3PPNA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Glycine betaine/carnitine/choline-binding protein
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppnA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppnA02
4JWOA 1M5CA 2UVHA 4H8JA 4N6PA 1B7ZA 2ZNTA 1SYHA 5L9MA 2ZYOA 4R73A 4DCYA 4OXVA 1EZ9A 3K4UA 1FQCA 1NMUA 5H8QB 3B6QA 1IXCA 2Q2CA 2VHAA 4R6KA 3PGFA 3EF7A 3T9VA 2XHDA 2F5XA 4U1OA 4F18A 1UTBB 2Y84A 4F1YA 5CM6A 3FV1A 1OIBA 1MPCA 1Y3QA 5LOMA 4IY6A 1UTHA 1M5EA 5L9SA 2O84X 4X48A 4GFRA 2RC9A 4HTGA 1Z7ME 2X7QA 4OVJA 1BIYA 4G8HA 1MQJA 2I58A 2NOOA 3G3KA 4IB2A 3RQTA 3E3KA 4IO7A 4QF9A 5DVFA 1H43A 3RNNA 3GBAA 3GXAA 1B4HA 5EHSA 4Q8RA 5BWJA 1IZ1A 1SBPA 1GV8A 2UXAA 3JZJA 4U4XA 3T9UA 3T66A 5K2XA 4ELRA 5I58A 5ITPA 4NEDA 4DDDA 2O1LA 3V5AA 3PD8A 3WAFA 3N6UA 4FAJA 1FQEA 2V3QA 3QUFA 1XVYA 4YB6A 1TWYA 3IB2A 3IOTA 2HAUA 3H7MA 5ISUA 2G29A 1RYOA 1MQDA 2F7AA 1TFDA 1B3FA 3B6WA 1MM7A 3FATA 1JW1A 4C1TA 4ONYA 2IEEA 4EDPA 1MY2A 4ZZAA 4Z7EA 3QK6A 3SEWA 2P1SA 1I6BA 2H25A 1IEJA 1MY4A 2VD2A 3FUZA 3JV9A 4NMYA 2NWJA 3O6HA 3C31A 4ZECA 3MVWA 1B7HA 3T9XB 2AL4A 3KN3A 1XT8A 1B3LA 1MM6A 2I6EA 3LSWA 3N6TA 5FTHA 3OOAA 1UTHB 4HS7A 2H98A 5H8SA 3R26A 1D3KA 3OSQA 3AXFA 2DWJA 1QJMA 3QSLA 5CI5A 2XX7A 3CFXA 5BUUA 3MWBA 1B40A 2A5SA 3FVNA 2F7CA 4GIZA 4YKIA 1AIVA 3I6VA 2W7YA 3EPEA 4FJPA 3EN3A 1NNFA 1OLCA 5I2KB 3IB0A 4BDNA 2A5TA 5I84A 3FIRA 4QFPA 4RJZA 1MXUA 3B7DA 2Z22A 3LSFB 4GQOA 1URGA 4GWOA 3TTNA 4DLDA 3Q29A 1ELJA 2NXOA 4ZEDA 4DXCA 1PB7A 2F6PA 4QSEA 2QMXA 4R6HA 3C36A 1LFGA 2YPNA 1S50A 3HN0A 4IO6A 5FHNA 1I6QA 3E4RA 2D5WA 5CMMA 4PFYA 4WKMA 3OXNA 1JEUA 3T9HB 4XTCQ 5M2VA 2ESNA 3VVDA 2Q2AA 4Q5TA 3Q25A 1XHYA 1LBBA 1MXYA 3JYRA 3C34A 3T22A 1IUDA 1QUJA 1B32A 2I4BA 2PT1A 1POTA 2Z8FA 2THIA 3IAZA 3O29A 3KSXA 3RUMA 3TYHA 4KPTA 2ZMBA 3IO4A 3THIA 3F11A 1NNKA 3H3GA 3O66A 3M3LA 4BDRA 1TXFA 4HCYA 4QSDA 4F3GA 2B3BA 1MDQA 3CFLA 1URSA 4TLMB 5DYHA 2XXPA 4ZS9A 3EQ1A 3KJ7A 4JDFA 3VV5A 2GHAA 3TTLA 5KZTA 3MP1A 4U1ZA 2DOJA 5I2KA 2XXUA 3TPAA 4F19A 2A5TB 2I0CA 3N94A 1Y3PA 5TU0A 3OEMA 4ELQA 5I2NB 3V83A 1DTGA 4H5FA 2REJA 1JVXA 4LQ5A 4Q0CA 4HW8A 1YTVA 1A8FA 3ONMA 4RNSA 1FTKA 3SETA 4DXUA 1SQYA 3M3KA 3I5OA 3GLBA 1WVJA 2YLNA 2ZNSA 1XS5A 3DP6A 3M3FA 5JEIA 1FQFA 3MVYA 5A5XB 3OEKA 1MXWA 1BP5A 1JW5A 4KQPA 3PMXA 4BDQA 2QS4A 4XKQA 4OETA 3FVKA 1N84A 1AL3A 4UACA 3U94A 2Z8DA 2UVGA 3CVGA 2OZZA 2H9BA 3MPLA 3VLUA 4OERA 2PMSA 3B6TA 4OFOA 2PVUA 4KR5A 1SYIA 3S9MC 2I3VA 3KG2A 1LB9A 4EF2A 1QUKA 1B7UA 4FEDA 3PUWE 1ZJLA 4OZ9A 1GVCA 3H03A 3HHGA 3GZGA 2DE2A 3HSTA 5I2NA 2Q88A 2IA4A 2O69A 3H6TA 4KCCA 3TDJA 3QAXA 4KI0E 3MC2A 3K01A 3IORA 4FE8A 4DCXA 3MVXA 5TP9B 3RPWA 3BFTA 1M5DA 5CRYA 2ONSA 5A5XA 4OQOA 3N5LA 2RF1A 1FTLA 4H1XA 3FJMA 4F1VA 4FATA 4QFKA 4ZEKA 2H4IA 1BTJA 3PD9A 3USDA 3W15C 1OVBA 1N3XA 4R9FA 1CE2A 4KYSA 1P1QA 2XX9A 3EHSA 1MXVA 3T96B 3U8QA 1R6ZA 1MQGA 4GF8A 3H6UA 1FW0A 3OELA 4IY5A 2CMOA 3RT6B 1B58A 1LAFE 3KOSA 4R75A 5EYFA 1OVTA 3D4CA 3FXUA 1PBQA 1ATGA 4LA9A 3WAEA 5CMCA 3HO7A 4YICA 3FJGA 3H4ZA 3BBRA 4G77A 2XD3A 1Y3NA 3N26A 5I59B 3FZVA 2I0BA 1N7WA 1XVXA 4KCDA 3OENA 4LVQA 4XKPA 4BDOA 4Q30B 2KLFA 2LAOA 3KFMA 4GVOA 4IO3A 3S4UA 3UK4A 4C1UA 3QIMA 4LZ5A 3S9EA 5FTIA 3RTWB 3K00A 3ILTB 2DS9A 1JEVA 4DIGA 1MY1A 1OLAA 1Q1KA 3K1PA 3U72A 1QKBA 2V93A 1EH3A 3T93B 5TP9A 1MS7A 3A09A 4FORA 4ZEIA 1MQHA 3ZKLA 3TFLA 4OFJA 2P0SA 1JETA 2R9JA 2F97A 2O51A 4G4PA 1MPDA 4GXAA 4M1VA 4MLVA 2F36A 3SERA 2I3WA 5AA2B 1B0HA 2OK2A 3Q26A 3TEPA 3LSLA 3O28A 1DSNA 1HSJA 1TFAA 1WDNA 2Q9TA 2NVUB 3TUSA 2R6GE 3CSBA 4RXLA 4JWYA 4G8NA 1GR2A 1LGBC 1S9TA 4YB7A 1O7TA 4FEBA 3IJXB 3K02A 3OMBA 4O3CA 4QSCA 4RY1A 5DVIA 4G68A 1ZTYA 1B1HA 1QW0A 3S2VA 1YAEA 3OO9A 3VLVA 3O6GA 5AA3A 2HZLA 1MH3A 3IX1A 5I59A 1MRPA 2Y7WA 4QHQA 4F39A 4U4SA 1QKAA 4WEDA 5DEXA 1PC3A 3PPPA 1ZMGA 4NE4A 5AE4A 1II5A 4EQ9A 1ZU0A 4ELOA 3MVZA 2VGQA 4YAHX 3Q27A 3KN8A 1B3GA 1B5HA 3FJ7A 2ZNUA 4I8CA 3PPNA 4NF5B 4EQ7A 1LCFA 1MXZA 4ZDMA 2XXXA 4LATA 3SEVA 4AQ4A 4F1UA 4F3PA 3C9HA 1EZPA 4AB6A 1B4ZA 3LBSA 2HFBA 4WXJA 3UN6A 1Y20A 2UYEA 1LBCA 2F8DA 3TODA 4YKPA 5JTYA 2QJEA 4EQBA 5B70A 1VE4A 1Y4CA 1A40A 2XXWA 5HM4B 3MQ9A 1P1WA 5AA2A 2F35A 2V3UA 3DM0A 3KBRA 5H8NB 2ABHA 1R9LA 4F2QA 1SI0A 1ZKBA 1B3HA 4H0WA 1PBPA 4U23A 1AH5A 3TQLA 4XIGQ 2GRVA 3PMWA 1B1XA 4P0IA 2PYYA 1LAGE 3VDFA 2F78A 4MF3A 2O1MA 4PP0A 2Y7PA 1QULA 4G68B 5DT6A 1GGGA 4OESA 4ECFA 4L17A 1AMFA 4YMBA 4ZE9A 1QUIA 3A3UA 4HCWA 5AA4B 1LSTA 1VFDA 3IJOB 2HEUA 5DEXB 4XKNA 3RT8A 3UIFA 4R9GA 1SW4A 4R72A 4NWDA 4OHNA 3I3VA 3TCGA 3VFJA 4OENA 2DE3A 3HCQA 5ITOA 2UVJA 2ALUA 4R2FA 4N07A 5H8FA 1POY1 1B5IA 1XC1A 1XOCA 3RN8A 3SESA 3RY3A 1DPEA 4RK2A 3K1MA 1VSOA 2XXIA 4H65A 4NF5A 3KZGA 1MQIA 1N0TA 3PPOA 1NKXA 1S7YA 3KOTA 3OD7A 4GRKA 4PE5B 3ILUB 5JK4A 1B51A 1T0KA 2DE4A 3VXCA 1N76A 1DTZA 3CR9A 3K2DA 5JTYB 3G3FA 3VVEA 4M4GA 4QFOA 1LCTA 3G3JA 3KEIA 3PPQA 4OTEA 3UA8A 5ICQA 2O7IA 4PQJA 1UIUA 1BKAA 3CIJA 4PFTA 3SEYA 4P11A 5H8NA 3VE1B 4E0WA 1EZOA 2B65A 2RCBA 4GXSB 4YU0A 4JSOA 4NF6A 1PB8A 2RINA 3H6WA 3KSJA 1TT1A 2F6GA 4IO2A 3CI8A 3ODBA 1Y1ZA 4H67A 2GH9A 3L6HA 2V84A 1IQ7A 3DELB 1NNPA 1UQWA 2AIXA 3E13X 3MZ1A 4LUBA 4U21A 4F31B 1P99A 5ELVA 2O7UA 3H6VA 1O63A 4ZZEA 5AA4A 1OQGA 1L5TA 5L9OA 3HPIA 4TQUQ 4JWXA 2ZYNA 3FVOA 3K6XA 4PETA 5CMBA 4OEVA 5EHMA 1MXXA 3Q28A 1DPPA 1WODA 4MBPA 5CC2A 5ICTA 5H8FB 3UGWA 4YMAA 1Y1MA 2GFEA 3W9WA 1Y9UA 2XXYA 2F7BA 3U92A 4F3BA 2PX1A 1PEBA 4YZZA 2OBGA 2XXVA 1RYXA 2RC7A 3CSGA 4NWCA 3E9XA 1R9QA 4ZEBA 4LONB 5I56B 2XXRA 1EU8A 2V25A 3KN7A 4FECA 1D9VA 2QMWA 4OEUA 3PU5A 4NF8A 4DE8A 3A3CA 4JSDA 3MAMA 3MJNA 4YKJA 3PUZE 3ZSFA 2RCAA 4NF6B 1HSEA 3SKPA 3V8XB 5HPQA 4IO5A 1OMPA 1IXHA 1IXIA 4ESXA 3G3HA 5HBCA 1IXGA 1PDAA 1URDA 2RC8A 2QSXA 3CFZA 3IB1A 2RKMA 1A7LA 3KGCA 3MUQA 3OO8A 1JW4A 4OFLA 2I4CA 2I49A 1P1NA 1LAXA 2QPQA 4LZ7A 4BDMA 1D4NA 1LB8A 3QYTA 1OQHA 2ZYKA 5FHMA 5AA1A 1NL5A 2OCUA 3SEUA 3IR1A 2QS3A 1PB9A 1NFTA 2B3FA 1FCKA 2PT2A 3ECRA 4RK9A 2Q89A 1N7XA 1JVYA 2HXWA 4NTLA 1P1OA 2WKYA 2GHBA 1SVXB 3H06B 2D21A 1RKMA 4KYEA 2HQ0A 2R71A 2FA7A 1QVSA 2XXQA 4EXKA 4X9TA 2DXYA 2DWHA 1Q35A 3BKIB 5I56A 2Y7KA 4U2RA 5DTBA 3IL1B 3FASA 4MFIA 2QS2A 1A55A 5FHOA 3ZS6A 1HSLA 4F29A 4NF8B 2OWTA 2VD3A 3TCFA 3VLWA 5KDTA 4X1DA 2D3IA 4GLIA 4MLQA 4DZ1A 3IOUA 2DXRA 1ZLQA 4F22A 2PBWA 2P2AA 2DVZA 2UYFA 3TQWA 5IAIA 2XXHA 3OO7A 1A99A 3PUXE 2REGA 3RTFB 3TELA 1SDXA 2H5YA 5TPAB 1N3WA 3UORA 4Z0IA 4EUOA 3P7IA 3R7XA 1LFHA 2HCAA 2FNCA 3U1OA 2NUVA 4FIMA 4N13A 3K6WA 3TMGA 1B3EA 4JXIA 4UA8A 3TTRA 4YB5A 1USYH 4F3SA 1P1UA 3MPKA 1H45A 1I69A 1NNTA 1SW1A 1N04A 3IOVA 3OSRA 3VXBA 3C35A 1A8EA 3R6UA 1LAHE 2VP1A 3MBPA 3FV2A 1YPNA 4G8MA 4QRZA 4H6DA 3TKDA 1DMBA 1H3DA 3PV0E 1US5A 2QS1A 4PFWA 1NH8A 4POXA 4C0RA 3K1NA 3PPRA 3O2AA 4GOTA 5KDTB 1M5BA 1A54A 3SEXA 4KHZE 4E0XA 1MPBA 5F7VA 3C33A 1DOTA 1ZBMA 3FGSA 3VVFA 1MG1A 3K6VA 2VOZA 3RGYA 1YCJA 3C32A 3TAJA 1FQAA 1UIVA 2E0SA 4O3AA 3TTKA 5TPAA 1KWHA 3FXQA 5F1QA 2FYIA 4KFQA 4NF4B 1SD3A 5AA2D 2F34A 2O68A 4AB5A 3MZ9A 2OLBA 2OJTA 3HV1A 3MW0A 3FD3A 3IO6A 4OWDA 3U93A 1JNFA 3S9NC 3CG3A 5CMKA 1B46A 2XX8A 1IIWA 4U22A 5K2YA 1VR5A 3C4MA 3IOWA 4JB7A 4R74A 1Y4TA 3TZAA 2Y7IA 3EHUA 4THIA 1F9BA 2DVCA 2M8CA 1VFEA 2O6AA 2DSFA 5DVJA 3RLFE 1B6HA 1O64A 4F2OA 3PUYE 3KJTA 4XXUA 1B2HA 2HZKA 2QL3A 4ZEFA 2YJPA 2H99A 1B5JA 3D4GA 4G2ZA 4DXBA 1D9YA 4WEPA 3BFUA 4RPOA 5H8HB 4OMBA 3S9LC 5I57A 3SDFA 1H44A 3PMVA 3EHTA 1FQDA 4I9DA 2DWAA 3K0VA 4RA1A 1CB6A 1M5FA 4LQ2A 4KYDA 4ISUA 2G93A 4TOZA 3LSXA 4I1DA 1MY0A 3LC8A 4O3BA 2DQVA 3TCHA 3DP4A 3TTMA 4BDLA 2HAVA 3MP6A 4GD5A 1LFIA 2OWSA 5CBRA 4NF4A 1ANFA 1B9JA 2DP8A 5KCJB 3ZKKA 4ND9A 4K3FA 4BLAA 5IKBA 3FVGA 1GTKA 5L8DA 2Z8EA 1MDP1 1MY3A 4POWA 2ANJA 4QFNA 3HHFA 1B52A 4JBZA 3IK6B 4R2BA 3OO6A 4GL0A 4OYVA 4RPNA 2X26A 2E1SA 1BLFA 1FTMA 4KD5A 3CG1A 3K6UA 1JQFA 4RYAA 3V89B 2Y7RA 3O97A 1ZIUA 1Z7NE 3MP8A 3O9PA 1AOVA 3FXRA 2Z23A 2QRYA 4IGTA 1NH7A 1MH4A 3LUYA 1IITA 4LP2B 2I48A 3DP8A 4GL8A 4P0GA 4TLLB 4ZE8A 5H8HA 1SI1A 4ELPA 4IGRA 4ESWA 5I57B 4G68C 3G3GA 5H8QA 4EF1A 3QXMA 2ZXTA 3G3IA 2CZLA 2AYSA 4H8IA 2BJJX 1B05A 1UTBA 3L6GA 3M8UA 3G7WA 4LZ8A 4EXLA 3O6IA 1FQBA 3PUVE 2XXTA 4PFUA 1B0LA 1FTJA 4XKRA 5CBSA 5KCJA 2ZYMA 2XD2A 4QFLA 2Q8JA 4IO4A 1I6AA 4R6YA 1SW2A 2ONRA 1R1NA 3DLNA 3GBBA 3LR1A 4H5GA 4I62A 4YKKA 2AL5A 2DYXA 3CRBA 1USYE 3W9VA 2ONKE 3MZBA 5B7DA 1J1NA 1SW5A 1US4A 2V3TA 4MH5A 3UP9A 5J1DA 5I58B 2DWIA 2UVIA 2X7PA 3QUJA 4X1BA 1LLSA 1FTOA 1H76A
chains in the Genus database with same CATH superfamily
4N6PA 1SYHA 1RDZA 2VPOA 1EZ9A 3K4UA 1NMUA 2Q2CA 2VHAA 4R6KA 3T9VA 2BJIA 1UTBB 2Y84A 1OIBA 1AWBA 2L5VA 1UTHA 5L9SA 2O84X 4HTGA 1Z7ME 3RQTA 4QF9A 3RNNA 3GXAA 4Q8RA 5K2XA 4NEDA 3V5AA 3N6UA 2V3QA 3IOTA 3H7MA 1MQDA 2F7AA 1B3FA 1MM7A 4ONYA 4EDPA 3SEWA 2P1SA 2VD2A 3O6HA 3T9XB 1B7HA 1XT8A 1B3LA 5FTHA 4HS7A 5H8SA 3QSLA 1NV2A 5CI5A 4N91A 2F7CA 4GIZA 4FJPA 1NNFA 3IB0A 2A5TA 4RJZA 4HXVA 3Q29A 1ELJA 2F6PA 2QMXA 1S50A 3HN0A 5FHNA 1I6QA 4WKMA 1JEUA 4Q5TA 3Q25A 1XHYA 3JYRA 2PT1A 3O29A 3E78A 3KSXA 4OANA 3RUMA 4KPTA 1D9QA 3O66A 3M3LA 4HCYA 2B3BA 4TLMB 4ZS9A 1URSA 5KZTA 4U1ZA 5I2KA 2XXUA 1Y3PA 1JVXA 4HW8A 1A8FA 3ONMA 3M3KA 3I5OA 2XWKA 3M3FA 2F3DA 3MVYA 1FPGA 1BP5A 3FVKA 1AL3A 3FBPA 2I3VA 1KA1A 4HE0A 4OZ9A 3H03A 2DE2A 5I2NA 4DCXA 3RPWA 5A5XA 4OQOA 4F1VA 4H1XA 4ZEKA 3PD9A 1BTJA 3W15C 1OVBA 1MXVA 4GF8A 3H6UA 1FW0A 3OELA 2MKZA 1LAFE 4R75A 1OVTA 3HO7A 3BBRA 5I59B 4XKPA 4LVQA 3KFMA 4LZ5A 2QFLA 2DS9A 1MY1A 1OLAA 3K1PA 3U72A 1QKBA 4ZEIA 4FORA 1MQHA 4PFBA 4GXAA 2I3WA 2OK2A 1DSNA 1HSJA 1WDNA 2NVUB 2Y5LA 5EQ7A 3CSBA 3T0JA 4G8NA 1NV5A 5EQ9A 3OO9A 2HZLA 1MH3A 3IX1A 1ZMGA 3MVZA 4YAHX 4EQ7A 4F1UA 1EZPA 3LBSA 2HFBA 4WXJA 3TODA 1FPEA 5JTYA 4EQBA 4N6DA 3MQ9A 5AA2A 2ABHA 1SI0A 1ZKBA 1PBPA 1B1XA 2PYYA 4MF3A 3A29A 2Y7PA 1QULA 5DT6A 4ZE9A 3A3UA 5IZ3B 3CHGA 3IJOB 2HEUA 3UIFA 2DE3A 2ALUA 4N07A 1POY1 1VSOA 1NUZA 4PE5B 5JTYB 3VVEA 4P9KA 4MAGA 3ROJA 1LCTA 3G3JA 4OTEA 3UA8A 5I5PA 1PB8A 1SPIA 4IO2A 2GH9A 3L6HA 2V84A 2AIXA 4NGUA 1O63A 3SZPA 1FBGA 4H46A 5CMBA 5EHMA 1WODA 3UGWA 1Y1MA 4YZZA 1FBCA 2OBGA 3CSGA 4FECA 2QMWA 4JSDA 4MHFA 4PFIA 3PUZE 3ZSFA 4NQ8A 3SKPA 4PTKA 2F3BA 4MNPA 3G3HA 5HBCA 1IXGA 2QSXA 4OFLA 4BDMA 2QPQA 2ZYKA 2OCUA 1EYJA 4NAPA 2PT2A 1JVYA 2GHBA 2D21A 4KYEA 2XXQA 4EXKA 1Q35A 3FASA 3ZS6A 5KDTA 4HE2A 4NF8B 2OWTA 3TCFA 3VLWA 4MLQA 4DZ1A 2DXRA 2PBWA 3TQWA 3RTFB 3UORA 2B4LA 2HCAA 2NUVA 4FIMA 3K6WA 3TMGA 5LTCA 3MPKA 3IOVA 3R6UA 3MBPA 4G8MA 4QRZA 4C0RA 4PE3A 4FBPA 5FBPA 5J16A 1A54A 1MPBA 5F7VA 3C33A 1RDYA 1KWHA 4KFQA 4AB5A 1FPKA 3D1RA 3MW0A 1IIWA 3C4MA 3IOWA 2Y7IA 5DVJA 3RLFE 2DSFA 4N15A 4XXUA 4F2OA 4P1LA 4ZEFA 2H99A 4DXBA 4I40A 4OMBA 3SDFA 3PMVA 3EHTA 4RA1A 2G93A 4O7MA 4BDLA 2DQVA 1NV7A 1LFIA 1FPIA 1FPJA 3IK6B 1BK4A 4PGPA 2E1SA 3CG1A 3K6UA 4RYAA 2Y7RA 3FXRA 3LUYA 2VT5A 4TLLB 4ELPA 4ZE8A 1SI1A 4IGRA 5H8QA 2DDKA 4EXLA 5CBSA 1FTJA 4QFLA 2Q8JA 4IO4A 1R1NA 4I62A 2P3NA 2V3TA 2X7PA 4X1BA 4OFJA 1FTOA 3PV0E 4PFRA 4JWOA 2ZNTA 5H8QB 1IXCA 2F5XA 4F1YA 3FV1A 1MPCA 4GFRA 1KA0A 1MQJA 2NOOA 5DVFA 1B4HA 5EHSA 1IZ1A 3T9UA 5I58A 2O1LA 3PD8A 3IB2A 2HAUA 3B6WA 4AS4A 2IEEA 3FXBA 3QK6A 3FUZA 1MY4A 2NWJA 2WX9A 3MVWA 2KQZA 3LSWA 4OVSA 2H98A 1D3KA 1NV6A 3CFXA 3MWBA 2A5SA 4YKIA 1AIVA 2W7YA 1OLCA 5I2KB 5I84A 3FIRA 1MXUA 3B7DA 4DLDA 4GQOA 4GWOA 1URGA 4ZEDA 2NXOA 4R6HA 3C36A 1LFGA 2YPNA 1LBXA 5CMMA 4PFYA 4PGNA 3OXNA 5M2VA 3VVDA 3C34A 3T22A 1QUJA 5ET7A 2I4BA 2ZMBA 4IR8A 3H3GA 4BDRA 1TXFA 3CFLA 2CEXA 4GX3A 2GHAA 3TTLA 2I0CA 1DTGA 4H5FA 4Q0CA 4PCDA 4RNSA 3SETA 3GLBA 2ZNSA 3DP6A 3OEKA 1MXWA 4KQPA 3T1BA 4XKQA 4OETA 3U94A 2Z8DA 3MPLA 2OZZA 2H9BA 4P3LA 4PF6A 4N81A 1K9YA 4FEDA 3PUWE 1ZJLA 3KC1A 4QXDA 4KCCA 4GWWA 2GQ1A 3IORA 5TP9B 3BFTA 1M5DA 3HFUA 3N5LA 4R9FA 1P1QA 2XX9A 3U8QA 4IY5A 3RT6B 1PBQA 4LA9A 3BIGA 3N26A 1XVXA 3RYDA 4BDOA 4C1UA 4GVOA 4IO3A 3RTWB 3K00A 2WYKA 1JEVA 2V93A 1EH3A 5TP9A 3ZKLA 2P0SA 4MLVA 3SERA 4G4PA 4M1VA 1MPDA 2F36A 3TEPA 1TFAA 2Q9TA 2R6GE 1LGBC 4FEBA 4O3CA 5DVIA 3S2VA 2XWVA 1ZTYA 1B1HA 3O6GA 4QHQA 4F39A 1QKAA 5DEXA 1PC3A 3PPPA 4NE4A 1B3GA 3FJ7A 4MCOA 1LCFA 3SEVA 4LATA 4YKPA 5EQ8A 5HM4B 3KBRA 4F2QA 1B3HA 4H0WA 4U23A 4XIGQ 2GRVA 3PMWA 2VPNA 2F78A 4G61A 4G68B 1GGGA 1IMCA 5AA4B 1FBFA 4R72A 4OHNA 5ITOA 2UVJA 4R2FA 5H8FA 1XC1A 3RN8A 4RK2A 3K1MA 2XXIA 4NF5A 1LBVA 1S7YA 3KOTA 3OD7A 4GRKA 1T0KA 3ILUB 3VXCA 1N76A 4MMPA 3K2DA 4QFOA 3PPQA 4PQJA 1BKAA 1LBYA 2B65A 4JSOA 2RINA 3H6WA 1NV3A 1Y1ZA 3E13X 1IQ7A 4LUBA 1P99A 5AA4A 2O7UA 1OQGA 2ZYNA 1MXXA 5CC2A 4F3BA 2PX1A 4NN3A 4PBHA 1R9QA 4ZEBA 1EU8A 2V25A 4KXPA 4NF8A 3MAMA 4YKJA 4GWSA 2RCAA 4NF6B 5HPQA 1OMPA 1IXHA 1PDAA 3IB1A 3CFZA 3MUQA 4QBAA 4H45A 1P1NA 1LAXA 1LB8A 1NL5A 2QS3A 1PB9A 1NFTA 3ECRA 1FCKA 1N7XA 1P1OA 1SVXB 5ET6A 3H06B 2HXRA 2DXYA 2DWHA 3IL1B 4MFIA 1A55A 2D3IA 3GYYA 2UYFA 3PUXE 4EUOA 1SDXA 1XI6A 5TPAB 1N3WA 3P7IA 4DI3D 1FTAA 1B3EA 4UA8A 1I69A 1NNTA 1N04A 3VXBA 1A8EA 2VP1A 1LEVA 5LOMA 4PFWA 1US5A 4POXA 3K1NA 3VVFA 1YCJA 3C32A 1FQAA 1UIVA 2E0SA 3TTKA 5TPAA 5F1QA 2PFZA 2XWOA 2O68A 4MEVA 2OLBA 3U93A 4OWDA 1JNFA 2QVRA 5CMKA 2XX8A 1VR5A 4JB7A 1Y4TA 3TZAA 4OVQA 1F9BA 2DVCA 4GBVA 1FPFA 3KC0A 2QL3A 4PF8A 1D9YA 3S9LC 5I57A 2DWAA 3K0VA 4TOZA 3TCHA 4O3BA 2HHMA 4GD5A 2OWSA 1ANFA 3EKIA 3ZKKA 4BLAA 3FVGA 5L8DA 2Z8EA 2QVVA 2ANJA 4JBZA 4OYVA 1BLFA 4KD5A 3V89B 4PDHA 2Q8MA 1MH4A 3DP8A 4P47A 3QXMA 2XA5A 1CNQA 1UTBA 3M8UA 3G7WA 4PFUA 1FQBA 2XD2A 3DLNA 4H5GA 4N8YA 2AL5A 1USYE 2ONKE 1J1NA 1SW5A 1US4A 5J1DA 1LLSA 2ZZVA 2XXKA 4R73A 4DCYA 5I7IA 3B6QA 3PGFA 3EF7A 4F18A 4U1OA 1Y3QA 2CZHA 4X48A 2X7QA 2QVUA 2I58A 3G3KA 4IB2A 1H43A 5BWJA 1GV8A 2UXAA 3JZJA 4DI4B 3WAFA 4FAJA 1FQEA 3QUFA 1XVYA 5ISUA 2G29A 1TFDA 3FATA 5F24A 1JW1A 4C1TA 1MY2A 3LUZA 4ZECA 3C31A 3KN3A 2I6EA 2ZZXA 4PAFA 2XX7A 5BUUA 3FVNA 4QFPA 5JEIA 2Z22A 3LSFB 3TTNA 1PB7A 4QSEA 4IO6A 4OVTA 3T9HB 4XTCQ 1IMEA 2Q2AA 5A5LA 1MXYA 1B32A 3TYHA 2KR0A 2THIA 3IO4A 4HE1A 3F11A 4QSDA 4F3GA 1K9ZA 5DYHA 3VV5A 2XXPA 3EQ1A 3KJ7A 3MP1A 2DOJA 3N94A 5TU0A 3V83A 2REJA 1YTVA 4N4UA 1FTKA 1SQYA 2YLNA 1NUYA 1FQFA 1JW5A 3PMXA 1N84A 3VLUA 4OFOA 1LBWA 4KR5A 1DBZA 1LB9A 4EF2A 3QMFA 3RPLA 4OVRA 3HHGA 3HSTA 2IA4A 3TDJA 4KI0E 3K01A 4FE8A 3MVXA 5CRYA 2ONSA 2RF1A 4XFEA 1FTLA 2H4IA 1CE2A 3T96B 1NV4A 1G0IA 1B58A 3KOSA 1FJ6A 5EYFA 3D4CA 1ATGA 3WAEA 3H4ZA 1Y3NA 2I0BA 4KCDA 3OENA 2ZZWA 2KLFA 3UK4A 3RPLB 4GX6A 3QIMA 3S9EA 4OVPA 4DIGA 3T93B 3IFCA 1MS7A 3A09A 3TFLA 5A5XB 1JETA 5AA2B 1B0HA 3Q26A 3LSLA 1YXIA 4JWYA 1S9TA 1O7TA 5L9MA 3IJXB 3K02A 4RY1A 3ISPA 5IZ3A 1MRPA 5AE4A 1II5A 4EQ9A 4ELOA 1FPDA 3Q27A 2ZNUA 2FIXA 5ET8A 4ZDMA 2XXXA 4AQ4A 4AB6A 1LBCA 2F8DA 2QJEA 4P8BA 2V3UA 3DM0A 5T3JA 5H8NB 1AH5A 3TQLA 4P0IA 3KBZA 4OESA 4YMBA 1AMFA 1IMFA 3RT8A 1FRPA 4R9GA 4NWDA 3VFJA 3I3VA 4OENA 2FHYA 1XOCA 3SESA 1FPLA 4H65A 3KZGA 3PPOA 1B51A 3CR9A 1DTZA 3G3FA 4M4GA 3KEIA 2B4MA 5I3SA 2O7IA 1UIUA 3CIJA 3SEYA 1EZOA 2RCBA 4GXSB 4NF6A 4JVIA 3KSJA 3CI8A 4H67A 3DELB 2V4CA 4OA4A 5ELVA 1L5TA 4TQUQ 3K6XA 1DPPA 5ICTA 1NI9A 1FBEA 2GFEA 2XXYA 3U92A 1PEBA 2RC7A 3MYUA 3E9XA 5I56B 3KN7A 1D9VA 3MJNA 4LN5A 3V8XB 4IO5A 1IXIA 4ESXA 3THIA 1URDA 4QFKA 3KGCA 3OO8A 4O7IA 1OQHA 5AA1A 2B3FA 4NTLA 2HXWA 2WKYA 2FA7A 5EYGA 2CEYA 4U2RA 5ET5A 5FHOA 1HSLA 4X1DA 3IOUA 1ZLQA 2P2AA 2DVZA 2XXHA 3OO7A 1IMDA 2H5YA 1EYKA 1LFHA 2FNCA 4AS5A 4F3SA 4PAKA 1YPNA 1FBDA 4EF1A 1H3DA 2QS1A 2HPGA 1NH8A 3PPRA 1M5BA 3SEXA 4GWXA 4KHZE 4GX4A 4E0XA 4PAIA 3RGYA 3K6VA 3MSTA 1IMBA 4O3AA 3FXQA 1SD3A 3HV1A 3FD3A 3IO6A 3S9NC 4R74A 4NG7A 2M8CA 1B6HA 1B2HA 2HZKA 1VDWA 2YJPA 1B5JA 2CZIA 4RPOA 4N8GA 1H44A 4I9DA 1CB6A 4LQ2A 4DDDA 3TTMA 3DP4A 4X04A 2HAVA 2PFYA 3MP6A 5CBRA 4NF4A 1B9JA 2DP8A 5KCJB 4K3FA 1GTKA 1FBPA 1MY3A 4R2BA 3OO6A 2X26A 1FTMA 5IGAA 1AOVA 4IGTA 2FBPA 1QGXA 4ESWA 4I3EA 5I57B 4G68C 3G3IA 2CZLA 1FBHA 4LZ8A 3O6IA 3PUVE 2XXTA 1B0LA 5KCJA 1I6AA 1SW2A 3GBBA 3LR1A 3CRBA 3W9VA 3MZBA 5I58B 2DWIA 2UVIA 3FXUA 1H76A 1M5CA 2UVHA 4H8JA 1B7ZA 5LDZA 2ZYOA 4OXVA 1FQCA 2FVZA 3LV0A 2XHDA 4IY6A 1M5EA 1FJ9A 2RC9A 4OVJA 1BIYA 3IFAA 4G8HA 3E3KA 4IO7A 3GBAA 1SBPA 5ESYA 4U4XA 3T66A 4ELRA 5ITPA 1FSAA 1DCUA 4YB6A 1TWYA 2OWZA 3OSRA 1RYOA 2WEFA 4ZZAA 4Z7EA 1I6BA 2H25A 1IEJA 3JV9A 4NMYA 4JVDA 2AL4A 1LBZA 1MM6A 3N6TA 3OOAA 1UTHB 3R26A 3OSQA 3AXFA 2DWJA 1QJMA 1YZ0A 1B40A 3I6VA 3EPEA 3EN3A 4BDNA 4DXCA 2R8TA 3E4RA 4GBWA 2D5WA 2ESNA 1LBBA 1IUDA 1POTA 2Z8FA 3IAZA 1NNKA 1MDQA 3U65A 4JDFA 3TPAA 4F19A 2A5TB 3OEMA 4ELQA 5I2NB 4MX6A 4LQ5A 4DXUA 1NV0A 4P56A 1WVJA 1XS5A 4UABA 4BDQA 2QS4A 3NOHA 4UACA 2UVGA 3CVGA 4OERA 2PMSA 3B6TA 1JP4A 2PVUA 1NUWA 3S9MC 1SYIA 3KG2A 1QUKA 1B7UA 1GVCA 3GZGA 2Q88A 1NV1A 2O69A 3H6TA 3QAXA 3MC2A 4FATA 3FJMA 3USDA 1N3XA 4KYSA 3EHSA 1R6ZA 1MQGA 2CMOA 5CMCA 4YICA 3FJGA 1EYIA 4G77A 2XD3A 3FZVA 1N7WA 4Q30B 3S4UA 2LAOA 5FTIA 4N17A 3ILTB 1Q1KA 4O94A 2XWIA 2R9JA 5CM6A 2F97A 2O51A 3O28A 3TUSA 4RXLA 4X8RA 1GR2A 4YB7A 3OMBA 3SEUA 4QSCA 4G68A 1QW0A 3VLVA 1YAEA 5EQAA 5AA3A 5I59A 1INPA 2Y7WA 4U4SA 4WEDA 4XEQA 1ZU0A 2VGQA 3KN8A 1B5HA 4I8CA 4P1EA 3PPNA 4NF5B 1MXZA 4F3PA 4O8MA 3C9HA 1B4ZA 3UN6A 1Y20A 2UYEA 5B70A 1VE4A 1Y4CA 1A40A 2XXWA 4GWUA 1P1WA 2F35A 1R9LA 1LAGE 3VDFA 2O1MA 4PP0A 4ECFA 4L17A 1QUIA 4HCWA 1LSTA 1VFDA 5DEXB 4XKNA 1SW4A 3TCGA 4NF0A 3HCQA 1B5IA 3RY3A 1DPEA 1MQIA 1N0TA 1NKXA 5JK4A 2DE4A 5ICQA 3E79A 2JJKA 4PFTA 3VE1B 4P11A 5H8NA 4E0WA 4NX1A 4YU0A 3B8BA 1TT1A 2F6GA 4PBQA 3ODBA 2FIEA 1NNPA 1UQWA 4F31B 3MZ1A 4U21A 4ZZEA 3H6VA 5L9OA 3HPIA 4JWXA 3FVOA 4PETA 4OEVA 3Q28A 4GWYA 4MBPA 1RDXA 5H8FB 4YMAA 3W9WA 1Y9UA 2F7BA 2XXVA 1RYXA 4NWCA 4LONB 2XXRA 4NHBA 4OEUA 3PU5A 4DE8A 3A3CA 3PTYA 1Q9DA 1HSEA 4PC9A 4JVCA 2WBBA 1IMAA 2WYPA 2RC8A 2RKMA 1A7LA 5IZ1A 1JW4A 2I4CA 2I49A 4LZ7A 1D4NA 3QYTA 5IM2A 5FHMA 2Y5KA 3IR1A 4RK9A 2Q89A 1RKMA 2HQ0A 2R71A 1QVSA 4X9TA 3BKIB 5I56A 2Y7KA 5DTBA 5IZZA 2QS2A 4F29A 2VD3A 3B50A 1KZ8A 4GLIA 5EYHA 4F22A 1DK4A 5IAIA 1A99A 4MJOA 2P3VA 1G0HA 2REGA 3TELA 4Z0IA 3R7XA 3U1OA 4N13A 4JXIA 3TTRA 4YB5A 1USYH 1P1UA 1H45A 1SW1A 1FPBA 3C35A 1LAHE 3FV2A 4H6DA 3TKDA 1DMBA 4GOTA 3O2AA 5KDTB 2PCRA 1DOTA 1ZBMA 3FGSA 1MG1A 2VOZA 3BIHA 3TAJA 5AA2D 2FYIA 4NF4B 2OX3A 2F34A 3MZ9A 2OJTA 4XF5A 3CG3A 1B46A 4U22A 5K2YA 3EHUA 4THIA 1VFEA 2O6AA 4I3YA 1O64A 3PUYE 3KJTA 2WBDA 1YYZA 3D4GA 4G2ZA 2Q74A 4WEPA 3BFUA 5H8HB 4PDDA 1FQDA 1M5FA 4KYDA 4ISUA 3LSXA 4I1DA 1MY0A 3LC8A 4MNIA 4ND9A 5IKBA 1MDP1 4POWA 4QFNA 3HHFA 1B52A 4N6KA 4GL0A 4RPNA 1JQFA 1NUXA 3O97A 1ZIUA 1Z7NE 3MP8A 3O9PA 2Z23A 2QRYA 1NH7A 1IITA 4LP2B 2I48A 4GL8A 4P0GA 5H8HA 3G3GA 2ZXTA 2AYSA 4H8IA 2BJJX 1B05A 3L6GA 4MNCA 4XKRA 2ZYMA 4MIJA 5DW8A 4R6YA 2ONRA 4YKKA 2DYXA 5B7DA 4MH5A 3UP9A 3QUJA 4GWZA 2CZKA
chains in the Genus database with same CATH topology
4JWOA 1M5CA 2UVHA 4H8JA 4N6PA 1B7ZA 2ZNTA 1SYHA 5L9MA 2ZYOA 4R73A 4DCYA 4OXVA 1EZ9A 3K4UA 1FQCA 1NMUA 5H8QB 3B6QA 1IXCA 2Q2CA 2VHAA 4R6KA 3PGFA 3EF7A 3T9VA 2XHDA 2F5XA 4U1OA 4F18A 1UTBB 2Y84A 4F1YA 5CM6A 3FV1A 1OIBA 1MPCA 1Y3QA 5LOMA 4IY6A 1UTHA 1M5EA 5L9SA 2O84X 4X48A 4GFRA 2RC9A 4HTGA 1Z7ME 2X7QA 4OVJA 1BIYA 4G8HA 1MQJA 2I58A 2NOOA 3G3KA 4IB2A 3RQTA 3E3KA 4IO7A 4QF9A 5DVFA 1H43A 3RNNA 3GBAA 3GXAA 1B4HA 5EHSA 4Q8RA 5BWJA 1IZ1A 1SBPA 1GV8A 2UXAA 3JZJA 4U4XA 3T9UA 3T66A 5K2XA 4ELRA 5I58A 5ITPA 4NEDA 4DDDA 2O1LA 3V5AA 3PD8A 3WAFA 3N6UA 4FAJA 1FQEA 2V3QA 3QUFA 1XVYA 4YB6A 1TWYA 3IB2A 3IOTA 2HAUA 3H7MA 5ISUA 2G29A 1RYOA 1MQDA 2F7AA 1TFDA 1B3FA 3B6WA 1MM7A 3FATA 1JW1A 4C1TA 4ONYA 2IEEA 4EDPA 1MY2A 4ZZAA 4Z7EA 3QK6A 3SEWA 2P1SA 1I6BA 2H25A 1IEJA 1MY4A 2VD2A 3FUZA 3JV9A 4NMYA 2NWJA 3O6HA 3C31A 4ZECA 3MVWA 1B7HA 3T9XB 2AL4A 3KN3A 1XT8A 1B3LA 1MM6A 2I6EA 3LSWA 3N6TA 5FTHA 3OOAA 1UTHB 4HS7A 2H98A 5H8SA 3R26A 1D3KA 3OSQA 3AXFA 2DWJA 1QJMA 3QSLA 5CI5A 2XX7A 3CFXA 5BUUA 3MWBA 1B40A 2A5SA 3FVNA 2F7CA 4GIZA 4YKIA 1AIVA 3I6VA 2W7YA 3EPEA 4FJPA 3EN3A 1NNFA 1OLCA 5I2KB 3IB0A 4BDNA 2A5TA 5I84A 3FIRA 4QFPA 4RJZA 1MXUA 3B7DA 2Z22A 3LSFB 4GQOA 1URGA 4GWOA 3TTNA 4DLDA 3Q29A 1ELJA 2NXOA 4ZEDA 4DXCA 1PB7A 2F6PA 4QSEA 2QMXA 4R6HA 3C36A 1LFGA 2YPNA 1S50A 3HN0A 4IO6A 5FHNA 1I6QA 3E4RA 2D5WA 5CMMA 4PFYA 4WKMA 3OXNA 1JEUA 3T9HB 4XTCQ 5M2VA 2ESNA 3VVDA 2Q2AA 4Q5TA 3Q25A 1XHYA 1LBBA 1MXYA 3JYRA 3C34A 3T22A 1IUDA 1QUJA 1B32A 2I4BA 2PT1A 1POTA 2Z8FA 2THIA 3IAZA 3O29A 3KSXA 3RUMA 3TYHA 4KPTA 2ZMBA 3IO4A 3THIA 3F11A 1NNKA 3H3GA 3O66A 3M3LA 4BDRA 1TXFA 4HCYA 4QSDA 4F3GA 2B3BA 1MDQA 3CFLA 1URSA 4TLMB 5DYHA 2XXPA 4ZS9A 3EQ1A 3KJ7A 4JDFA 3VV5A 2GHAA 3TTLA 5KZTA 3MP1A 4U1ZA 2DOJA 5I2KA 2XXUA 3TPAA 4F19A 2A5TB 2I0CA 3N94A 1Y3PA 5TU0A 3OEMA 4ELQA 5I2NB 3V83A 1DTGA 4H5FA 2REJA 1JVXA 4LQ5A 4Q0CA 4HW8A 1YTVA 1A8FA 3ONMA 4RNSA 1FTKA 3SETA 4DXUA 1SQYA 3M3KA 3I5OA 3GLBA 1WVJA 2YLNA 2ZNSA 1XS5A 3DP6A 3M3FA 5JEIA 1FQFA 3MVYA 5A5XB 3OEKA 1MXWA 1BP5A 1JW5A 4KQPA 3PMXA 4BDQA 2QS4A 4XKQA 4OETA 3FVKA 1N84A 1AL3A 4UACA 3U94A 2Z8DA 2UVGA 3CVGA 2OZZA 2H9BA 3MPLA 3VLUA 4OERA 2PMSA 3B6TA 4OFOA 2PVUA 4KR5A 1SYIA 3S9MC 2I3VA 3KG2A 1LB9A 4EF2A 1QUKA 1B7UA 4FEDA 3PUWE 1ZJLA 4OZ9A 1GVCA 3H03A 3HHGA 3GZGA 2DE2A 3HSTA 5I2NA 2Q88A 2IA4A 2O69A 3H6TA 4KCCA 3TDJA 3QAXA 4KI0E 3MC2A 3K01A 3IORA 4FE8A 4DCXA 3MVXA 5TP9B 3RPWA 3BFTA 1M5DA 5CRYA 2ONSA 5A5XA 4OQOA 3N5LA 2RF1A 1FTLA 4H1XA 3FJMA 4F1VA 4FATA 4QFKA 4ZEKA 2H4IA 1BTJA 3PD9A 3USDA 3W15C 1OVBA 1N3XA 4R9FA 1CE2A 4KYSA 1P1QA 2XX9A 3EHSA 1MXVA 3T96B 3U8QA 1R6ZA 1MQGA 4GF8A 3H6UA 1FW0A 3OELA 4IY5A 2CMOA 3RT6B 1B58A 1LAFE 3KOSA 4R75A 5EYFA 1OVTA 3D4CA 3FXUA 1PBQA 1ATGA 4LA9A 3WAEA 5CMCA 3HO7A 4YICA 3FJGA 3H4ZA 3BBRA 4G77A 2XD3A 1Y3NA 3N26A 5I59B 3FZVA 2I0BA 1N7WA 1XVXA 4KCDA 3OENA 4LVQA 4XKPA 4BDOA 4Q30B 2KLFA 2LAOA 3KFMA 4GVOA 4IO3A 3S4UA 3UK4A 4C1UA 3QIMA 4LZ5A 3S9EA 5FTIA 3RTWB 3K00A 3ILTB 2DS9A 1JEVA 4DIGA 1MY1A 1OLAA 1Q1KA 3K1PA 3U72A 1QKBA 2V93A 1EH3A 3T93B 5TP9A 1MS7A 3A09A 4FORA 4ZEIA 1MQHA 3ZKLA 3TFLA 4OFJA 2P0SA 1JETA 2R9JA 2F97A 2O51A 4G4PA 1MPDA 4GXAA 4M1VA 4MLVA 2F36A 3SERA 2I3WA 5AA2B 1B0HA 2OK2A 3Q26A 3TEPA 3LSLA 3O28A 1DSNA 1HSJA 1TFAA 1WDNA 2Q9TA 2NVUB 3TUSA 2R6GE 3CSBA 4RXLA 4JWYA 4G8NA 1GR2A 1LGBC 1S9TA 4YB7A 1O7TA 4FEBA 3IJXB 3K02A 3OMBA 4O3CA 4QSCA 4RY1A 5DVIA 4G68A 1ZTYA 1B1HA 1QW0A 3S2VA 1YAEA 3OO9A 3VLVA 3O6GA 5AA3A 2HZLA 1MH3A 3IX1A 5I59A 1MRPA 2Y7WA 4QHQA 4F39A 4U4SA 1QKAA 4WEDA 5DEXA 1PC3A 3PPPA 1ZMGA 4NE4A 5AE4A 1II5A 4EQ9A 1ZU0A 4ELOA 3MVZA 2VGQA 4YAHX 3Q27A 3KN8A 1B3GA 1B5HA 3FJ7A 2ZNUA 4I8CA 3PPNA 4NF5B 4EQ7A 1LCFA 1MXZA 4ZDMA 2XXXA 4LATA 3SEVA 4AQ4A 4F1UA 4F3PA 3C9HA 1EZPA 4AB6A 1B4ZA 3LBSA 2HFBA 4WXJA 3UN6A 1Y20A 2UYEA 1LBCA 2F8DA 3TODA 4YKPA 5JTYA 2QJEA 4EQBA 5B70A 1VE4A 1Y4CA 1A40A 2XXWA 5HM4B 3MQ9A 1P1WA 5AA2A 2F35A 2V3UA 3DM0A 3KBRA 5H8NB 2ABHA 1R9LA 4F2QA 1SI0A 1ZKBA 1B3HA 4H0WA 1PBPA 4U23A 1AH5A 3TQLA 4XIGQ 2GRVA 3PMWA 1B1XA 4P0IA 2PYYA 1LAGE 3VDFA 2F78A 4MF3A 2O1MA 4PP0A 2Y7PA 1QULA 4G68B 5DT6A 1GGGA 4OESA 4ECFA 4L17A 1AMFA 4YMBA 4ZE9A 1QUIA 3A3UA 4HCWA 5AA4B 1LSTA 1VFDA 3IJOB 2HEUA 5DEXB 4XKNA 3RT8A 3UIFA 4R9GA 1SW4A 4R72A 4NWDA 4OHNA 3I3VA 3TCGA 3VFJA 4OENA 2DE3A 3HCQA 5ITOA 2UVJA 2ALUA 4R2FA 4N07A 5H8FA 1POY1 1B5IA 1XC1A 1XOCA 3RN8A 3SESA 3RY3A 1DPEA 4RK2A 3K1MA 1VSOA 2XXIA 4H65A 4NF5A 3KZGA 1MQIA 1N0TA 3PPOA 1NKXA 1S7YA 3KOTA 3OD7A 4GRKA 4PE5B 3ILUB 5JK4A 1B51A 1T0KA 2DE4A 3VXCA 1N76A 1DTZA 3CR9A 3K2DA 5JTYB 3G3FA 3VVEA 4M4GA 4QFOA 1LCTA 3G3JA 3KEIA 3PPQA 4OTEA 3UA8A 5ICQA 2O7IA 4PQJA 1UIUA 1BKAA 3CIJA 4PFTA 3SEYA 4P11A 5H8NA 3VE1B 4E0WA 1EZOA 2B65A 2RCBA 4GXSB 4YU0A 4JSOA 4NF6A 1PB8A 2RINA 3H6WA 3KSJA 1TT1A 2F6GA 4IO2A 3CI8A 3ODBA 1Y1ZA 4H67A 2GH9A 3L6HA 2V84A 1IQ7A 3DELB 1NNPA 1UQWA 2AIXA 3E13X 3MZ1A 4LUBA 4U21A 4F31B 1P99A 5ELVA 2O7UA 3H6VA 1O63A 4ZZEA 5AA4A 1OQGA 1L5TA 5L9OA 3HPIA 4TQUQ 4JWXA 2ZYNA 3FVOA 3K6XA 4PETA 5CMBA 4OEVA 5EHMA 1MXXA 3Q28A 1DPPA 1WODA 4MBPA 5CC2A 5ICTA 5H8FB 3UGWA 4YMAA 1Y1MA 2GFEA 3W9WA 1Y9UA 2XXYA 2F7BA 3U92A 4F3BA 2PX1A 1PEBA 4YZZA 2OBGA 2XXVA 1RYXA 2RC7A 3CSGA 4NWCA 3E9XA 1R9QA 4ZEBA 4LONB 5I56B 2XXRA 1EU8A 2V25A 3KN7A 4FECA 1D9VA 2QMWA 4OEUA 3PU5A 4NF8A 4DE8A 3A3CA 4JSDA 3MAMA 3MJNA 4YKJA 3PUZE 3ZSFA 2RCAA 4NF6B 1HSEA 3SKPA 3V8XB 5HPQA 4IO5A 1OMPA 1IXHA 1IXIA 4ESXA 3G3HA 5HBCA 1IXGA 1PDAA 1URDA 2RC8A 2QSXA 3CFZA 3IB1A 2RKMA 1A7LA 3KGCA 3MUQA 3OO8A 1JW4A 4OFLA 2I4CA 2I49A 1P1NA 1LAXA 2QPQA 4LZ7A 4BDMA 1D4NA 1LB8A 3QYTA 1OQHA 2ZYKA 5FHMA 5AA1A 1NL5A 2OCUA 3SEUA 3IR1A 2QS3A 1PB9A 1NFTA 2B3FA 1FCKA 2PT2A 3ECRA 4RK9A 2Q89A 1N7XA 1JVYA 2HXWA 4NTLA 1P1OA 2WKYA 2GHBA 1SVXB 3H06B 2D21A 1RKMA 4KYEA 2HQ0A 2R71A 2FA7A 1QVSA 2XXQA 4EXKA 4X9TA 2DXYA 2DWHA 1Q35A 3BKIB 5I56A 2Y7KA 4U2RA 5DTBA 3IL1B 3FASA 4MFIA 2QS2A 1A55A 5FHOA 3ZS6A 1HSLA 4F29A 4NF8B 2OWTA 2VD3A 3TCFA 3VLWA 5KDTA 4X1DA 2D3IA 4GLIA 4MLQA 4DZ1A 3IOUA 2DXRA 1ZLQA 4F22A 2PBWA 2P2AA 2DVZA 2UYFA 3TQWA 5IAIA 2XXHA 3OO7A 1A99A 3PUXE 2REGA 3RTFB 3TELA 1SDXA 2H5YA 5TPAB 1N3WA 3UORA 4Z0IA 4EUOA 3P7IA 3R7XA 1LFHA 2HCAA 2FNCA 3U1OA 2NUVA 4FIMA 4N13A 3K6WA 3TMGA 1B3EA 4JXIA 4UA8A 3TTRA 4YB5A 1USYH 4F3SA 1P1UA 3MPKA 1H45A 1I69A 1NNTA 1SW1A 1N04A 3IOVA 3OSRA 3VXBA 3C35A 1A8EA 3R6UA 1LAHE 2VP1A 3MBPA 3FV2A 1YPNA 4G8MA 4QRZA 4H6DA 3TKDA 1DMBA 1H3DA 3PV0E 1US5A 2QS1A 4PFWA 1NH8A 4POXA 4C0RA 3K1NA 3PPRA 3O2AA 4GOTA 5KDTB 1M5BA 1A54A 3SEXA 4KHZE 4E0XA 1MPBA 5F7VA 3C33A 1DOTA 1ZBMA 3FGSA 3VVFA 1MG1A 3K6VA 2VOZA 3RGYA 1YCJA 3C32A 3TAJA 1FQAA 1UIVA 2E0SA 4O3AA 3TTKA 5TPAA 1KWHA 3FXQA 5F1QA 2FYIA 4KFQA 4NF4B 1SD3A 5AA2D 2F34A 2O68A 4AB5A 3MZ9A 2OLBA 2OJTA 3HV1A 3MW0A 3FD3A 3IO6A 4OWDA 3U93A 1JNFA 3S9NC 3CG3A 5CMKA 1B46A 2XX8A 1IIWA 4U22A 5K2YA 1VR5A 3C4MA 3IOWA 4JB7A 4R74A 1Y4TA 3TZAA 2Y7IA 3EHUA 4THIA 1F9BA 2DVCA 2M8CA 1VFEA 2O6AA 2DSFA 5DVJA 3RLFE 1B6HA 1O64A 4F2OA 3PUYE 3KJTA 4XXUA 1B2HA 2HZKA 2QL3A 4ZEFA 2YJPA 2H99A 1B5JA 3D4GA 4G2ZA 4DXBA 1D9YA 4WEPA 3BFUA 4RPOA 5H8HB 4OMBA 3S9LC 5I57A 3SDFA 1H44A 3PMVA 3EHTA 1FQDA 4I9DA 2DWAA 3K0VA 4RA1A 1CB6A 1M5FA 4LQ2A 4KYDA 4ISUA 2G93A 4TOZA 3LSXA 4I1DA 1MY0A 3LC8A 4O3BA 2DQVA 3TCHA 3DP4A 3TTMA 4BDLA 2HAVA 3MP6A 4GD5A 1LFIA 2OWSA 5CBRA 4NF4A 1ANFA 1B9JA 2DP8A 5KCJB 3ZKKA 4ND9A 4K3FA 4BLAA 5IKBA 3FVGA 1GTKA 5L8DA 2Z8EA 1MDP1 1MY3A 4POWA 2ANJA 4QFNA 3HHFA 1B52A 4JBZA 3IK6B 4R2BA 3OO6A 4GL0A 4OYVA 4RPNA 2X26A 2E1SA 1BLFA 1FTMA 4KD5A 3CG1A 3K6UA 1JQFA 4RYAA 3V89B 2Y7RA 3O97A 1ZIUA 1Z7NE 3MP8A 3O9PA 1AOVA 3FXRA 2Z23A 2QRYA 4IGTA 1NH7A 1MH4A 3LUYA 1IITA 4LP2B 2I48A 3DP8A 4GL8A 4P0GA 4TLLB 4ZE8A 5H8HA 1SI1A 4ELPA 4IGRA 4ESWA 5I57B 4G68C 3G3GA 5H8QA 4EF1A 3QXMA 2ZXTA 3G3IA 2CZLA 2AYSA 4H8IA 2BJJX 1B05A 1UTBA 3L6GA 3M8UA 3G7WA 4LZ8A 4EXLA 3O6IA 1FQBA 3PUVE 2XXTA 4PFUA 1B0LA 1FTJA 4XKRA 5CBSA 5KCJA 2ZYMA 2XD2A 4QFLA 2Q8JA 4IO4A 1I6AA 4R6YA 1SW2A 2ONRA 1R1NA 3DLNA 3GBBA 3LR1A 4H5GA 4I62A 4YKKA 2AL5A 2DYXA 3CRBA 1USYE 3W9VA 2ONKE 3MZBA 5B7DA 1J1NA 1SW5A 1US4A 2V3TA 4MH5A 3UP9A 5J1DA 5I58B 2DWIA 2UVIA 2X7PA 3QUJA 4X1BA 1LLSA 1FTOA 1H76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWO A;  1M5C A;  2UVH A;  4H8J A;  4N6P A;  1B7Z A;  2ZNT A;  1SYH A;  5L9M A;  2ZYO A;  4R73 A;  4DCY A;  4OXV A;  1EZ9 A;  3K4U A;  1FQC A;  1NMU A;  5H8Q B;  3B6Q A;  1IXC A;  2Q2C A;  2VHA A;  4R6K A;  3PGF A;  3EF7 A;  3T9V A;  2XHD A;  2F5X A;  4U1O A;  4F18 A;  1UTB B;  2Y84 A;  4F1Y A;  5CM6 A;  3FV1 A;  1OIB A;  1MPC A;  1Y3Q A;  5LOM A;  4IY6 A;  1UTH A;  1M5E A;  5L9S A;  2O84 X;  4X48 A;  4GFR A;  2RC9 A;  4HTG A;  1Z7M E;  2X7Q A;  4OVJ A;  1BIY A;  4G8H A;  1MQJ A;  2I58 A;  2NOO A;  3G3K A;  4IB2 A;  3RQT A;  3E3K A;  4IO7 A;  4QF9 A;  5DVF A;  1H43 A;  3RNN A;  3GBA A;  3GXA A;  1B4H A;  5EHS A;  4Q8R A;  5BWJ A;  1IZ1 A;  1SBP A;  1GV8 A;  2UXA A;  3JZJ A;  4U4X A;  3T9U A;  3T66 A;  5K2X A;  4ELR A;  5I58 A;  5ITP A;  4NED A;  4DDD A;  2O1L A;  3V5A A;  3PD8 A;  3WAF A;  3N6U A;  4FAJ A;  1FQE A;  2V3Q A;  3QUF A;  1XVY A;  4YB6 A;  1TWY A;  3IB2 A;  3IOT A;  2HAU A;  3H7M A;  5ISU A;  2G29 A;  1RYO A;  1MQD A;  2F7A A;  1TFD A;  1B3F A;  3B6W A;  1MM7 A;  3FAT A;  1JW1 A;  4C1T A;  4ONY A;  2IEE A;  4EDP A;  1MY2 A;  4ZZA A;  4Z7E A;  3QK6 A;  3SEW A;  2P1S A;  1I6B A;  2H25 A;  1IEJ A;  1MY4 A;  2VD2 A;  3FUZ A;  3JV9 A;  4NMY A;  2NWJ A;  3O6H A;  3C31 A;  4ZEC A;  3MVW A;  1B7H A;  3T9X B;  2AL4 A;  3KN3 A;  1XT8 A;  1B3L A;  1MM6 A;  2I6E A;  3LSW A;  3N6T A;  5FTH A;  3OOA A;  1UTH B;  4HS7 A;  2H98 A;  5H8S A;  3R26 A;  1D3K A;  3OSQ A;  3AXF A;  2DWJ A;  1QJM A;  3QSL A;  5CI5 A;  2XX7 A;  3CFX A;  5BUU A;  3MWB A;  1B40 A;  2A5S A;  3FVN A;  2F7C A;  4GIZ A;  4YKI A;  1AIV A;  3I6V A;  2W7Y A;  3EPE A;  4FJP A;  3EN3 A;  1NNF A;  1OLC A;  5I2K B;  3IB0 A;  4BDN A;  2A5T A;  5I84 A;  3FIR A;  4QFP A;  4RJZ A;  1MXU A;  3B7D A;  2Z22 A;  3LSF B;  4GQO A;  1URG A;  4GWO A;  3TTN A;  4DLD A;  3Q29 A;  1ELJ A;  2NXO A;  4ZED A;  4DXC A;  1PB7 A;  2F6P A;  4QSE A;  2QMX A;  4R6H A;  3C36 A;  1LFG A;  2YPN A;  1S50 A;  3HN0 A;  4IO6 A;  5FHN A;  1I6Q A;  3E4R A;  2D5W A;  5CMM A;  4PFY A;  4WKM A;  3OXN A;  1JEU A;  3T9H B;  4XTC Q;  5M2V A;  2ESN A;  3VVD A;  2Q2A A;  4Q5T A;  3Q25 A;  1XHY A;  1LBB A;  1MXY A;  3JYR A;  3C34 A;  3T22 A;  1IUD A;  1QUJ A;  1B32 A;  2I4B A;  2PT1 A;  1POT A;  2Z8F A;  2THI A;  3IAZ A;  3O29 A;  3KSX A;  3RUM A;  3TYH A;  4KPT A;  2ZMB A;  3IO4 A;  3THI A;  3F11 A;  1NNK A;  3H3G A;  3O66 A;  3M3L A;  4BDR A;  1TXF A;  4HCY A;  4QSD A;  4F3G A;  2B3B A;  1MDQ A;  3CFL A;  1URS A;  4TLM B;  5DYH A;  2XXP A;  4ZS9 A;  3EQ1 A;  3KJ7 A;  4JDF A;  3VV5 A;  2GHA A;  3TTL A;  5KZT A;  3MP1 A;  4U1Z A;  2DOJ A;  5I2K A;  2XXU A;  3TPA A;  4F19 A;  2A5T B;  2I0C A;  3N94 A;  1Y3P A;  5TU0 A;  3OEM A;  4ELQ A;  5I2N B;  3V83 A;  1DTG A;  4H5F A;  2REJ A;  1JVX A;  4LQ5 A;  4Q0C A;  4HW8 A;  1YTV A;  1A8F A;  3ONM A;  4RNS A;  1FTK A;  3SET A;  4DXU A;  1SQY A;  3M3K A;  3I5O A;  3GLB A;  1WVJ A;  2YLN A;  2ZNS A;  1XS5 A;  3DP6 A;  3M3F A;  5JEI A;  1FQF A;  3MVY A;  5A5X B;  3OEK A;  1MXW A;  1BP5 A;  1JW5 A;  4KQP A;  3PMX A;  4BDQ A;  2QS4 A;  4XKQ A;  4OET A;  3FVK A;  1N84 A;  1AL3 A;  4UAC A;  3U94 A;  2Z8D A;  2UVG A;  3CVG A;  2OZZ A;  2H9B A;  3MPL A;  3VLU A;  4OER A;  2PMS A;  3B6T A;  4OFO A;  2PVU A;  4KR5 A;  1SYI A;  3S9M C;  2I3V A;  3KG2 A;  1LB9 A;  4EF2 A;  1QUK A;  1B7U A;  4FED A;  3PUW E;  1ZJL A;  4OZ9 A;  1GVC A;  3H03 A;  3HHG A;  3GZG A;  2DE2 A;  3HST A;  5I2N A;  2Q88 A;  2IA4 A;  2O69 A;  3H6T A;  4KCC A;  3TDJ A;  3QAX A;  4KI0 E;  3MC2 A;  3K01 A;  3IOR A;  4FE8 A;  4DCX A;  3MVX A;  5TP9 B;  3RPW A;  3BFT A;  1M5D A;  5CRY A;  2ONS A;  5A5X A;  4OQO A;  3N5L A;  2RF1 A;  1FTL A;  4H1X A;  3FJM A;  4F1V A;  4FAT A;  4QFK A;  4ZEK A;  2H4I A;  1BTJ A;  3PD9 A;  3USD A;  3W15 C;  1OVB A;  1N3X A;  4R9F A;  1CE2 A;  4KYS A;  1P1Q A;  2XX9 A;  3EHS A;  1MXV A;  3T96 B;  3U8Q A;  1R6Z A;  1MQG A;  4GF8 A;  3H6U A;  1FW0 A;  3OEL A;  4IY5 A;  2CMO A;  3RT6 B;  1B58 A;  1LAF E;  3KOS A;  4R75 A;  5EYF A;  1OVT A;  3D4C A;  3FXU A;  1PBQ A;  1ATG A;  4LA9 A;  3WAE A;  5CMC A;  3HO7 A;  4YIC A;  3FJG A;  3H4Z A;  3BBR A;  4G77 A;  2XD3 A;  1Y3N A;  3N26 A;  5I59 B;  3FZV A;  2I0B A;  1N7W A;  1XVX A;  4KCD A;  3OEN A;  4LVQ A;  4XKP A;  4BDO A;  4Q30 B;  2KLF A;  2LAO A;  3KFM A;  4GVO A;  4IO3 A;  3S4U A;  3UK4 A;  4C1U A;  3QIM A;  4LZ5 A;  3S9E A;  5FTI A;  3RTW B;  3K00 A;  3ILT B;  2DS9 A;  1JEV A;  4DIG A;  1MY1 A;  1OLA A;  1Q1K A;  3K1P A;  3U72 A;  1QKB A;  2V93 A;  1EH3 A;  3T93 B;  5TP9 A;  1MS7 A;  3A09 A;  4FOR A;  4ZEI A;  1MQH A;  3ZKL A;  3TFL A;  4OFJ A;  2P0S A;  1JET A;  2R9J A;  2F97 A;  2O51 A;  4G4P A;  1MPD A;  4GXA A;  4M1V A;  4MLV A;  2F36 A;  3SER A;  2I3W A;  5AA2 B;  1B0H A;  2OK2 A;  3Q26 A;  3TEP A;  3LSL A;  3O28 A;  1DSN A;  1HSJ A;  1TFA A;  1WDN A;  2Q9T A;  2NVU B;  3TUS A;  2R6G E;  3CSB A;  4RXL A;  4JWY A;  4G8N A;  1GR2 A;  1LGB C;  1S9T A;  4YB7 A;  1O7T A;  4FEB A;  3IJX B;  3K02 A;  3OMB A;  4O3C A;  4QSC A;  4RY1 A;  5DVI A;  4G68 A;  1ZTY A;  1B1H A;  1QW0 A;  3S2V A;  1YAE A;  3OO9 A;  3VLV A;  3O6G A;  5AA3 A;  2HZL A;  1MH3 A;  3IX1 A;  5I59 A;  1MRP A;  2Y7W A;  4QHQ A;  4F39 A;  4U4S A;  1QKA A;  4WED A;  5DEX A;  1PC3 A;  3PPP A;  1ZMG A;  4NE4 A;  5AE4 A;  1II5 A;  4EQ9 A;  1ZU0 A;  4ELO A;  3MVZ A;  2VGQ A;  4YAH X;  3Q27 A;  3KN8 A;  1B3G A;  1B5H A;  3FJ7 A;  2ZNU A;  4I8C A;  3PPN A;  4NF5 B;  4EQ7 A;  1LCF A;  1MXZ A;  4ZDM A;  2XXX A;  4LAT A;  3SEV A;  4AQ4 A;  4F1U A;  4F3P A;  3C9H A;  1EZP A;  4AB6 A;  1B4Z A;  3LBS A;  2HFB A;  4WXJ A;  3UN6 A;  1Y20 A;  2UYE A;  1LBC A;  2F8D A;  3TOD A;  4YKP A;  5JTY A;  2QJE A;  4EQB A;  5B70 A;  1VE4 A;  1Y4C A;  1A40 A;  2XXW A;  5HM4 B;  3MQ9 A;  1P1W A;  5AA2 A;  2F35 A;  2V3U A;  3DM0 A;  3KBR A;  5H8N B;  2ABH A;  1R9L A;  4F2Q A;  1SI0 A;  1ZKB A;  1B3H A;  4H0W A;  1PBP A;  4U23 A;  1AH5 A;  3TQL A;  4XIG Q;  2GRV A;  3PMW A;  1B1X A;  4P0I A;  2PYY A;  1LAG E;  3VDF A;  2F78 A;  4MF3 A;  2O1M A;  4PP0 A;  2Y7P A;  1QUL A;  4G68 B;  5DT6 A;  1GGG A;  4OES A;  4ECF A;  4L17 A;  1AMF A;  4YMB A;  4ZE9 A;  1QUI A;  3A3U A;  4HCW A;  5AA4 B;  1LST A;  1VFD A;  3IJO B;  2HEU A;  5DEX B;  4XKN A;  3RT8 A;  3UIF A;  4R9G A;  1SW4 A;  4R72 A;  4NWD A;  4OHN A;  3I3V A;  3TCG A;  3VFJ A;  4OEN A;  2DE3 A;  3HCQ A;  5ITO A;  2UVJ A;  2ALU A;  4R2F A;  4N07 A;  5H8F A;  1POY 1;  1B5I A;  1XC1 A;  1XOC A;  3RN8 A;  3SES A;  3RY3 A;  1DPE A;  4RK2 A;  3K1M A;  1VSO A;  2XXI A;  4H65 A;  4NF5 A;  3KZG A;  1MQI A;  1N0T A;  3PPO A;  1NKX A;  1S7Y A;  3KOT A;  3OD7 A;  4GRK A;  4PE5 B;  3ILU B;  5JK4 A;  1B51 A;  1T0K A;  2DE4 A;  3VXC A;  1N76 A;  1DTZ A;  3CR9 A;  3K2D A;  5JTY B;  3G3F A;  3VVE A;  4M4G A;  4QFO A;  1LCT A;  3G3J A;  3KEI A;  3PPQ A;  4OTE A;  3UA8 A;  5ICQ A;  2O7I A;  4PQJ A;  1UIU A;  1BKA A;  3CIJ A;  4PFT A;  3SEY A;  4P11 A;  5H8N A;  3VE1 B;  4E0W A;  1EZO A;  2B65 A;  2RCB A;  4GXS B;  4YU0 A;  4JSO A;  4NF6 A;  1PB8 A;  2RIN A;  3H6W A;  3KSJ A;  1TT1 A;  2F6G A;  4IO2 A;  3CI8 A;  3ODB A;  1Y1Z A;  4H67 A;  2GH9 A;  3L6H A;  2V84 A;  1IQ7 A;  3DEL B;  1NNP A;  1UQW A;  2AIX A;  3E13 X;  3MZ1 A;  4LUB A;  4U21 A;  4F31 B;  1P99 A;  5ELV A;  2O7U A;  3H6V A;  1O63 A;  4ZZE A;  5AA4 A;  1OQG A;  1L5T A;  5L9O A;  3HPI A;  4TQU Q;  4JWX A;  2ZYN A;  3FVO A;  3K6X A;  4PET A;  5CMB A;  4OEV A;  5EHM A;  1MXX A;  3Q28 A;  1DPP A;  1WOD A;  4MBP A;  5CC2 A;  5ICT A;  5H8F B;  3UGW A;  4YMA A;  1Y1M A;  2GFE A;  3W9W A;  1Y9U A;  2XXY A;  2F7B A;  3U92 A;  4F3B A;  2PX1 A;  1PEB A;  4YZZ A;  2OBG A;  2XXV A;  1RYX A;  2RC7 A;  3CSG A;  4NWC A;  3E9X A;  1R9Q A;  4ZEB A;  4LON B;  5I56 B;  2XXR A;  1EU8 A;  2V25 A;  3KN7 A;  4FEC A;  1D9V A;  2QMW A;  4OEU A;  3PU5 A;  4NF8 A;  4DE8 A;  3A3C A;  4JSD A;  3MAM A;  3MJN A;  4YKJ A;  3PUZ E;  3ZSF A;  2RCA A;  4NF6 B;  1HSE A;  3SKP A;  3V8X B;  5HPQ A;  4IO5 A;  1OMP A;  1IXH A;  1IXI A;  4ESX A;  3G3H A;  5HBC A;  1IXG A;  1PDA A;  1URD A;  2RC8 A;  2QSX A;  3CFZ A;  3IB1 A;  2RKM A;  1A7L A;  3KGC A;  3MUQ A;  3OO8 A;  1JW4 A;  4OFL A;  2I4C A;  2I49 A;  1P1N A;  1LAX A;  2QPQ A;  4LZ7 A;  4BDM A;  1D4N A;  1LB8 A;  3QYT A;  1OQH A;  2ZYK A;  5FHM A;  5AA1 A;  1NL5 A;  2OCU A;  3SEU A;  3IR1 A;  2QS3 A;  1PB9 A;  1NFT A;  2B3F A;  1FCK A;  2PT2 A;  3ECR A;  4RK9 A;  2Q89 A;  1N7X A;  1JVY A;  2HXW A;  4NTL A;  1P1O A;  2WKY A;  2GHB A;  1SVX B;  3H06 B;  2D21 A;  1RKM A;  4KYE A;  2HQ0 A;  2R71 A;  2FA7 A;  1QVS A;  2XXQ A;  4EXK A;  4X9T A;  2DXY A;  2DWH A;  1Q35 A;  3BKI B;  5I56 A;  2Y7K A;  4U2R A;  5DTB A;  3IL1 B;  3FAS A;  4MFI A;  2QS2 A;  1A55 A;  5FHO A;  3ZS6 A;  1HSL A;  4F29 A;  4NF8 B;  2OWT A;  2VD3 A;  3TCF A;  3VLW A;  5KDT A;  4X1D A;  2D3I A;  4GLI A;  4MLQ A;  4DZ1 A;  3IOU A;  2DXR A;  1ZLQ A;  4F22 A;  2PBW A;  2P2A A;  2DVZ A;  2UYF A;  3TQW A;  5IAI A;  2XXH A;  3OO7 A;  1A99 A;  3PUX E;  2REG A;  3RTF B;  3TEL A;  1SDX A;  2H5Y A;  5TPA B;  1N3W A;  3UOR A;  4Z0I A;  4EUO A;  3P7I A;  3R7X A;  1LFH A;  2HCA A;  2FNC A;  3U1O A;  2NUV A;  4FIM A;  4N13 A;  3K6W A;  3TMG A;  1B3E A;  4JXI A;  4UA8 A;  3TTR A;  4YB5 A;  1USY H;  4F3S A;  1P1U A;  3MPK A;  1H45 A;  1I69 A;  1NNT A;  1SW1 A;  1N04 A;  3IOV A;  3OSR A;  3VXB A;  3C35 A;  1A8E A;  3R6U A;  1LAH E;  2VP1 A;  3MBP A;  3FV2 A;  1YPN A;  4G8M A;  4QRZ A;  4H6D A;  3TKD A;  1DMB A;  1H3D A;  3PV0 E;  1US5 A;  2QS1 A;  4PFW A;  1NH8 A;  4POX A;  4C0R A;  3K1N A;  3PPR A;  3O2A A;  4GOT A;  5KDT B;  1M5B A;  1A54 A;  3SEX A;  4KHZ E;  4E0X A;  1MPB A;  5F7V A;  3C33 A;  1DOT A;  1ZBM A;  3FGS A;  3VVF A;  1MG1 A;  3K6V A;  2VOZ A;  3RGY A;  1YCJ A;  3C32 A;  3TAJ A;  1FQA A;  1UIV A;  2E0S A;  4O3A A;  3TTK A;  5TPA A;  1KWH A;  3FXQ A;  5F1Q A;  2FYI A;  4KFQ A;  4NF4 B;  1SD3 A;  5AA2 D;  2F34 A;  2O68 A;  4AB5 A;  3MZ9 A;  2OLB A;  2OJT A;  3HV1 A;  3MW0 A;  3FD3 A;  3IO6 A;  4OWD A;  3U93 A;  1JNF A;  3S9N C;  3CG3 A;  5CMK A;  1B46 A;  2XX8 A;  1IIW A;  4U22 A;  5K2Y A;  1VR5 A;  3C4M A;  3IOW A;  4JB7 A;  4R74 A;  1Y4T A;  3TZA A;  2Y7I A;  3EHU A;  4THI A;  1F9B A;  2DVC A;  2M8C A;  1VFE A;  2O6A A;  2DSF A;  5DVJ A;  3RLF E;  1B6H A;  1O64 A;  4F2O A;  3PUY E;  3KJT A;  4XXU A;  1B2H A;  2HZK A;  2QL3 A;  4ZEF A;  2YJP A;  2H99 A;  1B5J A;  3D4G A;  4G2Z A;  4DXB A;  1D9Y A;  4WEP A;  3BFU A;  4RPO A;  5H8H B;  4OMB A;  3S9L C;  5I57 A;  3SDF A;  1H44 A;  3PMV A;  3EHT A;  1FQD A;  4I9D A;  2DWA A;  3K0V A;  4RA1 A;  1CB6 A;  1M5F A;  4LQ2 A;  4KYD A;  4ISU A;  2G93 A;  4TOZ A;  3LSX A;  4I1D A;  1MY0 A;  3LC8 A;  4O3B A;  2DQV A;  3TCH A;  3DP4 A;  3TTM A;  4BDL A;  2HAV A;  3MP6 A;  4GD5 A;  1LFI A;  2OWS A;  5CBR A;  4NF4 A;  1ANF A;  1B9J A;  2DP8 A;  5KCJ B;  3ZKK A;  4ND9 A;  4K3F A;  4BLA A;  5IKB A;  3FVG A;  1GTK A;  5L8D A;  2Z8E A;  1MDP 1;  1MY3 A;  4POW A;  2ANJ A;  4QFN A;  3HHF A;  1B52 A;  4JBZ A;  3IK6 B;  4R2B A;  3OO6 A;  4GL0 A;  4OYV A;  4RPN A;  2X26 A;  2E1S A;  1BLF A;  1FTM A;  4KD5 A;  3CG1 A;  3K6U A;  1JQF A;  4RYA A;  3V89 B;  2Y7R A;  3O97 A;  1ZIU A;  1Z7N E;  3MP8 A;  3O9P A;  1AOV A;  3FXR A;  2Z23 A;  2QRY A;  4IGT A;  1NH7 A;  1MH4 A;  3LUY A;  1IIT A;  4LP2 B;  2I48 A;  3DP8 A;  4GL8 A;  4P0G A;  4TLL B;  4ZE8 A;  5H8H A;  1SI1 A;  4ELP A;  4IGR A;  4ESW A;  5I57 B;  4G68 C;  3G3G A;  5H8Q A;  4EF1 A;  3QXM A;  2ZXT A;  3G3I A;  2CZL A;  2AYS A;  4H8I A;  2BJJ X;  1B05 A;  1UTB A;  3L6G A;  3M8U A;  3G7W A;  4LZ8 A;  4EXL A;  3O6I A;  1FQB A;  3PUV E;  2XXT A;  4PFU A;  1B0L A;  1FTJ A;  4XKR A;  5CBS A;  5KCJ A;  2ZYM A;  2XD2 A;  4QFL A;  2Q8J A;  4IO4 A;  1I6A A;  4R6Y A;  1SW2 A;  2ONR A;  1R1N A;  3DLN A;  3GBB A;  3LR1 A;  4H5G A;  4I62 A;  4YKK A;  2AL5 A;  2DYX A;  3CRB A;  1USY E;  3W9V A;  2ONK E;  3MZB A;  5B7D A;  1J1N A;  1SW5 A;  1US4 A;  2V3T A;  4MH5 A;  3UP9 A;  5J1D A;  5I58 B;  2DWI A;  2UVI A;  2X7P A;  3QUJ A;  4X1B A;  1LLS A;  1FTO A;  1H76 A; 
#chains in the Genus database with same CATH topology
 4N6P A;  1SYH A;  1RDZ A;  2VPO A;  1EZ9 A;  3K4U A;  1NMU A;  2Q2C A;  2VHA A;  4R6K A;  3T9V A;  2BJI A;  1UTB B;  2Y84 A;  1OIB A;  1AWB A;  2L5V A;  1UTH A;  5L9S A;  2O84 X;  4HTG A;  1Z7M E;  3RQT A;  4QF9 A;  3RNN A;  3GXA A;  4Q8R A;  5K2X A;  4NED A;  3V5A A;  3N6U A;  2V3Q A;  3IOT A;  3H7M A;  1MQD A;  2F7A A;  1B3F A;  1MM7 A;  4ONY A;  4EDP A;  3SEW A;  2P1S A;  2VD2 A;  3O6H A;  3T9X B;  1B7H A;  1XT8 A;  1B3L A;  5FTH A;  4HS7 A;  5H8S A;  3QSL A;  1NV2 A;  5CI5 A;  4N91 A;  2F7C A;  4GIZ A;  4FJP A;  1NNF A;  3IB0 A;  2A5T A;  4RJZ A;  4HXV A;  3Q29 A;  1ELJ A;  2F6P A;  2QMX A;  1S50 A;  3HN0 A;  5FHN A;  1I6Q A;  4WKM A;  1JEU A;  4Q5T A;  3Q25 A;  1XHY A;  3JYR A;  2PT1 A;  3O29 A;  3E78 A;  3KSX A;  4OAN A;  3RUM A;  4KPT A;  1D9Q A;  3O66 A;  3M3L A;  4HCY A;  2B3B A;  4TLM B;  4ZS9 A;  1URS A;  5KZT A;  4U1Z A;  5I2K A;  2XXU A;  1Y3P A;  1JVX A;  4HW8 A;  1A8F A;  3ONM A;  3M3K A;  3I5O A;  2XWK A;  3M3F A;  2F3D A;  3MVY A;  1FPG A;  1BP5 A;  3FVK A;  1AL3 A;  3FBP A;  2I3V A;  1KA1 A;  4HE0 A;  4OZ9 A;  3H03 A;  2DE2 A;  5I2N A;  4DCX A;  3RPW A;  5A5X A;  4OQO A;  4F1V A;  4H1X A;  4ZEK A;  3PD9 A;  1BTJ A;  3W15 C;  1OVB A;  1MXV A;  4GF8 A;  3H6U A;  1FW0 A;  3OEL A;  2MKZ A;  1LAF E;  4R75 A;  1OVT A;  3HO7 A;  3BBR A;  5I59 B;  4XKP A;  4LVQ A;  3KFM A;  4LZ5 A;  2QFL A;  2DS9 A;  1MY1 A;  1OLA A;  3K1P A;  3U72 A;  1QKB A;  4ZEI A;  4FOR A;  1MQH A;  4PFB A;  4GXA A;  2I3W A;  2OK2 A;  1DSN A;  1HSJ A;  1WDN A;  2NVU B;  2Y5L A;  5EQ7 A;  3CSB A;  3T0J A;  4G8N A;  1NV5 A;  5EQ9 A;  3OO9 A;  2HZL A;  1MH3 A;  3IX1 A;  1ZMG A;  3MVZ A;  4YAH X;  4EQ7 A;  4F1U A;  1EZP A;  3LBS A;  2HFB A;  4WXJ A;  3TOD A;  1FPE A;  5JTY A;  4EQB A;  4N6D A;  3MQ9 A;  5AA2 A;  2ABH A;  1SI0 A;  1ZKB A;  1PBP A;  1B1X A;  2PYY A;  4MF3 A;  3A29 A;  2Y7P A;  1QUL A;  5DT6 A;  4ZE9 A;  3A3U A;  5IZ3 B;  3CHG A;  3IJO B;  2HEU A;  3UIF A;  2DE3 A;  2ALU A;  4N07 A;  1POY 1;  1VSO A;  1NUZ A;  4PE5 B;  5JTY B;  3VVE A;  4P9K A;  4MAG A;  3ROJ A;  1LCT A;  3G3J A;  4OTE A;  3UA8 A;  5I5P A;  1PB8 A;  1SPI A;  4IO2 A;  2GH9 A;  3L6H A;  2V84 A;  2AIX A;  4NGU A;  1O63 A;  3SZP A;  1FBG A;  4H46 A;  5CMB A;  5EHM A;  1WOD A;  3UGW A;  1Y1M A;  4YZZ A;  1FBC A;  2OBG A;  3CSG A;  4FEC A;  2QMW A;  4JSD A;  4MHF A;  4PFI A;  3PUZ E;  3ZSF A;  4NQ8 A;  3SKP A;  4PTK A;  2F3B A;  4MNP A;  3G3H A;  5HBC A;  1IXG A;  2QSX A;  4OFL A;  4BDM A;  2QPQ A;  2ZYK A;  2OCU A;  1EYJ A;  4NAP A;  2PT2 A;  1JVY A;  2GHB A;  2D21 A;  4KYE A;  2XXQ A;  4EXK A;  1Q35 A;  3FAS A;  3ZS6 A;  5KDT A;  4HE2 A;  4NF8 B;  2OWT A;  3TCF A;  3VLW A;  4MLQ A;  4DZ1 A;  2DXR A;  2PBW A;  3TQW A;  3RTF B;  3UOR A;  2B4L A;  2HCA A;  2NUV A;  4FIM A;  3K6W A;  3TMG A;  5LTC A;  3MPK A;  3IOV A;  3R6U A;  3MBP A;  4G8M A;  4QRZ A;  4C0R A;  4PE3 A;  4FBP A;  5FBP A;  5J16 A;  1A54 A;  1MPB A;  5F7V A;  3C33 A;  1RDY A;  1KWH A;  4KFQ A;  4AB5 A;  1FPK A;  3D1R A;  3MW0 A;  1IIW A;  3C4M A;  3IOW A;  2Y7I A;  5DVJ A;  3RLF E;  2DSF A;  4N15 A;  4XXU A;  4F2O A;  4P1L A;  4ZEF A;  2H99 A;  4DXB A;  4I40 A;  4OMB A;  3SDF A;  3PMV A;  3EHT A;  4RA1 A;  2G93 A;  4O7M A;  4BDL A;  2DQV A;  1NV7 A;  1LFI A;  1FPI A;  1FPJ A;  3IK6 B;  1BK4 A;  4PGP A;  2E1S A;  3CG1 A;  3K6U A;  4RYA A;  2Y7R A;  3FXR A;  3LUY A;  2VT5 A;  4TLL B;  4ELP A;  4ZE8 A;  1SI1 A;  4IGR A;  5H8Q A;  2DDK A;  4EXL A;  5CBS A;  1FTJ A;  4QFL A;  2Q8J A;  4IO4 A;  1R1N A;  4I62 A;  2P3N A;  2V3T A;  2X7P A;  4X1B A;  4OFJ A;  1FTO A;  3PV0 E;  4PFR A;  4JWO A;  2ZNT A;  5H8Q B;  1IXC A;  2F5X A;  4F1Y A;  3FV1 A;  1MPC A;  4GFR A;  1KA0 A;  1MQJ A;  2NOO A;  5DVF A;  1B4H A;  5EHS A;  1IZ1 A;  3T9U A;  5I58 A;  2O1L A;  3PD8 A;  3IB2 A;  2HAU A;  3B6W A;  4AS4 A;  2IEE A;  3FXB A;  3QK6 A;  3FUZ A;  1MY4 A;  2NWJ A;  2WX9 A;  3MVW A;  2KQZ A;  3LSW A;  4OVS A;  2H98 A;  1D3K A;  1NV6 A;  3CFX A;  3MWB A;  2A5S A;  4YKI A;  1AIV A;  2W7Y A;  1OLC A;  5I2K B;  5I84 A;  3FIR A;  1MXU A;  3B7D A;  4DLD A;  4GQO A;  4GWO A;  1URG A;  4ZED A;  2NXO A;  4R6H A;  3C36 A;  1LFG A;  2YPN A;  1LBX A;  5CMM A;  4PFY A;  4PGN A;  3OXN A;  5M2V A;  3VVD A;  3C34 A;  3T22 A;  1QUJ A;  5ET7 A;  2I4B A;  2ZMB A;  4IR8 A;  3H3G A;  4BDR A;  1TXF A;  3CFL A;  2CEX A;  4GX3 A;  2GHA A;  3TTL A;  2I0C A;  1DTG A;  4H5F A;  4Q0C A;  4PCD A;  4RNS A;  3SET A;  3GLB A;  2ZNS A;  3DP6 A;  3OEK A;  1MXW A;  4KQP A;  3T1B A;  4XKQ A;  4OET A;  3U94 A;  2Z8D A;  3MPL A;  2OZZ A;  2H9B A;  4P3L A;  4PF6 A;  4N81 A;  1K9Y A;  4FED A;  3PUW E;  1ZJL A;  3KC1 A;  4QXD A;  4KCC A;  4GWW A;  2GQ1 A;  3IOR A;  5TP9 B;  3BFT A;  1M5D A;  3HFU A;  3N5L A;  4R9F A;  1P1Q A;  2XX9 A;  3U8Q A;  4IY5 A;  3RT6 B;  1PBQ A;  4LA9 A;  3BIG A;  3N26 A;  1XVX A;  3RYD A;  4BDO A;  4C1U A;  4GVO A;  4IO3 A;  3RTW B;  3K00 A;  2WYK A;  1JEV A;  2V93 A;  1EH3 A;  5TP9 A;  3ZKL A;  2P0S A;  4MLV A;  3SER A;  4G4P A;  4M1V A;  1MPD A;  2F36 A;  3TEP A;  1TFA A;  2Q9T A;  2R6G E;  1LGB C;  4FEB A;  4O3C A;  5DVI A;  3S2V A;  2XWV A;  1ZTY A;  1B1H A;  3O6G A;  4QHQ A;  4F39 A;  1QKA A;  5DEX A;  1PC3 A;  3PPP A;  4NE4 A;  1B3G A;  3FJ7 A;  4MCO A;  1LCF A;  3SEV A;  4LAT A;  4YKP A;  5EQ8 A;  5HM4 B;  3KBR A;  4F2Q A;  1B3H A;  4H0W A;  4U23 A;  4XIG Q;  2GRV A;  3PMW A;  2VPN A;  2F78 A;  4G61 A;  4G68 B;  1GGG A;  1IMC A;  5AA4 B;  1FBF A;  4R72 A;  4OHN A;  5ITO A;  2UVJ A;  4R2F A;  5H8F A;  1XC1 A;  3RN8 A;  4RK2 A;  3K1M A;  2XXI A;  4NF5 A;  1LBV A;  1S7Y A;  3KOT A;  3OD7 A;  4GRK A;  1T0K A;  3ILU B;  3VXC A;  1N76 A;  4MMP A;  3K2D A;  4QFO A;  3PPQ A;  4PQJ A;  1BKA A;  1LBY A;  2B65 A;  4JSO A;  2RIN A;  3H6W A;  1NV3 A;  1Y1Z A;  3E13 X;  1IQ7 A;  4LUB A;  1P99 A;  5AA4 A;  2O7U A;  1OQG A;  2ZYN A;  1MXX A;  5CC2 A;  4F3B A;  2PX1 A;  4NN3 A;  4PBH A;  1R9Q A;  4ZEB A;  1EU8 A;  2V25 A;  4KXP A;  4NF8 A;  3MAM A;  4YKJ A;  4GWS A;  2RCA A;  4NF6 B;  5HPQ A;  1OMP A;  1IXH A;  1PDA A;  3IB1 A;  3CFZ A;  3MUQ A;  4QBA A;  4H45 A;  1P1N A;  1LAX A;  1LB8 A;  1NL5 A;  2QS3 A;  1PB9 A;  1NFT A;  3ECR A;  1FCK A;  1N7X A;  1P1O A;  1SVX B;  5ET6 A;  3H06 B;  2HXR A;  2DXY A;  2DWH A;  3IL1 B;  4MFI A;  1A55 A;  2D3I A;  3GYY A;  2UYF A;  3PUX E;  4EUO A;  1SDX A;  1XI6 A;  5TPA B;  1N3W A;  3P7I A;  4DI3 D;  1FTA A;  1B3E A;  4UA8 A;  1I69 A;  1NNT A;  1N04 A;  3VXB A;  1A8E A;  2VP1 A;  1LEV A;  5LOM A;  4PFW A;  1US5 A;  4POX A;  3K1N A;  3VVF A;  1YCJ A;  3C32 A;  1FQA A;  1UIV A;  2E0S A;  3TTK A;  5TPA A;  5F1Q A;  2PFZ A;  2XWO A;  2O68 A;  4MEV A;  2OLB A;  3U93 A;  4OWD A;  1JNF A;  2QVR A;  5CMK A;  2XX8 A;  1VR5 A;  4JB7 A;  1Y4T A;  3TZA A;  4OVQ A;  1F9B A;  2DVC A;  4GBV A;  1FPF A;  3KC0 A;  2QL3 A;  4PF8 A;  1D9Y A;  3S9L C;  5I57 A;  2DWA A;  3K0V A;  4TOZ A;  3TCH A;  4O3B A;  2HHM A;  4GD5 A;  2OWS A;  1ANF A;  3EKI A;  3ZKK A;  4BLA A;  3FVG A;  5L8D A;  2Z8E A;  2QVV A;  2ANJ A;  4JBZ A;  4OYV A;  1BLF A;  4KD5 A;  3V89 B;  4PDH A;  2Q8M A;  1MH4 A;  3DP8 A;  4P47 A;  3QXM A;  2XA5 A;  1CNQ A;  1UTB A;  3M8U A;  3G7W A;  4PFU A;  1FQB A;  2XD2 A;  3DLN A;  4H5G A;  4N8Y A;  2AL5 A;  1USY E;  2ONK E;  1J1N A;  1SW5 A;  1US4 A;  5J1D A;  1LLS A;  2ZZV A;  2XXK A;  4R73 A;  4DCY A;  5I7I A;  3B6Q A;  3PGF A;  3EF7 A;  4F18 A;  4U1O A;  1Y3Q A;  2CZH A;  4X48 A;  2X7Q A;  2QVU A;  2I58 A;  3G3K A;  4IB2 A;  1H43 A;  5BWJ A;  1GV8 A;  2UXA A;  3JZJ A;  4DI4 B;  3WAF A;  4FAJ A;  1FQE A;  3QUF A;  1XVY A;  5ISU A;  2G29 A;  1TFD A;  3FAT A;  5F24 A;  1JW1 A;  4C1T A;  1MY2 A;  3LUZ A;  4ZEC A;  3C31 A;  3KN3 A;  2I6E A;  2ZZX A;  4PAF A;  2XX7 A;  5BUU A;  3FVN A;  4QFP A;  5JEI A;  2Z22 A;  3LSF B;  3TTN A;  1PB7 A;  4QSE A;  4IO6 A;  4OVT A;  3T9H B;  4XTC Q;  1IME A;  2Q2A A;  5A5L A;  1MXY A;  1B32 A;  3TYH A;  2KR0 A;  2THI A;  3IO4 A;  4HE1 A;  3F11 A;  4QSD A;  4F3G A;  1K9Z A;  5DYH A;  3VV5 A;  2XXP A;  3EQ1 A;  3KJ7 A;  3MP1 A;  2DOJ A;  3N94 A;  5TU0 A;  3V83 A;  2REJ A;  1YTV A;  4N4U A;  1FTK A;  1SQY A;  2YLN A;  1NUY A;  1FQF A;  1JW5 A;  3PMX A;  1N84 A;  3VLU A;  4OFO A;  1LBW A;  4KR5 A;  1DBZ A;  1LB9 A;  4EF2 A;  3QMF A;  3RPL A;  4OVR A;  3HHG A;  3HST A;  2IA4 A;  3TDJ A;  4KI0 E;  3K01 A;  4FE8 A;  3MVX A;  5CRY A;  2ONS A;  2RF1 A;  4XFE A;  1FTL A;  2H4I A;  1CE2 A;  3T96 B;  1NV4 A;  1G0I A;  1B58 A;  3KOS A;  1FJ6 A;  5EYF A;  3D4C A;  1ATG A;  3WAE A;  3H4Z A;  1Y3N A;  2I0B A;  4KCD A;  3OEN A;  2ZZW A;  2KLF A;  3UK4 A;  3RPL B;  4GX6 A;  3QIM A;  3S9E A;  4OVP A;  4DIG A;  3T93 B;  3IFC A;  1MS7 A;  3A09 A;  3TFL A;  5A5X B;  1JET A;  5AA2 B;  1B0H A;  3Q26 A;  3LSL A;  1YXI A;  4JWY A;  1S9T A;  1O7T A;  5L9M A;  3IJX B;  3K02 A;  4RY1 A;  3ISP A;  5IZ3 A;  1MRP A;  5AE4 A;  1II5 A;  4EQ9 A;  4ELO A;  1FPD A;  3Q27 A;  2ZNU A;  2FIX A;  5ET8 A;  4ZDM A;  2XXX A;  4AQ4 A;  4AB6 A;  1LBC A;  2F8D A;  2QJE A;  4P8B A;  2V3U A;  3DM0 A;  5T3J A;  5H8N B;  1AH5 A;  3TQL A;  4P0I A;  3KBZ A;  4OES A;  4YMB A;  1AMF A;  1IMF A;  3RT8 A;  1FRP A;  4R9G A;  4NWD A;  3VFJ A;  3I3V A;  4OEN A;  2FHY A;  1XOC A;  3SES A;  1FPL A;  4H65 A;  3KZG A;  3PPO A;  1B51 A;  3CR9 A;  1DTZ A;  3G3F A;  4M4G A;  3KEI A;  2B4M A;  5I3S A;  2O7I A;  1UIU A;  3CIJ A;  3SEY A;  1EZO A;  2RCB A;  4GXS B;  4NF6 A;  4JVI A;  3KSJ A;  3CI8 A;  4H67 A;  3DEL B;  2V4C A;  4OA4 A;  5ELV A;  1L5T A;  4TQU Q;  3K6X A;  1DPP A;  5ICT A;  1NI9 A;  1FBE A;  2GFE A;  2XXY A;  3U92 A;  1PEB A;  2RC7 A;  3MYU A;  3E9X A;  5I56 B;  3KN7 A;  1D9V A;  3MJN A;  4LN5 A;  3V8X B;  4IO5 A;  1IXI A;  4ESX A;  3THI A;  1URD A;  4QFK A;  3KGC A;  3OO8 A;  4O7I A;  1OQH A;  5AA1 A;  2B3F A;  4NTL A;  2HXW A;  2WKY A;  2FA7 A;  5EYG A;  2CEY A;  4U2R A;  5ET5 A;  5FHO A;  1HSL A;  4X1D A;  3IOU A;  1ZLQ A;  2P2A A;  2DVZ A;  2XXH A;  3OO7 A;  1IMD A;  2H5Y A;  1EYK A;  1LFH A;  2FNC A;  4AS5 A;  4F3S A;  4PAK A;  1YPN A;  1FBD A;  4EF1 A;  1H3D A;  2QS1 A;  2HPG A;  1NH8 A;  3PPR A;  1M5B A;  3SEX A;  4GWX A;  4KHZ E;  4GX4 A;  4E0X A;  4PAI A;  3RGY A;  3K6V A;  3MST A;  1IMB A;  4O3A A;  3FXQ A;  1SD3 A;  3HV1 A;  3FD3 A;  3IO6 A;  3S9N C;  4R74 A;  4NG7 A;  2M8C A;  1B6H A;  1B2H A;  2HZK A;  1VDW A;  2YJP A;  1B5J A;  2CZI A;  4RPO A;  4N8G A;  1H44 A;  4I9D A;  1CB6 A;  4LQ2 A;  4DDD A;  3TTM A;  3DP4 A;  4X04 A;  2HAV A;  2PFY A;  3MP6 A;  5CBR A;  4NF4 A;  1B9J A;  2DP8 A;  5KCJ B;  4K3F A;  1GTK A;  1FBP A;  1MY3 A;  4R2B A;  3OO6 A;  2X26 A;  1FTM A;  5IGA A;  1AOV A;  4IGT A;  2FBP A;  1QGX A;  4ESW A;  4I3E A;  5I57 B;  4G68 C;  3G3I A;  2CZL A;  1FBH A;  4LZ8 A;  3O6I A;  3PUV E;  2XXT A;  1B0L A;  5KCJ A;  1I6A A;  1SW2 A;  3GBB A;  3LR1 A;  3CRB A;  3W9V A;  3MZB A;  5I58 B;  2DWI A;  2UVI A;  3FXU A;  1H76 A;  1M5C A;  2UVH A;  4H8J A;  1B7Z A;  5LDZ A;  2ZYO A;  4OXV A;  1FQC A;  2FVZ A;  3LV0 A;  2XHD A;  4IY6 A;  1M5E A;  1FJ9 A;  2RC9 A;  4OVJ A;  1BIY A;  3IFA A;  4G8H A;  3E3K A;  4IO7 A;  3GBA A;  1SBP A;  5ESY A;  4U4X A;  3T66 A;  4ELR A;  5ITP A;  1FSA A;  1DCU A;  4YB6 A;  1TWY A;  2OWZ A;  3OSR A;  1RYO A;  2WEF A;  4ZZA A;  4Z7E A;  1I6B A;  2H25 A;  1IEJ A;  3JV9 A;  4NMY A;  4JVD A;  2AL4 A;  1LBZ A;  1MM6 A;  3N6T A;  3OOA A;  1UTH B;  3R26 A;  3OSQ A;  3AXF A;  2DWJ A;  1QJM A;  1YZ0 A;  1B40 A;  3I6V A;  3EPE A;  3EN3 A;  4BDN A;  4DXC A;  2R8T A;  3E4R A;  4GBW A;  2D5W A;  2ESN A;  1LBB A;  1IUD A;  1POT A;  2Z8F A;  3IAZ A;  1NNK A;  1MDQ A;  3U65 A;  4JDF A;  3TPA A;  4F19 A;  2A5T B;  3OEM A;  4ELQ A;  5I2N B;  4MX6 A;  4LQ5 A;  4DXU A;  1NV0 A;  4P56 A;  1WVJ A;  1XS5 A;  4UAB A;  4BDQ A;  2QS4 A;  3NOH A;  4UAC A;  2UVG A;  3CVG A;  4OER A;  2PMS A;  3B6T A;  1JP4 A;  2PVU A;  1NUW A;  3S9M C;  1SYI A;  3KG2 A;  1QUK A;  1B7U A;  1GVC A;  3GZG A;  2Q88 A;  1NV1 A;  2O69 A;  3H6T A;  3QAX A;  3MC2 A;  4FAT A;  3FJM A;  3USD A;  1N3X A;  4KYS A;  3EHS A;  1R6Z A;  1MQG A;  2CMO A;  5CMC A;  4YIC A;  3FJG A;  1EYI A;  4G77 A;  2XD3 A;  3FZV A;  1N7W A;  4Q30 B;  3S4U A;  2LAO A;  5FTI A;  4N17 A;  3ILT B;  1Q1K A;  4O94 A;  2XWI A;  2R9J A;  5CM6 A;  2F97 A;  2O51 A;  3O28 A;  3TUS A;  4RXL A;  4X8R A;  1GR2 A;  4YB7 A;  3OMB A;  3SEU A;  4QSC A;  4G68 A;  1QW0 A;  3VLV A;  1YAE A;  5EQA A;  5AA3 A;  5I59 A;  1INP A;  2Y7W A;  4U4S A;  4WED A;  4XEQ A;  1ZU0 A;  2VGQ A;  3KN8 A;  1B5H A;  4I8C A;  4P1E A;  3PPN A;  4NF5 B;  1MXZ A;  4F3P A;  4O8M A;  3C9H A;  1B4Z A;  3UN6 A;  1Y20 A;  2UYE A;  5B70 A;  1VE4 A;  1Y4C A;  1A40 A;  2XXW A;  4GWU A;  1P1W A;  2F35 A;  1R9L A;  1LAG E;  3VDF A;  2O1M A;  4PP0 A;  4ECF A;  4L17 A;  1QUI A;  4HCW A;  1LST A;  1VFD A;  5DEX B;  4XKN A;  1SW4 A;  3TCG A;  4NF0 A;  3HCQ A;  1B5I A;  3RY3 A;  1DPE A;  1MQI A;  1N0T A;  1NKX A;  5JK4 A;  2DE4 A;  5ICQ A;  3E79 A;  2JJK A;  4PFT A;  3VE1 B;  4P11 A;  5H8N A;  4E0W A;  4NX1 A;  4YU0 A;  3B8B A;  1TT1 A;  2F6G A;  4PBQ A;  3ODB A;  2FIE A;  1NNP A;  1UQW A;  4F31 B;  3MZ1 A;  4U21 A;  4ZZE A;  3H6V A;  5L9O A;  3HPI A;  4JWX A;  3FVO A;  4PET A;  4OEV A;  3Q28 A;  4GWY A;  4MBP A;  1RDX A;  5H8F B;  4YMA A;  3W9W A;  1Y9U A;  2F7B A;  2XXV A;  1RYX A;  4NWC A;  4LON B;  2XXR A;  4NHB A;  4OEU A;  3PU5 A;  4DE8 A;  3A3C A;  3PTY A;  1Q9D A;  1HSE A;  4PC9 A;  4JVC A;  2WBB A;  1IMA A;  2WYP A;  2RC8 A;  2RKM A;  1A7L A;  5IZ1 A;  1JW4 A;  2I4C A;  2I49 A;  4LZ7 A;  1D4N A;  3QYT A;  5IM2 A;  5FHM A;  2Y5K A;  3IR1 A;  4RK9 A;  2Q89 A;  1RKM A;  2HQ0 A;  2R71 A;  1QVS A;  4X9T A;  3BKI B;  5I56 A;  2Y7K A;  5DTB A;  5IZZ A;  2QS2 A;  4F29 A;  2VD3 A;  3B50 A;  1KZ8 A;  4GLI A;  5EYH A;  4F22 A;  1DK4 A;  5IAI A;  1A99 A;  4MJO A;  2P3V A;  1G0H A;  2REG A;  3TEL A;  4Z0I A;  3R7X A;  3U1O A;  4N13 A;  4JXI A;  3TTR A;  4YB5 A;  1USY H;  1P1U A;  1H45 A;  1SW1 A;  1FPB A;  3C35 A;  1LAH E;  3FV2 A;  4H6D A;  3TKD A;  1DMB A;  4GOT A;  3O2A A;  5KDT B;  2PCR A;  1DOT A;  1ZBM A;  3FGS A;  1MG1 A;  2VOZ A;  3BIH A;  3TAJ A;  5AA2 D;  2FYI A;  4NF4 B;  2OX3 A;  2F34 A;  3MZ9 A;  2OJT A;  4XF5 A;  3CG3 A;  1B46 A;  4U22 A;  5K2Y A;  3EHU A;  4THI A;  1VFE A;  2O6A A;  4I3Y A;  1O64 A;  3PUY E;  3KJT A;  2WBD A;  1YYZ A;  3D4G A;  4G2Z A;  2Q74 A;  4WEP A;  3BFU A;  5H8H B;  4PDD A;  1FQD A;  1M5F A;  4KYD A;  4ISU A;  3LSX A;  4I1D A;  1MY0 A;  3LC8 A;  4MNI A;  4ND9 A;  5IKB A;  1MDP 1;  4POW A;  4QFN A;  3HHF A;  1B52 A;  4N6K A;  4GL0 A;  4RPN A;  1JQF A;  1NUX A;  3O97 A;  1ZIU A;  1Z7N E;  3MP8 A;  3O9P A;  2Z23 A;  2QRY A;  1NH7 A;  1IIT A;  4LP2 B;  2I48 A;  4GL8 A;  4P0G A;  5H8H A;  3G3G A;  2ZXT A;  2AYS A;  4H8I A;  2BJJ X;  1B05 A;  3L6G A;  4MNC A;  4XKR A;  2ZYM A;  4MIJ A;  5DW8 A;  4R6Y A;  2ONR A;  4YKK A;  2DYX A;  5B7D A;  4MH5 A;  3UP9 A;  3QUJ A;  4GWZ A;  2CZK A; 
#chains in the Genus database with same CATH homology
 4JWO A;  1M5C A;  2UVH A;  4H8J A;  4N6P A;  1B7Z A;  2ZNT A;  1SYH A;  5L9M A;  2ZYO A;  4R73 A;  4DCY A;  4OXV A;  1EZ9 A;  3K4U A;  1FQC A;  1NMU A;  5H8Q B;  3B6Q A;  1IXC A;  2Q2C A;  2VHA A;  4R6K A;  3PGF A;  3EF7 A;  3T9V A;  2XHD A;  2F5X A;  4U1O A;  4F18 A;  1UTB B;  2Y84 A;  4F1Y A;  5CM6 A;  3FV1 A;  1OIB A;  1MPC A;  1Y3Q A;  5LOM A;  4IY6 A;  1UTH A;  1M5E A;  5L9S A;  2O84 X;  4X48 A;  4GFR A;  2RC9 A;  4HTG A;  1Z7M E;  2X7Q A;  4OVJ A;  1BIY A;  4G8H A;  1MQJ A;  2I58 A;  2NOO A;  3G3K A;  4IB2 A;  3RQT A;  3E3K A;  4IO7 A;  4QF9 A;  5DVF A;  1H43 A;  3RNN A;  3GBA A;  3GXA A;  1B4H A;  5EHS A;  4Q8R A;  5BWJ A;  1IZ1 A;  1SBP A;  1GV8 A;  2UXA A;  3JZJ A;  4U4X A;  3T9U A;  3T66 A;  5K2X A;  4ELR A;  5I58 A;  5ITP A;  4NED A;  4DDD A;  2O1L A;  3V5A A;  3PD8 A;  3WAF A;  3N6U A;  4FAJ A;  1FQE A;  2V3Q A;  3QUF A;  1XVY A;  4YB6 A;  1TWY A;  3IB2 A;  3IOT A;  2HAU A;  3H7M A;  5ISU A;  2G29 A;  1RYO A;  1MQD A;  2F7A A;  1TFD A;  1B3F A;  3B6W A;  1MM7 A;  3FAT A;  1JW1 A;  4C1T A;  4ONY A;  2IEE A;  4EDP A;  1MY2 A;  4ZZA A;  4Z7E A;  3QK6 A;  3SEW A;  2P1S A;  1I6B A;  2H25 A;  1IEJ A;  1MY4 A;  2VD2 A;  3FUZ A;  3JV9 A;  4NMY A;  2NWJ A;  3O6H A;  3C31 A;  4ZEC A;  3MVW A;  1B7H A;  3T9X B;  2AL4 A;  3KN3 A;  1XT8 A;  1B3L A;  1MM6 A;  2I6E A;  3LSW A;  3N6T A;  5FTH A;  3OOA A;  1UTH B;  4HS7 A;  2H98 A;  5H8S A;  3R26 A;  1D3K A;  3OSQ A;  3AXF A;  2DWJ A;  1QJM A;  3QSL A;  5CI5 A;  2XX7 A;  3CFX A;  5BUU A;  3MWB A;  1B40 A;  2A5S A;  3FVN A;  2F7C A;  4GIZ A;  4YKI A;  1AIV A;  3I6V A;  2W7Y A;  3EPE A;  4FJP A;  3EN3 A;  1NNF A;  1OLC A;  5I2K B;  3IB0 A;  4BDN A;  2A5T A;  5I84 A;  3FIR A;  4QFP A;  4RJZ A;  1MXU A;  3B7D A;  2Z22 A;  3LSF B;  4GQO A;  1URG A;  4GWO A;  3TTN A;  4DLD A;  3Q29 A;  1ELJ A;  2NXO A;  4ZED A;  4DXC A;  1PB7 A;  2F6P A;  4QSE A;  2QMX A;  4R6H A;  3C36 A;  1LFG A;  2YPN A;  1S50 A;  3HN0 A;  4IO6 A;  5FHN A;  1I6Q A;  3E4R A;  2D5W A;  5CMM A;  4PFY A;  4WKM A;  3OXN A;  1JEU A;  3T9H B;  4XTC Q;  5M2V A;  2ESN A;  3VVD A;  2Q2A A;  4Q5T A;  3Q25 A;  1XHY A;  1LBB A;  1MXY A;  3JYR A;  3C34 A;  3T22 A;  1IUD A;  1QUJ A;  1B32 A;  2I4B A;  2PT1 A;  1POT A;  2Z8F A;  2THI A;  3IAZ A;  3O29 A;  3KSX A;  3RUM A;  3TYH A;  4KPT A;  2ZMB A;  3IO4 A;  3THI A;  3F11 A;  1NNK A;  3H3G A;  3O66 A;  3M3L A;  4BDR A;  1TXF A;  4HCY A;  4QSD A;  4F3G A;  2B3B A;  1MDQ A;  3CFL A;  1URS A;  4TLM B;  5DYH A;  2XXP A;  4ZS9 A;  3EQ1 A;  3KJ7 A;  4JDF A;  3VV5 A;  2GHA A;  3TTL A;  5KZT A;  3MP1 A;  4U1Z A;  2DOJ A;  5I2K A;  2XXU A;  3TPA A;  4F19 A;  2A5T B;  2I0C A;  3N94 A;  1Y3P A;  5TU0 A;  3OEM A;  4ELQ A;  5I2N B;  3V83 A;  1DTG A;  4H5F A;  2REJ A;  1JVX A;  4LQ5 A;  4Q0C A;  4HW8 A;  1YTV A;  1A8F A;  3ONM A;  4RNS A;  1FTK A;  3SET A;  4DXU A;  1SQY A;  3M3K A;  3I5O A;  3GLB A;  1WVJ A;  2YLN A;  2ZNS A;  1XS5 A;  3DP6 A;  3M3F A;  5JEI A;  1FQF A;  3MVY A;  5A5X B;  3OEK A;  1MXW A;  1BP5 A;  1JW5 A;  4KQP A;  3PMX A;  4BDQ A;  2QS4 A;  4XKQ A;  4OET A;  3FVK A;  1N84 A;  1AL3 A;  4UAC A;  3U94 A;  2Z8D A;  2UVG A;  3CVG A;  2OZZ A;  2H9B A;  3MPL A;  3VLU A;  4OER A;  2PMS A;  3B6T A;  4OFO A;  2PVU A;  4KR5 A;  1SYI A;  3S9M C;  2I3V A;  3KG2 A;  1LB9 A;  4EF2 A;  1QUK A;  1B7U A;  4FED A;  3PUW E;  1ZJL A;  4OZ9 A;  1GVC A;  3H03 A;  3HHG A;  3GZG A;  2DE2 A;  3HST A;  5I2N A;  2Q88 A;  2IA4 A;  2O69 A;  3H6T A;  4KCC A;  3TDJ A;  3QAX A;  4KI0 E;  3MC2 A;  3K01 A;  3IOR A;  4FE8 A;  4DCX A;  3MVX A;  5TP9 B;  3RPW A;  3BFT A;  1M5D A;  5CRY A;  2ONS A;  5A5X A;  4OQO A;  3N5L A;  2RF1 A;  1FTL A;  4H1X A;  3FJM A;  4F1V A;  4FAT A;  4QFK A;  4ZEK A;  2H4I A;  1BTJ A;  3PD9 A;  3USD A;  3W15 C;  1OVB A;  1N3X A;  4R9F A;  1CE2 A;  4KYS A;  1P1Q A;  2XX9 A;  3EHS A;  1MXV A;  3T96 B;  3U8Q A;  1R6Z A;  1MQG A;  4GF8 A;  3H6U A;  1FW0 A;  3OEL A;  4IY5 A;  2CMO A;  3RT6 B;  1B58 A;  1LAF E;  3KOS A;  4R75 A;  5EYF A;  1OVT A;  3D4C A;  3FXU A;  1PBQ A;  1ATG A;  4LA9 A;  3WAE A;  5CMC A;  3HO7 A;  4YIC A;  3FJG A;  3H4Z A;  3BBR A;  4G77 A;  2XD3 A;  1Y3N A;  3N26 A;  5I59 B;  3FZV A;  2I0B A;  1N7W A;  1XVX A;  4KCD A;  3OEN A;  4LVQ A;  4XKP A;  4BDO A;  4Q30 B;  2KLF A;  2LAO A;  3KFM A;  4GVO A;  4IO3 A;  3S4U A;  3UK4 A;  4C1U A;  3QIM A;  4LZ5 A;  3S9E A;  5FTI A;  3RTW B;  3K00 A;  3ILT B;  2DS9 A;  1JEV A;  4DIG A;  1MY1 A;  1OLA A;  1Q1K A;  3K1P A;  3U72 A;  1QKB A;  2V93 A;  1EH3 A;  3T93 B;  5TP9 A;  1MS7 A;  3A09 A;  4FOR A;  4ZEI A;  1MQH A;  3ZKL A;  3TFL A;  4OFJ A;  2P0S A;  1JET A;  2R9J A;  2F97 A;  2O51 A;  4G4P A;  1MPD A;  4GXA A;  4M1V A;  4MLV A;  2F36 A;  3SER A;  2I3W A;  5AA2 B;  1B0H A;  2OK2 A;  3Q26 A;  3TEP A;  3LSL A;  3O28 A;  1DSN A;  1HSJ A;  1TFA A;  1WDN A;  2Q9T A;  2NVU B;  3TUS A;  2R6G E;  3CSB A;  4RXL A;  4JWY A;  4G8N A;  1GR2 A;  1LGB C;  1S9T A;  4YB7 A;  1O7T A;  4FEB A;  3IJX B;  3K02 A;  3OMB A;  4O3C A;  4QSC A;  4RY1 A;  5DVI A;  4G68 A;  1ZTY A;  1B1H A;  1QW0 A;  3S2V A;  1YAE A;  3OO9 A;  3VLV A;  3O6G A;  5AA3 A;  2HZL A;  1MH3 A;  3IX1 A;  5I59 A;  1MRP A;  2Y7W A;  4QHQ A;  4F39 A;  4U4S A;  1QKA A;  4WED A;  5DEX A;  1PC3 A;  3PPP A;  1ZMG A;  4NE4 A;  5AE4 A;  1II5 A;  4EQ9 A;  1ZU0 A;  4ELO A;  3MVZ A;  2VGQ A;  4YAH X;  3Q27 A;  3KN8 A;  1B3G A;  1B5H A;  3FJ7 A;  2ZNU A;  4I8C A;  3PPN A;  4NF5 B;  4EQ7 A;  1LCF A;  1MXZ A;  4ZDM A;  2XXX A;  4LAT A;  3SEV A;  4AQ4 A;  4F1U A;  4F3P A;  3C9H A;  1EZP A;  4AB6 A;  1B4Z A;  3LBS A;  2HFB A;  4WXJ A;  3UN6 A;  1Y20 A;  2UYE A;  1LBC A;  2F8D A;  3TOD A;  4YKP A;  5JTY A;  2QJE A;  4EQB A;  5B70 A;  1VE4 A;  1Y4C A;  1A40 A;  2XXW A;  5HM4 B;  3MQ9 A;  1P1W A;  5AA2 A;  2F35 A;  2V3U A;  3DM0 A;  3KBR A;  5H8N B;  2ABH A;  1R9L A;  4F2Q A;  1SI0 A;  1ZKB A;  1B3H A;  4H0W A;  1PBP A;  4U23 A;  1AH5 A;  3TQL A;  4XIG Q;  2GRV A;  3PMW A;  1B1X A;  4P0I A;  2PYY A;  1LAG E;  3VDF A;  2F78 A;  4MF3 A;  2O1M A;  4PP0 A;  2Y7P A;  1QUL A;  4G68 B;  5DT6 A;  1GGG A;  4OES A;  4ECF A;  4L17 A;  1AMF A;  4YMB A;  4ZE9 A;  1QUI A;  3A3U A;  4HCW A;  5AA4 B;  1LST A;  1VFD A;  3IJO B;  2HEU A;  5DEX B;  4XKN A;  3RT8 A;  3UIF A;  4R9G A;  1SW4 A;  4R72 A;  4NWD A;  4OHN A;  3I3V A;  3TCG A;  3VFJ A;  4OEN A;  2DE3 A;  3HCQ A;  5ITO A;  2UVJ A;  2ALU A;  4R2F A;  4N07 A;  5H8F A;  1POY 1;  1B5I A;  1XC1 A;  1XOC A;  3RN8 A;  3SES A;  3RY3 A;  1DPE A;  4RK2 A;  3K1M A;  1VSO A;  2XXI A;  4H65 A;  4NF5 A;  3KZG A;  1MQI A;  1N0T A;  3PPO A;  1NKX A;  1S7Y A;  3KOT A;  3OD7 A;  4GRK A;  4PE5 B;  3ILU B;  5JK4 A;  1B51 A;  1T0K A;  2DE4 A;  3VXC A;  1N76 A;  1DTZ A;  3CR9 A;  3K2D A;  5JTY B;  3G3F A;  3VVE A;  4M4G A;  4QFO A;  1LCT A;  3G3J A;  3KEI A;  3PPQ A;  4OTE A;  3UA8 A;  5ICQ A;  2O7I A;  4PQJ A;  1UIU A;  1BKA A;  3CIJ A;  4PFT A;  3SEY A;  4P11 A;  5H8N A;  3VE1 B;  4E0W A;  1EZO A;  2B65 A;  2RCB A;  4GXS B;  4YU0 A;  4JSO A;  4NF6 A;  1PB8 A;  2RIN A;  3H6W A;  3KSJ A;  1TT1 A;  2F6G A;  4IO2 A;  3CI8 A;  3ODB A;  1Y1Z A;  4H67 A;  2GH9 A;  3L6H A;  2V84 A;  1IQ7 A;  3DEL B;  1NNP A;  1UQW A;  2AIX A;  3E13 X;  3MZ1 A;  4LUB A;  4U21 A;  4F31 B;  1P99 A;  5ELV A;  2O7U A;  3H6V A;  1O63 A;  4ZZE A;  5AA4 A;  1OQG A;  1L5T A;  5L9O A;  3HPI A;  4TQU Q;  4JWX A;  2ZYN A;  3FVO A;  3K6X A;  4PET A;  5CMB A;  4OEV A;  5EHM A;  1MXX A;  3Q28 A;  1DPP A;  1WOD A;  4MBP A;  5CC2 A;  5ICT A;  5H8F B;  3UGW A;  4YMA A;  1Y1M A;  2GFE A;  3W9W A;  1Y9U A;  2XXY A;  2F7B A;  3U92 A;  4F3B A;  2PX1 A;  1PEB A;  4YZZ A;  2OBG A;  2XXV A;  1RYX A;  2RC7 A;  3CSG A;  4NWC A;  3E9X A;  1R9Q A;  4ZEB A;  4LON B;  5I56 B;  2XXR A;  1EU8 A;  2V25 A;  3KN7 A;  4FEC A;  1D9V A;  2QMW A;  4OEU A;  3PU5 A;  4NF8 A;  4DE8 A;  3A3C A;  4JSD A;  3MAM A;  3MJN A;  4YKJ A;  3PUZ E;  3ZSF A;  2RCA A;  4NF6 B;  1HSE A;  3SKP A;  3V8X B;  5HPQ A;  4IO5 A;  1OMP A;  1IXH A;  1IXI A;  4ESX A;  3G3H A;  5HBC A;  1IXG A;  1PDA A;  1URD A;  2RC8 A;  2QSX A;  3CFZ A;  3IB1 A;  2RKM A;  1A7L A;  3KGC A;  3MUQ A;  3OO8 A;  1JW4 A;  4OFL A;  2I4C A;  2I49 A;  1P1N A;  1LAX A;  2QPQ A;  4LZ7 A;  4BDM A;  1D4N A;  1LB8 A;  3QYT A;  1OQH A;  2ZYK A;  5FHM A;  5AA1 A;  1NL5 A;  2OCU A;  3SEU A;  3IR1 A;  2QS3 A;  1PB9 A;  1NFT A;  2B3F A;  1FCK A;  2PT2 A;  3ECR A;  4RK9 A;  2Q89 A;  1N7X A;  1JVY A;  2HXW A;  4NTL A;  1P1O A;  2WKY A;  2GHB A;  1SVX B;  3H06 B;  2D21 A;  1RKM A;  4KYE A;  2HQ0 A;  2R71 A;  2FA7 A;  1QVS A;  2XXQ A;  4EXK A;  4X9T A;  2DXY A;  2DWH A;  1Q35 A;  3BKI B;  5I56 A;  2Y7K A;  4U2R A;  5DTB A;  3IL1 B;  3FAS A;  4MFI A;  2QS2 A;  1A55 A;  5FHO A;  3ZS6 A;  1HSL A;  4F29 A;  4NF8 B;  2OWT A;  2VD3 A;  3TCF A;  3VLW A;  5KDT A;  4X1D A;  2D3I A;  4GLI A;  4MLQ A;  4DZ1 A;  3IOU A;  2DXR A;  1ZLQ A;  4F22 A;  2PBW A;  2P2A A;  2DVZ A;  2UYF A;  3TQW A;  5IAI A;  2XXH A;  3OO7 A;  1A99 A;  3PUX E;  2REG A;  3RTF B;  3TEL A;  1SDX A;  2H5Y A;  5TPA B;  1N3W A;  3UOR A;  4Z0I A;  4EUO A;  3P7I A;  3R7X A;  1LFH A;  2HCA A;  2FNC A;  3U1O A;  2NUV A;  4FIM A;  4N13 A;  3K6W A;  3TMG A;  1B3E A;  4JXI A;  4UA8 A;  3TTR A;  4YB5 A;  1USY H;  4F3S A;  1P1U A;  3MPK A;  1H45 A;  1I69 A;  1NNT A;  1SW1 A;  1N04 A;  3IOV A;  3OSR A;  3VXB A;  3C35 A;  1A8E A;  3R6U A;  1LAH E;  2VP1 A;  3MBP A;  3FV2 A;  1YPN A;  4G8M A;  4QRZ A;  4H6D A;  3TKD A;  1DMB A;  1H3D A;  3PV0 E;  1US5 A;  2QS1 A;  4PFW A;  1NH8 A;  4POX A;  4C0R A;  3K1N A;  3PPR A;  3O2A A;  4GOT A;  5KDT B;  1M5B A;  1A54 A;  3SEX A;  4KHZ E;  4E0X A;  1MPB A;  5F7V A;  3C33 A;  1DOT A;  1ZBM A;  3FGS A;  3VVF A;  1MG1 A;  3K6V A;  2VOZ A;  3RGY A;  1YCJ A;  3C32 A;  3TAJ A;  1FQA A;  1UIV A;  2E0S A;  4O3A A;  3TTK A;  5TPA A;  1KWH A;  3FXQ A;  5F1Q A;  2FYI A;  4KFQ A;  4NF4 B;  1SD3 A;  5AA2 D;  2F34 A;  2O68 A;  4AB5 A;  3MZ9 A;  2OLB A;  2OJT A;  3HV1 A;  3MW0 A;  3FD3 A;  3IO6 A;  4OWD A;  3U93 A;  1JNF A;  3S9N C;  3CG3 A;  5CMK A;  1B46 A;  2XX8 A;  1IIW A;  4U22 A;  5K2Y A;  1VR5 A;  3C4M A;  3IOW A;  4JB7 A;  4R74 A;  1Y4T A;  3TZA A;  2Y7I A;  3EHU A;  4THI A;  1F9B A;  2DVC A;  2M8C A;  1VFE A;  2O6A A;  2DSF A;  5DVJ A;  3RLF E;  1B6H A;  1O64 A;  4F2O A;  3PUY E;  3KJT A;  4XXU A;  1B2H A;  2HZK A;  2QL3 A;  4ZEF A;  2YJP A;  2H99 A;  1B5J A;  3D4G A;  4G2Z A;  4DXB A;  1D9Y A;  4WEP A;  3BFU A;  4RPO A;  5H8H B;  4OMB A;  3S9L C;  5I57 A;  3SDF A;  1H44 A;  3PMV A;  3EHT A;  1FQD A;  4I9D A;  2DWA A;  3K0V A;  4RA1 A;  1CB6 A;  1M5F A;  4LQ2 A;  4KYD A;  4ISU A;  2G93 A;  4TOZ A;  3LSX A;  4I1D A;  1MY0 A;  3LC8 A;  4O3B A;  2DQV A;  3TCH A;  3DP4 A;  3TTM A;  4BDL A;  2HAV A;  3MP6 A;  4GD5 A;  1LFI A;  2OWS A;  5CBR A;  4NF4 A;  1ANF A;  1B9J A;  2DP8 A;  5KCJ B;  3ZKK A;  4ND9 A;  4K3F A;  4BLA A;  5IKB A;  3FVG A;  1GTK A;  5L8D A;  2Z8E A;  1MDP 1;  1MY3 A;  4POW A;  2ANJ A;  4QFN A;  3HHF A;  1B52 A;  4JBZ A;  3IK6 B;  4R2B A;  3OO6 A;  4GL0 A;  4OYV A;  4RPN A;  2X26 A;  2E1S A;  1BLF A;  1FTM A;  4KD5 A;  3CG1 A;  3K6U A;  1JQF A;  4RYA A;  3V89 B;  2Y7R A;  3O97 A;  1ZIU A;  1Z7N E;  3MP8 A;  3O9P A;  1AOV A;  3FXR A;  2Z23 A;  2QRY A;  4IGT A;  1NH7 A;  1MH4 A;  3LUY A;  1IIT A;  4LP2 B;  2I48 A;  3DP8 A;  4GL8 A;  4P0G A;  4TLL B;  4ZE8 A;  5H8H A;  1SI1 A;  4ELP A;  4IGR A;  4ESW A;  5I57 B;  4G68 C;  3G3G A;  5H8Q A;  4EF1 A;  3QXM A;  2ZXT A;  3G3I A;  2CZL A;  2AYS A;  4H8I A;  2BJJ X;  1B05 A;  1UTB A;  3L6G A;  3M8U A;  3G7W A;  4LZ8 A;  4EXL A;  3O6I A;  1FQB A;  3PUV E;  2XXT A;  4PFU A;  1B0L A;  1FTJ A;  4XKR A;  5CBS A;  5KCJ A;  2ZYM A;  2XD2 A;  4QFL A;  2Q8J A;  4IO4 A;  1I6A A;  4R6Y A;  1SW2 A;  2ONR A;  1R1N A;  3DLN A;  3GBB A;  3LR1 A;  4H5G A;  4I62 A;  4YKK A;  2AL5 A;  2DYX A;  3CRB A;  1USY E;  3W9V A;  2ONK E;  3MZB A;  5B7D A;  1J1N A;  1SW5 A;  1US4 A;  2V3T A;  4MH5 A;  3UP9 A;  5J1D A;  5I58 B;  2DWI A;  2UVI A;  2X7P A;  3QUJ A;  4X1B A;  1LLS A;  1FTO A;  1H76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...