3PPLA

Crystal structure of an aspartate transaminase (ncgl0237, cgl0240) from corynebacterium glutamicum atcc 13032 kitasato at 1.25 a resolution
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
424
structure length
424
Chain Sequence
SSVSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structure of an aspartate transaminase (NCgl0237, Cgl0240) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 1.25 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 146
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3pplA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3pplA01
4GE7A 4F5HA 4RM1A 1ASAA 3GZDC 1P3WA 4AZKA 1W7MA 2OQXA 4JEWA 5M49A 1BJOA 1C7NA 1G7XA 2PB2A 2Z9XA 4U1TA 5AX8A 3JW9A 2R5EA 1N8PA 3PD6B 4Q6RA 1AICA 1UU2A 4ZDPA 4MSOA 4WXGA 3QM2A 5JAYA 2RFVA 3FVSA 5FT8A 2Z1YA 4LNJA 4DGTA 1QITA 4WYGA 2AY7A 3R9AA 1V2EA 2YKXA 3DYDA 1BJ4A 1CQ6A 3H14A 2CH2A 4JE5A 1QZ9A 1DGDA 1TPLA 3CBFA 3BB8A 2ZSLA 2ZY2A 2ZY4A 3PD6A 1AMAA 2W7KA 2BIEA 4Y0DA 2CFBA 2W7LA 3NU8A 4W1VA 1FG7A 1KL2A 3ASAA 2WK7A 4ZASA 2ZC0A 2VLFA 1AKCA 2C7TA 1DKAA 4O6ZA 2DGKA 3K28A 4F4EA 2BWNA 2HUUA 5M4DA 2JGTA 3GSBA 1I43A 3I4JA 1DFOA 2VMSA 5IWQA 4A6TA 3AEPA 2E7JA 2Z9WA 3NYSA 1KKPA 1M6SA 1QJ3A 1X29A 1ASFA 1GEYA 3EIBA 2YKUA 2V1PA 1QIRA 3PA9A 1E5EA 2VMXA 1D7UA 3B1DA 1ARSA 4K2MA 4BMKA 5EUEA 3FQAA 1I41A 2FNIA 1MDOA 1G7WA 5K8BA 1DTYA 2HP1A 1TOJA 3Q8NA 5D5SA 1IX6A 4WYAA 4TMRA 2W7FA 3JWAA 4WYEA 4ADBA 4EB5A 3BS8A 2VMOA 4ADCA 2VGVA 2JG2A 1BT4A 2OATA 4WP0A 4R8DA 2W7JA 4UHOA 5BJ4A 4W1WA 1KMKA 2VI9A 3BV0A 2VLHA 2AY8A 3ACZA 3FVXA 3FFHA 2VGTA 2FN6A 5EFSA 1ECXA 4AH3A 2GMSA 3TFUA 5DJ9A 2Z61A 4CXQA 1E5FA 3JWBA 3NNKA 4XJOA 4PIWA 1GC0A 1YIZA 3HMUA 1AIBA 3WX9A 2D61A 3BWOA 3LV2A 3LVLB 3MKJA 2CJHA 3M5UA 3A9XA 3WLXA 9AATA 1B5PA 5G2PA 4B98A 3HQTA 4M2JA 2PB0A 5HHYA 2AY6A 1S08A 3AENB 2E54A 3A9ZA 2W7GA 2OKJA 1RVUA 3ISLA 4P7YA 4DBCA 3FDDA 4E77A 1ASLA 1C0NA 4IX8A 4IYOB 5EIGB 2VGWA 5EUNA 3PAAA 4ITXA 1G4VA 3AEMC 2YKYA 3FDBA 1QGNA 2NMPA 2Z9UA 2QMAA 1SZUA 2EPJA 3E77A 4J5UA 3USFA 5DX5A 4WYFA 2EZ1A 4IXZA 4DQ6A 2EGYA 3NYTA 4UHMA 3OP7A 1MAPA 5TF5A 1MLYA 1FC4A 3AENA 2BIAA 3CQ6A 1PMMA 5LH9A 3F9TA 2W8UA 1YAAA 2BHXA 2VMUA 3PGYA 1SFFA 3NYUA 1W7LA 3B8XA 3FFRA 3ECDA 1T3IA 1ASDA 2W8VA 3ZZJA 4F5IA 4Y0HA 4IYOA 3K40A 4U2HA 3VK3A 4BA5A 1AHEA 1DJUA 3QHXA 1ZODA 4WYDA 3ELEA 1D7VA 4W91A 4ADDA 1YJYA 1G4XA 1GBNA 2HP2A 3DZZA 2DGMA 1BJWA 3PDBB 4Y0IA 2DR1A 4MQRA 4Q31A 3I5TA 1LC5A 1MGVA 2C44A 4F5KA 2AY5A 2X5DA 3EIAA 1IJIA 3HDOA 3WCOA 1IX8A 3OKSA 3EI7A 1AHGA 3AEMA 3K7YA 3QN6A 1KL1A 5E5IA 2W8JA 4E3RA 1AJSB 4WB0B 4K2IA 1M0NA 1OHWA 3AATA 3FCRA 3WCNA 2BI3A 3PDBA 1ARTA 1I29A 2VMNA 2R2NA 4LW4A 4ZDLA 3DC1A 2ZUKA 4ZWMA 2Q7WA 3B46A 2R0TA 3JTXA 1V72A 4JF0A 1OXPA 4RAEA 1V2FA 1M0QA 1I48A 2C0RA 5BJ3A 1Y4IA 2BI1A 3VK4A 1ZOBA 1AX4A 3LVMA 3MAUA 1AJSA 1CS1A 1RVYA 2Z1ZA 4PVFA 4WB0A 3PPLA 3E2YA 2JJEA 1AAMA 1MAQA 3KKIA 5DJ1A 1IUGA 1OXOA 4F5JA 3F0HA 2ZY3A 4UOYA 1YJSA 1WYVB 4XJMA 3HL2A 2EO5A 4CBSA 1CQ8A 3RCHB 2HUFA 1C7GA 2BI5A 4BA4A 4GDYA 4W8IA 1LW4A 3CQ4A 2CJDA 2GSAA 3RQ1A 4W1XA 4MQQA 2AY1A 3KE3A 2ORDA 2EH6A 3EI6A 3LWSA 2X3LA 1AHXA 2VGUA 1AY4A 1BS0A 1TOIA 1AKBA 3AOVA 2AATA 3G0TA 5FT6A 5DB5A 1LKCA 3QPGA 4JF1A 1IAYA 2W7DA 2O0RA 1M0OA 1M32A 2VMZA 4N0BA 4UQVA 1D7RA 1W23A 4CXRA 3FTBA 3PJ0A 2QBTA 2AY9A 1WYVA 3WGBA 4WLJA 2W7EA 3MAFB 5EQCA 3NTJA 4F5LA 3E6GA 4KYOA 5M46A 3BN1A 1Z7DA 1RV3A 3N5MA 1JF9A 2C81A 4RKDA 3W1IA 1TATA 2W8WA 3NRAA 4KAMA 4R2NA 5G09A 2YRIA 4IW7A 3RBLA 1PFFA 1QISA 2VI8A 2D7YA 1AHFA 2GQNA 4ATPA 2VIAA 3DXVA 1DGEA 1LW5A 4ISYA 1GDEA 1KMJA 3IF2A 1ELQA 3GBXA 1ASEA 2VMYA 3HVYA 1VJOA 4GRXA 4L0OA 4XJLA 3NUBA 1DJ9A 1DJEA 1AIAA 1PG8A 2BI9A 1LC8A 1TOKA 1D2FA 4OT8A 1BJNA 1WSTA 3GWPA 4MGRA 4W5KA 4ITGA 4OMAA 4LNLA 3PIUA 4BQ0A 1ARHA 4LNMA 1MDZA 3B1EA 3DR4A 1OHVA 1W3UA 4MY5A 3BCXA 1EJIA 1CL1A 1YNUA 3KGXA 4TN4A 2YKVA 1H0CA 3DXWA 4R5FA 4JEVA 4ZSYA 2O7CA 1O4SA 2R5CB 3G8MA 1BQAA 5F8VA 2JJHA 4PFFA 3FKDA 3FZ8A 1CQ7A 2EZ2A 3DODA 4F5MA 3W1JA 3E2ZB 1U08A 1YIYA 1AJRA 4A0HA 3MEBA 2BI2A 2OGEA 1OHYA 1ASNA 2VGSA 2VMRA 4OC9A 4WYCA 1ASGA 3ZRPA 3HBXA 3EUCA 4MKKA 2DKJA 1IBJA 2YCNA 4F5GA 1SZKA 1CZCA 1AY8A 5G4JA 2R5CA 1O61A 2W7MA 1YJZA 4XAUA 3D6KA 4LW2A 1QJ5A 3F6TA 4MKJA 4N0WA 3G7QA 5G4IA 1SVVA 4TV7A 3AEJC 5EIGA 4RITA 1X2AA 8AATA 3QBOA 3BCBA 3ATHA 3L8AA 1WYTB 5E3KA 1ZC9A 4E3QA 4UHNA 1AHYA 1M4NA 2AEUA 4HF8A 2OKKA 4CVQA 3ZRRA 4OCAA 3AV7A 4AO4A 1N31A 2YHKA 2YRRA 1X28A 4A6UA 1TARA 1ARGA 3II0A 2CB1A 3A8UX 2D63A 2Z9VA 1WKGA 1CZEA 2AY3A 3CQ5A 3BWNA 3EZ1A 4JEXA 4A6RA 2V0YA 4OBUA 5EAVA 3LVKA 4ZDOA 2HZPA 3TATA 1WKHA 1WYTA 4R5ZA 4RLGA 1W7NA 2BWPA 2CSTA 4ZM3A 2X5FA 1O62A 5G2QA 3P1TA 1BJOB 2D64A 4RJ0A 1VEFA 3JU7A 4GEBA 4WBTA 3ZRQA 2JJFA 3ZZKA 7AATA 4EU1A 3TFTA 1TASA 2AY2A 2D7ZA 1KKJA 3DR7A 1O69A 3KGWA 3AEJA 3MBBA 3E2FA 4OYTA 4RJYA 4AZJA 4EFFA 4XK1A 2BIGA 3EI8A 2WK8A 3FD0A 1S09A 3HT4A 4WLHA 3FSLA 1SPAA 4ZSWA 3RI6A 1B4XA 2VMVA 2DKBA 5C6UA 1J32A 3GJUA 1M0PA 4PFNA 3DRDA 2ZP7A 1X0MA 1ASBA 4KXKA 2FNUA 3WKRA 2HUIA 1C9CA 1AKAA 1AY5A 3TQXA 3VAXA 4CBRA 4Q75A 2VMQA 4ADEA 1TOEA 5M4BA 3LVJA 4WXFA 3VK2A 1GC4A 2BWOA 5I92A 1D7SA 1ASMA 1GEXA 4A72A 3FRKA 2HOYA 1J04A 3WY7A 4K2BA 3GZCA 3BC8A 5D95A 1VP4A 4RKCA 1EG5A 2FQ6A 2W7IA 2DOUA 1LS3A 2HORA 3EI9A 2CJGA 4J8LA 1S06A 2WKAA 4P3MA 4Q76A 4A0FA 1AAWA 3P6KA 3RCHA 1BQDA 1GEWA 3FQ8A 1IX7A 5FT5A 1Z3ZA 4FL0A 3AELA 4OBVA 1OATA 4QGRA 3E9KA 1UU0A 2E7UA 2HOXA 1FG3A 3UWCA 2FYFA 2VMWA 1M7YA 3NDNA 2VYCA 2ZJGA 3GZDA 2VIBA 1ASCA 1JG8A 1TOGA 3A2BA 1EQBA 4B9BA 3T32A 3FZ6A 1B5OA 3JZLA 4E1OA 2CANA 2YCTA 3MAFA 3RBFA 4XJPA 4RIZA 1AMSA 4JE5D 1N2TA 1S07A 3GR9A 1H1CA 3N75A 2W7HA 1B8GA 1IAXA 1WYUB 1AMQA 3N0LA 1GC3A 4NOGA 4IXOA 1MDXA 2CTZA 1MLZA 3LG0A 2BKWA 3TCMA 4GE9A 1LK9A 1XEYA 5FT4A 4M2MA 5F9SA 3DU4A 3EI5A 3WZFA 3H7FA 3L44A 2AEVA 3HLMA 3CAIA 5LHAA 4XQ2A 1JS3A 2YOBA 3ASBA 3RUYA 3AEOA 2GMUA 3BWNC 1WYUA 4A0RA 3A9YA 2WK9A 2XBNA 2Z67A 3MC6C 3LY1A 2CY8A 2OGAA 3COGA 1B9IA 1CL2A 2D5YA 1LC7A 4F5FA 2CH1A 2O1BA 1YOOA 4HVKA 4IXSA 3FVUA 5G0AA 2ZY5A 1IVRA 3PDXA 4ZM4A 4WXBA 2GB3A 4AO9A 4WD2A 2BYLA 4AOAA 3UE8A 4XEWA 4ATQA 1ORDA 2FM1A 2JISA 2ZSMA 4LC3A 2BYJA 4IY7A 4A00A 3WGCA 3E2ZA 2VMTA 4OTLA 3VOMA 3QGUA 1UKJA 2F8JA 1V2DA 2QB2A 4FFCA 4JEZA 3FZ7A 2DGLA 3BCAA 4MQPA 3R4TA 3MADA 3NUIA 4GSAA 1JS6A 1UU1A 1BKGA 2VMPA 2YCPA 2TPLA 2QB3A 1BW0A 1S0AA 2VGZA 3AOWA 3B1CA 3NX3A 5J8QA 3W1HA 1GCKA 1SZSA 1C7OA 4ZLVA 3UAKA 1PMOA 2QLRA 5EUDA 3NU7A 3QI6A 2HOZA 2JJGA 4EB7A 2Z20A 3MC6A 1ELUA 1GC2A 3FQ7A 3WKSA 2X8UA 4ZWVA 2W8TA 1SF2A 1C4KA 2XH1A 5HDMA 1CJ0A 5E4ZA 2D66A 4JEYA 2G6WA 1RV4A 3GETA 2AY4A 1AMRA 1ARIA 3EZSA 4M2KA 1XI9A 3IHJA 4BHDA 5HXXA 4H51A 4I8AA 2QA3A 4GE4A 3ELPA 2PO3A 2D65A 2CINA 3I16A 1GD9A 5EAAA 2E7IA 2ZYJA 4EMYA 1B9HA 4ZAHA 3VP6A 4A0GA
chains in the Genus database with same CATH superfamily
4K05A 4GE7A 4F5HA 4RM1A 1ASAA 3GZDC 1P3WA 4AZKA 1W7MA 2OQXA 2FKIA 4JEWA 5M49A 1BJOA 1C7NA 1G7XA 2PB2A 2Z9XA 4U1TA 5AX8A 3JW9A 2R5EA 1N8PA 3PD6B 4Q6RA 3N4RA 1AICA 1UU2A 4ZDPA 4MSOA 4WXGA 3QM2A 5JAYA 3N7NA 2RFVA 3FVSA 5FT8A 2Z1YA 4LNJA 4DGTA 1QITA 4WYGA 2AY7A 3R9AA 1V2EA 2YKXA 1KAFA 3DYDA 1BJ4A 1CQ6A 3H14A 2CH2A 4JE5A 1QZ9A 1DGDA 1TPLA 3CBFA 3BB8A 2ZSLA 2ZY2A 2ZY4A 3PD6A 1AMAA 2W7KA 2BIEA 4Y0DA 2CFBA 2W7LA 3NU8A 4W1VA 1FG7A 1KL2A 3ASAA 2WK7A 4ZASA 2ZC0A 2VLFA 1AKCA 2C7TA 1DKAA 4O6ZA 2DGKA 3K28A 4F4EA 2BWNA 2HUUA 5M4DA 2JGTA 3GSBA 1I43A 3I4JA 1DFOA 2VMSA 5IWQA 4A6TA 3AEPA 2E7JA 2Z9WA 3NYSA 1KKPA 1M6SA 1QJ3A 1X29A 1ASFA 1GEYA 3EIBA 2YKUA 2V1PA 1QIRA 3PA9A 1E5EA 2VMXA 1D7UA 3B1DA 1ARSA 4K2MA 4BMKA 5EUEA 3FQAA 1I41A 2FNIA 1MDOA 1G7WA 5K8BA 1DTYA 2HP1A 1TOJA 3Q8NA 5D5SA 1IX6A 4WYAA 4TMRA 2W7FA 3JWAA 4WYEA 4ADBA 4H63Q 4EB5A 3BS8A 2VMOA 4ADCA 2VGVA 2JG2A 1BT4A 2OATA 4WP0A 4R8DA 2W7JA 4UHOA 5BJ4A 4W1WA 1KMKA 2VI9A 3BV0A 2VLHA 2AY8A 3ACZA 3FVXA 3FFHA 2VGTA 2FN6A 5EFSA 1ECXA 4AH3A 2GMSA 3TFUA 5DJ9A 2Z61A 4CXQA 1E5FA 3JWBA 3NNKA 4XJOA 4PIWA 1GC0A 1YIZA 3HMUA 1AIBA 3WX9A 2D61A 3BWOA 3LV2A 3LVLB 3MKJA 2CJHA 3M5UA 3A9XA 3WLXA 9AATA 1B5PA 5G2PA 4B98A 3HQTA 4M2JA 2PB0A 5HHYA 2AY6A 1S08A 3AENB 2E54A 3A9ZA 2W7GA 2OKJA 1RVUA 3ISLA 4P7YA 4DBCA 3FDDA 4E77A 1ASLA 1C0NA 4IX8A 4IYOB 5EIGB 2VGWA 5EUNA 3PAAA 4ITXA 1G4VA 3AEMC 2YKYA 3FDBA 1QGNA 2NMPA 2Z9UA 2QMAA 1SZUA 2EPJA 3E77A 4J5UA 3USFA 5DX5A 4WYFA 2EZ1A 4IXZA 4DQ6A 2EGYA 3NYTA 4UHMA 3OP7A 1MAPA 5TF5A 1MLYA 1FC4A 3AENA 2BIAA 3CQ6A 1PMMA 5LH9A 3F9TA 2W8UA 1YAAA 2BHXA 2VMUA 3PGYA 1SFFA 3NYUA 1W7LA 3B8XA 3FFRA 3ECDA 1T3IA 1ASDA 2W8VA 3ZZJA 4F5IA 4Y0HA 4IYOA 3K40A 4U2HA 3VK3A 3N4SA 4BA5A 1AHEA 1DJUA 3QHXA 1ZODA 4WYDA 3ELEA 1D7VA 4W91A 4ADDA 3N4XA 1YJYA 1G4XA 1GBNA 2HP2A 3DZZA 2DGMA 1BJWA 3PDBB 4Y0IA 2DR1A 4MQRA 4Q31A 3I5TA 1LC5A 1MGVA 2C44A 4F5KA 2AY5A 2X5DA 3EIAA 1IJIA 3HDOA 3WCOA 1IX8A 3OKSA 3EI7A 1AHGA 2WB6A 3AEMA 3K7YA 3QN6A 1KL1A 5E5IA 2W8JA 4E3RA 1AJSB 4WB0B 4K2IA 1M0NA 1OHWA 3AATA 3FCRA 3WCNA 2BI3A 3PDBA 1ARTA 1I29A 2VMNA 2R2NA 4LW4A 4ZDLA 3DC1A 2ZUKA 4ZWMA 2Q7WA 3B46A 2R0TA 3JTXA 1V72A 4JF0A 1OXPA 4RAEA 1V2FA 1M0QA 1I48A 2C0RA 5BJ3A 1Y4IA 2BI1A 3VK4A 1ZOBA 1AX4A 3LVMA 5KTBA 3MAUA 1AJSA 1CS1A 1RVYA 2Z1ZA 4PVFA 4WB0A 2EYQA 3PPLA 3E2YA 2JJEA 1AAMA 1MAQA 3KKIA 5DJ1A 1IUGA 1OXOA 4F5JA 3F0HA 2ZY3A 4UOYA 1YJSA 1WYVB 4XJMA 3HL2A 2EO5A 4CBSA 1CQ8A 3RCHB 2HUFA 1C7GA 2BI5A 4BA4A 4GDYA 4W8IA 1LW4A 3CQ4A 2CJDA 2GSAA 3RQ1A 4W1XA 4MQQA 2AY1A 3KE3A 2ORDA 2EH6A 3EI6A 3LWSA 2X3LA 1AHXA 2VGUA 1AY4A 1BS0A 1TOIA 1AKBA 3AOVA 2AATA 3G0TA 5FT6A 5DB5A 1LKCA 3QPGA 4JF1A 1IAYA 2W7DA 2O0RA 1M0OA 1M32A 2VMZA 4N0BA 4UQVA 1D7RA 1W23A 4CXRA 3FTBA 3PJ0A 2QBTA 2AY9A 1WYVA 3WGBA 4WLJA 2W7EA 3MAFB 5EQCA 3NTJA 4F5LA 3E6GA 4KYOA 5M46A 3BN1A 1Z7DA 1RV3A 3N5MA 1JF9A 2C81A 4RKDA 3W1IA 1TATA 2W8WA 3NRAA 4KAMA 4R2NA 5G09A 2YRIA 4IW7A 3RBLA 1PFFA 1QISA 2VI8A 2D7YA 1AHFA 2GQNA 4ATPA 2VIAA 3DXVA 1DGEA 1LW5A 4ISYA 1GDEA 1KMJA 3IF2A 1ELQA 3GBXA 1ASEA 2VMYA 3HVYA 1VJOA 4GRXA 4L0OA 4XJLA 3NUBA 1DJ9A 1DJEA 1AIAA 1PG8A 2BI9A 1LC8A 1TOKA 1D2FA 4OT8A 1BJNA 1WSTA 3GWPA 4MGRA 4W5KA 4ITGA 4OMAA 4LNLA 3PIUA 4BQ0A 1ARHA 4LNMA 1MDZA 3B1EA 3DR4A 1OHVA 1W3UA 4MY5A 3BCXA 1EJIA 1CL1A 1YNUA 3KGXA 4TN4A 2YKVA 1H0CA 3DXWA 4R5FA 4JEVA 4ZSYA 2O7CA 1O4SA 2R5CB 3G8MA 1BQAA 5F8VA 2JJHA 4PFFA 3FKDA 3FZ8A 1CQ7A 2EZ2A 3DODA 4F5MA 3W1JA 3E2ZB 1U08A 1YIYA 1AJRA 4A0HA 3MEBA 2BI2A 2OGEA 1OHYA 1ASNA 2VGSA 2VMRA 4OC9A 4WYCA 1ASGA 3ZRPA 3HBXA 3EUCA 4MKKA 2DKJA 1IBJA 2YCNA 4F5GA 1SZKA 1CZCA 1AY8A 5G4JA 2R5CA 1O61A 2W7MA 1YJZA 4XAUA 3D6KA 4LW2A 1QJ5A 3F6TA 4MKJA 4N0WA 3G7QA 5G4IA 3H9XA 1SVVA 4TV7A 3AEJC 5EIGA 4RITA 1X2AA 8AATA 3QBOA 3BCBA 3ATHA 3L8AA 1WYTB 5E3KA 1ZC9A 4E3QA 4UHNA 1AHYA 1M4NA 2AEUA 4HF8A 2OKKA 4CVQA 3ZRRA 4OCAA 3AV7A 4AO4A 1N31A 2YHKA 2YRRA 1X28A 4A6UA 1TARA 1ARGA 3II0A 2CB1A 3A8UX 2D63A 2Z9VA 1WKGA 1CZEA 2AY3A 3CQ5A 3BWNA 3EZ1A 4JEXA 4A6RA 2V0YA 4OBUA 5EAVA 3LVKA 4ZDOA 2HZPA 2G7JA 3TATA 1WKHA 1WYTA 4R5ZA 4RLGA 1W7NA 2BWPA 2CSTA 4ZM3A 2X5FA 1O62A 5G2QA 3P1TA 1BJOB 2D64A 4RJ0A 1VEFA 3JU7A 4GEBA 4WBTA 3ZRQA 2JJFA 3ZZKA 7AATA 4EU1A 3TFTA 1TASA 2AY2A 2D7ZA 1KKJA 3DR7A 1O69A 3KGWA 3AEJA 3MBBA 3E2FA 4OYTA 4RJYA 4AZJA 4EFFA 4XK1A 2BIGA 3EI8A 2WK8A 3FD0A 1S09A 3HT4A 4WLHA 3FSLA 1SPAA 4ZSWA 3RI6A 1B4XA 2VMVA 2DKBA 5C6UA 1J32A 3GJUA 1M0PA 4PFNA 3DRDA 2ZP7A 1X0MA 1ASBA 4KXKA 2FNUA 3WKRA 2HUIA 1C9CA 1AKAA 1AY5A 3TQXA 3VAXA 4CBRA 4Q75A 2VMQA 4ADEA 1TOEA 5M4BA 3LVJA 4WXFA 3VK2A 1GC4A 2BWOA 5I92A 1D7SA 1ASMA 1GEXA 4A72A 3FRKA 2HOYA 1J04A 3WY7A 4K2BA 3GZCA 3BC8A 5D95A 1VP4A 2A1VA 4RKCA 1EG5A 2FQ6A 2W7IA 2DOUA 1LS3A 2HORA 3EI9A 2CJGA 4J8LA 1S06A 2WKAA 4P3MA 4Q76A 4A0FA 2KFPA 1AAWA 3P6KA 3RCHA 1BQDA 1GEWA 3FQ8A 1IX7A 5FT5A 1Z3ZA 4FL0A 3AELA 4OBVA 1OATA 4QGRA 3E9KA 1UU0A 2E7UA 2HOXA 1FG3A 3UWCA 2FYFA 2VMWA 1M7YA 3NDNA 2VYCA 2ZJGA 3GZDA 2VIBA 1ASCA 1JG8A 1TOGA 3A2BA 1EQBA 4B9BA 3T32A 3FZ6A 1B5OA 3JZLA 4E1OA 2CANA 2YCTA 3MAFA 3RBFA 4XJPA 4RIZA 1AMSA 4JE5D 1N2TA 1S07A 3GR9A 1H1CA 3N75A 2W7HA 1B8GA 1IAXA 1WYUB 1AMQA 3N0LA 1GC3A 4NOGA 4IXOA 1MDXA 2CTZA 1MLZA 3LG0A 2BKWA 3TCMA 4GE9A 1LK9A 1XEYA 5FT4A 4M2MA 5F9SA 3DU4A 3EI5A 3WZFA 3H7FA 3L44A 2AEVA 3HLMA 3CAIA 5LHAA 4XQ2A 1JS3A 2YOBA 3ASBA 3RUYA 3AEOA 2GMUA 3BWNC 1WYUA 4A0RA 3A9YA 2WK9A 2XBNA 2Z67A 3MC6C 3LY1A 2CY8A 2OGAA 3COGA 1B9IA 1CL2A 2D5YA 1LC7A 4F5FA 2CH1A 2O1BA 1YOOA 4HVKA 4IXSA 3FVUA 5G0AA 2ZY5A 1IVRA 3PDXA 4ZM4A 4WXBA 2GB3A 4AO9A 4WD2A 2BYLA 4AOAA 3UE8A 4XEWA 4ATQA 1ORDA 2FM1A 2JISA 2ZSMA 4LC3A 2BYJA 4IY7A 4A00A 3WGCA 2QSRA 3E2ZA 2VMTA 4OTLA 3VOMA 3QGUA 1UKJA 2F8JA 1V2DA 2QB2A 4FFCA 4JEZA 3FZ7A 2DGLA 3BCAA 4MQPA 3R4TA 3MADA 3NUIA 4GSAA 1JS6A 1UU1A 1BKGA 2VMPA 2YCPA 2TPLA 2QB3A 1BW0A 1S0AA 2VGZA 3AOWA 3B1CA 3NX3A 5J8QA 3W1HA 1GCKA 1SZSA 1C7OA 4ZLVA 3UAKA 1PMOA 2QLRA 5EUDA 3NU7A 3QI6A 2HOZA 2JJGA 4EB7A 2Z20A 3MC6A 1ELUA 1GC2A 3FQ7A 3WKSA 2X8UA 4ZWVA 2W8TA 1SF2A 1C4KA 2XH1A 5HDMA 1CJ0A 5E4ZA 2D66A 4JEYA 2G6WA 1RV4A 3GETA 2AY4A 1AMRA 1ARIA 3EZSA 4M2KA 1XI9A 3IHJA 4BHDA 5HXXA 4H51A 4I8AA 2QA3A 4GE4A 3ELPA 2PO3A 2D65A 2CINA 3I16A 1GD9A 5EAAA 2E7IA 2ZYJA 4EMYA 1B9HA 4ZAHA 3VP6A 4A0GA
chains in the Genus database with same CATH topology
4K05A 4GE7A 4F5HA 4RM1A 1ASAA 3GZDC 1P3WA 4AZKA 1W7MA 2OQXA 2FKIA 4JEWA 5M49A 1BJOA 1C7NA 1G7XA 2PB2A 2Z9XA 4U1TA 5AX8A 3JW9A 2R5EA 1N8PA 3PD6B 4Q6RA 3N4RA 1AICA 1UU2A 4ZDPA 4MSOA 4WXGA 3QM2A 5JAYA 3N7NA 2RFVA 3FVSA 5FT8A 2Z1YA 4LNJA 4DGTA 1QITA 4WYGA 2AY7A 3R9AA 1V2EA 2YKXA 3DYDA 1BJ4A 1CQ6A 3H14A 2CH2A 4JE5A 1QZ9A 1DGDA 1TPLA 3CBFA 3BB8A 2ZSLA 2ZY2A 2ZY4A 3PD6A 1AMAA 2W7KA 2BIEA 4Y0DA 2CFBA 2W7LA 3NU8A 4W1VA 1FG7A 1KL2A 3ASAA 2WK7A 4ZASA 2ZC0A 2VLFA 1AKCA 2C7TA 1DKAA 4O6ZA 2DGKA 3K28A 4F4EA 2BWNA 2HUUA 5M4DA 2JGTA 3GSBA 1I43A 3I4JA 1DFOA 2VMSA 5IWQA 4A6TA 3AEPA 2E7JA 2Z9WA 3NYSA 1KKPA 1M6SA 1QJ3A 1X29A 1ASFA 1GEYA 3EIBA 2YKUA 2V1PA 1QIRA 3PA9A 1E5EA 2VMXA 1D7UA 3B1DA 1ARSA 4K2MA 4BMKA 5EUEA 3FQAA 1I41A 2FNIA 1MDOA 1G7WA 5K8BA 1DTYA 2HP1A 1TOJA 3Q8NA 5D5SA 1IX6A 4WYAA 4TMRA 2W7FA 3JWAA 4WYEA 4ADBA 4H63Q 4EB5A 3BS8A 2VMOA 4ADCA 2VGVA 2JG2A 1BT4A 2OATA 4WP0A 4R8DA 2W7JA 4UHOA 5BJ4A 4W1WA 1KMKA 2VI9A 3BV0A 2VLHA 2AY8A 3ACZA 3FVXA 3FFHA 2VGTA 2FN6A 5EFSA 1ECXA 4AH3A 2GMSA 3TFUA 5DJ9A 2Z61A 4CXQA 1E5FA 3JWBA 3NNKA 4XJOA 4PIWA 1GC0A 1YIZA 3HMUA 1AIBA 3WX9A 2D61A 3BWOA 3LV2A 3LVLB 3MKJA 2CJHA 3M5UA 3A9XA 3WLXA 9AATA 1B5PA 5G2PA 4B98A 3HQTA 4M2JA 2PB0A 5HHYA 2AY6A 1S08A 3AENB 2E54A 3A9ZA 2W7GA 2OKJA 1RVUA 3ISLA 4P7YA 4DBCA 3FDDA 4E77A 1ASLA 1C0NA 4IX8A 4IYOB 5EIGB 2VGWA 5EUNA 3PAAA 4ITXA 1G4VA 3AEMC 2YKYA 3FDBA 1QGNA 2NMPA 2Z9UA 2QMAA 1SZUA 2EPJA 3E77A 4J5UA 3USFA 5DX5A 4WYFA 2EZ1A 4IXZA 4DQ6A 2EGYA 3NYTA 4UHMA 3OP7A 1MAPA 5TF5A 1MLYA 1FC4A 3AENA 2BIAA 3CQ6A 1PMMA 5LH9A 3F9TA 2W8UA 1YAAA 2BHXA 2VMUA 3PGYA 1SFFA 3NYUA 1W7LA 3B8XA 3FFRA 3ECDA 1T3IA 1ASDA 2W8VA 3ZZJA 4F5IA 4Y0HA 4IYOA 3K40A 4U2HA 3VK3A 3N4SA 4BA5A 1AHEA 1DJUA 3QHXA 1ZODA 4WYDA 3ELEA 1D7VA 4W91A 4ADDA 3N4XA 1YJYA 1G4XA 1GBNA 2HP2A 3DZZA 2DGMA 1BJWA 3PDBB 4Y0IA 2DR1A 4MQRA 4Q31A 3I5TA 1LC5A 1MGVA 2C44A 4F5KA 2AY5A 2X5DA 3EIAA 1IJIA 3HDOA 3WCOA 1IX8A 3OKSA 3EI7A 1AHGA 2WB6A 3AEMA 3K7YA 3QN6A 1KL1A 5E5IA 2W8JA 4E3RA 1AJSB 4WB0B 4K2IA 1M0NA 1OHWA 3AATA 3FCRA 3WCNA 2BI3A 3PDBA 1ARTA 1I29A 2VMNA 2R2NA 4LW4A 4ZDLA 3DC1A 2ZUKA 4ZWMA 2Q7WA 3B46A 2R0TA 3JTXA 1V72A 4JF0A 1OXPA 4RAEA 1V2FA 1M0QA 1I48A 2C0RA 5BJ3A 1Y4IA 2BI1A 3VK4A 1ZOBA 1AX4A 3LVMA 5KTBA 3MAUA 1AJSA 1CS1A 1RVYA 2Z1ZA 4PVFA 4WB0A 2EYQA 3PPLA 3E2YA 2JJEA 1AAMA 1MAQA 3KKIA 5DJ1A 1IUGA 1OXOA 4F5JA 3F0HA 2ZY3A 4UOYA 1YJSA 1WYVB 4XJMA 3HL2A 2EO5A 4CBSA 1CQ8A 3RCHB 2HUFA 1C7GA 2BI5A 4BA4A 4GDYA 4W8IA 1LW4A 3CQ4A 2CJDA 2GSAA 3RQ1A 4W1XA 4MQQA 2AY1A 3KE3A 2ORDA 2EH6A 3EI6A 3LWSA 2X3LA 1AHXA 2VGUA 1AY4A 1BS0A 1TOIA 1AKBA 3AOVA 2AATA 3G0TA 5FT6A 5DB5A 1LKCA 3QPGA 4JF1A 1IAYA 2W7DA 2O0RA 1M0OA 1M32A 2VMZA 4N0BA 4UQVA 1D7RA 1W23A 4CXRA 3FTBA 3PJ0A 2QBTA 2AY9A 1WYVA 3WGBA 4WLJA 2W7EA 3MAFB 5EQCA 3NTJA 4F5LA 3E6GA 4KYOA 5M46A 3BN1A 1Z7DA 1RV3A 3N5MA 1JF9A 2C81A 4RKDA 3W1IA 1TATA 2W8WA 3NRAA 4KAMA 4R2NA 5G09A 2YRIA 4IW7A 3RBLA 1PFFA 1QISA 2VI8A 2D7YA 1AHFA 2GQNA 4ATPA 2VIAA 3DXVA 1DGEA 1LW5A 4ISYA 1GDEA 1KMJA 3IF2A 1ELQA 3GBXA 1ASEA 2VMYA 3HVYA 1VJOA 4GRXA 4L0OA 4XJLA 3NUBA 1DJ9A 1DJEA 1AIAA 1PG8A 2BI9A 1LC8A 1TOKA 1D2FA 4OT8A 1BJNA 1WSTA 3GWPA 4MGRA 4W5KA 4ITGA 4OMAA 4LNLA 3PIUA 4BQ0A 1ARHA 4LNMA 1MDZA 3B1EA 3DR4A 1OHVA 1W3UA 4MY5A 3BCXA 1EJIA 1CL1A 1YNUA 3KGXA 4TN4A 2YKVA 1H0CA 3DXWA 4R5FA 4JEVA 4ZSYA 2O7CA 1O4SA 2R5CB 3G8MA 1BQAA 5F8VA 2JJHA 4PFFA 3FKDA 3FZ8A 1CQ7A 2EZ2A 3DODA 4F5MA 3W1JA 3E2ZB 1U08A 1YIYA 1AJRA 4A0HA 3MEBA 2BI2A 2OGEA 1OHYA 1ASNA 2VGSA 2VMRA 4OC9A 4WYCA 1ASGA 3ZRPA 3HBXA 3EUCA 4MKKA 2DKJA 1IBJA 2YCNA 4F5GA 1SZKA 1CZCA 1AY8A 5G4JA 2R5CA 1O61A 2W7MA 1YJZA 4XAUA 3D6KA 4LW2A 1QJ5A 3F6TA 4MKJA 4N0WA 3G7QA 5G4IA 3H9XA 1SVVA 4TV7A 3AEJC 5EIGA 4RITA 1X2AA 8AATA 3QBOA 3BCBA 3ATHA 3L8AA 1WYTB 5E3KA 1ZC9A 4E3QA 4UHNA 1AHYA 1M4NA 2AEUA 4HF8A 2OKKA 4CVQA 3ZRRA 4OCAA 3AV7A 4AO4A 1N31A 2YHKA 2YRRA 1X28A 4A6UA 1TARA 1ARGA 3II0A 2CB1A 3A8UX 2D63A 2Z9VA 1WKGA 1CZEA 2AY3A 3CQ5A 3BWNA 3EZ1A 4JEXA 4A6RA 2V0YA 4OBUA 5EAVA 3LVKA 4ZDOA 2HZPA 2G7JA 3TATA 1WKHA 1WYTA 4R5ZA 4RLGA 1W7NA 2BWPA 2CSTA 4ZM3A 2X5FA 1O62A 5G2QA 3P1TA 1BJOB 2D64A 4RJ0A 1VEFA 3JU7A 4GEBA 4WBTA 3ZRQA 2JJFA 3ZZKA 7AATA 4EU1A 3TFTA 1TASA 2AY2A 2D7ZA 1KKJA 3DR7A 1O69A 3KGWA 3AEJA 3MBBA 3E2FA 4OYTA 4RJYA 4AZJA 4EFFA 4XK1A 2BIGA 3EI8A 2WK8A 3FD0A 1S09A 3HT4A 4WLHA 3FSLA 1SPAA 4ZSWA 3RI6A 1B4XA 2VMVA 2DKBA 5C6UA 1J32A 3GJUA 1M0PA 4PFNA 3DRDA 2ZP7A 1X0MA 1ASBA 4KXKA 2FNUA 3WKRA 2HUIA 1C9CA 1AKAA 1AY5A 3TQXA 3VAXA 4CBRA 4Q75A 2VMQA 4ADEA 1TOEA 5M4BA 3LVJA 4WXFA 3VK2A 1GC4A 2BWOA 5I92A 1D7SA 1ASMA 1GEXA 4A72A 3FRKA 2HOYA 1J04A 3WY7A 4K2BA 3GZCA 3BC8A 5D95A 1VP4A 2A1VA 4RKCA 1EG5A 2FQ6A 2W7IA 2DOUA 1LS3A 2HORA 3EI9A 2CJGA 4J8LA 1S06A 2WKAA 4P3MA 4Q76A 4A0FA 2KFPA 1AAWA 3P6KA 3RCHA 1BQDA 1GEWA 3FQ8A 1IX7A 5FT5A 1Z3ZA 4FL0A 3AELA 4OBVA 1OATA 4QGRA 3E9KA 1UU0A 2E7UA 2HOXA 1FG3A 3UWCA 2FYFA 2VMWA 1M7YA 3NDNA 2VYCA 2ZJGA 3GZDA 2VIBA 1ASCA 1JG8A 1TOGA 3A2BA 1EQBA 4B9BA 3T32A 3FZ6A 1B5OA 3JZLA 4E1OA 2CANA 2YCTA 3MAFA 3RBFA 4XJPA 4RIZA 1AMSA 4JE5D 1N2TA 1S07A 3GR9A 1H1CA 3N75A 2W7HA 1B8GA 1IAXA 1WYUB 1AMQA 3N0LA 1GC3A 4NOGA 4IXOA 1MDXA 2CTZA 1MLZA 3LG0A 2BKWA 3TCMA 4GE9A 1LK9A 1XEYA 5FT4A 4M2MA 5F9SA 3DU4A 3EI5A 3WZFA 3H7FA 3L44A 2AEVA 3HLMA 3CAIA 5LHAA 4XQ2A 1JS3A 2YOBA 3ASBA 3RUYA 3AEOA 2GMUA 3BWNC 1WYUA 4A0RA 3A9YA 2WK9A 2XBNA 2Z67A 3MC6C 3LY1A 2CY8A 2OGAA 3COGA 1B9IA 1CL2A 2D5YA 1LC7A 4F5FA 2CH1A 2O1BA 1YOOA 4HVKA 4IXSA 3FVUA 5G0AA 2ZY5A 1IVRA 3PDXA 4ZM4A 4WXBA 2GB3A 4AO9A 4WD2A 2BYLA 4AOAA 3UE8A 4XEWA 4ATQA 1ORDA 2FM1A 2JISA 2ZSMA 4LC3A 2BYJA 4IY7A 4A00A 3WGCA 2QSRA 3E2ZA 2VMTA 4OTLA 3VOMA 3QGUA 1UKJA 2F8JA 1V2DA 2QB2A 4FFCA 4JEZA 3FZ7A 2DGLA 3BCAA 4MQPA 3R4TA 3MADA 3NUIA 4GSAA 1JS6A 1UU1A 1BKGA 2VMPA 2YCPA 2TPLA 2QB3A 1BW0A 1S0AA 2VGZA 3AOWA 3B1CA 3NX3A 5J8QA 3W1HA 1GCKA 1SZSA 1C7OA 4ZLVA 3UAKA 1PMOA 2QLRA 5EUDA 3NU7A 3QI6A 2HOZA 2JJGA 4EB7A 2Z20A 3MC6A 1ELUA 1GC2A 3FQ7A 3WKSA 2X8UA 4ZWVA 2W8TA 1SF2A 1C4KA 2XH1A 5HDMA 1CJ0A 5E4ZA 2D66A 4JEYA 2G6WA 1RV4A 3GETA 2AY4A 1AMRA 1ARIA 3EZSA 4M2KA 1XI9A 3IHJA 4BHDA 5HXXA 4H51A 4I8AA 2QA3A 4GE4A 3ELPA 2PO3A 2D65A 2CINA 3I16A 1GD9A 5EAAA 2E7IA 2ZYJA 4EMYA 1B9HA 4ZAHA 3VP6A 4A0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GE7 A;  4F5H A;  4RM1 A;  1ASA A;  3GZD C;  1P3W A;  4AZK A;  1W7M A;  2OQX A;  4JEW A;  5M49 A;  1BJO A;  1C7N A;  1G7X A;  2PB2 A;  2Z9X A;  4U1T A;  5AX8 A;  3JW9 A;  2R5E A;  1N8P A;  3PD6 B;  4Q6R A;  1AIC A;  1UU2 A;  4ZDP A;  4MSO A;  4WXG A;  3QM2 A;  5JAY A;  2RFV A;  3FVS A;  5FT8 A;  2Z1Y A;  4LNJ A;  4DGT A;  1QIT A;  4WYG A;  2AY7 A;  3R9A A;  1V2E A;  2YKX A;  3DYD A;  1BJ4 A;  1CQ6 A;  3H14 A;  2CH2 A;  4JE5 A;  1QZ9 A;  1DGD A;  1TPL A;  3CBF A;  3BB8 A;  2ZSL A;  2ZY2 A;  2ZY4 A;  3PD6 A;  1AMA A;  2W7K A;  2BIE A;  4Y0D A;  2CFB A;  2W7L A;  3NU8 A;  4W1V A;  1FG7 A;  1KL2 A;  3ASA A;  2WK7 A;  4ZAS A;  2ZC0 A;  2VLF A;  1AKC A;  2C7T A;  1DKA A;  4O6Z A;  2DGK A;  3K28 A;  4F4E A;  2BWN A;  2HUU A;  5M4D A;  2JGT A;  3GSB A;  1I43 A;  3I4J A;  1DFO A;  2VMS A;  5IWQ A;  4A6T A;  3AEP A;  2E7J A;  2Z9W A;  3NYS A;  1KKP A;  1M6S A;  1QJ3 A;  1X29 A;  1ASF A;  1GEY A;  3EIB A;  2YKU A;  2V1P A;  1QIR A;  3PA9 A;  1E5E A;  2VMX A;  1D7U A;  3B1D A;  1ARS A;  4K2M A;  4BMK A;  5EUE A;  3FQA A;  1I41 A;  2FNI A;  1MDO A;  1G7W A;  5K8B A;  1DTY A;  2HP1 A;  1TOJ A;  3Q8N A;  5D5S A;  1IX6 A;  4WYA A;  4TMR A;  2W7F A;  3JWA A;  4WYE A;  4ADB A;  4EB5 A;  3BS8 A;  2VMO A;  4ADC A;  2VGV A;  2JG2 A;  1BT4 A;  2OAT A;  4WP0 A;  4R8D A;  2W7J A;  4UHO A;  5BJ4 A;  4W1W A;  1KMK A;  2VI9 A;  3BV0 A;  2VLH A;  2AY8 A;  3ACZ A;  3FVX A;  3FFH A;  2VGT A;  2FN6 A;  5EFS A;  1ECX A;  4AH3 A;  2GMS A;  3TFU A;  5DJ9 A;  2Z61 A;  4CXQ A;  1E5F A;  3JWB A;  3NNK A;  4XJO A;  4PIW A;  1GC0 A;  1YIZ A;  3HMU A;  1AIB A;  3WX9 A;  2D61 A;  3BWO A;  3LV2 A;  3LVL B;  3MKJ A;  2CJH A;  3M5U A;  3A9X A;  3WLX A;  9AAT A;  1B5P A;  5G2P A;  4B98 A;  3HQT A;  4M2J A;  2PB0 A;  5HHY A;  2AY6 A;  1S08 A;  3AEN B;  2E54 A;  3A9Z A;  2W7G A;  2OKJ A;  1RVU A;  3ISL A;  4P7Y A;  4DBC A;  3FDD A;  4E77 A;  1ASL A;  1C0N A;  4IX8 A;  4IYO B;  5EIG B;  2VGW A;  5EUN A;  3PAA A;  4ITX A;  1G4V A;  3AEM C;  2YKY A;  3FDB A;  1QGN A;  2NMP A;  2Z9U A;  2QMA A;  1SZU A;  2EPJ A;  3E77 A;  4J5U A;  3USF A;  5DX5 A;  4WYF A;  2EZ1 A;  4IXZ A;  4DQ6 A;  2EGY A;  3NYT A;  4UHM A;  3OP7 A;  1MAP A;  5TF5 A;  1MLY A;  1FC4 A;  3AEN A;  2BIA A;  3CQ6 A;  1PMM A;  5LH9 A;  3F9T A;  2W8U A;  1YAA A;  2BHX A;  2VMU A;  3PGY A;  1SFF A;  3NYU A;  1W7L A;  3B8X A;  3FFR A;  3ECD A;  1T3I A;  1ASD A;  2W8V A;  3ZZJ A;  4F5I A;  4Y0H A;  4IYO A;  3K40 A;  4U2H A;  3VK3 A;  4BA5 A;  1AHE A;  1DJU A;  3QHX A;  1ZOD A;  4WYD A;  3ELE A;  1D7V A;  4W91 A;  4ADD A;  1YJY A;  1G4X A;  1GBN A;  2HP2 A;  3DZZ A;  2DGM A;  1BJW A;  3PDB B;  4Y0I A;  2DR1 A;  4MQR A;  4Q31 A;  3I5T A;  1LC5 A;  1MGV A;  2C44 A;  4F5K A;  2AY5 A;  2X5D A;  3EIA A;  1IJI A;  3HDO A;  3WCO A;  1IX8 A;  3OKS A;  3EI7 A;  1AHG A;  3AEM A;  3K7Y A;  3QN6 A;  1KL1 A;  5E5I A;  2W8J A;  4E3R A;  1AJS B;  4WB0 B;  4K2I A;  1M0N A;  1OHW A;  3AAT A;  3FCR A;  3WCN A;  2BI3 A;  3PDB A;  1ART A;  1I29 A;  2VMN A;  2R2N A;  4LW4 A;  4ZDL A;  3DC1 A;  2ZUK A;  4ZWM A;  2Q7W A;  3B46 A;  2R0T A;  3JTX A;  1V72 A;  4JF0 A;  1OXP A;  4RAE A;  1V2F A;  1M0Q A;  1I48 A;  2C0R A;  5BJ3 A;  1Y4I A;  2BI1 A;  3VK4 A;  1ZOB A;  1AX4 A;  3LVM A;  3MAU A;  1AJS A;  1CS1 A;  1RVY A;  2Z1Z A;  4PVF A;  4WB0 A;  3PPL A;  3E2Y A;  2JJE A;  1AAM A;  1MAQ A;  3KKI A;  5DJ1 A;  1IUG A;  1OXO A;  4F5J A;  3F0H A;  2ZY3 A;  4UOY A;  1YJS A;  1WYV B;  4XJM A;  3HL2 A;  2EO5 A;  4CBS A;  1CQ8 A;  3RCH B;  2HUF A;  1C7G A;  2BI5 A;  4BA4 A;  4GDY A;  4W8I A;  1LW4 A;  3CQ4 A;  2CJD A;  2GSA A;  3RQ1 A;  4W1X A;  4MQQ A;  2AY1 A;  3KE3 A;  2ORD A;  2EH6 A;  3EI6 A;  3LWS A;  2X3L A;  1AHX A;  2VGU A;  1AY4 A;  1BS0 A;  1TOI A;  1AKB A;  3AOV A;  2AAT A;  3G0T A;  5FT6 A;  5DB5 A;  1LKC A;  3QPG A;  4JF1 A;  1IAY A;  2W7D A;  2O0R A;  1M0O A;  1M32 A;  2VMZ A;  4N0B A;  4UQV A;  1D7R A;  1W23 A;  4CXR A;  3FTB A;  3PJ0 A;  2QBT A;  2AY9 A;  1WYV A;  3WGB A;  4WLJ A;  2W7E A;  3MAF B;  5EQC A;  3NTJ A;  4F5L A;  3E6G A;  4KYO A;  5M46 A;  3BN1 A;  1Z7D A;  1RV3 A;  3N5M A;  1JF9 A;  2C81 A;  4RKD A;  3W1I A;  1TAT A;  2W8W A;  3NRA A;  4KAM A;  4R2N A;  5G09 A;  2YRI A;  4IW7 A;  3RBL A;  1PFF A;  1QIS A;  2VI8 A;  2D7Y A;  1AHF A;  2GQN A;  4ATP A;  2VIA A;  3DXV A;  1DGE A;  1LW5 A;  4ISY A;  1GDE A;  1KMJ A;  3IF2 A;  1ELQ A;  3GBX A;  1ASE A;  2VMY A;  3HVY A;  1VJO A;  4GRX A;  4L0O A;  4XJL A;  3NUB A;  1DJ9 A;  1DJE A;  1AIA A;  1PG8 A;  2BI9 A;  1LC8 A;  1TOK A;  1D2F A;  4OT8 A;  1BJN A;  1WST A;  3GWP A;  4MGR A;  4W5K A;  4ITG A;  4OMA A;  4LNL A;  3PIU A;  4BQ0 A;  1ARH A;  4LNM A;  1MDZ A;  3B1E A;  3DR4 A;  1OHV A;  1W3U A;  4MY5 A;  3BCX A;  1EJI A;  1CL1 A;  1YNU A;  3KGX A;  4TN4 A;  2YKV A;  1H0C A;  3DXW A;  4R5F A;  4JEV A;  4ZSY A;  2O7C A;  1O4S A;  2R5C B;  3G8M A;  1BQA A;  5F8V A;  2JJH A;  4PFF A;  3FKD A;  3FZ8 A;  1CQ7 A;  2EZ2 A;  3DOD A;  4F5M A;  3W1J A;  3E2Z B;  1U08 A;  1YIY A;  1AJR A;  4A0H A;  3MEB A;  2BI2 A;  2OGE A;  1OHY A;  1ASN A;  2VGS A;  2VMR A;  4OC9 A;  4WYC A;  1ASG A;  3ZRP A;  3HBX A;  3EUC A;  4MKK A;  2DKJ A;  1IBJ A;  2YCN A;  4F5G A;  1SZK A;  1CZC A;  1AY8 A;  5G4J A;  2R5C A;  1O61 A;  2W7M A;  1YJZ A;  4XAU A;  3D6K A;  4LW2 A;  1QJ5 A;  3F6T A;  4MKJ A;  4N0W A;  3G7Q A;  5G4I A;  1SVV A;  4TV7 A;  3AEJ C;  5EIG A;  4RIT A;  1X2A A;  8AAT A;  3QBO A;  3BCB A;  3ATH A;  3L8A A;  1WYT B;  5E3K A;  1ZC9 A;  4E3Q A;  4UHN A;  1AHY A;  1M4N A;  2AEU A;  4HF8 A;  2OKK A;  4CVQ A;  3ZRR A;  4OCA A;  3AV7 A;  4AO4 A;  1N31 A;  2YHK A;  2YRR A;  1X28 A;  4A6U A;  1TAR A;  1ARG A;  3II0 A;  2CB1 A;  3A8U X;  2D63 A;  2Z9V A;  1WKG A;  1CZE A;  2AY3 A;  3CQ5 A;  3BWN A;  3EZ1 A;  4JEX A;  4A6R A;  2V0Y A;  4OBU A;  5EAV A;  3LVK A;  4ZDO A;  2HZP A;  3TAT A;  1WKH A;  1WYT A;  4R5Z A;  4RLG A;  1W7N A;  2BWP A;  2CST A;  4ZM3 A;  2X5F A;  1O62 A;  5G2Q A;  3P1T A;  1BJO B;  2D64 A;  4RJ0 A;  1VEF A;  3JU7 A;  4GEB A;  4WBT A;  3ZRQ A;  2JJF A;  3ZZK A;  7AAT A;  4EU1 A;  3TFT A;  1TAS A;  2AY2 A;  2D7Z A;  1KKJ A;  3DR7 A;  1O69 A;  3KGW A;  3AEJ A;  3MBB A;  3E2F A;  4OYT A;  4RJY A;  4AZJ A;  4EFF A;  4XK1 A;  2BIG A;  3EI8 A;  2WK8 A;  3FD0 A;  1S09 A;  3HT4 A;  4WLH A;  3FSL A;  1SPA A;  4ZSW A;  3RI6 A;  1B4X A;  2VMV A;  2DKB A;  5C6U A;  1J32 A;  3GJU A;  1M0P A;  4PFN A;  3DRD A;  2ZP7 A;  1X0M A;  1ASB A;  4KXK A;  2FNU A;  3WKR A;  2HUI A;  1C9C A;  1AKA A;  1AY5 A;  3TQX A;  3VAX A;  4CBR A;  4Q75 A;  2VMQ A;  4ADE A;  1TOE A;  5M4B A;  3LVJ A;  4WXF A;  3VK2 A;  1GC4 A;  2BWO A;  5I92 A;  1D7S A;  1ASM A;  1GEX A;  4A72 A;  3FRK A;  2HOY A;  1J04 A;  3WY7 A;  4K2B A;  3GZC A;  3BC8 A;  5D95 A;  1VP4 A;  4RKC A;  1EG5 A;  2FQ6 A;  2W7I A;  2DOU A;  1LS3 A;  2HOR A;  3EI9 A;  2CJG A;  4J8L A;  1S06 A;  2WKA A;  4P3M A;  4Q76 A;  4A0F A;  1AAW A;  3P6K A;  3RCH A;  1BQD A;  1GEW A;  3FQ8 A;  1IX7 A;  5FT5 A;  1Z3Z A;  4FL0 A;  3AEL A;  4OBV A;  1OAT A;  4QGR A;  3E9K A;  1UU0 A;  2E7U A;  2HOX A;  1FG3 A;  3UWC A;  2FYF A;  2VMW A;  1M7Y A;  3NDN A;  2VYC A;  2ZJG A;  3GZD A;  2VIB A;  1ASC A;  1JG8 A;  1TOG A;  3A2B A;  1EQB A;  4B9B A;  3T32 A;  3FZ6 A;  1B5O A;  3JZL A;  4E1O A;  2CAN A;  2YCT A;  3MAF A;  3RBF A;  4XJP A;  4RIZ A;  1AMS A;  4JE5 D;  1N2T A;  1S07 A;  3GR9 A;  1H1C A;  3N75 A;  2W7H A;  1B8G A;  1IAX A;  1WYU B;  1AMQ A;  3N0L A;  1GC3 A;  4NOG A;  4IXO A;  1MDX A;  2CTZ A;  1MLZ A;  3LG0 A;  2BKW A;  3TCM A;  4GE9 A;  1LK9 A;  1XEY A;  5FT4 A;  4M2M A;  5F9S A;  3DU4 A;  3EI5 A;  3WZF A;  3H7F A;  3L44 A;  2AEV A;  3HLM A;  3CAI A;  5LHA A;  4XQ2 A;  1JS3 A;  2YOB A;  3ASB A;  3RUY A;  3AEO A;  2GMU A;  3BWN C;  1WYU A;  4A0R A;  3A9Y A;  2WK9 A;  2XBN A;  2Z67 A;  3MC6 C;  3LY1 A;  2CY8 A;  2OGA A;  3COG A;  1B9I A;  1CL2 A;  2D5Y A;  1LC7 A;  4F5F A;  2CH1 A;  2O1B A;  1YOO A;  4HVK A;  4IXS A;  3FVU A;  5G0A A;  2ZY5 A;  1IVR A;  3PDX A;  4ZM4 A;  4WXB A;  2GB3 A;  4AO9 A;  4WD2 A;  2BYL A;  4AOA A;  3UE8 A;  4XEW A;  4ATQ A;  1ORD A;  2FM1 A;  2JIS A;  2ZSM A;  4LC3 A;  2BYJ A;  4IY7 A;  4A00 A;  3WGC A;  3E2Z A;  2VMT A;  4OTL A;  3VOM A;  3QGU A;  1UKJ A;  2F8J A;  1V2D A;  2QB2 A;  4FFC A;  4JEZ A;  3FZ7 A;  2DGL A;  3BCA A;  4MQP A;  3R4T A;  3MAD A;  3NUI A;  4GSA A;  1JS6 A;  1UU1 A;  1BKG A;  2VMP A;  2YCP A;  2TPL A;  2QB3 A;  1BW0 A;  1S0A A;  2VGZ A;  3AOW A;  3B1C A;  3NX3 A;  5J8Q A;  3W1H A;  1GCK A;  1SZS A;  1C7O A;  4ZLV A;  3UAK A;  1PMO A;  2QLR A;  5EUD A;  3NU7 A;  3QI6 A;  2HOZ A;  2JJG A;  4EB7 A;  2Z20 A;  3MC6 A;  1ELU A;  1GC2 A;  3FQ7 A;  3WKS A;  2X8U A;  4ZWV A;  2W8T A;  1SF2 A;  1C4K A;  2XH1 A;  5HDM A;  1CJ0 A;  5E4Z A;  2D66 A;  4JEY A;  2G6W A;  1RV4 A;  3GET A;  2AY4 A;  1AMR A;  1ARI A;  3EZS A;  4M2K A;  1XI9 A;  3IHJ A;  4BHD A;  5HXX A;  4H51 A;  4I8A A;  2QA3 A;  4GE4 A;  3ELP A;  2PO3 A;  2D65 A;  2CIN A;  3I16 A;  1GD9 A;  5EAA A;  2E7I A;  2ZYJ A;  4EMY A;  1B9H A;  4ZAH A;  3VP6 A;  4A0G A; 
#chains in the Genus database with same CATH topology
 4K05 A;  4GE7 A;  4F5H A;  4RM1 A;  1ASA A;  3GZD C;  1P3W A;  4AZK A;  1W7M A;  2OQX A;  2FKI A;  4JEW A;  5M49 A;  1BJO A;  1C7N A;  1G7X A;  2PB2 A;  2Z9X A;  4U1T A;  5AX8 A;  3JW9 A;  2R5E A;  1N8P A;  3PD6 B;  4Q6R A;  3N4R A;  1AIC A;  1UU2 A;  4ZDP A;  4MSO A;  4WXG A;  3QM2 A;  5JAY A;  3N7N A;  2RFV A;  3FVS A;  5FT8 A;  2Z1Y A;  4LNJ A;  4DGT A;  1QIT A;  4WYG A;  2AY7 A;  3R9A A;  1V2E A;  2YKX A;  1KAF A;  3DYD A;  1BJ4 A;  1CQ6 A;  3H14 A;  2CH2 A;  4JE5 A;  1QZ9 A;  1DGD A;  1TPL A;  3CBF A;  3BB8 A;  2ZSL A;  2ZY2 A;  2ZY4 A;  3PD6 A;  1AMA A;  2W7K A;  2BIE A;  4Y0D A;  2CFB A;  2W7L A;  3NU8 A;  4W1V A;  1FG7 A;  1KL2 A;  3ASA A;  2WK7 A;  4ZAS A;  2ZC0 A;  2VLF A;  1AKC A;  2C7T A;  1DKA A;  4O6Z A;  2DGK A;  3K28 A;  4F4E A;  2BWN A;  2HUU A;  5M4D A;  2JGT A;  3GSB A;  1I43 A;  3I4J A;  1DFO A;  2VMS A;  5IWQ A;  4A6T A;  3AEP A;  2E7J A;  2Z9W A;  3NYS A;  1KKP A;  1M6S A;  1QJ3 A;  1X29 A;  1ASF A;  1GEY A;  3EIB A;  2YKU A;  2V1P A;  1QIR A;  3PA9 A;  1E5E A;  2VMX A;  1D7U A;  3B1D A;  1ARS A;  4K2M A;  4BMK A;  5EUE A;  3FQA A;  1I41 A;  2FNI A;  1MDO A;  1G7W A;  5K8B A;  1DTY A;  2HP1 A;  1TOJ A;  3Q8N A;  5D5S A;  1IX6 A;  4WYA A;  4TMR A;  2W7F A;  3JWA A;  4WYE A;  4ADB A;  4H63 Q;  4EB5 A;  3BS8 A;  2VMO A;  4ADC A;  2VGV A;  2JG2 A;  1BT4 A;  2OAT A;  4WP0 A;  4R8D A;  2W7J A;  4UHO A;  5BJ4 A;  4W1W A;  1KMK A;  2VI9 A;  3BV0 A;  2VLH A;  2AY8 A;  3ACZ A;  3FVX A;  3FFH A;  2VGT A;  2FN6 A;  5EFS A;  1ECX A;  4AH3 A;  2GMS A;  3TFU A;  5DJ9 A;  2Z61 A;  4CXQ A;  1E5F A;  3JWB A;  3NNK A;  4XJO A;  4PIW A;  1GC0 A;  1YIZ A;  3HMU A;  1AIB A;  3WX9 A;  2D61 A;  3BWO A;  3LV2 A;  3LVL B;  3MKJ A;  2CJH A;  3M5U A;  3A9X A;  3WLX A;  9AAT A;  1B5P A;  5G2P A;  4B98 A;  3HQT A;  4M2J A;  2PB0 A;  5HHY A;  2AY6 A;  1S08 A;  3AEN B;  2E54 A;  3A9Z A;  2W7G A;  2OKJ A;  1RVU A;  3ISL A;  4P7Y A;  4DBC A;  3FDD A;  4E77 A;  1ASL A;  1C0N A;  4IX8 A;  4IYO B;  5EIG B;  2VGW A;  5EUN A;  3PAA A;  4ITX A;  1G4V A;  3AEM C;  2YKY A;  3FDB A;  1QGN A;  2NMP A;  2Z9U A;  2QMA A;  1SZU A;  2EPJ A;  3E77 A;  4J5U A;  3USF A;  5DX5 A;  4WYF A;  2EZ1 A;  4IXZ A;  4DQ6 A;  2EGY A;  3NYT A;  4UHM A;  3OP7 A;  1MAP A;  5TF5 A;  1MLY A;  1FC4 A;  3AEN A;  2BIA A;  3CQ6 A;  1PMM A;  5LH9 A;  3F9T A;  2W8U A;  1YAA A;  2BHX A;  2VMU A;  3PGY A;  1SFF A;  3NYU A;  1W7L A;  3B8X A;  3FFR A;  3ECD A;  1T3I A;  1ASD A;  2W8V A;  3ZZJ A;  4F5I A;  4Y0H A;  4IYO A;  3K40 A;  4U2H A;  3VK3 A;  3N4S A;  4BA5 A;  1AHE A;  1DJU A;  3QHX A;  1ZOD A;  4WYD A;  3ELE A;  1D7V A;  4W91 A;  4ADD A;  3N4X A;  1YJY A;  1G4X A;  1GBN A;  2HP2 A;  3DZZ A;  2DGM A;  1BJW A;  3PDB B;  4Y0I A;  2DR1 A;  4MQR A;  4Q31 A;  3I5T A;  1LC5 A;  1MGV A;  2C44 A;  4F5K A;  2AY5 A;  2X5D A;  3EIA A;  1IJI A;  3HDO A;  3WCO A;  1IX8 A;  3OKS A;  3EI7 A;  1AHG A;  2WB6 A;  3AEM A;  3K7Y A;  3QN6 A;  1KL1 A;  5E5I A;  2W8J A;  4E3R A;  1AJS B;  4WB0 B;  4K2I A;  1M0N A;  1OHW A;  3AAT A;  3FCR A;  3WCN A;  2BI3 A;  3PDB A;  1ART A;  1I29 A;  2VMN A;  2R2N A;  4LW4 A;  4ZDL A;  3DC1 A;  2ZUK A;  4ZWM A;  2Q7W A;  3B46 A;  2R0T A;  3JTX A;  1V72 A;  4JF0 A;  1OXP A;  4RAE A;  1V2F A;  1M0Q A;  1I48 A;  2C0R A;  5BJ3 A;  1Y4I A;  2BI1 A;  3VK4 A;  1ZOB A;  1AX4 A;  3LVM A;  5KTB A;  3MAU A;  1AJS A;  1CS1 A;  1RVY A;  2Z1Z A;  4PVF A;  4WB0 A;  2EYQ A;  3PPL A;  3E2Y A;  2JJE A;  1AAM A;  1MAQ A;  3KKI A;  5DJ1 A;  1IUG A;  1OXO A;  4F5J A;  3F0H A;  2ZY3 A;  4UOY A;  1YJS A;  1WYV B;  4XJM A;  3HL2 A;  2EO5 A;  4CBS A;  1CQ8 A;  3RCH B;  2HUF A;  1C7G A;  2BI5 A;  4BA4 A;  4GDY A;  4W8I A;  1LW4 A;  3CQ4 A;  2CJD A;  2GSA A;  3RQ1 A;  4W1X A;  4MQQ A;  2AY1 A;  3KE3 A;  2ORD A;  2EH6 A;  3EI6 A;  3LWS A;  2X3L A;  1AHX A;  2VGU A;  1AY4 A;  1BS0 A;  1TOI A;  1AKB A;  3AOV A;  2AAT A;  3G0T A;  5FT6 A;  5DB5 A;  1LKC A;  3QPG A;  4JF1 A;  1IAY A;  2W7D A;  2O0R A;  1M0O A;  1M32 A;  2VMZ A;  4N0B A;  4UQV A;  1D7R A;  1W23 A;  4CXR A;  3FTB A;  3PJ0 A;  2QBT A;  2AY9 A;  1WYV A;  3WGB A;  4WLJ A;  2W7E A;  3MAF B;  5EQC A;  3NTJ A;  4F5L A;  3E6G A;  4KYO A;  5M46 A;  3BN1 A;  1Z7D A;  1RV3 A;  3N5M A;  1JF9 A;  2C81 A;  4RKD A;  3W1I A;  1TAT A;  2W8W A;  3NRA A;  4KAM A;  4R2N A;  5G09 A;  2YRI A;  4IW7 A;  3RBL A;  1PFF A;  1QIS A;  2VI8 A;  2D7Y A;  1AHF A;  2GQN A;  4ATP A;  2VIA A;  3DXV A;  1DGE A;  1LW5 A;  4ISY A;  1GDE A;  1KMJ A;  3IF2 A;  1ELQ A;  3GBX A;  1ASE A;  2VMY A;  3HVY A;  1VJO A;  4GRX A;  4L0O A;  4XJL A;  3NUB A;  1DJ9 A;  1DJE A;  1AIA A;  1PG8 A;  2BI9 A;  1LC8 A;  1TOK A;  1D2F A;  4OT8 A;  1BJN A;  1WST A;  3GWP A;  4MGR A;  4W5K A;  4ITG A;  4OMA A;  4LNL A;  3PIU A;  4BQ0 A;  1ARH A;  4LNM A;  1MDZ A;  3B1E A;  3DR4 A;  1OHV A;  1W3U A;  4MY5 A;  3BCX A;  1EJI A;  1CL1 A;  1YNU A;  3KGX A;  4TN4 A;  2YKV A;  1H0C A;  3DXW A;  4R5F A;  4JEV A;  4ZSY A;  2O7C A;  1O4S A;  2R5C B;  3G8M A;  1BQA A;  5F8V A;  2JJH A;  4PFF A;  3FKD A;  3FZ8 A;  1CQ7 A;  2EZ2 A;  3DOD A;  4F5M A;  3W1J A;  3E2Z B;  1U08 A;  1YIY A;  1AJR A;  4A0H A;  3MEB A;  2BI2 A;  2OGE A;  1OHY A;  1ASN A;  2VGS A;  2VMR A;  4OC9 A;  4WYC A;  1ASG A;  3ZRP A;  3HBX A;  3EUC A;  4MKK A;  2DKJ A;  1IBJ A;  2YCN A;  4F5G A;  1SZK A;  1CZC A;  1AY8 A;  5G4J A;  2R5C A;  1O61 A;  2W7M A;  1YJZ A;  4XAU A;  3D6K A;  4LW2 A;  1QJ5 A;  3F6T A;  4MKJ A;  4N0W A;  3G7Q A;  5G4I A;  3H9X A;  1SVV A;  4TV7 A;  3AEJ C;  5EIG A;  4RIT A;  1X2A A;  8AAT A;  3QBO A;  3BCB A;  3ATH A;  3L8A A;  1WYT B;  5E3K A;  1ZC9 A;  4E3Q A;  4UHN A;  1AHY A;  1M4N A;  2AEU A;  4HF8 A;  2OKK A;  4CVQ A;  3ZRR A;  4OCA A;  3AV7 A;  4AO4 A;  1N31 A;  2YHK A;  2YRR A;  1X28 A;  4A6U A;  1TAR A;  1ARG A;  3II0 A;  2CB1 A;  3A8U X;  2D63 A;  2Z9V A;  1WKG A;  1CZE A;  2AY3 A;  3CQ5 A;  3BWN A;  3EZ1 A;  4JEX A;  4A6R A;  2V0Y A;  4OBU A;  5EAV A;  3LVK A;  4ZDO A;  2HZP A;  2G7J A;  3TAT A;  1WKH A;  1WYT A;  4R5Z A;  4RLG A;  1W7N A;  2BWP A;  2CST A;  4ZM3 A;  2X5F A;  1O62 A;  5G2Q A;  3P1T A;  1BJO B;  2D64 A;  4RJ0 A;  1VEF A;  3JU7 A;  4GEB A;  4WBT A;  3ZRQ A;  2JJF A;  3ZZK A;  7AAT A;  4EU1 A;  3TFT A;  1TAS A;  2AY2 A;  2D7Z A;  1KKJ A;  3DR7 A;  1O69 A;  3KGW A;  3AEJ A;  3MBB A;  3E2F A;  4OYT A;  4RJY A;  4AZJ A;  4EFF A;  4XK1 A;  2BIG A;  3EI8 A;  2WK8 A;  3FD0 A;  1S09 A;  3HT4 A;  4WLH A;  3FSL A;  1SPA A;  4ZSW A;  3RI6 A;  1B4X A;  2VMV A;  2DKB A;  5C6U A;  1J32 A;  3GJU A;  1M0P A;  4PFN A;  3DRD A;  2ZP7 A;  1X0M A;  1ASB A;  4KXK A;  2FNU A;  3WKR A;  2HUI A;  1C9C A;  1AKA A;  1AY5 A;  3TQX A;  3VAX A;  4CBR A;  4Q75 A;  2VMQ A;  4ADE A;  1TOE A;  5M4B A;  3LVJ A;  4WXF A;  3VK2 A;  1GC4 A;  2BWO A;  5I92 A;  1D7S A;  1ASM A;  1GEX A;  4A72 A;  3FRK A;  2HOY A;  1J04 A;  3WY7 A;  4K2B A;  3GZC A;  3BC8 A;  5D95 A;  1VP4 A;  2A1V A;  4RKC A;  1EG5 A;  2FQ6 A;  2W7I A;  2DOU A;  1LS3 A;  2HOR A;  3EI9 A;  2CJG A;  4J8L A;  1S06 A;  2WKA A;  4P3M A;  4Q76 A;  4A0F A;  2KFP A;  1AAW A;  3P6K A;  3RCH A;  1BQD A;  1GEW A;  3FQ8 A;  1IX7 A;  5FT5 A;  1Z3Z A;  4FL0 A;  3AEL A;  4OBV A;  1OAT A;  4QGR A;  3E9K A;  1UU0 A;  2E7U A;  2HOX A;  1FG3 A;  3UWC A;  2FYF A;  2VMW A;  1M7Y A;  3NDN A;  2VYC A;  2ZJG A;  3GZD A;  2VIB A;  1ASC A;  1JG8 A;  1TOG A;  3A2B A;  1EQB A;  4B9B A;  3T32 A;  3FZ6 A;  1B5O A;  3JZL A;  4E1O A;  2CAN A;  2YCT A;  3MAF A;  3RBF A;  4XJP A;  4RIZ A;  1AMS A;  4JE5 D;  1N2T A;  1S07 A;  3GR9 A;  1H1C A;  3N75 A;  2W7H A;  1B8G A;  1IAX A;  1WYU B;  1AMQ A;  3N0L A;  1GC3 A;  4NOG A;  4IXO A;  1MDX A;  2CTZ A;  1MLZ A;  3LG0 A;  2BKW A;  3TCM A;  4GE9 A;  1LK9 A;  1XEY A;  5FT4 A;  4M2M A;  5F9S A;  3DU4 A;  3EI5 A;  3WZF A;  3H7F A;  3L44 A;  2AEV A;  3HLM A;  3CAI A;  5LHA A;  4XQ2 A;  1JS3 A;  2YOB A;  3ASB A;  3RUY A;  3AEO A;  2GMU A;  3BWN C;  1WYU A;  4A0R A;  3A9Y A;  2WK9 A;  2XBN A;  2Z67 A;  3MC6 C;  3LY1 A;  2CY8 A;  2OGA A;  3COG A;  1B9I A;  1CL2 A;  2D5Y A;  1LC7 A;  4F5F A;  2CH1 A;  2O1B A;  1YOO A;  4HVK A;  4IXS A;  3FVU A;  5G0A A;  2ZY5 A;  1IVR A;  3PDX A;  4ZM4 A;  4WXB A;  2GB3 A;  4AO9 A;  4WD2 A;  2BYL A;  4AOA A;  3UE8 A;  4XEW A;  4ATQ A;  1ORD A;  2FM1 A;  2JIS A;  2ZSM A;  4LC3 A;  2BYJ A;  4IY7 A;  4A00 A;  3WGC A;  2QSR A;  3E2Z A;  2VMT A;  4OTL A;  3VOM A;  3QGU A;  1UKJ A;  2F8J A;  1V2D A;  2QB2 A;  4FFC A;  4JEZ A;  3FZ7 A;  2DGL A;  3BCA A;  4MQP A;  3R4T A;  3MAD A;  3NUI A;  4GSA A;  1JS6 A;  1UU1 A;  1BKG A;  2VMP A;  2YCP A;  2TPL A;  2QB3 A;  1BW0 A;  1S0A A;  2VGZ A;  3AOW A;  3B1C A;  3NX3 A;  5J8Q A;  3W1H A;  1GCK A;  1SZS A;  1C7O A;  4ZLV A;  3UAK A;  1PMO A;  2QLR A;  5EUD A;  3NU7 A;  3QI6 A;  2HOZ A;  2JJG A;  4EB7 A;  2Z20 A;  3MC6 A;  1ELU A;  1GC2 A;  3FQ7 A;  3WKS A;  2X8U A;  4ZWV A;  2W8T A;  1SF2 A;  1C4K A;  2XH1 A;  5HDM A;  1CJ0 A;  5E4Z A;  2D66 A;  4JEY A;  2G6W A;  1RV4 A;  3GET A;  2AY4 A;  1AMR A;  1ARI A;  3EZS A;  4M2K A;  1XI9 A;  3IHJ A;  4BHD A;  5HXX A;  4H51 A;  4I8A A;  2QA3 A;  4GE4 A;  3ELP A;  2PO3 A;  2D65 A;  2CIN A;  3I16 A;  1GD9 A;  5EAA A;  2E7I A;  2ZYJ A;  4EMY A;  1B9H A;  4ZAH A;  3VP6 A;  4A0G A; 
#chains in the Genus database with same CATH homology
 4K05 A;  4GE7 A;  4F5H A;  4RM1 A;  1ASA A;  3GZD C;  1P3W A;  4AZK A;  1W7M A;  2OQX A;  2FKI A;  4JEW A;  5M49 A;  1BJO A;  1C7N A;  1G7X A;  2PB2 A;  2Z9X A;  4U1T A;  5AX8 A;  3JW9 A;  2R5E A;  1N8P A;  3PD6 B;  4Q6R A;  3N4R A;  1AIC A;  1UU2 A;  4ZDP A;  4MSO A;  4WXG A;  3QM2 A;  5JAY A;  3N7N A;  2RFV A;  3FVS A;  5FT8 A;  2Z1Y A;  4LNJ A;  4DGT A;  1QIT A;  4WYG A;  2AY7 A;  3R9A A;  1V2E A;  2YKX A;  3DYD A;  1BJ4 A;  1CQ6 A;  3H14 A;  2CH2 A;  4JE5 A;  1QZ9 A;  1DGD A;  1TPL A;  3CBF A;  3BB8 A;  2ZSL A;  2ZY2 A;  2ZY4 A;  3PD6 A;  1AMA A;  2W7K A;  2BIE A;  4Y0D A;  2CFB A;  2W7L A;  3NU8 A;  4W1V A;  1FG7 A;  1KL2 A;  3ASA A;  2WK7 A;  4ZAS A;  2ZC0 A;  2VLF A;  1AKC A;  2C7T A;  1DKA A;  4O6Z A;  2DGK A;  3K28 A;  4F4E A;  2BWN A;  2HUU A;  5M4D A;  2JGT A;  3GSB A;  1I43 A;  3I4J A;  1DFO A;  2VMS A;  5IWQ A;  4A6T A;  3AEP A;  2E7J A;  2Z9W A;  3NYS A;  1KKP A;  1M6S A;  1QJ3 A;  1X29 A;  1ASF A;  1GEY A;  3EIB A;  2YKU A;  2V1P A;  1QIR A;  3PA9 A;  1E5E A;  2VMX A;  1D7U A;  3B1D A;  1ARS A;  4K2M A;  4BMK A;  5EUE A;  3FQA A;  1I41 A;  2FNI A;  1MDO A;  1G7W A;  5K8B A;  1DTY A;  2HP1 A;  1TOJ A;  3Q8N A;  5D5S A;  1IX6 A;  4WYA A;  4TMR A;  2W7F A;  3JWA A;  4WYE A;  4ADB A;  4H63 Q;  4EB5 A;  3BS8 A;  2VMO A;  4ADC A;  2VGV A;  2JG2 A;  1BT4 A;  2OAT A;  4WP0 A;  4R8D A;  2W7J A;  4UHO A;  5BJ4 A;  4W1W A;  1KMK A;  2VI9 A;  3BV0 A;  2VLH A;  2AY8 A;  3ACZ A;  3FVX A;  3FFH A;  2VGT A;  2FN6 A;  5EFS A;  1ECX A;  4AH3 A;  2GMS A;  3TFU A;  5DJ9 A;  2Z61 A;  4CXQ A;  1E5F A;  3JWB A;  3NNK A;  4XJO A;  4PIW A;  1GC0 A;  1YIZ A;  3HMU A;  1AIB A;  3WX9 A;  2D61 A;  3BWO A;  3LV2 A;  3LVL B;  3MKJ A;  2CJH A;  3M5U A;  3A9X A;  3WLX A;  9AAT A;  1B5P A;  5G2P A;  4B98 A;  3HQT A;  4M2J A;  2PB0 A;  5HHY A;  2AY6 A;  1S08 A;  3AEN B;  2E54 A;  3A9Z A;  2W7G A;  2OKJ A;  1RVU A;  3ISL A;  4P7Y A;  4DBC A;  3FDD A;  4E77 A;  1ASL A;  1C0N A;  4IX8 A;  4IYO B;  5EIG B;  2VGW A;  5EUN A;  3PAA A;  4ITX A;  1G4V A;  3AEM C;  2YKY A;  3FDB A;  1QGN A;  2NMP A;  2Z9U A;  2QMA A;  1SZU A;  2EPJ A;  3E77 A;  4J5U A;  3USF A;  5DX5 A;  4WYF A;  2EZ1 A;  4IXZ A;  4DQ6 A;  2EGY A;  3NYT A;  4UHM A;  3OP7 A;  1MAP A;  5TF5 A;  1MLY A;  1FC4 A;  3AEN A;  2BIA A;  3CQ6 A;  1PMM A;  5LH9 A;  3F9T A;  2W8U A;  1YAA A;  2BHX A;  2VMU A;  3PGY A;  1SFF A;  3NYU A;  1W7L A;  3B8X A;  3FFR A;  3ECD A;  1T3I A;  1ASD A;  2W8V A;  3ZZJ A;  4F5I A;  4Y0H A;  4IYO A;  3K40 A;  4U2H A;  3VK3 A;  3N4S A;  4BA5 A;  1AHE A;  1DJU A;  3QHX A;  1ZOD A;  4WYD A;  3ELE A;  1D7V A;  4W91 A;  4ADD A;  3N4X A;  1YJY A;  1G4X A;  1GBN A;  2HP2 A;  3DZZ A;  2DGM A;  1BJW A;  3PDB B;  4Y0I A;  2DR1 A;  4MQR A;  4Q31 A;  3I5T A;  1LC5 A;  1MGV A;  2C44 A;  4F5K A;  2AY5 A;  2X5D A;  3EIA A;  1IJI A;  3HDO A;  3WCO A;  1IX8 A;  3OKS A;  3EI7 A;  1AHG A;  2WB6 A;  3AEM A;  3K7Y A;  3QN6 A;  1KL1 A;  5E5I A;  2W8J A;  4E3R A;  1AJS B;  4WB0 B;  4K2I A;  1M0N A;  1OHW A;  3AAT A;  3FCR A;  3WCN A;  2BI3 A;  3PDB A;  1ART A;  1I29 A;  2VMN A;  2R2N A;  4LW4 A;  4ZDL A;  3DC1 A;  2ZUK A;  4ZWM A;  2Q7W A;  3B46 A;  2R0T A;  3JTX A;  1V72 A;  4JF0 A;  1OXP A;  4RAE A;  1V2F A;  1M0Q A;  1I48 A;  2C0R A;  5BJ3 A;  1Y4I A;  2BI1 A;  3VK4 A;  1ZOB A;  1AX4 A;  3LVM A;  5KTB A;  3MAU A;  1AJS A;  1CS1 A;  1RVY A;  2Z1Z A;  4PVF A;  4WB0 A;  2EYQ A;  3PPL A;  3E2Y A;  2JJE A;  1AAM A;  1MAQ A;  3KKI A;  5DJ1 A;  1IUG A;  1OXO A;  4F5J A;  3F0H A;  2ZY3 A;  4UOY A;  1YJS A;  1WYV B;  4XJM A;  3HL2 A;  2EO5 A;  4CBS A;  1CQ8 A;  3RCH B;  2HUF A;  1C7G A;  2BI5 A;  4BA4 A;  4GDY A;  4W8I A;  1LW4 A;  3CQ4 A;  2CJD A;  2GSA A;  3RQ1 A;  4W1X A;  4MQQ A;  2AY1 A;  3KE3 A;  2ORD A;  2EH6 A;  3EI6 A;  3LWS A;  2X3L A;  1AHX A;  2VGU A;  1AY4 A;  1BS0 A;  1TOI A;  1AKB A;  3AOV A;  2AAT A;  3G0T A;  5FT6 A;  5DB5 A;  1LKC A;  3QPG A;  4JF1 A;  1IAY A;  2W7D A;  2O0R A;  1M0O A;  1M32 A;  2VMZ A;  4N0B A;  4UQV A;  1D7R A;  1W23 A;  4CXR A;  3FTB A;  3PJ0 A;  2QBT A;  2AY9 A;  1WYV A;  3WGB A;  4WLJ A;  2W7E A;  3MAF B;  5EQC A;  3NTJ A;  4F5L A;  3E6G A;  4KYO A;  5M46 A;  3BN1 A;  1Z7D A;  1RV3 A;  3N5M A;  1JF9 A;  2C81 A;  4RKD A;  3W1I A;  1TAT A;  2W8W A;  3NRA A;  4KAM A;  4R2N A;  5G09 A;  2YRI A;  4IW7 A;  3RBL A;  1PFF A;  1QIS A;  2VI8 A;  2D7Y A;  1AHF A;  2GQN A;  4ATP A;  2VIA A;  3DXV A;  1DGE A;  1LW5 A;  4ISY A;  1GDE A;  1KMJ A;  3IF2 A;  1ELQ A;  3GBX A;  1ASE A;  2VMY A;  3HVY A;  1VJO A;  4GRX A;  4L0O A;  4XJL A;  3NUB A;  1DJ9 A;  1DJE A;  1AIA A;  1PG8 A;  2BI9 A;  1LC8 A;  1TOK A;  1D2F A;  4OT8 A;  1BJN A;  1WST A;  3GWP A;  4MGR A;  4W5K A;  4ITG A;  4OMA A;  4LNL A;  3PIU A;  4BQ0 A;  1ARH A;  4LNM A;  1MDZ A;  3B1E A;  3DR4 A;  1OHV A;  1W3U A;  4MY5 A;  3BCX A;  1EJI A;  1CL1 A;  1YNU A;  3KGX A;  4TN4 A;  2YKV A;  1H0C A;  3DXW A;  4R5F A;  4JEV A;  4ZSY A;  2O7C A;  1O4S A;  2R5C B;  3G8M A;  1BQA A;  5F8V A;  2JJH A;  4PFF A;  3FKD A;  3FZ8 A;  1CQ7 A;  2EZ2 A;  3DOD A;  4F5M A;  3W1J A;  3E2Z B;  1U08 A;  1YIY A;  1AJR A;  4A0H A;  3MEB A;  2BI2 A;  2OGE A;  1OHY A;  1ASN A;  2VGS A;  2VMR A;  4OC9 A;  4WYC A;  1ASG A;  3ZRP A;  3HBX A;  3EUC A;  4MKK A;  2DKJ A;  1IBJ A;  2YCN A;  4F5G A;  1SZK A;  1CZC A;  1AY8 A;  5G4J A;  2R5C A;  1O61 A;  2W7M A;  1YJZ A;  4XAU A;  3D6K A;  4LW2 A;  1QJ5 A;  3F6T A;  4MKJ A;  4N0W A;  3G7Q A;  5G4I A;  3H9X A;  1SVV A;  4TV7 A;  3AEJ C;  5EIG A;  4RIT A;  1X2A A;  8AAT A;  3QBO A;  3BCB A;  3ATH A;  3L8A A;  1WYT B;  5E3K A;  1ZC9 A;  4E3Q A;  4UHN A;  1AHY A;  1M4N A;  2AEU A;  4HF8 A;  2OKK A;  4CVQ A;  3ZRR A;  4OCA A;  3AV7 A;  4AO4 A;  1N31 A;  2YHK A;  2YRR A;  1X28 A;  4A6U A;  1TAR A;  1ARG A;  3II0 A;  2CB1 A;  3A8U X;  2D63 A;  2Z9V A;  1WKG A;  1CZE A;  2AY3 A;  3CQ5 A;  3BWN A;  3EZ1 A;  4JEX A;  4A6R A;  2V0Y A;  4OBU A;  5EAV A;  3LVK A;  4ZDO A;  2HZP A;  2G7J A;  3TAT A;  1WKH A;  1WYT A;  4R5Z A;  4RLG A;  1W7N A;  2BWP A;  2CST A;  4ZM3 A;  2X5F A;  1O62 A;  5G2Q A;  3P1T A;  1BJO B;  2D64 A;  4RJ0 A;  1VEF A;  3JU7 A;  4GEB A;  4WBT A;  3ZRQ A;  2JJF A;  3ZZK A;  7AAT A;  4EU1 A;  3TFT A;  1TAS A;  2AY2 A;  2D7Z A;  1KKJ A;  3DR7 A;  1O69 A;  3KGW A;  3AEJ A;  3MBB A;  3E2F A;  4OYT A;  4RJY A;  4AZJ A;  4EFF A;  4XK1 A;  2BIG A;  3EI8 A;  2WK8 A;  3FD0 A;  1S09 A;  3HT4 A;  4WLH A;  3FSL A;  1SPA A;  4ZSW A;  3RI6 A;  1B4X A;  2VMV A;  2DKB A;  5C6U A;  1J32 A;  3GJU A;  1M0P A;  4PFN A;  3DRD A;  2ZP7 A;  1X0M A;  1ASB A;  4KXK A;  2FNU A;  3WKR A;  2HUI A;  1C9C A;  1AKA A;  1AY5 A;  3TQX A;  3VAX A;  4CBR A;  4Q75 A;  2VMQ A;  4ADE A;  1TOE A;  5M4B A;  3LVJ A;  4WXF A;  3VK2 A;  1GC4 A;  2BWO A;  5I92 A;  1D7S A;  1ASM A;  1GEX A;  4A72 A;  3FRK A;  2HOY A;  1J04 A;  3WY7 A;  4K2B A;  3GZC A;  3BC8 A;  5D95 A;  1VP4 A;  2A1V A;  4RKC A;  1EG5 A;  2FQ6 A;  2W7I A;  2DOU A;  1LS3 A;  2HOR A;  3EI9 A;  2CJG A;  4J8L A;  1S06 A;  2WKA A;  4P3M A;  4Q76 A;  4A0F A;  2KFP A;  1AAW A;  3P6K A;  3RCH A;  1BQD A;  1GEW A;  3FQ8 A;  1IX7 A;  5FT5 A;  1Z3Z A;  4FL0 A;  3AEL A;  4OBV A;  1OAT A;  4QGR A;  3E9K A;  1UU0 A;  2E7U A;  2HOX A;  1FG3 A;  3UWC A;  2FYF A;  2VMW A;  1M7Y A;  3NDN A;  2VYC A;  2ZJG A;  3GZD A;  2VIB A;  1ASC A;  1JG8 A;  1TOG A;  3A2B A;  1EQB A;  4B9B A;  3T32 A;  3FZ6 A;  1B5O A;  3JZL A;  4E1O A;  2CAN A;  2YCT A;  3MAF A;  3RBF A;  4XJP A;  4RIZ A;  1AMS A;  4JE5 D;  1N2T A;  1S07 A;  3GR9 A;  1H1C A;  3N75 A;  2W7H A;  1B8G A;  1IAX A;  1WYU B;  1AMQ A;  3N0L A;  1GC3 A;  4NOG A;  4IXO A;  1MDX A;  2CTZ A;  1MLZ A;  3LG0 A;  2BKW A;  3TCM A;  4GE9 A;  1LK9 A;  1XEY A;  5FT4 A;  4M2M A;  5F9S A;  3DU4 A;  3EI5 A;  3WZF A;  3H7F A;  3L44 A;  2AEV A;  3HLM A;  3CAI A;  5LHA A;  4XQ2 A;  1JS3 A;  2YOB A;  3ASB A;  3RUY A;  3AEO A;  2GMU A;  3BWN C;  1WYU A;  4A0R A;  3A9Y A;  2WK9 A;  2XBN A;  2Z67 A;  3MC6 C;  3LY1 A;  2CY8 A;  2OGA A;  3COG A;  1B9I A;  1CL2 A;  2D5Y A;  1LC7 A;  4F5F A;  2CH1 A;  2O1B A;  1YOO A;  4HVK A;  4IXS A;  3FVU A;  5G0A A;  2ZY5 A;  1IVR A;  3PDX A;  4ZM4 A;  4WXB A;  2GB3 A;  4AO9 A;  4WD2 A;  2BYL A;  4AOA A;  3UE8 A;  4XEW A;  4ATQ A;  1ORD A;  2FM1 A;  2JIS A;  2ZSM A;  4LC3 A;  2BYJ A;  4IY7 A;  4A00 A;  3WGC A;  2QSR A;  3E2Z A;  2VMT A;  4OTL A;  3VOM A;  3QGU A;  1UKJ A;  2F8J A;  1V2D A;  2QB2 A;  4FFC A;  4JEZ A;  3FZ7 A;  2DGL A;  3BCA A;  4MQP A;  3R4T A;  3MAD A;  3NUI A;  4GSA A;  1JS6 A;  1UU1 A;  1BKG A;  2VMP A;  2YCP A;  2TPL A;  2QB3 A;  1BW0 A;  1S0A A;  2VGZ A;  3AOW A;  3B1C A;  3NX3 A;  5J8Q A;  3W1H A;  1GCK A;  1SZS A;  1C7O A;  4ZLV A;  3UAK A;  1PMO A;  2QLR A;  5EUD A;  3NU7 A;  3QI6 A;  2HOZ A;  2JJG A;  4EB7 A;  2Z20 A;  3MC6 A;  1ELU A;  1GC2 A;  3FQ7 A;  3WKS A;  2X8U A;  4ZWV A;  2W8T A;  1SF2 A;  1C4K A;  2XH1 A;  5HDM A;  1CJ0 A;  5E4Z A;  2D66 A;  4JEY A;  2G6W A;  1RV4 A;  3GET A;  2AY4 A;  1AMR A;  1ARI A;  3EZS A;  4M2K A;  1XI9 A;  3IHJ A;  4BHD A;  5HXX A;  4H51 A;  4I8A A;  2QA3 A;  4GE4 A;  3ELP A;  2PO3 A;  2D65 A;  2CIN A;  3I16 A;  1GD9 A;  5EAA A;  2E7I A;  2ZYJ A;  4EMY A;  1B9H A;  4ZAH A;  3VP6 A;  4A0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...