3PPLA

Crystal structure of an aspartate transaminase (ncgl0237, cgl0240) from corynebacterium glutamicum atcc 13032 kitasato at 1.25 a resolution
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
424
structure length
424
Chain Sequence
SSVSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structure of an aspartate transaminase (NCgl0237, Cgl0240) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 1.25 A resolution
rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 146
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3pplA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3pplA01
3QBOA 4MKJA 4R5ZA 1DJ9A 3PAAA 3FCRA 2OQXA 4JF0A 1LS3A 2BI5A 1ASLA 5DJ9A 2VGUA 1AHFA 5D95A 3JW9A 2W7GA 2BWOA 2X5FA 3NUIA 4XJLA 3VK2A 1WKHA 1ELQA 2ZP7A 1FC4A 5FT6A 4PVFA 5LHAA 3P6KA 1OHYA 1BT4A 2W7JA 2GMUA 1MLYA 4OTLA 1BJOA 3LY1A 1DKAA 1OHWA 2RFVA 1ARHA 9AATA 4KAMA 1JS6A 5EUEA 3AEMC 4WB0A 1GCKA 3QN6A 4A0HA 2X3LA 4WYEA 3JWBA 4UHNA 3AENB 2HUFA 3EUCA 3NRAA 4GE9A 4DGTA 5J8QA 3ZRQA 1C7NA 3JTXA 4K2BA 4F4EA 4OCAA 4F5LA 2YCTA 3RUYA 3AEMA 1GC0A 2DGLA 1U08A 4AH3A 3NYTA 3E9KA 1ORDA 4AO9A 1TATA 2D5YA 3DR4A 1UU2A 4H51A 3BWNA 3P1TA 1JF9A 4MGRA 1TOGA 3WGCA 3RQ1A 4EMYA 3KGWA 2JISA 3FZ6A 3QM2A 3ACZA 4QGRA 1IBJA 4WLHA 3RI6A 4ADEA 1GBNA 2AATA 3ISLA 3BV0A 1M6SA 1AHYA 1ASMA 3AENA 2AY2A 2GQNA 2BWNA 3FKDA 2ZSMA 3QHXA 2YKVA 3LVLB 2E7UA 4IY7A 3HBXA 4LW2A 4MY5A 1AIAA 4UQVA 3DXVA 5G4JA 2QMAA 3E77A 4A00A 4CBRA 1QJ3A 1AHEA 3BWOA 3ELPA 4ITGA 3KE3A 1CQ8A 2JJHA 2ZYJA 1P3WA 1XEYA 3B1DA 2E54A 1V2DA 3LVKA 1C7GA 2VGZA 4Y0HA 3RBFA 3MADA 1N2TA 1TOKA 3LVJA 4A6TA 4UHMA 1W23A 5M46A 1IX8A 2Z1YA 4JEXA 1TOIA 3E2ZB 4RM1A 2CJHA 4A6RA 2D64A 2W7KA 3KKIA 4UHOA 2ZJGA 1SVVA 3ZRPA 3TFTA 2HP2A 3E2FA 4EB7A 2HORA 3JZLA 4ZASA 1N8PA 4Q6RA 2XH1A 3D6KA 2Z9WA 1S06A 4Q76A 1MGVA 1SFFA 1UKJA 3CBFA 3GBXA 2VI8A 4ADDA 1JG8A 2YRIA 3AOWA 1IX7A 4JEWA 1AMQA 3VAXA 2HP1A 3FFHA 1CL2A 3QI6A 4PFNA 2HUIA 4MQRA 2WK9A 1GDEA 1AMSA 4M2KA 1GC2A 4WXGA 4ADBA 4AO4A 3EZ1A 1QZ9A 2OATA 3L8AA 3E2ZA 1MAQA 3MEBA 2W7LA 4EB5A 3EI6A 3PA9A 2W8VA 4ZWMA 1FG3A 1AKBA 1UU0A 4HVKA 1ECXA 3MC6C 1GEXA 4OBUA 4J8LA 1AJSA 4GSAA 1ARSA 1V2FA 3OKSA 1AMAA 3DR7A 2CJDA 1SZUA 2TPLA 3AEOA 1M0NA 4RKDA 3FTBA 1AIBA 5I92A 3AEJC 1D7SA 4F5IA 3PDBB 3PD6A 3RBLA 4FL0A 1IAXA 1QITA 2JJGA 3N75A 3IHJA 4ZAHA 1PFFA 1LK9A 1X28A 4B98A 1GEYA 2Z20A 1YIZA 3USFA 1ASCA 1WYTB 3NNKA 1LW5A 2BHXA 1QISA 4TMRA 4A0GA 2OKJA 2O1BA 3AEJA 1WYUB 4LW4A 1IX6A 2W7DA 5C6UA 2BWPA 3TATA 4R8DA 2OKKA 2BYLA 1PMOA 2ORDA 1AX4A 3NYSA 2CY8A 3L44A 1KKJA 2EGYA 3LG0A 1BQAA 2VMWA 4RJYA 4O6ZA 3G7QA 3OP7A 2R5CB 1TPLA 3HMUA 3PDBA 2D7YA 4KYOA 1AAMA 1IUGA 2VMPA 1B5PA 3DU4A 3BB8A 4JE5A 4ZSYA 4R5FA 2VI9A 2WK7A 4W1XA 1Y4IA 4CVQA 3I16A 1ARGA 1WYTA 3BCBA 1O62A 3A8UX 5F8VA 3NU7A 1WYUA 2GMSA 5G0AA 1WKGA 2PB0A 2QA3A 3WX9A 4IW7A 1N31A 4RIZA 2Z67A 1YJYA 3WCNA 1ZODA 4RAEA 5HDMA 3T32A 4WYFA 5EUNA 3FDDA 4ATPA 2VMRA 2R5CA 1W3UA 1YAAA 2O0RA 4ZM4A 4A0FA 1KKPA 3BWNC 3PGYA 4OYTA 3A9ZA 4KXKA 2FM1A 2W8TA 3DXWA 4PIWA 5E4ZA 3CQ6A 2WK8A 5G2PA 5IWQA 1X29A 4F5HA 2EZ2A 1E5FA 2Z9VA 3EI8A 1AKAA 1W7MA 2W7EA 4ITXA 1XI9A 3F6TA 4OT8A 4WYDA 3K7YA 1EG5A 1CL1A 4AZKA 2Z61A 5DB5A 4F5JA 2ZUKA 2E7JA 4ATQA 2VIAA 4B9BA 4ZM3A 1BJWA 3EIAA 1B5OA 1QGNA 3F9TA 2CH2A 3MAUA 7AATA 3JU7A 2AY9A 2GSAA 4Y0DA 4ZLVA 1TOEA 3AATA 4CXQA 3IF2A 1RV4A 4BQ0A 1H1CA 1WYVB 1ZOBA 1AJRA 1O61A 4UOYA 2Z1ZA 4XQ2A 2D7ZA 5G09A 5K8BA 1GEWA 1M0OA 3FVXA 4M2MA 1G7XA 4EFFA 1DJEA 1KL2A 2BI9A 4XAUA 1M7YA 2HOZA 4ISYA 1AMRA 2VMNA 4IYOB 4M2JA 3GWPA 4W1VA 1M0PA 1AHGA 4ZDPA 1H0CA 1GC4A 5FT4A 2NMPA 4AOAA 1OXPA 2VMQA 3GR9A 2PO3A 1YNUA 3TCMA 5G2QA 4BMKA 3CAIA 3FQAA 3GJUA 2EZ1A 2YRRA 1AJSB 3FVSA 4A6UA 1PG8A 1EQBA 1B8GA 5E5IA 2W7FA 4HF8A 4WYAA 3VK4A 1WYVA 1D2FA 2YHKA 1DGEA 4ZDLA 1AAWA 1TASA 3WGBA 4ZWVA 3HDOA 3B8XA 1B9IA 3QPGA 4GDYA 3PD6B 4N0WA 3FSLA 2XBNA 1WSTA 1C7OA 1S0AA 2CFBA 3EI9A 1BJ4A 2Z9XA 1AY4A 3K40A 4P3MA 2EH6A 2WKAA 4IYOA 5E3KA 4JEZA 1MLZA 2AY1A 4IXSA 3G0TA 2VMXA 2QBTA 3DZZA 4NOGA 1W7LA 3DRDA 2CSTA 4JEVA 5DX5A 3PPLA 5LH9A 3DODA 5HXXA 3QGUA 1V2EA 4RKCA 3W1JA 3BCAA 2VYCA 4WYGA 3ZZKA 2QLRA 3GZDC 4CXRA 4F5KA 8AATA 4GRXA 2BIEA 1M4NA 1TOJA 3PIUA 2JG2A 1O4SA 4F5MA 3NYUA 1D7VA 2ZY5A 4ZSWA 3G8MA 4WBTA 2FYFA 2BI3A 2AY4A 4XEWA 1MDOA 1SF2A 3FRKA 1DTYA 1TARA 4OC9A 3FD0A 3GZDA 3UE8A 1DGDA 2V0YA 3AEPA 1CQ7A 1QJ5A 1YIYA 4K2MA 1LC5A 3LV2A 3BN1A 5EAAA 1X2AA 2Q7WA 3AOVA 1ELUA 1PMMA 3NU8A 5AX8A 1UU1A 4WD2A 5BJ3A 2F8JA 4JE5D 4RITA 4LNMA 1I43A 4U1TA 3B1EA 1IVRA 1OHVA 1S09A 2HZPA 1Z7DA 1LC7A 1CZEA 4PFFA 4WYCA 3RCHB 3VK3A 4BHDA 1G4VA 2DGMA 2W8UA 4F5GA 4AZJA 5DJ1A 2AY8A 3WKRA 2AY5A 2BIGA 2O7CA 3H14A 4XJOA 3R4TA 1BJNA 1YJZA 2DGKA 2BKWA 4W5KA 2Z9UA 3W1HA 2CINA 2EPJA 3UWCA 3WY7A 2C81A 1ARIA 4XK1A 4E3QA 1G7WA 2VGSA 4E1OA 1AKCA 4IXZA 3AELA 1D7RA 5EAVA 3A9YA 1I29A 3E6GA 3HVYA 3ECDA 1EJIA 1M32A 3GETA 4JEYA 1GD9A 5FT8A 4MKKA 3LWSA 3NDNA 1AY5A 2ZY2A 2W7HA 3GSBA 4L0OA 1OXOA 1KMJA 1VP4A 2HOYA 3BCXA 3MAFB 1YJSA 1I41A 1BQDA 4Q31A 3RCHA 3K28A 2BIAA 2HUUA 1BS0A 1BW0A 2C44A 4LC3A 1LW4A 2CB1A 1C4KA 2OGAA 3R9AA 3LVMA 3HLMA 1CZCA 1M0QA 2D65A 2VMYA 1O69A 1J32A 1B9HA 2DKBA 3HQTA 1I48A 3BS8A 4WXFA 4XJMA 2FNUA 2VMUA 3MKJA 5FT5A 3AV7A 3WCOA 3NTJA 5F9SA 1J04A 3A2BA 2W8JA 1IJIA 1ASGA 1RVYA 4WP0A 2AY3A 1MDZA 1LKCA 2AEUA 2X5DA 2W8WA 1AHXA 1T3IA 2AEVA 3ASBA 2YOBA 3MAFA 1S07A 4A0RA 2CANA 4TN4A 1ASNA 3E2YA 4TV7A 3NX3A 4BA4A 5M4DA 1IAYA 2OGEA 2JGTA 4W8IA 4BA5A 3FZ8A 2FQ6A 3WKSA 3DYDA 5EUDA 3PDXA 4F5FA 3EZSA 4W91A 4MQPA 2BYJA 5EQCA 1VJOA 3HT4A 3ASAA 4IXOA 1KL1A 2VMTA 5HHYA 1CQ6A 4LNJA 1FG7A 2VGWA 2VGTA 3FQ8A 5EFSA 2X8UA 4DQ6A 4ZDOA 2E7IA 3CQ4A 1MAPA 2VMZA 3PJ0A 2W7IA 3I4JA 3VOMA 2G6WA 3H7FA 5BJ4A 5JAYA 1SPAA 2FN6A 1SZKA 3N5MA 1C0NA 1DFOA 4OMAA 4Y0IA 3HL2A 3I5TA 5G4IA 1X0MA 2JJFA 2DR1A 3FDBA 4K2IA 3B1CA 4WLJA 5M4BA 1S08A 1ASAA 2YKUA 3MBBA 3ZRRA 2VGVA 2AY6A 4Q75A 2DKJA 2ZC0A 4E3RA 1GC3A 1JS3A 3A9XA 2R0TA 1ASEA 3FZ7A 3M5UA 2AY7A 4EU1A 3JWAA 4FFCA 2VLFA 3BC8A 2YCPA 3Q8NA 2VMVA 1VEFA 2V1PA 3W1IA 1YOOA 2D61A 5EIGB 1SZSA 1ZC9A 3II0A 3F0HA 2VMOA 1ASDA 3EI5A 2YCNA 2ZY3A 2ZY4A 3ZZJA 4IX8A 3ELEA 4U2HA 1ARTA 1CJ0A 1OATA 3N0LA 2R5EA 3TQXA 4MQQA 5M49A 5D5SA 1V72A 2C0RA 1CS1A 4GE7A 1B4XA 2VIBA 4I8AA 2CH1A 2C7TA 3WZFA 3NUBA 3ATHA 1ASFA 2BI1A 1E5EA 3EI7A 4XJPA 3VP6A 4CBSA 2ZSLA 2GB3A 1D7UA 3FQ7A 3FFRA 4MSOA 2QB3A 4W1WA 5EIGA 4P7YA 1C9CA 2CTZA 2QB2A 2YKXA 4WXBA 4DBCA 2D63A 1ASBA 4J5UA 3FVUA 3COGA 1BKGA 4R2NA 3B46A 1RVUA 3MC6A 2CJGA 4GE4A 2VMSA 3WLXA 3EIBA 4A72A 1DJUA 2EO5A 1Z3ZA 2PB2A 2JJEA 2BI2A 1G4XA 3DC1A 3TFUA 1W7NA 2DOUA 2FNIA 2YKYA 3GZCA 2W7MA 3KGXA 4ADCA 1RV3A 4LNLA 1LC8A 4RLGA 1BJOB 3UAKA 1QIRA 1MDXA 2VLHA 3CQ5A 2D66A 5TF5A 2R2NA 4E77A 4JF1A 4WB0B 4GEBA 1AY8A 1AICA 1KMKA 4OBVA 2HOXA 4RJ0A 4N0BA
chains in the Genus database with same CATH superfamily
3QBOA 4MKJA 4R5ZA 1DJ9A 3PAAA 3FCRA 2OQXA 4JF0A 1LS3A 2BI5A 1ASLA 5DJ9A 2VGUA 1AHFA 5D95A 3JW9A 2W7GA 2BWOA 2X5FA 3NUIA 4XJLA 3VK2A 1WKHA 1ELQA 2ZP7A 1FC4A 5FT6A 4PVFA 5LHAA 3P6KA 1OHYA 1BT4A 2W7JA 2GMUA 1MLYA 4OTLA 1BJOA 3LY1A 1KAFA 1DKAA 1OHWA 2RFVA 1ARHA 9AATA 4KAMA 1JS6A 5EUEA 3AEMC 4WB0A 1GCKA 3QN6A 4A0HA 2X3LA 4WYEA 3JWBA 4UHNA 3AENB 2HUFA 3EUCA 3NRAA 4GE9A 4DGTA 5J8QA 3ZRQA 1C7NA 3JTXA 4K2BA 4F4EA 4OCAA 4F5LA 2YCTA 3RUYA 3AEMA 1GC0A 2DGLA 1U08A 4AH3A 3NYTA 3E9KA 1ORDA 4AO9A 1TATA 2D5YA 3DR4A 1UU2A 4H51A 3BWNA 3P1TA 1JF9A 4MGRA 1TOGA 3WGCA 3RQ1A 4EMYA 2A1VA 3KGWA 2JISA 3FZ6A 3QM2A 3ACZA 4QGRA 1IBJA 4WLHA 3RI6A 4ADEA 1GBNA 2AATA 3ISLA 3BV0A 1M6SA 1AHYA 1ASMA 3AENA 2AY2A 2GQNA 2BWNA 3FKDA 2ZSMA 3N7NA 3QHXA 2YKVA 3LVLB 2E7UA 4IY7A 3HBXA 4LW2A 4MY5A 1AIAA 4UQVA 3DXVA 5G4JA 2QMAA 3E77A 4A00A 4CBRA 1QJ3A 1AHEA 3BWOA 3ELPA 4ITGA 3KE3A 1CQ8A 2JJHA 2ZYJA 1P3WA 1XEYA 3B1DA 2E54A 1V2DA 3LVKA 1C7GA 2VGZA 4Y0HA 3RBFA 3MADA 1N2TA 1TOKA 3LVJA 4A6TA 4UHMA 1W23A 5M46A 1IX8A 2Z1YA 4JEXA 1TOIA 3E2ZB 4RM1A 2CJHA 4A6RA 2D64A 2W7KA 3KKIA 4UHOA 2ZJGA 1SVVA 3ZRPA 3TFTA 2HP2A 3E2FA 4EB7A 2HORA 3JZLA 4ZASA 1N8PA 4Q6RA 2XH1A 3D6KA 2Z9WA 1S06A 4Q76A 1MGVA 1SFFA 1UKJA 3CBFA 3GBXA 2VI8A 4ADDA 1JG8A 2YRIA 3AOWA 1IX7A 4JEWA 2QSRA 1AMQA 3VAXA 2HP1A 3FFHA 1CL2A 3QI6A 4PFNA 2HUIA 4MQRA 3N4SA 2WK9A 1GDEA 1AMSA 4M2KA 1GC2A 4WXGA 4ADBA 4AO4A 3EZ1A 1QZ9A 2OATA 3L8AA 3E2ZA 1MAQA 3MEBA 2W7LA 4EB5A 5KTBA 3EI6A 3PA9A 2W8VA 4ZWMA 1FG3A 1AKBA 1UU0A 4HVKA 1ECXA 3MC6C 1GEXA 4OBUA 4J8LA 1AJSA 4GSAA 1ARSA 1V2FA 3OKSA 1AMAA 3DR7A 2CJDA 1SZUA 2TPLA 3AEOA 1M0NA 4RKDA 3FTBA 1AIBA 5I92A 3AEJC 1D7SA 4F5IA 3PDBB 3PD6A 3RBLA 4FL0A 1IAXA 1QITA 2JJGA 3N75A 3IHJA 4ZAHA 1PFFA 1LK9A 1X28A 3H9XA 4B98A 1GEYA 2Z20A 1YIZA 3USFA 1ASCA 1WYTB 3NNKA 1LW5A 2BHXA 1QISA 4TMRA 4A0GA 2OKJA 2O1BA 3AEJA 1WYUB 4LW4A 1IX6A 2W7DA 5C6UA 2BWPA 3TATA 4R8DA 2OKKA 2BYLA 1PMOA 2ORDA 1AX4A 3NYSA 2CY8A 3L44A 1KKJA 2EGYA 3LG0A 1BQAA 2VMWA 2FKIA 4RJYA 4O6ZA 3G7QA 3OP7A 2R5CB 1TPLA 3HMUA 3PDBA 2D7YA 4KYOA 1AAMA 1IUGA 2VMPA 1B5PA 3DU4A 3BB8A 4JE5A 4ZSYA 4R5FA 2VI9A 2WK7A 4W1XA 4H63Q 1Y4IA 4CVQA 3I16A 1ARGA 1WYTA 3BCBA 1O62A 3A8UX 5F8VA 3NU7A 1WYUA 2GMSA 5G0AA 2G7JA 1WKGA 2PB0A 2QA3A 3WX9A 3N4XA 4IW7A 1N31A 4RIZA 2Z67A 1YJYA 3WCNA 1ZODA 4RAEA 5HDMA 3T32A 4WYFA 5EUNA 3FDDA 4ATPA 2VMRA 2R5CA 1W3UA 1YAAA 2O0RA 4ZM4A 4A0FA 1KKPA 3BWNC 3PGYA 4OYTA 3A9ZA 4KXKA 2FM1A 2W8TA 3DXWA 4PIWA 5E4ZA 3CQ6A 2WK8A 5G2PA 5IWQA 1X29A 4F5HA 2EZ2A 1E5FA 2Z9VA 3EI8A 1AKAA 1W7MA 2W7EA 4ITXA 1XI9A 3F6TA 4OT8A 4WYDA 3K7YA 1EG5A 1CL1A 4AZKA 2Z61A 5DB5A 4F5JA 2ZUKA 2E7JA 4ATQA 2VIAA 4B9BA 4ZM3A 1BJWA 3EIAA 1B5OA 1QGNA 3F9TA 2CH2A 3MAUA 7AATA 3JU7A 2AY9A 2GSAA 4Y0DA 4ZLVA 1TOEA 3AATA 4CXQA 3IF2A 1RV4A 4BQ0A 1H1CA 1WYVB 1ZOBA 1AJRA 1O61A 4UOYA 2Z1ZA 4XQ2A 2D7ZA 5G09A 5K8BA 1GEWA 1M0OA 3FVXA 4M2MA 1G7XA 4EFFA 1DJEA 1KL2A 2BI9A 4XAUA 1M7YA 2HOZA 4ISYA 1AMRA 2VMNA 4IYOB 4M2JA 3GWPA 4W1VA 1M0PA 1AHGA 4ZDPA 1H0CA 1GC4A 5FT4A 2NMPA 4AOAA 1OXPA 2VMQA 3GR9A 2PO3A 1YNUA 3TCMA 5G2QA 4BMKA 3CAIA 3FQAA 3GJUA 2EZ1A 2YRRA 1AJSB 3FVSA 4A6UA 1PG8A 1EQBA 1B8GA 5E5IA 2W7FA 4HF8A 4WYAA 3VK4A 1WYVA 1D2FA 2YHKA 1DGEA 4ZDLA 1AAWA 1TASA 3WGBA 4ZWVA 3HDOA 3B8XA 1B9IA 3QPGA 4GDYA 3PD6B 4N0WA 3FSLA 2XBNA 1WSTA 1C7OA 1S0AA 2CFBA 3EI9A 1BJ4A 2Z9XA 1AY4A 3K40A 4P3MA 2EH6A 2WKAA 4IYOA 5E3KA 4JEZA 1MLZA 2AY1A 4IXSA 3G0TA 2VMXA 2EYQA 2QBTA 3DZZA 4NOGA 1W7LA 3DRDA 2CSTA 4JEVA 5DX5A 3PPLA 5LH9A 3DODA 5HXXA 3QGUA 1V2EA 4RKCA 3W1JA 3BCAA 2VYCA 4WYGA 3ZZKA 2QLRA 3GZDC 4CXRA 4F5KA 8AATA 4GRXA 2BIEA 1M4NA 1TOJA 3N4RA 3PIUA 2JG2A 1O4SA 4F5MA 3NYUA 1D7VA 2ZY5A 4ZSWA 3G8MA 4WBTA 2FYFA 2BI3A 2AY4A 4XEWA 1MDOA 1SF2A 3FRKA 1DTYA 1TARA 4OC9A 3FD0A 3GZDA 3UE8A 1DGDA 2V0YA 3AEPA 1CQ7A 1QJ5A 1YIYA 4K2MA 1LC5A 3LV2A 3BN1A 5EAAA 2KFPA 1X2AA 2Q7WA 3AOVA 1ELUA 1PMMA 3NU8A 5AX8A 1UU1A 4WD2A 5BJ3A 2F8JA 4JE5D 4RITA 4LNMA 1I43A 4U1TA 3B1EA 1IVRA 1OHVA 1S09A 2HZPA 1Z7DA 1LC7A 1CZEA 4PFFA 4WYCA 3RCHB 3VK3A 4BHDA 1G4VA 2DGMA 2W8UA 4F5GA 4AZJA 5DJ1A 2AY8A 3WKRA 2AY5A 2BIGA 2O7CA 3H14A 4XJOA 3R4TA 1BJNA 1YJZA 2DGKA 2BKWA 4W5KA 2Z9UA 3W1HA 2CINA 2EPJA 3UWCA 3WY7A 2C81A 1ARIA 4XK1A 4E3QA 1G7WA 2VGSA 4E1OA 1AKCA 4IXZA 3AELA 1D7RA 5EAVA 3A9YA 1I29A 3E6GA 3HVYA 3ECDA 1EJIA 1M32A 3GETA 4JEYA 1GD9A 5FT8A 4MKKA 3LWSA 3NDNA 1AY5A 2ZY2A 2W7HA 3GSBA 4L0OA 1OXOA 1KMJA 1VP4A 2HOYA 3BCXA 3MAFB 1YJSA 1I41A 1BQDA 4Q31A 3RCHA 3K28A 2BIAA 2HUUA 1BS0A 1BW0A 2C44A 4LC3A 1LW4A 2CB1A 1C4KA 2OGAA 3R9AA 3LVMA 3HLMA 1CZCA 1M0QA 2D65A 2VMYA 1O69A 1J32A 1B9HA 2DKBA 3HQTA 1I48A 3BS8A 4WXFA 4XJMA 2FNUA 2VMUA 3MKJA 5FT5A 3AV7A 3WCOA 3NTJA 5F9SA 1J04A 3A2BA 2W8JA 1IJIA 1ASGA 1RVYA 4WP0A 2AY3A 1MDZA 1LKCA 2AEUA 2X5DA 2W8WA 1AHXA 1T3IA 2AEVA 3ASBA 2YOBA 3MAFA 1S07A 4A0RA 2CANA 4TN4A 1ASNA 3E2YA 4TV7A 3NX3A 4BA4A 5M4DA 1IAYA 2OGEA 2JGTA 4W8IA 4BA5A 3FZ8A 2FQ6A 3WKSA 3DYDA 5EUDA 3PDXA 4F5FA 3EZSA 4W91A 4MQPA 2BYJA 5EQCA 1VJOA 3HT4A 3ASAA 4IXOA 1KL1A 2VMTA 5HHYA 1CQ6A 4LNJA 1FG7A 2VGWA 2VGTA 3FQ8A 5EFSA 2X8UA 4DQ6A 4ZDOA 2E7IA 3CQ4A 1MAPA 2VMZA 3PJ0A 2W7IA 3I4JA 3VOMA 2G6WA 3H7FA 5BJ4A 5JAYA 1SPAA 2FN6A 1SZKA 3N5MA 1C0NA 1DFOA 4OMAA 4Y0IA 3HL2A 3I5TA 5G4IA 1X0MA 2JJFA 2DR1A 3FDBA 4K2IA 3B1CA 4WLJA 5M4BA 1S08A 1ASAA 2YKUA 3MBBA 3ZRRA 2VGVA 2AY6A 4Q75A 4K05A 2DKJA 2ZC0A 4E3RA 1GC3A 1JS3A 3A9XA 2R0TA 1ASEA 3FZ7A 3M5UA 2AY7A 4EU1A 3JWAA 4FFCA 2VLFA 3BC8A 2YCPA 3Q8NA 2VMVA 1VEFA 2V1PA 3W1IA 1YOOA 2D61A 5EIGB 1SZSA 1ZC9A 3II0A 3F0HA 2VMOA 1ASDA 3EI5A 2YCNA 2ZY3A 2ZY4A 3ZZJA 4IX8A 3ELEA 4U2HA 1ARTA 1CJ0A 1OATA 3N0LA 2R5EA 3TQXA 4MQQA 5M49A 5D5SA 1V72A 2C0RA 1CS1A 4GE7A 1B4XA 2VIBA 4I8AA 2CH1A 2C7TA 3WZFA 3NUBA 3ATHA 1ASFA 2BI1A 1E5EA 3EI7A 4XJPA 3VP6A 4CBSA 2ZSLA 2GB3A 1D7UA 3FQ7A 3FFRA 4MSOA 2QB3A 4W1WA 5EIGA 4P7YA 1C9CA 2CTZA 2QB2A 2YKXA 4WXBA 4DBCA 2D63A 1ASBA 4J5UA 3FVUA 3COGA 1BKGA 4R2NA 3B46A 1RVUA 3MC6A 2CJGA 4GE4A 2VMSA 3WLXA 3EIBA 4A72A 1DJUA 2EO5A 1Z3ZA 2PB2A 2JJEA 2BI2A 1G4XA 3DC1A 3TFUA 1W7NA 2DOUA 2FNIA 2YKYA 3GZCA 2W7MA 3KGXA 4ADCA 1RV3A 4LNLA 1LC8A 4RLGA 1BJOB 2WB6A 3UAKA 1QIRA 1MDXA 2VLHA 3CQ5A 2D66A 5TF5A 2R2NA 4E77A 4JF1A 4WB0B 4GEBA 1AY8A 1AICA 1KMKA 4OBVA 2HOXA 4RJ0A 4N0BA
chains in the Genus database with same CATH topology
3QBOA 4MKJA 4R5ZA 1DJ9A 3PAAA 3FCRA 2OQXA 4JF0A 1LS3A 2BI5A 1ASLA 5DJ9A 2VGUA 1AHFA 5D95A 3JW9A 2W7GA 2BWOA 2X5FA 3NUIA 4XJLA 3VK2A 1WKHA 1ELQA 2ZP7A 1FC4A 5FT6A 4PVFA 5LHAA 3P6KA 1OHYA 1BT4A 2W7JA 2GMUA 1MLYA 4OTLA 1BJOA 3LY1A 1DKAA 1OHWA 2RFVA 1ARHA 9AATA 4KAMA 1JS6A 5EUEA 3AEMC 4WB0A 1GCKA 3QN6A 4A0HA 2X3LA 4WYEA 3JWBA 4UHNA 3AENB 2HUFA 3EUCA 3NRAA 4GE9A 4DGTA 5J8QA 3ZRQA 1C7NA 3JTXA 4K2BA 4F4EA 4OCAA 4F5LA 2YCTA 3RUYA 3AEMA 1GC0A 2DGLA 1U08A 4AH3A 3NYTA 3E9KA 1ORDA 4AO9A 1TATA 2D5YA 3DR4A 1UU2A 4H51A 3BWNA 3P1TA 1JF9A 4MGRA 1TOGA 3WGCA 3RQ1A 4EMYA 2A1VA 3KGWA 2JISA 3FZ6A 3QM2A 3ACZA 4QGRA 1IBJA 4WLHA 3RI6A 4ADEA 1GBNA 2AATA 3ISLA 3BV0A 1M6SA 1AHYA 1ASMA 3AENA 2AY2A 2GQNA 2BWNA 3FKDA 2ZSMA 3N7NA 3QHXA 2YKVA 3LVLB 2E7UA 4IY7A 3HBXA 4LW2A 4MY5A 1AIAA 4UQVA 3DXVA 5G4JA 2QMAA 3E77A 4A00A 4CBRA 1QJ3A 1AHEA 3BWOA 3ELPA 4ITGA 3KE3A 1CQ8A 2JJHA 2ZYJA 1P3WA 1XEYA 3B1DA 2E54A 1V2DA 3LVKA 1C7GA 2VGZA 4Y0HA 3RBFA 3MADA 1N2TA 1TOKA 3LVJA 4A6TA 4UHMA 1W23A 5M46A 1IX8A 2Z1YA 4JEXA 1TOIA 3E2ZB 4RM1A 2CJHA 4A6RA 2D64A 2W7KA 3KKIA 4UHOA 2ZJGA 1SVVA 3ZRPA 3TFTA 2HP2A 3E2FA 4EB7A 2HORA 3JZLA 4ZASA 1N8PA 4Q6RA 2XH1A 3D6KA 2Z9WA 1S06A 4Q76A 1MGVA 1SFFA 1UKJA 3CBFA 3GBXA 2VI8A 4ADDA 1JG8A 2YRIA 3AOWA 1IX7A 4JEWA 2QSRA 1AMQA 3VAXA 2HP1A 3FFHA 1CL2A 3QI6A 4PFNA 2HUIA 4MQRA 3N4SA 2WK9A 1GDEA 1AMSA 4M2KA 1GC2A 4WXGA 4ADBA 4AO4A 3EZ1A 1QZ9A 2OATA 3L8AA 3E2ZA 1MAQA 3MEBA 2W7LA 4EB5A 5KTBA 3EI6A 3PA9A 2W8VA 4ZWMA 1FG3A 1AKBA 1UU0A 4HVKA 1ECXA 3MC6C 1GEXA 4OBUA 4J8LA 1AJSA 4GSAA 1ARSA 1V2FA 3OKSA 1AMAA 3DR7A 2CJDA 1SZUA 2TPLA 3AEOA 1M0NA 4RKDA 3FTBA 1AIBA 5I92A 3AEJC 1D7SA 4F5IA 3PDBB 3PD6A 3RBLA 4FL0A 1IAXA 1QITA 2JJGA 3N75A 3IHJA 4ZAHA 1PFFA 1LK9A 1X28A 3H9XA 4B98A 1GEYA 2Z20A 1YIZA 3USFA 1ASCA 1WYTB 3NNKA 1LW5A 2BHXA 1QISA 4TMRA 4A0GA 2OKJA 2O1BA 3AEJA 1WYUB 4LW4A 1IX6A 2W7DA 5C6UA 2BWPA 3TATA 4R8DA 2OKKA 2BYLA 1PMOA 2ORDA 1AX4A 3NYSA 2CY8A 3L44A 1KKJA 2EGYA 3LG0A 1BQAA 2VMWA 2FKIA 4RJYA 4O6ZA 3G7QA 3OP7A 2R5CB 1TPLA 3HMUA 3PDBA 2D7YA 4KYOA 1AAMA 1IUGA 2VMPA 1B5PA 3DU4A 3BB8A 4JE5A 4ZSYA 4R5FA 2VI9A 2WK7A 4W1XA 4H63Q 1Y4IA 4CVQA 3I16A 1ARGA 1WYTA 3BCBA 1O62A 3A8UX 5F8VA 3NU7A 1WYUA 2GMSA 5G0AA 2G7JA 1WKGA 2PB0A 2QA3A 3WX9A 3N4XA 4IW7A 1N31A 4RIZA 2Z67A 1YJYA 3WCNA 1ZODA 4RAEA 5HDMA 3T32A 4WYFA 5EUNA 3FDDA 4ATPA 2VMRA 2R5CA 1W3UA 1YAAA 2O0RA 4ZM4A 4A0FA 1KKPA 3BWNC 3PGYA 4OYTA 3A9ZA 4KXKA 2FM1A 2W8TA 3DXWA 4PIWA 5E4ZA 3CQ6A 2WK8A 5G2PA 5IWQA 1X29A 4F5HA 2EZ2A 1E5FA 2Z9VA 3EI8A 1AKAA 1W7MA 2W7EA 4ITXA 1XI9A 3F6TA 4OT8A 4WYDA 3K7YA 1EG5A 1CL1A 4AZKA 2Z61A 5DB5A 4F5JA 2ZUKA 2E7JA 4ATQA 2VIAA 4B9BA 4ZM3A 1BJWA 3EIAA 1B5OA 1QGNA 3F9TA 2CH2A 3MAUA 7AATA 3JU7A 2AY9A 2GSAA 4Y0DA 4ZLVA 1TOEA 3AATA 4CXQA 3IF2A 1RV4A 4BQ0A 1H1CA 1WYVB 1ZOBA 1AJRA 1O61A 4UOYA 2Z1ZA 4XQ2A 2D7ZA 5G09A 5K8BA 1GEWA 1M0OA 3FVXA 4M2MA 1G7XA 4EFFA 1DJEA 1KL2A 2BI9A 4XAUA 1M7YA 2HOZA 4ISYA 1AMRA 2VMNA 4IYOB 4M2JA 3GWPA 4W1VA 1M0PA 1AHGA 4ZDPA 1H0CA 1GC4A 5FT4A 2NMPA 4AOAA 1OXPA 2VMQA 3GR9A 2PO3A 1YNUA 3TCMA 5G2QA 4BMKA 3CAIA 3FQAA 3GJUA 2EZ1A 2YRRA 1AJSB 3FVSA 4A6UA 1PG8A 1EQBA 1B8GA 5E5IA 2W7FA 4HF8A 4WYAA 3VK4A 1WYVA 1D2FA 2YHKA 1DGEA 4ZDLA 1AAWA 1TASA 3WGBA 4ZWVA 3HDOA 3B8XA 1B9IA 3QPGA 4GDYA 3PD6B 4N0WA 3FSLA 2XBNA 1WSTA 1C7OA 1S0AA 2CFBA 3EI9A 1BJ4A 2Z9XA 1AY4A 3K40A 4P3MA 2EH6A 2WKAA 4IYOA 5E3KA 4JEZA 1MLZA 2AY1A 4IXSA 3G0TA 2VMXA 2EYQA 2QBTA 3DZZA 4NOGA 1W7LA 3DRDA 2CSTA 4JEVA 5DX5A 3PPLA 5LH9A 3DODA 5HXXA 3QGUA 1V2EA 4RKCA 3W1JA 3BCAA 2VYCA 4WYGA 3ZZKA 2QLRA 3GZDC 4CXRA 4F5KA 8AATA 4GRXA 2BIEA 1M4NA 1TOJA 3N4RA 3PIUA 2JG2A 1O4SA 4F5MA 3NYUA 1D7VA 2ZY5A 4ZSWA 3G8MA 4WBTA 2FYFA 2BI3A 2AY4A 4XEWA 1MDOA 1SF2A 3FRKA 1DTYA 1TARA 4OC9A 3FD0A 3GZDA 3UE8A 1DGDA 2V0YA 3AEPA 1CQ7A 1QJ5A 1YIYA 4K2MA 1LC5A 3LV2A 3BN1A 5EAAA 2KFPA 1X2AA 2Q7WA 3AOVA 1ELUA 1PMMA 3NU8A 5AX8A 1UU1A 4WD2A 5BJ3A 2F8JA 4JE5D 4RITA 4LNMA 1I43A 4U1TA 3B1EA 1IVRA 1OHVA 1S09A 2HZPA 1Z7DA 1LC7A 1CZEA 4PFFA 4WYCA 3RCHB 3VK3A 4BHDA 1G4VA 2DGMA 2W8UA 4F5GA 4AZJA 5DJ1A 2AY8A 3WKRA 2AY5A 2BIGA 2O7CA 3H14A 4XJOA 3R4TA 1BJNA 1YJZA 2DGKA 2BKWA 4W5KA 2Z9UA 3W1HA 2CINA 2EPJA 3UWCA 3WY7A 2C81A 1ARIA 4XK1A 4E3QA 1G7WA 2VGSA 4E1OA 1AKCA 4IXZA 3AELA 1D7RA 5EAVA 3A9YA 1I29A 3E6GA 3HVYA 3ECDA 1EJIA 1M32A 3GETA 4JEYA 1GD9A 5FT8A 4MKKA 3LWSA 3NDNA 1AY5A 2ZY2A 2W7HA 3GSBA 4L0OA 1OXOA 1KMJA 1VP4A 2HOYA 3BCXA 3MAFB 1YJSA 1I41A 1BQDA 4Q31A 3RCHA 3K28A 2BIAA 2HUUA 1BS0A 1BW0A 2C44A 4LC3A 1LW4A 2CB1A 1C4KA 2OGAA 3R9AA 3LVMA 3HLMA 1CZCA 1M0QA 2D65A 2VMYA 1O69A 1J32A 1B9HA 2DKBA 3HQTA 1I48A 3BS8A 4WXFA 4XJMA 2FNUA 2VMUA 3MKJA 5FT5A 3AV7A 3WCOA 3NTJA 5F9SA 1J04A 3A2BA 2W8JA 1IJIA 1ASGA 1RVYA 4WP0A 2AY3A 1MDZA 1LKCA 2AEUA 2X5DA 2W8WA 1AHXA 1T3IA 2AEVA 3ASBA 2YOBA 3MAFA 1S07A 4A0RA 2CANA 4TN4A 1ASNA 3E2YA 4TV7A 3NX3A 4BA4A 5M4DA 1IAYA 2OGEA 2JGTA 4W8IA 4BA5A 3FZ8A 2FQ6A 3WKSA 3DYDA 5EUDA 3PDXA 4F5FA 3EZSA 4W91A 4MQPA 2BYJA 5EQCA 1VJOA 3HT4A 3ASAA 4IXOA 1KL1A 2VMTA 5HHYA 1CQ6A 4LNJA 1FG7A 2VGWA 2VGTA 3FQ8A 5EFSA 2X8UA 4DQ6A 4ZDOA 2E7IA 3CQ4A 1MAPA 2VMZA 3PJ0A 2W7IA 3I4JA 3VOMA 2G6WA 3H7FA 5BJ4A 5JAYA 1SPAA 2FN6A 1SZKA 3N5MA 1C0NA 1DFOA 4OMAA 4Y0IA 3HL2A 3I5TA 5G4IA 1X0MA 2JJFA 2DR1A 3FDBA 4K2IA 3B1CA 4WLJA 5M4BA 1S08A 1ASAA 2YKUA 3MBBA 3ZRRA 2VGVA 2AY6A 4Q75A 4K05A 2DKJA 2ZC0A 4E3RA 1GC3A 1JS3A 3A9XA 2R0TA 1ASEA 3FZ7A 3M5UA 2AY7A 4EU1A 3JWAA 4FFCA 2VLFA 3BC8A 2YCPA 3Q8NA 2VMVA 1VEFA 2V1PA 3W1IA 1YOOA 2D61A 5EIGB 1SZSA 1ZC9A 3II0A 3F0HA 2VMOA 1ASDA 3EI5A 2YCNA 2ZY3A 2ZY4A 3ZZJA 4IX8A 3ELEA 4U2HA 1ARTA 1CJ0A 1OATA 3N0LA 2R5EA 3TQXA 4MQQA 5M49A 5D5SA 1V72A 2C0RA 1CS1A 4GE7A 1B4XA 2VIBA 4I8AA 2CH1A 2C7TA 3WZFA 3NUBA 3ATHA 1ASFA 2BI1A 1E5EA 3EI7A 4XJPA 3VP6A 4CBSA 2ZSLA 2GB3A 1D7UA 3FQ7A 3FFRA 4MSOA 2QB3A 4W1WA 5EIGA 4P7YA 1C9CA 2CTZA 2QB2A 2YKXA 4WXBA 4DBCA 2D63A 1ASBA 4J5UA 3FVUA 3COGA 1BKGA 4R2NA 3B46A 1RVUA 3MC6A 2CJGA 4GE4A 2VMSA 3WLXA 3EIBA 4A72A 1DJUA 2EO5A 1Z3ZA 2PB2A 2JJEA 2BI2A 1G4XA 3DC1A 3TFUA 1W7NA 2DOUA 2FNIA 2YKYA 3GZCA 2W7MA 3KGXA 4ADCA 1RV3A 4LNLA 1LC8A 4RLGA 1BJOB 2WB6A 3UAKA 1QIRA 1MDXA 2VLHA 3CQ5A 2D66A 5TF5A 2R2NA 4E77A 4JF1A 4WB0B 4GEBA 1AY8A 1AICA 1KMKA 4OBVA 2HOXA 4RJ0A 4N0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBO A;  4MKJ A;  4R5Z A;  1DJ9 A;  3PAA A;  3FCR A;  2OQX A;  4JF0 A;  1LS3 A;  2BI5 A;  1ASL A;  5DJ9 A;  2VGU A;  1AHF A;  5D95 A;  3JW9 A;  2W7G A;  2BWO A;  2X5F A;  3NUI A;  4XJL A;  3VK2 A;  1WKH A;  1ELQ A;  2ZP7 A;  1FC4 A;  5FT6 A;  4PVF A;  5LHA A;  3P6K A;  1OHY A;  1BT4 A;  2W7J A;  2GMU A;  1MLY A;  4OTL A;  1BJO A;  3LY1 A;  1DKA A;  1OHW A;  2RFV A;  1ARH A;  9AAT A;  4KAM A;  1JS6 A;  5EUE A;  3AEM C;  4WB0 A;  1GCK A;  3QN6 A;  4A0H A;  2X3L A;  4WYE A;  3JWB A;  4UHN A;  3AEN B;  2HUF A;  3EUC A;  3NRA A;  4GE9 A;  4DGT A;  5J8Q A;  3ZRQ A;  1C7N A;  3JTX A;  4K2B A;  4F4E A;  4OCA A;  4F5L A;  2YCT A;  3RUY A;  3AEM A;  1GC0 A;  2DGL A;  1U08 A;  4AH3 A;  3NYT A;  3E9K A;  1ORD A;  4AO9 A;  1TAT A;  2D5Y A;  3DR4 A;  1UU2 A;  4H51 A;  3BWN A;  3P1T A;  1JF9 A;  4MGR A;  1TOG A;  3WGC A;  3RQ1 A;  4EMY A;  3KGW A;  2JIS A;  3FZ6 A;  3QM2 A;  3ACZ A;  4QGR A;  1IBJ A;  4WLH A;  3RI6 A;  4ADE A;  1GBN A;  2AAT A;  3ISL A;  3BV0 A;  1M6S A;  1AHY A;  1ASM A;  3AEN A;  2AY2 A;  2GQN A;  2BWN A;  3FKD A;  2ZSM A;  3QHX A;  2YKV A;  3LVL B;  2E7U A;  4IY7 A;  3HBX A;  4LW2 A;  4MY5 A;  1AIA A;  4UQV A;  3DXV A;  5G4J A;  2QMA A;  3E77 A;  4A00 A;  4CBR A;  1QJ3 A;  1AHE A;  3BWO A;  3ELP A;  4ITG A;  3KE3 A;  1CQ8 A;  2JJH A;  2ZYJ A;  1P3W A;  1XEY A;  3B1D A;  2E54 A;  1V2D A;  3LVK A;  1C7G A;  2VGZ A;  4Y0H A;  3RBF A;  3MAD A;  1N2T A;  1TOK A;  3LVJ A;  4A6T A;  4UHM A;  1W23 A;  5M46 A;  1IX8 A;  2Z1Y A;  4JEX A;  1TOI A;  3E2Z B;  4RM1 A;  2CJH A;  4A6R A;  2D64 A;  2W7K A;  3KKI A;  4UHO A;  2ZJG A;  1SVV A;  3ZRP A;  3TFT A;  2HP2 A;  3E2F A;  4EB7 A;  2HOR A;  3JZL A;  4ZAS A;  1N8P A;  4Q6R A;  2XH1 A;  3D6K A;  2Z9W A;  1S06 A;  4Q76 A;  1MGV A;  1SFF A;  1UKJ A;  3CBF A;  3GBX A;  2VI8 A;  4ADD A;  1JG8 A;  2YRI A;  3AOW A;  1IX7 A;  4JEW A;  1AMQ A;  3VAX A;  2HP1 A;  3FFH A;  1CL2 A;  3QI6 A;  4PFN A;  2HUI A;  4MQR A;  2WK9 A;  1GDE A;  1AMS A;  4M2K A;  1GC2 A;  4WXG A;  4ADB A;  4AO4 A;  3EZ1 A;  1QZ9 A;  2OAT A;  3L8A A;  3E2Z A;  1MAQ A;  3MEB A;  2W7L A;  4EB5 A;  3EI6 A;  3PA9 A;  2W8V A;  4ZWM A;  1FG3 A;  1AKB A;  1UU0 A;  4HVK A;  1ECX A;  3MC6 C;  1GEX A;  4OBU A;  4J8L A;  1AJS A;  4GSA A;  1ARS A;  1V2F A;  3OKS A;  1AMA A;  3DR7 A;  2CJD A;  1SZU A;  2TPL A;  3AEO A;  1M0N A;  4RKD A;  3FTB A;  1AIB A;  5I92 A;  3AEJ C;  1D7S A;  4F5I A;  3PDB B;  3PD6 A;  3RBL A;  4FL0 A;  1IAX A;  1QIT A;  2JJG A;  3N75 A;  3IHJ A;  4ZAH A;  1PFF A;  1LK9 A;  1X28 A;  4B98 A;  1GEY A;  2Z20 A;  1YIZ A;  3USF A;  1ASC A;  1WYT B;  3NNK A;  1LW5 A;  2BHX A;  1QIS A;  4TMR A;  4A0G A;  2OKJ A;  2O1B A;  3AEJ A;  1WYU B;  4LW4 A;  1IX6 A;  2W7D A;  5C6U A;  2BWP A;  3TAT A;  4R8D A;  2OKK A;  2BYL A;  1PMO A;  2ORD A;  1AX4 A;  3NYS A;  2CY8 A;  3L44 A;  1KKJ A;  2EGY A;  3LG0 A;  1BQA A;  2VMW A;  4RJY A;  4O6Z A;  3G7Q A;  3OP7 A;  2R5C B;  1TPL A;  3HMU A;  3PDB A;  2D7Y A;  4KYO A;  1AAM A;  1IUG A;  2VMP A;  1B5P A;  3DU4 A;  3BB8 A;  4JE5 A;  4ZSY A;  4R5F A;  2VI9 A;  2WK7 A;  4W1X A;  1Y4I A;  4CVQ A;  3I16 A;  1ARG A;  1WYT A;  3BCB A;  1O62 A;  3A8U X;  5F8V A;  3NU7 A;  1WYU A;  2GMS A;  5G0A A;  1WKG A;  2PB0 A;  2QA3 A;  3WX9 A;  4IW7 A;  1N31 A;  4RIZ A;  2Z67 A;  1YJY A;  3WCN A;  1ZOD A;  4RAE A;  5HDM A;  3T32 A;  4WYF A;  5EUN A;  3FDD A;  4ATP A;  2VMR A;  2R5C A;  1W3U A;  1YAA A;  2O0R A;  4ZM4 A;  4A0F A;  1KKP A;  3BWN C;  3PGY A;  4OYT A;  3A9Z A;  4KXK A;  2FM1 A;  2W8T A;  3DXW A;  4PIW A;  5E4Z A;  3CQ6 A;  2WK8 A;  5G2P A;  5IWQ A;  1X29 A;  4F5H A;  2EZ2 A;  1E5F A;  2Z9V A;  3EI8 A;  1AKA A;  1W7M A;  2W7E A;  4ITX A;  1XI9 A;  3F6T A;  4OT8 A;  4WYD A;  3K7Y A;  1EG5 A;  1CL1 A;  4AZK A;  2Z61 A;  5DB5 A;  4F5J A;  2ZUK A;  2E7J A;  4ATQ A;  2VIA A;  4B9B A;  4ZM3 A;  1BJW A;  3EIA A;  1B5O A;  1QGN A;  3F9T A;  2CH2 A;  3MAU A;  7AAT A;  3JU7 A;  2AY9 A;  2GSA A;  4Y0D A;  4ZLV A;  1TOE A;  3AAT A;  4CXQ A;  3IF2 A;  1RV4 A;  4BQ0 A;  1H1C A;  1WYV B;  1ZOB A;  1AJR A;  1O61 A;  4UOY A;  2Z1Z A;  4XQ2 A;  2D7Z A;  5G09 A;  5K8B A;  1GEW A;  1M0O A;  3FVX A;  4M2M A;  1G7X A;  4EFF A;  1DJE A;  1KL2 A;  2BI9 A;  4XAU A;  1M7Y A;  2HOZ A;  4ISY A;  1AMR A;  2VMN A;  4IYO B;  4M2J A;  3GWP A;  4W1V A;  1M0P A;  1AHG A;  4ZDP A;  1H0C A;  1GC4 A;  5FT4 A;  2NMP A;  4AOA A;  1OXP A;  2VMQ A;  3GR9 A;  2PO3 A;  1YNU A;  3TCM A;  5G2Q A;  4BMK A;  3CAI A;  3FQA A;  3GJU A;  2EZ1 A;  2YRR A;  1AJS B;  3FVS A;  4A6U A;  1PG8 A;  1EQB A;  1B8G A;  5E5I A;  2W7F A;  4HF8 A;  4WYA A;  3VK4 A;  1WYV A;  1D2F A;  2YHK A;  1DGE A;  4ZDL A;  1AAW A;  1TAS A;  3WGB A;  4ZWV A;  3HDO A;  3B8X A;  1B9I A;  3QPG A;  4GDY A;  3PD6 B;  4N0W A;  3FSL A;  2XBN A;  1WST A;  1C7O A;  1S0A A;  2CFB A;  3EI9 A;  1BJ4 A;  2Z9X A;  1AY4 A;  3K40 A;  4P3M A;  2EH6 A;  2WKA A;  4IYO A;  5E3K A;  4JEZ A;  1MLZ A;  2AY1 A;  4IXS A;  3G0T A;  2VMX A;  2QBT A;  3DZZ A;  4NOG A;  1W7L A;  3DRD A;  2CST A;  4JEV A;  5DX5 A;  3PPL A;  5LH9 A;  3DOD A;  5HXX A;  3QGU A;  1V2E A;  4RKC A;  3W1J A;  3BCA A;  2VYC A;  4WYG A;  3ZZK A;  2QLR A;  3GZD C;  4CXR A;  4F5K A;  8AAT A;  4GRX A;  2BIE A;  1M4N A;  1TOJ A;  3PIU A;  2JG2 A;  1O4S A;  4F5M A;  3NYU A;  1D7V A;  2ZY5 A;  4ZSW A;  3G8M A;  4WBT A;  2FYF A;  2BI3 A;  2AY4 A;  4XEW A;  1MDO A;  1SF2 A;  3FRK A;  1DTY A;  1TAR A;  4OC9 A;  3FD0 A;  3GZD A;  3UE8 A;  1DGD A;  2V0Y A;  3AEP A;  1CQ7 A;  1QJ5 A;  1YIY A;  4K2M A;  1LC5 A;  3LV2 A;  3BN1 A;  5EAA A;  1X2A A;  2Q7W A;  3AOV A;  1ELU A;  1PMM A;  3NU8 A;  5AX8 A;  1UU1 A;  4WD2 A;  5BJ3 A;  2F8J A;  4JE5 D;  4RIT A;  4LNM A;  1I43 A;  4U1T A;  3B1E A;  1IVR A;  1OHV A;  1S09 A;  2HZP A;  1Z7D A;  1LC7 A;  1CZE A;  4PFF A;  4WYC A;  3RCH B;  3VK3 A;  4BHD A;  1G4V A;  2DGM A;  2W8U A;  4F5G A;  4AZJ A;  5DJ1 A;  2AY8 A;  3WKR A;  2AY5 A;  2BIG A;  2O7C A;  3H14 A;  4XJO A;  3R4T A;  1BJN A;  1YJZ A;  2DGK A;  2BKW A;  4W5K A;  2Z9U A;  3W1H A;  2CIN A;  2EPJ A;  3UWC A;  3WY7 A;  2C81 A;  1ARI A;  4XK1 A;  4E3Q A;  1G7W A;  2VGS A;  4E1O A;  1AKC A;  4IXZ A;  3AEL A;  1D7R A;  5EAV A;  3A9Y A;  1I29 A;  3E6G A;  3HVY A;  3ECD A;  1EJI A;  1M32 A;  3GET A;  4JEY A;  1GD9 A;  5FT8 A;  4MKK A;  3LWS A;  3NDN A;  1AY5 A;  2ZY2 A;  2W7H A;  3GSB A;  4L0O A;  1OXO A;  1KMJ A;  1VP4 A;  2HOY A;  3BCX A;  3MAF B;  1YJS A;  1I41 A;  1BQD A;  4Q31 A;  3RCH A;  3K28 A;  2BIA A;  2HUU A;  1BS0 A;  1BW0 A;  2C44 A;  4LC3 A;  1LW4 A;  2CB1 A;  1C4K A;  2OGA A;  3R9A A;  3LVM A;  3HLM A;  1CZC A;  1M0Q A;  2D65 A;  2VMY A;  1O69 A;  1J32 A;  1B9H A;  2DKB A;  3HQT A;  1I48 A;  3BS8 A;  4WXF A;  4XJM A;  2FNU A;  2VMU A;  3MKJ A;  5FT5 A;  3AV7 A;  3WCO A;  3NTJ A;  5F9S A;  1J04 A;  3A2B A;  2W8J A;  1IJI A;  1ASG A;  1RVY A;  4WP0 A;  2AY3 A;  1MDZ A;  1LKC A;  2AEU A;  2X5D A;  2W8W A;  1AHX A;  1T3I A;  2AEV A;  3ASB A;  2YOB A;  3MAF A;  1S07 A;  4A0R A;  2CAN A;  4TN4 A;  1ASN A;  3E2Y A;  4TV7 A;  3NX3 A;  4BA4 A;  5M4D A;  1IAY A;  2OGE A;  2JGT A;  4W8I A;  4BA5 A;  3FZ8 A;  2FQ6 A;  3WKS A;  3DYD A;  5EUD A;  3PDX A;  4F5F A;  3EZS A;  4W91 A;  4MQP A;  2BYJ A;  5EQC A;  1VJO A;  3HT4 A;  3ASA A;  4IXO A;  1KL1 A;  2VMT A;  5HHY A;  1CQ6 A;  4LNJ A;  1FG7 A;  2VGW A;  2VGT A;  3FQ8 A;  5EFS A;  2X8U A;  4DQ6 A;  4ZDO A;  2E7I A;  3CQ4 A;  1MAP A;  2VMZ A;  3PJ0 A;  2W7I A;  3I4J A;  3VOM A;  2G6W A;  3H7F A;  5BJ4 A;  5JAY A;  1SPA A;  2FN6 A;  1SZK A;  3N5M A;  1C0N A;  1DFO A;  4OMA A;  4Y0I A;  3HL2 A;  3I5T A;  5G4I A;  1X0M A;  2JJF A;  2DR1 A;  3FDB A;  4K2I A;  3B1C A;  4WLJ A;  5M4B A;  1S08 A;  1ASA A;  2YKU A;  3MBB A;  3ZRR A;  2VGV A;  2AY6 A;  4Q75 A;  2DKJ A;  2ZC0 A;  4E3R A;  1GC3 A;  1JS3 A;  3A9X A;  2R0T A;  1ASE A;  3FZ7 A;  3M5U A;  2AY7 A;  4EU1 A;  3JWA A;  4FFC A;  2VLF A;  3BC8 A;  2YCP A;  3Q8N A;  2VMV A;  1VEF A;  2V1P A;  3W1I A;  1YOO A;  2D61 A;  5EIG B;  1SZS A;  1ZC9 A;  3II0 A;  3F0H A;  2VMO A;  1ASD A;  3EI5 A;  2YCN A;  2ZY3 A;  2ZY4 A;  3ZZJ A;  4IX8 A;  3ELE A;  4U2H A;  1ART A;  1CJ0 A;  1OAT A;  3N0L A;  2R5E A;  3TQX A;  4MQQ A;  5M49 A;  5D5S A;  1V72 A;  2C0R A;  1CS1 A;  4GE7 A;  1B4X A;  2VIB A;  4I8A A;  2CH1 A;  2C7T A;  3WZF A;  3NUB A;  3ATH A;  1ASF A;  2BI1 A;  1E5E A;  3EI7 A;  4XJP A;  3VP6 A;  4CBS A;  2ZSL A;  2GB3 A;  1D7U A;  3FQ7 A;  3FFR A;  4MSO A;  2QB3 A;  4W1W A;  5EIG A;  4P7Y A;  1C9C A;  2CTZ A;  2QB2 A;  2YKX A;  4WXB A;  4DBC A;  2D63 A;  1ASB A;  4J5U A;  3FVU A;  3COG A;  1BKG A;  4R2N A;  3B46 A;  1RVU A;  3MC6 A;  2CJG A;  4GE4 A;  2VMS A;  3WLX A;  3EIB A;  4A72 A;  1DJU A;  2EO5 A;  1Z3Z A;  2PB2 A;  2JJE A;  2BI2 A;  1G4X A;  3DC1 A;  3TFU A;  1W7N A;  2DOU A;  2FNI A;  2YKY A;  3GZC A;  2W7M A;  3KGX A;  4ADC A;  1RV3 A;  4LNL A;  1LC8 A;  4RLG A;  1BJO B;  3UAK A;  1QIR A;  1MDX A;  2VLH A;  3CQ5 A;  2D66 A;  5TF5 A;  2R2N A;  4E77 A;  4JF1 A;  4WB0 B;  4GEB A;  1AY8 A;  1AIC A;  1KMK A;  4OBV A;  2HOX A;  4RJ0 A;  4N0B A; 
#chains in the Genus database with same CATH topology
 3QBO A;  4MKJ A;  4R5Z A;  1DJ9 A;  3PAA A;  3FCR A;  2OQX A;  4JF0 A;  1LS3 A;  2BI5 A;  1ASL A;  5DJ9 A;  2VGU A;  1AHF A;  5D95 A;  3JW9 A;  2W7G A;  2BWO A;  2X5F A;  3NUI A;  4XJL A;  3VK2 A;  1WKH A;  1ELQ A;  2ZP7 A;  1FC4 A;  5FT6 A;  4PVF A;  5LHA A;  3P6K A;  1OHY A;  1BT4 A;  2W7J A;  2GMU A;  1MLY A;  4OTL A;  1BJO A;  3LY1 A;  1KAF A;  1DKA A;  1OHW A;  2RFV A;  1ARH A;  9AAT A;  4KAM A;  1JS6 A;  5EUE A;  3AEM C;  4WB0 A;  1GCK A;  3QN6 A;  4A0H A;  2X3L A;  4WYE A;  3JWB A;  4UHN A;  3AEN B;  2HUF A;  3EUC A;  3NRA A;  4GE9 A;  4DGT A;  5J8Q A;  3ZRQ A;  1C7N A;  3JTX A;  4K2B A;  4F4E A;  4OCA A;  4F5L A;  2YCT A;  3RUY A;  3AEM A;  1GC0 A;  2DGL A;  1U08 A;  4AH3 A;  3NYT A;  3E9K A;  1ORD A;  4AO9 A;  1TAT A;  2D5Y A;  3DR4 A;  1UU2 A;  4H51 A;  3BWN A;  3P1T A;  1JF9 A;  4MGR A;  1TOG A;  3WGC A;  3RQ1 A;  4EMY A;  2A1V A;  3KGW A;  2JIS A;  3FZ6 A;  3QM2 A;  3ACZ A;  4QGR A;  1IBJ A;  4WLH A;  3RI6 A;  4ADE A;  1GBN A;  2AAT A;  3ISL A;  3BV0 A;  1M6S A;  1AHY A;  1ASM A;  3AEN A;  2AY2 A;  2GQN A;  2BWN A;  3FKD A;  2ZSM A;  3N7N A;  3QHX A;  2YKV A;  3LVL B;  2E7U A;  4IY7 A;  3HBX A;  4LW2 A;  4MY5 A;  1AIA A;  4UQV A;  3DXV A;  5G4J A;  2QMA A;  3E77 A;  4A00 A;  4CBR A;  1QJ3 A;  1AHE A;  3BWO A;  3ELP A;  4ITG A;  3KE3 A;  1CQ8 A;  2JJH A;  2ZYJ A;  1P3W A;  1XEY A;  3B1D A;  2E54 A;  1V2D A;  3LVK A;  1C7G A;  2VGZ A;  4Y0H A;  3RBF A;  3MAD A;  1N2T A;  1TOK A;  3LVJ A;  4A6T A;  4UHM A;  1W23 A;  5M46 A;  1IX8 A;  2Z1Y A;  4JEX A;  1TOI A;  3E2Z B;  4RM1 A;  2CJH A;  4A6R A;  2D64 A;  2W7K A;  3KKI A;  4UHO A;  2ZJG A;  1SVV A;  3ZRP A;  3TFT A;  2HP2 A;  3E2F A;  4EB7 A;  2HOR A;  3JZL A;  4ZAS A;  1N8P A;  4Q6R A;  2XH1 A;  3D6K A;  2Z9W A;  1S06 A;  4Q76 A;  1MGV A;  1SFF A;  1UKJ A;  3CBF A;  3GBX A;  2VI8 A;  4ADD A;  1JG8 A;  2YRI A;  3AOW A;  1IX7 A;  4JEW A;  2QSR A;  1AMQ A;  3VAX A;  2HP1 A;  3FFH A;  1CL2 A;  3QI6 A;  4PFN A;  2HUI A;  4MQR A;  3N4S A;  2WK9 A;  1GDE A;  1AMS A;  4M2K A;  1GC2 A;  4WXG A;  4ADB A;  4AO4 A;  3EZ1 A;  1QZ9 A;  2OAT A;  3L8A A;  3E2Z A;  1MAQ A;  3MEB A;  2W7L A;  4EB5 A;  5KTB A;  3EI6 A;  3PA9 A;  2W8V A;  4ZWM A;  1FG3 A;  1AKB A;  1UU0 A;  4HVK A;  1ECX A;  3MC6 C;  1GEX A;  4OBU A;  4J8L A;  1AJS A;  4GSA A;  1ARS A;  1V2F A;  3OKS A;  1AMA A;  3DR7 A;  2CJD A;  1SZU A;  2TPL A;  3AEO A;  1M0N A;  4RKD A;  3FTB A;  1AIB A;  5I92 A;  3AEJ C;  1D7S A;  4F5I A;  3PDB B;  3PD6 A;  3RBL A;  4FL0 A;  1IAX A;  1QIT A;  2JJG A;  3N75 A;  3IHJ A;  4ZAH A;  1PFF A;  1LK9 A;  1X28 A;  3H9X A;  4B98 A;  1GEY A;  2Z20 A;  1YIZ A;  3USF A;  1ASC A;  1WYT B;  3NNK A;  1LW5 A;  2BHX A;  1QIS A;  4TMR A;  4A0G A;  2OKJ A;  2O1B A;  3AEJ A;  1WYU B;  4LW4 A;  1IX6 A;  2W7D A;  5C6U A;  2BWP A;  3TAT A;  4R8D A;  2OKK A;  2BYL A;  1PMO A;  2ORD A;  1AX4 A;  3NYS A;  2CY8 A;  3L44 A;  1KKJ A;  2EGY A;  3LG0 A;  1BQA A;  2VMW A;  2FKI A;  4RJY A;  4O6Z A;  3G7Q A;  3OP7 A;  2R5C B;  1TPL A;  3HMU A;  3PDB A;  2D7Y A;  4KYO A;  1AAM A;  1IUG A;  2VMP A;  1B5P A;  3DU4 A;  3BB8 A;  4JE5 A;  4ZSY A;  4R5F A;  2VI9 A;  2WK7 A;  4W1X A;  4H63 Q;  1Y4I A;  4CVQ A;  3I16 A;  1ARG A;  1WYT A;  3BCB A;  1O62 A;  3A8U X;  5F8V A;  3NU7 A;  1WYU A;  2GMS A;  5G0A A;  2G7J A;  1WKG A;  2PB0 A;  2QA3 A;  3WX9 A;  3N4X A;  4IW7 A;  1N31 A;  4RIZ A;  2Z67 A;  1YJY A;  3WCN A;  1ZOD A;  4RAE A;  5HDM A;  3T32 A;  4WYF A;  5EUN A;  3FDD A;  4ATP A;  2VMR A;  2R5C A;  1W3U A;  1YAA A;  2O0R A;  4ZM4 A;  4A0F A;  1KKP A;  3BWN C;  3PGY A;  4OYT A;  3A9Z A;  4KXK A;  2FM1 A;  2W8T A;  3DXW A;  4PIW A;  5E4Z A;  3CQ6 A;  2WK8 A;  5G2P A;  5IWQ A;  1X29 A;  4F5H A;  2EZ2 A;  1E5F A;  2Z9V A;  3EI8 A;  1AKA A;  1W7M A;  2W7E A;  4ITX A;  1XI9 A;  3F6T A;  4OT8 A;  4WYD A;  3K7Y A;  1EG5 A;  1CL1 A;  4AZK A;  2Z61 A;  5DB5 A;  4F5J A;  2ZUK A;  2E7J A;  4ATQ A;  2VIA A;  4B9B A;  4ZM3 A;  1BJW A;  3EIA A;  1B5O A;  1QGN A;  3F9T A;  2CH2 A;  3MAU A;  7AAT A;  3JU7 A;  2AY9 A;  2GSA A;  4Y0D A;  4ZLV A;  1TOE A;  3AAT A;  4CXQ A;  3IF2 A;  1RV4 A;  4BQ0 A;  1H1C A;  1WYV B;  1ZOB A;  1AJR A;  1O61 A;  4UOY A;  2Z1Z A;  4XQ2 A;  2D7Z A;  5G09 A;  5K8B A;  1GEW A;  1M0O A;  3FVX A;  4M2M A;  1G7X A;  4EFF A;  1DJE A;  1KL2 A;  2BI9 A;  4XAU A;  1M7Y A;  2HOZ A;  4ISY A;  1AMR A;  2VMN A;  4IYO B;  4M2J A;  3GWP A;  4W1V A;  1M0P A;  1AHG A;  4ZDP A;  1H0C A;  1GC4 A;  5FT4 A;  2NMP A;  4AOA A;  1OXP A;  2VMQ A;  3GR9 A;  2PO3 A;  1YNU A;  3TCM A;  5G2Q A;  4BMK A;  3CAI A;  3FQA A;  3GJU A;  2EZ1 A;  2YRR A;  1AJS B;  3FVS A;  4A6U A;  1PG8 A;  1EQB A;  1B8G A;  5E5I A;  2W7F A;  4HF8 A;  4WYA A;  3VK4 A;  1WYV A;  1D2F A;  2YHK A;  1DGE A;  4ZDL A;  1AAW A;  1TAS A;  3WGB A;  4ZWV A;  3HDO A;  3B8X A;  1B9I A;  3QPG A;  4GDY A;  3PD6 B;  4N0W A;  3FSL A;  2XBN A;  1WST A;  1C7O A;  1S0A A;  2CFB A;  3EI9 A;  1BJ4 A;  2Z9X A;  1AY4 A;  3K40 A;  4P3M A;  2EH6 A;  2WKA A;  4IYO A;  5E3K A;  4JEZ A;  1MLZ A;  2AY1 A;  4IXS A;  3G0T A;  2VMX A;  2EYQ A;  2QBT A;  3DZZ A;  4NOG A;  1W7L A;  3DRD A;  2CST A;  4JEV A;  5DX5 A;  3PPL A;  5LH9 A;  3DOD A;  5HXX A;  3QGU A;  1V2E A;  4RKC A;  3W1J A;  3BCA A;  2VYC A;  4WYG A;  3ZZK A;  2QLR A;  3GZD C;  4CXR A;  4F5K A;  8AAT A;  4GRX A;  2BIE A;  1M4N A;  1TOJ A;  3N4R A;  3PIU A;  2JG2 A;  1O4S A;  4F5M A;  3NYU A;  1D7V A;  2ZY5 A;  4ZSW A;  3G8M A;  4WBT A;  2FYF A;  2BI3 A;  2AY4 A;  4XEW A;  1MDO A;  1SF2 A;  3FRK A;  1DTY A;  1TAR A;  4OC9 A;  3FD0 A;  3GZD A;  3UE8 A;  1DGD A;  2V0Y A;  3AEP A;  1CQ7 A;  1QJ5 A;  1YIY A;  4K2M A;  1LC5 A;  3LV2 A;  3BN1 A;  5EAA A;  2KFP A;  1X2A A;  2Q7W A;  3AOV A;  1ELU A;  1PMM A;  3NU8 A;  5AX8 A;  1UU1 A;  4WD2 A;  5BJ3 A;  2F8J A;  4JE5 D;  4RIT A;  4LNM A;  1I43 A;  4U1T A;  3B1E A;  1IVR A;  1OHV A;  1S09 A;  2HZP A;  1Z7D A;  1LC7 A;  1CZE A;  4PFF A;  4WYC A;  3RCH B;  3VK3 A;  4BHD A;  1G4V A;  2DGM A;  2W8U A;  4F5G A;  4AZJ A;  5DJ1 A;  2AY8 A;  3WKR A;  2AY5 A;  2BIG A;  2O7C A;  3H14 A;  4XJO A;  3R4T A;  1BJN A;  1YJZ A;  2DGK A;  2BKW A;  4W5K A;  2Z9U A;  3W1H A;  2CIN A;  2EPJ A;  3UWC A;  3WY7 A;  2C81 A;  1ARI A;  4XK1 A;  4E3Q A;  1G7W A;  2VGS A;  4E1O A;  1AKC A;  4IXZ A;  3AEL A;  1D7R A;  5EAV A;  3A9Y A;  1I29 A;  3E6G A;  3HVY A;  3ECD A;  1EJI A;  1M32 A;  3GET A;  4JEY A;  1GD9 A;  5FT8 A;  4MKK A;  3LWS A;  3NDN A;  1AY5 A;  2ZY2 A;  2W7H A;  3GSB A;  4L0O A;  1OXO A;  1KMJ A;  1VP4 A;  2HOY A;  3BCX A;  3MAF B;  1YJS A;  1I41 A;  1BQD A;  4Q31 A;  3RCH A;  3K28 A;  2BIA A;  2HUU A;  1BS0 A;  1BW0 A;  2C44 A;  4LC3 A;  1LW4 A;  2CB1 A;  1C4K A;  2OGA A;  3R9A A;  3LVM A;  3HLM A;  1CZC A;  1M0Q A;  2D65 A;  2VMY A;  1O69 A;  1J32 A;  1B9H A;  2DKB A;  3HQT A;  1I48 A;  3BS8 A;  4WXF A;  4XJM A;  2FNU A;  2VMU A;  3MKJ A;  5FT5 A;  3AV7 A;  3WCO A;  3NTJ A;  5F9S A;  1J04 A;  3A2B A;  2W8J A;  1IJI A;  1ASG A;  1RVY A;  4WP0 A;  2AY3 A;  1MDZ A;  1LKC A;  2AEU A;  2X5D A;  2W8W A;  1AHX A;  1T3I A;  2AEV A;  3ASB A;  2YOB A;  3MAF A;  1S07 A;  4A0R A;  2CAN A;  4TN4 A;  1ASN A;  3E2Y A;  4TV7 A;  3NX3 A;  4BA4 A;  5M4D A;  1IAY A;  2OGE A;  2JGT A;  4W8I A;  4BA5 A;  3FZ8 A;  2FQ6 A;  3WKS A;  3DYD A;  5EUD A;  3PDX A;  4F5F A;  3EZS A;  4W91 A;  4MQP A;  2BYJ A;  5EQC A;  1VJO A;  3HT4 A;  3ASA A;  4IXO A;  1KL1 A;  2VMT A;  5HHY A;  1CQ6 A;  4LNJ A;  1FG7 A;  2VGW A;  2VGT A;  3FQ8 A;  5EFS A;  2X8U A;  4DQ6 A;  4ZDO A;  2E7I A;  3CQ4 A;  1MAP A;  2VMZ A;  3PJ0 A;  2W7I A;  3I4J A;  3VOM A;  2G6W A;  3H7F A;  5BJ4 A;  5JAY A;  1SPA A;  2FN6 A;  1SZK A;  3N5M A;  1C0N A;  1DFO A;  4OMA A;  4Y0I A;  3HL2 A;  3I5T A;  5G4I A;  1X0M A;  2JJF A;  2DR1 A;  3FDB A;  4K2I A;  3B1C A;  4WLJ A;  5M4B A;  1S08 A;  1ASA A;  2YKU A;  3MBB A;  3ZRR A;  2VGV A;  2AY6 A;  4Q75 A;  4K05 A;  2DKJ A;  2ZC0 A;  4E3R A;  1GC3 A;  1JS3 A;  3A9X A;  2R0T A;  1ASE A;  3FZ7 A;  3M5U A;  2AY7 A;  4EU1 A;  3JWA A;  4FFC A;  2VLF A;  3BC8 A;  2YCP A;  3Q8N A;  2VMV A;  1VEF A;  2V1P A;  3W1I A;  1YOO A;  2D61 A;  5EIG B;  1SZS A;  1ZC9 A;  3II0 A;  3F0H A;  2VMO A;  1ASD A;  3EI5 A;  2YCN A;  2ZY3 A;  2ZY4 A;  3ZZJ A;  4IX8 A;  3ELE A;  4U2H A;  1ART A;  1CJ0 A;  1OAT A;  3N0L A;  2R5E A;  3TQX A;  4MQQ A;  5M49 A;  5D5S A;  1V72 A;  2C0R A;  1CS1 A;  4GE7 A;  1B4X A;  2VIB A;  4I8A A;  2CH1 A;  2C7T A;  3WZF A;  3NUB A;  3ATH A;  1ASF A;  2BI1 A;  1E5E A;  3EI7 A;  4XJP A;  3VP6 A;  4CBS A;  2ZSL A;  2GB3 A;  1D7U A;  3FQ7 A;  3FFR A;  4MSO A;  2QB3 A;  4W1W A;  5EIG A;  4P7Y A;  1C9C A;  2CTZ A;  2QB2 A;  2YKX A;  4WXB A;  4DBC A;  2D63 A;  1ASB A;  4J5U A;  3FVU A;  3COG A;  1BKG A;  4R2N A;  3B46 A;  1RVU A;  3MC6 A;  2CJG A;  4GE4 A;  2VMS A;  3WLX A;  3EIB A;  4A72 A;  1DJU A;  2EO5 A;  1Z3Z A;  2PB2 A;  2JJE A;  2BI2 A;  1G4X A;  3DC1 A;  3TFU A;  1W7N A;  2DOU A;  2FNI A;  2YKY A;  3GZC A;  2W7M A;  3KGX A;  4ADC A;  1RV3 A;  4LNL A;  1LC8 A;  4RLG A;  1BJO B;  2WB6 A;  3UAK A;  1QIR A;  1MDX A;  2VLH A;  3CQ5 A;  2D66 A;  5TF5 A;  2R2N A;  4E77 A;  4JF1 A;  4WB0 B;  4GEB A;  1AY8 A;  1AIC A;  1KMK A;  4OBV A;  2HOX A;  4RJ0 A;  4N0B A; 
#chains in the Genus database with same CATH homology
 3QBO A;  4MKJ A;  4R5Z A;  1DJ9 A;  3PAA A;  3FCR A;  2OQX A;  4JF0 A;  1LS3 A;  2BI5 A;  1ASL A;  5DJ9 A;  2VGU A;  1AHF A;  5D95 A;  3JW9 A;  2W7G A;  2BWO A;  2X5F A;  3NUI A;  4XJL A;  3VK2 A;  1WKH A;  1ELQ A;  2ZP7 A;  1FC4 A;  5FT6 A;  4PVF A;  5LHA A;  3P6K A;  1OHY A;  1BT4 A;  2W7J A;  2GMU A;  1MLY A;  4OTL A;  1BJO A;  3LY1 A;  1DKA A;  1OHW A;  2RFV A;  1ARH A;  9AAT A;  4KAM A;  1JS6 A;  5EUE A;  3AEM C;  4WB0 A;  1GCK A;  3QN6 A;  4A0H A;  2X3L A;  4WYE A;  3JWB A;  4UHN A;  3AEN B;  2HUF A;  3EUC A;  3NRA A;  4GE9 A;  4DGT A;  5J8Q A;  3ZRQ A;  1C7N A;  3JTX A;  4K2B A;  4F4E A;  4OCA A;  4F5L A;  2YCT A;  3RUY A;  3AEM A;  1GC0 A;  2DGL A;  1U08 A;  4AH3 A;  3NYT A;  3E9K A;  1ORD A;  4AO9 A;  1TAT A;  2D5Y A;  3DR4 A;  1UU2 A;  4H51 A;  3BWN A;  3P1T A;  1JF9 A;  4MGR A;  1TOG A;  3WGC A;  3RQ1 A;  4EMY A;  2A1V A;  3KGW A;  2JIS A;  3FZ6 A;  3QM2 A;  3ACZ A;  4QGR A;  1IBJ A;  4WLH A;  3RI6 A;  4ADE A;  1GBN A;  2AAT A;  3ISL A;  3BV0 A;  1M6S A;  1AHY A;  1ASM A;  3AEN A;  2AY2 A;  2GQN A;  2BWN A;  3FKD A;  2ZSM A;  3N7N A;  3QHX A;  2YKV A;  3LVL B;  2E7U A;  4IY7 A;  3HBX A;  4LW2 A;  4MY5 A;  1AIA A;  4UQV A;  3DXV A;  5G4J A;  2QMA A;  3E77 A;  4A00 A;  4CBR A;  1QJ3 A;  1AHE A;  3BWO A;  3ELP A;  4ITG A;  3KE3 A;  1CQ8 A;  2JJH A;  2ZYJ A;  1P3W A;  1XEY A;  3B1D A;  2E54 A;  1V2D A;  3LVK A;  1C7G A;  2VGZ A;  4Y0H A;  3RBF A;  3MAD A;  1N2T A;  1TOK A;  3LVJ A;  4A6T A;  4UHM A;  1W23 A;  5M46 A;  1IX8 A;  2Z1Y A;  4JEX A;  1TOI A;  3E2Z B;  4RM1 A;  2CJH A;  4A6R A;  2D64 A;  2W7K A;  3KKI A;  4UHO A;  2ZJG A;  1SVV A;  3ZRP A;  3TFT A;  2HP2 A;  3E2F A;  4EB7 A;  2HOR A;  3JZL A;  4ZAS A;  1N8P A;  4Q6R A;  2XH1 A;  3D6K A;  2Z9W A;  1S06 A;  4Q76 A;  1MGV A;  1SFF A;  1UKJ A;  3CBF A;  3GBX A;  2VI8 A;  4ADD A;  1JG8 A;  2YRI A;  3AOW A;  1IX7 A;  4JEW A;  2QSR A;  1AMQ A;  3VAX A;  2HP1 A;  3FFH A;  1CL2 A;  3QI6 A;  4PFN A;  2HUI A;  4MQR A;  3N4S A;  2WK9 A;  1GDE A;  1AMS A;  4M2K A;  1GC2 A;  4WXG A;  4ADB A;  4AO4 A;  3EZ1 A;  1QZ9 A;  2OAT A;  3L8A A;  3E2Z A;  1MAQ A;  3MEB A;  2W7L A;  4EB5 A;  5KTB A;  3EI6 A;  3PA9 A;  2W8V A;  4ZWM A;  1FG3 A;  1AKB A;  1UU0 A;  4HVK A;  1ECX A;  3MC6 C;  1GEX A;  4OBU A;  4J8L A;  1AJS A;  4GSA A;  1ARS A;  1V2F A;  3OKS A;  1AMA A;  3DR7 A;  2CJD A;  1SZU A;  2TPL A;  3AEO A;  1M0N A;  4RKD A;  3FTB A;  1AIB A;  5I92 A;  3AEJ C;  1D7S A;  4F5I A;  3PDB B;  3PD6 A;  3RBL A;  4FL0 A;  1IAX A;  1QIT A;  2JJG A;  3N75 A;  3IHJ A;  4ZAH A;  1PFF A;  1LK9 A;  1X28 A;  3H9X A;  4B98 A;  1GEY A;  2Z20 A;  1YIZ A;  3USF A;  1ASC A;  1WYT B;  3NNK A;  1LW5 A;  2BHX A;  1QIS A;  4TMR A;  4A0G A;  2OKJ A;  2O1B A;  3AEJ A;  1WYU B;  4LW4 A;  1IX6 A;  2W7D A;  5C6U A;  2BWP A;  3TAT A;  4R8D A;  2OKK A;  2BYL A;  1PMO A;  2ORD A;  1AX4 A;  3NYS A;  2CY8 A;  3L44 A;  1KKJ A;  2EGY A;  3LG0 A;  1BQA A;  2VMW A;  2FKI A;  4RJY A;  4O6Z A;  3G7Q A;  3OP7 A;  2R5C B;  1TPL A;  3HMU A;  3PDB A;  2D7Y A;  4KYO A;  1AAM A;  1IUG A;  2VMP A;  1B5P A;  3DU4 A;  3BB8 A;  4JE5 A;  4ZSY A;  4R5F A;  2VI9 A;  2WK7 A;  4W1X A;  4H63 Q;  1Y4I A;  4CVQ A;  3I16 A;  1ARG A;  1WYT A;  3BCB A;  1O62 A;  3A8U X;  5F8V A;  3NU7 A;  1WYU A;  2GMS A;  5G0A A;  2G7J A;  1WKG A;  2PB0 A;  2QA3 A;  3WX9 A;  3N4X A;  4IW7 A;  1N31 A;  4RIZ A;  2Z67 A;  1YJY A;  3WCN A;  1ZOD A;  4RAE A;  5HDM A;  3T32 A;  4WYF A;  5EUN A;  3FDD A;  4ATP A;  2VMR A;  2R5C A;  1W3U A;  1YAA A;  2O0R A;  4ZM4 A;  4A0F A;  1KKP A;  3BWN C;  3PGY A;  4OYT A;  3A9Z A;  4KXK A;  2FM1 A;  2W8T A;  3DXW A;  4PIW A;  5E4Z A;  3CQ6 A;  2WK8 A;  5G2P A;  5IWQ A;  1X29 A;  4F5H A;  2EZ2 A;  1E5F A;  2Z9V A;  3EI8 A;  1AKA A;  1W7M A;  2W7E A;  4ITX A;  1XI9 A;  3F6T A;  4OT8 A;  4WYD A;  3K7Y A;  1EG5 A;  1CL1 A;  4AZK A;  2Z61 A;  5DB5 A;  4F5J A;  2ZUK A;  2E7J A;  4ATQ A;  2VIA A;  4B9B A;  4ZM3 A;  1BJW A;  3EIA A;  1B5O A;  1QGN A;  3F9T A;  2CH2 A;  3MAU A;  7AAT A;  3JU7 A;  2AY9 A;  2GSA A;  4Y0D A;  4ZLV A;  1TOE A;  3AAT A;  4CXQ A;  3IF2 A;  1RV4 A;  4BQ0 A;  1H1C A;  1WYV B;  1ZOB A;  1AJR A;  1O61 A;  4UOY A;  2Z1Z A;  4XQ2 A;  2D7Z A;  5G09 A;  5K8B A;  1GEW A;  1M0O A;  3FVX A;  4M2M A;  1G7X A;  4EFF A;  1DJE A;  1KL2 A;  2BI9 A;  4XAU A;  1M7Y A;  2HOZ A;  4ISY A;  1AMR A;  2VMN A;  4IYO B;  4M2J A;  3GWP A;  4W1V A;  1M0P A;  1AHG A;  4ZDP A;  1H0C A;  1GC4 A;  5FT4 A;  2NMP A;  4AOA A;  1OXP A;  2VMQ A;  3GR9 A;  2PO3 A;  1YNU A;  3TCM A;  5G2Q A;  4BMK A;  3CAI A;  3FQA A;  3GJU A;  2EZ1 A;  2YRR A;  1AJS B;  3FVS A;  4A6U A;  1PG8 A;  1EQB A;  1B8G A;  5E5I A;  2W7F A;  4HF8 A;  4WYA A;  3VK4 A;  1WYV A;  1D2F A;  2YHK A;  1DGE A;  4ZDL A;  1AAW A;  1TAS A;  3WGB A;  4ZWV A;  3HDO A;  3B8X A;  1B9I A;  3QPG A;  4GDY A;  3PD6 B;  4N0W A;  3FSL A;  2XBN A;  1WST A;  1C7O A;  1S0A A;  2CFB A;  3EI9 A;  1BJ4 A;  2Z9X A;  1AY4 A;  3K40 A;  4P3M A;  2EH6 A;  2WKA A;  4IYO A;  5E3K A;  4JEZ A;  1MLZ A;  2AY1 A;  4IXS A;  3G0T A;  2VMX A;  2EYQ A;  2QBT A;  3DZZ A;  4NOG A;  1W7L A;  3DRD A;  2CST A;  4JEV A;  5DX5 A;  3PPL A;  5LH9 A;  3DOD A;  5HXX A;  3QGU A;  1V2E A;  4RKC A;  3W1J A;  3BCA A;  2VYC A;  4WYG A;  3ZZK A;  2QLR A;  3GZD C;  4CXR A;  4F5K A;  8AAT A;  4GRX A;  2BIE A;  1M4N A;  1TOJ A;  3N4R A;  3PIU A;  2JG2 A;  1O4S A;  4F5M A;  3NYU A;  1D7V A;  2ZY5 A;  4ZSW A;  3G8M A;  4WBT A;  2FYF A;  2BI3 A;  2AY4 A;  4XEW A;  1MDO A;  1SF2 A;  3FRK A;  1DTY A;  1TAR A;  4OC9 A;  3FD0 A;  3GZD A;  3UE8 A;  1DGD A;  2V0Y A;  3AEP A;  1CQ7 A;  1QJ5 A;  1YIY A;  4K2M A;  1LC5 A;  3LV2 A;  3BN1 A;  5EAA A;  2KFP A;  1X2A A;  2Q7W A;  3AOV A;  1ELU A;  1PMM A;  3NU8 A;  5AX8 A;  1UU1 A;  4WD2 A;  5BJ3 A;  2F8J A;  4JE5 D;  4RIT A;  4LNM A;  1I43 A;  4U1T A;  3B1E A;  1IVR A;  1OHV A;  1S09 A;  2HZP A;  1Z7D A;  1LC7 A;  1CZE A;  4PFF A;  4WYC A;  3RCH B;  3VK3 A;  4BHD A;  1G4V A;  2DGM A;  2W8U A;  4F5G A;  4AZJ A;  5DJ1 A;  2AY8 A;  3WKR A;  2AY5 A;  2BIG A;  2O7C A;  3H14 A;  4XJO A;  3R4T A;  1BJN A;  1YJZ A;  2DGK A;  2BKW A;  4W5K A;  2Z9U A;  3W1H A;  2CIN A;  2EPJ A;  3UWC A;  3WY7 A;  2C81 A;  1ARI A;  4XK1 A;  4E3Q A;  1G7W A;  2VGS A;  4E1O A;  1AKC A;  4IXZ A;  3AEL A;  1D7R A;  5EAV A;  3A9Y A;  1I29 A;  3E6G A;  3HVY A;  3ECD A;  1EJI A;  1M32 A;  3GET A;  4JEY A;  1GD9 A;  5FT8 A;  4MKK A;  3LWS A;  3NDN A;  1AY5 A;  2ZY2 A;  2W7H A;  3GSB A;  4L0O A;  1OXO A;  1KMJ A;  1VP4 A;  2HOY A;  3BCX A;  3MAF B;  1YJS A;  1I41 A;  1BQD A;  4Q31 A;  3RCH A;  3K28 A;  2BIA A;  2HUU A;  1BS0 A;  1BW0 A;  2C44 A;  4LC3 A;  1LW4 A;  2CB1 A;  1C4K A;  2OGA A;  3R9A A;  3LVM A;  3HLM A;  1CZC A;  1M0Q A;  2D65 A;  2VMY A;  1O69 A;  1J32 A;  1B9H A;  2DKB A;  3HQT A;  1I48 A;  3BS8 A;  4WXF A;  4XJM A;  2FNU A;  2VMU A;  3MKJ A;  5FT5 A;  3AV7 A;  3WCO A;  3NTJ A;  5F9S A;  1J04 A;  3A2B A;  2W8J A;  1IJI A;  1ASG A;  1RVY A;  4WP0 A;  2AY3 A;  1MDZ A;  1LKC A;  2AEU A;  2X5D A;  2W8W A;  1AHX A;  1T3I A;  2AEV A;  3ASB A;  2YOB A;  3MAF A;  1S07 A;  4A0R A;  2CAN A;  4TN4 A;  1ASN A;  3E2Y A;  4TV7 A;  3NX3 A;  4BA4 A;  5M4D A;  1IAY A;  2OGE A;  2JGT A;  4W8I A;  4BA5 A;  3FZ8 A;  2FQ6 A;  3WKS A;  3DYD A;  5EUD A;  3PDX A;  4F5F A;  3EZS A;  4W91 A;  4MQP A;  2BYJ A;  5EQC A;  1VJO A;  3HT4 A;  3ASA A;  4IXO A;  1KL1 A;  2VMT A;  5HHY A;  1CQ6 A;  4LNJ A;  1FG7 A;  2VGW A;  2VGT A;  3FQ8 A;  5EFS A;  2X8U A;  4DQ6 A;  4ZDO A;  2E7I A;  3CQ4 A;  1MAP A;  2VMZ A;  3PJ0 A;  2W7I A;  3I4J A;  3VOM A;  2G6W A;  3H7F A;  5BJ4 A;  5JAY A;  1SPA A;  2FN6 A;  1SZK A;  3N5M A;  1C0N A;  1DFO A;  4OMA A;  4Y0I A;  3HL2 A;  3I5T A;  5G4I A;  1X0M A;  2JJF A;  2DR1 A;  3FDB A;  4K2I A;  3B1C A;  4WLJ A;  5M4B A;  1S08 A;  1ASA A;  2YKU A;  3MBB A;  3ZRR A;  2VGV A;  2AY6 A;  4Q75 A;  4K05 A;  2DKJ A;  2ZC0 A;  4E3R A;  1GC3 A;  1JS3 A;  3A9X A;  2R0T A;  1ASE A;  3FZ7 A;  3M5U A;  2AY7 A;  4EU1 A;  3JWA A;  4FFC A;  2VLF A;  3BC8 A;  2YCP A;  3Q8N A;  2VMV A;  1VEF A;  2V1P A;  3W1I A;  1YOO A;  2D61 A;  5EIG B;  1SZS A;  1ZC9 A;  3II0 A;  3F0H A;  2VMO A;  1ASD A;  3EI5 A;  2YCN A;  2ZY3 A;  2ZY4 A;  3ZZJ A;  4IX8 A;  3ELE A;  4U2H A;  1ART A;  1CJ0 A;  1OAT A;  3N0L A;  2R5E A;  3TQX A;  4MQQ A;  5M49 A;  5D5S A;  1V72 A;  2C0R A;  1CS1 A;  4GE7 A;  1B4X A;  2VIB A;  4I8A A;  2CH1 A;  2C7T A;  3WZF A;  3NUB A;  3ATH A;  1ASF A;  2BI1 A;  1E5E A;  3EI7 A;  4XJP A;  3VP6 A;  4CBS A;  2ZSL A;  2GB3 A;  1D7U A;  3FQ7 A;  3FFR A;  4MSO A;  2QB3 A;  4W1W A;  5EIG A;  4P7Y A;  1C9C A;  2CTZ A;  2QB2 A;  2YKX A;  4WXB A;  4DBC A;  2D63 A;  1ASB A;  4J5U A;  3FVU A;  3COG A;  1BKG A;  4R2N A;  3B46 A;  1RVU A;  3MC6 A;  2CJG A;  4GE4 A;  2VMS A;  3WLX A;  3EIB A;  4A72 A;  1DJU A;  2EO5 A;  1Z3Z A;  2PB2 A;  2JJE A;  2BI2 A;  1G4X A;  3DC1 A;  3TFU A;  1W7N A;  2DOU A;  2FNI A;  2YKY A;  3GZC A;  2W7M A;  3KGX A;  4ADC A;  1RV3 A;  4LNL A;  1LC8 A;  4RLG A;  1BJO B;  2WB6 A;  3UAK A;  1QIR A;  1MDX A;  2VLH A;  3CQ5 A;  2D66 A;  5TF5 A;  2R2N A;  4E77 A;  4JF1 A;  4WB0 B;  4GEB A;  1AY8 A;  1AIC A;  1KMK A;  4OBV A;  2HOX A;  4RJ0 A;  4N0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...