5F49 A;  5F48 A;  3PP9 A;  2PR8 A;  1EE3 P;  2IQ6 A;  3G8W A;  3KKW A;  2BUE A;  4FD7 A;  4QB9 A;  4MHD A;  1RXT A;  4R76 A;  5D29 A;  1Y0R A;  5EC4 A;  1XFO A;  2EUI A;  2DEA A;  1TXR A;  2Y0M A;  1XIX A;  1BAV A;  4MBU A;  1SQH A;  4UIA A;  5HXD A;  4MJ8 A;  4KZT A;  3V8I A;  4CGP A;  2JDD A;  3DLJ A;  4ZX8 A;  3FMC A;  3PBB A;  1I1D A;  2ZEF A;  3SXN A;  5H86 A;  3KL9 A;  1Y7E A;  5ISV A;  5AG4 A;  3DR6 A;  3E0K A;  3KI9 A;  4RI1 A;  5G1Z A;  2NYQ A;  2WZN A;  5LYD A;  3W6X A;  4L8A A;  2GIV A;  4B11 A;  3D4U A;  1IU8 A;  3SI2 A;  2PVW A;  3B8G A;  2Q44 A;  1ZG8 A;  5IX3 A;  4U5Y A;  3F8K A;  4F0X A;  4XPD B;  1M4G A;  4MCP A;  4UIB A;  4FD4 A;  3PFE A;  3VWD A;  5DWM A;  2A4N A;  3F5B A;  3R1K A;  4HPS A;  4JWP A;  3R9F A;  1B87 A;  3WC7 A;  4OME A;  4E8O A;  4P4E A;  2YNC A;  2ZW6 A;  2R8V A;  5GCN A;  1S7N A;  1WK4 A;  4YFJ A;  2VQY A;  3B35 A;  4PSX A;  2REE A;  2PJ5 A;  4F0Y A;  1YW6 A;  4LQ6 A;  4A39 A;  4CYN A;  3ISZ A;  2Z10 A;  3WR7 A;  4UWJ A;  1M1D A;  3WT4 A;  5LYI A;  1DTD A;  2Q0Y A;  3TO6 A;  4K3N A;  1YK3 A;  3SJE A;  5CNP A;  3DGV A;  1LRZ A;  2HUZ A;  3PRT A;  4E0A A;  2B5G B;  2ZW5 A;  3KHX A;  5JH9 A;  4CS0 B;  2C27 A;  4M85 A;  2DPS A;  1YR0 A;  1VKC A;  1Z4R A;  3H8E A;  2ATR A;  4GS4 A;  4A37 A;  4BD9 A;  4BBH A;  1ZG9 A;  3SJF A;  2O4H A;  2EK9 A;  2WPX A;  4U9Y A;  3K9T A;  2WPW A;  4R8F A;  1YGH A;  4Q7A A;  4CGN A;  5CBM A;  1R3N A;  3GLJ A;  4FUU A;  1U6M A;  2V8G A;  4NXY A;  1P0H A;  4DJL A;  4CGL A;  5K8P A;  2CNS A;  2AFX A;  2D4O A;  3BI1 A;  3FJU A;  3CZX A;  3PEI A;  4DYO A;  1PYT B;  3S6H A;  2EK8 A;  2YNE A;  3IGR A;  4OC5 A;  3RNZ A;  4M6H A;  1LAM A;  4NGT A;  5F46 A;  3NH5 A;  3KAS A;  4I49 A;  2PJ3 A;  1S7F A;  3DNS A;  5KTA A;  2GU2 A;  2PJ1 A;  1Z2L A;  1OZP A;  3VAR A;  1Z9U A;  2VZY A;  2OOT A;  3PB8 X;  4UEF A;  1YME A;  2WSA A;  3GKR A;  2AJ6 A;  4AVC A;  3L2N A;  2PRQ A;  4A31 A;  2CNT A;  5HVH A;  2AFZ A;  3FB3 A;  2KCW A;  4YRH A;  2Q4Z A;  3PBE A;  4ZYQ A;  1XJO A;  5KTC A;  2PE3 A;  3R9E A;  2Q04 A;  4X3R A;  5A27 A;  4ZGY B;  3PB6 X;  2DPT A;  4AG9 A;  4B5O A;  1IB1 E;  2Z3O A;  2JEV A;  2Q43 A;  1AUG A;  2C6G A;  3B3W A;  2PVV A;  3IO1 A;  4H6U A;  4LQG A;  4R9M A;  4WWV A;  5CPA A;  5ELY A;  4KUA A;  3HUV A;  5I0C A;  3TFY A;  4OIW A;  4MXU A;  2C6C A;  4MFJ A;  1XBU A;  4ZY1 A;  1KWM A;  2EBJ A;  1ARM A;  4FD5 A;  1XRY A;  3SI0 A;  1IID A;  3KHZ A;  5C88 A;  4P45 A;  2OH1 A;  2FIA A;  4H2K A;  2XEG A;  4G1P A;  1YRE A;  2R98 A;  3IEH A;  3MRU A;  2G3A A;  3EO4 A;  4KOX A;  4F9U A;  1FY7 A;  2C6P A;  3SI1 A;  4OID A;  1Y9K A;  2K5T A;  3BXM A;  3P2H A;  4CGM A;  2ZEH A;  4EME A;  2Z3P A;  1Z5R A;  3LMS A;  4PV6 A;  3CXP A;  1NMT A;  2FL4 A;  3IWE A;  3KZW A;  3TTH A;  3ZZI A;  5C82 A;  4MFQ A;  4JZ0 A;  4MFZ A;  5AG7 A;  2VBQ A;  4K30 A;  2R1I A;  2PC1 A;  3UY5 A;  4II9 A;  1MK4 A;  4UFV A;  4A2Z A;  3IFE A;  4B6Z A;  1CG2 A;  4KOU A;  2Q51 A;  3IWW A;  2VI7 A;  4OC1 A;  3TT2 A;  4FD6 A;  4NCZ A;  4YGO A;  3D8P A;  1GHE A;  3TOA A;  4PXC A;  3IWG A;  1M44 A;  2ABZ A;  1CP7 A;  2OR4 A;  4PXD A;  4X5K A;  4C2Z A;  4H89 A;  4KOT A;  2Z3N A;  1TKH A;  2ZEL A;  2AFM A;  2ZXV A;  1LCP A;  3SJX A;  2QYV A;  4CYP A;  2GRE A;  3C26 A;  2ZW4 A;  3QB8 A;  4MHY A;  4PK2 A;  4ZX9 A;  3W91 A;  2ZPA A;  2JLM A;  4MHN A;  3SXO A;  4HNX B;  2WUU A;  2P0W A;  3QAH A;  1Y7R A;  2BOA A;  3S9N A;  4ZI6 A;  2Z0Z A;  2XEF A;  4LX9 A;  4NGN A;  3WC6 A;  2FIW A;  2Q7S A;  3PB4 X;  3R9G A;  2EVN A;  3D2P A;  3B7I A;  3DR8 A;  3T9Y A;  3H8G A;  3W6S A;  1XOV A;  4DUK A;  4Q38 A;  2EO8 A;  4AB7 A;  4BMH A;  4PQA A;  1XEB A;  4B5P A;  4P4F A;  2OU2 A;  2VZZ A;  2B4D A;  3B3V A;  1QSN A;  1M4L A;  2HC9 A;  2REF A;  3I3G A;  3P2F A;  1LFW A;  1QST A;  2FCK A;  2OB0 A;  4MFK A;  4UCM A;  4UFW A;  5DS0 A;  3D66 A;  5FVJ A;  4EVY A;  2ZOF A;  2BSW A;  2Q4Y A;  3KR5 A;  4KVX A;  1IYL A;  4A30 A;  3TOB A;  3S9L A;  4JXR A;  3TC8 A;  1QSM A;  1XMB A;  1Z8L A;  4CAE A;  4OC0 A;  1TF8 A;  3FBU A;  4XPK A;  1MJA A;  1CP6 A;  2XEJ A;  2POK A;  1ELM P;  2J9A A;  1NSA A;  1R43 A;  4IHM A;  4AVA A;  4UFX A;  3GY9 A;  2J8R A;  2YNC C;  1HDQ A;  2PJ2 A;  2I00 A;  4CGO A;  4LUA A;  5D8N A;  5HVF A;  4P4D A;  3FYN A;  2D4P A;  5HVG A;  3RZA A;  2CY2 A;  3HLP A;  2VXK A;  4O23 A;  5G22 A;  3S6G A;  2AFS A;  2DF5 A;  4CYO A;  5J8C A;  3GIU A;  2ZEE A;  4FWU A;  1FNO A;  3B3T A;  3CXS A;  1ON0 A;  3LD2 A;  1NSL A;  3A9L A;  3TO7 A;  4CAF A;  1A2Z A;  4U9Z A;  4BIN A;  1CM0 A;  5AGE A;  4A94 A;  2G3T A;  2J8N A;  4L89 A;  4NGR A;  3CPX A;  4KVO E;  1I12 A;  5K8N A;  1HEE A;  3LAC A;  1BO4 A;  5LYF A;  3FED A;  2FXF A;  4KOY A;  1VHO A;  4NF1 A;  3CDX A;  2QVP A;  1JQG A;  4WJB A;  4R87 A;  1F57 A;  3V7Z A;  4KSI A;  4CAX A;  3FRM A;  1KZF A;  2ODF A;  4W9Y A;  2YGW A;  5AG5 A;  1YX0 A;  3GYA A;  1XE4 A;  4QUS A;  4C7I A;  2GAN A;  3T8W A;  1R57 A;  2PQ8 A;  2R7H A;  4NJR A;  1WWZ A;  3JTK A;  1ARL A;  4JYW A;  4P4I A;  1ZG7 A;  3G3S A;  1OBR A;  2IL4 A;  3PGP A;  3PZJ A;  3S9M A;  2B4B A;  5J1Q A;  3BHX A;  4PPZ A;  4IK2 A;  4B12 A;  4MRI A;  3JRU A;  1M4D A;  2PJ9 A;  4UEE A;  4NGS A;  4TWE A;  2ZEG A;  3NH8 A;  4A33 A;  4MHP A;  2GLJ A;  5LRJ A;  1AMP A;  2PJ6 A;  1PUA A;  4C68 A;  3RBU A;  1CPS A;  4ONU A;  3NFZ A;  2Z3M A;  2O53 A;  4B13 A;  5KTD A;  5HH1 A;  3EXN A;  1LAP A;  4DNC A;  4R57 A;  3DSB A;  1BLL E;  1LOK A;  2P6E A;  5JQ4 A;  4KLV A;  2EWB A;  4PXE A;  1YVO A;  4MCR A;  4PK3 A;  1RTQ A;  2AFO A;  2FVG A;  5IV0 A;  1ZLI A;  2C1C A;  2CTC A;  1YQE A;  2P6F A;  4J3G A;  1Q7L A;  5E96 A;  2FT0 A;  5K8M A;  3KGQ A;  1Q2Y A;  2PIY A;  5AG6 A;  2I3C A;  1BOB A;  4PXB A;  5LYL A;  4Z65 A;  4B10 A;  2XEI A;  2V77 A;  2PJ8 A;  3H4Q A;  3K2K A;  3BI0 A;  4HNW B;  4QVT A;  4AXV A;  2H5M A;  4ZY2 A;  3JVN A;  1MJ9 A;  5IB9 A;  4R6T A;  3RAM A;  2ZEM A;  4M6I A;  3KR4 A;  1JWQ A;  4OC4 A;  2B3U A;  2F5I A;  3PB9 X;  2PDO A;  4KSF A;  4MFP A;  5F09 A;  1ZO0 A;  4KOV A;  4UEZ A;  2PJ4 A;  1TIQ A;  3FEC A;  4AVB A;  1KUX A;  3PFO A;  1XMT A;  5LRK A;  4KLW A;  2PJ0 A;  4IF5 A;  4JLY A;  4KOW A;  3R96 A;  4F8Z A;  1X12 A;  3CXQ A;  2JBK A;  2BL1 A;  3IIB A;  3CPA A;  2Z3L A;  3D3S A;  3TCV A;  4NJQ A;  1Z4E A;  2JDC A;  2Q4V A;  3T90 A;  2PJ7 A;  1S3Z A;  2GFQ A;  4HKF A;  1Z8X A;  2F7V A;  3NH4 A;  4B14 A;  4KOS A;  4CAV A;  3VAT A;  1IGB A;  3F0A A;  2GE3 A;  4MY0 A;  5THW A;  4TNU A;  8CPA A;  3BLN A;  2AFW A;  2QIR A;  3H8F A;  4AG7 A;  2Z11 A;  3ZJ0 A;  2B5G A;  4RS2 A;  4CPA A;  6CPA A;  3NE8 A;  4YWY A;  3OWC A;  5JM6 A;  1UWY A;  3D2M A;  4OP4 A;  3VWE A;  2GLF A;  1LAN A;  2PIZ A;  3D68 A;  1J4J A;  2CNM A;  2FS5 A;  5HMN A;  4QBJ A;  2I79 A;  2CXA A;  4QC6 A;  4NFR A;  5DWN A;  3TX8 A;  4P10 A;  2RFH A;  3GB0 A;  1K4J A;  2B58 A;  2AFU A;  3FNC A;  4UWI A;  4NGQ A;  3PB7 X;  1Y9W A;  4RUH A;  2HB6 A;  3N7Z A;  1PU9 A;  3QNV A;  3D67 A;  4X2T A;  4CYQ A;  4OAE A;  1Q2C A;  4Q36 A;  4NGM A;  4OAD A;  2PJC A;  2OZU A;  2PSW A;  3IU1 A;  5G20 A;  5J8F A;  3ISX A;  4ORF A;  3NA6 A;  2QEC A;  3LOD A;  4KSA A;  1BPM A;  2ARH A;  2JEW A;  1Q2D A;  2BCO A;  5JPH A;  2FE7 A;  2OZG A;  4NEX A;  3IU2 A;  2V8H A;  1Y0Y A;  3IJ3 A;  1VGY A;  4CAW A;  4IUS A;  4XNH C;  4OC2 A;  1S5K A;  5H84 A;  4FAI A;  1UFH A;  1VIX A;  3V38 A;  3VH9 A;  4C7H A;  4MCQ A;  3IC1 A;  4CRY B;  1F2O A;  3LWU A;  3R95 A;  2IJZ A;  1YLE A;  2VL1 A;  1X10 A;  2ZED A;  3MGD A;  4MCS A; 
#chains in the Genus database with same CATH homology
 3EY5 A;  2O28 A;  2HQY A;  4CRZ B;  1RO5 A;  1P4N A;  1S7K A;  4KOR A;  4F6A A;  4R3L A;  2OZH A;  5BWA B;  2FSR A;  4JXQ A;  3I9S A;  4KUB A;  4KS9 A;  4B5P B;  4JJX A;  2X7B A;  3BJ7 A;  4XNH B;  4JD6 A;  2B4D B;  2DXQ A;  1IYK A;  2QML A;  4HNY B;  3SHP A;  2B3V A;  2ZW7 A;  1M4I A;  4ZBG A;  1KUV A;  3EFA A;  3NE7 A;  4NSQ A;  5G21 A;  1S60 A;  1S7L A;  1L0C A;  4Y49 C;  2PR1 A;  4A95 A;  3JUW A;  3RYO A;  3DDD A;  2VEZ A;  3TE4 A;  3K9U A;  4PSW A;  5F47 A;  1YVK A;  2HV2 A;  2NMT A;  4UBR A;  3S6K A;  1B6B A;  4H6Z A;  1V0C A;  1XF8 A;  2RC4 A;  2Z3K A;  4UCP A;  4MY3 A;  2PRB A;  4MI4 A;  1MJB A;  3FIX A;  4KVM E;  2Q7B A;  2BEI A;  2AE6 A;  1N71 A;  1QSR A;  4UCN A;  2J8M A;  2P6G A;  5EBV A;  4OLL A;  2G0B A;  3BJ8 A;  1VHS A;  4M3S A;  2YND A;  3EC4 A;  1KUY A;  4MFL A;  4Y49 B;  4A32 A;  1QSO A;  5IB0 A;  3FXT A;  4UA3 A;  1I21 A;  1IIC A;  3TO9 A;  3H5Z A;  4XPL A;  4C2X A;  3S6F A;  4C2Y A;  4E2A A;  4XPD C;  1NE9 A;  4R3K A;  1CJW A;  5A28 A;  5F49 A;  5F48 A;  3PP9 A;  2PR8 A;  3G8W A;  3KKW A;  4FD7 A;  2BUE A;  4QB9 A;  4MHD A;  1RXT A;  5EC4 A;  2EUI A;  2Y0M A;  1XIX A;  4MBU A;  1SQH A;  4MJ8 A;  4KZT A;  3V8I A;  4CGP A;  2JDD A;  3SXN A;  1I1D A;  5H86 A;  5ISV A;  5AG4 A;  3E0K A;  3DR6 A;  4RI1 A;  5G1Z A;  3W6X A;  4L8A A;  2GIV A;  4B11 A;  3B8G A;  2Q44 A;  5IX3 A;  4U5Y A;  3F8K A;  4F0X A;  4XPD B;  1M4G A;  4FD4 A;  3VWD A;  5DWM A;  2A4N A;  3F5B A;  3R1K A;  4JWP A;  3R9F A;  1B87 A;  4E8O A;  2YNC A;  2ZW6 A;  2R8V A;  5GCN A;  1S7N A;  1WK4 A;  4YFJ A;  2VQY A;  4PSX A;  2REE A;  4F0Y A;  4CYN A;  2Z10 A;  3WR7 A;  4UWJ A;  1M1D A;  2Q0Y A;  3TO6 A;  1YK3 A;  5CNP A;  1LRZ A;  2HUZ A;  4E0A A;  2B5G B;  2ZW5 A;  4CS0 B;  2C27 A;  4M85 A;  2DPS A;  1YR0 A;  1VKC A;  1Z4R A;  4GS4 A;  2ATR A;  4BBH A;  2WPX A;  4U9Y A;  2WPW A;  1YGH A;  4CGN A;  1U6M A;  4NXY A;  1P0H A;  4CGL A;  2CNS A;  2D4O A;  3S6H A;  2YNE A;  3IGR A;  5F46 A;  4I49 A;  1S7F A;  3DNS A;  5KTA A;  1OZP A;  1Z9U A;  2VZY A;  2WSA A;  3GKR A;  2AJ6 A;  4AVC A;  4A31 A;  2CNT A;  3FB3 A;  2KCW A;  4YRH A;  5KTC A;  3R9E A;  5A27 A;  2Q04 A;  4ZGY B;  2DPT A;  4AG9 A;  4B5O A;  1IB1 E;  2Z3O A;  2JEV A;  4H6U A;  4R9M A;  5I0C A;  3TFY A;  4KUA A;  4MFJ A;  4FD5 A;  1IID A;  5C88 A;  2OH1 A;  2FIA A;  1YRE A;  2R98 A;  2G3A A;  3EO4 A;  4KOX A;  1FY7 A;  1Y9K A;  2K5T A;  3P2H A;  4CGM A;  2Z3P A;  4PV6 A;  3CXP A;  1NMT A;  2FL4 A;  3IWE A;  3TTH A;  3ZZI A;  4MFQ A;  4MFZ A;  5AG7 A;  2VBQ A;  4K30 A;  2R1I A;  2PC1 A;  3UY5 A;  1MK4 A;  4UFV A;  4A2Z A;  4KOU A;  2VI7 A;  3TT2 A;  4FD6 A;  4NCZ A;  4YGO A;  3D8P A;  1GHE A;  3TOA A;  3IWG A;  1M44 A;  4X5K A;  4C2Z A;  4H89 A;  4KOT A;  2Z3N A;  2ZXV A;  4CYP A;  3C26 A;  2ZW4 A;  3QB8 A;  4PK2 A;  3W91 A;  2ZPA A;  2JLM A;  3SXO A;  4HNX B;  2WUU A;  2P0W A;  3QAH A;  1Y7R A;  2Z0Z A;  4LX9 A;  4BMH A;  2FIW A;  3R9G A;  3T9Y A;  4II9 A;  2EVN A;  3D2P A;  3DR8 A;  3W6S A;  4Q38 A;  4AB7 A;  1XEB A;  4B5P A;  2OU2 A;  2VZZ A;  2B4D A;  1QSN A;  2REF A;  3I3G A;  3P2F A;  4MFK A;  1QST A;  2FCK A;  2OB0 A;  4UFW A;  4UCM A;  5C82 A;  5FVJ A;  4EVY A;  2BSW A;  2Q4Y A;  4KVX A;  1IYL A;  4A30 A;  3TOB A;  4JXR A;  1QSM A;  4CAE A;  3FBU A;  4XPK A;  1MJA A;  4AVA A;  4UFX A;  3GY9 A;  2J8R A;  2YNC C;  2I00 A;  4CGO A;  4LUA A;  3FYN A;  2D4P A;  2CY2 A;  2VXK A;  5G22 A;  3S6G A;  4CYO A;  5J8C A;  3CXS A;  1ON0 A;  3LD2 A;  1NSL A;  3A9L A;  3TO7 A;  4CAF A;  4U9Z A;  1CM0 A;  5AGE A;  2G3T A;  2J8N A;  4L89 A;  4KVO E;  1I12 A;  1BO4 A;  2FXF A;  4KOY A;  4NF1 A;  4R87 A;  4CAX A;  3FRM A;  1KZF A;  5AG5 A;  2YGW A;  1YX0 A;  3GYA A;  1XE4 A;  4QUS A;  4C7I A;  2GAN A;  1R57 A;  2PQ8 A;  2R7H A;  1WWZ A;  3JTK A;  3G3S A;  2IL4 A;  3PGP A;  3PZJ A;  2B4B A;  4B12 A;  1M4D A;  4A33 A;  4C68 A;  1PUA A;  4ONU A;  2Z3M A;  4B13 A;  5KTD A;  5HH1 A;  3EXN A;  4DNC A;  4R57 A;  3DSB A;  2P6E A;  5JQ4 A;  4KLV A;  1YVO A;  4PK3 A;  5IV0 A;  2P6F A;  4J3G A;  5E96 A;  2FT0 A;  1Q2Y A;  5AG6 A;  1BOB A;  4B10 A;  3H4Q A;  4HNW B;  4QVT A;  2H5M A;  3JVN A;  1MJ9 A;  2B3U A;  2F5I A;  4KSF A;  2PDO A;  4MFP A;  1ZO0 A;  4KOV A;  1TIQ A;  4AVB A;  1KUX A;  1XMT A;  4KLW A;  4IF5 A;  4JLY A;  4KOW A;  3R96 A;  3CXQ A;  2BL1 A;  2Z3L A;  3D3S A;  3TCV A;  1Z4E A;  2JDC A;  2Q4V A;  3T90 A;  4B14 A;  1S3Z A;  4HKF A;  4CAV A;  4KOS A;  3F0A A;  2GE3 A;  4MY0 A;  3BLN A;  2QIR A;  4AG7 A;  2Z11 A;  3ZJ0 A;  2B5G A;  4RS2 A;  3OWC A;  3D2M A;  3VWE A;  1J4J A;  2CNM A;  2FS5 A;  5HMN A;  4QBJ A;  2I79 A;  2CXA A;  4QC6 A;  5DWN A;  1K4J A;  2B58 A;  3FNC A;  4UWI A;  1Y9W A;  3N7Z A;  1PU9 A;  4CYQ A;  4OAE A;  1Q2C A;  4Q36 A;  4OAD A;  2OZU A;  2PSW A;  3IU1 A;  5G20 A;  5J8F A;  4ORF A;  2QEC A;  3LOD A;  4KSA A;  2ARH A;  1Q2D A;  5JPH A;  2FE7 A;  2OZG A;  4NEX A;  3IU2 A;  4CAW A;  4IUS A;  4XNH C;  5H84 A;  1S5K A;  1UFH A;  4C7H A;  4CRY B;  3R95 A;  1YLE A;  3MGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...