3PPNA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppnA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppnA02
4F1UA 1B40A 1B4ZA 4NF6B 3T93B 3S9NC 5B7DA 3P7IA 4R75A 4QFOA 3C34A 4I1DA 2HEUA 1BTJA 1QULA 3C36A 3GBAA 4GRKA 4L17A 4QFPA 2QS4A 2PMSA 3MP6A 2Z23A 2I48A 4O3AA 1MY0A 3I3VA 3FV1A 4JWOA 3MZ1A 4DE8A 2VP1A 3IB1A 4LQ2A 4QFNA 3WAFA 2DWAA 1VFEA 2HCAA 1QVSA 3FVNA 1D3KA 2QS1A 1B3EA 4OQOA 3VXBA 4KYSA 4HCWA 1IXHA 4ZEDA 4QFKA 4WEDA 1FQCA 4R2FA 3OOAA 4BDLA 2Q9TA 2RCBA 3K1NA 2DE3A 1YCJA 5CMKA 1UQWA 5A5XB 2RC9A 3C35A 3M3LA 4GIZA 2H25A 4G68A 4YZZA 3U94A 3IL1B 3C4MA 1SW5A 4YICA 4UACA 1S50A 5HPQA 3U1OA 3F11A 4ONYA 1B9JA 5ICQA 4EXKA 1JW4A 2B65A 3MUQA 2V93A 1FTKA 1A8FA 4NF4B 3FXUA 3VVEA 2UYEA 1UIVA 5ITOA 3S4UA 5IKBA 4XKRA 1QKBA 1YPNA 2G29A 3R7XA 2RKMA 2W7YA 1GVCA 4YB7A 3FJGA 4P11A 3KOSA 1LCTA 2FNCA 2DOJA 3OXNA 1P1OA 2XXYA 1B3HA 3S9LC 3PPQA 1Y4CA 5I2KB 2HFBA 5DT6A 2I3VA 1B0LA 1MQHA 2ZXTA 2V84A 3HPIA 5DVFA 2Q88A 1AH5A 3CR9A 3W15C 1DTGA 4JBZA 2QMWA 3MZBA 2D5WA 3TZAA 4OFLA 4PP0A 2NUVA 1MY3A 1MS7A 1TFAA 1MXXA 1MPCA 2QMXA 2R6GE 3PUXE 4OETA 3V8XB 3FVGA 3VDFA 1NNFA 3U8QA 2F34A 1JVXA 5BWJA 3CG1A 3MZ9A 1NH8A 4PE5B 3CSGA 3SERA 4R6YA 2H99A 1B51A 5H8QA 4N13A 3PPRA 3TTRA 4F1YA 3ONMA 2NVUB 3K2DA 4ZEIA 2CMOA 3IOTA 1J1NA 2AYSA 1RKMA 1I69A 4DLDA 2DE4A 1HSLA 5DEXB 3T9HB 2P0SA 3LSLA 1IITA 2KLFA 2ABHA 5ISUA 3TODA 2CZLA 1A54A 1DPPA 2I58A 2PYYA 2Y7RA 3D4GA 4C0RA 1P99A 2H5YA 1LAXA 3OO6A 2F5XA 1B3FA 1B5IA 3UA8A 4XKQA 1M5DA 2ONSA 3H7MA 3BKIB 3PV0E 1FTMA 3TCFA 3UP9A 4FEBA 1XVYA 1PBPA 3CFXA 1B58A 4F3BA 3KGCA 1LCFA 3R6UA 3PMXA 3MJNA 1XS5A 3G3FA 4XKPA 2ZYOA 1H43A 2XXPA 4MLVA 1A40A 1DTZA 3TCGA 4OYVA 1Q35A 3SESA 1Q1KA 3KJTA 1GGGA 3K00A 2REJA 4EXLA 4U4SA 3E4RA 4Z7EA 1B1XA 5HBCA 3K1PA 3HV1A 1JNFA 1LFGA 2Y7KA 3VLWA 5I59B 5KCJB 2XD2A 5DTBA 2Z8FA 5B70A 1BKAA 2Y84A 3H6TA 1AL3A 3CVGA 4NMYA 4OFJA 2OK2A 4U2RA 3DLNA 3KOTA 4GL0A 3G3IA 3EPEA 1QUIA 3O2AA 2F7CA 3PUWE 4QSCA 4U22A 5BUUA 2XHDA 1P1WA 4MLQA 3OD7A 1B7UA 4RNSA 1PBQA 1B46A 3JZJA 1PC3A 4YAHX 1I6BA 5F7VA 2QL3A 1MXYA 3ZKKA 4AB5A 3ILUB 3K1MA 1R9LA 1VR5A 4YB6A 1LAFE 4F19A 2R71A 2GH9A 1MDQA 1JQFA 3KSJA 1TT1A 4P0GA 3N5LA 1FCKA 1LAGE 4DIGA 5H8HA 3JV9A 3L6GA 2IA4A 4F18A 2O51A 3M8UA 1QJMA 1LBBA 5AA2A 3QAXA 4PFWA 2DP8A 5I58B 2F78A 4H5GA 4ECFA 3N6TA 3G3HA 4YKKA 4HS7A 3MWBA 3FV2A 2F35A 4KD5A 3VVFA 2UVHA 1YTVA 1P1UA 2VHAA 2E0SA 3TTNA 3VV5A 1NH7A 3IB2A 2A5TA 3SEXA 2UVIA 3HN0A 4H6DA 2REGA 4ESWA 4R9GA 1B05A 1GR2A 1IQ7A 4FEDA 4YKIA 1OQHA 1R1NA 3E13X 5TP9B 1Y4TA 2FYIA 3CRBA 3MBPA 4H8IA 4QFLA 4LA9A 3TTLA 3W9WA 5ICTA 1OLCA 1Y1ZA 4AQ4A 4IO6A 2I3WA 3KFMA 1IZ1A 4TLMB 2Y7PA 4ND9A 2O84X 4LVQA 4MH5A 3SEWA 4ESXA 1B7ZA 1ZJLA 2PX1A 4OWDA 1ZU0A 3A3CA 2HZKA 2I0CA 2G93A 3QYTA 2X7PA 3SEUA 3T9UA 1SYIA 2I4BA 3IR1A 1H3DA 2M8CA 2X26A 2P1SA 4YMBA 3UIFA 4KYEA 3K0VA 3C9HA 1N7WA 4DDDA 2ESNA 3T9VA 3IAZA 3K01A 1B5JA 4FAJA 3I5OA 1N3WA 3OO7A 4NF5A 4GD5A 5EHSA 1ZLQA 3O29A 4YU0A 1HSJA 1SD3A 3TKDA 4ZEFA 3O6IA 2Z8DA 3FIRA 3PMWA 3KBRA 4ELOA 3PUZE 4TLLB 2OBGA 4C1TA 1SW1A 3OSQA 1UTBB 3TQWA 2DWIA 3RGYA 1US5A 3Q25A 5ITPA 2A5SA 3T22A 3FXQA 3H3GA 2Q2AA 4OESA 1D9YA 2DVZA 1NNPA 4GFRA 1FTOA 2QPQA 5CRYA 1MG1A 3LUYA 3THIA 3IO6A 3H4ZA 4GF8A 1PDAA 4HCYA 1FQDA 4EF2A 3GBBA 3N26A 4LUBA 5A5XA 4PFUA 2Q8JA 4YB5A 3RUMA 1JEUA 1USYH 4G68C 1CB6A 2OWTA 1P1NA 5CM6A 3KN3A 1NMUA 3SKPA 5KDTB 1FTLA 3BFUA 1UTHB 5DVJA 5TPAB 1LAHE 4LZ7A 4OZ9A 4PFTA 3PMVA 3V89B 2VD3A 4QSEA 3RQTA 4NF4A 3OO9A 2XXRA 1OVBA 2Y7IA 3E9XA 3EHTA 1POY1 4O3CA 2H4IA 5CBSA 1MY1A 3K4UA 3RTFB 4XTCQ 2DWJA 3K6WA 4RPNA 3RLFE 5TU0A 4G77A 2Z22A 1PEBA 2YJPA 1FQEA 3PPNA 5I2KA 4KCDA 2Q2CA 3KN8A 4GVOA 1IXCA 2DXYA 3TEPA 4Q0CA 2VOZA 1NNKA 1R6ZA 3IB0A 1NNTA 3LR1A 4ZEBA 3R26A 1HSEA 4POXA 2Y7WA 2O1MA 3L6HA 5AA4B 4H8JA 2I4CA 2IEEA 2XX9A 4AB6A 4FE8A 1SBPA 5H8FB 1B3LA 1SYHA 3O97A 2XX8A 3MP1A 1KWHA 4KCCA 2XXXA 3TTKA 3U92A 4BDOA 4U4XA 1S7YA 3DP4A 2Q89A 1BLFA 4THIA 4PETA 4X1BA 1FQFA 3IOVA 5DEXA 4GXAA 3H6WA 3B7DA 1MY4A 1N76A 4N07A 4ZDMA 5JTYB 1L5TA 3PUVE 2GHBA 3E3KA 5KZTA 4IO5A 1T0KA 4F1VA 1Y3QA 1LFHA 4OENA 3UN6A 3KEIA 4G8MA 3TQLA 3QIMA 1VSOA 3V5AA 4KR5A 1DPEA 1MQDA 1MQJA 4NEDA 1JVYA 2QSXA 5I2NB 2F7AA 2B3FA 3S9EA 4PFYA 3IORA 4OTEA 2O68A 5FTHA 3DP8A 1IIWA 2VGQA 2RCAA 4BLAA 1MH4A 4F29A 1VFDA 1ANFA 3KJ7A 3G3GA 4IO4A 4R6KA 2ZNSA 2YPNA 1TWYA 2ZYKA 4LONB 4NF8B 1URGA 4DCYA 1O63A 1JW5A 3DM0A 3G3KA 4DZ1A 4X48A 1B0HA 2XXHA 5I56A 5I59A 4MF3A 5KCJA 2F7BA 1ZBMA 3C33A 1M5BA 4IB2A 5H8NB 5CMMA 4OHNA 3SEVA 4F2OA 1BIYA 3ZSFA 1CE2A 3CI8A 1DMBA 3DELB 1H44A 1H45A 3KSXA 1LGBC 1MXZA 1ZKBA 3MVZA 3RTWB 3MQ9A 3A09A 2B3BA 4M1VA 5FHOA 3VFJA 2XXUA 3LBSA 3IO4A 1XHYA 4ZE9A 2F36A 2LAOA 1MPDA 3S9MC 1SDXA 5CI5A 3SDFA 4KFQA 3SETA 2GRVA 5AA1A 4IGTA 5LOMA 5JK4A 5DVIA 2XXTA 1FW0A 3C32A 1D9VA 3D4CA 1GTKA 1XOCA 1OVTA 1B5HA 2XXIA 2ZNUA 2RC8A 3QUFA 3USDA 3OSRA 1URDA 4ZECA 4H1XA 1TFDA 4Q8RA 4C1UA 4R2BA 3VVDA 4RXLA 4NWCA 4DXBA 5I58A 2OWSA 1O7TA 3H6VA 4PQJA 4FIMA 2HXWA 4DXCA 4YMAA 1S9TA 5I57B 4R73A 3LSFB 4GWOA 1N3XA 1MQGA 4LATA 3TCHA 4R74A 5CMCA 4Q5TA 4G8HA 1A55A 4X1DA 2QS2A 5TP9A 2PT2A 5H8HB 2ZYNA 3ODBA 3MVYA 5L8DA 3T96B 1ZIUA 4FATA 4DXUA 3RN8A 1WODA 1B1HA 4HW8A 2ALUA 3HHFA 3V83A 4N6PA 1WVJA 1RYXA 4EDPA 4ELPA 1B52A 4XXUA 4TOZA 1XT8A 1ZTYA 4HTGA 4WEPA 1XC1A 3ZS6A 1Z7NE 4GLIA 1F9BA 3Q27A 4O3BA 1B7HA 3EHUA 3JYRA 1Y1MA 3B6QA 4BDRA 4ZS9A 1YAEA 4Z0IA 2NOOA 2F6PA 1I6QA 4I9DA 3RT6B 4R72A 5DYHA 2XX7A 4NF6A 4LP2B 4OEVA 5CC2A 3S2VA 1UTBA 3VLVA 3ECRA 2F8DA 4WXJA 3C31A 4RY1A 4TQUQ 2OLBA 2GHAA 5I84A 2THIA 1DOTA 1JW1A 1MY2A 5FHMA 1MQIA 3RPWA 3UORA 1EZ9A 4F3PA 4JSDA 2HAVA 3MP8A 4IO3A 4E0WA 3MPKA 1QUKA 3EQ1A 4NF5B 5J1DA 1DSNA 1Y9UA 3CIJA 2OJTA 4IY6A 2DS9A 4POWA 3BBRA 1QKAA 3ZKLA 2XXVA 4QF9A 2UVJA 5KDTA 5CMBA 1SVXB 1UTHA 4NTLA 5TPAA 1XVXA 3LSXA 4KI0E 1PB7A 1R9QA 3K6VA 3QXMA 1B3GA 3A3UA 4JSOA 1B6HA 4BDNA 5HM4B 4NE4A 4YKPA 4G4PA 4I8CA 1MXVA 5CBRA 4DCXA 4KYDA 3Q26A 3H03A 5L9OA 1POTA 1ZMGA 2XD3A 3HO7A 4BDMA 3K6XA 3KG2A 1FQAA 4RPOA 4OFOA 2UXAA 4JB7A 2PT1A 3N6UA 4X9TA 3G3JA 2QS3A 2DXRA 4G68B 1D4NA 5K2XA 2HAUA 4OEUA 2DQVA 2O69A 3EHSA 1NL5A 3QUJA 5L9SA 5AA4A 5AA2D 1B4HA 1SI0A 4H67A 5H8FA 4I62A 5FTIA 1PB9A 2YLNA 4F39A 1US4A 1EZOA 2P2AA 4EQ9A 3FVKA 4ISUA 3Q28A 1A8EA 2DVCA 4GL8A 3IJXB 3FUZA 3FJMA 2V3UA 4OERA 1Y3PA 1PB8A 2I49A 4XIGQ 5JTYA 3FASA 2ANJA 2RC7A 5EYFA 1OQGA 3PU5A 1N04A 1Y20A 4R6HA 1IUDA 1MH3A 1I6AA 3MPLA 2D21A 4F3GA 1EZPA 4JXIA 2X7QA 3W9VA 4KHZE 4OMBA 4G8NA 4K3FA 3PD8A 4Q30B 3VE1B 1LFIA 3HSTA 3UGWA 5I2NA 5JEIA 3DP6A 1QW0A 3IX1A 1MM7A 3HHGA 1MRPA 3VXCA 4GOTA 2DE2A 1MXUA 2F6GA 1IEJA 1SQYA 3TYHA 2NWJA 5H8QB 4RYAA 3RY3A 4LQ5A 1MPBA 3FGSA 1M5EA 2WKYA 5L9MA 3PUYE 3LC8A 4LZ5A 4KPTA 4RJZA 4WKMA 3VLUA 5K2YA 3OMBA 4NF8A 1N0TA 3TFLA 3TUSA 3MVWA 3HCQA 3IOWA 4RA1A 2XXQA 1FQBA 2UYFA 2DWHA 5F1QA 3O28A 4FORA 1N7XA 2AL5A 3O6HA 5H8NA 3UK4A 4NWDA 4UA8A 4M4GA 2VD2A 3BFTA 4JDFA 5FHNA 3TELA 4IY5A 2HQ0A 2Z8EA 1IXIA 2V3TA 4F31B 4P0IA 3FVOA 4JWXA 1H76A 2ZYMA 3TPAA 2V3QA 4JWYA 4H65A 3OO8A 3U93A 4RK9A 1SW2A 1LBCA 3H6UA 2GFEA 2R9JA 1LSTA 2BJJX 5ELVA 2O7IA 5I56B 1LB9A 1URSA 2RF1A 4F22A 3GXAA 2UVGA 2DYXA 3G7WA 3MAMA 1FTJA 4IO2A 2HZLA 4FECA 1A99A 5H8SA 2ZNTA 3IOUA 3PGFA 2QRYA 1Y3NA 1OMPA 3B6TA 4QSDA 4ELQA 4QHQA 1M5FA 1MM6A 3K6UA 4RK2A 1N84A 4R9FA 4ZZAA 1LLSA 2NXOA 3EN3A 3OEMA 1P1QA 2V25A 3TAJA 3O9PA 2ONKE 4ZEKA 3LSWA 5I57A 1SW4A 3N94A 3AXFA 4G2ZA 2H9BA 2DSFA 4F2QA 4F3SA 1II5A 4EUOA 3QSLA 4BDQA 4EF1A 3FXRA 5IAIA 1TXFA 1RYOA 3K02A 1MXWA 4IGRA 4MBPA 3M3FA 3FD3A 4H5FA 2O6AA 2H98A 4LZ8A 1LB8A 3PPOA 4U23A 4OXVA 2ONRA 3T66A 1EU8A 3MVXA 3CSBA 2O1LA 3WAEA 4XKNA 3O66A 1SI1A 4OVJA 1NKXA 3Q29A 2I6EA 3EF7A 3PPPA 3RT8A 3RNNA 2XXWA 3KZGA 4FJPA 1OLAA 3MC2A 3B6WA 3ILTB 1M5CA 2OZZA 3TMGA 2AL4A 3H06B 4EQ7A 5AA2B 1ELJA 3CFLA 5AE4A 4ZE8A 1JETA 2QJEA 3FZVA 1IXGA 4ELRA 4H0WA 3GZGA 5AA3A 3IK6B 1JEVA 3M3KA 1AMFA 3SEYA 3TDJA 3I6VA 2PBWA 4IO7A 3U72A 1AIVA 2I0BA 3T9XB 3PD9A 3CFZA 3IJOB 1OIBA 4QRZA 1WDNA 3GLBA 2RINA 2A5TB 2F97A 4U1ZA 3FATA 2D3IA 4KQPA 1B32A 2E1SA 4E0XA 1UIUA 1O64A 1VE4A 3CG3A 5M2VA 2PVUA 2O7UA 3O6GA 1Z7ME 3OENA 4EQBA 1NFTA 3QK6A 1GV8A 2FA7A 1MDP1 1EH3A 2ZMBA 3OELA 1BP5A 1USYE 3KN7A 1QUJA 4U1OA 1ATGA 5EHMA 3FJ7A 4YKJA 2AIXA 3OEKA 4ZZEA 1AOVA 4MFIA 1A7LA 4GXSB 1B2HA 4GQOA 3MW0A 4U21A 2OCUA 3TTMA
chains in the Genus database with same CATH superfamily
4F1UA 1B40A 1FBGA 1LBWA 1B4ZA 4NF6B 3T93B 3S9NC 5B7DA 3P7IA 4R75A 4QFOA 3C34A 4I1DA 2HEUA 1BTJA 1QULA 3C36A 3GBAA 4GRKA 4L17A 4QFPA 2QS4A 2PMSA 3MP6A 2Z23A 2I48A 4O3AA 1MY0A 3I3VA 2WBDA 4DI4B 3FV1A 4JWOA 1RDZA 3MZ1A 4DE8A 2VP1A 3IB1A 4LQ2A 4QFNA 5F24A 3WAFA 2DWAA 1VFEA 2HCAA 1FBPA 1QVSA 3FVNA 4HE0A 1D3KA 2QS1A 1B3EA 4OQOA 3VXBA 2DDKA 4KYSA 4HCWA 1IXHA 4ZEDA 4QFKA 4WEDA 1FQCA 4R2FA 3OOAA 4PGPA 4BDLA 2Q9TA 4GWXA 2RCBA 3K1NA 2DE3A 1YCJA 2Q8MA 2FVZA 5CMKA 1UQWA 4P47A 5A5XB 2RC9A 3C35A 3M3LA 4GIZA 2H25A 4G68A 4YZZA 3U94A 3IL1B 3C4MA 1SW5A 4YICA 4UACA 1S50A 5HPQA 3U1OA 3F11A 4ONYA 4PE3A 1B9JA 5ICQA 4EXKA 1JW4A 2B65A 3MUQA 2V93A 1FTKA 1A8FA 4NF4B 3FXUA 3VVEA 4MHFA 4PAKA 2UYEA 1UIVA 5ITOA 3S4UA 5IKBA 4XKRA 1QKBA 1YPNA 2G29A 3R7XA 2RKMA 2W7YA 1GVCA 4YB7A 3FJGA 1FBFA 4P11A 1IMBA 3KOSA 1LCTA 1K9ZA 2FNCA 2DOJA 3OXNA 1P1OA 2QFLA 2F3BA 4N17A 2XXYA 1B3HA 3S9LC 3PPQA 1Y4CA 5I2KB 2HFBA 5DT6A 2I3VA 2FIEA 1B0LA 1MQHA 2ZXTA 2V84A 1FJ6A 3HPIA 5DVFA 2Q88A 1AH5A 3CR9A 3W15C 1DTGA 4JBZA 2QMWA 3MZBA 2D5WA 3TZAA 4OFLA 4PP0A 2P3VA 4GWWA 2NUVA 1MY3A 1MS7A 1TFAA 1MXXA 1MPCA 2QMXA 2R6GE 3PUXE 4OETA 3V8XB 1IMDA 3FVGA 3VDFA 1NNFA 3U8QA 3KC1A 2F34A 1JVXA 2ZZWA 3FBPA 5BWJA 3CG1A 3MZ9A 1NH8A 4PE5B 3CSGA 3SERA 4R6YA 2H99A 1B51A 5H8QA 3GYYA 4N13A 3PPRA 3TTRA 4F1YA 3ONMA 2NVUB 4GWZA 3K2DA 4OVRA 4ZEIA 2CMOA 4P8BA 3IOTA 4AS4A 3FXBA 1J1NA 2AYSA 1RKMA 1I69A 4DLDA 2DE4A 1HSLA 5DEXB 3T9HB 2P0SA 3LSLA 1IITA 2KLFA 2ABHA 5ISUA 4X8RA 3TODA 2PFZA 2CZLA 1A54A 1DPPA 2I58A 2PYYA 2Y7RA 3D4GA 3EKIA 4C0RA 1P99A 2H5YA 1LAXA 3OO6A 2F5XA 1B3FA 1B5IA 3UA8A 4XKQA 1M5DA 2ONSA 3H7MA 3BKIB 1FPLA 3PV0E 1FTMA 3TCFA 3UP9A 4FEBA 1XVYA 1PBPA 3CFXA 1B58A 4F3BA 3KGCA 1LCFA 1FPJA 4PTKA 5EYHA 3R6UA 1BK4A 3PMXA 1KZ8A 3MJNA 1XS5A 3G3FA 4XKPA 2ZYOA 1H43A 2XXPA 4P56A 4MLVA 1A40A 1DTZA 3TCGA 4OYVA 1Q35A 4P3LA 3SESA 1Q1KA 3KJTA 1GGGA 2WYPA 1NI9A 3B8BA 3K00A 2REJA 4EXLA 4U4SA 3E4RA 4Z7EA 1B1XA 4FBPA 5HBCA 3K1PA 3HV1A 1JNFA 1LFGA 2Y7KA 3VLWA 5I59B 5KCJB 2XD2A 5DTBA 2Z8FA 4QBAA 5B70A 1BKAA 4PGNA 2Y84A 3H6TA 1AL3A 1IMFA 4N15A 3CVGA 4NMYA 4OFJA 2OK2A 4NQ8A 4U2RA 3DLNA 3KOTA 4GBWA 3ROJA 4GL0A 3G3IA 3EPEA 1QUIA 3O2AA 5IZZA 4AS5A 2F7CA 3PUWE 1FBCA 4QSCA 4U22A 5BUUA 2XHDA 1P1WA 4MLQA 3OD7A 1B7UA 4RNSA 1PBQA 4O94A 1B46A 3JZJA 1PC3A 4YAHX 1I6BA 5F7VA 2QL3A 1MXYA 2WX9A 3ZKKA 4AB5A 3ILUB 3K1MA 1R9LA 1VR5A 4YB6A 1LAFE 4F19A 2R71A 4N81A 3NOHA 2GH9A 1MDQA 1VDWA 1JQFA 3BIHA 3KSJA 1NV6A 1TT1A 4P0GA 3N5LA 2CZHA 1FCKA 2XWOA 4OVSA 1LAGE 4DIGA 5H8HA 3JV9A 3L6GA 2IA4A 4F18A 2O51A 3M8UA 3LV0A 1QJMA 1LBBA 5AA2A 3QAXA 4PFWA 2DP8A 5I58B 2F78A 4H5GA 4ECFA 3N6TA 3G3HA 4YKKA 4HS7A 3MWBA 3FV2A 3KBZA 2F35A 4MIJA 4KD5A 3VVFA 2UVHA 1YTVA 1P1UA 5ET8A 2VHAA 2E0SA 3TTNA 3VV5A 4QXDA 1G0IA 1NH7A 3IB2A 4KXPA 2A5TA 3SEXA 2UVIA 3HN0A 4H6DA 2REGA 4ESWA 4R9GA 1NV0A 1B05A 1JP4A 1GR2A 4JVDA 1IQ7A 4FEDA 4YKIA 1OQHA 1R1NA 3E13X 5TP9B 1Y4TA 2FYIA 3CRBA 3MBPA 2B4LA 4H8IA 4QFLA 4LA9A 3TTLA 4PAFA 3W9WA 5ICTA 1OLCA 1Y1ZA 5IZ3A 4AQ4A 4IO6A 2L5VA 2I3WA 3KFMA 1IZ1A 2PFYA 4TLMB 2Y7PA 4ND9A 2O84X 4LVQA 4MH5A 3SEWA 3HFUA 4ESXA 1B7ZA 1ZJLA 2PX1A 4OWDA 1ZU0A 4X04A 1DCUA 3A3CA 2HZKA 3ISPA 2I0CA 2G93A 3QYTA 2QVUA 2X7PA 3SEUA 3T9UA 1SYIA 2I4BA 3IR1A 1QGXA 1H3DA 2M8CA 2X26A 2P1SA 4YMBA 3UIFA 4KYEA 3K0VA 3C9HA 4MNIA 1N7WA 4DDDA 2ESNA 4NF0A 5EYGA 3T9VA 3IAZA 3K01A 1B5JA 4FAJA 3I5OA 1N3WA 3OO7A 4NF5A 4GD5A 5EHSA 1ZLQA 3O29A 4YU0A 5ET6A 1HSJA 4PFBA 1SD3A 3TKDA 4ZEFA 3O6IA 5I5PA 2Z8DA 3FIRA 3PMWA 4NX1A 1RDYA 3KBRA 4ELOA 3PUZE 4XFEA 4TLLB 2OBGA 4C1TA 1SW1A 3MYUA 3OSQA 1UTBB 3TQWA 2DWIA 3RGYA 1US5A 5EQ8A 3Q25A 5ITPA 2A5SA 3T22A 3FXQA 3H3GA 4MAGA 2Q2AA 4OESA 1D9YA 2DVZA 1NNPA 4GFRA 1FTOA 2QPQA 5CRYA 4PF8A 1MG1A 3LUYA 3THIA 3IO6A 1FPFA 3H4ZA 4GF8A 1PDAA 4HCYA 1FQDA 2VPNA 4EF2A 4OANA 1NV1A 3GBBA 3N26A 4LUBA 5A5XA 4PFUA 2Q8JA 4YB5A 3RUMA 1FPDA 1JEUA 1USYH 4G68C 1CB6A 2OWTA 1P1NA 5CM6A 3KN3A 5LDZA 1NMUA 3SKPA 5KDTB 1FTLA 3BFUA 1UTHB 5DVJA 5TPAB 1LAHE 1FBEA 4LZ7A 4OZ9A 4PFTA 3PMVA 3V89B 2VD3A 1LBVA 4QSEA 3RQTA 4NF4A 3OO9A 2XXRA 1OVBA 2Y7IA 3E9XA 3EHTA 5IZ1A 1POY1 4O3CA 2H4IA 5CBSA 1MY1A 3K4UA 3RTFB 4XTCQ 2DWJA 3K6WA 4RPNA 1LBYA 3RLFE 5TU0A 4G77A 2Z22A 1PEBA 5EQAA 4I3EA 1FPKA 2YJPA 1FQEA 3PPNA 5I2KA 4KCDA 4GBVA 2Q2CA 3KN8A 4GVOA 1IXCA 2DXYA 3TEPA 4Q0CA 4DI3D 2VOZA 1NNKA 4NGUA 1R6ZA 3IB0A 1NNTA 3LR1A 4ZEBA 3R26A 1HSEA 4POXA 2Y7WA 2O1MA 4N91A 3L6HA 4MNPA 5AA4B 1Q9DA 2QVVA 4GWUA 4H8JA 2I4CA 2IEEA 2XX9A 4O8MA 4AB6A 4FE8A 1NV7A 1SBPA 5H8FB 2XWKA 1B3LA 5EQ7A 1SYHA 3O97A 5J16A 2XX8A 3MP1A 1KWHA 1FBHA 4KCCA 2XXXA 3TTKA 3U92A 4BDOA 4U4XA 1S7YA 3B50A 3DP4A 3E79A 2Q89A 1BLFA 2GQ1A 4THIA 4PETA 4X1BA 1FQFA 3IOVA 5DEXA 2KQZA 4GXAA 3H6WA 3B7DA 1MY4A 4I40A 1N76A 4N07A 4ZDMA 4NAPA 5JTYB 1L5TA 3PUVE 2OX3A 2GHBA 3E3KA 5KZTA 4IO5A 1T0KA 1IMAA 4F1VA 1Y3QA 1LFHA 4OENA 3UN6A 3KEIA 4G8MA 3TQLA 2ZZVA 1NV3A 4PCDA 3QIMA 1VSOA 3V5AA 4KR5A 1DPEA 1MQDA 1MQJA 4NEDA 1JVYA 2QSXA 5I2NB 2F7AA 2B3FA 3S9EA 2BJIA 4PFYA 3IORA 4OTEA 2O68A 5FTHA 3DP8A 4OVPA 2B4MA 1YXIA 1IIWA 2VGQA 2RCAA 4BLAA 1MH4A 4F29A 1VFDA 1ANFA 3KJ7A 3G3GA 4IO4A 4NN3A 1K9YA 4R6KA 3RPLB 2ZNSA 1FBDA 2YPNA 4MEVA 1TWYA 2ZYKA 4LONB 4NF8B 1URGA 2WEFA 4DCYA 1O63A 1JW5A 3DM0A 3G3KA 4DZ1A 4X48A 1DBZA 4PBHA 1B0HA 2XXHA 5I56A 5I59A 4MF3A 5KCJA 2F7BA 1ZBMA 3C33A 1M5BA 4PF6A 1XI6A 4IB2A 2FHYA 5H8NB 5CMMA 4OHNA 2XA5A 3E78A 3SEVA 4F2OA 1BIYA 3ZSFA 1CE2A 3CI8A 1DMBA 2Q74A 3DELB 1H44A 1H45A 3KSXA 1LGBC 1MXZA 1ZKBA 3MVZA 1FPGA 3RTWB 3MQ9A 3A09A 2B3BA 4M1VA 4GX4A 4PDHA 5FHOA 3VFJA 2XXUA 3LBSA 4OVTA 3IO4A 1XHYA 4ZE9A 4PBQA 2F36A 2LAOA 1MPDA 3S9MC 1SDXA 5CI5A 4N8GA 3SDFA 4MMPA 4KFQA 3SETA 2GRVA 2KR0A 2VT5A 5AA1A 4IGTA 5LOMA 5JK4A 5DVIA 2XXTA 1FW0A 3C32A 5IGAA 1D9VA 3D4CA 1AWBA 4MX6A 1GTKA 1OVTA 1XOCA 4HXVA 4JVIA 1B5HA 5EQ9A 2XXIA 2ZNUA 2RC8A 3QUFA 3USDA 3SZPA 3OSRA 1URDA 4ZECA 4H1XA 1TFDA 4Q8RA 4C1UA 5ET7A 3BIGA 3T0JA 4R2BA 3VVDA 4RXLA 4NWCA 4OVQA 4DXBA 5I58A 2OWSA 2CEYA 1O7TA 4GX3A 3H6VA 4PQJA 4FIMA 2HXWA 3U65A 4DXCA 4MCOA 4YMAA 1S9TA 5I57B 4R73A 3LSFB 4GWOA 4N6DA 1N3XA 1MQGA 1FPIA 5ET5A 4LATA 4O7IA 3TCHA 4R74A 5CMCA 4Q5TA 1FTAA 4G8HA 4PC9A 1A55A 4X1DA 2QS2A 5TP9A 2VPOA 2PT2A 1EYKA 5H8HB 2ZYNA 3ODBA 3MVYA 5L8DA 3T96B 1ZIUA 4FATA 4DXUA 3RN8A 1WODA 1B1HA 4HW8A 1LBZA 2ALUA 3HHFA 3V83A 4N6PA 3A29A 1WVJA 2P3NA 1RYXA 4GWYA 4OA4A 4EDPA 4ELPA 4GWSA 1B52A 4XXUA 4TOZA 1XT8A 1ZTYA 4HTGA 4WEPA 4XEQA 1XC1A 3ZS6A 2QVRA 1Z7NE 4GLIA 4MNCA 1F9BA 3Q27A 4O3BA 1B7HA 3EHUA 3JYRA 1Y1MA 3B6QA 4O7MA 4P9KA 1DK4A 4BDRA 4ZS9A 1YAEA 4Z0IA 2NOOA 4NHBA 2F6PA 1I6QA 4I9DA 3RT6B 4R72A 5DYHA 2XX7A 1FJ9A 2CZKA 4NF6A 1LBXA 2HXRA 4LP2B 4OEVA 5IM2A 5CC2A 1CNQA 3MSTA 3S2VA 1UTBA 3VLVA 3ECRA 5ESYA 2F8DA 4WXJA 3C31A 4RY1A 4NG7A 3PTYA 4TQUQ 2OLBA 1FSAA 2GHAA 5I84A 2THIA 1DOTA 1JW1A 1MY2A 5FHMA 1MQIA 3RPWA 3UORA 1EZ9A 4F3PA 4JSDA 2HAVA 3MP8A 4IO3A 4E0WA 3MPKA 1QUKA 3EQ1A 4NF5B 5J1DA 1DSNA 1Y9UA 3CIJA 2OJTA 4IY6A 2DS9A 4POWA 3BBRA 1QKAA 3ZKLA 2XXVA 4QF9A 2CEXA 2UVJA 5KDTA 5CMBA 1SVXB 1UTHA 4NTLA 5TPAA 1XVXA 3LSXA 4KI0E 1PB7A 1R9QA 1IMCA 3K6VA 3QXMA 2OWZA 4N6KA 1B3GA 2CZIA 3QMFA 3A3UA 4JSOA 1B6HA 3IFAA 4BDNA 5HM4B 4NE4A 4YKPA 4G4PA 4I8CA 1MXVA 5CBRA 4DCXA 4N4UA 2MKZA 4KYDA 3LUZA 3Q26A 3H03A 4HE1A 5L9OA 1POTA 1ZMGA 4P1EA 2XD3A 3HO7A 4BDMA 3K6XA 3KG2A 1FQAA 4RPOA 4OFOA 2WBBA 2UXAA 4JB7A 2PT1A 3N6UA 4X9TA 3G3JA 2QS3A 2DXRA 4G68B 1D4NA 2HHMA 5K2XA 2HAUA 4OEUA 2DQVA 2O69A 3EHSA 1NL5A 3QUJA 5L9SA 4HE2A 1KA1A 5AA4A 5AA2D 1B4HA 2F3DA 5FBPA 1SI0A 3IFCA 4H67A 5H8FA 4I62A 2XWIA 5FTIA 2XWVA 1PB9A 2YLNA 4F39A 1US4A 1EZOA 2P2AA 4EQ9A 3FVKA 4ISUA 2FBPA 3Q28A 4PFIA 1A8EA 2DVCA 4GL8A 3IJXB 3FUZA 3FJMA 1FPBA 4XF5A 2V3UA 4OERA 1FRPA 1Y3PA 1FPEA 1PB8A 2I49A 4XIGQ 5JTYA 3FASA 2ANJA 2RC7A 5EYFA 4H45A 2XXKA 1OQGA 3PU5A 1N04A 1Y20A 4R6HA 1IUDA 1MH3A 1I6AA 3MPLA 2D21A 4F3GA 1EZPA 4JXIA 2X7QA 3W9VA 4KHZE 4OMBA 4G8NA 2ZZXA 1G0HA 4K3FA 3PD8A 4P1LA 4Q30B 4LN5A 1RDXA 3VE1B 1LFIA 3RYDA 3HSTA 3UGWA 5I2NA 5JEIA 3DP6A 1QW0A 3IX1A 1MM7A 1NUZA 3HHGA 1MRPA 3VXCA 4GOTA 2DE2A 1MXUA 2F6GA 1IEJA 1SQYA 3TYHA 2NWJA 5H8QB 4RYAA 3RY3A 4LQ5A 1MPBA 1NUYA 3FGSA 1M5EA 2WKYA 1NUWA 1SPIA 3RPLA 4JVCA 5L9MA 3PUYE 3LC8A 4LZ5A 1YYZA 4KPTA 4RJZA 4WKMA 3VLUA 5K2YA 3OMBA 4NF8A 1N0TA 3TFLA 3TUSA 5DW8A 3MVWA 3HCQA 3IOWA 5A5LA 1NUXA 5T3JA 4RA1A 2XXQA 1FQBA 2UYFA 2DWHA 1D9QA 4IR8A 5F1QA 3O28A 4FORA 1N7XA 2AL5A 3O6HA 5H8NA 3UK4A 4NWDA 4UA8A 4M4GA 2VD2A 3BFTA 4JDFA 5FHNA 3TELA 4IY5A 4PAIA 2HQ0A 2Z8EA 1IXIA 2V3TA 4F31B 4P0IA 3FVOA 4JWXA 1H76A 2ZYMA 3TPAA 2V3QA 4JWYA 4H65A 3OO8A 1IMEA 3U93A 4RK9A 1SW2A 1LBCA 3H6UA 2GFEA 2R9JA 1LSTA 2BJJX 5ELVA 1EYJA 2O7IA 1INPA 1KA0A 5I56B 1LB9A 1URSA 2RF1A 4F22A 3GXAA 2UVGA 2DYXA 3G7WA 2R8TA 3MAMA 1FTJA 4IO2A 5I7IA 2HZLA 3KC0A 4FECA 1A99A 5H8SA 2ZNTA 3IOUA 3PGFA 2QRYA 1Y3NA 1OMPA 4G61A 3B6TA 4QSDA 4ELQA 2Y5KA 4QHQA 1M5FA 1MM6A 3K6UA 4RK2A 1N84A 4R9FA 4I3YA 4ZZAA 1LLSA 4PFRA 2NXOA 3EN3A 3OEMA 4GX6A 1P1QA 2V25A 3TAJA 3O9PA 2ONKE 4ZEKA 3LSWA 5I57A 1SW4A 3N94A 3AXFA 4G2ZA 2H9BA 2DSFA 4F2QA 4F3SA 1II5A 4EUOA 3QSLA 4BDQA 4EF1A 3FXRA 5IAIA 1TXFA 1RYOA 3K02A 1MXWA 4IGRA 4MBPA 3M3FA 5LTCA 3FD3A 1YZ0A 4H5FA 5I3SA 2O6AA 1NV5A 3CHGA 2H98A 4LZ8A 1LB8A 1NV4A 3PPOA 4U23A 4OXVA 2ONRA 3T66A 1NV2A 1EU8A 3MVXA 3CSBA 2JJKA 2O1LA 3WAEA 4XKNA 3O66A 1SI1A 4OVJA 1NKXA 3Q29A 2I6EA 3EF7A 3PPPA 3RT8A 3RNNA 2XXWA 3KZGA 4FJPA 1OLAA 3MC2A 3B6WA 3ILTB 1M5CA 2HPGA 2OZZA 4N8YA 3TMGA 2WYKA 2AL4A 3H06B 4EQ7A 5AA2B 4PDDA 1ELJA 3CFLA 5AE4A 4ZE8A 1JETA 2QJEA 3FZVA 1IXGA 2V4CA 4ELRA 4H0WA 3GZGA 5AA3A 3IK6B 1JEVA 3M3KA 1AMFA 3SEYA 3TDJA 3I6VA 2PBWA 4IO7A 3U72A 1AIVA 2I0BA 3T9XB 3PD9A 3CFZA 3IJOB 1OIBA 4QRZA 1WDNA 3GLBA 2RINA 2A5TB 2F97A 4U1ZA 3FATA 2D3IA 4H46A 4KQPA 1B32A 2E1SA 4E0XA 1UIUA 1O64A 1VE4A 3CG3A 5M2VA 2PVUA 2FIXA 2O7UA 3O6GA 4MJOA 1Z7ME 3OENA 2Y5LA 4EQBA 1NFTA 3QK6A 1GV8A 5IZ3B 4UABA 3D1RA 2FA7A 1MDP1 1EH3A 2ZMBA 1EYIA 3OELA 1BP5A 1USYE 4U1OA 1QUJA 3KN7A 1ATGA 5EHMA 3FJ7A 1LEVA 4YKJA 2AIXA 3OEKA 4ZZEA 1AOVA 4MFIA 1A7LA 4GXSB 1B2HA 4GQOA 3MW0A 3T1BA 4U21A 2OCUA 3TTMA 2PCRA
chains in the Genus database with same CATH topology
4F1UA 1B40A 1B4ZA 4NF6B 3T93B 3S9NC 5B7DA 3P7IA 4R75A 4QFOA 3C34A 4I1DA 2HEUA 1BTJA 1QULA 3C36A 3GBAA 4GRKA 4L17A 4QFPA 2QS4A 2PMSA 3MP6A 2Z23A 2I48A 4O3AA 1MY0A 3I3VA 3FV1A 4JWOA 3MZ1A 4DE8A 2VP1A 3IB1A 4LQ2A 4QFNA 3WAFA 2DWAA 1VFEA 2HCAA 1QVSA 3FVNA 1D3KA 2QS1A 1B3EA 4OQOA 3VXBA 4KYSA 4HCWA 1IXHA 4ZEDA 4QFKA 4WEDA 1FQCA 4R2FA 3OOAA 4BDLA 2Q9TA 2RCBA 3K1NA 2DE3A 1YCJA 5CMKA 1UQWA 5A5XB 2RC9A 3C35A 3M3LA 4GIZA 2H25A 4G68A 4YZZA 3U94A 3IL1B 3C4MA 1SW5A 4YICA 4UACA 1S50A 5HPQA 3U1OA 3F11A 4ONYA 1B9JA 5ICQA 4EXKA 1JW4A 2B65A 3MUQA 2V93A 1FTKA 1A8FA 4NF4B 3FXUA 3VVEA 2UYEA 1UIVA 5ITOA 3S4UA 5IKBA 4XKRA 1QKBA 1YPNA 2G29A 3R7XA 2RKMA 2W7YA 1GVCA 4YB7A 3FJGA 4P11A 3KOSA 1LCTA 2FNCA 2DOJA 3OXNA 1P1OA 2XXYA 1B3HA 3S9LC 3PPQA 1Y4CA 5I2KB 2HFBA 5DT6A 2I3VA 1B0LA 1MQHA 2ZXTA 2V84A 3HPIA 5DVFA 2Q88A 1AH5A 3CR9A 3W15C 1DTGA 4JBZA 2QMWA 3MZBA 2D5WA 3TZAA 4OFLA 4PP0A 2NUVA 1MY3A 1MS7A 1TFAA 1MXXA 1MPCA 2QMXA 2R6GE 3PUXE 4OETA 3V8XB 3FVGA 3VDFA 1NNFA 3U8QA 2F34A 1JVXA 5BWJA 3CG1A 3MZ9A 1NH8A 4PE5B 3CSGA 3SERA 4R6YA 2H99A 1B51A 5H8QA 4N13A 3PPRA 3TTRA 4F1YA 3ONMA 2NVUB 3K2DA 4ZEIA 2CMOA 3IOTA 1J1NA 2AYSA 1RKMA 1I69A 4DLDA 2DE4A 1HSLA 5DEXB 3T9HB 2P0SA 3LSLA 1IITA 2KLFA 2ABHA 5ISUA 3TODA 2CZLA 1A54A 1DPPA 2I58A 2PYYA 2Y7RA 3D4GA 4C0RA 1P99A 2H5YA 1LAXA 3OO6A 2F5XA 1B3FA 1B5IA 3UA8A 4XKQA 1M5DA 2ONSA 3H7MA 3BKIB 3PV0E 1FTMA 3TCFA 3UP9A 4FEBA 1XVYA 1PBPA 3CFXA 1B58A 4F3BA 3KGCA 1LCFA 3R6UA 3PMXA 3MJNA 1XS5A 3G3FA 4XKPA 2ZYOA 1H43A 2XXPA 4MLVA 1A40A 1DTZA 3TCGA 4OYVA 1Q35A 3SESA 1Q1KA 3KJTA 1GGGA 3K00A 2REJA 4EXLA 4U4SA 3E4RA 4Z7EA 1B1XA 5HBCA 3K1PA 3HV1A 1JNFA 1LFGA 2Y7KA 3VLWA 5I59B 5KCJB 2XD2A 5DTBA 2Z8FA 5B70A 1BKAA 2Y84A 3H6TA 1AL3A 3CVGA 4NMYA 4OFJA 2OK2A 4U2RA 3DLNA 3KOTA 4GL0A 3G3IA 3EPEA 1QUIA 3O2AA 2F7CA 3PUWE 4QSCA 4U22A 5BUUA 2XHDA 1P1WA 4MLQA 3OD7A 1B7UA 4RNSA 1PBQA 1B46A 3JZJA 1PC3A 4YAHX 1I6BA 5F7VA 2QL3A 1MXYA 3ZKKA 4AB5A 3ILUB 3K1MA 1R9LA 1VR5A 4YB6A 1LAFE 4F19A 2R71A 2GH9A 1MDQA 1JQFA 3KSJA 1TT1A 4P0GA 3N5LA 1FCKA 1LAGE 4DIGA 5H8HA 3JV9A 3L6GA 2IA4A 4F18A 2O51A 3M8UA 1QJMA 1LBBA 5AA2A 3QAXA 4PFWA 2DP8A 5I58B 2F78A 4H5GA 4ECFA 3N6TA 3G3HA 4YKKA 4HS7A 3MWBA 3FV2A 2F35A 4KD5A 3VVFA 2UVHA 1YTVA 1P1UA 2VHAA 2E0SA 3TTNA 3VV5A 1NH7A 3IB2A 2A5TA 3SEXA 2UVIA 3HN0A 4H6DA 2REGA 4ESWA 4R9GA 1B05A 1GR2A 1IQ7A 4FEDA 4YKIA 1OQHA 1R1NA 3E13X 5TP9B 1Y4TA 2FYIA 3CRBA 3MBPA 4H8IA 4QFLA 4LA9A 3TTLA 3W9WA 5ICTA 1OLCA 1Y1ZA 4AQ4A 4IO6A 2I3WA 3KFMA 1IZ1A 4TLMB 2Y7PA 4ND9A 2O84X 4LVQA 4MH5A 3SEWA 4ESXA 1B7ZA 1ZJLA 2PX1A 4OWDA 1ZU0A 3A3CA 2HZKA 2I0CA 2G93A 3QYTA 2X7PA 3SEUA 3T9UA 1SYIA 2I4BA 3IR1A 1H3DA 2M8CA 2X26A 2P1SA 4YMBA 3UIFA 4KYEA 3K0VA 3C9HA 1N7WA 4DDDA 2ESNA 3T9VA 3IAZA 3K01A 1B5JA 4FAJA 3I5OA 1N3WA 3OO7A 4NF5A 4GD5A 5EHSA 1ZLQA 3O29A 4YU0A 1HSJA 1SD3A 3TKDA 4ZEFA 3O6IA 2Z8DA 3FIRA 3PMWA 3KBRA 4ELOA 3PUZE 4TLLB 2OBGA 4C1TA 1SW1A 3OSQA 1UTBB 3TQWA 2DWIA 3RGYA 1US5A 3Q25A 5ITPA 2A5SA 3T22A 3FXQA 3H3GA 2Q2AA 4OESA 1D9YA 2DVZA 1NNPA 4GFRA 1FTOA 2QPQA 5CRYA 1MG1A 3LUYA 3THIA 3IO6A 3H4ZA 4GF8A 1PDAA 4HCYA 1FQDA 4EF2A 3GBBA 3N26A 4LUBA 5A5XA 4PFUA 2Q8JA 4YB5A 3RUMA 1JEUA 1USYH 4G68C 1CB6A 2OWTA 1P1NA 5CM6A 3KN3A 1NMUA 3SKPA 5KDTB 1FTLA 3BFUA 1UTHB 5DVJA 5TPAB 1LAHE 4LZ7A 4OZ9A 4PFTA 3PMVA 3V89B 2VD3A 4QSEA 3RQTA 4NF4A 3OO9A 2XXRA 1OVBA 2Y7IA 3E9XA 3EHTA 1POY1 4O3CA 2H4IA 5CBSA 1MY1A 3K4UA 3RTFB 4XTCQ 2DWJA 3K6WA 4RPNA 3RLFE 5TU0A 4G77A 2Z22A 1PEBA 2YJPA 1FQEA 3PPNA 5I2KA 4KCDA 2Q2CA 3KN8A 4GVOA 1IXCA 2DXYA 3TEPA 4Q0CA 2VOZA 1NNKA 1R6ZA 3IB0A 1NNTA 3LR1A 4ZEBA 3R26A 1HSEA 4POXA 2Y7WA 2O1MA 3L6HA 5AA4B 4H8JA 2I4CA 2IEEA 2XX9A 4AB6A 4FE8A 1SBPA 5H8FB 1B3LA 1SYHA 3O97A 2XX8A 3MP1A 1KWHA 4KCCA 2XXXA 3TTKA 3U92A 4BDOA 4U4XA 1S7YA 3DP4A 2Q89A 1BLFA 4THIA 4PETA 4X1BA 1FQFA 3IOVA 5DEXA 4GXAA 3H6WA 3B7DA 1MY4A 1N76A 4N07A 4ZDMA 5JTYB 1L5TA 3PUVE 2GHBA 3E3KA 5KZTA 4IO5A 1T0KA 4F1VA 1Y3QA 1LFHA 4OENA 3UN6A 3KEIA 4G8MA 3TQLA 3QIMA 1VSOA 3V5AA 4KR5A 1DPEA 1MQDA 1MQJA 4NEDA 1JVYA 2QSXA 5I2NB 2F7AA 2B3FA 3S9EA 4PFYA 3IORA 4OTEA 2O68A 5FTHA 3DP8A 1IIWA 2VGQA 2RCAA 4BLAA 1MH4A 4F29A 1VFDA 1ANFA 3KJ7A 3G3GA 4IO4A 4R6KA 2ZNSA 2YPNA 1TWYA 2ZYKA 4LONB 4NF8B 1URGA 4DCYA 1O63A 1JW5A 3DM0A 3G3KA 4DZ1A 4X48A 1B0HA 2XXHA 5I56A 5I59A 4MF3A 5KCJA 2F7BA 1ZBMA 3C33A 1M5BA 4IB2A 5H8NB 5CMMA 4OHNA 3SEVA 4F2OA 1BIYA 3ZSFA 1CE2A 3CI8A 1DMBA 3DELB 1H44A 1H45A 3KSXA 1LGBC 1MXZA 1ZKBA 3MVZA 3RTWB 3MQ9A 3A09A 2B3BA 4M1VA 5FHOA 3VFJA 2XXUA 3LBSA 3IO4A 1XHYA 4ZE9A 2F36A 2LAOA 1MPDA 3S9MC 1SDXA 5CI5A 3SDFA 4KFQA 3SETA 2GRVA 5AA1A 4IGTA 5LOMA 5JK4A 5DVIA 2XXTA 1FW0A 3C32A 1D9VA 3D4CA 1GTKA 1XOCA 1OVTA 1B5HA 2XXIA 2ZNUA 2RC8A 3QUFA 3USDA 3OSRA 1URDA 4ZECA 4H1XA 1TFDA 4Q8RA 4C1UA 4R2BA 3VVDA 4RXLA 4NWCA 4DXBA 5I58A 2OWSA 1O7TA 3H6VA 4PQJA 4FIMA 2HXWA 4DXCA 4YMAA 1S9TA 5I57B 4R73A 3LSFB 4GWOA 1N3XA 1MQGA 4LATA 3TCHA 4R74A 5CMCA 4Q5TA 4G8HA 1A55A 4X1DA 2QS2A 5TP9A 2PT2A 5H8HB 2ZYNA 3ODBA 3MVYA 5L8DA 3T96B 1ZIUA 4FATA 4DXUA 3RN8A 1WODA 1B1HA 4HW8A 2ALUA 3HHFA 3V83A 4N6PA 1WVJA 1RYXA 4EDPA 4ELPA 1B52A 4XXUA 4TOZA 1XT8A 1ZTYA 4HTGA 4WEPA 1XC1A 3ZS6A 1Z7NE 4GLIA 1F9BA 3Q27A 4O3BA 1B7HA 3EHUA 3JYRA 1Y1MA 3B6QA 4BDRA 4ZS9A 1YAEA 4Z0IA 2NOOA 2F6PA 1I6QA 4I9DA 3RT6B 4R72A 5DYHA 2XX7A 4NF6A 4LP2B 4OEVA 5CC2A 3S2VA 1UTBA 3VLVA 3ECRA 2F8DA 4WXJA 3C31A 4RY1A 4TQUQ 2OLBA 2GHAA 5I84A 2THIA 1DOTA 1JW1A 1MY2A 5FHMA 1MQIA 3RPWA 3UORA 1EZ9A 4F3PA 4JSDA 2HAVA 3MP8A 4IO3A 4E0WA 3MPKA 1QUKA 3EQ1A 4NF5B 5J1DA 1DSNA 1Y9UA 3CIJA 2OJTA 4IY6A 2DS9A 4POWA 3BBRA 1QKAA 3ZKLA 2XXVA 4QF9A 2UVJA 5KDTA 5CMBA 1SVXB 1UTHA 4NTLA 5TPAA 1XVXA 3LSXA 4KI0E 1PB7A 1R9QA 3K6VA 3QXMA 1B3GA 3A3UA 4JSOA 1B6HA 4BDNA 5HM4B 4NE4A 4YKPA 4G4PA 4I8CA 1MXVA 5CBRA 4DCXA 4KYDA 3Q26A 3H03A 5L9OA 1POTA 1ZMGA 2XD3A 3HO7A 4BDMA 3K6XA 3KG2A 1FQAA 4RPOA 4OFOA 2UXAA 4JB7A 2PT1A 3N6UA 4X9TA 3G3JA 2QS3A 2DXRA 4G68B 1D4NA 5K2XA 2HAUA 4OEUA 2DQVA 2O69A 3EHSA 1NL5A 3QUJA 5L9SA 5AA4A 5AA2D 1B4HA 1SI0A 4H67A 5H8FA 4I62A 5FTIA 1PB9A 2YLNA 4F39A 1US4A 1EZOA 2P2AA 4EQ9A 3FVKA 4ISUA 3Q28A 1A8EA 2DVCA 4GL8A 3IJXB 3FUZA 3FJMA 2V3UA 4OERA 1Y3PA 1PB8A 2I49A 4XIGQ 5JTYA 3FASA 2ANJA 2RC7A 5EYFA 1OQGA 3PU5A 1N04A 1Y20A 4R6HA 1IUDA 1MH3A 1I6AA 3MPLA 2D21A 4F3GA 1EZPA 4JXIA 2X7QA 3W9VA 4KHZE 4OMBA 4G8NA 4K3FA 3PD8A 4Q30B 3VE1B 1LFIA 3HSTA 3UGWA 5I2NA 5JEIA 3DP6A 1QW0A 3IX1A 1MM7A 3HHGA 1MRPA 3VXCA 4GOTA 2DE2A 1MXUA 2F6GA 1IEJA 1SQYA 3TYHA 2NWJA 5H8QB 4RYAA 3RY3A 4LQ5A 1MPBA 3FGSA 1M5EA 2WKYA 5L9MA 3PUYE 3LC8A 4LZ5A 4KPTA 4RJZA 4WKMA 3VLUA 5K2YA 3OMBA 4NF8A 1N0TA 3TFLA 3TUSA 3MVWA 3HCQA 3IOWA 4RA1A 2XXQA 1FQBA 2UYFA 2DWHA 5F1QA 3O28A 4FORA 1N7XA 2AL5A 3O6HA 5H8NA 3UK4A 4NWDA 4UA8A 4M4GA 2VD2A 3BFTA 4JDFA 5FHNA 3TELA 4IY5A 2HQ0A 2Z8EA 1IXIA 2V3TA 4F31B 4P0IA 3FVOA 4JWXA 1H76A 2ZYMA 3TPAA 2V3QA 4JWYA 4H65A 3OO8A 3U93A 4RK9A 1SW2A 1LBCA 3H6UA 2GFEA 2R9JA 1LSTA 2BJJX 5ELVA 2O7IA 5I56B 1LB9A 1URSA 2RF1A 4F22A 3GXAA 2UVGA 2DYXA 3G7WA 3MAMA 1FTJA 4IO2A 2HZLA 4FECA 1A99A 5H8SA 2ZNTA 3IOUA 3PGFA 2QRYA 1Y3NA 1OMPA 3B6TA 4QSDA 4ELQA 4QHQA 1M5FA 1MM6A 3K6UA 4RK2A 1N84A 4R9FA 4ZZAA 1LLSA 2NXOA 3EN3A 3OEMA 1P1QA 2V25A 3TAJA 3O9PA 2ONKE 4ZEKA 3LSWA 5I57A 1SW4A 3N94A 3AXFA 4G2ZA 2H9BA 2DSFA 4F2QA 4F3SA 1II5A 4EUOA 3QSLA 4BDQA 4EF1A 3FXRA 5IAIA 1TXFA 1RYOA 3K02A 1MXWA 4IGRA 4MBPA 3M3FA 3FD3A 4H5FA 2O6AA 2H98A 4LZ8A 1LB8A 3PPOA 4U23A 4OXVA 2ONRA 3T66A 1EU8A 3MVXA 3CSBA 2O1LA 3WAEA 4XKNA 3O66A 1SI1A 4OVJA 1NKXA 3Q29A 2I6EA 3EF7A 3PPPA 3RT8A 3RNNA 2XXWA 3KZGA 4FJPA 1OLAA 3MC2A 3B6WA 3ILTB 1M5CA 2OZZA 3TMGA 2AL4A 3H06B 4EQ7A 5AA2B 1ELJA 3CFLA 5AE4A 4ZE8A 1JETA 2QJEA 3FZVA 1IXGA 4ELRA 4H0WA 3GZGA 5AA3A 3IK6B 1JEVA 3M3KA 1AMFA 3SEYA 3TDJA 3I6VA 2PBWA 4IO7A 3U72A 1AIVA 2I0BA 3T9XB 3PD9A 3CFZA 3IJOB 1OIBA 4QRZA 1WDNA 3GLBA 2RINA 2A5TB 2F97A 4U1ZA 3FATA 2D3IA 4KQPA 1B32A 2E1SA 4E0XA 1UIUA 1O64A 1VE4A 3CG3A 5M2VA 2PVUA 2O7UA 3O6GA 1Z7ME 3OENA 4EQBA 1NFTA 3QK6A 1GV8A 2FA7A 1MDP1 1EH3A 2ZMBA 3OELA 1BP5A 1USYE 3KN7A 1QUJA 4U1OA 1ATGA 5EHMA 3FJ7A 4YKJA 2AIXA 3OEKA 4ZZEA 1AOVA 4MFIA 1A7LA 4GXSB 1B2HA 4GQOA 3MW0A 4U21A 2OCUA 3TTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1U A;  1B40 A;  1B4Z A;  4NF6 B;  3T93 B;  3S9N C;  5B7D A;  3P7I A;  4R75 A;  4QFO A;  3C34 A;  4I1D A;  2HEU A;  1BTJ A;  1QUL A;  3C36 A;  3GBA A;  4GRK A;  4L17 A;  4QFP A;  2QS4 A;  2PMS A;  3MP6 A;  2Z23 A;  2I48 A;  4O3A A;  1MY0 A;  3I3V A;  3FV1 A;  4JWO A;  3MZ1 A;  4DE8 A;  2VP1 A;  3IB1 A;  4LQ2 A;  4QFN A;  3WAF A;  2DWA A;  1VFE A;  2HCA A;  1QVS A;  3FVN A;  1D3K A;  2QS1 A;  1B3E A;  4OQO A;  3VXB A;  4KYS A;  4HCW A;  1IXH A;  4ZED A;  4QFK A;  4WED A;  1FQC A;  4R2F A;  3OOA A;  4BDL A;  2Q9T A;  2RCB A;  3K1N A;  2DE3 A;  1YCJ A;  5CMK A;  1UQW A;  5A5X B;  2RC9 A;  3C35 A;  3M3L A;  4GIZ A;  2H25 A;  4G68 A;  4YZZ A;  3U94 A;  3IL1 B;  3C4M A;  1SW5 A;  4YIC A;  4UAC A;  1S50 A;  5HPQ A;  3U1O A;  3F11 A;  4ONY A;  1B9J A;  5ICQ A;  4EXK A;  1JW4 A;  2B65 A;  3MUQ A;  2V93 A;  1FTK A;  1A8F A;  4NF4 B;  3FXU A;  3VVE A;  2UYE A;  1UIV A;  5ITO A;  3S4U A;  5IKB A;  4XKR A;  1QKB A;  1YPN A;  2G29 A;  3R7X A;  2RKM A;  2W7Y A;  1GVC A;  4YB7 A;  3FJG A;  4P11 A;  3KOS A;  1LCT A;  2FNC A;  2DOJ A;  3OXN A;  1P1O A;  2XXY A;  1B3H A;  3S9L C;  3PPQ A;  1Y4C A;  5I2K B;  2HFB A;  5DT6 A;  2I3V A;  1B0L A;  1MQH A;  2ZXT A;  2V84 A;  3HPI A;  5DVF A;  2Q88 A;  1AH5 A;  3CR9 A;  3W15 C;  1DTG A;  4JBZ A;  2QMW A;  3MZB A;  2D5W A;  3TZA A;  4OFL A;  4PP0 A;  2NUV A;  1MY3 A;  1MS7 A;  1TFA A;  1MXX A;  1MPC A;  2QMX A;  2R6G E;  3PUX E;  4OET A;  3V8X B;  3FVG A;  3VDF A;  1NNF A;  3U8Q A;  2F34 A;  1JVX A;  5BWJ A;  3CG1 A;  3MZ9 A;  1NH8 A;  4PE5 B;  3CSG A;  3SER A;  4R6Y A;  2H99 A;  1B51 A;  5H8Q A;  4N13 A;  3PPR A;  3TTR A;  4F1Y A;  3ONM A;  2NVU B;  3K2D A;  4ZEI A;  2CMO A;  3IOT A;  1J1N A;  2AYS A;  1RKM A;  1I69 A;  4DLD A;  2DE4 A;  1HSL A;  5DEX B;  3T9H B;  2P0S A;  3LSL A;  1IIT A;  2KLF A;  2ABH A;  5ISU A;  3TOD A;  2CZL A;  1A54 A;  1DPP A;  2I58 A;  2PYY A;  2Y7R A;  3D4G A;  4C0R A;  1P99 A;  2H5Y A;  1LAX A;  3OO6 A;  2F5X A;  1B3F A;  1B5I A;  3UA8 A;  4XKQ A;  1M5D A;  2ONS A;  3H7M A;  3BKI B;  3PV0 E;  1FTM A;  3TCF A;  3UP9 A;  4FEB A;  1XVY A;  1PBP A;  3CFX A;  1B58 A;  4F3B A;  3KGC A;  1LCF A;  3R6U A;  3PMX A;  3MJN A;  1XS5 A;  3G3F A;  4XKP A;  2ZYO A;  1H43 A;  2XXP A;  4MLV A;  1A40 A;  1DTZ A;  3TCG A;  4OYV A;  1Q35 A;  3SES A;  1Q1K A;  3KJT A;  1GGG A;  3K00 A;  2REJ A;  4EXL A;  4U4S A;  3E4R A;  4Z7E A;  1B1X A;  5HBC A;  3K1P A;  3HV1 A;  1JNF A;  1LFG A;  2Y7K A;  3VLW A;  5I59 B;  5KCJ B;  2XD2 A;  5DTB A;  2Z8F A;  5B70 A;  1BKA A;  2Y84 A;  3H6T A;  1AL3 A;  3CVG A;  4NMY A;  4OFJ A;  2OK2 A;  4U2R A;  3DLN A;  3KOT A;  4GL0 A;  3G3I A;  3EPE A;  1QUI A;  3O2A A;  2F7C A;  3PUW E;  4QSC A;  4U22 A;  5BUU A;  2XHD A;  1P1W A;  4MLQ A;  3OD7 A;  1B7U A;  4RNS A;  1PBQ A;  1B46 A;  3JZJ A;  1PC3 A;  4YAH X;  1I6B A;  5F7V A;  2QL3 A;  1MXY A;  3ZKK A;  4AB5 A;  3ILU B;  3K1M A;  1R9L A;  1VR5 A;  4YB6 A;  1LAF E;  4F19 A;  2R71 A;  2GH9 A;  1MDQ A;  1JQF A;  3KSJ A;  1TT1 A;  4P0G A;  3N5L A;  1FCK A;  1LAG E;  4DIG A;  5H8H A;  3JV9 A;  3L6G A;  2IA4 A;  4F18 A;  2O51 A;  3M8U A;  1QJM A;  1LBB A;  5AA2 A;  3QAX A;  4PFW A;  2DP8 A;  5I58 B;  2F78 A;  4H5G A;  4ECF A;  3N6T A;  3G3H A;  4YKK A;  4HS7 A;  3MWB A;  3FV2 A;  2F35 A;  4KD5 A;  3VVF A;  2UVH A;  1YTV A;  1P1U A;  2VHA A;  2E0S A;  3TTN A;  3VV5 A;  1NH7 A;  3IB2 A;  2A5T A;  3SEX A;  2UVI A;  3HN0 A;  4H6D A;  2REG A;  4ESW A;  4R9G A;  1B05 A;  1GR2 A;  1IQ7 A;  4FED A;  4YKI A;  1OQH A;  1R1N A;  3E13 X;  5TP9 B;  1Y4T A;  2FYI A;  3CRB A;  3MBP A;  4H8I A;  4QFL A;  4LA9 A;  3TTL A;  3W9W A;  5ICT A;  1OLC A;  1Y1Z A;  4AQ4 A;  4IO6 A;  2I3W A;  3KFM A;  1IZ1 A;  4TLM B;  2Y7P A;  4ND9 A;  2O84 X;  4LVQ A;  4MH5 A;  3SEW A;  4ESX A;  1B7Z A;  1ZJL A;  2PX1 A;  4OWD A;  1ZU0 A;  3A3C A;  2HZK A;  2I0C A;  2G93 A;  3QYT A;  2X7P A;  3SEU A;  3T9U A;  1SYI A;  2I4B A;  3IR1 A;  1H3D A;  2M8C A;  2X26 A;  2P1S A;  4YMB A;  3UIF A;  4KYE A;  3K0V A;  3C9H A;  1N7W A;  4DDD A;  2ESN A;  3T9V A;  3IAZ A;  3K01 A;  1B5J A;  4FAJ A;  3I5O A;  1N3W A;  3OO7 A;  4NF5 A;  4GD5 A;  5EHS A;  1ZLQ A;  3O29 A;  4YU0 A;  1HSJ A;  1SD3 A;  3TKD A;  4ZEF A;  3O6I A;  2Z8D A;  3FIR A;  3PMW A;  3KBR A;  4ELO A;  3PUZ E;  4TLL B;  2OBG A;  4C1T A;  1SW1 A;  3OSQ A;  1UTB B;  3TQW A;  2DWI A;  3RGY A;  1US5 A;  3Q25 A;  5ITP A;  2A5S A;  3T22 A;  3FXQ A;  3H3G A;  2Q2A A;  4OES A;  1D9Y A;  2DVZ A;  1NNP A;  4GFR A;  1FTO A;  2QPQ A;  5CRY A;  1MG1 A;  3LUY A;  3THI A;  3IO6 A;  3H4Z A;  4GF8 A;  1PDA A;  4HCY A;  1FQD A;  4EF2 A;  3GBB A;  3N26 A;  4LUB A;  5A5X A;  4PFU A;  2Q8J A;  4YB5 A;  3RUM A;  1JEU A;  1USY H;  4G68 C;  1CB6 A;  2OWT A;  1P1N A;  5CM6 A;  3KN3 A;  1NMU A;  3SKP A;  5KDT B;  1FTL A;  3BFU A;  1UTH B;  5DVJ A;  5TPA B;  1LAH E;  4LZ7 A;  4OZ9 A;  4PFT A;  3PMV A;  3V89 B;  2VD3 A;  4QSE A;  3RQT A;  4NF4 A;  3OO9 A;  2XXR A;  1OVB A;  2Y7I A;  3E9X A;  3EHT A;  1POY 1;  4O3C A;  2H4I A;  5CBS A;  1MY1 A;  3K4U A;  3RTF B;  4XTC Q;  2DWJ A;  3K6W A;  4RPN A;  3RLF E;  5TU0 A;  4G77 A;  2Z22 A;  1PEB A;  2YJP A;  1FQE A;  3PPN A;  5I2K A;  4KCD A;  2Q2C A;  3KN8 A;  4GVO A;  1IXC A;  2DXY A;  3TEP A;  4Q0C A;  2VOZ A;  1NNK A;  1R6Z A;  3IB0 A;  1NNT A;  3LR1 A;  4ZEB A;  3R26 A;  1HSE A;  4POX A;  2Y7W A;  2O1M A;  3L6H A;  5AA4 B;  4H8J A;  2I4C A;  2IEE A;  2XX9 A;  4AB6 A;  4FE8 A;  1SBP A;  5H8F B;  1B3L A;  1SYH A;  3O97 A;  2XX8 A;  3MP1 A;  1KWH A;  4KCC A;  2XXX A;  3TTK A;  3U92 A;  4BDO A;  4U4X A;  1S7Y A;  3DP4 A;  2Q89 A;  1BLF A;  4THI A;  4PET A;  4X1B A;  1FQF A;  3IOV A;  5DEX A;  4GXA A;  3H6W A;  3B7D A;  1MY4 A;  1N76 A;  4N07 A;  4ZDM A;  5JTY B;  1L5T A;  3PUV E;  2GHB A;  3E3K A;  5KZT A;  4IO5 A;  1T0K A;  4F1V A;  1Y3Q A;  1LFH A;  4OEN A;  3UN6 A;  3KEI A;  4G8M A;  3TQL A;  3QIM A;  1VSO A;  3V5A A;  4KR5 A;  1DPE A;  1MQD A;  1MQJ A;  4NED A;  1JVY A;  2QSX A;  5I2N B;  2F7A A;  2B3F A;  3S9E A;  4PFY A;  3IOR A;  4OTE A;  2O68 A;  5FTH A;  3DP8 A;  1IIW A;  2VGQ A;  2RCA A;  4BLA A;  1MH4 A;  4F29 A;  1VFD A;  1ANF A;  3KJ7 A;  3G3G A;  4IO4 A;  4R6K A;  2ZNS A;  2YPN A;  1TWY A;  2ZYK A;  4LON B;  4NF8 B;  1URG A;  4DCY A;  1O63 A;  1JW5 A;  3DM0 A;  3G3K A;  4DZ1 A;  4X48 A;  1B0H A;  2XXH A;  5I56 A;  5I59 A;  4MF3 A;  5KCJ A;  2F7B A;  1ZBM A;  3C33 A;  1M5B A;  4IB2 A;  5H8N B;  5CMM A;  4OHN A;  3SEV A;  4F2O A;  1BIY A;  3ZSF A;  1CE2 A;  3CI8 A;  1DMB A;  3DEL B;  1H44 A;  1H45 A;  3KSX A;  1LGB C;  1MXZ A;  1ZKB A;  3MVZ A;  3RTW B;  3MQ9 A;  3A09 A;  2B3B A;  4M1V A;  5FHO A;  3VFJ A;  2XXU A;  3LBS A;  3IO4 A;  1XHY A;  4ZE9 A;  2F36 A;  2LAO A;  1MPD A;  3S9M C;  1SDX A;  5CI5 A;  3SDF A;  4KFQ A;  3SET A;  2GRV A;  5AA1 A;  4IGT A;  5LOM A;  5JK4 A;  5DVI A;  2XXT A;  1FW0 A;  3C32 A;  1D9V A;  3D4C A;  1GTK A;  1XOC A;  1OVT A;  1B5H A;  2XXI A;  2ZNU A;  2RC8 A;  3QUF A;  3USD A;  3OSR A;  1URD A;  4ZEC A;  4H1X A;  1TFD A;  4Q8R A;  4C1U A;  4R2B A;  3VVD A;  4RXL A;  4NWC A;  4DXB A;  5I58 A;  2OWS A;  1O7T A;  3H6V A;  4PQJ A;  4FIM A;  2HXW A;  4DXC A;  4YMA A;  1S9T A;  5I57 B;  4R73 A;  3LSF B;  4GWO A;  1N3X A;  1MQG A;  4LAT A;  3TCH A;  4R74 A;  5CMC A;  4Q5T A;  4G8H A;  1A55 A;  4X1D A;  2QS2 A;  5TP9 A;  2PT2 A;  5H8H B;  2ZYN A;  3ODB A;  3MVY A;  5L8D A;  3T96 B;  1ZIU A;  4FAT A;  4DXU A;  3RN8 A;  1WOD A;  1B1H A;  4HW8 A;  2ALU A;  3HHF A;  3V83 A;  4N6P A;  1WVJ A;  1RYX A;  4EDP A;  4ELP A;  1B52 A;  4XXU A;  4TOZ A;  1XT8 A;  1ZTY A;  4HTG A;  4WEP A;  1XC1 A;  3ZS6 A;  1Z7N E;  4GLI A;  1F9B A;  3Q27 A;  4O3B A;  1B7H A;  3EHU A;  3JYR A;  1Y1M A;  3B6Q A;  4BDR A;  4ZS9 A;  1YAE A;  4Z0I A;  2NOO A;  2F6P A;  1I6Q A;  4I9D A;  3RT6 B;  4R72 A;  5DYH A;  2XX7 A;  4NF6 A;  4LP2 B;  4OEV A;  5CC2 A;  3S2V A;  1UTB A;  3VLV A;  3ECR A;  2F8D A;  4WXJ A;  3C31 A;  4RY1 A;  4TQU Q;  2OLB A;  2GHA A;  5I84 A;  2THI A;  1DOT A;  1JW1 A;  1MY2 A;  5FHM A;  1MQI A;  3RPW A;  3UOR A;  1EZ9 A;  4F3P A;  4JSD A;  2HAV A;  3MP8 A;  4IO3 A;  4E0W A;  3MPK A;  1QUK A;  3EQ1 A;  4NF5 B;  5J1D A;  1DSN A;  1Y9U A;  3CIJ A;  2OJT A;  4IY6 A;  2DS9 A;  4POW A;  3BBR A;  1QKA A;  3ZKL A;  2XXV A;  4QF9 A;  2UVJ A;  5KDT A;  5CMB A;  1SVX B;  1UTH A;  4NTL A;  5TPA A;  1XVX A;  3LSX A;  4KI0 E;  1PB7 A;  1R9Q A;  3K6V A;  3QXM A;  1B3G A;  3A3U A;  4JSO A;  1B6H A;  4BDN A;  5HM4 B;  4NE4 A;  4YKP A;  4G4P A;  4I8C A;  1MXV A;  5CBR A;  4DCX A;  4KYD A;  3Q26 A;  3H03 A;  5L9O A;  1POT A;  1ZMG A;  2XD3 A;  3HO7 A;  4BDM A;  3K6X A;  3KG2 A;  1FQA A;  4RPO A;  4OFO A;  2UXA A;  4JB7 A;  2PT1 A;  3N6U A;  4X9T A;  3G3J A;  2QS3 A;  2DXR A;  4G68 B;  1D4N A;  5K2X A;  2HAU A;  4OEU A;  2DQV A;  2O69 A;  3EHS A;  1NL5 A;  3QUJ A;  5L9S A;  5AA4 A;  5AA2 D;  1B4H A;  1SI0 A;  4H67 A;  5H8F A;  4I62 A;  5FTI A;  1PB9 A;  2YLN A;  4F39 A;  1US4 A;  1EZO A;  2P2A A;  4EQ9 A;  3FVK A;  4ISU A;  3Q28 A;  1A8E A;  2DVC A;  4GL8 A;  3IJX B;  3FUZ A;  3FJM A;  2V3U A;  4OER A;  1Y3P A;  1PB8 A;  2I49 A;  4XIG Q;  5JTY A;  3FAS A;  2ANJ A;  2RC7 A;  5EYF A;  1OQG A;  3PU5 A;  1N04 A;  1Y20 A;  4R6H A;  1IUD A;  1MH3 A;  1I6A A;  3MPL A;  2D21 A;  4F3G A;  1EZP A;  4JXI A;  2X7Q A;  3W9V A;  4KHZ E;  4OMB A;  4G8N A;  4K3F A;  3PD8 A;  4Q30 B;  3VE1 B;  1LFI A;  3HST A;  3UGW A;  5I2N A;  5JEI A;  3DP6 A;  1QW0 A;  3IX1 A;  1MM7 A;  3HHG A;  1MRP A;  3VXC A;  4GOT A;  2DE2 A;  1MXU A;  2F6G A;  1IEJ A;  1SQY A;  3TYH A;  2NWJ A;  5H8Q B;  4RYA A;  3RY3 A;  4LQ5 A;  1MPB A;  3FGS A;  1M5E A;  2WKY A;  5L9M A;  3PUY E;  3LC8 A;  4LZ5 A;  4KPT A;  4RJZ A;  4WKM A;  3VLU A;  5K2Y A;  3OMB A;  4NF8 A;  1N0T A;  3TFL A;  3TUS A;  3MVW A;  3HCQ A;  3IOW A;  4RA1 A;  2XXQ A;  1FQB A;  2UYF A;  2DWH A;  5F1Q A;  3O28 A;  4FOR A;  1N7X A;  2AL5 A;  3O6H A;  5H8N A;  3UK4 A;  4NWD A;  4UA8 A;  4M4G A;  2VD2 A;  3BFT A;  4JDF A;  5FHN A;  3TEL A;  4IY5 A;  2HQ0 A;  2Z8E A;  1IXI A;  2V3T A;  4F31 B;  4P0I A;  3FVO A;  4JWX A;  1H76 A;  2ZYM A;  3TPA A;  2V3Q A;  4JWY A;  4H65 A;  3OO8 A;  3U93 A;  4RK9 A;  1SW2 A;  1LBC A;  3H6U A;  2GFE A;  2R9J A;  1LST A;  2BJJ X;  5ELV A;  2O7I A;  5I56 B;  1LB9 A;  1URS A;  2RF1 A;  4F22 A;  3GXA A;  2UVG A;  2DYX A;  3G7W A;  3MAM A;  1FTJ A;  4IO2 A;  2HZL A;  4FEC A;  1A99 A;  5H8S A;  2ZNT A;  3IOU A;  3PGF A;  2QRY A;  1Y3N A;  1OMP A;  3B6T A;  4QSD A;  4ELQ A;  4QHQ A;  1M5F A;  1MM6 A;  3K6U A;  4RK2 A;  1N84 A;  4R9F A;  4ZZA A;  1LLS A;  2NXO A;  3EN3 A;  3OEM A;  1P1Q A;  2V25 A;  3TAJ A;  3O9P A;  2ONK E;  4ZEK A;  3LSW A;  5I57 A;  1SW4 A;  3N94 A;  3AXF A;  4G2Z A;  2H9B A;  2DSF A;  4F2Q A;  4F3S A;  1II5 A;  4EUO A;  3QSL A;  4BDQ A;  4EF1 A;  3FXR A;  5IAI A;  1TXF A;  1RYO A;  3K02 A;  1MXW A;  4IGR A;  4MBP A;  3M3F A;  3FD3 A;  4H5F A;  2O6A A;  2H98 A;  4LZ8 A;  1LB8 A;  3PPO A;  4U23 A;  4OXV A;  2ONR A;  3T66 A;  1EU8 A;  3MVX A;  3CSB A;  2O1L A;  3WAE A;  4XKN A;  3O66 A;  1SI1 A;  4OVJ A;  1NKX A;  3Q29 A;  2I6E A;  3EF7 A;  3PPP A;  3RT8 A;  3RNN A;  2XXW A;  3KZG A;  4FJP A;  1OLA A;  3MC2 A;  3B6W A;  3ILT B;  1M5C A;  2OZZ A;  3TMG A;  2AL4 A;  3H06 B;  4EQ7 A;  5AA2 B;  1ELJ A;  3CFL A;  5AE4 A;  4ZE8 A;  1JET A;  2QJE A;  3FZV A;  1IXG A;  4ELR A;  4H0W A;  3GZG A;  5AA3 A;  3IK6 B;  1JEV A;  3M3K A;  1AMF A;  3SEY A;  3TDJ A;  3I6V A;  2PBW A;  4IO7 A;  3U72 A;  1AIV A;  2I0B A;  3T9X B;  3PD9 A;  3CFZ A;  3IJO B;  1OIB A;  4QRZ A;  1WDN A;  3GLB A;  2RIN A;  2A5T B;  2F97 A;  4U1Z A;  3FAT A;  2D3I A;  4KQP A;  1B32 A;  2E1S A;  4E0X A;  1UIU A;  1O64 A;  1VE4 A;  3CG3 A;  5M2V A;  2PVU A;  2O7U A;  3O6G A;  1Z7M E;  3OEN A;  4EQB A;  1NFT A;  3QK6 A;  1GV8 A;  2FA7 A;  1MDP 1;  1EH3 A;  2ZMB A;  3OEL A;  1BP5 A;  1USY E;  3KN7 A;  1QUJ A;  4U1O A;  1ATG A;  5EHM A;  3FJ7 A;  4YKJ A;  2AIX A;  3OEK A;  4ZZE A;  1AOV A;  4MFI A;  1A7L A;  4GXS B;  1B2H A;  4GQO A;  3MW0 A;  4U21 A;  2OCU A;  3TTM A; 
#chains in the Genus database with same CATH topology
 4F1U A;  1B40 A;  1FBG A;  1LBW A;  1B4Z A;  4NF6 B;  3T93 B;  3S9N C;  5B7D A;  3P7I A;  4R75 A;  4QFO A;  3C34 A;  4I1D A;  2HEU A;  1BTJ A;  1QUL A;  3C36 A;  3GBA A;  4GRK A;  4L17 A;  4QFP A;  2QS4 A;  2PMS A;  3MP6 A;  2Z23 A;  2I48 A;  4O3A A;  1MY0 A;  3I3V A;  2WBD A;  4DI4 B;  3FV1 A;  4JWO A;  1RDZ A;  3MZ1 A;  4DE8 A;  2VP1 A;  3IB1 A;  4LQ2 A;  4QFN A;  5F24 A;  3WAF A;  2DWA A;  1VFE A;  2HCA A;  1FBP A;  1QVS A;  3FVN A;  4HE0 A;  1D3K A;  2QS1 A;  1B3E A;  4OQO A;  3VXB A;  2DDK A;  4KYS A;  4HCW A;  1IXH A;  4ZED A;  4QFK A;  4WED A;  1FQC A;  4R2F A;  3OOA A;  4PGP A;  4BDL A;  2Q9T A;  4GWX A;  2RCB A;  3K1N A;  2DE3 A;  1YCJ A;  2Q8M A;  2FVZ A;  5CMK A;  1UQW A;  4P47 A;  5A5X B;  2RC9 A;  3C35 A;  3M3L A;  4GIZ A;  2H25 A;  4G68 A;  4YZZ A;  3U94 A;  3IL1 B;  3C4M A;  1SW5 A;  4YIC A;  4UAC A;  1S50 A;  5HPQ A;  3U1O A;  3F11 A;  4ONY A;  4PE3 A;  1B9J A;  5ICQ A;  4EXK A;  1JW4 A;  2B65 A;  3MUQ A;  2V93 A;  1FTK A;  1A8F A;  4NF4 B;  3FXU A;  3VVE A;  4MHF A;  4PAK A;  2UYE A;  1UIV A;  5ITO A;  3S4U A;  5IKB A;  4XKR A;  1QKB A;  1YPN A;  2G29 A;  3R7X A;  2RKM A;  2W7Y A;  1GVC A;  4YB7 A;  3FJG A;  1FBF A;  4P11 A;  1IMB A;  3KOS A;  1LCT A;  1K9Z A;  2FNC A;  2DOJ A;  3OXN A;  1P1O A;  2QFL A;  2F3B A;  4N17 A;  2XXY A;  1B3H A;  3S9L C;  3PPQ A;  1Y4C A;  5I2K B;  2HFB A;  5DT6 A;  2I3V A;  2FIE A;  1B0L A;  1MQH A;  2ZXT A;  2V84 A;  1FJ6 A;  3HPI A;  5DVF A;  2Q88 A;  1AH5 A;  3CR9 A;  3W15 C;  1DTG A;  4JBZ A;  2QMW A;  3MZB A;  2D5W A;  3TZA A;  4OFL A;  4PP0 A;  2P3V A;  4GWW A;  2NUV A;  1MY3 A;  1MS7 A;  1TFA A;  1MXX A;  1MPC A;  2QMX A;  2R6G E;  3PUX E;  4OET A;  3V8X B;  1IMD A;  3FVG A;  3VDF A;  1NNF A;  3U8Q A;  3KC1 A;  2F34 A;  1JVX A;  2ZZW A;  3FBP A;  5BWJ A;  3CG1 A;  3MZ9 A;  1NH8 A;  4PE5 B;  3CSG A;  3SER A;  4R6Y A;  2H99 A;  1B51 A;  5H8Q A;  3GYY A;  4N13 A;  3PPR A;  3TTR A;  4F1Y A;  3ONM A;  2NVU B;  4GWZ A;  3K2D A;  4OVR A;  4ZEI A;  2CMO A;  4P8B A;  3IOT A;  4AS4 A;  3FXB A;  1J1N A;  2AYS A;  1RKM A;  1I69 A;  4DLD A;  2DE4 A;  1HSL A;  5DEX B;  3T9H B;  2P0S A;  3LSL A;  1IIT A;  2KLF A;  2ABH A;  5ISU A;  4X8R A;  3TOD A;  2PFZ A;  2CZL A;  1A54 A;  1DPP A;  2I58 A;  2PYY A;  2Y7R A;  3D4G A;  3EKI A;  4C0R A;  1P99 A;  2H5Y A;  1LAX A;  3OO6 A;  2F5X A;  1B3F A;  1B5I A;  3UA8 A;  4XKQ A;  1M5D A;  2ONS A;  3H7M A;  3BKI B;  1FPL A;  3PV0 E;  1FTM A;  3TCF A;  3UP9 A;  4FEB A;  1XVY A;  1PBP A;  3CFX A;  1B58 A;  4F3B A;  3KGC A;  1LCF A;  1FPJ A;  4PTK A;  5EYH A;  3R6U A;  1BK4 A;  3PMX A;  1KZ8 A;  3MJN A;  1XS5 A;  3G3F A;  4XKP A;  2ZYO A;  1H43 A;  2XXP A;  4P56 A;  4MLV A;  1A40 A;  1DTZ A;  3TCG A;  4OYV A;  1Q35 A;  4P3L A;  3SES A;  1Q1K A;  3KJT A;  1GGG A;  2WYP A;  1NI9 A;  3B8B A;  3K00 A;  2REJ A;  4EXL A;  4U4S A;  3E4R A;  4Z7E A;  1B1X A;  4FBP A;  5HBC A;  3K1P A;  3HV1 A;  1JNF A;  1LFG A;  2Y7K A;  3VLW A;  5I59 B;  5KCJ B;  2XD2 A;  5DTB A;  2Z8F A;  4QBA A;  5B70 A;  1BKA A;  4PGN A;  2Y84 A;  3H6T A;  1AL3 A;  1IMF A;  4N15 A;  3CVG A;  4NMY A;  4OFJ A;  2OK2 A;  4NQ8 A;  4U2R A;  3DLN A;  3KOT A;  4GBW A;  3ROJ A;  4GL0 A;  3G3I A;  3EPE A;  1QUI A;  3O2A A;  5IZZ A;  4AS5 A;  2F7C A;  3PUW E;  1FBC A;  4QSC A;  4U22 A;  5BUU A;  2XHD A;  1P1W A;  4MLQ A;  3OD7 A;  1B7U A;  4RNS A;  1PBQ A;  4O94 A;  1B46 A;  3JZJ A;  1PC3 A;  4YAH X;  1I6B A;  5F7V A;  2QL3 A;  1MXY A;  2WX9 A;  3ZKK A;  4AB5 A;  3ILU B;  3K1M A;  1R9L A;  1VR5 A;  4YB6 A;  1LAF E;  4F19 A;  2R71 A;  4N81 A;  3NOH A;  2GH9 A;  1MDQ A;  1VDW A;  1JQF A;  3BIH A;  3KSJ A;  1NV6 A;  1TT1 A;  4P0G A;  3N5L A;  2CZH A;  1FCK A;  2XWO A;  4OVS A;  1LAG E;  4DIG A;  5H8H A;  3JV9 A;  3L6G A;  2IA4 A;  4F18 A;  2O51 A;  3M8U A;  3LV0 A;  1QJM A;  1LBB A;  5AA2 A;  3QAX A;  4PFW A;  2DP8 A;  5I58 B;  2F78 A;  4H5G A;  4ECF A;  3N6T A;  3G3H A;  4YKK A;  4HS7 A;  3MWB A;  3FV2 A;  3KBZ A;  2F35 A;  4MIJ A;  4KD5 A;  3VVF A;  2UVH A;  1YTV A;  1P1U A;  5ET8 A;  2VHA A;  2E0S A;  3TTN A;  3VV5 A;  4QXD A;  1G0I A;  1NH7 A;  3IB2 A;  4KXP A;  2A5T A;  3SEX A;  2UVI A;  3HN0 A;  4H6D A;  2REG A;  4ESW A;  4R9G A;  1NV0 A;  1B05 A;  1JP4 A;  1GR2 A;  4JVD A;  1IQ7 A;  4FED A;  4YKI A;  1OQH A;  1R1N A;  3E13 X;  5TP9 B;  1Y4T A;  2FYI A;  3CRB A;  3MBP A;  2B4L A;  4H8I A;  4QFL A;  4LA9 A;  3TTL A;  4PAF A;  3W9W A;  5ICT A;  1OLC A;  1Y1Z A;  5IZ3 A;  4AQ4 A;  4IO6 A;  2L5V A;  2I3W A;  3KFM A;  1IZ1 A;  2PFY A;  4TLM B;  2Y7P A;  4ND9 A;  2O84 X;  4LVQ A;  4MH5 A;  3SEW A;  3HFU A;  4ESX A;  1B7Z A;  1ZJL A;  2PX1 A;  4OWD A;  1ZU0 A;  4X04 A;  1DCU A;  3A3C A;  2HZK A;  3ISP A;  2I0C A;  2G93 A;  3QYT A;  2QVU A;  2X7P A;  3SEU A;  3T9U A;  1SYI A;  2I4B A;  3IR1 A;  1QGX A;  1H3D A;  2M8C A;  2X26 A;  2P1S A;  4YMB A;  3UIF A;  4KYE A;  3K0V A;  3C9H A;  4MNI A;  1N7W A;  4DDD A;  2ESN A;  4NF0 A;  5EYG A;  3T9V A;  3IAZ A;  3K01 A;  1B5J A;  4FAJ A;  3I5O A;  1N3W A;  3OO7 A;  4NF5 A;  4GD5 A;  5EHS A;  1ZLQ A;  3O29 A;  4YU0 A;  5ET6 A;  1HSJ A;  4PFB A;  1SD3 A;  3TKD A;  4ZEF A;  3O6I A;  5I5P A;  2Z8D A;  3FIR A;  3PMW A;  4NX1 A;  1RDY A;  3KBR A;  4ELO A;  3PUZ E;  4XFE A;  4TLL B;  2OBG A;  4C1T A;  1SW1 A;  3MYU A;  3OSQ A;  1UTB B;  3TQW A;  2DWI A;  3RGY A;  1US5 A;  5EQ8 A;  3Q25 A;  5ITP A;  2A5S A;  3T22 A;  3FXQ A;  3H3G A;  4MAG A;  2Q2A A;  4OES A;  1D9Y A;  2DVZ A;  1NNP A;  4GFR A;  1FTO A;  2QPQ A;  5CRY A;  4PF8 A;  1MG1 A;  3LUY A;  3THI A;  3IO6 A;  1FPF A;  3H4Z A;  4GF8 A;  1PDA A;  4HCY A;  1FQD A;  2VPN A;  4EF2 A;  4OAN A;  1NV1 A;  3GBB A;  3N26 A;  4LUB A;  5A5X A;  4PFU A;  2Q8J A;  4YB5 A;  3RUM A;  1FPD A;  1JEU A;  1USY H;  4G68 C;  1CB6 A;  2OWT A;  1P1N A;  5CM6 A;  3KN3 A;  5LDZ A;  1NMU A;  3SKP A;  5KDT B;  1FTL A;  3BFU A;  1UTH B;  5DVJ A;  5TPA B;  1LAH E;  1FBE A;  4LZ7 A;  4OZ9 A;  4PFT A;  3PMV A;  3V89 B;  2VD3 A;  1LBV A;  4QSE A;  3RQT A;  4NF4 A;  3OO9 A;  2XXR A;  1OVB A;  2Y7I A;  3E9X A;  3EHT A;  5IZ1 A;  1POY 1;  4O3C A;  2H4I A;  5CBS A;  1MY1 A;  3K4U A;  3RTF B;  4XTC Q;  2DWJ A;  3K6W A;  4RPN A;  1LBY A;  3RLF E;  5TU0 A;  4G77 A;  2Z22 A;  1PEB A;  5EQA A;  4I3E A;  1FPK A;  2YJP A;  1FQE A;  3PPN A;  5I2K A;  4KCD A;  4GBV A;  2Q2C A;  3KN8 A;  4GVO A;  1IXC A;  2DXY A;  3TEP A;  4Q0C A;  4DI3 D;  2VOZ A;  1NNK A;  4NGU A;  1R6Z A;  3IB0 A;  1NNT A;  3LR1 A;  4ZEB A;  3R26 A;  1HSE A;  4POX A;  2Y7W A;  2O1M A;  4N91 A;  3L6H A;  4MNP A;  5AA4 B;  1Q9D A;  2QVV A;  4GWU A;  4H8J A;  2I4C A;  2IEE A;  2XX9 A;  4O8M A;  4AB6 A;  4FE8 A;  1NV7 A;  1SBP A;  5H8F B;  2XWK A;  1B3L A;  5EQ7 A;  1SYH A;  3O97 A;  5J16 A;  2XX8 A;  3MP1 A;  1KWH A;  1FBH A;  4KCC A;  2XXX A;  3TTK A;  3U92 A;  4BDO A;  4U4X A;  1S7Y A;  3B50 A;  3DP4 A;  3E79 A;  2Q89 A;  1BLF A;  2GQ1 A;  4THI A;  4PET A;  4X1B A;  1FQF A;  3IOV A;  5DEX A;  2KQZ A;  4GXA A;  3H6W A;  3B7D A;  1MY4 A;  4I40 A;  1N76 A;  4N07 A;  4ZDM A;  4NAP A;  5JTY B;  1L5T A;  3PUV E;  2OX3 A;  2GHB A;  3E3K A;  5KZT A;  4IO5 A;  1T0K A;  1IMA A;  4F1V A;  1Y3Q A;  1LFH A;  4OEN A;  3UN6 A;  3KEI A;  4G8M A;  3TQL A;  2ZZV A;  1NV3 A;  4PCD A;  3QIM A;  1VSO A;  3V5A A;  4KR5 A;  1DPE A;  1MQD A;  1MQJ A;  4NED A;  1JVY A;  2QSX A;  5I2N B;  2F7A A;  2B3F A;  3S9E A;  2BJI A;  4PFY A;  3IOR A;  4OTE A;  2O68 A;  5FTH A;  3DP8 A;  4OVP A;  2B4M A;  1YXI A;  1IIW A;  2VGQ A;  2RCA A;  4BLA A;  1MH4 A;  4F29 A;  1VFD A;  1ANF A;  3KJ7 A;  3G3G A;  4IO4 A;  4NN3 A;  1K9Y A;  4R6K A;  3RPL B;  2ZNS A;  1FBD A;  2YPN A;  4MEV A;  1TWY A;  2ZYK A;  4LON B;  4NF8 B;  1URG A;  2WEF A;  4DCY A;  1O63 A;  1JW5 A;  3DM0 A;  3G3K A;  4DZ1 A;  4X48 A;  1DBZ A;  4PBH A;  1B0H A;  2XXH A;  5I56 A;  5I59 A;  4MF3 A;  5KCJ A;  2F7B A;  1ZBM A;  3C33 A;  1M5B A;  4PF6 A;  1XI6 A;  4IB2 A;  2FHY A;  5H8N B;  5CMM A;  4OHN A;  2XA5 A;  3E78 A;  3SEV A;  4F2O A;  1BIY A;  3ZSF A;  1CE2 A;  3CI8 A;  1DMB A;  2Q74 A;  3DEL B;  1H44 A;  1H45 A;  3KSX A;  1LGB C;  1MXZ A;  1ZKB A;  3MVZ A;  1FPG A;  3RTW B;  3MQ9 A;  3A09 A;  2B3B A;  4M1V A;  4GX4 A;  4PDH A;  5FHO A;  3VFJ A;  2XXU A;  3LBS A;  4OVT A;  3IO4 A;  1XHY A;  4ZE9 A;  4PBQ A;  2F36 A;  2LAO A;  1MPD A;  3S9M C;  1SDX A;  5CI5 A;  4N8G A;  3SDF A;  4MMP A;  4KFQ A;  3SET A;  2GRV A;  2KR0 A;  2VT5 A;  5AA1 A;  4IGT A;  5LOM A;  5JK4 A;  5DVI A;  2XXT A;  1FW0 A;  3C32 A;  5IGA A;  1D9V A;  3D4C A;  1AWB A;  4MX6 A;  1GTK A;  1OVT A;  1XOC A;  4HXV A;  4JVI A;  1B5H A;  5EQ9 A;  2XXI A;  2ZNU A;  2RC8 A;  3QUF A;  3USD A;  3SZP A;  3OSR A;  1URD A;  4ZEC A;  4H1X A;  1TFD A;  4Q8R A;  4C1U A;  5ET7 A;  3BIG A;  3T0J A;  4R2B A;  3VVD A;  4RXL A;  4NWC A;  4OVQ A;  4DXB A;  5I58 A;  2OWS A;  2CEY A;  1O7T A;  4GX3 A;  3H6V A;  4PQJ A;  4FIM A;  2HXW A;  3U65 A;  4DXC A;  4MCO A;  4YMA A;  1S9T A;  5I57 B;  4R73 A;  3LSF B;  4GWO A;  4N6D A;  1N3X A;  1MQG A;  1FPI A;  5ET5 A;  4LAT A;  4O7I A;  3TCH A;  4R74 A;  5CMC A;  4Q5T A;  1FTA A;  4G8H A;  4PC9 A;  1A55 A;  4X1D A;  2QS2 A;  5TP9 A;  2VPO A;  2PT2 A;  1EYK A;  5H8H B;  2ZYN A;  3ODB A;  3MVY A;  5L8D A;  3T96 B;  1ZIU A;  4FAT A;  4DXU A;  3RN8 A;  1WOD A;  1B1H A;  4HW8 A;  1LBZ A;  2ALU A;  3HHF A;  3V83 A;  4N6P A;  3A29 A;  1WVJ A;  2P3N A;  1RYX A;  4GWY A;  4OA4 A;  4EDP A;  4ELP A;  4GWS A;  1B52 A;  4XXU A;  4TOZ A;  1XT8 A;  1ZTY A;  4HTG A;  4WEP A;  4XEQ A;  1XC1 A;  3ZS6 A;  2QVR A;  1Z7N E;  4GLI A;  4MNC A;  1F9B A;  3Q27 A;  4O3B A;  1B7H A;  3EHU A;  3JYR A;  1Y1M A;  3B6Q A;  4O7M A;  4P9K A;  1DK4 A;  4BDR A;  4ZS9 A;  1YAE A;  4Z0I A;  2NOO A;  4NHB A;  2F6P A;  1I6Q A;  4I9D A;  3RT6 B;  4R72 A;  5DYH A;  2XX7 A;  1FJ9 A;  2CZK A;  4NF6 A;  1LBX A;  2HXR A;  4LP2 B;  4OEV A;  5IM2 A;  5CC2 A;  1CNQ A;  3MST A;  3S2V A;  1UTB A;  3VLV A;  3ECR A;  5ESY A;  2F8D A;  4WXJ A;  3C31 A;  4RY1 A;  4NG7 A;  3PTY A;  4TQU Q;  2OLB A;  1FSA A;  2GHA A;  5I84 A;  2THI A;  1DOT A;  1JW1 A;  1MY2 A;  5FHM A;  1MQI A;  3RPW A;  3UOR A;  1EZ9 A;  4F3P A;  4JSD A;  2HAV A;  3MP8 A;  4IO3 A;  4E0W A;  3MPK A;  1QUK A;  3EQ1 A;  4NF5 B;  5J1D A;  1DSN A;  1Y9U A;  3CIJ A;  2OJT A;  4IY6 A;  2DS9 A;  4POW A;  3BBR A;  1QKA A;  3ZKL A;  2XXV A;  4QF9 A;  2CEX A;  2UVJ A;  5KDT A;  5CMB A;  1SVX B;  1UTH A;  4NTL A;  5TPA A;  1XVX A;  3LSX A;  4KI0 E;  1PB7 A;  1R9Q A;  1IMC A;  3K6V A;  3QXM A;  2OWZ A;  4N6K A;  1B3G A;  2CZI A;  3QMF A;  3A3U A;  4JSO A;  1B6H A;  3IFA A;  4BDN A;  5HM4 B;  4NE4 A;  4YKP A;  4G4P A;  4I8C A;  1MXV A;  5CBR A;  4DCX A;  4N4U A;  2MKZ A;  4KYD A;  3LUZ A;  3Q26 A;  3H03 A;  4HE1 A;  5L9O A;  1POT A;  1ZMG A;  4P1E A;  2XD3 A;  3HO7 A;  4BDM A;  3K6X A;  3KG2 A;  1FQA A;  4RPO A;  4OFO A;  2WBB A;  2UXA A;  4JB7 A;  2PT1 A;  3N6U A;  4X9T A;  3G3J A;  2QS3 A;  2DXR A;  4G68 B;  1D4N A;  2HHM A;  5K2X A;  2HAU A;  4OEU A;  2DQV A;  2O69 A;  3EHS A;  1NL5 A;  3QUJ A;  5L9S A;  4HE2 A;  1KA1 A;  5AA4 A;  5AA2 D;  1B4H A;  2F3D A;  5FBP A;  1SI0 A;  3IFC A;  4H67 A;  5H8F A;  4I62 A;  2XWI A;  5FTI A;  2XWV A;  1PB9 A;  2YLN A;  4F39 A;  1US4 A;  1EZO A;  2P2A A;  4EQ9 A;  3FVK A;  4ISU A;  2FBP A;  3Q28 A;  4PFI A;  1A8E A;  2DVC A;  4GL8 A;  3IJX B;  3FUZ A;  3FJM A;  1FPB A;  4XF5 A;  2V3U A;  4OER A;  1FRP A;  1Y3P A;  1FPE A;  1PB8 A;  2I49 A;  4XIG Q;  5JTY A;  3FAS A;  2ANJ A;  2RC7 A;  5EYF A;  4H45 A;  2XXK A;  1OQG A;  3PU5 A;  1N04 A;  1Y20 A;  4R6H A;  1IUD A;  1MH3 A;  1I6A A;  3MPL A;  2D21 A;  4F3G A;  1EZP A;  4JXI A;  2X7Q A;  3W9V A;  4KHZ E;  4OMB A;  4G8N A;  2ZZX A;  1G0H A;  4K3F A;  3PD8 A;  4P1L A;  4Q30 B;  4LN5 A;  1RDX A;  3VE1 B;  1LFI A;  3RYD A;  3HST A;  3UGW A;  5I2N A;  5JEI A;  3DP6 A;  1QW0 A;  3IX1 A;  1MM7 A;  1NUZ A;  3HHG A;  1MRP A;  3VXC A;  4GOT A;  2DE2 A;  1MXU A;  2F6G A;  1IEJ A;  1SQY A;  3TYH A;  2NWJ A;  5H8Q B;  4RYA A;  3RY3 A;  4LQ5 A;  1MPB A;  1NUY A;  3FGS A;  1M5E A;  2WKY A;  1NUW A;  1SPI A;  3RPL A;  4JVC A;  5L9M A;  3PUY E;  3LC8 A;  4LZ5 A;  1YYZ A;  4KPT A;  4RJZ A;  4WKM A;  3VLU A;  5K2Y A;  3OMB A;  4NF8 A;  1N0T A;  3TFL A;  3TUS A;  5DW8 A;  3MVW A;  3HCQ A;  3IOW A;  5A5L A;  1NUX A;  5T3J A;  4RA1 A;  2XXQ A;  1FQB A;  2UYF A;  2DWH A;  1D9Q A;  4IR8 A;  5F1Q A;  3O28 A;  4FOR A;  1N7X A;  2AL5 A;  3O6H A;  5H8N A;  3UK4 A;  4NWD A;  4UA8 A;  4M4G A;  2VD2 A;  3BFT A;  4JDF A;  5FHN A;  3TEL A;  4IY5 A;  4PAI A;  2HQ0 A;  2Z8E A;  1IXI A;  2V3T A;  4F31 B;  4P0I A;  3FVO A;  4JWX A;  1H76 A;  2ZYM A;  3TPA A;  2V3Q A;  4JWY A;  4H65 A;  3OO8 A;  1IME A;  3U93 A;  4RK9 A;  1SW2 A;  1LBC A;  3H6U A;  2GFE A;  2R9J A;  1LST A;  2BJJ X;  5ELV A;  1EYJ A;  2O7I A;  1INP A;  1KA0 A;  5I56 B;  1LB9 A;  1URS A;  2RF1 A;  4F22 A;  3GXA A;  2UVG A;  2DYX A;  3G7W A;  2R8T A;  3MAM A;  1FTJ A;  4IO2 A;  5I7I A;  2HZL A;  3KC0 A;  4FEC A;  1A99 A;  5H8S A;  2ZNT A;  3IOU A;  3PGF A;  2QRY A;  1Y3N A;  1OMP A;  4G61 A;  3B6T A;  4QSD A;  4ELQ A;  2Y5K A;  4QHQ A;  1M5F A;  1MM6 A;  3K6U A;  4RK2 A;  1N84 A;  4R9F A;  4I3Y A;  4ZZA A;  1LLS A;  4PFR A;  2NXO A;  3EN3 A;  3OEM A;  4GX6 A;  1P1Q A;  2V25 A;  3TAJ A;  3O9P A;  2ONK E;  4ZEK A;  3LSW A;  5I57 A;  1SW4 A;  3N94 A;  3AXF A;  4G2Z A;  2H9B A;  2DSF A;  4F2Q A;  4F3S A;  1II5 A;  4EUO A;  3QSL A;  4BDQ A;  4EF1 A;  3FXR A;  5IAI A;  1TXF A;  1RYO A;  3K02 A;  1MXW A;  4IGR A;  4MBP A;  3M3F A;  5LTC A;  3FD3 A;  1YZ0 A;  4H5F A;  5I3S A;  2O6A A;  1NV5 A;  3CHG A;  2H98 A;  4LZ8 A;  1LB8 A;  1NV4 A;  3PPO A;  4U23 A;  4OXV A;  2ONR A;  3T66 A;  1NV2 A;  1EU8 A;  3MVX A;  3CSB A;  2JJK A;  2O1L A;  3WAE A;  4XKN A;  3O66 A;  1SI1 A;  4OVJ A;  1NKX A;  3Q29 A;  2I6E A;  3EF7 A;  3PPP A;  3RT8 A;  3RNN A;  2XXW A;  3KZG A;  4FJP A;  1OLA A;  3MC2 A;  3B6W A;  3ILT B;  1M5C A;  2HPG A;  2OZZ A;  4N8Y A;  3TMG A;  2WYK A;  2AL4 A;  3H06 B;  4EQ7 A;  5AA2 B;  4PDD A;  1ELJ A;  3CFL A;  5AE4 A;  4ZE8 A;  1JET A;  2QJE A;  3FZV A;  1IXG A;  2V4C A;  4ELR A;  4H0W A;  3GZG A;  5AA3 A;  3IK6 B;  1JEV A;  3M3K A;  1AMF A;  3SEY A;  3TDJ A;  3I6V A;  2PBW A;  4IO7 A;  3U72 A;  1AIV A;  2I0B A;  3T9X B;  3PD9 A;  3CFZ A;  3IJO B;  1OIB A;  4QRZ A;  1WDN A;  3GLB A;  2RIN A;  2A5T B;  2F97 A;  4U1Z A;  3FAT A;  2D3I A;  4H46 A;  4KQP A;  1B32 A;  2E1S A;  4E0X A;  1UIU A;  1O64 A;  1VE4 A;  3CG3 A;  5M2V A;  2PVU A;  2FIX A;  2O7U A;  3O6G A;  4MJO A;  1Z7M E;  3OEN A;  2Y5L A;  4EQB A;  1NFT A;  3QK6 A;  1GV8 A;  5IZ3 B;  4UAB A;  3D1R A;  2FA7 A;  1MDP 1;  1EH3 A;  2ZMB A;  1EYI A;  3OEL A;  1BP5 A;  1USY E;  4U1O A;  1QUJ A;  3KN7 A;  1ATG A;  5EHM A;  3FJ7 A;  1LEV A;  4YKJ A;  2AIX A;  3OEK A;  4ZZE A;  1AOV A;  4MFI A;  1A7L A;  4GXS B;  1B2H A;  4GQO A;  3MW0 A;  3T1B A;  4U21 A;  2OCU A;  3TTM A;  2PCR A; 
#chains in the Genus database with same CATH homology
 4F1U A;  1B40 A;  1B4Z A;  4NF6 B;  3T93 B;  3S9N C;  5B7D A;  3P7I A;  4R75 A;  4QFO A;  3C34 A;  4I1D A;  2HEU A;  1BTJ A;  1QUL A;  3C36 A;  3GBA A;  4GRK A;  4L17 A;  4QFP A;  2QS4 A;  2PMS A;  3MP6 A;  2Z23 A;  2I48 A;  4O3A A;  1MY0 A;  3I3V A;  3FV1 A;  4JWO A;  3MZ1 A;  4DE8 A;  2VP1 A;  3IB1 A;  4LQ2 A;  4QFN A;  3WAF A;  2DWA A;  1VFE A;  2HCA A;  1QVS A;  3FVN A;  1D3K A;  2QS1 A;  1B3E A;  4OQO A;  3VXB A;  4KYS A;  4HCW A;  1IXH A;  4ZED A;  4QFK A;  4WED A;  1FQC A;  4R2F A;  3OOA A;  4BDL A;  2Q9T A;  2RCB A;  3K1N A;  2DE3 A;  1YCJ A;  5CMK A;  1UQW A;  5A5X B;  2RC9 A;  3C35 A;  3M3L A;  4GIZ A;  2H25 A;  4G68 A;  4YZZ A;  3U94 A;  3IL1 B;  3C4M A;  1SW5 A;  4YIC A;  4UAC A;  1S50 A;  5HPQ A;  3U1O A;  3F11 A;  4ONY A;  1B9J A;  5ICQ A;  4EXK A;  1JW4 A;  2B65 A;  3MUQ A;  2V93 A;  1FTK A;  1A8F A;  4NF4 B;  3FXU A;  3VVE A;  2UYE A;  1UIV A;  5ITO A;  3S4U A;  5IKB A;  4XKR A;  1QKB A;  1YPN A;  2G29 A;  3R7X A;  2RKM A;  2W7Y A;  1GVC A;  4YB7 A;  3FJG A;  4P11 A;  3KOS A;  1LCT A;  2FNC A;  2DOJ A;  3OXN A;  1P1O A;  2XXY A;  1B3H A;  3S9L C;  3PPQ A;  1Y4C A;  5I2K B;  2HFB A;  5DT6 A;  2I3V A;  1B0L A;  1MQH A;  2ZXT A;  2V84 A;  3HPI A;  5DVF A;  2Q88 A;  1AH5 A;  3CR9 A;  3W15 C;  1DTG A;  4JBZ A;  2QMW A;  3MZB A;  2D5W A;  3TZA A;  4OFL A;  4PP0 A;  2NUV A;  1MY3 A;  1MS7 A;  1TFA A;  1MXX A;  1MPC A;  2QMX A;  2R6G E;  3PUX E;  4OET A;  3V8X B;  3FVG A;  3VDF A;  1NNF A;  3U8Q A;  2F34 A;  1JVX A;  5BWJ A;  3CG1 A;  3MZ9 A;  1NH8 A;  4PE5 B;  3CSG A;  3SER A;  4R6Y A;  2H99 A;  1B51 A;  5H8Q A;  4N13 A;  3PPR A;  3TTR A;  4F1Y A;  3ONM A;  2NVU B;  3K2D A;  4ZEI A;  2CMO A;  3IOT A;  1J1N A;  2AYS A;  1RKM A;  1I69 A;  4DLD A;  2DE4 A;  1HSL A;  5DEX B;  3T9H B;  2P0S A;  3LSL A;  1IIT A;  2KLF A;  2ABH A;  5ISU A;  3TOD A;  2CZL A;  1A54 A;  1DPP A;  2I58 A;  2PYY A;  2Y7R A;  3D4G A;  4C0R A;  1P99 A;  2H5Y A;  1LAX A;  3OO6 A;  2F5X A;  1B3F A;  1B5I A;  3UA8 A;  4XKQ A;  1M5D A;  2ONS A;  3H7M A;  3BKI B;  3PV0 E;  1FTM A;  3TCF A;  3UP9 A;  4FEB A;  1XVY A;  1PBP A;  3CFX A;  1B58 A;  4F3B A;  3KGC A;  1LCF A;  3R6U A;  3PMX A;  3MJN A;  1XS5 A;  3G3F A;  4XKP A;  2ZYO A;  1H43 A;  2XXP A;  4MLV A;  1A40 A;  1DTZ A;  3TCG A;  4OYV A;  1Q35 A;  3SES A;  1Q1K A;  3KJT A;  1GGG A;  3K00 A;  2REJ A;  4EXL A;  4U4S A;  3E4R A;  4Z7E A;  1B1X A;  5HBC A;  3K1P A;  3HV1 A;  1JNF A;  1LFG A;  2Y7K A;  3VLW A;  5I59 B;  5KCJ B;  2XD2 A;  5DTB A;  2Z8F A;  5B70 A;  1BKA A;  2Y84 A;  3H6T A;  1AL3 A;  3CVG A;  4NMY A;  4OFJ A;  2OK2 A;  4U2R A;  3DLN A;  3KOT A;  4GL0 A;  3G3I A;  3EPE A;  1QUI A;  3O2A A;  2F7C A;  3PUW E;  4QSC A;  4U22 A;  5BUU A;  2XHD A;  1P1W A;  4MLQ A;  3OD7 A;  1B7U A;  4RNS A;  1PBQ A;  1B46 A;  3JZJ A;  1PC3 A;  4YAH X;  1I6B A;  5F7V A;  2QL3 A;  1MXY A;  3ZKK A;  4AB5 A;  3ILU B;  3K1M A;  1R9L A;  1VR5 A;  4YB6 A;  1LAF E;  4F19 A;  2R71 A;  2GH9 A;  1MDQ A;  1JQF A;  3KSJ A;  1TT1 A;  4P0G A;  3N5L A;  1FCK A;  1LAG E;  4DIG A;  5H8H A;  3JV9 A;  3L6G A;  2IA4 A;  4F18 A;  2O51 A;  3M8U A;  1QJM A;  1LBB A;  5AA2 A;  3QAX A;  4PFW A;  2DP8 A;  5I58 B;  2F78 A;  4H5G A;  4ECF A;  3N6T A;  3G3H A;  4YKK A;  4HS7 A;  3MWB A;  3FV2 A;  2F35 A;  4KD5 A;  3VVF A;  2UVH A;  1YTV A;  1P1U A;  2VHA A;  2E0S A;  3TTN A;  3VV5 A;  1NH7 A;  3IB2 A;  2A5T A;  3SEX A;  2UVI A;  3HN0 A;  4H6D A;  2REG A;  4ESW A;  4R9G A;  1B05 A;  1GR2 A;  1IQ7 A;  4FED A;  4YKI A;  1OQH A;  1R1N A;  3E13 X;  5TP9 B;  1Y4T A;  2FYI A;  3CRB A;  3MBP A;  4H8I A;  4QFL A;  4LA9 A;  3TTL A;  3W9W A;  5ICT A;  1OLC A;  1Y1Z A;  4AQ4 A;  4IO6 A;  2I3W A;  3KFM A;  1IZ1 A;  4TLM B;  2Y7P A;  4ND9 A;  2O84 X;  4LVQ A;  4MH5 A;  3SEW A;  4ESX A;  1B7Z A;  1ZJL A;  2PX1 A;  4OWD A;  1ZU0 A;  3A3C A;  2HZK A;  2I0C A;  2G93 A;  3QYT A;  2X7P A;  3SEU A;  3T9U A;  1SYI A;  2I4B A;  3IR1 A;  1H3D A;  2M8C A;  2X26 A;  2P1S A;  4YMB A;  3UIF A;  4KYE A;  3K0V A;  3C9H A;  1N7W A;  4DDD A;  2ESN A;  3T9V A;  3IAZ A;  3K01 A;  1B5J A;  4FAJ A;  3I5O A;  1N3W A;  3OO7 A;  4NF5 A;  4GD5 A;  5EHS A;  1ZLQ A;  3O29 A;  4YU0 A;  1HSJ A;  1SD3 A;  3TKD A;  4ZEF A;  3O6I A;  2Z8D A;  3FIR A;  3PMW A;  3KBR A;  4ELO A;  3PUZ E;  4TLL B;  2OBG A;  4C1T A;  1SW1 A;  3OSQ A;  1UTB B;  3TQW A;  2DWI A;  3RGY A;  1US5 A;  3Q25 A;  5ITP A;  2A5S A;  3T22 A;  3FXQ A;  3H3G A;  2Q2A A;  4OES A;  1D9Y A;  2DVZ A;  1NNP A;  4GFR A;  1FTO A;  2QPQ A;  5CRY A;  1MG1 A;  3LUY A;  3THI A;  3IO6 A;  3H4Z A;  4GF8 A;  1PDA A;  4HCY A;  1FQD A;  4EF2 A;  3GBB A;  3N26 A;  4LUB A;  5A5X A;  4PFU A;  2Q8J A;  4YB5 A;  3RUM A;  1JEU A;  1USY H;  4G68 C;  1CB6 A;  2OWT A;  1P1N A;  5CM6 A;  3KN3 A;  1NMU A;  3SKP A;  5KDT B;  1FTL A;  3BFU A;  1UTH B;  5DVJ A;  5TPA B;  1LAH E;  4LZ7 A;  4OZ9 A;  4PFT A;  3PMV A;  3V89 B;  2VD3 A;  4QSE A;  3RQT A;  4NF4 A;  3OO9 A;  2XXR A;  1OVB A;  2Y7I A;  3E9X A;  3EHT A;  1POY 1;  4O3C A;  2H4I A;  5CBS A;  1MY1 A;  3K4U A;  3RTF B;  4XTC Q;  2DWJ A;  3K6W A;  4RPN A;  3RLF E;  5TU0 A;  4G77 A;  2Z22 A;  1PEB A;  2YJP A;  1FQE A;  3PPN A;  5I2K A;  4KCD A;  2Q2C A;  3KN8 A;  4GVO A;  1IXC A;  2DXY A;  3TEP A;  4Q0C A;  2VOZ A;  1NNK A;  1R6Z A;  3IB0 A;  1NNT A;  3LR1 A;  4ZEB A;  3R26 A;  1HSE A;  4POX A;  2Y7W A;  2O1M A;  3L6H A;  5AA4 B;  4H8J A;  2I4C A;  2IEE A;  2XX9 A;  4AB6 A;  4FE8 A;  1SBP A;  5H8F B;  1B3L A;  1SYH A;  3O97 A;  2XX8 A;  3MP1 A;  1KWH A;  4KCC A;  2XXX A;  3TTK A;  3U92 A;  4BDO A;  4U4X A;  1S7Y A;  3DP4 A;  2Q89 A;  1BLF A;  4THI A;  4PET A;  4X1B A;  1FQF A;  3IOV A;  5DEX A;  4GXA A;  3H6W A;  3B7D A;  1MY4 A;  1N76 A;  4N07 A;  4ZDM A;  5JTY B;  1L5T A;  3PUV E;  2GHB A;  3E3K A;  5KZT A;  4IO5 A;  1T0K A;  4F1V A;  1Y3Q A;  1LFH A;  4OEN A;  3UN6 A;  3KEI A;  4G8M A;  3TQL A;  3QIM A;  1VSO A;  3V5A A;  4KR5 A;  1DPE A;  1MQD A;  1MQJ A;  4NED A;  1JVY A;  2QSX A;  5I2N B;  2F7A A;  2B3F A;  3S9E A;  4PFY A;  3IOR A;  4OTE A;  2O68 A;  5FTH A;  3DP8 A;  1IIW A;  2VGQ A;  2RCA A;  4BLA A;  1MH4 A;  4F29 A;  1VFD A;  1ANF A;  3KJ7 A;  3G3G A;  4IO4 A;  4R6K A;  2ZNS A;  2YPN A;  1TWY A;  2ZYK A;  4LON B;  4NF8 B;  1URG A;  4DCY A;  1O63 A;  1JW5 A;  3DM0 A;  3G3K A;  4DZ1 A;  4X48 A;  1B0H A;  2XXH A;  5I56 A;  5I59 A;  4MF3 A;  5KCJ A;  2F7B A;  1ZBM A;  3C33 A;  1M5B A;  4IB2 A;  5H8N B;  5CMM A;  4OHN A;  3SEV A;  4F2O A;  1BIY A;  3ZSF A;  1CE2 A;  3CI8 A;  1DMB A;  3DEL B;  1H44 A;  1H45 A;  3KSX A;  1LGB C;  1MXZ A;  1ZKB A;  3MVZ A;  3RTW B;  3MQ9 A;  3A09 A;  2B3B A;  4M1V A;  5FHO A;  3VFJ A;  2XXU A;  3LBS A;  3IO4 A;  1XHY A;  4ZE9 A;  2F36 A;  2LAO A;  1MPD A;  3S9M C;  1SDX A;  5CI5 A;  3SDF A;  4KFQ A;  3SET A;  2GRV A;  5AA1 A;  4IGT A;  5LOM A;  5JK4 A;  5DVI A;  2XXT A;  1FW0 A;  3C32 A;  1D9V A;  3D4C A;  1GTK A;  1XOC A;  1OVT A;  1B5H A;  2XXI A;  2ZNU A;  2RC8 A;  3QUF A;  3USD A;  3OSR A;  1URD A;  4ZEC A;  4H1X A;  1TFD A;  4Q8R A;  4C1U A;  4R2B A;  3VVD A;  4RXL A;  4NWC A;  4DXB A;  5I58 A;  2OWS A;  1O7T A;  3H6V A;  4PQJ A;  4FIM A;  2HXW A;  4DXC A;  4YMA A;  1S9T A;  5I57 B;  4R73 A;  3LSF B;  4GWO A;  1N3X A;  1MQG A;  4LAT A;  3TCH A;  4R74 A;  5CMC A;  4Q5T A;  4G8H A;  1A55 A;  4X1D A;  2QS2 A;  5TP9 A;  2PT2 A;  5H8H B;  2ZYN A;  3ODB A;  3MVY A;  5L8D A;  3T96 B;  1ZIU A;  4FAT A;  4DXU A;  3RN8 A;  1WOD A;  1B1H A;  4HW8 A;  2ALU A;  3HHF A;  3V83 A;  4N6P A;  1WVJ A;  1RYX A;  4EDP A;  4ELP A;  1B52 A;  4XXU A;  4TOZ A;  1XT8 A;  1ZTY A;  4HTG A;  4WEP A;  1XC1 A;  3ZS6 A;  1Z7N E;  4GLI A;  1F9B A;  3Q27 A;  4O3B A;  1B7H A;  3EHU A;  3JYR A;  1Y1M A;  3B6Q A;  4BDR A;  4ZS9 A;  1YAE A;  4Z0I A;  2NOO A;  2F6P A;  1I6Q A;  4I9D A;  3RT6 B;  4R72 A;  5DYH A;  2XX7 A;  4NF6 A;  4LP2 B;  4OEV A;  5CC2 A;  3S2V A;  1UTB A;  3VLV A;  3ECR A;  2F8D A;  4WXJ A;  3C31 A;  4RY1 A;  4TQU Q;  2OLB A;  2GHA A;  5I84 A;  2THI A;  1DOT A;  1JW1 A;  1MY2 A;  5FHM A;  1MQI A;  3RPW A;  3UOR A;  1EZ9 A;  4F3P A;  4JSD A;  2HAV A;  3MP8 A;  4IO3 A;  4E0W A;  3MPK A;  1QUK A;  3EQ1 A;  4NF5 B;  5J1D A;  1DSN A;  1Y9U A;  3CIJ A;  2OJT A;  4IY6 A;  2DS9 A;  4POW A;  3BBR A;  1QKA A;  3ZKL A;  2XXV A;  4QF9 A;  2UVJ A;  5KDT A;  5CMB A;  1SVX B;  1UTH A;  4NTL A;  5TPA A;  1XVX A;  3LSX A;  4KI0 E;  1PB7 A;  1R9Q A;  3K6V A;  3QXM A;  1B3G A;  3A3U A;  4JSO A;  1B6H A;  4BDN A;  5HM4 B;  4NE4 A;  4YKP A;  4G4P A;  4I8C A;  1MXV A;  5CBR A;  4DCX A;  4KYD A;  3Q26 A;  3H03 A;  5L9O A;  1POT A;  1ZMG A;  2XD3 A;  3HO7 A;  4BDM A;  3K6X A;  3KG2 A;  1FQA A;  4RPO A;  4OFO A;  2UXA A;  4JB7 A;  2PT1 A;  3N6U A;  4X9T A;  3G3J A;  2QS3 A;  2DXR A;  4G68 B;  1D4N A;  5K2X A;  2HAU A;  4OEU A;  2DQV A;  2O69 A;  3EHS A;  1NL5 A;  3QUJ A;  5L9S A;  5AA4 A;  5AA2 D;  1B4H A;  1SI0 A;  4H67 A;  5H8F A;  4I62 A;  5FTI A;  1PB9 A;  2YLN A;  4F39 A;  1US4 A;  1EZO A;  2P2A A;  4EQ9 A;  3FVK A;  4ISU A;  3Q28 A;  1A8E A;  2DVC A;  4GL8 A;  3IJX B;  3FUZ A;  3FJM A;  2V3U A;  4OER A;  1Y3P A;  1PB8 A;  2I49 A;  4XIG Q;  5JTY A;  3FAS A;  2ANJ A;  2RC7 A;  5EYF A;  1OQG A;  3PU5 A;  1N04 A;  1Y20 A;  4R6H A;  1IUD A;  1MH3 A;  1I6A A;  3MPL A;  2D21 A;  4F3G A;  1EZP A;  4JXI A;  2X7Q A;  3W9V A;  4KHZ E;  4OMB A;  4G8N A;  4K3F A;  3PD8 A;  4Q30 B;  3VE1 B;  1LFI A;  3HST A;  3UGW A;  5I2N A;  5JEI A;  3DP6 A;  1QW0 A;  3IX1 A;  1MM7 A;  3HHG A;  1MRP A;  3VXC A;  4GOT A;  2DE2 A;  1MXU A;  2F6G A;  1IEJ A;  1SQY A;  3TYH A;  2NWJ A;  5H8Q B;  4RYA A;  3RY3 A;  4LQ5 A;  1MPB A;  3FGS A;  1M5E A;  2WKY A;  5L9M A;  3PUY E;  3LC8 A;  4LZ5 A;  4KPT A;  4RJZ A;  4WKM A;  3VLU A;  5K2Y A;  3OMB A;  4NF8 A;  1N0T A;  3TFL A;  3TUS A;  3MVW A;  3HCQ A;  3IOW A;  4RA1 A;  2XXQ A;  1FQB A;  2UYF A;  2DWH A;  5F1Q A;  3O28 A;  4FOR A;  1N7X A;  2AL5 A;  3O6H A;  5H8N A;  3UK4 A;  4NWD A;  4UA8 A;  4M4G A;  2VD2 A;  3BFT A;  4JDF A;  5FHN A;  3TEL A;  4IY5 A;  2HQ0 A;  2Z8E A;  1IXI A;  2V3T A;  4F31 B;  4P0I A;  3FVO A;  4JWX A;  1H76 A;  2ZYM A;  3TPA A;  2V3Q A;  4JWY A;  4H65 A;  3OO8 A;  3U93 A;  4RK9 A;  1SW2 A;  1LBC A;  3H6U A;  2GFE A;  2R9J A;  1LST A;  2BJJ X;  5ELV A;  2O7I A;  5I56 B;  1LB9 A;  1URS A;  2RF1 A;  4F22 A;  3GXA A;  2UVG A;  2DYX A;  3G7W A;  3MAM A;  1FTJ A;  4IO2 A;  2HZL A;  4FEC A;  1A99 A;  5H8S A;  2ZNT A;  3IOU A;  3PGF A;  2QRY A;  1Y3N A;  1OMP A;  3B6T A;  4QSD A;  4ELQ A;  4QHQ A;  1M5F A;  1MM6 A;  3K6U A;  4RK2 A;  1N84 A;  4R9F A;  4ZZA A;  1LLS A;  2NXO A;  3EN3 A;  3OEM A;  1P1Q A;  2V25 A;  3TAJ A;  3O9P A;  2ONK E;  4ZEK A;  3LSW A;  5I57 A;  1SW4 A;  3N94 A;  3AXF A;  4G2Z A;  2H9B A;  2DSF A;  4F2Q A;  4F3S A;  1II5 A;  4EUO A;  3QSL A;  4BDQ A;  4EF1 A;  3FXR A;  5IAI A;  1TXF A;  1RYO A;  3K02 A;  1MXW A;  4IGR A;  4MBP A;  3M3F A;  3FD3 A;  4H5F A;  2O6A A;  2H98 A;  4LZ8 A;  1LB8 A;  3PPO A;  4U23 A;  4OXV A;  2ONR A;  3T66 A;  1EU8 A;  3MVX A;  3CSB A;  2O1L A;  3WAE A;  4XKN A;  3O66 A;  1SI1 A;  4OVJ A;  1NKX A;  3Q29 A;  2I6E A;  3EF7 A;  3PPP A;  3RT8 A;  3RNN A;  2XXW A;  3KZG A;  4FJP A;  1OLA A;  3MC2 A;  3B6W A;  3ILT B;  1M5C A;  2OZZ A;  3TMG A;  2AL4 A;  3H06 B;  4EQ7 A;  5AA2 B;  1ELJ A;  3CFL A;  5AE4 A;  4ZE8 A;  1JET A;  2QJE A;  3FZV A;  1IXG A;  4ELR A;  4H0W A;  3GZG A;  5AA3 A;  3IK6 B;  1JEV A;  3M3K A;  1AMF A;  3SEY A;  3TDJ A;  3I6V A;  2PBW A;  4IO7 A;  3U72 A;  1AIV A;  2I0B A;  3T9X B;  3PD9 A;  3CFZ A;  3IJO B;  1OIB A;  4QRZ A;  1WDN A;  3GLB A;  2RIN A;  2A5T B;  2F97 A;  4U1Z A;  3FAT A;  2D3I A;  4KQP A;  1B32 A;  2E1S A;  4E0X A;  1UIU A;  1O64 A;  1VE4 A;  3CG3 A;  5M2V A;  2PVU A;  2O7U A;  3O6G A;  1Z7M E;  3OEN A;  4EQB A;  1NFT A;  3QK6 A;  1GV8 A;  2FA7 A;  1MDP 1;  1EH3 A;  2ZMB A;  3OEL A;  1BP5 A;  1USY E;  3KN7 A;  1QUJ A;  4U1O A;  1ATG A;  5EHM A;  3FJ7 A;  4YKJ A;  2AIX A;  3OEK A;  4ZZE A;  1AOV A;  4MFI A;  1A7L A;  4GXS B;  1B2H A;  4GQO A;  3MW0 A;  4U21 A;  2OCU A;  3TTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...