3PPNA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
b'DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppnA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppnA02
1LAHE 3B6QA 1B5HA 1MDQA 5DEXB 3T93B 3RT6B 3G3HA 3CFXA 5DT6A 2ZNTA 3CR9A 3CSBA 2O68A 1MM7A 3U94A 2A5TB 2Z23A 3C33A 5CC2A 4KD5A 1MPCA 3O9PA 1I6BA 4HS7A 5B7DA 4LA9A 5FTIA 2OWSA 5B70A 2HAUA 1M5FA 1LAGE 2UYFA 1ZBMA 3ECRA 3IOTA 1PC3A 3DM0A 2XX7A 4H67A 2P2AA 5I56B 3FIRA 4ND9A 1FQEA 2DOJA 2F35A 1O7TA 1UTBA 4RPNA 4RPOA 4R2FA 1XVXA 4BDOA 4DLDA 2G29A 3C4MA 3T9UA 1MQDA 3BFTA 1P1WA 3VLWA 2DP8A 1A40A 2PMSA 4DXBA 1D3KA 3C34A 1B7HA 4MH5A 1LBCA 3MPLA 3RQTA 3V89B 3S9EA 2HZLA 1NH8A 4KYSA 1TFAA 4XKPA 2F34A 4RA1A 3MVYA 4NF8A 3HCQA 2OZZA 3FJGA 1CB6A 3KN7A 3QAXA 2ZYKA 2I4BA 4ZDMA 1URSA 4OFLA 3PMWA 1Y4TA 3RY3A 1GVCA 5CBRA 3U92A 3OEMA 3SEXA 1TT1A 4F29A 3K02A 4N07A 2HAVA 2DVZA 1LCTA 5CI5A 2H9BA 3FVOA 1R9QA 1EU8A 1FQFA 2ONKE 3KJ7A 2RCBA 1S9TA 2Z8EA 3GLBA 5FHMA 3EHTA 1VFDA 4QFLA 2UVHA 4EUOA 1AIVA 3CFLA 1MG1A 4KQPA 3G3JA 4G68C 1B1XA 3CVGA 3WAFA 2V3QA 1JNFA 2PYYA 3F11A 1A55A 2E1SA 1IEJA 1Y3QA 2DVCA 2OWTA 3TQWA 3CRBA 1LFGA 3AXFA 4QFOA 5H8SA 1J1NA 3G3FA 4JWYA 4DCYA 5H8NB 4H1XA 4RXLA 4LZ5A 4PP0A 1NMUA 4KCCA 4Q8RA 1XS5A 1A99A 3ILTB 2R6GE 4FIMA 4OENA 1B3LA 3PUXE 3OEKA 2F5XA 5DEXA 4G8HA 5K2XA 2QS4A 4U21A 4FJPA 4LZ8A 4OETA 2YPNA 4XKQA 4R73A 4G68B 3PUWE 1SW1A 3SDFA 4RK9A 3PPOA 4OESA 1MQHA 1VSOA 1NNKA 4YMAA 1MH4A 1B3FA 2O6AA 4PFYA 5TP9B 2Q88A 3QSLA 3GZGA 4UACA 3VXCA 4JSOA 5ICTA 2RC7A 2Q89A 4NTLA 3SEUA 4YKIA 3B6WA 3IK6B 4BDRA 1MXXA 3IR1A 4OEUA 4JWXA 3KJTA 4FORA 1B40A 4H5FA 4OXVA 2GFEA 2I3WA 3Q29A 4JXIA 3K6WA 3A3CA 1B51A 4QF9A 4R75A 1JETA 4EF1A 3KZGA 3FXQA 3RLFE 1MQGA 4GFRA 4ZEBA 3IOWA 4LONB 3FJ7A 3LC8A 1EZ9A 3PD9A 1LCFA 4OYVA 3E4RA 3OSQA 5I2KA 3U8QA 2PT1A 4U1ZA 3TTKA 4E0WA 4TLMB 4JSDA 2V3TA 1IUDA 3TUSA 4RY1A 1JW4A 5AA1A 3N5LA 3EQ1A 1DOTA 2Z8FA 5BUUA 3QUJA 1H45A 1MM6A 2BJJX 4HTGA 4NE4A 4QSDA 2V25A 3UIFA 4Q30B 1SDXA 5CRYA 2ZYMA 1NNFA 4ESWA 2GHBA 4KR5A 3O66A 2Z8DA 1B6HA 1UIUA 3E3KA 2XD3A 1B05A 4C0RA 2O1MA 1ZKBA 2V93A 3K1PA 4PFTA 1WODA 1H44A 5CMBA 2GRVA 2VGQA 3D4GA 3O28A 2B65A 4YB6A 3ILUB 2F6GA 1MDP1 3H06B 3IJXB 2DE3A 5H8NA 3A09A 4ZEKA 5CMCA 2OCUA 5I57B 1B5IA 3IB2A 3IOVA 4GWOA 3VXBA 3O6HA 1R1NA 1MY4A 3MP6A 1H43A 3B7DA 3PUYE 2H5YA 3RN8A 2I48A 5H8HB 4MLQA 3ZS6A 1Y3NA 2THIA 1POY1 3PPRA 4G68A 4I62A 3S4UA 2XXHA 5L9OA 2HFBA 1B5JA 3PD8A 3SEYA 5TP9A 2DWIA 4H5GA 4F22A 3KOTA 3TEPA 1OQHA 3N26A 1YPNA 1D9VA 3K4UA 4KI0E 4U22A 4F31B 4PFWA 4NWDA 4I8CA 1Z7ME 4AB6A 5KCJB 3ODBA 1QUIA 3VVDA 1XT8A 1XOCA 1BP5A 4HCWA 4GQOA 2XXYA 5F1QA 2AYSA 3Q25A 3FASA 5L8DA 3U1OA 4DXCA 5HPQA 2ZXTA 2ONRA 3PPNA 3KSXA 4LUBA 4X48A 3E9XA 4YKKA 4IO2A 2F7CA 5DVJA 5L9MA 3N6UA 4ZZAA 1LSTA 2R71A 1VR5A 4F1YA 3C35A 1GTKA 3OSRA 1NNPA 5I59B 2XXWA 1ZU0A 3FXUA 2NXOA 5DTBA 1SI0A 4R9GA 1B3GA 3T9XB 4OEVA 4RNSA 2CZLA 5AE4A 1MRPA 4BDQA 3O97A 4G4PA 4YKPA 2AL4A 4F3GA 4EF2A 2Y7KA 4PQJA 5IKBA 4JB7A 3FV1A 3TELA 4H8IA 1RYOA 3IX1A 4NF5B 4O3CA 4LZ7A 1TFDA 2IEEA 1OLAA 2YLNA 3SEWA 4ZEFA 3OO6A 1O63A 1WDNA 2X26A 3I6VA 1PBPA 3LSLA 1DPEA 3BBRA 2QL3A 1XHYA 1OIBA 4FECA 3OO9A 4OFJA 3OXNA 1B3HA 3TYHA 5I57A 3ZKKA 2XXIA 1B9JA 3DP6A 3ZSFA 3PUZE 1AL3A 1LB8A 4Q0CA 4MLVA 4H0WA 1FTMA 5I2KB 5H8HA 3RT8A 3LBSA 4XKNA 4O3BA 1JW1A 1B4HA 2D5WA 3IB0A 3C32A 4U4XA 3M8UA 3WAEA 3H6UA 3FVGA 1BLFA 3D4CA 4F18A 3C9HA 1ZTYA 2RKMA 3PMXA 1UTHB 1SQYA 5FHNA 4EXKA 1N84A 3MW0A 2XX8A 2O7UA 4ELQA 3EHUA 2Y7IA 3TQLA 1RKMA 4F1VA 3M3KA 1Q35A 1B7ZA 3K00A 3S9NC 2O1LA 2A5SA 3K01A 2F36A 4ZZEA 1ZJLA 5TPAB 4LQ2A 4BLAA 3KG2A 5KCJA 4ESXA 3MAMA 2VD2A 3M3LA 1LAFE 2VHAA 4C1UA 5JK4A 3GBAA 4F3SA 1FQDA 2Q9TA 1DSNA 1URGA 2H99A 4DE8A 2YJPA 5I84A 1MH3A 4QFPA 1US5A 3CG3A 4ZS9A 1A54A 5A5XB 3CI8A 4GL0A 4U4SA 2AL5A 3K6XA 3M3FA 5L9SA 4H65A 5I59A 1JVYA 1QJMA 2OK2A 5ITPA 4OTEA 5DVIA 2X7QA 1NNTA 2RC8A 4EDPA 3PU5A 4HW8A 4ISUA 1GR2A 1ZLQA 4I9DA 1MPBA 3RNNA 3FGSA 1P1OA 4WEDA 5IAIA 1I6QA 5H8FB 2O51A 1MXYA 2Y7WA 2FNCA 4POWA 3V5AA 3H03A 3MC2A 1IXGA 1Z7NE 1PB7A 3IB1A 3FXRA 4QSCA 5JEIA 4NF5A 1PB8A 2M8CA 4THIA 5EYFA 3QIMA 1N7WA 3RTFB 3S2VA 4AQ4A 1R6ZA 1SW5A 3MVXA 3HPIA 1MPDA 4Z7EA 3O29A 1FQBA 1CE2A 3H4ZA 4KYDA 1TXFA 1FTKA 4LVQA 2XXUA 2KLFA 4U23A 1Q1KA 1M5BA 1GV8A 3KSJA 4R9FA 1RYXA 4F2QA 2CMOA 4P0IA 2Z22A 4BDLA 3MVWA 3FVNA 3KN8A 3MPKA 1FTJA 3W9VA 2XXXA 1B32A 1AOVA 3TZAA 3TAJA 1YTVA 4YMBA 1B58A 3V83A 4R6HA 2I6EA 2F7AA 1N76A 3OD7A 3TPAA 1VE4A 3PGFA 4NWCA 4G77A 4X1BA 4F2OA 1UTHA 1JW5A 4POXA 4KPTA 3OO7A 4GRKA 3R7XA 3O6GA 4JDFA 3FVKA 1R9LA 3PV0E 3ZKLA 2QS3A 4JWOA 3R26A 1SD3A 3EF7A 1P1QA 3HHFA 4YU0A 5LOMA 3CFZA 3V8XB 4Z0IA 4RYAA 3SERA 3UP9A 3KOSA 1B0LA 3H6WA 2ZNSA 2DE4A 4WKMA 4TQUQ 5TPAA 2Y7RA 1PDAA 1YCJA 3JYRA 4XXUA 2DXYA 1B4ZA 3UORA 1DTZA 1NKXA 1QKAA 3LR1A 2HCAA 1ZMGA 4FE8A 1M5CA 1YAEA 3CIJA 4FEBA 1M5DA 1NL5A 3LSXA 3CG1A 3G7WA 1POTA 1Y9UA 3T22A 1OMPA 4R72A 4ELOA 3OO8A 5ELVA 5A5XA 1QUJA 4OMBA 4H8JA 5J1DA 2AIXA 3VVEA 4U1OA 3SESA 3TDJA 4M4GA 4IO7A 4MBPA 3KGCA 2QPQA 4BDMA 2XXQA 1PB9A 1QKBA 2OBGA 2GHAA 3BKIB 4GLIA 4X9TA 4GL8A 3KN3A 1OVBA 3O6IA 5AA4B 3MWBA 3T66A 2UVIA 3T9VA 2P1SA 2F78A 5H8FA 2LAOA 2Y7PA 3QUFA 1FTLA 1ELJA 3MZ1A 4PFUA 3GXAA 1LLSA 2F6PA 3FJMA 3OMBA 4XKRA 1MQJA 5I58B 4QSEA 1MY1A 4JBZA 1IXHA 1MXWA 3K0VA 1MY2A 1DMBA 3MP1A 4PETA 2H25A 2RCAA 1VFEA 2QS2A 3PMVA 5ICQA 1MS7A 2PT2A 1LAXA 5JTYB 3DLNA 3EPEA 3K6VA 5KDTB 4DCXA 1B2HA 3I5OA 4YB5A 1KWHA 3MP8A 3KBRA 3VLUA 1USYE 4YKJA 4F3PA 3KEIA 3QYTA 2XHDA 1O64A 2QMWA 4LQ5A 1HSLA 4E0XA 1II5A 2VOZA 2NVUB 4OFOA 3L6GA 4MF3A 3K1MA 2REGA 1DPPA 2WKYA 4R2BA 4EQ9A 3UA8A 4IO5A 4AB5A 1FQCA 2XXRA 2P0SA 4OERA 1XVYA 5AA2A 3UK4A 4MFIA 3FZVA 2D3IA 3N6TA 5AA2D 3S9LC 4F19A 1N3WA 5CBSA 1OLCA 2F8DA 4P11A 1IXIA 2ZNUA 2DXRA 1B52A 2ZYNA 3RTWB 4GXAA 1NFTA 5ISUA 1QUKA 4IB2A 2I4CA 2HEUA 4G8MA 3W15C 4KYEA 3W9WA 4XTCQ 4F1UA 3OOAA 4WXJA 1BKAA 4U2RA 2X7PA 3T96B 5HBCA 2Y84A 1NH7A 1UIVA 1PBQA 3I3VA 3VVFA 1EH3A 3DP4A 4TLLB 1MXVA 3DELB 1DTGA 2OJTA 5AA3A 2QS1A 1LB9A 5K2YA 1JEUA 1D9YA 4QHQA 2XXVA 3MBPA 3N94A 4RK2A 2DS9A 1LFIA 4ZEIA 3TMGA 3TTNA 4ZE8A 3TODA 4F39A 1A8EA 4DIGA 3HN0A 3C36A 1IIWA 1H3DA 1Y20A 4YB7A 4OVJA 5AA4A 1LGBC 4X1DA 1T0KA 2ALUA 1Y1MA 1Y1ZA 5M2VA 3FUZA 3MZBA 3CSGA 5FHOA 3HHGA 4OQOA 1HSEA 2XD2A 3L6HA 1OVTA 2F7BA 1S50A 5I58A 2PVUA 5F7VA 1LBBA 3IOUA 3C31A 1MY3A 1AH5A 2V84A 1TWYA 5CM6A 2GH9A 2B3FA 3TTLA 3UGWA 1MQIA 2O84X 3GBBA 3A3UA 3JV9A 3U72A 1Y4CA 4OWDA 4NMYA 4EQBA 1P99A 1N0TA 3IAZA 5JTYA 2QRYA 2VD3A 5KDTA 1MXUA 1IZ1A 3LSWA 4ELRA 3K2DA 2ESNA 3FV2A 4IO3A 3BFUA 3MVZA 4FEDA 3LSFB 2XXTA 5CMMA 3MUQA 4FATA 3FD3A 1USYH 1B1HA 4O3AA 5DYHA 4F3BA 1FQAA 4ECFA 1ATGA 3OENA 4YAHX 2D21A 4NEDA 2REJA 3O2AA 1B7UA 3TKDA 3Q28A 4L17A 2XX9A 2G93A 4GF8A 3EHSA 2UVJA 2DSFA 2PX1A 3JZJA 4LATA 2ZMBA 1Y3PA 3SKPA 2UVGA 1IITA 1H76A 4NF4B 1M5EA 1JVXA 5EHMA 3TFLA 1SW2A 2A5TA 4TOZA 3UN6A 3VFJA 4KFQA 1SBPA 1FW0A 4K3FA 3LUYA 3HO7A 5TU0A 2OLBA 5DVFA 2IA4A 4IGRA 1N04A 5EHSA 1I69A 5I56A 2B3BA 4NF6B 5H8QB 3HSTA 1LFHA 4GIZA 2W7YA 3H3GA 3SEVA 4I1DA 2ANJA 3K1NA 2ONSA 1FCKA 4P0GA 2VP1A 4HCYA 1L5TA 1GGGA 2I3VA 4DZ1A 5HM4B 1SW4A 2RF1A 1I6AA 3VE1B 4RJZA 3RUMA 1B46A 4R6KA 3EN3A 3TTMA 1XC1A 1BIYA 3Q26A 1EZOA 2ABHA 3HV1A 4ONYA 3DP8A 4DXUA 1IXCA 3PPQA 1MY0A 4YZZA 1QULA 4ZE9A 2O7IA 2XXPA 4G8NA 1D4NA 2DE2A 5I2NB 4N13A 3IORA 4R6YA 3PPPA 4LP2B 2E0SA 5AA2B 4Q5TA 3H6TA 3THIA 4YICA 1JEVA 1EZPA 1ANFA 2FYIA 3RGYA 1SI1A 3H6VA 4ZEDA 2I0BA 2UXAA 2DQVA 2I0CA 4GD5A 3TCHA 2UYEA 4N6PA 3TTRA 5FTHA 1SVXB 5CMKA 1N3XA 2HQ0A 2HXWA 3G3KA 1SYHA 3Q27A 2Q2AA 2F97A 3MQ9A 2I49A 4H6DA 3OELA 1P1NA 1UQWA 5KZTA 4QFNA 3USDA 1URDA 5ITOA 4KHZE 2RC9A 2DWJA 2O69A 1MXZA 4FAJA 3SETA 3G3IA 3P7IA 1BTJA 1UTBB 1N7XA 4QRZA 1PEBA 2Q8JA 3IO6A 3S9MC 1FTOA 2NWJA 2H4IA 1JQFA 4M1VA 3B6TA 3PUVE 1QVSA 4DDDA 4GVOA 4GOTA 3QXMA 2PBWA 3MJNA 1QW0A 1US4A 4EQ7A 4NF8B 2NOOA 5BWJA 1A8FA 3R6UA 2Q2CA 2H98A 4XIGQ 3TCFA 4IGTA 3VLVA 4NF4A 3TCGA 3U93A 1B3EA 4IY5A 4IO6A 2FA7A 3H7MA 3RPWA 4IO4A 2DWAA 4QFKA 1AMFA 3VDFA 4R74A 2QSXA 3E13X 4GXSB 3KFMA 2HZKA 2RINA 1IQ7A 1OQGA 3MZ9A 3QK6A 4BDNA 4IY6A 4NF6A 3IJOB 5H8QA 4ELPA 4PE5B 1WVJA 3IL1B 1P1UA 3T9HB 4WEPA 4C1TA 3VV5A 1ZIUA 2V3UA 2I58A 4ZECA 2R9JA 1SYIA 3K6UA 3IO4A 1F9BA 4G2ZA 3FATA 3ONMA 1HSJA 3G3GA 2DYXA 2DWHA 1A7LA 4EXLA 4OHNA 4KCDA 4UA8A 2ZYOA 4OZ9A 2NUVA 1S7YA 2QJEA 1B0HA 2QMXA 5I2NA
chains in the Genus database with same CATH superfamily
1LAHE 3B6QA 1IMAA 1B5HA 1MDQA 5DEXB 3T93B 3RT6B 3G3HA 3CFXA 5DT6A 1FPEA 2ZNTA 3CR9A 4O8MA 2XWVA 3CSBA 2O68A 1MM7A 3U94A 2A5TB 2Z23A 1FBHA 3C33A 1DCUA 4KD5A 5CC2A 3IFAA 1MPCA 3O9PA 1I6BA 4HS7A 5B7DA 4LA9A 4O7MA 2OWSA 5FTIA 5B70A 2HAUA 4PF6A 1M5FA 4NX1A 1LAGE 1G0IA 2UYFA 1ZBMA 3ECRA 3IOTA 2CZKA 1PC3A 2ZZVA 3DM0A 4HE2A 2XX7A 4H67A 2P2AA 5I56B 3FIRA 4ND9A 1FQEA 2DOJA 2F35A 1O7TA 1UTBA 4RPNA 4P56A 4RPOA 4R2FA 1XVXA 4BDOA 4DLDA 5F24A 2G29A 3C4MA 3T9UA 1MQDA 3BFTA 1P1WA 3VLWA 2DP8A 1A40A 2PMSA 3PTYA 4XEQA 1NV6A 4DXBA 1D3KA 3C34A 4N6DA 1B7HA 4MH5A 1LBCA 3MPLA 3RQTA 3V89B 3S9EA 2HZLA 1NH8A 4KYSA 1TFAA 4XKPA 2F34A 4RA1A 3MVYA 1IMDA 4NF8A 3HCQA 2OZZA 3FJGA 1CB6A 3KN7A 3QAXA 2ZYKA 2I4BA 4ZDMA 1URSA 4OFLA 3PMWA 1Y4TA 3RY3A 1GVCA 5CBRA 3U92A 3OEMA 2HHMA 3SEXA 3KC0A 1NV0A 2Y5LA 1TT1A 4F29A 3U65A 3K02A 4N07A 1FPDA 2HAVA 2DVZA 1LCTA 5CI5A 2H9BA 3FVOA 1R9QA 1EU8A 1FQFA 2ONKE 3KJ7A 2QVVA 2RCBA 1AWBA 1S9TA 4X8RA 2Z8EA 3GLBA 5EYHA 5FHMA 3EHTA 1VFDA 4QFLA 2UVHA 1IMFA 4EUOA 1AIVA 3CFLA 1MG1A 4KQPA 1YZ0A 3G3JA 4G68C 2XWIA 1B1XA 3CVGA 3WAFA 2V3QA 1JNFA 2PYYA 3F11A 1A55A 2E1SA 1IEJA 1Y3QA 2DVCA 1BK4A 2OWTA 3TQWA 3CRBA 1LFGA 3AXFA 4QFOA 5H8SA 1J1NA 3G3FA 4JWYA 2WEFA 2CZHA 4DCYA 5H8NB 4H1XA 4RXLA 4LZ5A 4PP0A 4NG7A 1NMUA 4KCCA 4Q8RA 1XS5A 1A99A 3ILTB 2R6GE 4FIMA 4OENA 1B3LA 3PUXE 3OEKA 2F5XA 5DEXA 4G8HA 5K2XA 2F3BA 2QS4A 2WYPA 2FVZA 4PGNA 4U21A 4FJPA 4LZ8A 4OETA 2YPNA 4XKQA 4R73A 4G68B 3PUWE 1SW1A 3SDFA 4HXVA 4PC9A 4RK9A 3PPOA 4OESA 1MQHA 1VSOA 1NNKA 4YMAA 1MH4A 1B3FA 2O6AA 4PFYA 5TP9B 2Q88A 3QSLA 3GZGA 4UACA 3VXCA 4JSOA 5ICTA 2RC7A 3NOHA 2Q89A 4NTLA 3SEUA 4YKIA 3B6WA 3IK6B 4BDRA 4PDDA 1MXXA 3IR1A 4OEUA 4JWXA 3KJTA 4FORA 1B40A 4H5FA 4OXVA 2GFEA 5ET5A 1EYIA 2FHYA 2I3WA 3E79A 3Q29A 4JXIA 3K6WA 3A3CA 1B51A 4QF9A 4R75A 4IR8A 1JETA 4EF1A 1NV5A 3KZGA 1NUZA 3MYUA 2XA5A 4N8GA 3FXQA 3RLFE 1MQGA 4GFRA 4ZEBA 3IOWA 4GWYA 4LONB 3FJ7A 3LC8A 1EZ9A 3FBPA 4MNPA 3PD9A 1LCFA 4OYVA 3E4RA 3OSQA 1EYKA 5I2KA 3U8QA 2PT1A 4U1ZA 3TTKA 5EYGA 4E0WA 4PFIA 4TLMB 4JSDA 2V3TA 1LBYA 1IUDA 3TUSA 4RY1A 1JW4A 5AA1A 3N5LA 1FPKA 3EQ1A 1DOTA 2Z8FA 5BUUA 3QUJA 1H45A 5ESYA 1MM6A 4O94A 2BJJX 1FBGA 4HTGA 4NE4A 4QSDA 2V25A 3UIFA 4Q30B 1SDXA 1IMCA 5CRYA 2ZYMA 1NNFA 4ESWA 2GHBA 2Q74A 4KR5A 3O66A 2Z8DA 1B6HA 4G61A 1FSAA 1UIUA 4PAKA 3E3KA 2XD3A 1B05A 4C0RA 2O1MA 5EQ7A 1ZKBA 2V93A 3K1PA 4PFTA 4P8BA 1WODA 1H44A 5CMBA 2GRVA 2VGQA 3D4GA 4N15A 3O28A 2B65A 4YB6A 4MCOA 3ILUB 2F6GA 1MDP1 3H06B 3HFUA 3IJXB 1RDXA 2DE3A 2WBBA 5H8NA 3A09A 1QGXA 4ZEKA 5CMCA 2OCUA 5I57B 1B5IA 4N6KA 3IB2A 3IOVA 4GWOA 3VXBA 3O6HA 1R1NA 1MY4A 3MP6A 1H43A 4MAGA 3B7DA 3PUYE 2H5YA 3RN8A 4OVRA 2I48A 5H8HB 4MLQA 3ZS6A 1Y3NA 2THIA 1POY1 5FBPA 3PPRA 4G68A 4I62A 3S4UA 2XXHA 5L9OA 2HFBA 1B5JA 2ZZXA 3PD8A 3SEYA 5TP9A 2WBDA 4JVCA 2DWIA 4P1LA 4H5GA 4GBWA 4F22A 3KOTA 3TEPA 1OQHA 3N26A 1YPNA 1D9VA 3K4UA 4KI0E 4U22A 4F31B 3A29A 4PFWA 4NWDA 4PFBA 4I8CA 5DW8A 1Z7ME 4AB6A 5KCJB 3ODBA 1QUIA 3VVDA 4JVIA 1XT8A 1XOCA 1BP5A 4HCWA 4GQOA 2XXYA 5F1QA 2AYSA 3Q25A 3FASA 5L8DA 3U1OA 4DXCA 5HPQA 2ZXTA 2ONRA 3PPNA 3KSXA 4LUBA 4UABA 4X48A 3E9XA 4YKKA 5A5LA 4IO2A 2F7CA 5DVJA 5L9MA 3N6UA 1YXIA 4ZZAA 1LSTA 1YYZA 2R71A 1VR5A 3FXBA 4DI4B 4F1YA 1FPGA 3C35A 1GTKA 3OSRA 1NNPA 5I59B 2XXWA 1ZU0A 3FXUA 3GYYA 2NXOA 5DTBA 1SI0A 4R9GA 1B3GA 3T9XB 4OEVA 4XFEA 4RNSA 2CZLA 5AE4A 2KR0A 1MRPA 2V4CA 4BDQA 3O97A 4G4PA 4YKPA 2AL4A 4F3GA 4EF2A 2Y7KA 4PQJA 5IKBA 4JB7A 3FV1A 3TELA 4H8IA 1RYOA 3IX1A 4NF5B 2FIXA 3ISPA 4O3CA 4LZ7A 1TFDA 2IEEA 1OLAA 2YLNA 3SEWA 1K9YA 1NV3A 4ZEFA 1FBDA 2F3DA 3OO6A 1O63A 1WDNA 2X26A 5LDZA 3I6VA 1PBPA 3LSLA 1DPEA 3KBZA 3BBRA 2QL3A 1OIBA 1XHYA 4FECA 3OO9A 4OFJA 3OXNA 1B3HA 2FIEA 5J16A 5LTCA 3TYHA 5T3JA 5I57A 3ZKKA 2XXIA 1B9JA 3DP6A 3ZSFA 3PUZE 1D9QA 1AL3A 1LB8A 4Q0CA 4MLVA 4H0WA 1FTMA 5I2KB 5H8HA 3RT8A 3LBSA 4XKNA 4O3BA 1JW1A 1B4HA 3CHGA 2D5WA 4PAFA 3IB0A 3C32A 4U4XA 3M8UA 3H6UA 2MKZA 3WAEA 3FVGA 1BLFA 3D4CA 4F18A 3C9HA 1ZTYA 2RKMA 3PMXA 1UTHB 1SQYA 5FHNA 4EXKA 1N84A 3MW0A 2XX8A 4N17A 2O7UA 4ELQA 2PFYA 1DBZA 3EHUA 4GX6A 2Y7IA 3TQLA 2DDKA 1RKMA 2P3NA 4F1VA 3M3KA 1Q35A 2VPOA 1B7ZA 1CNQA 3K00A 4KXPA 3S9NC 2O1LA 2A5SA 3K01A 2F36A 4ZZEA 1ZJLA 5TPAB 1FPFA 4LQ2A 4BLAA 3KG2A 3T0JA 5KCJA 4ESXA 3MAMA 4AS4A 2VD2A 3M3LA 1LAFE 2VHAA 4C1UA 5JK4A 3GBAA 4F3SA 1FQDA 2Q9TA 2QFLA 1DSNA 3ROJA 1URGA 1NV2A 2P3VA 4I3EA 4PTKA 2H99A 4DE8A 2YJPA 5I84A 3LV0A 1MH3A 4QFPA 4HE1A 4MIJA 1US5A 3CG3A 4ZS9A 3LUZA 1A54A 5A5XB 3CI8A 4GL0A 4U4SA 2AL5A 3K6XA 3M3FA 5ET6A 5I3SA 4N4UA 5L9SA 4H65A 2CEXA 5I59A 5ET7A 1JVYA 1QJMA 4PGPA 2OK2A 5ITPA 5IZZA 4OTEA 2BJIA 5DVIA 2X7QA 1NNTA 2RC8A 4EDPA 3PU5A 4HW8A 4ISUA 1GR2A 1ZLQA 4I9DA 1MPBA 3T1BA 3RNNA 4OVQA 3FGSA 1EYJA 1P1OA 4WEDA 5IAIA 1I6QA 5H8FB 2O51A 2R8TA 4P3LA 1MXYA 2Y7WA 2FNCA 4POWA 3V5AA 3H03A 3MC2A 1IXGA 1Z7NE 1PB7A 3IB1A 3FXRA 4QSCA 5JEIA 4NF5A 1PB8A 4GWZA 2M8CA 4THIA 5EYFA 3IFCA 3QIMA 1N7WA 1RDYA 3RTFB 3S2VA 4AQ4A 1R6ZA 1SW5A 3MVXA 2JJKA 3HPIA 1MPDA 4Z7EA 3O29A 1FQBA 4JVDA 1CE2A 5EQAA 3H4ZA 4KYDA 1TXFA 1FTKA 4LVQA 2XXUA 2KLFA 4U23A 1Q1KA 1LBWA 1M5BA 1GV8A 3KSJA 4R9FA 1RYXA 4F2QA 2CMOA 4P0IA 2Z22A 4BDLA 3MVWA 2VT5A 5IGAA 4LN5A 3FVNA 3KN8A 3MPKA 1FTJA 3W9VA 2XXXA 1B32A 1AOVA 3TZAA 3TAJA 1YTVA 4YMBA 1B58A 5IZ3B 3V83A 4R6HA 2I6EA 2F7AA 1N76A 3OD7A 3TPAA 1VE4A 3PGFA 4QBAA 4NWCA 4G77A 4X1BA 4F2OA 1UTHA 1JW5A 4POXA 2XWKA 4KPTA 3OO7A 4OVPA 4GRKA 3R7XA 3O6GA 4JDFA 3FVKA 4N81A 1R9LA 3PV0E 3ZKLA 2QS3A 4JWOA 3R26A 1FRPA 1SD3A 3EF7A 1P1QA 3HHFA 4YU0A 5LOMA 3CFZA 3SZPA 3V8XB 5EQ9A 4Z0IA 4RYAA 3SERA 4OANA 3UP9A 3KOSA 1B0LA 3H6WA 2ZNSA 2DE4A 4WKMA 4TQUQ 5TPAA 2Y7RA 1NUYA 1PDAA 1YCJA 2OX3A 3JYRA 4XXUA 5I5PA 2DXYA 1FPJA 1B4ZA 3UORA 1DTZA 1NKXA 3QMFA 1QKAA 3LR1A 2HCAA 1ZMGA 4FE8A 1M5CA 1DK4A 1YAEA 3CIJA 4FEBA 1M5DA 4DI3D 1NL5A 3LSXA 4N91A 3CG1A 3G7WA 1POTA 1Y9UA 3T22A 1OMPA 4R72A 4ELOA 3OO8A 4N8YA 5ELVA 5A5XA 4GX3A 1QUJA 1NI9A 4OMBA 1FBFA 4GWSA 4H8JA 5J1DA 2AIXA 3VVEA 4U1OA 3SESA 3TDJA 4M4GA 4IO7A 4MBPA 3KGCA 1VDWA 2QPQA 4BDMA 2Q8MA 2XXQA 1PB9A 1QKBA 2OBGA 2GHAA 3BKIB 4GLIA 4X9TA 4GL8A 3KN3A 1OVBA 1FBPA 3O6IA 5AA4B 3MWBA 3T66A 1LEVA 2UVIA 3T9VA 2P1SA 2F78A 1NV1A 5H8FA 2LAOA 2Y7PA 3QUFA 1FTLA 1ELJA 4GWXA 3MZ1A 4PFUA 3GXAA 1LLSA 2F6PA 3FJMA 3OMBA 4XKRA 1MQJA 5I58B 4QSEA 1MY1A 4JBZA 1IXHA 2PCRA 1MXWA 3K0VA 1MY2A 1DMBA 3MP1A 1K9ZA 4PETA 2H25A 2RCAA 1VFEA 2QS2A 3PMVA 5ICQA 3RPLB 4H46A 1MS7A 2PT2A 1LAXA 1LBZA 5JTYB 3DLNA 3EPEA 3K6VA 5KDTB 1B2HA 1FJ6A 4DCXA 3I5OA 4YB5A 1KWHA 3MP8A 1KZ8A 2B4LA 3KBRA 3VLUA 1USYE 4YKJA 4F3PA 3KEIA 1FBEA 3QYTA 1LBXA 2XHDA 1O64A 2QMWA 4LQ5A 1HSLA 4MEVA 4E0XA 1NV4A 5IZ3A 1KA1A 1II5A 2VOZA 2NVUB 4OFOA 3L6GA 4MF3A 3K1MA 2REGA 1DPPA 2WKYA 4R2BA 4EQ9A 3E78A 3UA8A 4IO5A 4AB5A 1FQCA 2Y5KA 2XXRA 2P0SA 4OERA 1XVYA 5AA2A 3UK4A 4MFIA 3FZVA 2D3IA 3N6TA 1FPLA 5AA2D 3S9LC 4F19A 1FTAA 3D1RA 1N3WA 5CBSA 1OLCA 2F8DA 4P11A 1IXIA 2ZNUA 2DXRA 1B52A 2ZYNA 3RTWB 4GXAA 1NFTA 5ISUA 1QUKA 2CEYA 4IB2A 2I4CA 2HEUA 4G8MA 3W15C 2XWOA 4KYEA 3W9WA 4XTCQ 4NAPA 1JP4A 4F1UA 3OOAA 4WXJA 1BKAA 2GQ1A 1FPIA 4U2RA 2X7PA 3T96B 5HBCA 2Y84A 1NH7A 1UIVA 3B8BA 1PBQA 3I3VA 3VVFA 4MMPA 1EH3A 1NUWA 3DP4A 4TLLB 2QVRA 1MXVA 3DELB 1DTGA 2OJTA 5AA3A 2QS1A 1LB9A 5K2YA 2OWZA 1JEUA 1D9YA 4QHQA 2XXVA 3MBPA 3N94A 4RK2A 2DS9A 1LFIA 4ZEIA 3TMGA 3TTNA 4P9KA 4ZE8A 3TODA 4F39A 1A8EA 4FBPA 4DIGA 3HN0A 3C36A 1IIWA 1H3DA 1Y20A 4YB7A 4OVJA 5AA4A 1LGBC 4X1DA 1T0KA 2ALUA 1Y1MA 4PBQA 1Y1ZA 5M2VA 3FUZA 3MZBA 3CSGA 5FHOA 3HHGA 4OQOA 4PBHA 1HSEA 2XD2A 3RYDA 3L6HA 1OVTA 2F7BA 1S50A 5I58A 2PVUA 5F7VA 1LBBA 3IOUA 3C31A 1MY3A 1AH5A 2V84A 1TWYA 2KQZA 2XXKA 5CM6A 2GH9A 2B3FA 3TTLA 3UGWA 1MQIA 2O84X 3GBBA 3A3UA 3JV9A 3U72A 1Y4CA 3RPLA 4OWDA 4NMYA 4EQBA 1P99A 1N0TA 3IAZA 5JTYA 2QRYA 2CZIA 2VD3A 4GWWA 5KDTA 1MXUA 1NV7A 1IZ1A 3LSWA 4ELRA 3K2DA 2ESNA 3FV2A 4IO3A 3BFUA 3MVZA 4FEDA 3LSFB 2XXTA 5CMMA 2QVUA 3MUQA 2WYKA 4FATA 4X04A 3FD3A 1USYH 1B1HA 4O3AA 5DYHA 4F3BA 1FQAA 4ECFA 4PAIA 3B50A 1ATGA 3OENA 4YAHX 2D21A 4NEDA 2REJA 4PF8A 3O2AA 1B7UA 5IM2A 3TKDA 3Q28A 4L17A 4HE0A 2XX9A 2G93A 4I40A 4GF8A 4NGUA 2ZZWA 3EHSA 2UVJA 2DSFA 2PX1A 3JZJA 4LATA 2ZMBA 1Y3PA 2HPGA 4P47A 2HXRA 3SKPA 1IMEA 2UVGA 1IITA 1H76A 4NF4B 1M5EA 1JVXA 4MNIA 5EHMA 3TFLA 1SW2A 2A5TA 4TOZA 3UN6A 3VFJA 4KFQA 1SBPA 1FW0A 4K3FA 3LUYA 3HO7A 5TU0A 4AS5A 5IZ1A 2OLBA 5DVFA 2IA4A 2VPNA 4IGRA 1N04A 5EHSA 1I69A 5I56A 2B3BA 4NF6B 5H8QB 3HSTA 1LFHA 4GIZA 3BIHA 2W7YA 3H3GA 4MX6A 3SEVA 4I1DA 2ANJA 2FBPA 3K1NA 4NQ8A 2ONSA 1FCKA 4P0GA 2VP1A 4HCYA 1L5TA 1GGGA 2I3VA 1FPBA 3MSTA 4DZ1A 5HM4B 1SW4A 1NUXA 2RF1A 1I6AA 3VE1B 4RJZA 3RUMA 1B46A 4R6KA 3EN3A 3TTMA 1XC1A 5EQ8A 1BIYA 3Q26A 1EZOA 2ABHA 3HV1A 4ONYA 2PFZA 3DP8A 4DXUA 1IXCA 4I3YA 3PPQA 1MY0A 4YZZA 1QULA 4OVSA 4ZE9A 2O7IA 2XXPA 4G8NA 4OVTA 1D4NA 2DE2A 4GBVA 5I2NB 4N13A 3IORA 4R6YA 3PPPA 4LP2B 2E0SA 4MNCA 5AA2B 4Q5TA 3H6TA 3THIA 4YICA 1JEVA 4NHBA 1EZPA 1ANFA 2FYIA 3RGYA 1SI1A 3H6VA 4ZEDA 1INPA 2I0BA 2UXAA 4PFRA 2DQVA 5I7IA 2I0CA 4GD5A 3TCHA 2UYEA 4N6PA 3TTRA 5FTHA 1SVXB 5CMKA 1N3XA 1G0HA 2HQ0A 2HXWA 3G3KA 1SYHA 1Q9DA 3Q27A 2Q2AA 2F97A 3MQ9A 2I49A 4H6DA 3OELA 1P1NA 1UQWA 5KZTA 1XI6A 5ET8A 4QFNA 3USDA 1URDA 1FBCA 5ITOA 3EKIA 4KHZE 2RC9A 2DWJA 2O69A 1MXZA 4FAJA 1KA0A 4XF5A 1RDZA 3SETA 3G3IA 3P7IA 1BTJA 1UTBB 1N7XA 4QRZA 1PEBA 2Q8JA 4QXDA 3IO6A 3S9MC 3BIGA 1FTOA 2NWJA 2H4IA 1JQFA 1LBVA 4M1VA 3B6TA 3PUVE 1QVSA 4DDDA 4GVOA 4GOTA 4MHFA 3QXMA 2PBWA 3MJNA 1QW0A 1US4A 4O7IA 4EQ7A 4NF8B 2NOOA 5BWJA 1A8FA 3R6UA 2Q2CA 2WX9A 2H98A 4XIGQ 4GX4A 4IGTA 3TCFA 3VLVA 4PDHA 4NF4A 3TCGA 3U93A 4PCDA 1SPIA 1B3EA 4IY5A 1IMBA 4IO6A 2FA7A 3H7MA 3RPWA 4IO4A 4NN3A 2DWAA 4QFKA 1AMFA 3VDFA 4R74A 2QSXA 3E13X 4NF0A 4GXSB 3KFMA 2HZKA 2RINA 1IQ7A 1OQGA 2B4MA 3MZ9A 3KC1A 3QK6A 4BDNA 4MJOA 4IY6A 4NF6A 3IJOB 5H8QA 4ELPA 4PE5B 1WVJA 3IL1B 1FJ9A 1P1UA 3T9HB 4WEPA 4C1TA 3VV5A 4GWUA 1ZIUA 2V3UA 2I58A 4ZECA 2R9JA 2L5VA 1SYIA 4OA4A 3K6UA 3IO4A 1F9BA 4G2ZA 3FATA 3ONMA 1HSJA 3G3GA 2DYXA 2DWHA 1A7LA 4EXLA 4OHNA 4KCDA 4UA8A 2ZYOA 4OZ9A 4P1EA 2NUVA 1S7YA 2QJEA 4PE3A 1B0HA 2QMXA 5I2NA 4H45A
chains in the Genus database with same CATH topology
1LAHE 3B6QA 1B5HA 1MDQA 5DEXB 3T93B 3RT6B 3G3HA 3CFXA 5DT6A 2ZNTA 3CR9A 3CSBA 2O68A 1MM7A 3U94A 2A5TB 2Z23A 3C33A 5CC2A 4KD5A 1MPCA 3O9PA 1I6BA 4HS7A 5B7DA 4LA9A 5FTIA 2OWSA 5B70A 2HAUA 1M5FA 1LAGE 2UYFA 1ZBMA 3ECRA 3IOTA 1PC3A 3DM0A 2XX7A 4H67A 2P2AA 5I56B 3FIRA 4ND9A 1FQEA 2DOJA 2F35A 1O7TA 1UTBA 4RPNA 4RPOA 4R2FA 1XVXA 4BDOA 4DLDA 2G29A 3C4MA 3T9UA 1MQDA 3BFTA 1P1WA 3VLWA 2DP8A 1A40A 2PMSA 4DXBA 1D3KA 3C34A 1B7HA 4MH5A 1LBCA 3MPLA 3RQTA 3V89B 3S9EA 2HZLA 1NH8A 4KYSA 1TFAA 4XKPA 2F34A 4RA1A 3MVYA 4NF8A 3HCQA 2OZZA 3FJGA 1CB6A 3KN7A 3QAXA 2ZYKA 2I4BA 4ZDMA 1URSA 4OFLA 3PMWA 1Y4TA 3RY3A 1GVCA 5CBRA 3U92A 3OEMA 3SEXA 1TT1A 4F29A 3K02A 4N07A 2HAVA 2DVZA 1LCTA 5CI5A 2H9BA 3FVOA 1R9QA 1EU8A 1FQFA 2ONKE 3KJ7A 2RCBA 1S9TA 2Z8EA 3GLBA 5FHMA 3EHTA 1VFDA 4QFLA 2UVHA 4EUOA 1AIVA 3CFLA 1MG1A 4KQPA 3G3JA 4G68C 1B1XA 3CVGA 3WAFA 2V3QA 1JNFA 2PYYA 3F11A 1A55A 2E1SA 1IEJA 1Y3QA 2DVCA 2OWTA 3TQWA 3CRBA 1LFGA 3AXFA 4QFOA 5H8SA 1J1NA 3G3FA 4JWYA 4DCYA 5H8NB 4H1XA 4RXLA 4LZ5A 4PP0A 1NMUA 4KCCA 4Q8RA 1XS5A 1A99A 3ILTB 2R6GE 4FIMA 4OENA 1B3LA 3PUXE 3OEKA 2F5XA 5DEXA 4G8HA 5K2XA 2QS4A 4U21A 4FJPA 4LZ8A 4OETA 2YPNA 4XKQA 4R73A 4G68B 3PUWE 1SW1A 3SDFA 4RK9A 3PPOA 4OESA 1MQHA 1VSOA 1NNKA 4YMAA 1MH4A 1B3FA 2O6AA 4PFYA 5TP9B 2Q88A 3QSLA 3GZGA 4UACA 3VXCA 4JSOA 5ICTA 2RC7A 2Q89A 4NTLA 3SEUA 4YKIA 3B6WA 3IK6B 4BDRA 1MXXA 3IR1A 4OEUA 4JWXA 3KJTA 4FORA 1B40A 4H5FA 4OXVA 2GFEA 2I3WA 3Q29A 4JXIA 3K6WA 3A3CA 1B51A 4QF9A 4R75A 1JETA 4EF1A 3KZGA 3FXQA 3RLFE 1MQGA 4GFRA 4ZEBA 3IOWA 4LONB 3FJ7A 3LC8A 1EZ9A 3PD9A 1LCFA 4OYVA 3E4RA 3OSQA 5I2KA 3U8QA 2PT1A 4U1ZA 3TTKA 4E0WA 4TLMB 4JSDA 2V3TA 1IUDA 3TUSA 4RY1A 1JW4A 5AA1A 3N5LA 3EQ1A 1DOTA 2Z8FA 5BUUA 3QUJA 1H45A 1MM6A 2BJJX 4HTGA 4NE4A 4QSDA 2V25A 3UIFA 4Q30B 1SDXA 5CRYA 2ZYMA 1NNFA 4ESWA 2GHBA 4KR5A 3O66A 2Z8DA 1B6HA 1UIUA 3E3KA 2XD3A 1B05A 4C0RA 2O1MA 1ZKBA 2V93A 3K1PA 4PFTA 1WODA 1H44A 5CMBA 2GRVA 2VGQA 3D4GA 3O28A 2B65A 4YB6A 3ILUB 2F6GA 1MDP1 3H06B 3IJXB 2DE3A 5H8NA 3A09A 4ZEKA 5CMCA 2OCUA 5I57B 1B5IA 3IB2A 3IOVA 4GWOA 3VXBA 3O6HA 1R1NA 1MY4A 3MP6A 1H43A 3B7DA 3PUYE 2H5YA 3RN8A 2I48A 5H8HB 4MLQA 3ZS6A 1Y3NA 2THIA 1POY1 3PPRA 4G68A 4I62A 3S4UA 2XXHA 5L9OA 2HFBA 1B5JA 3PD8A 3SEYA 5TP9A 2DWIA 4H5GA 4F22A 3KOTA 3TEPA 1OQHA 3N26A 1YPNA 1D9VA 3K4UA 4KI0E 4U22A 4F31B 4PFWA 4NWDA 4I8CA 1Z7ME 4AB6A 5KCJB 3ODBA 1QUIA 3VVDA 1XT8A 1XOCA 1BP5A 4HCWA 4GQOA 2XXYA 5F1QA 2AYSA 3Q25A 3FASA 5L8DA 3U1OA 4DXCA 5HPQA 2ZXTA 2ONRA 3PPNA 3KSXA 4LUBA 4X48A 3E9XA 4YKKA 4IO2A 2F7CA 5DVJA 5L9MA 3N6UA 4ZZAA 1LSTA 2R71A 1VR5A 4F1YA 3C35A 1GTKA 3OSRA 1NNPA 5I59B 2XXWA 1ZU0A 3FXUA 2NXOA 5DTBA 1SI0A 4R9GA 1B3GA 3T9XB 4OEVA 4RNSA 2CZLA 5AE4A 1MRPA 4BDQA 3O97A 4G4PA 4YKPA 2AL4A 4F3GA 4EF2A 2Y7KA 4PQJA 5IKBA 4JB7A 3FV1A 3TELA 4H8IA 1RYOA 3IX1A 4NF5B 4O3CA 4LZ7A 1TFDA 2IEEA 1OLAA 2YLNA 3SEWA 4ZEFA 3OO6A 1O63A 1WDNA 2X26A 3I6VA 1PBPA 3LSLA 1DPEA 3BBRA 2QL3A 1XHYA 1OIBA 4FECA 3OO9A 4OFJA 3OXNA 1B3HA 3TYHA 5I57A 3ZKKA 2XXIA 1B9JA 3DP6A 3ZSFA 3PUZE 1AL3A 1LB8A 4Q0CA 4MLVA 4H0WA 1FTMA 5I2KB 5H8HA 3RT8A 3LBSA 4XKNA 4O3BA 1JW1A 1B4HA 2D5WA 3IB0A 3C32A 4U4XA 3M8UA 3WAEA 3H6UA 3FVGA 1BLFA 3D4CA 4F18A 3C9HA 1ZTYA 2RKMA 3PMXA 1UTHB 1SQYA 5FHNA 4EXKA 1N84A 3MW0A 2XX8A 2O7UA 4ELQA 3EHUA 2Y7IA 3TQLA 1RKMA 4F1VA 3M3KA 1Q35A 1B7ZA 3K00A 3S9NC 2O1LA 2A5SA 3K01A 2F36A 4ZZEA 1ZJLA 5TPAB 4LQ2A 4BLAA 3KG2A 5KCJA 4ESXA 3MAMA 2VD2A 3M3LA 1LAFE 2VHAA 4C1UA 5JK4A 3GBAA 4F3SA 1FQDA 2Q9TA 1DSNA 1URGA 2H99A 4DE8A 2YJPA 5I84A 1MH3A 4QFPA 1US5A 3CG3A 4ZS9A 1A54A 5A5XB 3CI8A 4GL0A 4U4SA 2AL5A 3K6XA 3M3FA 5L9SA 4H65A 5I59A 1JVYA 1QJMA 2OK2A 5ITPA 4OTEA 5DVIA 2X7QA 1NNTA 2RC8A 4EDPA 3PU5A 4HW8A 4ISUA 1GR2A 1ZLQA 4I9DA 1MPBA 3RNNA 3FGSA 1P1OA 4WEDA 5IAIA 1I6QA 5H8FB 2O51A 1MXYA 2Y7WA 2FNCA 4POWA 3V5AA 3H03A 3MC2A 1IXGA 1Z7NE 1PB7A 3IB1A 3FXRA 4QSCA 5JEIA 4NF5A 1PB8A 2M8CA 4THIA 5EYFA 3QIMA 1N7WA 3RTFB 3S2VA 4AQ4A 1R6ZA 1SW5A 3MVXA 3HPIA 1MPDA 4Z7EA 3O29A 1FQBA 1CE2A 3H4ZA 4KYDA 1TXFA 1FTKA 4LVQA 2XXUA 2KLFA 4U23A 1Q1KA 1M5BA 1GV8A 3KSJA 4R9FA 1RYXA 4F2QA 2CMOA 4P0IA 2Z22A 4BDLA 3MVWA 3FVNA 3KN8A 3MPKA 1FTJA 3W9VA 2XXXA 1B32A 1AOVA 3TZAA 3TAJA 1YTVA 4YMBA 1B58A 3V83A 4R6HA 2I6EA 2F7AA 1N76A 3OD7A 3TPAA 1VE4A 3PGFA 4NWCA 4G77A 4X1BA 4F2OA 1UTHA 1JW5A 4POXA 4KPTA 3OO7A 4GRKA 3R7XA 3O6GA 4JDFA 3FVKA 1R9LA 3PV0E 3ZKLA 2QS3A 4JWOA 3R26A 1SD3A 3EF7A 1P1QA 3HHFA 4YU0A 5LOMA 3CFZA 3V8XB 4Z0IA 4RYAA 3SERA 3UP9A 3KOSA 1B0LA 3H6WA 2ZNSA 2DE4A 4WKMA 4TQUQ 5TPAA 2Y7RA 1PDAA 1YCJA 3JYRA 4XXUA 2DXYA 1B4ZA 3UORA 1DTZA 1NKXA 1QKAA 3LR1A 2HCAA 1ZMGA 4FE8A 1M5CA 1YAEA 3CIJA 4FEBA 1M5DA 1NL5A 3LSXA 3CG1A 3G7WA 1POTA 1Y9UA 3T22A 1OMPA 4R72A 4ELOA 3OO8A 5ELVA 5A5XA 1QUJA 4OMBA 4H8JA 5J1DA 2AIXA 3VVEA 4U1OA 3SESA 3TDJA 4M4GA 4IO7A 4MBPA 3KGCA 2QPQA 4BDMA 2XXQA 1PB9A 1QKBA 2OBGA 2GHAA 3BKIB 4GLIA 4X9TA 4GL8A 3KN3A 1OVBA 3O6IA 5AA4B 3MWBA 3T66A 2UVIA 3T9VA 2P1SA 2F78A 5H8FA 2LAOA 2Y7PA 3QUFA 1FTLA 1ELJA 3MZ1A 4PFUA 3GXAA 1LLSA 2F6PA 3FJMA 3OMBA 4XKRA 1MQJA 5I58B 4QSEA 1MY1A 4JBZA 1IXHA 1MXWA 3K0VA 1MY2A 1DMBA 3MP1A 4PETA 2H25A 2RCAA 1VFEA 2QS2A 3PMVA 5ICQA 1MS7A 2PT2A 1LAXA 5JTYB 3DLNA 3EPEA 3K6VA 5KDTB 4DCXA 1B2HA 3I5OA 4YB5A 1KWHA 3MP8A 3KBRA 3VLUA 1USYE 4YKJA 4F3PA 3KEIA 3QYTA 2XHDA 1O64A 2QMWA 4LQ5A 1HSLA 4E0XA 1II5A 2VOZA 2NVUB 4OFOA 3L6GA 4MF3A 3K1MA 2REGA 1DPPA 2WKYA 4R2BA 4EQ9A 3UA8A 4IO5A 4AB5A 1FQCA 2XXRA 2P0SA 4OERA 1XVYA 5AA2A 3UK4A 4MFIA 3FZVA 2D3IA 3N6TA 5AA2D 3S9LC 4F19A 1N3WA 5CBSA 1OLCA 2F8DA 4P11A 1IXIA 2ZNUA 2DXRA 1B52A 2ZYNA 3RTWB 4GXAA 1NFTA 5ISUA 1QUKA 4IB2A 2I4CA 2HEUA 4G8MA 3W15C 4KYEA 3W9WA 4XTCQ 4F1UA 3OOAA 4WXJA 1BKAA 4U2RA 2X7PA 3T96B 5HBCA 2Y84A 1NH7A 1UIVA 1PBQA 3I3VA 3VVFA 1EH3A 3DP4A 4TLLB 1MXVA 3DELB 1DTGA 2OJTA 5AA3A 2QS1A 1LB9A 5K2YA 1JEUA 1D9YA 4QHQA 2XXVA 3MBPA 3N94A 4RK2A 2DS9A 1LFIA 4ZEIA 3TMGA 3TTNA 4ZE8A 3TODA 4F39A 1A8EA 4DIGA 3HN0A 3C36A 1IIWA 1H3DA 1Y20A 4YB7A 4OVJA 5AA4A 1LGBC 4X1DA 1T0KA 2ALUA 1Y1MA 1Y1ZA 5M2VA 3FUZA 3MZBA 3CSGA 5FHOA 3HHGA 4OQOA 1HSEA 2XD2A 3L6HA 1OVTA 2F7BA 1S50A 5I58A 2PVUA 5F7VA 1LBBA 3IOUA 3C31A 1MY3A 1AH5A 2V84A 1TWYA 5CM6A 2GH9A 2B3FA 3TTLA 3UGWA 1MQIA 2O84X 3GBBA 3A3UA 3JV9A 3U72A 1Y4CA 4OWDA 4NMYA 4EQBA 1P99A 1N0TA 3IAZA 5JTYA 2QRYA 2VD3A 5KDTA 1MXUA 1IZ1A 3LSWA 4ELRA 3K2DA 2ESNA 3FV2A 4IO3A 3BFUA 3MVZA 4FEDA 3LSFB 2XXTA 5CMMA 3MUQA 4FATA 3FD3A 1USYH 1B1HA 4O3AA 5DYHA 4F3BA 1FQAA 4ECFA 1ATGA 3OENA 4YAHX 2D21A 4NEDA 2REJA 3O2AA 1B7UA 3TKDA 3Q28A 4L17A 2XX9A 2G93A 4GF8A 3EHSA 2UVJA 2DSFA 2PX1A 3JZJA 4LATA 2ZMBA 1Y3PA 3SKPA 2UVGA 1IITA 1H76A 4NF4B 1M5EA 1JVXA 5EHMA 3TFLA 1SW2A 2A5TA 4TOZA 3UN6A 3VFJA 4KFQA 1SBPA 1FW0A 4K3FA 3LUYA 3HO7A 5TU0A 2OLBA 5DVFA 2IA4A 4IGRA 1N04A 5EHSA 1I69A 5I56A 2B3BA 4NF6B 5H8QB 3HSTA 1LFHA 4GIZA 2W7YA 3H3GA 3SEVA 4I1DA 2ANJA 3K1NA 2ONSA 1FCKA 4P0GA 2VP1A 4HCYA 1L5TA 1GGGA 2I3VA 4DZ1A 5HM4B 1SW4A 2RF1A 1I6AA 3VE1B 4RJZA 3RUMA 1B46A 4R6KA 3EN3A 3TTMA 1XC1A 1BIYA 3Q26A 1EZOA 2ABHA 3HV1A 4ONYA 3DP8A 4DXUA 1IXCA 3PPQA 1MY0A 4YZZA 1QULA 4ZE9A 2O7IA 2XXPA 4G8NA 1D4NA 2DE2A 5I2NB 4N13A 3IORA 4R6YA 3PPPA 4LP2B 2E0SA 5AA2B 4Q5TA 3H6TA 3THIA 4YICA 1JEVA 1EZPA 1ANFA 2FYIA 3RGYA 1SI1A 3H6VA 4ZEDA 2I0BA 2UXAA 2DQVA 2I0CA 4GD5A 3TCHA 2UYEA 4N6PA 3TTRA 5FTHA 1SVXB 5CMKA 1N3XA 2HQ0A 2HXWA 3G3KA 1SYHA 3Q27A 2Q2AA 2F97A 3MQ9A 2I49A 4H6DA 3OELA 1P1NA 1UQWA 5KZTA 4QFNA 3USDA 1URDA 5ITOA 4KHZE 2RC9A 2DWJA 2O69A 1MXZA 4FAJA 3SETA 3G3IA 3P7IA 1BTJA 1UTBB 1N7XA 4QRZA 1PEBA 2Q8JA 3IO6A 3S9MC 1FTOA 2NWJA 2H4IA 1JQFA 4M1VA 3B6TA 3PUVE 1QVSA 4DDDA 4GVOA 4GOTA 3QXMA 2PBWA 3MJNA 1QW0A 1US4A 4EQ7A 4NF8B 2NOOA 5BWJA 1A8FA 3R6UA 2Q2CA 2H98A 4XIGQ 3TCFA 4IGTA 3VLVA 4NF4A 3TCGA 3U93A 1B3EA 4IY5A 4IO6A 2FA7A 3H7MA 3RPWA 4IO4A 2DWAA 4QFKA 1AMFA 3VDFA 4R74A 2QSXA 3E13X 4GXSB 3KFMA 2HZKA 2RINA 1IQ7A 1OQGA 3MZ9A 3QK6A 4BDNA 4IY6A 4NF6A 3IJOB 5H8QA 4ELPA 4PE5B 1WVJA 3IL1B 1P1UA 3T9HB 4WEPA 4C1TA 3VV5A 1ZIUA 2V3UA 2I58A 4ZECA 2R9JA 1SYIA 3K6UA 3IO4A 1F9BA 4G2ZA 3FATA 3ONMA 1HSJA 3G3GA 2DYXA 2DWHA 1A7LA 4EXLA 4OHNA 4KCDA 4UA8A 2ZYOA 4OZ9A 2NUVA 1S7YA 2QJEA 1B0HA 2QMXA 5I2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAH E;  3B6Q A;  1B5H A;  1MDQ A;  5DEX B;  3T93 B;  3RT6 B;  3G3H A;  3CFX A;  5DT6 A;  2ZNT A;  3CR9 A;  3CSB A;  2O68 A;  1MM7 A;  3U94 A;  2A5T B;  2Z23 A;  3C33 A;  5CC2 A;  4KD5 A;  1MPC A;  3O9P A;  1I6B A;  4HS7 A;  5B7D A;  4LA9 A;  5FTI A;  2OWS A;  5B70 A;  2HAU A;  1M5F A;  1LAG E;  2UYF A;  1ZBM A;  3ECR A;  3IOT A;  1PC3 A;  3DM0 A;  2XX7 A;  4H67 A;  2P2A A;  5I56 B;  3FIR A;  4ND9 A;  1FQE A;  2DOJ A;  2F35 A;  1O7T A;  1UTB A;  4RPN A;  4RPO A;  4R2F A;  1XVX A;  4BDO A;  4DLD A;  2G29 A;  3C4M A;  3T9U A;  1MQD A;  3BFT A;  1P1W A;  3VLW A;  2DP8 A;  1A40 A;  2PMS A;  4DXB A;  1D3K A;  3C34 A;  1B7H A;  4MH5 A;  1LBC A;  3MPL A;  3RQT A;  3V89 B;  3S9E A;  2HZL A;  1NH8 A;  4KYS A;  1TFA A;  4XKP A;  2F34 A;  4RA1 A;  3MVY A;  4NF8 A;  3HCQ A;  2OZZ A;  3FJG A;  1CB6 A;  3KN7 A;  3QAX A;  2ZYK A;  2I4B A;  4ZDM A;  1URS A;  4OFL A;  3PMW A;  1Y4T A;  3RY3 A;  1GVC A;  5CBR A;  3U92 A;  3OEM A;  3SEX A;  1TT1 A;  4F29 A;  3K02 A;  4N07 A;  2HAV A;  2DVZ A;  1LCT A;  5CI5 A;  2H9B A;  3FVO A;  1R9Q A;  1EU8 A;  1FQF A;  2ONK E;  3KJ7 A;  2RCB A;  1S9T A;  2Z8E A;  3GLB A;  5FHM A;  3EHT A;  1VFD A;  4QFL A;  2UVH A;  4EUO A;  1AIV A;  3CFL A;  1MG1 A;  4KQP A;  3G3J A;  4G68 C;  1B1X A;  3CVG A;  3WAF A;  2V3Q A;  1JNF A;  2PYY A;  3F11 A;  1A55 A;  2E1S A;  1IEJ A;  1Y3Q A;  2DVC A;  2OWT A;  3TQW A;  3CRB A;  1LFG A;  3AXF A;  4QFO A;  5H8S A;  1J1N A;  3G3F A;  4JWY A;  4DCY A;  5H8N B;  4H1X A;  4RXL A;  4LZ5 A;  4PP0 A;  1NMU A;  4KCC A;  4Q8R A;  1XS5 A;  1A99 A;  3ILT B;  2R6G E;  4FIM A;  4OEN A;  1B3L A;  3PUX E;  3OEK A;  2F5X A;  5DEX A;  4G8H A;  5K2X A;  2QS4 A;  4U21 A;  4FJP A;  4LZ8 A;  4OET A;  2YPN A;  4XKQ A;  4R73 A;  4G68 B;  3PUW E;  1SW1 A;  3SDF A;  4RK9 A;  3PPO A;  4OES A;  1MQH A;  1VSO A;  1NNK A;  4YMA A;  1MH4 A;  1B3F A;  2O6A A;  4PFY A;  5TP9 B;  2Q88 A;  3QSL A;  3GZG A;  4UAC A;  3VXC A;  4JSO A;  5ICT A;  2RC7 A;  2Q89 A;  4NTL A;  3SEU A;  4YKI A;  3B6W A;  3IK6 B;  4BDR A;  1MXX A;  3IR1 A;  4OEU A;  4JWX A;  3KJT A;  4FOR A;  1B40 A;  4H5F A;  4OXV A;  2GFE A;  2I3W A;  3Q29 A;  4JXI A;  3K6W A;  3A3C A;  1B51 A;  4QF9 A;  4R75 A;  1JET A;  4EF1 A;  3KZG A;  3FXQ A;  3RLF E;  1MQG A;  4GFR A;  4ZEB A;  3IOW A;  4LON B;  3FJ7 A;  3LC8 A;  1EZ9 A;  3PD9 A;  1LCF A;  4OYV A;  3E4R A;  3OSQ A;  5I2K A;  3U8Q A;  2PT1 A;  4U1Z A;  3TTK A;  4E0W A;  4TLM B;  4JSD A;  2V3T A;  1IUD A;  3TUS A;  4RY1 A;  1JW4 A;  5AA1 A;  3N5L A;  3EQ1 A;  1DOT A;  2Z8F A;  5BUU A;  3QUJ A;  1H45 A;  1MM6 A;  2BJJ X;  4HTG A;  4NE4 A;  4QSD A;  2V25 A;  3UIF A;  4Q30 B;  1SDX A;  5CRY A;  2ZYM A;  1NNF A;  4ESW A;  2GHB A;  4KR5 A;  3O66 A;  2Z8D A;  1B6H A;  1UIU A;  3E3K A;  2XD3 A;  1B05 A;  4C0R A;  2O1M A;  1ZKB A;  2V93 A;  3K1P A;  4PFT A;  1WOD A;  1H44 A;  5CMB A;  2GRV A;  2VGQ A;  3D4G A;  3O28 A;  2B65 A;  4YB6 A;  3ILU B;  2F6G A;  1MDP 1;  3H06 B;  3IJX B;  2DE3 A;  5H8N A;  3A09 A;  4ZEK A;  5CMC A;  2OCU A;  5I57 B;  1B5I A;  3IB2 A;  3IOV A;  4GWO A;  3VXB A;  3O6H A;  1R1N A;  1MY4 A;  3MP6 A;  1H43 A;  3B7D A;  3PUY E;  2H5Y A;  3RN8 A;  2I48 A;  5H8H B;  4MLQ A;  3ZS6 A;  1Y3N A;  2THI A;  1POY 1;  3PPR A;  4G68 A;  4I62 A;  3S4U A;  2XXH A;  5L9O A;  2HFB A;  1B5J A;  3PD8 A;  3SEY A;  5TP9 A;  2DWI A;  4H5G A;  4F22 A;  3KOT A;  3TEP A;  1OQH A;  3N26 A;  1YPN A;  1D9V A;  3K4U A;  4KI0 E;  4U22 A;  4F31 B;  4PFW A;  4NWD A;  4I8C A;  1Z7M E;  4AB6 A;  5KCJ B;  3ODB A;  1QUI A;  3VVD A;  1XT8 A;  1XOC A;  1BP5 A;  4HCW A;  4GQO A;  2XXY A;  5F1Q A;  2AYS A;  3Q25 A;  3FAS A;  5L8D A;  3U1O A;  4DXC A;  5HPQ A;  2ZXT A;  2ONR A;  3PPN A;  3KSX A;  4LUB A;  4X48 A;  3E9X A;  4YKK A;  4IO2 A;  2F7C A;  5DVJ A;  5L9M A;  3N6U A;  4ZZA A;  1LST A;  2R71 A;  1VR5 A;  4F1Y A;  3C35 A;  1GTK A;  3OSR A;  1NNP A;  5I59 B;  2XXW A;  1ZU0 A;  3FXU A;  2NXO A;  5DTB A;  1SI0 A;  4R9G A;  1B3G A;  3T9X B;  4OEV A;  4RNS A;  2CZL A;  5AE4 A;  1MRP A;  4BDQ A;  3O97 A;  4G4P A;  4YKP A;  2AL4 A;  4F3G A;  4EF2 A;  2Y7K A;  4PQJ A;  5IKB A;  4JB7 A;  3FV1 A;  3TEL A;  4H8I A;  1RYO A;  3IX1 A;  4NF5 B;  4O3C A;  4LZ7 A;  1TFD A;  2IEE A;  1OLA A;  2YLN A;  3SEW A;  4ZEF A;  3OO6 A;  1O63 A;  1WDN A;  2X26 A;  3I6V A;  1PBP A;  3LSL A;  1DPE A;  3BBR A;  2QL3 A;  1XHY A;  1OIB A;  4FEC A;  3OO9 A;  4OFJ A;  3OXN A;  1B3H A;  3TYH A;  5I57 A;  3ZKK A;  2XXI A;  1B9J A;  3DP6 A;  3ZSF A;  3PUZ E;  1AL3 A;  1LB8 A;  4Q0C A;  4MLV A;  4H0W A;  1FTM A;  5I2K B;  5H8H A;  3RT8 A;  3LBS A;  4XKN A;  4O3B A;  1JW1 A;  1B4H A;  2D5W A;  3IB0 A;  3C32 A;  4U4X A;  3M8U A;  3WAE A;  3H6U A;  3FVG A;  1BLF A;  3D4C A;  4F18 A;  3C9H A;  1ZTY A;  2RKM A;  3PMX A;  1UTH B;  1SQY A;  5FHN A;  4EXK A;  1N84 A;  3MW0 A;  2XX8 A;  2O7U A;  4ELQ A;  3EHU A;  2Y7I A;  3TQL A;  1RKM A;  4F1V A;  3M3K A;  1Q35 A;  1B7Z A;  3K00 A;  3S9N C;  2O1L A;  2A5S A;  3K01 A;  2F36 A;  4ZZE A;  1ZJL A;  5TPA B;  4LQ2 A;  4BLA A;  3KG2 A;  5KCJ A;  4ESX A;  3MAM A;  2VD2 A;  3M3L A;  1LAF E;  2VHA A;  4C1U A;  5JK4 A;  3GBA A;  4F3S A;  1FQD A;  2Q9T A;  1DSN A;  1URG A;  2H99 A;  4DE8 A;  2YJP A;  5I84 A;  1MH3 A;  4QFP A;  1US5 A;  3CG3 A;  4ZS9 A;  1A54 A;  5A5X B;  3CI8 A;  4GL0 A;  4U4S A;  2AL5 A;  3K6X A;  3M3F A;  5L9S A;  4H65 A;  5I59 A;  1JVY A;  1QJM A;  2OK2 A;  5ITP A;  4OTE A;  5DVI A;  2X7Q A;  1NNT A;  2RC8 A;  4EDP A;  3PU5 A;  4HW8 A;  4ISU A;  1GR2 A;  1ZLQ A;  4I9D A;  1MPB A;  3RNN A;  3FGS A;  1P1O A;  4WED A;  5IAI A;  1I6Q A;  5H8F B;  2O51 A;  1MXY A;  2Y7W A;  2FNC A;  4POW A;  3V5A A;  3H03 A;  3MC2 A;  1IXG A;  1Z7N E;  1PB7 A;  3IB1 A;  3FXR A;  4QSC A;  5JEI A;  4NF5 A;  1PB8 A;  2M8C A;  4THI A;  5EYF A;  3QIM A;  1N7W A;  3RTF B;  3S2V A;  4AQ4 A;  1R6Z A;  1SW5 A;  3MVX A;  3HPI A;  1MPD A;  4Z7E A;  3O29 A;  1FQB A;  1CE2 A;  3H4Z A;  4KYD A;  1TXF A;  1FTK A;  4LVQ A;  2XXU A;  2KLF A;  4U23 A;  1Q1K A;  1M5B A;  1GV8 A;  3KSJ A;  4R9F A;  1RYX A;  4F2Q A;  2CMO A;  4P0I A;  2Z22 A;  4BDL A;  3MVW A;  3FVN A;  3KN8 A;  3MPK A;  1FTJ A;  3W9V A;  2XXX A;  1B32 A;  1AOV A;  3TZA A;  3TAJ A;  1YTV A;  4YMB A;  1B58 A;  3V83 A;  4R6H A;  2I6E A;  2F7A A;  1N76 A;  3OD7 A;  3TPA A;  1VE4 A;  3PGF A;  4NWC A;  4G77 A;  4X1B A;  4F2O A;  1UTH A;  1JW5 A;  4POX A;  4KPT A;  3OO7 A;  4GRK A;  3R7X A;  3O6G A;  4JDF A;  3FVK A;  1R9L A;  3PV0 E;  3ZKL A;  2QS3 A;  4JWO A;  3R26 A;  1SD3 A;  3EF7 A;  1P1Q A;  3HHF A;  4YU0 A;  5LOM A;  3CFZ A;  3V8X B;  4Z0I A;  4RYA A;  3SER A;  3UP9 A;  3KOS A;  1B0L A;  3H6W A;  2ZNS A;  2DE4 A;  4WKM A;  4TQU Q;  5TPA A;  2Y7R A;  1PDA A;  1YCJ A;  3JYR A;  4XXU A;  2DXY A;  1B4Z A;  3UOR A;  1DTZ A;  1NKX A;  1QKA A;  3LR1 A;  2HCA A;  1ZMG A;  4FE8 A;  1M5C A;  1YAE A;  3CIJ A;  4FEB A;  1M5D A;  1NL5 A;  3LSX A;  3CG1 A;  3G7W A;  1POT A;  1Y9U A;  3T22 A;  1OMP A;  4R72 A;  4ELO A;  3OO8 A;  5ELV A;  5A5X A;  1QUJ A;  4OMB A;  4H8J A;  5J1D A;  2AIX A;  3VVE A;  4U1O A;  3SES A;  3TDJ A;  4M4G A;  4IO7 A;  4MBP A;  3KGC A;  2QPQ A;  4BDM A;  2XXQ A;  1PB9 A;  1QKB A;  2OBG A;  2GHA A;  3BKI B;  4GLI A;  4X9T A;  4GL8 A;  3KN3 A;  1OVB A;  3O6I A;  5AA4 B;  3MWB A;  3T66 A;  2UVI A;  3T9V A;  2P1S A;  2F78 A;  5H8F A;  2LAO A;  2Y7P A;  3QUF A;  1FTL A;  1ELJ A;  3MZ1 A;  4PFU A;  3GXA A;  1LLS A;  2F6P A;  3FJM A;  3OMB A;  4XKR A;  1MQJ A;  5I58 B;  4QSE A;  1MY1 A;  4JBZ A;  1IXH A;  1MXW A;  3K0V A;  1MY2 A;  1DMB A;  3MP1 A;  4PET A;  2H25 A;  2RCA A;  1VFE A;  2QS2 A;  3PMV A;  5ICQ A;  1MS7 A;  2PT2 A;  1LAX A;  5JTY B;  3DLN A;  3EPE A;  3K6V A;  5KDT B;  4DCX A;  1B2H A;  3I5O A;  4YB5 A;  1KWH A;  3MP8 A;  3KBR A;  3VLU A;  1USY E;  4YKJ A;  4F3P A;  3KEI A;  3QYT A;  2XHD A;  1O64 A;  2QMW A;  4LQ5 A;  1HSL A;  4E0X A;  1II5 A;  2VOZ A;  2NVU B;  4OFO A;  3L6G A;  4MF3 A;  3K1M A;  2REG A;  1DPP A;  2WKY A;  4R2B A;  4EQ9 A;  3UA8 A;  4IO5 A;  4AB5 A;  1FQC A;  2XXR A;  2P0S A;  4OER A;  1XVY A;  5AA2 A;  3UK4 A;  4MFI A;  3FZV A;  2D3I A;  3N6T A;  5AA2 D;  3S9L C;  4F19 A;  1N3W A;  5CBS A;  1OLC A;  2F8D A;  4P11 A;  1IXI A;  2ZNU A;  2DXR A;  1B52 A;  2ZYN A;  3RTW B;  4GXA A;  1NFT A;  5ISU A;  1QUK A;  4IB2 A;  2I4C A;  2HEU A;  4G8M A;  3W15 C;  4KYE A;  3W9W A;  4XTC Q;  4F1U A;  3OOA A;  4WXJ A;  1BKA A;  4U2R A;  2X7P A;  3T96 B;  5HBC A;  2Y84 A;  1NH7 A;  1UIV A;  1PBQ A;  3I3V A;  3VVF A;  1EH3 A;  3DP4 A;  4TLL B;  1MXV A;  3DEL B;  1DTG A;  2OJT A;  5AA3 A;  2QS1 A;  1LB9 A;  5K2Y A;  1JEU A;  1D9Y A;  4QHQ A;  2XXV A;  3MBP A;  3N94 A;  4RK2 A;  2DS9 A;  1LFI A;  4ZEI A;  3TMG A;  3TTN A;  4ZE8 A;  3TOD A;  4F39 A;  1A8E A;  4DIG A;  3HN0 A;  3C36 A;  1IIW A;  1H3D A;  1Y20 A;  4YB7 A;  4OVJ A;  5AA4 A;  1LGB C;  4X1D A;  1T0K A;  2ALU A;  1Y1M A;  1Y1Z A;  5M2V A;  3FUZ A;  3MZB A;  3CSG A;  5FHO A;  3HHG A;  4OQO A;  1HSE A;  2XD2 A;  3L6H A;  1OVT A;  2F7B A;  1S50 A;  5I58 A;  2PVU A;  5F7V A;  1LBB A;  3IOU A;  3C31 A;  1MY3 A;  1AH5 A;  2V84 A;  1TWY A;  5CM6 A;  2GH9 A;  2B3F A;  3TTL A;  3UGW A;  1MQI A;  2O84 X;  3GBB A;  3A3U A;  3JV9 A;  3U72 A;  1Y4C A;  4OWD A;  4NMY A;  4EQB A;  1P99 A;  1N0T A;  3IAZ A;  5JTY A;  2QRY A;  2VD3 A;  5KDT A;  1MXU A;  1IZ1 A;  3LSW A;  4ELR A;  3K2D A;  2ESN A;  3FV2 A;  4IO3 A;  3BFU A;  3MVZ A;  4FED A;  3LSF B;  2XXT A;  5CMM A;  3MUQ A;  4FAT A;  3FD3 A;  1USY H;  1B1H A;  4O3A A;  5DYH A;  4F3B A;  1FQA A;  4ECF A;  1ATG A;  3OEN A;  4YAH X;  2D21 A;  4NED A;  2REJ A;  3O2A A;  1B7U A;  3TKD A;  3Q28 A;  4L17 A;  2XX9 A;  2G93 A;  4GF8 A;  3EHS A;  2UVJ A;  2DSF A;  2PX1 A;  3JZJ A;  4LAT A;  2ZMB A;  1Y3P A;  3SKP A;  2UVG A;  1IIT A;  1H76 A;  4NF4 B;  1M5E A;  1JVX A;  5EHM A;  3TFL A;  1SW2 A;  2A5T A;  4TOZ A;  3UN6 A;  3VFJ A;  4KFQ A;  1SBP A;  1FW0 A;  4K3F A;  3LUY A;  3HO7 A;  5TU0 A;  2OLB A;  5DVF A;  2IA4 A;  4IGR A;  1N04 A;  5EHS A;  1I69 A;  5I56 A;  2B3B A;  4NF6 B;  5H8Q B;  3HST A;  1LFH A;  4GIZ A;  2W7Y A;  3H3G A;  3SEV A;  4I1D A;  2ANJ A;  3K1N A;  2ONS A;  1FCK A;  4P0G A;  2VP1 A;  4HCY A;  1L5T A;  1GGG A;  2I3V A;  4DZ1 A;  5HM4 B;  1SW4 A;  2RF1 A;  1I6A A;  3VE1 B;  4RJZ A;  3RUM A;  1B46 A;  4R6K A;  3EN3 A;  3TTM A;  1XC1 A;  1BIY A;  3Q26 A;  1EZO A;  2ABH A;  3HV1 A;  4ONY A;  3DP8 A;  4DXU A;  1IXC A;  3PPQ A;  1MY0 A;  4YZZ A;  1QUL A;  4ZE9 A;  2O7I A;  2XXP A;  4G8N A;  1D4N A;  2DE2 A;  5I2N B;  4N13 A;  3IOR A;  4R6Y A;  3PPP A;  4LP2 B;  2E0S A;  5AA2 B;  4Q5T A;  3H6T A;  3THI A;  4YIC A;  1JEV A;  1EZP A;  1ANF A;  2FYI A;  3RGY A;  1SI1 A;  3H6V A;  4ZED A;  2I0B A;  2UXA A;  2DQV A;  2I0C A;  4GD5 A;  3TCH A;  2UYE A;  4N6P A;  3TTR A;  5FTH A;  1SVX B;  5CMK A;  1N3X A;  2HQ0 A;  2HXW A;  3G3K A;  1SYH A;  3Q27 A;  2Q2A A;  2F97 A;  3MQ9 A;  2I49 A;  4H6D A;  3OEL A;  1P1N A;  1UQW A;  5KZT A;  4QFN A;  3USD A;  1URD A;  5ITO A;  4KHZ E;  2RC9 A;  2DWJ A;  2O69 A;  1MXZ A;  4FAJ A;  3SET A;  3G3I A;  3P7I A;  1BTJ A;  1UTB B;  1N7X A;  4QRZ A;  1PEB A;  2Q8J A;  3IO6 A;  3S9M C;  1FTO A;  2NWJ A;  2H4I A;  1JQF A;  4M1V A;  3B6T A;  3PUV E;  1QVS A;  4DDD A;  4GVO A;  4GOT A;  3QXM A;  2PBW A;  3MJN A;  1QW0 A;  1US4 A;  4EQ7 A;  4NF8 B;  2NOO A;  5BWJ A;  1A8F A;  3R6U A;  2Q2C A;  2H98 A;  4XIG Q;  3TCF A;  4IGT A;  3VLV A;  4NF4 A;  3TCG A;  3U93 A;  1B3E A;  4IY5 A;  4IO6 A;  2FA7 A;  3H7M A;  3RPW A;  4IO4 A;  2DWA A;  4QFK A;  1AMF A;  3VDF A;  4R74 A;  2QSX A;  3E13 X;  4GXS B;  3KFM A;  2HZK A;  2RIN A;  1IQ7 A;  1OQG A;  3MZ9 A;  3QK6 A;  4BDN A;  4IY6 A;  4NF6 A;  3IJO B;  5H8Q A;  4ELP A;  4PE5 B;  1WVJ A;  3IL1 B;  1P1U A;  3T9H B;  4WEP A;  4C1T A;  3VV5 A;  1ZIU A;  2V3U A;  2I58 A;  4ZEC A;  2R9J A;  1SYI A;  3K6U A;  3IO4 A;  1F9B A;  4G2Z A;  3FAT A;  3ONM A;  1HSJ A;  3G3G A;  2DYX A;  2DWH A;  1A7L A;  4EXL A;  4OHN A;  4KCD A;  4UA8 A;  2ZYO A;  4OZ9 A;  2NUV A;  1S7Y A;  2QJE A;  1B0H A;  2QMX A;  5I2N A; 
#chains in the Genus database with same CATH topology
 1LAH E;  3B6Q A;  1IMA A;  1B5H A;  1MDQ A;  5DEX B;  3T93 B;  3RT6 B;  3G3H A;  3CFX A;  5DT6 A;  1FPE A;  2ZNT A;  3CR9 A;  4O8M A;  2XWV A;  3CSB A;  2O68 A;  1MM7 A;  3U94 A;  2A5T B;  2Z23 A;  1FBH A;  3C33 A;  1DCU A;  4KD5 A;  5CC2 A;  3IFA A;  1MPC A;  3O9P A;  1I6B A;  4HS7 A;  5B7D A;  4LA9 A;  4O7M A;  2OWS A;  5FTI A;  5B70 A;  2HAU A;  4PF6 A;  1M5F A;  4NX1 A;  1LAG E;  1G0I A;  2UYF A;  1ZBM A;  3ECR A;  3IOT A;  2CZK A;  1PC3 A;  2ZZV A;  3DM0 A;  4HE2 A;  2XX7 A;  4H67 A;  2P2A A;  5I56 B;  3FIR A;  4ND9 A;  1FQE A;  2DOJ A;  2F35 A;  1O7T A;  1UTB A;  4RPN A;  4P56 A;  4RPO A;  4R2F A;  1XVX A;  4BDO A;  4DLD A;  5F24 A;  2G29 A;  3C4M A;  3T9U A;  1MQD A;  3BFT A;  1P1W A;  3VLW A;  2DP8 A;  1A40 A;  2PMS A;  3PTY A;  4XEQ A;  1NV6 A;  4DXB A;  1D3K A;  3C34 A;  4N6D A;  1B7H A;  4MH5 A;  1LBC A;  3MPL A;  3RQT A;  3V89 B;  3S9E A;  2HZL A;  1NH8 A;  4KYS A;  1TFA A;  4XKP A;  2F34 A;  4RA1 A;  3MVY A;  1IMD A;  4NF8 A;  3HCQ A;  2OZZ A;  3FJG A;  1CB6 A;  3KN7 A;  3QAX A;  2ZYK A;  2I4B A;  4ZDM A;  1URS A;  4OFL A;  3PMW A;  1Y4T A;  3RY3 A;  1GVC A;  5CBR A;  3U92 A;  3OEM A;  2HHM A;  3SEX A;  3KC0 A;  1NV0 A;  2Y5L A;  1TT1 A;  4F29 A;  3U65 A;  3K02 A;  4N07 A;  1FPD A;  2HAV A;  2DVZ A;  1LCT A;  5CI5 A;  2H9B A;  3FVO A;  1R9Q A;  1EU8 A;  1FQF A;  2ONK E;  3KJ7 A;  2QVV A;  2RCB A;  1AWB A;  1S9T A;  4X8R A;  2Z8E A;  3GLB A;  5EYH A;  5FHM A;  3EHT A;  1VFD A;  4QFL A;  2UVH A;  1IMF A;  4EUO A;  1AIV A;  3CFL A;  1MG1 A;  4KQP A;  1YZ0 A;  3G3J A;  4G68 C;  2XWI A;  1B1X A;  3CVG A;  3WAF A;  2V3Q A;  1JNF A;  2PYY A;  3F11 A;  1A55 A;  2E1S A;  1IEJ A;  1Y3Q A;  2DVC A;  1BK4 A;  2OWT A;  3TQW A;  3CRB A;  1LFG A;  3AXF A;  4QFO A;  5H8S A;  1J1N A;  3G3F A;  4JWY A;  2WEF A;  2CZH A;  4DCY A;  5H8N B;  4H1X A;  4RXL A;  4LZ5 A;  4PP0 A;  4NG7 A;  1NMU A;  4KCC A;  4Q8R A;  1XS5 A;  1A99 A;  3ILT B;  2R6G E;  4FIM A;  4OEN A;  1B3L A;  3PUX E;  3OEK A;  2F5X A;  5DEX A;  4G8H A;  5K2X A;  2F3B A;  2QS4 A;  2WYP A;  2FVZ A;  4PGN A;  4U21 A;  4FJP A;  4LZ8 A;  4OET A;  2YPN A;  4XKQ A;  4R73 A;  4G68 B;  3PUW E;  1SW1 A;  3SDF A;  4HXV A;  4PC9 A;  4RK9 A;  3PPO A;  4OES A;  1MQH A;  1VSO A;  1NNK A;  4YMA A;  1MH4 A;  1B3F A;  2O6A A;  4PFY A;  5TP9 B;  2Q88 A;  3QSL A;  3GZG A;  4UAC A;  3VXC A;  4JSO A;  5ICT A;  2RC7 A;  3NOH A;  2Q89 A;  4NTL A;  3SEU A;  4YKI A;  3B6W A;  3IK6 B;  4BDR A;  4PDD A;  1MXX A;  3IR1 A;  4OEU A;  4JWX A;  3KJT A;  4FOR A;  1B40 A;  4H5F A;  4OXV A;  2GFE A;  5ET5 A;  1EYI A;  2FHY A;  2I3W A;  3E79 A;  3Q29 A;  4JXI A;  3K6W A;  3A3C A;  1B51 A;  4QF9 A;  4R75 A;  4IR8 A;  1JET A;  4EF1 A;  1NV5 A;  3KZG A;  1NUZ A;  3MYU A;  2XA5 A;  4N8G A;  3FXQ A;  3RLF E;  1MQG A;  4GFR A;  4ZEB A;  3IOW A;  4GWY A;  4LON B;  3FJ7 A;  3LC8 A;  1EZ9 A;  3FBP A;  4MNP A;  3PD9 A;  1LCF A;  4OYV A;  3E4R A;  3OSQ A;  1EYK A;  5I2K A;  3U8Q A;  2PT1 A;  4U1Z A;  3TTK A;  5EYG A;  4E0W A;  4PFI A;  4TLM B;  4JSD A;  2V3T A;  1LBY A;  1IUD A;  3TUS A;  4RY1 A;  1JW4 A;  5AA1 A;  3N5L A;  1FPK A;  3EQ1 A;  1DOT A;  2Z8F A;  5BUU A;  3QUJ A;  1H45 A;  5ESY A;  1MM6 A;  4O94 A;  2BJJ X;  1FBG A;  4HTG A;  4NE4 A;  4QSD A;  2V25 A;  3UIF A;  4Q30 B;  1SDX A;  1IMC A;  5CRY A;  2ZYM A;  1NNF A;  4ESW A;  2GHB A;  2Q74 A;  4KR5 A;  3O66 A;  2Z8D A;  1B6H A;  4G61 A;  1FSA A;  1UIU A;  4PAK A;  3E3K A;  2XD3 A;  1B05 A;  4C0R A;  2O1M A;  5EQ7 A;  1ZKB A;  2V93 A;  3K1P A;  4PFT A;  4P8B A;  1WOD A;  1H44 A;  5CMB A;  2GRV A;  2VGQ A;  3D4G A;  4N15 A;  3O28 A;  2B65 A;  4YB6 A;  4MCO A;  3ILU B;  2F6G A;  1MDP 1;  3H06 B;  3HFU A;  3IJX B;  1RDX A;  2DE3 A;  2WBB A;  5H8N A;  3A09 A;  1QGX A;  4ZEK A;  5CMC A;  2OCU A;  5I57 B;  1B5I A;  4N6K A;  3IB2 A;  3IOV A;  4GWO A;  3VXB A;  3O6H A;  1R1N A;  1MY4 A;  3MP6 A;  1H43 A;  4MAG A;  3B7D A;  3PUY E;  2H5Y A;  3RN8 A;  4OVR A;  2I48 A;  5H8H B;  4MLQ A;  3ZS6 A;  1Y3N A;  2THI A;  1POY 1;  5FBP A;  3PPR A;  4G68 A;  4I62 A;  3S4U A;  2XXH A;  5L9O A;  2HFB A;  1B5J A;  2ZZX A;  3PD8 A;  3SEY A;  5TP9 A;  2WBD A;  4JVC A;  2DWI A;  4P1L A;  4H5G A;  4GBW A;  4F22 A;  3KOT A;  3TEP A;  1OQH A;  3N26 A;  1YPN A;  1D9V A;  3K4U A;  4KI0 E;  4U22 A;  4F31 B;  3A29 A;  4PFW A;  4NWD A;  4PFB A;  4I8C A;  5DW8 A;  1Z7M E;  4AB6 A;  5KCJ B;  3ODB A;  1QUI A;  3VVD A;  4JVI A;  1XT8 A;  1XOC A;  1BP5 A;  4HCW A;  4GQO A;  2XXY A;  5F1Q A;  2AYS A;  3Q25 A;  3FAS A;  5L8D A;  3U1O A;  4DXC A;  5HPQ A;  2ZXT A;  2ONR A;  3PPN A;  3KSX A;  4LUB A;  4UAB A;  4X48 A;  3E9X A;  4YKK A;  5A5L A;  4IO2 A;  2F7C A;  5DVJ A;  5L9M A;  3N6U A;  1YXI A;  4ZZA A;  1LST A;  1YYZ A;  2R71 A;  1VR5 A;  3FXB A;  4DI4 B;  4F1Y A;  1FPG A;  3C35 A;  1GTK A;  3OSR A;  1NNP A;  5I59 B;  2XXW A;  1ZU0 A;  3FXU A;  3GYY A;  2NXO A;  5DTB A;  1SI0 A;  4R9G A;  1B3G A;  3T9X B;  4OEV A;  4XFE A;  4RNS A;  2CZL A;  5AE4 A;  2KR0 A;  1MRP A;  2V4C A;  4BDQ A;  3O97 A;  4G4P A;  4YKP A;  2AL4 A;  4F3G A;  4EF2 A;  2Y7K A;  4PQJ A;  5IKB A;  4JB7 A;  3FV1 A;  3TEL A;  4H8I A;  1RYO A;  3IX1 A;  4NF5 B;  2FIX A;  3ISP A;  4O3C A;  4LZ7 A;  1TFD A;  2IEE A;  1OLA A;  2YLN A;  3SEW A;  1K9Y A;  1NV3 A;  4ZEF A;  1FBD A;  2F3D A;  3OO6 A;  1O63 A;  1WDN A;  2X26 A;  5LDZ A;  3I6V A;  1PBP A;  3LSL A;  1DPE A;  3KBZ A;  3BBR A;  2QL3 A;  1OIB A;  1XHY A;  4FEC A;  3OO9 A;  4OFJ A;  3OXN A;  1B3H A;  2FIE A;  5J16 A;  5LTC A;  3TYH A;  5T3J A;  5I57 A;  3ZKK A;  2XXI A;  1B9J A;  3DP6 A;  3ZSF A;  3PUZ E;  1D9Q A;  1AL3 A;  1LB8 A;  4Q0C A;  4MLV A;  4H0W A;  1FTM A;  5I2K B;  5H8H A;  3RT8 A;  3LBS A;  4XKN A;  4O3B A;  1JW1 A;  1B4H A;  3CHG A;  2D5W A;  4PAF A;  3IB0 A;  3C32 A;  4U4X A;  3M8U A;  3H6U A;  2MKZ A;  3WAE A;  3FVG A;  1BLF A;  3D4C A;  4F18 A;  3C9H A;  1ZTY A;  2RKM A;  3PMX A;  1UTH B;  1SQY A;  5FHN A;  4EXK A;  1N84 A;  3MW0 A;  2XX8 A;  4N17 A;  2O7U A;  4ELQ A;  2PFY A;  1DBZ A;  3EHU A;  4GX6 A;  2Y7I A;  3TQL A;  2DDK A;  1RKM A;  2P3N A;  4F1V A;  3M3K A;  1Q35 A;  2VPO A;  1B7Z A;  1CNQ A;  3K00 A;  4KXP A;  3S9N C;  2O1L A;  2A5S A;  3K01 A;  2F36 A;  4ZZE A;  1ZJL A;  5TPA B;  1FPF A;  4LQ2 A;  4BLA A;  3KG2 A;  3T0J A;  5KCJ A;  4ESX A;  3MAM A;  4AS4 A;  2VD2 A;  3M3L A;  1LAF E;  2VHA A;  4C1U A;  5JK4 A;  3GBA A;  4F3S A;  1FQD A;  2Q9T A;  2QFL A;  1DSN A;  3ROJ A;  1URG A;  1NV2 A;  2P3V A;  4I3E A;  4PTK A;  2H99 A;  4DE8 A;  2YJP A;  5I84 A;  3LV0 A;  1MH3 A;  4QFP A;  4HE1 A;  4MIJ A;  1US5 A;  3CG3 A;  4ZS9 A;  3LUZ A;  1A54 A;  5A5X B;  3CI8 A;  4GL0 A;  4U4S A;  2AL5 A;  3K6X A;  3M3F A;  5ET6 A;  5I3S A;  4N4U A;  5L9S A;  4H65 A;  2CEX A;  5I59 A;  5ET7 A;  1JVY A;  1QJM A;  4PGP A;  2OK2 A;  5ITP A;  5IZZ A;  4OTE A;  2BJI A;  5DVI A;  2X7Q A;  1NNT A;  2RC8 A;  4EDP A;  3PU5 A;  4HW8 A;  4ISU A;  1GR2 A;  1ZLQ A;  4I9D A;  1MPB A;  3T1B A;  3RNN A;  4OVQ A;  3FGS A;  1EYJ A;  1P1O A;  4WED A;  5IAI A;  1I6Q A;  5H8F B;  2O51 A;  2R8T A;  4P3L A;  1MXY A;  2Y7W A;  2FNC A;  4POW A;  3V5A A;  3H03 A;  3MC2 A;  1IXG A;  1Z7N E;  1PB7 A;  3IB1 A;  3FXR A;  4QSC A;  5JEI A;  4NF5 A;  1PB8 A;  4GWZ A;  2M8C A;  4THI A;  5EYF A;  3IFC A;  3QIM A;  1N7W A;  1RDY A;  3RTF B;  3S2V A;  4AQ4 A;  1R6Z A;  1SW5 A;  3MVX A;  2JJK A;  3HPI A;  1MPD A;  4Z7E A;  3O29 A;  1FQB A;  4JVD A;  1CE2 A;  5EQA A;  3H4Z A;  4KYD A;  1TXF A;  1FTK A;  4LVQ A;  2XXU A;  2KLF A;  4U23 A;  1Q1K A;  1LBW A;  1M5B A;  1GV8 A;  3KSJ A;  4R9F A;  1RYX A;  4F2Q A;  2CMO A;  4P0I A;  2Z22 A;  4BDL A;  3MVW A;  2VT5 A;  5IGA A;  4LN5 A;  3FVN A;  3KN8 A;  3MPK A;  1FTJ A;  3W9V A;  2XXX A;  1B32 A;  1AOV A;  3TZA A;  3TAJ A;  1YTV A;  4YMB A;  1B58 A;  5IZ3 B;  3V83 A;  4R6H A;  2I6E A;  2F7A A;  1N76 A;  3OD7 A;  3TPA A;  1VE4 A;  3PGF A;  4QBA A;  4NWC A;  4G77 A;  4X1B A;  4F2O A;  1UTH A;  1JW5 A;  4POX A;  2XWK A;  4KPT A;  3OO7 A;  4OVP A;  4GRK A;  3R7X A;  3O6G A;  4JDF A;  3FVK A;  4N81 A;  1R9L A;  3PV0 E;  3ZKL A;  2QS3 A;  4JWO A;  3R26 A;  1FRP A;  1SD3 A;  3EF7 A;  1P1Q A;  3HHF A;  4YU0 A;  5LOM A;  3CFZ A;  3SZP A;  3V8X B;  5EQ9 A;  4Z0I A;  4RYA A;  3SER A;  4OAN A;  3UP9 A;  3KOS A;  1B0L A;  3H6W A;  2ZNS A;  2DE4 A;  4WKM A;  4TQU Q;  5TPA A;  2Y7R A;  1NUY A;  1PDA A;  1YCJ A;  2OX3 A;  3JYR A;  4XXU A;  5I5P A;  2DXY A;  1FPJ A;  1B4Z A;  3UOR A;  1DTZ A;  1NKX A;  3QMF A;  1QKA A;  3LR1 A;  2HCA A;  1ZMG A;  4FE8 A;  1M5C A;  1DK4 A;  1YAE A;  3CIJ A;  4FEB A;  1M5D A;  4DI3 D;  1NL5 A;  3LSX A;  4N91 A;  3CG1 A;  3G7W A;  1POT A;  1Y9U A;  3T22 A;  1OMP A;  4R72 A;  4ELO A;  3OO8 A;  4N8Y A;  5ELV A;  5A5X A;  4GX3 A;  1QUJ A;  1NI9 A;  4OMB A;  1FBF A;  4GWS A;  4H8J A;  5J1D A;  2AIX A;  3VVE A;  4U1O A;  3SES A;  3TDJ A;  4M4G A;  4IO7 A;  4MBP A;  3KGC A;  1VDW A;  2QPQ A;  4BDM A;  2Q8M A;  2XXQ A;  1PB9 A;  1QKB A;  2OBG A;  2GHA A;  3BKI B;  4GLI A;  4X9T A;  4GL8 A;  3KN3 A;  1OVB A;  1FBP A;  3O6I A;  5AA4 B;  3MWB A;  3T66 A;  1LEV A;  2UVI A;  3T9V A;  2P1S A;  2F78 A;  1NV1 A;  5H8F A;  2LAO A;  2Y7P A;  3QUF A;  1FTL A;  1ELJ A;  4GWX A;  3MZ1 A;  4PFU A;  3GXA A;  1LLS A;  2F6P A;  3FJM A;  3OMB A;  4XKR A;  1MQJ A;  5I58 B;  4QSE A;  1MY1 A;  4JBZ A;  1IXH A;  2PCR A;  1MXW A;  3K0V A;  1MY2 A;  1DMB A;  3MP1 A;  1K9Z A;  4PET A;  2H25 A;  2RCA A;  1VFE A;  2QS2 A;  3PMV A;  5ICQ A;  3RPL B;  4H46 A;  1MS7 A;  2PT2 A;  1LAX A;  1LBZ A;  5JTY B;  3DLN A;  3EPE A;  3K6V A;  5KDT B;  1B2H A;  1FJ6 A;  4DCX A;  3I5O A;  4YB5 A;  1KWH A;  3MP8 A;  1KZ8 A;  2B4L A;  3KBR A;  3VLU A;  1USY E;  4YKJ A;  4F3P A;  3KEI A;  1FBE A;  3QYT A;  1LBX A;  2XHD A;  1O64 A;  2QMW A;  4LQ5 A;  1HSL A;  4MEV A;  4E0X A;  1NV4 A;  5IZ3 A;  1KA1 A;  1II5 A;  2VOZ A;  2NVU B;  4OFO A;  3L6G A;  4MF3 A;  3K1M A;  2REG A;  1DPP A;  2WKY A;  4R2B A;  4EQ9 A;  3E78 A;  3UA8 A;  4IO5 A;  4AB5 A;  1FQC A;  2Y5K A;  2XXR A;  2P0S A;  4OER A;  1XVY A;  5AA2 A;  3UK4 A;  4MFI A;  3FZV A;  2D3I A;  3N6T A;  1FPL A;  5AA2 D;  3S9L C;  4F19 A;  1FTA A;  3D1R A;  1N3W A;  5CBS A;  1OLC A;  2F8D A;  4P11 A;  1IXI A;  2ZNU A;  2DXR A;  1B52 A;  2ZYN A;  3RTW B;  4GXA A;  1NFT A;  5ISU A;  1QUK A;  2CEY A;  4IB2 A;  2I4C A;  2HEU A;  4G8M A;  3W15 C;  2XWO A;  4KYE A;  3W9W A;  4XTC Q;  4NAP A;  1JP4 A;  4F1U A;  3OOA A;  4WXJ A;  1BKA A;  2GQ1 A;  1FPI A;  4U2R A;  2X7P A;  3T96 B;  5HBC A;  2Y84 A;  1NH7 A;  1UIV A;  3B8B A;  1PBQ A;  3I3V A;  3VVF A;  4MMP A;  1EH3 A;  1NUW A;  3DP4 A;  4TLL B;  2QVR A;  1MXV A;  3DEL B;  1DTG A;  2OJT A;  5AA3 A;  2QS1 A;  1LB9 A;  5K2Y A;  2OWZ A;  1JEU A;  1D9Y A;  4QHQ A;  2XXV A;  3MBP A;  3N94 A;  4RK2 A;  2DS9 A;  1LFI A;  4ZEI A;  3TMG A;  3TTN A;  4P9K A;  4ZE8 A;  3TOD A;  4F39 A;  1A8E A;  4FBP A;  4DIG A;  3HN0 A;  3C36 A;  1IIW A;  1H3D A;  1Y20 A;  4YB7 A;  4OVJ A;  5AA4 A;  1LGB C;  4X1D A;  1T0K A;  2ALU A;  1Y1M A;  4PBQ A;  1Y1Z A;  5M2V A;  3FUZ A;  3MZB A;  3CSG A;  5FHO A;  3HHG A;  4OQO A;  4PBH A;  1HSE A;  2XD2 A;  3RYD A;  3L6H A;  1OVT A;  2F7B A;  1S50 A;  5I58 A;  2PVU A;  5F7V A;  1LBB A;  3IOU A;  3C31 A;  1MY3 A;  1AH5 A;  2V84 A;  1TWY A;  2KQZ A;  2XXK A;  5CM6 A;  2GH9 A;  2B3F A;  3TTL A;  3UGW A;  1MQI A;  2O84 X;  3GBB A;  3A3U A;  3JV9 A;  3U72 A;  1Y4C A;  3RPL A;  4OWD A;  4NMY A;  4EQB A;  1P99 A;  1N0T A;  3IAZ A;  5JTY A;  2QRY A;  2CZI A;  2VD3 A;  4GWW A;  5KDT A;  1MXU A;  1NV7 A;  1IZ1 A;  3LSW A;  4ELR A;  3K2D A;  2ESN A;  3FV2 A;  4IO3 A;  3BFU A;  3MVZ A;  4FED A;  3LSF B;  2XXT A;  5CMM A;  2QVU A;  3MUQ A;  2WYK A;  4FAT A;  4X04 A;  3FD3 A;  1USY H;  1B1H A;  4O3A A;  5DYH A;  4F3B A;  1FQA A;  4ECF A;  4PAI A;  3B50 A;  1ATG A;  3OEN A;  4YAH X;  2D21 A;  4NED A;  2REJ A;  4PF8 A;  3O2A A;  1B7U A;  5IM2 A;  3TKD A;  3Q28 A;  4L17 A;  4HE0 A;  2XX9 A;  2G93 A;  4I40 A;  4GF8 A;  4NGU A;  2ZZW A;  3EHS A;  2UVJ A;  2DSF A;  2PX1 A;  3JZJ A;  4LAT A;  2ZMB A;  1Y3P A;  2HPG A;  4P47 A;  2HXR A;  3SKP A;  1IME A;  2UVG A;  1IIT A;  1H76 A;  4NF4 B;  1M5E A;  1JVX A;  4MNI A;  5EHM A;  3TFL A;  1SW2 A;  2A5T A;  4TOZ A;  3UN6 A;  3VFJ A;  4KFQ A;  1SBP A;  1FW0 A;  4K3F A;  3LUY A;  3HO7 A;  5TU0 A;  4AS5 A;  5IZ1 A;  2OLB A;  5DVF A;  2IA4 A;  2VPN A;  4IGR A;  1N04 A;  5EHS A;  1I69 A;  5I56 A;  2B3B A;  4NF6 B;  5H8Q B;  3HST A;  1LFH A;  4GIZ A;  3BIH A;  2W7Y A;  3H3G A;  4MX6 A;  3SEV A;  4I1D A;  2ANJ A;  2FBP A;  3K1N A;  4NQ8 A;  2ONS A;  1FCK A;  4P0G A;  2VP1 A;  4HCY A;  1L5T A;  1GGG A;  2I3V A;  1FPB A;  3MST A;  4DZ1 A;  5HM4 B;  1SW4 A;  1NUX A;  2RF1 A;  1I6A A;  3VE1 B;  4RJZ A;  3RUM A;  1B46 A;  4R6K A;  3EN3 A;  3TTM A;  1XC1 A;  5EQ8 A;  1BIY A;  3Q26 A;  1EZO A;  2ABH A;  3HV1 A;  4ONY A;  2PFZ A;  3DP8 A;  4DXU A;  1IXC A;  4I3Y A;  3PPQ A;  1MY0 A;  4YZZ A;  1QUL A;  4OVS A;  4ZE9 A;  2O7I A;  2XXP A;  4G8N A;  4OVT A;  1D4N A;  2DE2 A;  4GBV A;  5I2N B;  4N13 A;  3IOR A;  4R6Y A;  3PPP A;  4LP2 B;  2E0S A;  4MNC A;  5AA2 B;  4Q5T A;  3H6T A;  3THI A;  4YIC A;  1JEV A;  4NHB A;  1EZP A;  1ANF A;  2FYI A;  3RGY A;  1SI1 A;  3H6V A;  4ZED A;  1INP A;  2I0B A;  2UXA A;  4PFR A;  2DQV A;  5I7I A;  2I0C A;  4GD5 A;  3TCH A;  2UYE A;  4N6P A;  3TTR A;  5FTH A;  1SVX B;  5CMK A;  1N3X A;  1G0H A;  2HQ0 A;  2HXW A;  3G3K A;  1SYH A;  1Q9D A;  3Q27 A;  2Q2A A;  2F97 A;  3MQ9 A;  2I49 A;  4H6D A;  3OEL A;  1P1N A;  1UQW A;  5KZT A;  1XI6 A;  5ET8 A;  4QFN A;  3USD A;  1URD A;  1FBC A;  5ITO A;  3EKI A;  4KHZ E;  2RC9 A;  2DWJ A;  2O69 A;  1MXZ A;  4FAJ A;  1KA0 A;  4XF5 A;  1RDZ A;  3SET A;  3G3I A;  3P7I A;  1BTJ A;  1UTB B;  1N7X A;  4QRZ A;  1PEB A;  2Q8J A;  4QXD A;  3IO6 A;  3S9M C;  3BIG A;  1FTO A;  2NWJ A;  2H4I A;  1JQF A;  1LBV A;  4M1V A;  3B6T A;  3PUV E;  1QVS A;  4DDD A;  4GVO A;  4GOT A;  4MHF A;  3QXM A;  2PBW A;  3MJN A;  1QW0 A;  1US4 A;  4O7I A;  4EQ7 A;  4NF8 B;  2NOO A;  5BWJ A;  1A8F A;  3R6U A;  2Q2C A;  2WX9 A;  2H98 A;  4XIG Q;  4GX4 A;  4IGT A;  3TCF A;  3VLV A;  4PDH A;  4NF4 A;  3TCG A;  3U93 A;  4PCD A;  1SPI A;  1B3E A;  4IY5 A;  1IMB A;  4IO6 A;  2FA7 A;  3H7M A;  3RPW A;  4IO4 A;  4NN3 A;  2DWA A;  4QFK A;  1AMF A;  3VDF A;  4R74 A;  2QSX A;  3E13 X;  4NF0 A;  4GXS B;  3KFM A;  2HZK A;  2RIN A;  1IQ7 A;  1OQG A;  2B4M A;  3MZ9 A;  3KC1 A;  3QK6 A;  4BDN A;  4MJO A;  4IY6 A;  4NF6 A;  3IJO B;  5H8Q A;  4ELP A;  4PE5 B;  1WVJ A;  3IL1 B;  1FJ9 A;  1P1U A;  3T9H B;  4WEP A;  4C1T A;  3VV5 A;  4GWU A;  1ZIU A;  2V3U A;  2I58 A;  4ZEC A;  2R9J A;  2L5V A;  1SYI A;  4OA4 A;  3K6U A;  3IO4 A;  1F9B A;  4G2Z A;  3FAT A;  3ONM A;  1HSJ A;  3G3G A;  2DYX A;  2DWH A;  1A7L A;  4EXL A;  4OHN A;  4KCD A;  4UA8 A;  2ZYO A;  4OZ9 A;  4P1E A;  2NUV A;  1S7Y A;  2QJE A;  4PE3 A;  1B0H A;  2QMX A;  5I2N A;  4H45 A; 
#chains in the Genus database with same CATH homology
 1LAH E;  3B6Q A;  1B5H A;  1MDQ A;  5DEX B;  3T93 B;  3RT6 B;  3G3H A;  3CFX A;  5DT6 A;  2ZNT A;  3CR9 A;  3CSB A;  2O68 A;  1MM7 A;  3U94 A;  2A5T B;  2Z23 A;  3C33 A;  5CC2 A;  4KD5 A;  1MPC A;  3O9P A;  1I6B A;  4HS7 A;  5B7D A;  4LA9 A;  5FTI A;  2OWS A;  5B70 A;  2HAU A;  1M5F A;  1LAG E;  2UYF A;  1ZBM A;  3ECR A;  3IOT A;  1PC3 A;  3DM0 A;  2XX7 A;  4H67 A;  2P2A A;  5I56 B;  3FIR A;  4ND9 A;  1FQE A;  2DOJ A;  2F35 A;  1O7T A;  1UTB A;  4RPN A;  4RPO A;  4R2F A;  1XVX A;  4BDO A;  4DLD A;  2G29 A;  3C4M A;  3T9U A;  1MQD A;  3BFT A;  1P1W A;  3VLW A;  2DP8 A;  1A40 A;  2PMS A;  4DXB A;  1D3K A;  3C34 A;  1B7H A;  4MH5 A;  1LBC A;  3MPL A;  3RQT A;  3V89 B;  3S9E A;  2HZL A;  1NH8 A;  4KYS A;  1TFA A;  4XKP A;  2F34 A;  4RA1 A;  3MVY A;  4NF8 A;  3HCQ A;  2OZZ A;  3FJG A;  1CB6 A;  3KN7 A;  3QAX A;  2ZYK A;  2I4B A;  4ZDM A;  1URS A;  4OFL A;  3PMW A;  1Y4T A;  3RY3 A;  1GVC A;  5CBR A;  3U92 A;  3OEM A;  3SEX A;  1TT1 A;  4F29 A;  3K02 A;  4N07 A;  2HAV A;  2DVZ A;  1LCT A;  5CI5 A;  2H9B A;  3FVO A;  1R9Q A;  1EU8 A;  1FQF A;  2ONK E;  3KJ7 A;  2RCB A;  1S9T A;  2Z8E A;  3GLB A;  5FHM A;  3EHT A;  1VFD A;  4QFL A;  2UVH A;  4EUO A;  1AIV A;  3CFL A;  1MG1 A;  4KQP A;  3G3J A;  4G68 C;  1B1X A;  3CVG A;  3WAF A;  2V3Q A;  1JNF A;  2PYY A;  3F11 A;  1A55 A;  2E1S A;  1IEJ A;  1Y3Q A;  2DVC A;  2OWT A;  3TQW A;  3CRB A;  1LFG A;  3AXF A;  4QFO A;  5H8S A;  1J1N A;  3G3F A;  4JWY A;  4DCY A;  5H8N B;  4H1X A;  4RXL A;  4LZ5 A;  4PP0 A;  1NMU A;  4KCC A;  4Q8R A;  1XS5 A;  1A99 A;  3ILT B;  2R6G E;  4FIM A;  4OEN A;  1B3L A;  3PUX E;  3OEK A;  2F5X A;  5DEX A;  4G8H A;  5K2X A;  2QS4 A;  4U21 A;  4FJP A;  4LZ8 A;  4OET A;  2YPN A;  4XKQ A;  4R73 A;  4G68 B;  3PUW E;  1SW1 A;  3SDF A;  4RK9 A;  3PPO A;  4OES A;  1MQH A;  1VSO A;  1NNK A;  4YMA A;  1MH4 A;  1B3F A;  2O6A A;  4PFY A;  5TP9 B;  2Q88 A;  3QSL A;  3GZG A;  4UAC A;  3VXC A;  4JSO A;  5ICT A;  2RC7 A;  2Q89 A;  4NTL A;  3SEU A;  4YKI A;  3B6W A;  3IK6 B;  4BDR A;  1MXX A;  3IR1 A;  4OEU A;  4JWX A;  3KJT A;  4FOR A;  1B40 A;  4H5F A;  4OXV A;  2GFE A;  2I3W A;  3Q29 A;  4JXI A;  3K6W A;  3A3C A;  1B51 A;  4QF9 A;  4R75 A;  1JET A;  4EF1 A;  3KZG A;  3FXQ A;  3RLF E;  1MQG A;  4GFR A;  4ZEB A;  3IOW A;  4LON B;  3FJ7 A;  3LC8 A;  1EZ9 A;  3PD9 A;  1LCF A;  4OYV A;  3E4R A;  3OSQ A;  5I2K A;  3U8Q A;  2PT1 A;  4U1Z A;  3TTK A;  4E0W A;  4TLM B;  4JSD A;  2V3T A;  1IUD A;  3TUS A;  4RY1 A;  1JW4 A;  5AA1 A;  3N5L A;  3EQ1 A;  1DOT A;  2Z8F A;  5BUU A;  3QUJ A;  1H45 A;  1MM6 A;  2BJJ X;  4HTG A;  4NE4 A;  4QSD A;  2V25 A;  3UIF A;  4Q30 B;  1SDX A;  5CRY A;  2ZYM A;  1NNF A;  4ESW A;  2GHB A;  4KR5 A;  3O66 A;  2Z8D A;  1B6H A;  1UIU A;  3E3K A;  2XD3 A;  1B05 A;  4C0R A;  2O1M A;  1ZKB A;  2V93 A;  3K1P A;  4PFT A;  1WOD A;  1H44 A;  5CMB A;  2GRV A;  2VGQ A;  3D4G A;  3O28 A;  2B65 A;  4YB6 A;  3ILU B;  2F6G A;  1MDP 1;  3H06 B;  3IJX B;  2DE3 A;  5H8N A;  3A09 A;  4ZEK A;  5CMC A;  2OCU A;  5I57 B;  1B5I A;  3IB2 A;  3IOV A;  4GWO A;  3VXB A;  3O6H A;  1R1N A;  1MY4 A;  3MP6 A;  1H43 A;  3B7D A;  3PUY E;  2H5Y A;  3RN8 A;  2I48 A;  5H8H B;  4MLQ A;  3ZS6 A;  1Y3N A;  2THI A;  1POY 1;  3PPR A;  4G68 A;  4I62 A;  3S4U A;  2XXH A;  5L9O A;  2HFB A;  1B5J A;  3PD8 A;  3SEY A;  5TP9 A;  2DWI A;  4H5G A;  4F22 A;  3KOT A;  3TEP A;  1OQH A;  3N26 A;  1YPN A;  1D9V A;  3K4U A;  4KI0 E;  4U22 A;  4F31 B;  4PFW A;  4NWD A;  4I8C A;  1Z7M E;  4AB6 A;  5KCJ B;  3ODB A;  1QUI A;  3VVD A;  1XT8 A;  1XOC A;  1BP5 A;  4HCW A;  4GQO A;  2XXY A;  5F1Q A;  2AYS A;  3Q25 A;  3FAS A;  5L8D A;  3U1O A;  4DXC A;  5HPQ A;  2ZXT A;  2ONR A;  3PPN A;  3KSX A;  4LUB A;  4X48 A;  3E9X A;  4YKK A;  4IO2 A;  2F7C A;  5DVJ A;  5L9M A;  3N6U A;  4ZZA A;  1LST A;  2R71 A;  1VR5 A;  4F1Y A;  3C35 A;  1GTK A;  3OSR A;  1NNP A;  5I59 B;  2XXW A;  1ZU0 A;  3FXU A;  2NXO A;  5DTB A;  1SI0 A;  4R9G A;  1B3G A;  3T9X B;  4OEV A;  4RNS A;  2CZL A;  5AE4 A;  1MRP A;  4BDQ A;  3O97 A;  4G4P A;  4YKP A;  2AL4 A;  4F3G A;  4EF2 A;  2Y7K A;  4PQJ A;  5IKB A;  4JB7 A;  3FV1 A;  3TEL A;  4H8I A;  1RYO A;  3IX1 A;  4NF5 B;  4O3C A;  4LZ7 A;  1TFD A;  2IEE A;  1OLA A;  2YLN A;  3SEW A;  4ZEF A;  3OO6 A;  1O63 A;  1WDN A;  2X26 A;  3I6V A;  1PBP A;  3LSL A;  1DPE A;  3BBR A;  2QL3 A;  1XHY A;  1OIB A;  4FEC A;  3OO9 A;  4OFJ A;  3OXN A;  1B3H A;  3TYH A;  5I57 A;  3ZKK A;  2XXI A;  1B9J A;  3DP6 A;  3ZSF A;  3PUZ E;  1AL3 A;  1LB8 A;  4Q0C A;  4MLV A;  4H0W A;  1FTM A;  5I2K B;  5H8H A;  3RT8 A;  3LBS A;  4XKN A;  4O3B A;  1JW1 A;  1B4H A;  2D5W A;  3IB0 A;  3C32 A;  4U4X A;  3M8U A;  3WAE A;  3H6U A;  3FVG A;  1BLF A;  3D4C A;  4F18 A;  3C9H A;  1ZTY A;  2RKM A;  3PMX A;  1UTH B;  1SQY A;  5FHN A;  4EXK A;  1N84 A;  3MW0 A;  2XX8 A;  2O7U A;  4ELQ A;  3EHU A;  2Y7I A;  3TQL A;  1RKM A;  4F1V A;  3M3K A;  1Q35 A;  1B7Z A;  3K00 A;  3S9N C;  2O1L A;  2A5S A;  3K01 A;  2F36 A;  4ZZE A;  1ZJL A;  5TPA B;  4LQ2 A;  4BLA A;  3KG2 A;  5KCJ A;  4ESX A;  3MAM A;  2VD2 A;  3M3L A;  1LAF E;  2VHA A;  4C1U A;  5JK4 A;  3GBA A;  4F3S A;  1FQD A;  2Q9T A;  1DSN A;  1URG A;  2H99 A;  4DE8 A;  2YJP A;  5I84 A;  1MH3 A;  4QFP A;  1US5 A;  3CG3 A;  4ZS9 A;  1A54 A;  5A5X B;  3CI8 A;  4GL0 A;  4U4S A;  2AL5 A;  3K6X A;  3M3F A;  5L9S A;  4H65 A;  5I59 A;  1JVY A;  1QJM A;  2OK2 A;  5ITP A;  4OTE A;  5DVI A;  2X7Q A;  1NNT A;  2RC8 A;  4EDP A;  3PU5 A;  4HW8 A;  4ISU A;  1GR2 A;  1ZLQ A;  4I9D A;  1MPB A;  3RNN A;  3FGS A;  1P1O A;  4WED A;  5IAI A;  1I6Q A;  5H8F B;  2O51 A;  1MXY A;  2Y7W A;  2FNC A;  4POW A;  3V5A A;  3H03 A;  3MC2 A;  1IXG A;  1Z7N E;  1PB7 A;  3IB1 A;  3FXR A;  4QSC A;  5JEI A;  4NF5 A;  1PB8 A;  2M8C A;  4THI A;  5EYF A;  3QIM A;  1N7W A;  3RTF B;  3S2V A;  4AQ4 A;  1R6Z A;  1SW5 A;  3MVX A;  3HPI A;  1MPD A;  4Z7E A;  3O29 A;  1FQB A;  1CE2 A;  3H4Z A;  4KYD A;  1TXF A;  1FTK A;  4LVQ A;  2XXU A;  2KLF A;  4U23 A;  1Q1K A;  1M5B A;  1GV8 A;  3KSJ A;  4R9F A;  1RYX A;  4F2Q A;  2CMO A;  4P0I A;  2Z22 A;  4BDL A;  3MVW A;  3FVN A;  3KN8 A;  3MPK A;  1FTJ A;  3W9V A;  2XXX A;  1B32 A;  1AOV A;  3TZA A;  3TAJ A;  1YTV A;  4YMB A;  1B58 A;  3V83 A;  4R6H A;  2I6E A;  2F7A A;  1N76 A;  3OD7 A;  3TPA A;  1VE4 A;  3PGF A;  4NWC A;  4G77 A;  4X1B A;  4F2O A;  1UTH A;  1JW5 A;  4POX A;  4KPT A;  3OO7 A;  4GRK A;  3R7X A;  3O6G A;  4JDF A;  3FVK A;  1R9L A;  3PV0 E;  3ZKL A;  2QS3 A;  4JWO A;  3R26 A;  1SD3 A;  3EF7 A;  1P1Q A;  3HHF A;  4YU0 A;  5LOM A;  3CFZ A;  3V8X B;  4Z0I A;  4RYA A;  3SER A;  3UP9 A;  3KOS A;  1B0L A;  3H6W A;  2ZNS A;  2DE4 A;  4WKM A;  4TQU Q;  5TPA A;  2Y7R A;  1PDA A;  1YCJ A;  3JYR A;  4XXU A;  2DXY A;  1B4Z A;  3UOR A;  1DTZ A;  1NKX A;  1QKA A;  3LR1 A;  2HCA A;  1ZMG A;  4FE8 A;  1M5C A;  1YAE A;  3CIJ A;  4FEB A;  1M5D A;  1NL5 A;  3LSX A;  3CG1 A;  3G7W A;  1POT A;  1Y9U A;  3T22 A;  1OMP A;  4R72 A;  4ELO A;  3OO8 A;  5ELV A;  5A5X A;  1QUJ A;  4OMB A;  4H8J A;  5J1D A;  2AIX A;  3VVE A;  4U1O A;  3SES A;  3TDJ A;  4M4G A;  4IO7 A;  4MBP A;  3KGC A;  2QPQ A;  4BDM A;  2XXQ A;  1PB9 A;  1QKB A;  2OBG A;  2GHA A;  3BKI B;  4GLI A;  4X9T A;  4GL8 A;  3KN3 A;  1OVB A;  3O6I A;  5AA4 B;  3MWB A;  3T66 A;  2UVI A;  3T9V A;  2P1S A;  2F78 A;  5H8F A;  2LAO A;  2Y7P A;  3QUF A;  1FTL A;  1ELJ A;  3MZ1 A;  4PFU A;  3GXA A;  1LLS A;  2F6P A;  3FJM A;  3OMB A;  4XKR A;  1MQJ A;  5I58 B;  4QSE A;  1MY1 A;  4JBZ A;  1IXH A;  1MXW A;  3K0V A;  1MY2 A;  1DMB A;  3MP1 A;  4PET A;  2H25 A;  2RCA A;  1VFE A;  2QS2 A;  3PMV A;  5ICQ A;  1MS7 A;  2PT2 A;  1LAX A;  5JTY B;  3DLN A;  3EPE A;  3K6V A;  5KDT B;  4DCX A;  1B2H A;  3I5O A;  4YB5 A;  1KWH A;  3MP8 A;  3KBR A;  3VLU A;  1USY E;  4YKJ A;  4F3P A;  3KEI A;  3QYT A;  2XHD A;  1O64 A;  2QMW A;  4LQ5 A;  1HSL A;  4E0X A;  1II5 A;  2VOZ A;  2NVU B;  4OFO A;  3L6G A;  4MF3 A;  3K1M A;  2REG A;  1DPP A;  2WKY A;  4R2B A;  4EQ9 A;  3UA8 A;  4IO5 A;  4AB5 A;  1FQC A;  2XXR A;  2P0S A;  4OER A;  1XVY A;  5AA2 A;  3UK4 A;  4MFI A;  3FZV A;  2D3I A;  3N6T A;  5AA2 D;  3S9L C;  4F19 A;  1N3W A;  5CBS A;  1OLC A;  2F8D A;  4P11 A;  1IXI A;  2ZNU A;  2DXR A;  1B52 A;  2ZYN A;  3RTW B;  4GXA A;  1NFT A;  5ISU A;  1QUK A;  4IB2 A;  2I4C A;  2HEU A;  4G8M A;  3W15 C;  4KYE A;  3W9W A;  4XTC Q;  4F1U A;  3OOA A;  4WXJ A;  1BKA A;  4U2R A;  2X7P A;  3T96 B;  5HBC A;  2Y84 A;  1NH7 A;  1UIV A;  1PBQ A;  3I3V A;  3VVF A;  1EH3 A;  3DP4 A;  4TLL B;  1MXV A;  3DEL B;  1DTG A;  2OJT A;  5AA3 A;  2QS1 A;  1LB9 A;  5K2Y A;  1JEU A;  1D9Y A;  4QHQ A;  2XXV A;  3MBP A;  3N94 A;  4RK2 A;  2DS9 A;  1LFI A;  4ZEI A;  3TMG A;  3TTN A;  4ZE8 A;  3TOD A;  4F39 A;  1A8E A;  4DIG A;  3HN0 A;  3C36 A;  1IIW A;  1H3D A;  1Y20 A;  4YB7 A;  4OVJ A;  5AA4 A;  1LGB C;  4X1D A;  1T0K A;  2ALU A;  1Y1M A;  1Y1Z A;  5M2V A;  3FUZ A;  3MZB A;  3CSG A;  5FHO A;  3HHG A;  4OQO A;  1HSE A;  2XD2 A;  3L6H A;  1OVT A;  2F7B A;  1S50 A;  5I58 A;  2PVU A;  5F7V A;  1LBB A;  3IOU A;  3C31 A;  1MY3 A;  1AH5 A;  2V84 A;  1TWY A;  5CM6 A;  2GH9 A;  2B3F A;  3TTL A;  3UGW A;  1MQI A;  2O84 X;  3GBB A;  3A3U A;  3JV9 A;  3U72 A;  1Y4C A;  4OWD A;  4NMY A;  4EQB A;  1P99 A;  1N0T A;  3IAZ A;  5JTY A;  2QRY A;  2VD3 A;  5KDT A;  1MXU A;  1IZ1 A;  3LSW A;  4ELR A;  3K2D A;  2ESN A;  3FV2 A;  4IO3 A;  3BFU A;  3MVZ A;  4FED A;  3LSF B;  2XXT A;  5CMM A;  3MUQ A;  4FAT A;  3FD3 A;  1USY H;  1B1H A;  4O3A A;  5DYH A;  4F3B A;  1FQA A;  4ECF A;  1ATG A;  3OEN A;  4YAH X;  2D21 A;  4NED A;  2REJ A;  3O2A A;  1B7U A;  3TKD A;  3Q28 A;  4L17 A;  2XX9 A;  2G93 A;  4GF8 A;  3EHS A;  2UVJ A;  2DSF A;  2PX1 A;  3JZJ A;  4LAT A;  2ZMB A;  1Y3P A;  3SKP A;  2UVG A;  1IIT A;  1H76 A;  4NF4 B;  1M5E A;  1JVX A;  5EHM A;  3TFL A;  1SW2 A;  2A5T A;  4TOZ A;  3UN6 A;  3VFJ A;  4KFQ A;  1SBP A;  1FW0 A;  4K3F A;  3LUY A;  3HO7 A;  5TU0 A;  2OLB A;  5DVF A;  2IA4 A;  4IGR A;  1N04 A;  5EHS A;  1I69 A;  5I56 A;  2B3B A;  4NF6 B;  5H8Q B;  3HST A;  1LFH A;  4GIZ A;  2W7Y A;  3H3G A;  3SEV A;  4I1D A;  2ANJ A;  3K1N A;  2ONS A;  1FCK A;  4P0G A;  2VP1 A;  4HCY A;  1L5T A;  1GGG A;  2I3V A;  4DZ1 A;  5HM4 B;  1SW4 A;  2RF1 A;  1I6A A;  3VE1 B;  4RJZ A;  3RUM A;  1B46 A;  4R6K A;  3EN3 A;  3TTM A;  1XC1 A;  1BIY A;  3Q26 A;  1EZO A;  2ABH A;  3HV1 A;  4ONY A;  3DP8 A;  4DXU A;  1IXC A;  3PPQ A;  1MY0 A;  4YZZ A;  1QUL A;  4ZE9 A;  2O7I A;  2XXP A;  4G8N A;  1D4N A;  2DE2 A;  5I2N B;  4N13 A;  3IOR A;  4R6Y A;  3PPP A;  4LP2 B;  2E0S A;  5AA2 B;  4Q5T A;  3H6T A;  3THI A;  4YIC A;  1JEV A;  1EZP A;  1ANF A;  2FYI A;  3RGY A;  1SI1 A;  3H6V A;  4ZED A;  2I0B A;  2UXA A;  2DQV A;  2I0C A;  4GD5 A;  3TCH A;  2UYE A;  4N6P A;  3TTR A;  5FTH A;  1SVX B;  5CMK A;  1N3X A;  2HQ0 A;  2HXW A;  3G3K A;  1SYH A;  3Q27 A;  2Q2A A;  2F97 A;  3MQ9 A;  2I49 A;  4H6D A;  3OEL A;  1P1N A;  1UQW A;  5KZT A;  4QFN A;  3USD A;  1URD A;  5ITO A;  4KHZ E;  2RC9 A;  2DWJ A;  2O69 A;  1MXZ A;  4FAJ A;  3SET A;  3G3I A;  3P7I A;  1BTJ A;  1UTB B;  1N7X A;  4QRZ A;  1PEB A;  2Q8J A;  3IO6 A;  3S9M C;  1FTO A;  2NWJ A;  2H4I A;  1JQF A;  4M1V A;  3B6T A;  3PUV E;  1QVS A;  4DDD A;  4GVO A;  4GOT A;  3QXM A;  2PBW A;  3MJN A;  1QW0 A;  1US4 A;  4EQ7 A;  4NF8 B;  2NOO A;  5BWJ A;  1A8F A;  3R6U A;  2Q2C A;  2H98 A;  4XIG Q;  3TCF A;  4IGT A;  3VLV A;  4NF4 A;  3TCG A;  3U93 A;  1B3E A;  4IY5 A;  4IO6 A;  2FA7 A;  3H7M A;  3RPW A;  4IO4 A;  2DWA A;  4QFK A;  1AMF A;  3VDF A;  4R74 A;  2QSX A;  3E13 X;  4GXS B;  3KFM A;  2HZK A;  2RIN A;  1IQ7 A;  1OQG A;  3MZ9 A;  3QK6 A;  4BDN A;  4IY6 A;  4NF6 A;  3IJO B;  5H8Q A;  4ELP A;  4PE5 B;  1WVJ A;  3IL1 B;  1P1U A;  3T9H B;  4WEP A;  4C1T A;  3VV5 A;  1ZIU A;  2V3U A;  2I58 A;  4ZEC A;  2R9J A;  1SYI A;  3K6U A;  3IO4 A;  1F9B A;  4G2Z A;  3FAT A;  3ONM A;  1HSJ A;  3G3G A;  2DYX A;  2DWH A;  1A7L A;  4EXL A;  4OHN A;  4KCD A;  4UA8 A;  2ZYO A;  4OZ9 A;  2NUV A;  1S7Y A;  2QJE A;  1B0H A;  2QMX A;  5I2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...