3PPNA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Glycine betaine/carnitine/choline-binding protein
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppnA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppnA02
2R6GE 4MBPA 1MY2A 2OLBA 4HCWA 4LATA 5F1QA 3TZAA 3N6TA 3E4RA 1QJMA 3B7DA 4KFQA 4Q8RA 5L9SA 3EPEA 1O63A 4BLAA 4POXA 1CE2A 1R1NA 1XHYA 1BLFA 1UTHB 4OQOA 4RPNA 2OJTA 3VFJA 5AA4B 1MH3A 3CR9A 1SQYA 4XXUA 2O6AA 2P0SA 1Y3QA 2FYIA 4I1DA 2H98A 3EHSA 4G8NA 1P1WA 2OWSA 2RC9A 4M4GA 1IXCA 3MZ1A 3KSXA 3TCHA 2HAVA 3LSLA 4F1VA 1J1NA 1AH5A 1M5FA 2UVJA 4ND9A 5KZTA 3HHGA 1UQWA 3V5AA 4GWOA 4AQ4A 3TELA 4QHQA 4H1XA 1B3LA 1VFDA 4R6HA 3TAJA 3TCFA 4JXIA 3PMWA 3HN0A 3IR1A 2X7QA 2HEUA 1GV8A 2X7PA 4ZECA 1R9QA 1B58A 3K2DA 4R72A 3K00A 1LB9A 2GHAA 4NWDA 3U92A 1UTHA 2QRYA 1SYIA 4ONYA 3K6VA 5AA3A 3OENA 4OYVA 5FHOA 1AIVA 2I4BA 2DP8A 3A09A 1EU8A 3V89B 1IQ7A 2O68A 3KOTA 2Y7WA 2XXWA 1OIBA 1B52A 4OFLA 3ZKKA 1M5DA 4LQ5A 1URGA 3N5LA 4GOTA 3W9WA 5JTYA 1NFTA 4GRKA 1LBBA 5I84A 1B40A 4DZ1A 3OEMA 2O1LA 1MY3A 4IB2A 2RC7A 1JW5A 4I62A 4ELQA 2D21A 4PP0A 2VD3A 2VOZA 3C36A 1P1OA 2F34A 3SEXA 4IO3A 4WKMA 1Y1MA 2DVCA 2DWHA 3OO9A 5I2KB 2DOJA 1MXWA 1M5CA 2I0CA 1S7YA 1TWYA 4JWXA 4ZE9A 1FQBA 2XD2A 3MWBA 2F7CA 3B6QA 1MY4A 4HCYA 2ONSA 3IOWA 4NF4A 4R2BA 3PUXE 5FHNA 3E3KA 3M3FA 2GRVA 2Q2AA 4LZ8A 3PPPA 3VLWA 4G77A 1WDNA 2UVIA 4H6DA 5J1DA 3VVFA 2O84X 4FIMA 3MBPA 3MVWA 5L9OA 4DXUA 3FXUA 3K6UA 3IJXB 4ELOA 3FVKA 3KG2A 5I2NB 4PFWA 5KCJA 3PUYE 5L8DA 1URDA 3UA8A 2XXQA 4DE8A 2I3WA 5B7DA 3G3IA 4YB5A 4OEUA 4C1TA 1MDP1 1Z7ME 2UYFA 1GTKA 2XXYA 1GVCA 4NWCA 3OXNA 2RF1A 3TTNA 1VE4A 4XKPA 3QAXA 4NE4A 5H8HB 1MQGA 3M3KA 3GLBA 4QF9A 4LUBA 4ELRA 3C4MA 4P0IA 3FVGA 4BDMA 3SEUA 3FATA 2P1SA 3ONMA 3SEYA 1B7UA 1LBCA 1MQHA 1Y1ZA 2I6EA 4G68B 2UVGA 3TYHA 2ALUA 2CZLA 4R74A 5CBSA 3S9MC 2H5YA 3LUYA 3KN3A 1S9TA 3RY3A 2V3TA 1LB8A 2F8DA 2ESNA 4AB5A 1IXIA 1I6QA 1MG1A 2GH9A 4H8JA 4IO5A 3I3VA 3S2VA 4IO4A 5I2NA 1B5JA 2H4IA 1H3DA 3MVXA 4G2ZA 3KEIA 3P7IA 1B3HA 3USDA 4QSDA 3RT6B 2X26A 4LZ5A 4ZDMA 3UP9A 3VDFA 2XX7A 1A40A 1IZ1A 5AA2D 2ONRA 1LAFE 1NH8A 4U4XA 3H3GA 1B7ZA 1B46A 3MJNA 1N76A 4F19A 1MM6A 3QUFA 2Q89A 4OTEA 4IY6A 5KDTA 4MH5A 3T9XB 1Z7NE 3PPRA 2XXRA 2O7UA 1B32A 1FW0A 1B51A 1FQDA 1P1QA 1SD3A 1SI0A 3IB0A 4KD5A 4NF6A 5H8QB 4ZEBA 2DVZA 1JW4A 1ZJLA 3FV2A 3K6XA 3LSXA 3PMXA 3UIFA 2F35A 5ICTA 3H6VA 2DWIA 4EQ9A 4R9FA 2Q9TA 1QW0A 3PPNA 4H8IA 1DPPA 1IXHA 3WAFA 2PT2A 3ILTB 1Y3NA 2M8CA 3QSLA 4FEDA 3O66A 4O3CA 3H6TA 2PYYA 3C33A 1MDQA 2V84A 1GR2A 1MPDA 4QFNA 1IXGA 4YU0A 3EHUA 1HSJA 4FJPA 1WVJA 4XIGQ 1O7TA 1Y9UA 2ZYMA 3UN6A 4F3GA 5ITPA 3F11A 1SBPA 3MZBA 4KCCA 4ESWA 5H8NA 3TODA 2VP1A 3CI8A 4DCYA 3U8QA 1B4HA 2YLNA 1MXZA 1QUKA 1B7HA 2ABHA 4THIA 3QYTA 3KSJA 4X9TA 1LGBC 1P1UA 2XHDA 3C32A 1SYHA 2Z22A 3N26A 5CC2A 1JEUA 1KWHA 2NUVA 3MC2A 4PE5B 3IB1A 4OEVA 1URSA 2DSFA 3TCGA 3DM0A 1JVYA 2I4CA 3U1OA 1PB9A 3BKIB 5H8HA 4ZS9A 3IO4A 2DYXA 3CFZA 4EDPA 4EXKA 1XS5A 3HPIA 1FTJA 4IGRA 2HCAA 2I48A 3MP8A 3PD9A 5M2VA 4EF1A 5AE4A 3MUQA 2HQ0A 2XXTA 2A5TA 5F7VA 4G68A 3Q28A 4KHZE 1SW2A 3FGSA 4QSCA 3TQWA 4F2OA 5H8FA 3ZSFA 2XXUA 4GXSB 2QMXA 3Q29A 5CMCA 3MZ9A 4KQPA 2V3QA 4RK2A 1S50A 3DP8A 3H7MA 2F36A 4R73A 3G3JA 3RN8A 1EH3A 5ISUA 5H8NB 4BDQA 1LAGE 3PUVE 3Q27A 5I58A 4N07A 3K01A 3VE1B 3E13X 3TTKA 5EYFA 1IIWA 4NEDA 2XXVA 1M5EA 4O3BA 5AA1A 2DQVA 1OMPA 4R75A 1PBQA 4PFYA 1RKMA 4XKQA 1YCJA 5HBCA 4MLVA 1MS7A 3PUZE 4G4PA 1SW1A 1FTLA 2AL5A 3I5OA 3JV9A 2HFBA 3IX1A 4Z7EA 5A5XA 2KLFA 5AA2B 1SW4A 4YMBA 3RQTA 3T9UA 4U22A 2LAOA 4LA9A 1B05A 4RXLA 1B1XA 1N7XA 1POTA 3K6WA 2A5TB 1P1NA 1NMUA 3B6WA 2B65A 2Y7PA 3FJMA 1PBPA 1AOVA 5B70A 5IAIA 3O9PA 4RYAA 4LVQA 3OOAA 2B3BA 1DPEA 1B5IA 1MXVA 2HXWA 5DYHA 3ZS6A 5K2YA 3MAMA 2R71A 3WAEA 5I2KA 4KYSA 5CMMA 2PMSA 1LSTA 2W7YA 3TFLA 2I0BA 4WEPA 1FTOA 1MQDA 4YZZA 3RTWB 3THIA 3IOTA 3OO6A 4NF4B 1SI1A 3R26A 4G68C 4H5GA 4LZ7A 3SKPA 1B3FA 1B0HA 1II5A 1PEBA 3FVOA 1HSLA 3JYRA 4BDNA 2F7BA 2V93A 3TDJA 1D4NA 2GFEA 2I3VA 3CRBA 3CSGA 3A3CA 3HHFA 3MVYA 4XKRA 2RINA 3CG1A 1IITA 2Q88A 1B5HA 4YB6A 4RNSA 5DVJA 5I57A 5IKBA 1MM7A 4NMYA 4R6KA 3GBBA 3MW0A 4F31B 5AA2A 3HV1A 1JNFA 4KYEA 5KCJB 3S4UA 3HSTA 3OSRA 5KDTB 4NF6B 4GXAA 4GD5A 1B1HA 3VV5A 4F29A 5TP9A 1HSEA 3UK4A 1NH7A 1N3XA 4QSEA 4OXVA 4R6YA 3OEKA 2DE2A 3PMVA 3R6UA 3U94A 3LC8A 3KZGA 3OSQA 4GQOA 3S9LC 1DTZA 3IORA 2XD3A 4R2FA 5HM4B 3H06B 3LSFB 4GFRA 2RCBA 3KOSA 4Q30B 3H6UA 3D4CA 5FTIA 1R6ZA 1B0LA 4OMBA 1NNTA 3IOVA 3RPWA 3U72A 2ZNUA 2ZYOA 5CBRA 3IO6A 4X1DA 1LFHA 2IA4A 1JVXA 2QPQA 5BWJA 2DS9A 4QFLA 4F2QA 2REJA 4BDLA 2HZLA 1XOCA 2DWJA 2VD2A 4ZEKA 4DIGA 5I58B 1IUDA 1UTBA 2HAUA 3BBRA 3IJOB 3C9HA 5L9MA 3Q25A 2XXXA 2UYEA 4MFIA 3KGCA 3LSWA 1QULA 1ZKBA 1R9LA 1EZOA 3H6WA 2NWJA 4E0XA 2AYSA 3G3FA 1N0TA 1CB6A 1QVSA 2ZMBA 2Z8FA 2NXOA 5A5XB 4WXJA 2F97A 2RKMA 3T9HB 3RT8A 4E0WA 1DTGA 3SERA 4IO2A 1JETA 1TXFA 1OLCA 2UXAA 2OWTA 5H8FB 2QS1A 1LAHE 2OK2A 4PFTA 1TFDA 5K2XA 3RUMA 1MXYA 4MLQA 1MH4A 3EN3A 4HS7A 2ANJA 3RTFB 3TQLA 1SDXA 3MP6A 4BDRA 4F39A 2UVHA 5ITOA 3U93A 4F3PA 4FATA 2OZZA 5I56A 2H25A 4IO7A 4FE8A 4U21A 2XX8A 1T0KA 1UIVA 3KJ7A 1MQJA 3L6HA 3W9VA 4NTLA 4KCDA 1BTJA 2DWAA 3TMGA 5ICQA 1XC1A 1B3GA 1I6AA 2A5SA 4AB6A 1BKAA 3MPKA 4RK9A 1PDAA 3V83A 3S9NC 4EXLA 1MPBA 1ZLQA 2RCAA 1EZ9A 1QKBA 2Z23A 4ISUA 1I6BA 4YB7A 5EHSA 1ATGA 2I49A 4G8MA 2AIXA 1MRPA 1JEVA 1YPNA 1YTVA 1ZTYA 2QSXA 4FECA 1POY1 3KN7A 4M1VA 3AXFA 1Y3PA 1ELJA 2PVUA 3ECRA 5TPAA 3SEWA 3MPLA 3HO7A 5BUUA 3TTRA 1A99A 4EF2A 4DDDA 4FAJA 1B2HA 5HPQA 2DXRA 3N6UA 1NNKA 3PV0E 1XVYA 3MQ9A 4NF8B 5TP9B 3OMBA 3T93B 2DXYA 1H45A 2O1MA 3W15C 4FEBA 4K3FA 2O7IA 2E0SA 2F7AA 2Z8EA 5LOMA 4I8CA 3TPAA 4Z0IA 3QUJA 2WKYA 2ZNSA 2ZXTA 3K0VA 4MF3A 3FJGA 4NF5B 3KFMA 4RJZA 1FTMA 2V25A 1A7LA 2Y7KA 3G3GA 4OFOA 4R9GA 3T9VA 4U23A 3H03A 2HZKA 2G29A 3PPOA 4ZE8A 4ESXA 1N7WA 2PT1A 3S9EA 2Z8DA 3KN8A 3O6GA 4X1BA 4TLLB 4GVOA 4TQUQ 3VVDA 1N3WA 3K1MA 4H5FA 1LCTA 1EZPA 4QFOA 1FCKA 2H9BA 3CG3A 3DP6A 3HCQA 1UTBB 1NNPA 3K1NA 4DXBA 4P0GA 5TU0A 3PPQA 1USYE 4N6PA 3VVEA 2QS4A 4JWYA 4KYDA 3SESA 3DELB 3ODBA 2D5WA 1Y4CA 4F1UA 2NOOA 3TKDA 3MVZA 3SEVA 3FASA 2F6PA 2Y7RA 2OCUA 2I58A 2FA7A 5DVIA 2ZNTA 4H0WA 4JB7A 1A55A 3K4UA 2IEEA 3PGFA 3FVNA 4H65A 1Q35A 4WEDA 2F6GA 2VHAA 3D4GA 3IB2A 2H99A 3MP1A 2YPNA 4LONB 1BIYA 3FIRA 1IEJA 4QFKA 4RY1A 4XTCQ 1MXUA 4TLMB 4PQJA 3CIJA 4YAHX 5FTHA 4OZ9A 2V3UA 1US5A 4POWA 1NKXA 4IGTA 1TFAA 2BJJX 3IAZA 1Y20A 1SVXB 3OD7A 1OLAA 2ONKE 4JDFA 4ZZEA 5I56B 1WODA 4HTGA 5FHMA 3JZJA 1LFGA 1FTKA 2DE3A 1NL5A 3B6TA 3BFTA 3I6VA 3PU5A 1RYOA 3CFLA 3E9XA 3FXQA 3VXBA 4F18A 1FQCA 3TEPA 1Q1KA 3IK6B 4GLIA 2D3IA 1O64A 3QXMA 3EHTA 3VLVA 1B6HA 1Y4TA 4FORA 1LAXA 3UORA 5I57B 1A54A 3IOUA 3EF7A 1H44A 2PBWA 4GL0A 1RYXA 4OHNA 2ZYKA 1DMBA 3QIMA 3FJ7A 3V8XB 3TTLA 5DT6A 4OENA 4X48A 3C31A 4OETA 4OWDA 5AA4A 2G93A 5CMBA 5I59A 1A8FA 1ZIUA 1QKAA 2F78A 4IY5A 1A8EA 4ZEFA 2AL4A 3SETA 3O6HA 4OESA 4UA8A 1JW1A 2ZYNA 3FUZA 4U1ZA 4YICA 5DEXA 5ELVA 3RLFE 1TT1A 1D3KA 1SW5A 1ANFA 5EHMA 1OQGA 1USYH 1US4A 2Q2CA 1B3EA 1M5BA 3GZGA 4KPTA 2VGQA 4OVJA 4Q5TA 3T66A 4F3SA 2THIA 1VSOA 2GHBA 1LCFA 2F5XA 4OERA 4PFUA 4H67A 1PC3A 4BDOA 3O28A 2O51A 4UACA 1JQFA 1FQFA 1H43A 3FV1A 3UGWA 1DOTA 4EQBA 3TTMA 3R7XA 1OVBA 4ZZAA 3CFXA 2O69A 1FQEA 3CSBA 4GIZA 4RPOA 3C34A 3PD8A 1OQHA 1VR5A 1MPCA 2RC8A 3O29A 4JSDA 4O3AA 2DE4A 3LR1A 4C1UA 1GGGA 1F9BA 1P99A 3IL1B 4DCXA 2XXPA 2R9JA 3EQ1A 3OO7A 5I59B 5DVFA 2OBGA 3K1PA 4C0RA 4F3BA 3M8UA 3OELA 4U4SA 3DLNA 1DSNA 3RGYA 3GBAA 4U1OA 2YJPA 1LFIA 3O97A 1LLSA 1L5TA 3M3LA 4F22A 5CI5A 3N94A 1AMFA 2B3FA 5CMKA 4NF5A 4ZEIA 4EUOA 3FXRA 3ILUB 3O2AA 3G3HA 4IO6A 1ZBMA 2XXIA 4U2RA 4KR5A 1NNFA 4G8HA 3SDFA 4ZEDA 3TUSA 1PB7A 4Q0CA 1ZMGA 2Y7IA 1H76A 4ECFA 1B9JA 4P11A 2CMOA 3BFUA 1BP5A 3H4ZA 3QK6A 4JBZA 5H8SA 2NVUB 1MQIA 3ZKLA 4HW8A 3VXCA 3T96B 1D9VA 3G3KA 1B4ZA 3Q26A 4KI0E 2XX9A 5JK4A 1VFEA 4XKNA 1FQAA 4I9DA 3L6GA 1MXXA 3CVGA 4RA1A 4JWOA 3O6IA 4YKIA 2QJEA 4LQ2A 4PETA 4YKPA 4YKKA 5JTYB 3A3UA 3K02A 3T22A 4EQ7A 1PB8A 2QS3A 2QS2A 1MY1A 4QFPA 3G7WA 3LBSA 4YKJA 1N84A 1ZU0A 3OO8A 5TPAB 1I69A 4YMAA 5CM6A 3GXAA 2Y84A 1QUJA 4DLDA 4F1YA 1XT8A 5DTBA 5H8QA 3KBRA 1D9YA 4GL8A 4OFJA 4L17A 4JSOA 4NF8A 4QRZA 4N13A 4ELPA 4LP2B 3VLUA 5DEXB 2P2AA 3FD3A 2Q8JA 3RNNA 4DXCA 3C35A 1YAEA 1MY0A 2QMWA 3DP4A 2XXHA 2PX1A 3FZVA 1UIUA 1OVTA 2FNCA 2QL3A 1XVXA 3PUWE 1N04A 1AL3A 2REGA 5JEIA 4GF8A 3KJTA 1QUIA 2E1SA 4TOZA 5CRYA
chains in the Genus database with same CATH superfamily
2R6GE 4MBPA 2OLBA 4HCWA 3E4RA 1QJMA 3B7DA 4N4UA 4KFQA 3BIGA 5L9SA 4BLAA 1O63A 1R1NA 4RPNA 1UTHB 5AA4B 3CR9A 4XXUA 2O6AA 2H98A 4PC9A 2HAVA 1LBZA 4R6HA 4ZECA 3K6VA 5AA3A 1AIVA 2I4BA 2Y7WA 1RDXA 1URGA 4PTKA 3W9WA 1B40A 2O1LA 4N6KA 2D21A 1Y1MA 3OO9A 2I0CA 1MXWA 4JWXA 3MWBA 2F7CA 1MY4A 3IOWA 3E3KA 2GRVA 3VLWA 3VVFA 2O84X 4OVQA 4PFWA 4YB5A 1Z7ME 1GTKA 4YMAA 3TTNA 4XKPA 5H8HB 4NE4A 1MQGA 4QF9A 3FVGA 4BDMA 3FATA 1LBWA 3U65A 3SEYA 1LBCA 4G68B 2ALUA 1G0HA 2CZLA 5CBSA 3S9MC 3RY3A 3LUYA 3KN3A 1LB8A 4AB5A 1I6QA 4IO5A 4OANA 5I2NA 1H3DA 3KEIA 3P7IA 1A40A 3H3GA 4PDDA 4OTEA 5I84A 2XXRA 4KD5A 1SD3A 2F35A 4XEQA 1DBZA 4FEDA 1YXIA 4PAIA 4QFNA 1MPDA 1IXGA 4YU0A 1HSJA 4XIGQ 1O7TA 1Y9UA 2ZYMA 4DI4B 5ITPA 3F11A 3MZBA 5H8NA 3TODA 2ABHA 4PFIA 5CC2A 1P1UA 2XHDA 3C32A 3N26A 3IB1A 1URSA 3TCGA 4LN5A 1IMAA 4EDPA 1XS5A 3HPIA 1FBFA 3MUQA 4MHFA 1RDYA 4KHZE 4F2OA 4PBHA 2QMXA 4KQPA 2V3QA 3DP8A 3H7MA 2F36A 4GX6A 3VE1B 2XXVA 5ET6A 4PFYA 4XKQA 4MLVA 4KXPA 1FTLA 2AL5A 3IX1A 5AA2B 1SW4A 5J16A 1B05A 1JP4A 1B1XA 5IAIA 3O9PA 4LVQA 3ZS6A 2HXWA 5K2YA 2PMSA 4PFRA 4WEPA 3RTWB 3OO6A 4NF4B 1SI1A 4H5GA 3JYRA 3TDJA 2GFEA 2I3VA 3CSGA 3A3CA 4XKRA 3MVYA 2RINA 5IKBA 4R6KA 3GBBA 5KCJB 3HV1A 1NUWA 1FPIA 1NH7A 4QSEA 3OEKA 2DE2A 3R6UA 3U94A 2XD3A 4PF6A 3LSFB 1FSAA 3KOSA 1R6ZA 2BJIA 1NNTA 3RPWA 1AWBA 1JVXA 5BWJA 5EQ7A 2DS9A 4QFLA 4F2QA 4OVRA 2VT5A 2DWJA 2VD2A 4DIGA 3BBRA 5L9MA 3Q25A 1QULA 3H6WA 3G3FA 1N0TA 5IZ1A 2F97A 3T9HB 2FIXA 1JETA 1TXFA 2OWTA 5H8FB 1Q9DA 2OK2A 4HS7A 4GWYA 4F3PA 4F39A 2UVHA 5I56A 4IO7A 1NUXA 1B3GA 4AB6A 2L5VA 1ZLQA 1EZ9A 1QKBA 4G8MA 2AIXA 4FECA 4M1VA 1ELJA 5BUUA 4EF2A 4FAJA 1B2HA 5HPQA 1NNKA 3PV0E 1H45A 2F7AA 2Z8EA 5LOMA 4I8CA 3TPAA 4MF3A 1NV3A 3KFMA 2Y7KA 1A7LA 2G29A 3PPOA 4P47A 2Z8DA 1NNPA 4DXBA 5TU0A 2WBDA 4P3LA 3MVZA 4PBQA 3IFCA 2QVUA 5DVIA 3K4UA 3FVNA 4H65A 1Q35A 4MCOA 2H99A 4QFKA 3FIRA 4YAHX 4P1EA 1MXUA 4TLMB 3CIJA 5FTHA 4OZ9A 1TFAA 3IAZA 1OLAA 1WODA 1LFGA 3B6TA 3VXBA 3TEPA 1Q1KA 4GLIA 1A54A 4OHNA 1FPGA 4X04A 3V8XB 4OENA 5AA4A 2G93A 5CMBA 4ZEFA 4OESA 5DEXA 1SW5A 1M5BA 3GZGA 4OVJA 4Q5TA 2F5XA 4PFUA 3O28A 2O51A 1JQFA 4NN3A 1H43A 3CSBA 4GIZA 4RPOA 3RPLA 3O29A 1MPCA 4O3AA 4DCXA 1P99A 4GX4A 2XXPA 3EQ1A 5I59B 4C0RA 1DSNA 2Y5KA 2HPGA 2YJPA 4HE0A 4NF5A 4EUOA 3FXRA 3O2AA 3G3HA 2PCRA 1ZMGA 2Y7IA 1H76A 4P11A 3ZKLA 2NVUB 4HW8A 3VXCA 1D9VA 5JK4A 4XKNA 3L6GA 3K02A 4EQ7A 3LBSA 1ZU0A 1I69A 3GXAA 1QUJA 3KBRA 4GL8A 1XI6A 3E78A 3VLUA 1YAEA 1MY0A 1OVTA 2QL3A 1XVXA 5JEIA 3N6TA 1K9YA 4Q8RA 1LBYA 2R8TA 4POXA 4P9KA 1BLFA 4OQOA 3VFJA 1MH3A 2Q74A 2P0SA 4MNPA 3EHSA 1P1WA 4GBWA 2RC9A 1IXCA 3MZ1A 3TCHA 1J1NA 1AH5A 1M5FA 2UVJA 4ND9A 5KZTA 4P56A 3D1RA 1FJ6A 4QHQA 1FRPA 1B3LA 3TCFA 2HEUA 3GYYA 1B58A 3K2DA 2QRYA 1SYIA 4OYVA 5FHOA 3A09A 1EU8A 1IQ7A 4OFLA 1OIBA 5JTYA 1NFTA 4IB2A 1MY3A 5EQ8A 4ELQA 4PP0A 2F34A 4NG7A 5I2KB 1S7YA 4HCYA 4R2BA 3PUXE 3M3FA 4LZ8A 5J1DA 1WDNA 2UVIA 3MBPA 1FPBA 4N8YA 3IJXB 4ELOA 3FVKA 3KG2A 3PUYE 4DE8A 5B7DA 4C1TA 1MDP1 2UYFA 1VE4A 3QAXA 4ELRA 4P0IA 4MNIA 1B7UA 2CZHA 2UVGA 3TYHA 2GH9A 3I3VA 2WYPA 3MVXA 4G2ZA 3USDA 4QSDA 1IZ1A 5FBPA 1B46A 3MJNA 2Q89A 4I3YA 1Z7NE 4ZE9A 3T9XB 1B51A 5H8QB 4ZEBA 4NHBA 1JW4A 1ZJLA 3LSXA 3UIFA 5ICTA 2DWIA 4EQ9A 1QW0A 3PPNA 3NOHA 4H8IA 1IXHA 3ILTB 3QSLA 3O66A 3H6TA 2PYYA 3FBPA 2VPOA 1GR2A 2F3DA 3EHUA 4FJPA 1WVJA 3UN6A 4DCYA 3U8QA 1QUKA 4X9TA 2Z22A 1JEUA 3FXBA 2I4CA 1PB9A 5H8HA 3IO4A 1FTJA 4IGRA 2HCAA 2I48A 5AE4A 2HQ0A 5F7VA 4G68A 5H8FA 3FGSA 1D9QA 4QSCA 3Q29A 3MZ9A 3RN8A 5ISUA 3Q27A 3K01A 3TTKA 5EYFA 5AA1A 1OMPA 2FBPA 5HBCA 1FJ9A 4G4PA 3JV9A 4Z7EA 2ZZVA 4YMBA 4LA9A 1EYJA 5IGAA 1N7XA 1POTA 2A5TB 3FJMA 5B70A 3OOAA 2B3BA 1B5IA 3MAMA 2R71A 4KYSA 1FTOA 3THIA 3IOTA 4G68C 4AS5A 4BDNA 2V93A 3A29A 3CG1A 1IITA 5I57A 5ESYA 4GXAA 4F29A 5TP9A 1HSEA 3UK4A 4OXVA 4R6YA 4JVIA 3LC8A 3OSQA 3IORA 4GFRA 2FIEA 1B0LA 3IOVA 2ZYOA 1KZ8A 3IO6A 2QPQA 2REJA 4ZEKA 1UTBA 2HAUA 2UYEA 4MFIA 3KGCA 2FHYA 1R9LA 2CZIA 4E0XA 1QVSA 2Z8FA 2NXOA 2RKMA 4E0WA 4JVDA 3RUMA 1FPEA 5I7IA 5K2XA 3EN3A 4BDRA 4FATA 3U93A 2H25A 2XX8A 1T0KA 5ICQA 4KCDA 3TMGA 2A5SA 3MPKA 4RK9A 3V83A 1MPBA 2Z23A 1MRPA 1ZTYA 1YPNA 1YTVA 1POY1 3KN7A 3SEWA 3HO7A 3N6UA 3MQ9A 3OMBA 3T93B 2DXYA 2HXRA 2ZXTA 3FJGA 4NF5B 1FTMA 2V25A 4OFOA 4U23A 3B50A 3KBZA 4ZE8A 2HZKA 3O6GA 4TQUQ 3VVDA 1N3WA 4H5FA 2OX3A 4NGUA 1IMBA 1FCKA 1BK4A 3CG3A 3HCQA 1NV0A 4N6PA 3IFAA 2QS4A 4JWYA 3SESA 3DELB 4F1UA 2OCUA 2FA7A 4JB7A 1YZ0A 2F6GA 3D4GA 2ZZWA 4XTCQ 2YPNA 1QGXA 2V3UA 2BJJX 1SVXB 5I56B 3JZJA 4MIJA 3CFLA 3E9XA 1O64A 3UORA 3EF7A 1FBGA 2PBWA 4GL0A 1IMCA 2ZYKA 3QIMA 2ZYNA 4U1ZA 3FUZA 1USYH 3T66A 4F3SA 1VSOA 1PC3A 4UACA 1FQFA 3FV1A 3UGWA 4EQBA 4NAPA 3TTMA 3R7XA 3CFXA 2O69A 3C34A 1VR5A 2RC8A 2DE4A 4C1UA 1F9BA 2R9JA 3OO7A 3K1PA 4XFEA 3GBAA 4U1OA 2XWIA 1LFIA 3O97A 5CI5A 3N94A 1AMFA 4O7IA 4ZEIA 3ILUB 4KR5A 1NNFA 4PAFA 3SDFA 4Q0CA 5IM2A 1NV4A 1LBXA 3H4ZA 2PFYA 4JBZA 3T96B 3G3KA 2XX9A 1FQAA 2XWKA 3CVGA 4YKIA 2QJEA 3LUZA 1PB8A 1MY1A 4YKJA 1NV7A 5TPAB 2Y84A 4DLDA 4F1YA 1XT8A 2ZZXA 3EKIA 4OFJA 4NF8A 1CNQA 3MSTA 4LP2B 5DEXB 2P2AA 1FBPA 2Q8JA 3C35A 2QMWA 2REGA 3K6UA 4IR8A 4LATA 3TZAA 5F1QA 1XHYA 3RPLB 1NV5A 1Y3QA 2FYIA 4G8NA 4M4GA 3LSLA 4F1VA 3V5AA 4GWOA 4OA4A 4JXIA 3HN0A 3IR1A 4MEVA 4O7MA 4MJOA 2X7PA 1R9QA 1LB9A 3U92A 1UTHA 1SPIA 4ONYA 1NV6A 2QVRA 2DP8A 1RDZA 1FPJA 1B52A 4GOTA 4GRKA 4AS4A 4DZ1A 3OEMA 4NF0A 4I62A 2VD3A 3C36A 1P1OA 4IO3A 4OVSA 2JJKA 4P8BA 1M5CA 1TWYA 2V4CA 4O8MA 3B6QA 2MKZA 4NF4A 2F3BA 3PPPA 4G77A 4H6DA 4FIMA 4GX3A 4DXUA 3FXUA 5I2NB 5KCJA 5L8DA 1URDA 2XXQA 3G3IA 4OEUA 2XXYA 1GVCA 4NWCA 2RF1A 3M3KA 3T0JA 4LUBA 3ONMA 1MQHA 4R74A 1S9TA 1MG1A 3S2VA 4IO4A 1B5JA 2H4IA 4QBAA 2X26A 3UP9A 4ZDMA 3VDFA 2XX7A 5AA2D 4U4XA 2FVZA 3QUFA 4MH5A 3PPRA 2O7UA 1B32A 1FQDA 3FV2A 3K6XA 4R9FA 2Q9TA 3WAFA 1Y3NA 2M8CA 4O3CA 1MDQA 2V84A 4F3GA 5ET8A 1SBPA 2VP1A 4THIA 1B4HA 2YLNA 1MXZA 1B7HA 3QYTA 1LGBC 2XA5A 3ROJA 3MC2A 2DDKA 3DM0A 1JVYA 3BKIB 4ZS9A 1EYKA 3MP8A 3PD9A 1IMDA 2XXTA 3Q28A 1SW2A 5ET5A 5CMCA 4RK2A 1S50A 5IZZA 4R73A 5H8NB 4BDQA 5I58A 4N07A 4OVPA 2PFZA 3E13X 4NEDA 4O3BA 1YCJA 1MS7A 5A5XA 4O94A 2HFBA 2KLFA 3T9UA 2LAOA 4RXLA 3K6WA 3TQLA 1P1NA 3B6WA 2B65A 2Y7PA 1PBPA 2WYKA 4RYAA 1DPEA 1MXVA 5DYHA 3WAEA 5CMMA 2W7YA 2I0BA 4YZZA 1B3FA 1B0HA 1PEBA 1HSLA 2F7BA 3HHFA 2KQZA 5EYGA 2Q88A 5DVJA 1MM7A 4NMYA 3MW0A 1IMEA 4F31B 5AA2A 4KYEA 5KDTB 3CHGA 3S4UA 3HSTA 3OSRA 4NF6B 3PMVA 4N91A 1FPDA 3KZGA 4R2FA 5HM4B 4PFBA 2RCBA 1VDWA 3D4CA 3U72A 5CBRA 4BDLA 2HZLA 4I3EA 1NUZA 3IJOB 2GQ1A 3LSWA 1ZKBA 1EZOA 1CB6A 2ZMBA 1DTGA 3SERA 1OLCA 5ET7A 2QS1A 1LAHE 4PFTA 4MLQA 5EYHA 3RTFB 2ANJA 4PE3A 1SDXA 2OZZA 4FE8A 4U21A 3KJ7A 4GWWA 4NTLA 1XC1A 4I40A 1I6AA 1BKAA 4EXLA 2RCAA 4ISUA 4YB7A 1ATGA 2I49A 1JEVA 3AXFA 2PVUA 3ECRA 1FBCA 3TTRA 1A99A 5TP9B 3W15C 1DCUA 2O7IA 2E0SA 1FPKA 4Z0IA 3QUJA 4RJZA 3T9VA 3H03A 5F24A 4ESXA 2PT1A 2QVVA 4X1BA 3K1MA 1LCTA 3DP6A 2Y5LA 1UTBB 4P0GA 3PPQA 1USYE 3VVEA 4KYDA 3ODBA 2D5WA 1Y4CA 3TKDA 1KA1A 2I58A 1FBDA 2ZNTA 4N6DA 2VHAA 3IB2A 4RY1A 4N15A 4PQJA 5I3SA 1NKXA 1Y20A 4ZZEA 4N81A 2ONKE 5FHMA 1FPFA 2CZKA 1FTKA 1NL5A 5IZ3A 1RYOA 1FQCA 2D3IA 3EHTA 3VLVA 4PAKA 1LAXA 4NQ8A 1EYIA 3FJ7A 5DT6A 4HE2A 3C31A 4OETA 5I59A 1A8FA 1ZIUA 4IY5A 3SETA 3MYUA 3O6HA 5ELVA 3RLFE 1D3KA 1OQGA 2Q2CA 1B3EA 4KPTA 2VGQA 2THIA 4HXVA 2GHBA 1LCFA 4BDOA 4OERA 1OVBA 1FQEA 3PD8A 3LR1A 1GGGA 3IL1B 5DVFA 2OBGA 3OELA 4U4SA 3HFUA 3RGYA 1L5TA 3M3LA 4F22A 2WEFA 4IO6A 1ZBMA 4U2RA 4G8HA 4ZEDA 3TUSA 1PB7A 4X8RA 1KA0A 4GWXA 3BFUA 1G0IA 1LEVA 3Q26A 4KI0E 4I9DA 1MXXA 4JWOA 4LQ2A 4PF8A 4YKPA 3LV0A 3T22A 4UABA 3G7WA 3OO8A 5DTBA 5H8QA 1D9YA 4JSOA 4QRZA 2WBBA 3RNNA 4DXCA 2PX1A 4GF8A 5A5LA 2Q8MA 1QUIA 1LSTA 2CEXA 3SKPA 3TFLA 1MY2A 4OVTA 3EPEA 1CE2A 2OJTA 1SQYA 4I1DA 2OWSA 3KSXA 4HE1A 3HHGA 1UQWA 4AQ4A 3TELA 4H1XA 1VFDA 3TAJA 3PMWA 2X7QA 1GV8A 4R72A 5LDZA 3K00A 2GHAA 4NWDA 3OENA 3QMFA 3V89B 2O68A 3KOTA 2XXWA 3ZKKA 1M5DA 2VPNA 4LQ5A 3N5LA 3T1BA 4PCDA 1LBBA 2RC7A 2XXKA 1JW5A 4MAGA 2VOZA 3SEXA 4WKMA 2DVCA 2DWHA 2DOJA 1FQBA 2XD2A 2ONSA 2Q2AA 5L9OA 3MVWA 3UA8A 1FBHA 2I3WA 1NV1A 4DI3D 2B4LA 3OXNA 3GLBA 2P3NA 3C4MA 3SEUA 2P1SA 1Y1ZA 4FBPA 2I6EA 2H5YA 2V3TA 2F8DA 2ESNA 1IXIA 4H8JA 2B4MA 4PGPA 4GWSA 1B3HA 4GBVA 3RT6B 3SZPA 4LZ5A 2ONRA 1LAFE 1NH8A 1B7ZA 1N76A 4F19A 5DW8A 1MM6A 4IY6A 5KDTA 1FW0A 1SI0A 1P1QA 3IB0A 4NF6A 1NUYA 2DVZA 3PMXA 3H6VA 1DPPA 2PT2A 3C33A 1INPA 4ESWA 4KCCA 3CI8A 3PTYA 3KSJA 1SYHA 1KWHA 2NUVA 4PE5B 4OEVA 2DSFA 3U1OA 2DYXA 3CFZA 4EXKA 4EF1A 5M2VA 2A5TA 4GWZA 3TQWA 3ZSFA 2XXUA 4GXSB 5T3JA 3G3JA 1EH3A 1LAGE 3PUVE 1IIWA 1M5EA 2QFLA 2DQVA 4R75A 1PBQA 1RKMA 1FPLA 3PUZE 1SW1A 1YYZA 3I5OA 3RQTA 4U22A 2XWVA 1AOVA 1NMUA 5I2KA 1MQDA 5CMKA 1LBVA 3R26A 4LZ7A 1II5A 3FVOA 4MX6A 2HHMA 1D4NA 3CRBA 4YB6A 1B5HA 4RNSA 3B8BA 1FTAA 1JNFA 4GD5A 1B1HA 3VV5A 1N3XA 3BIHA 4GQOA 4N8GA 3S9LC 1DTZA 3H06B 4Q30B 3H6UA 5FTIA 4OMBA 4PGNA 2ZNUA 4G61A 4X1DA 1LFHA 2IA4A 2XWOA 1IMFA 1XOCA 1K9ZA 1IUDA 5I58B 4JVCA 3C9HA 5IZ3B 2XXXA 1NV2A 2NWJA 2AYSA 3KC0A 5LTCA 5A5XB 4WXJA 3RT8A 4IO2A 4H45A 2UXAA 1TFDA 1MXYA 1MH4A 3KC1A 3MP6A 5ITOA 1UIVA 1MQJA 3L6HA 3W9VA 1BTJA 2DWAA 1PDAA 3S9NC 1I6BA 5EHSA 2QSXA 1Y3PA 5TPAA 3MPLA 4DDDA 2DXRA 4NF8B 1XVYA 2O1MA 4FEBA 4K3FA 4MNCA 2WKYA 2ZNSA 3K0VA 4R9GA 3G3GA 1N7WA 3S9EA 3KN8A 2WX9A 4TLLB 4GVOA 1EZPA 4QFOA 5I5PA 3K1NA 2H9BA 4N17A 2NOOA 3SEVA 3FASA 2F6PA 2Y7RA 4QXDA 4H0WA 1A55A 2IEEA 5FHNA 4WEDA 3PGFA 3MP1A 4LONB 1BIYA 1IEJA 4PDHA 4POWA 1US5A 4IGTA 4JDFA 2KR0A 3OD7A 4HTGA 2DE3A 3BFTA 3PU5A 3I6VA 4F18A 3FXQA 3IK6B 3QXMA 1B6HA 1Y4TA 4FORA 5I57B 3IOUA 1H44A 1RYXA 3RYDA 1DMBA 4GWUA 3TTLA 4X48A 4OWDA 1QKAA 2F78A 1A8EA 2AL4A 4UA8A 5EQAA 1JW1A 4YICA 4H46A 1TT1A 1ANFA 5EHMA 1US4A 1FBEA 4H67A 4XF5A 1DOTA 4ZZAA 4NX1A 1OQHA 4JSDA 4F3BA 3M8UA 3DLNA 4P1LA 1LLSA 2B3FA 2P3VA 5EQ9A 2XXIA 4ECFA 1B9JA 2CMOA 1BP5A 3QK6A 5H8SA 1MQIA 1B4ZA 1VFEA 4RA1A 1DK4A 3O6IA 4PETA 5JTYB 4YKKA 3A3UA 2QS3A 2QS2A 4QFPA 1N84A 3ISPA 2CEYA 5CM6A 4MMPA 4L17A 1NI9A 4N13A 4ELPA 3E79A 3FD3A 3DP4A 2XXHA 3FZVA 1UIUA 2FNCA 3PUWE 1N04A 1AL3A 3KJTA 2E1SA 4TOZA 2OWZA 5CRYA
chains in the Genus database with same CATH topology
2R6GE 4MBPA 1MY2A 2OLBA 4HCWA 4LATA 5F1QA 3TZAA 3N6TA 3E4RA 1QJMA 3B7DA 4KFQA 4Q8RA 5L9SA 3EPEA 1O63A 4BLAA 4POXA 1CE2A 1R1NA 1XHYA 1BLFA 1UTHB 4OQOA 4RPNA 2OJTA 3VFJA 5AA4B 1MH3A 3CR9A 1SQYA 4XXUA 2O6AA 2P0SA 1Y3QA 2FYIA 4I1DA 2H98A 3EHSA 4G8NA 1P1WA 2OWSA 2RC9A 4M4GA 1IXCA 3MZ1A 3KSXA 3TCHA 2HAVA 3LSLA 4F1VA 1J1NA 1AH5A 1M5FA 2UVJA 4ND9A 5KZTA 3HHGA 1UQWA 3V5AA 4GWOA 4AQ4A 3TELA 4QHQA 4H1XA 1B3LA 1VFDA 4R6HA 3TAJA 3TCFA 4JXIA 3PMWA 3HN0A 3IR1A 2X7QA 2HEUA 1GV8A 2X7PA 4ZECA 1R9QA 1B58A 3K2DA 4R72A 3K00A 1LB9A 2GHAA 4NWDA 3U92A 1UTHA 2QRYA 1SYIA 4ONYA 3K6VA 5AA3A 3OENA 4OYVA 5FHOA 1AIVA 2I4BA 2DP8A 3A09A 1EU8A 3V89B 1IQ7A 2O68A 3KOTA 2Y7WA 2XXWA 1OIBA 1B52A 4OFLA 3ZKKA 1M5DA 4LQ5A 1URGA 3N5LA 4GOTA 3W9WA 5JTYA 1NFTA 4GRKA 1LBBA 5I84A 1B40A 4DZ1A 3OEMA 2O1LA 1MY3A 4IB2A 2RC7A 1JW5A 4I62A 4ELQA 2D21A 4PP0A 2VD3A 2VOZA 3C36A 1P1OA 2F34A 3SEXA 4IO3A 4WKMA 1Y1MA 2DVCA 2DWHA 3OO9A 5I2KB 2DOJA 1MXWA 1M5CA 2I0CA 1S7YA 1TWYA 4JWXA 4ZE9A 1FQBA 2XD2A 3MWBA 2F7CA 3B6QA 1MY4A 4HCYA 2ONSA 3IOWA 4NF4A 4R2BA 3PUXE 5FHNA 3E3KA 3M3FA 2GRVA 2Q2AA 4LZ8A 3PPPA 3VLWA 4G77A 1WDNA 2UVIA 4H6DA 5J1DA 3VVFA 2O84X 4FIMA 3MBPA 3MVWA 5L9OA 4DXUA 3FXUA 3K6UA 3IJXB 4ELOA 3FVKA 3KG2A 5I2NB 4PFWA 5KCJA 3PUYE 5L8DA 1URDA 3UA8A 2XXQA 4DE8A 2I3WA 5B7DA 3G3IA 4YB5A 4OEUA 4C1TA 1MDP1 1Z7ME 2UYFA 1GTKA 2XXYA 1GVCA 4NWCA 3OXNA 2RF1A 3TTNA 1VE4A 4XKPA 3QAXA 4NE4A 5H8HB 1MQGA 3M3KA 3GLBA 4QF9A 4LUBA 4ELRA 3C4MA 4P0IA 3FVGA 4BDMA 3SEUA 3FATA 2P1SA 3ONMA 3SEYA 1B7UA 1LBCA 1MQHA 1Y1ZA 2I6EA 4G68B 2UVGA 3TYHA 2ALUA 2CZLA 4R74A 5CBSA 3S9MC 2H5YA 3LUYA 3KN3A 1S9TA 3RY3A 2V3TA 1LB8A 2F8DA 2ESNA 4AB5A 1IXIA 1I6QA 1MG1A 2GH9A 4H8JA 4IO5A 3I3VA 3S2VA 4IO4A 5I2NA 1B5JA 2H4IA 1H3DA 3MVXA 4G2ZA 3KEIA 3P7IA 1B3HA 3USDA 4QSDA 3RT6B 2X26A 4LZ5A 4ZDMA 3UP9A 3VDFA 2XX7A 1A40A 1IZ1A 5AA2D 2ONRA 1LAFE 1NH8A 4U4XA 3H3GA 1B7ZA 1B46A 3MJNA 1N76A 4F19A 1MM6A 3QUFA 2Q89A 4OTEA 4IY6A 5KDTA 4MH5A 3T9XB 1Z7NE 3PPRA 2XXRA 2O7UA 1B32A 1FW0A 1B51A 1FQDA 1P1QA 1SD3A 1SI0A 3IB0A 4KD5A 4NF6A 5H8QB 4ZEBA 2DVZA 1JW4A 1ZJLA 3FV2A 3K6XA 3LSXA 3PMXA 3UIFA 2F35A 5ICTA 3H6VA 2DWIA 4EQ9A 4R9FA 2Q9TA 1QW0A 3PPNA 4H8IA 1DPPA 1IXHA 3WAFA 2PT2A 3ILTB 1Y3NA 2M8CA 3QSLA 4FEDA 3O66A 4O3CA 3H6TA 2PYYA 3C33A 1MDQA 2V84A 1GR2A 1MPDA 4QFNA 1IXGA 4YU0A 3EHUA 1HSJA 4FJPA 1WVJA 4XIGQ 1O7TA 1Y9UA 2ZYMA 3UN6A 4F3GA 5ITPA 3F11A 1SBPA 3MZBA 4KCCA 4ESWA 5H8NA 3TODA 2VP1A 3CI8A 4DCYA 3U8QA 1B4HA 2YLNA 1MXZA 1QUKA 1B7HA 2ABHA 4THIA 3QYTA 3KSJA 4X9TA 1LGBC 1P1UA 2XHDA 3C32A 1SYHA 2Z22A 3N26A 5CC2A 1JEUA 1KWHA 2NUVA 3MC2A 4PE5B 3IB1A 4OEVA 1URSA 2DSFA 3TCGA 3DM0A 1JVYA 2I4CA 3U1OA 1PB9A 3BKIB 5H8HA 4ZS9A 3IO4A 2DYXA 3CFZA 4EDPA 4EXKA 1XS5A 3HPIA 1FTJA 4IGRA 2HCAA 2I48A 3MP8A 3PD9A 5M2VA 4EF1A 5AE4A 3MUQA 2HQ0A 2XXTA 2A5TA 5F7VA 4G68A 3Q28A 4KHZE 1SW2A 3FGSA 4QSCA 3TQWA 4F2OA 5H8FA 3ZSFA 2XXUA 4GXSB 2QMXA 3Q29A 5CMCA 3MZ9A 4KQPA 2V3QA 4RK2A 1S50A 3DP8A 3H7MA 2F36A 4R73A 3G3JA 3RN8A 1EH3A 5ISUA 5H8NB 4BDQA 1LAGE 3PUVE 3Q27A 5I58A 4N07A 3K01A 3VE1B 3E13X 3TTKA 5EYFA 1IIWA 4NEDA 2XXVA 1M5EA 4O3BA 5AA1A 2DQVA 1OMPA 4R75A 1PBQA 4PFYA 1RKMA 4XKQA 1YCJA 5HBCA 4MLVA 1MS7A 3PUZE 4G4PA 1SW1A 1FTLA 2AL5A 3I5OA 3JV9A 2HFBA 3IX1A 4Z7EA 5A5XA 2KLFA 5AA2B 1SW4A 4YMBA 3RQTA 3T9UA 4U22A 2LAOA 4LA9A 1B05A 4RXLA 1B1XA 1N7XA 1POTA 3K6WA 2A5TB 1P1NA 1NMUA 3B6WA 2B65A 2Y7PA 3FJMA 1PBPA 1AOVA 5B70A 5IAIA 3O9PA 4RYAA 4LVQA 3OOAA 2B3BA 1DPEA 1B5IA 1MXVA 2HXWA 5DYHA 3ZS6A 5K2YA 3MAMA 2R71A 3WAEA 5I2KA 4KYSA 5CMMA 2PMSA 1LSTA 2W7YA 3TFLA 2I0BA 4WEPA 1FTOA 1MQDA 4YZZA 3RTWB 3THIA 3IOTA 3OO6A 4NF4B 1SI1A 3R26A 4G68C 4H5GA 4LZ7A 3SKPA 1B3FA 1B0HA 1II5A 1PEBA 3FVOA 1HSLA 3JYRA 4BDNA 2F7BA 2V93A 3TDJA 1D4NA 2GFEA 2I3VA 3CRBA 3CSGA 3A3CA 3HHFA 3MVYA 4XKRA 2RINA 3CG1A 1IITA 2Q88A 1B5HA 4YB6A 4RNSA 5DVJA 5I57A 5IKBA 1MM7A 4NMYA 4R6KA 3GBBA 3MW0A 4F31B 5AA2A 3HV1A 1JNFA 4KYEA 5KCJB 3S4UA 3HSTA 3OSRA 5KDTB 4NF6B 4GXAA 4GD5A 1B1HA 3VV5A 4F29A 5TP9A 1HSEA 3UK4A 1NH7A 1N3XA 4QSEA 4OXVA 4R6YA 3OEKA 2DE2A 3PMVA 3R6UA 3U94A 3LC8A 3KZGA 3OSQA 4GQOA 3S9LC 1DTZA 3IORA 2XD3A 4R2FA 5HM4B 3H06B 3LSFB 4GFRA 2RCBA 3KOSA 4Q30B 3H6UA 3D4CA 5FTIA 1R6ZA 1B0LA 4OMBA 1NNTA 3IOVA 3RPWA 3U72A 2ZNUA 2ZYOA 5CBRA 3IO6A 4X1DA 1LFHA 2IA4A 1JVXA 2QPQA 5BWJA 2DS9A 4QFLA 4F2QA 2REJA 4BDLA 2HZLA 1XOCA 2DWJA 2VD2A 4ZEKA 4DIGA 5I58B 1IUDA 1UTBA 2HAUA 3BBRA 3IJOB 3C9HA 5L9MA 3Q25A 2XXXA 2UYEA 4MFIA 3KGCA 3LSWA 1QULA 1ZKBA 1R9LA 1EZOA 3H6WA 2NWJA 4E0XA 2AYSA 3G3FA 1N0TA 1CB6A 1QVSA 2ZMBA 2Z8FA 2NXOA 5A5XB 4WXJA 2F97A 2RKMA 3T9HB 3RT8A 4E0WA 1DTGA 3SERA 4IO2A 1JETA 1TXFA 1OLCA 2UXAA 2OWTA 5H8FB 2QS1A 1LAHE 2OK2A 4PFTA 1TFDA 5K2XA 3RUMA 1MXYA 4MLQA 1MH4A 3EN3A 4HS7A 2ANJA 3RTFB 3TQLA 1SDXA 3MP6A 4BDRA 4F39A 2UVHA 5ITOA 3U93A 4F3PA 4FATA 2OZZA 5I56A 2H25A 4IO7A 4FE8A 4U21A 2XX8A 1T0KA 1UIVA 3KJ7A 1MQJA 3L6HA 3W9VA 4NTLA 4KCDA 1BTJA 2DWAA 3TMGA 5ICQA 1XC1A 1B3GA 1I6AA 2A5SA 4AB6A 1BKAA 3MPKA 4RK9A 1PDAA 3V83A 3S9NC 4EXLA 1MPBA 1ZLQA 2RCAA 1EZ9A 1QKBA 2Z23A 4ISUA 1I6BA 4YB7A 5EHSA 1ATGA 2I49A 4G8MA 2AIXA 1MRPA 1JEVA 1YPNA 1YTVA 1ZTYA 2QSXA 4FECA 1POY1 3KN7A 4M1VA 3AXFA 1Y3PA 1ELJA 2PVUA 3ECRA 5TPAA 3SEWA 3MPLA 3HO7A 5BUUA 3TTRA 1A99A 4EF2A 4DDDA 4FAJA 1B2HA 5HPQA 2DXRA 3N6UA 1NNKA 3PV0E 1XVYA 3MQ9A 4NF8B 5TP9B 3OMBA 3T93B 2DXYA 1H45A 2O1MA 3W15C 4FEBA 4K3FA 2O7IA 2E0SA 2F7AA 2Z8EA 5LOMA 4I8CA 3TPAA 4Z0IA 3QUJA 2WKYA 2ZNSA 2ZXTA 3K0VA 4MF3A 3FJGA 4NF5B 3KFMA 4RJZA 1FTMA 2V25A 1A7LA 2Y7KA 3G3GA 4OFOA 4R9GA 3T9VA 4U23A 3H03A 2HZKA 2G29A 3PPOA 4ZE8A 4ESXA 1N7WA 2PT1A 3S9EA 2Z8DA 3KN8A 3O6GA 4X1BA 4TLLB 4GVOA 4TQUQ 3VVDA 1N3WA 3K1MA 4H5FA 1LCTA 1EZPA 4QFOA 1FCKA 2H9BA 3CG3A 3DP6A 3HCQA 1UTBB 1NNPA 3K1NA 4DXBA 4P0GA 5TU0A 3PPQA 1USYE 4N6PA 3VVEA 2QS4A 4JWYA 4KYDA 3SESA 3DELB 3ODBA 2D5WA 1Y4CA 4F1UA 2NOOA 3TKDA 3MVZA 3SEVA 3FASA 2F6PA 2Y7RA 2OCUA 2I58A 2FA7A 5DVIA 2ZNTA 4H0WA 4JB7A 1A55A 3K4UA 2IEEA 3PGFA 3FVNA 4H65A 1Q35A 4WEDA 2F6GA 2VHAA 3D4GA 3IB2A 2H99A 3MP1A 2YPNA 4LONB 1BIYA 3FIRA 1IEJA 4QFKA 4RY1A 4XTCQ 1MXUA 4TLMB 4PQJA 3CIJA 4YAHX 5FTHA 4OZ9A 2V3UA 1US5A 4POWA 1NKXA 4IGTA 1TFAA 2BJJX 3IAZA 1Y20A 1SVXB 3OD7A 1OLAA 2ONKE 4JDFA 4ZZEA 5I56B 1WODA 4HTGA 5FHMA 3JZJA 1LFGA 1FTKA 2DE3A 1NL5A 3B6TA 3BFTA 3I6VA 3PU5A 1RYOA 3CFLA 3E9XA 3FXQA 3VXBA 4F18A 1FQCA 3TEPA 1Q1KA 3IK6B 4GLIA 2D3IA 1O64A 3QXMA 3EHTA 3VLVA 1B6HA 1Y4TA 4FORA 1LAXA 3UORA 5I57B 1A54A 3IOUA 3EF7A 1H44A 2PBWA 4GL0A 1RYXA 4OHNA 2ZYKA 1DMBA 3QIMA 3FJ7A 3V8XB 3TTLA 5DT6A 4OENA 4X48A 3C31A 4OETA 4OWDA 5AA4A 2G93A 5CMBA 5I59A 1A8FA 1ZIUA 1QKAA 2F78A 4IY5A 1A8EA 4ZEFA 2AL4A 3SETA 3O6HA 4OESA 4UA8A 1JW1A 2ZYNA 3FUZA 4U1ZA 4YICA 5DEXA 5ELVA 3RLFE 1TT1A 1D3KA 1SW5A 1ANFA 5EHMA 1OQGA 1USYH 1US4A 2Q2CA 1B3EA 1M5BA 3GZGA 4KPTA 2VGQA 4OVJA 4Q5TA 3T66A 4F3SA 2THIA 1VSOA 2GHBA 1LCFA 2F5XA 4OERA 4PFUA 4H67A 1PC3A 4BDOA 3O28A 2O51A 4UACA 1JQFA 1FQFA 1H43A 3FV1A 3UGWA 1DOTA 4EQBA 3TTMA 3R7XA 1OVBA 4ZZAA 3CFXA 2O69A 1FQEA 3CSBA 4GIZA 4RPOA 3C34A 3PD8A 1OQHA 1VR5A 1MPCA 2RC8A 3O29A 4JSDA 4O3AA 2DE4A 3LR1A 4C1UA 1GGGA 1F9BA 1P99A 3IL1B 4DCXA 2XXPA 2R9JA 3EQ1A 3OO7A 5I59B 5DVFA 2OBGA 3K1PA 4C0RA 4F3BA 3M8UA 3OELA 4U4SA 3DLNA 1DSNA 3RGYA 3GBAA 4U1OA 2YJPA 1LFIA 3O97A 1LLSA 1L5TA 3M3LA 4F22A 5CI5A 3N94A 1AMFA 2B3FA 5CMKA 4NF5A 4ZEIA 4EUOA 3FXRA 3ILUB 3O2AA 3G3HA 4IO6A 1ZBMA 2XXIA 4U2RA 4KR5A 1NNFA 4G8HA 3SDFA 4ZEDA 3TUSA 1PB7A 4Q0CA 1ZMGA 2Y7IA 1H76A 4ECFA 1B9JA 4P11A 2CMOA 3BFUA 1BP5A 3H4ZA 3QK6A 4JBZA 5H8SA 2NVUB 1MQIA 3ZKLA 4HW8A 3VXCA 3T96B 1D9VA 3G3KA 1B4ZA 3Q26A 4KI0E 2XX9A 5JK4A 1VFEA 4XKNA 1FQAA 4I9DA 3L6GA 1MXXA 3CVGA 4RA1A 4JWOA 3O6IA 4YKIA 2QJEA 4LQ2A 4PETA 4YKPA 4YKKA 5JTYB 3A3UA 3K02A 3T22A 4EQ7A 1PB8A 2QS3A 2QS2A 1MY1A 4QFPA 3G7WA 3LBSA 4YKJA 1N84A 1ZU0A 3OO8A 5TPAB 1I69A 4YMAA 5CM6A 3GXAA 2Y84A 1QUJA 4DLDA 4F1YA 1XT8A 5DTBA 5H8QA 3KBRA 1D9YA 4GL8A 4OFJA 4L17A 4JSOA 4NF8A 4QRZA 4N13A 4ELPA 4LP2B 3VLUA 5DEXB 2P2AA 3FD3A 2Q8JA 3RNNA 4DXCA 3C35A 1YAEA 1MY0A 2QMWA 3DP4A 2XXHA 2PX1A 3FZVA 1UIUA 1OVTA 2FNCA 2QL3A 1XVXA 3PUWE 1N04A 1AL3A 2REGA 5JEIA 4GF8A 3KJTA 1QUIA 2E1SA 4TOZA 5CRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G E;  4MBP A;  1MY2 A;  2OLB A;  4HCW A;  4LAT A;  5F1Q A;  3TZA A;  3N6T A;  3E4R A;  1QJM A;  3B7D A;  4KFQ A;  4Q8R A;  5L9S A;  3EPE A;  1O63 A;  4BLA A;  4POX A;  1CE2 A;  1R1N A;  1XHY A;  1BLF A;  1UTH B;  4OQO A;  4RPN A;  2OJT A;  3VFJ A;  5AA4 B;  1MH3 A;  3CR9 A;  1SQY A;  4XXU A;  2O6A A;  2P0S A;  1Y3Q A;  2FYI A;  4I1D A;  2H98 A;  3EHS A;  4G8N A;  1P1W A;  2OWS A;  2RC9 A;  4M4G A;  1IXC A;  3MZ1 A;  3KSX A;  3TCH A;  2HAV A;  3LSL A;  4F1V A;  1J1N A;  1AH5 A;  1M5F A;  2UVJ A;  4ND9 A;  5KZT A;  3HHG A;  1UQW A;  3V5A A;  4GWO A;  4AQ4 A;  3TEL A;  4QHQ A;  4H1X A;  1B3L A;  1VFD A;  4R6H A;  3TAJ A;  3TCF A;  4JXI A;  3PMW A;  3HN0 A;  3IR1 A;  2X7Q A;  2HEU A;  1GV8 A;  2X7P A;  4ZEC A;  1R9Q A;  1B58 A;  3K2D A;  4R72 A;  3K00 A;  1LB9 A;  2GHA A;  4NWD A;  3U92 A;  1UTH A;  2QRY A;  1SYI A;  4ONY A;  3K6V A;  5AA3 A;  3OEN A;  4OYV A;  5FHO A;  1AIV A;  2I4B A;  2DP8 A;  3A09 A;  1EU8 A;  3V89 B;  1IQ7 A;  2O68 A;  3KOT A;  2Y7W A;  2XXW A;  1OIB A;  1B52 A;  4OFL A;  3ZKK A;  1M5D A;  4LQ5 A;  1URG A;  3N5L A;  4GOT A;  3W9W A;  5JTY A;  1NFT A;  4GRK A;  1LBB A;  5I84 A;  1B40 A;  4DZ1 A;  3OEM A;  2O1L A;  1MY3 A;  4IB2 A;  2RC7 A;  1JW5 A;  4I62 A;  4ELQ A;  2D21 A;  4PP0 A;  2VD3 A;  2VOZ A;  3C36 A;  1P1O A;  2F34 A;  3SEX A;  4IO3 A;  4WKM A;  1Y1M A;  2DVC A;  2DWH A;  3OO9 A;  5I2K B;  2DOJ A;  1MXW A;  1M5C A;  2I0C A;  1S7Y A;  1TWY A;  4JWX A;  4ZE9 A;  1FQB A;  2XD2 A;  3MWB A;  2F7C A;  3B6Q A;  1MY4 A;  4HCY A;  2ONS A;  3IOW A;  4NF4 A;  4R2B A;  3PUX E;  5FHN A;  3E3K A;  3M3F A;  2GRV A;  2Q2A A;  4LZ8 A;  3PPP A;  3VLW A;  4G77 A;  1WDN A;  2UVI A;  4H6D A;  5J1D A;  3VVF A;  2O84 X;  4FIM A;  3MBP A;  3MVW A;  5L9O A;  4DXU A;  3FXU A;  3K6U A;  3IJX B;  4ELO A;  3FVK A;  3KG2 A;  5I2N B;  4PFW A;  5KCJ A;  3PUY E;  5L8D A;  1URD A;  3UA8 A;  2XXQ A;  4DE8 A;  2I3W A;  5B7D A;  3G3I A;  4YB5 A;  4OEU A;  4C1T A;  1MDP 1;  1Z7M E;  2UYF A;  1GTK A;  2XXY A;  1GVC A;  4NWC A;  3OXN A;  2RF1 A;  3TTN A;  1VE4 A;  4XKP A;  3QAX A;  4NE4 A;  5H8H B;  1MQG A;  3M3K A;  3GLB A;  4QF9 A;  4LUB A;  4ELR A;  3C4M A;  4P0I A;  3FVG A;  4BDM A;  3SEU A;  3FAT A;  2P1S A;  3ONM A;  3SEY A;  1B7U A;  1LBC A;  1MQH A;  1Y1Z A;  2I6E A;  4G68 B;  2UVG A;  3TYH A;  2ALU A;  2CZL A;  4R74 A;  5CBS A;  3S9M C;  2H5Y A;  3LUY A;  3KN3 A;  1S9T A;  3RY3 A;  2V3T A;  1LB8 A;  2F8D A;  2ESN A;  4AB5 A;  1IXI A;  1I6Q A;  1MG1 A;  2GH9 A;  4H8J A;  4IO5 A;  3I3V A;  3S2V A;  4IO4 A;  5I2N A;  1B5J A;  2H4I A;  1H3D A;  3MVX A;  4G2Z A;  3KEI A;  3P7I A;  1B3H A;  3USD A;  4QSD A;  3RT6 B;  2X26 A;  4LZ5 A;  4ZDM A;  3UP9 A;  3VDF A;  2XX7 A;  1A40 A;  1IZ1 A;  5AA2 D;  2ONR A;  1LAF E;  1NH8 A;  4U4X A;  3H3G A;  1B7Z A;  1B46 A;  3MJN A;  1N76 A;  4F19 A;  1MM6 A;  3QUF A;  2Q89 A;  4OTE A;  4IY6 A;  5KDT A;  4MH5 A;  3T9X B;  1Z7N E;  3PPR A;  2XXR A;  2O7U A;  1B32 A;  1FW0 A;  1B51 A;  1FQD A;  1P1Q A;  1SD3 A;  1SI0 A;  3IB0 A;  4KD5 A;  4NF6 A;  5H8Q B;  4ZEB A;  2DVZ A;  1JW4 A;  1ZJL A;  3FV2 A;  3K6X A;  3LSX A;  3PMX A;  3UIF A;  2F35 A;  5ICT A;  3H6V A;  2DWI A;  4EQ9 A;  4R9F A;  2Q9T A;  1QW0 A;  3PPN A;  4H8I A;  1DPP A;  1IXH A;  3WAF A;  2PT2 A;  3ILT B;  1Y3N A;  2M8C A;  3QSL A;  4FED A;  3O66 A;  4O3C A;  3H6T A;  2PYY A;  3C33 A;  1MDQ A;  2V84 A;  1GR2 A;  1MPD A;  4QFN A;  1IXG A;  4YU0 A;  3EHU A;  1HSJ A;  4FJP A;  1WVJ A;  4XIG Q;  1O7T A;  1Y9U A;  2ZYM A;  3UN6 A;  4F3G A;  5ITP A;  3F11 A;  1SBP A;  3MZB A;  4KCC A;  4ESW A;  5H8N A;  3TOD A;  2VP1 A;  3CI8 A;  4DCY A;  3U8Q A;  1B4H A;  2YLN A;  1MXZ A;  1QUK A;  1B7H A;  2ABH A;  4THI A;  3QYT A;  3KSJ A;  4X9T A;  1LGB C;  1P1U A;  2XHD A;  3C32 A;  1SYH A;  2Z22 A;  3N26 A;  5CC2 A;  1JEU A;  1KWH A;  2NUV A;  3MC2 A;  4PE5 B;  3IB1 A;  4OEV A;  1URS A;  2DSF A;  3TCG A;  3DM0 A;  1JVY A;  2I4C A;  3U1O A;  1PB9 A;  3BKI B;  5H8H A;  4ZS9 A;  3IO4 A;  2DYX A;  3CFZ A;  4EDP A;  4EXK A;  1XS5 A;  3HPI A;  1FTJ A;  4IGR A;  2HCA A;  2I48 A;  3MP8 A;  3PD9 A;  5M2V A;  4EF1 A;  5AE4 A;  3MUQ A;  2HQ0 A;  2XXT A;  2A5T A;  5F7V A;  4G68 A;  3Q28 A;  4KHZ E;  1SW2 A;  3FGS A;  4QSC A;  3TQW A;  4F2O A;  5H8F A;  3ZSF A;  2XXU A;  4GXS B;  2QMX A;  3Q29 A;  5CMC A;  3MZ9 A;  4KQP A;  2V3Q A;  4RK2 A;  1S50 A;  3DP8 A;  3H7M A;  2F36 A;  4R73 A;  3G3J A;  3RN8 A;  1EH3 A;  5ISU A;  5H8N B;  4BDQ A;  1LAG E;  3PUV E;  3Q27 A;  5I58 A;  4N07 A;  3K01 A;  3VE1 B;  3E13 X;  3TTK A;  5EYF A;  1IIW A;  4NED A;  2XXV A;  1M5E A;  4O3B A;  5AA1 A;  2DQV A;  1OMP A;  4R75 A;  1PBQ A;  4PFY A;  1RKM A;  4XKQ A;  1YCJ A;  5HBC A;  4MLV A;  1MS7 A;  3PUZ E;  4G4P A;  1SW1 A;  1FTL A;  2AL5 A;  3I5O A;  3JV9 A;  2HFB A;  3IX1 A;  4Z7E A;  5A5X A;  2KLF A;  5AA2 B;  1SW4 A;  4YMB A;  3RQT A;  3T9U A;  4U22 A;  2LAO A;  4LA9 A;  1B05 A;  4RXL A;  1B1X A;  1N7X A;  1POT A;  3K6W A;  2A5T B;  1P1N A;  1NMU A;  3B6W A;  2B65 A;  2Y7P A;  3FJM A;  1PBP A;  1AOV A;  5B70 A;  5IAI A;  3O9P A;  4RYA A;  4LVQ A;  3OOA A;  2B3B A;  1DPE A;  1B5I A;  1MXV A;  2HXW A;  5DYH A;  3ZS6 A;  5K2Y A;  3MAM A;  2R71 A;  3WAE A;  5I2K A;  4KYS A;  5CMM A;  2PMS A;  1LST A;  2W7Y A;  3TFL A;  2I0B A;  4WEP A;  1FTO A;  1MQD A;  4YZZ A;  3RTW B;  3THI A;  3IOT A;  3OO6 A;  4NF4 B;  1SI1 A;  3R26 A;  4G68 C;  4H5G A;  4LZ7 A;  3SKP A;  1B3F A;  1B0H A;  1II5 A;  1PEB A;  3FVO A;  1HSL A;  3JYR A;  4BDN A;  2F7B A;  2V93 A;  3TDJ A;  1D4N A;  2GFE A;  2I3V A;  3CRB A;  3CSG A;  3A3C A;  3HHF A;  3MVY A;  4XKR A;  2RIN A;  3CG1 A;  1IIT A;  2Q88 A;  1B5H A;  4YB6 A;  4RNS A;  5DVJ A;  5I57 A;  5IKB A;  1MM7 A;  4NMY A;  4R6K A;  3GBB A;  3MW0 A;  4F31 B;  5AA2 A;  3HV1 A;  1JNF A;  4KYE A;  5KCJ B;  3S4U A;  3HST A;  3OSR A;  5KDT B;  4NF6 B;  4GXA A;  4GD5 A;  1B1H A;  3VV5 A;  4F29 A;  5TP9 A;  1HSE A;  3UK4 A;  1NH7 A;  1N3X A;  4QSE A;  4OXV A;  4R6Y A;  3OEK A;  2DE2 A;  3PMV A;  3R6U A;  3U94 A;  3LC8 A;  3KZG A;  3OSQ A;  4GQO A;  3S9L C;  1DTZ A;  3IOR A;  2XD3 A;  4R2F A;  5HM4 B;  3H06 B;  3LSF B;  4GFR A;  2RCB A;  3KOS A;  4Q30 B;  3H6U A;  3D4C A;  5FTI A;  1R6Z A;  1B0L A;  4OMB A;  1NNT A;  3IOV A;  3RPW A;  3U72 A;  2ZNU A;  2ZYO A;  5CBR A;  3IO6 A;  4X1D A;  1LFH A;  2IA4 A;  1JVX A;  2QPQ A;  5BWJ A;  2DS9 A;  4QFL A;  4F2Q A;  2REJ A;  4BDL A;  2HZL A;  1XOC A;  2DWJ A;  2VD2 A;  4ZEK A;  4DIG A;  5I58 B;  1IUD A;  1UTB A;  2HAU A;  3BBR A;  3IJO B;  3C9H A;  5L9M A;  3Q25 A;  2XXX A;  2UYE A;  4MFI A;  3KGC A;  3LSW A;  1QUL A;  1ZKB A;  1R9L A;  1EZO A;  3H6W A;  2NWJ A;  4E0X A;  2AYS A;  3G3F A;  1N0T A;  1CB6 A;  1QVS A;  2ZMB A;  2Z8F A;  2NXO A;  5A5X B;  4WXJ A;  2F97 A;  2RKM A;  3T9H B;  3RT8 A;  4E0W A;  1DTG A;  3SER A;  4IO2 A;  1JET A;  1TXF A;  1OLC A;  2UXA A;  2OWT A;  5H8F B;  2QS1 A;  1LAH E;  2OK2 A;  4PFT A;  1TFD A;  5K2X A;  3RUM A;  1MXY A;  4MLQ A;  1MH4 A;  3EN3 A;  4HS7 A;  2ANJ A;  3RTF B;  3TQL A;  1SDX A;  3MP6 A;  4BDR A;  4F39 A;  2UVH A;  5ITO A;  3U93 A;  4F3P A;  4FAT A;  2OZZ A;  5I56 A;  2H25 A;  4IO7 A;  4FE8 A;  4U21 A;  2XX8 A;  1T0K A;  1UIV A;  3KJ7 A;  1MQJ A;  3L6H A;  3W9V A;  4NTL A;  4KCD A;  1BTJ A;  2DWA A;  3TMG A;  5ICQ A;  1XC1 A;  1B3G A;  1I6A A;  2A5S A;  4AB6 A;  1BKA A;  3MPK A;  4RK9 A;  1PDA A;  3V83 A;  3S9N C;  4EXL A;  1MPB A;  1ZLQ A;  2RCA A;  1EZ9 A;  1QKB A;  2Z23 A;  4ISU A;  1I6B A;  4YB7 A;  5EHS A;  1ATG A;  2I49 A;  4G8M A;  2AIX A;  1MRP A;  1JEV A;  1YPN A;  1YTV A;  1ZTY A;  2QSX A;  4FEC A;  1POY 1;  3KN7 A;  4M1V A;  3AXF A;  1Y3P A;  1ELJ A;  2PVU A;  3ECR A;  5TPA A;  3SEW A;  3MPL A;  3HO7 A;  5BUU A;  3TTR A;  1A99 A;  4EF2 A;  4DDD A;  4FAJ A;  1B2H A;  5HPQ A;  2DXR A;  3N6U A;  1NNK A;  3PV0 E;  1XVY A;  3MQ9 A;  4NF8 B;  5TP9 B;  3OMB A;  3T93 B;  2DXY A;  1H45 A;  2O1M A;  3W15 C;  4FEB A;  4K3F A;  2O7I A;  2E0S A;  2F7A A;  2Z8E A;  5LOM A;  4I8C A;  3TPA A;  4Z0I A;  3QUJ A;  2WKY A;  2ZNS A;  2ZXT A;  3K0V A;  4MF3 A;  3FJG A;  4NF5 B;  3KFM A;  4RJZ A;  1FTM A;  2V25 A;  1A7L A;  2Y7K A;  3G3G A;  4OFO A;  4R9G A;  3T9V A;  4U23 A;  3H03 A;  2HZK A;  2G29 A;  3PPO A;  4ZE8 A;  4ESX A;  1N7W A;  2PT1 A;  3S9E A;  2Z8D A;  3KN8 A;  3O6G A;  4X1B A;  4TLL B;  4GVO A;  4TQU Q;  3VVD A;  1N3W A;  3K1M A;  4H5F A;  1LCT A;  1EZP A;  4QFO A;  1FCK A;  2H9B A;  3CG3 A;  3DP6 A;  3HCQ A;  1UTB B;  1NNP A;  3K1N A;  4DXB A;  4P0G A;  5TU0 A;  3PPQ A;  1USY E;  4N6P A;  3VVE A;  2QS4 A;  4JWY A;  4KYD A;  3SES A;  3DEL B;  3ODB A;  2D5W A;  1Y4C A;  4F1U A;  2NOO A;  3TKD A;  3MVZ A;  3SEV A;  3FAS A;  2F6P A;  2Y7R A;  2OCU A;  2I58 A;  2FA7 A;  5DVI A;  2ZNT A;  4H0W A;  4JB7 A;  1A55 A;  3K4U A;  2IEE A;  3PGF A;  3FVN A;  4H65 A;  1Q35 A;  4WED A;  2F6G A;  2VHA A;  3D4G A;  3IB2 A;  2H99 A;  3MP1 A;  2YPN A;  4LON B;  1BIY A;  3FIR A;  1IEJ A;  4QFK A;  4RY1 A;  4XTC Q;  1MXU A;  4TLM B;  4PQJ A;  3CIJ A;  4YAH X;  5FTH A;  4OZ9 A;  2V3U A;  1US5 A;  4POW A;  1NKX A;  4IGT A;  1TFA A;  2BJJ X;  3IAZ A;  1Y20 A;  1SVX B;  3OD7 A;  1OLA A;  2ONK E;  4JDF A;  4ZZE A;  5I56 B;  1WOD A;  4HTG A;  5FHM A;  3JZJ A;  1LFG A;  1FTK A;  2DE3 A;  1NL5 A;  3B6T A;  3BFT A;  3I6V A;  3PU5 A;  1RYO A;  3CFL A;  3E9X A;  3FXQ A;  3VXB A;  4F18 A;  1FQC A;  3TEP A;  1Q1K A;  3IK6 B;  4GLI A;  2D3I A;  1O64 A;  3QXM A;  3EHT A;  3VLV A;  1B6H A;  1Y4T A;  4FOR A;  1LAX A;  3UOR A;  5I57 B;  1A54 A;  3IOU A;  3EF7 A;  1H44 A;  2PBW A;  4GL0 A;  1RYX A;  4OHN A;  2ZYK A;  1DMB A;  3QIM A;  3FJ7 A;  3V8X B;  3TTL A;  5DT6 A;  4OEN A;  4X48 A;  3C31 A;  4OET A;  4OWD A;  5AA4 A;  2G93 A;  5CMB A;  5I59 A;  1A8F A;  1ZIU A;  1QKA A;  2F78 A;  4IY5 A;  1A8E A;  4ZEF A;  2AL4 A;  3SET A;  3O6H A;  4OES A;  4UA8 A;  1JW1 A;  2ZYN A;  3FUZ A;  4U1Z A;  4YIC A;  5DEX A;  5ELV A;  3RLF E;  1TT1 A;  1D3K A;  1SW5 A;  1ANF A;  5EHM A;  1OQG A;  1USY H;  1US4 A;  2Q2C A;  1B3E A;  1M5B A;  3GZG A;  4KPT A;  2VGQ A;  4OVJ A;  4Q5T A;  3T66 A;  4F3S A;  2THI A;  1VSO A;  2GHB A;  1LCF A;  2F5X A;  4OER A;  4PFU A;  4H67 A;  1PC3 A;  4BDO A;  3O28 A;  2O51 A;  4UAC A;  1JQF A;  1FQF A;  1H43 A;  3FV1 A;  3UGW A;  1DOT A;  4EQB A;  3TTM A;  3R7X A;  1OVB A;  4ZZA A;  3CFX A;  2O69 A;  1FQE A;  3CSB A;  4GIZ A;  4RPO A;  3C34 A;  3PD8 A;  1OQH A;  1VR5 A;  1MPC A;  2RC8 A;  3O29 A;  4JSD A;  4O3A A;  2DE4 A;  3LR1 A;  4C1U A;  1GGG A;  1F9B A;  1P99 A;  3IL1 B;  4DCX A;  2XXP A;  2R9J A;  3EQ1 A;  3OO7 A;  5I59 B;  5DVF A;  2OBG A;  3K1P A;  4C0R A;  4F3B A;  3M8U A;  3OEL A;  4U4S A;  3DLN A;  1DSN A;  3RGY A;  3GBA A;  4U1O A;  2YJP A;  1LFI A;  3O97 A;  1LLS A;  1L5T A;  3M3L A;  4F22 A;  5CI5 A;  3N94 A;  1AMF A;  2B3F A;  5CMK A;  4NF5 A;  4ZEI A;  4EUO A;  3FXR A;  3ILU B;  3O2A A;  3G3H A;  4IO6 A;  1ZBM A;  2XXI A;  4U2R A;  4KR5 A;  1NNF A;  4G8H A;  3SDF A;  4ZED A;  3TUS A;  1PB7 A;  4Q0C A;  1ZMG A;  2Y7I A;  1H76 A;  4ECF A;  1B9J A;  4P11 A;  2CMO A;  3BFU A;  1BP5 A;  3H4Z A;  3QK6 A;  4JBZ A;  5H8S A;  2NVU B;  1MQI A;  3ZKL A;  4HW8 A;  3VXC A;  3T96 B;  1D9V A;  3G3K A;  1B4Z A;  3Q26 A;  4KI0 E;  2XX9 A;  5JK4 A;  1VFE A;  4XKN A;  1FQA A;  4I9D A;  3L6G A;  1MXX A;  3CVG A;  4RA1 A;  4JWO A;  3O6I A;  4YKI A;  2QJE A;  4LQ2 A;  4PET A;  4YKP A;  4YKK A;  5JTY B;  3A3U A;  3K02 A;  3T22 A;  4EQ7 A;  1PB8 A;  2QS3 A;  2QS2 A;  1MY1 A;  4QFP A;  3G7W A;  3LBS A;  4YKJ A;  1N84 A;  1ZU0 A;  3OO8 A;  5TPA B;  1I69 A;  4YMA A;  5CM6 A;  3GXA A;  2Y84 A;  1QUJ A;  4DLD A;  4F1Y A;  1XT8 A;  5DTB A;  5H8Q A;  3KBR A;  1D9Y A;  4GL8 A;  4OFJ A;  4L17 A;  4JSO A;  4NF8 A;  4QRZ A;  4N13 A;  4ELP A;  4LP2 B;  3VLU A;  5DEX B;  2P2A A;  3FD3 A;  2Q8J A;  3RNN A;  4DXC A;  3C35 A;  1YAE A;  1MY0 A;  2QMW A;  3DP4 A;  2XXH A;  2PX1 A;  3FZV A;  1UIU A;  1OVT A;  2FNC A;  2QL3 A;  1XVX A;  3PUW E;  1N04 A;  1AL3 A;  2REG A;  5JEI A;  4GF8 A;  3KJT A;  1QUI A;  2E1S A;  4TOZ A;  5CRY A; 
#chains in the Genus database with same CATH topology
 2R6G E;  4MBP A;  2OLB A;  4HCW A;  3E4R A;  1QJM A;  3B7D A;  4N4U A;  4KFQ A;  3BIG A;  5L9S A;  4BLA A;  1O63 A;  1R1N A;  4RPN A;  1UTH B;  5AA4 B;  3CR9 A;  4XXU A;  2O6A A;  2H98 A;  4PC9 A;  2HAV A;  1LBZ A;  4R6H A;  4ZEC A;  3K6V A;  5AA3 A;  1AIV A;  2I4B A;  2Y7W A;  1RDX A;  1URG A;  4PTK A;  3W9W A;  1B40 A;  2O1L A;  4N6K A;  2D21 A;  1Y1M A;  3OO9 A;  2I0C A;  1MXW A;  4JWX A;  3MWB A;  2F7C A;  1MY4 A;  3IOW A;  3E3K A;  2GRV A;  3VLW A;  3VVF A;  2O84 X;  4OVQ A;  4PFW A;  4YB5 A;  1Z7M E;  1GTK A;  4YMA A;  3TTN A;  4XKP A;  5H8H B;  4NE4 A;  1MQG A;  4QF9 A;  3FVG A;  4BDM A;  3FAT A;  1LBW A;  3U65 A;  3SEY A;  1LBC A;  4G68 B;  2ALU A;  1G0H A;  2CZL A;  5CBS A;  3S9M C;  3RY3 A;  3LUY A;  3KN3 A;  1LB8 A;  4AB5 A;  1I6Q A;  4IO5 A;  4OAN A;  5I2N A;  1H3D A;  3KEI A;  3P7I A;  1A40 A;  3H3G A;  4PDD A;  4OTE A;  5I84 A;  2XXR A;  4KD5 A;  1SD3 A;  2F35 A;  4XEQ A;  1DBZ A;  4FED A;  1YXI A;  4PAI A;  4QFN A;  1MPD A;  1IXG A;  4YU0 A;  1HSJ A;  4XIG Q;  1O7T A;  1Y9U A;  2ZYM A;  4DI4 B;  5ITP A;  3F11 A;  3MZB A;  5H8N A;  3TOD A;  2ABH A;  4PFI A;  5CC2 A;  1P1U A;  2XHD A;  3C32 A;  3N26 A;  3IB1 A;  1URS A;  3TCG A;  4LN5 A;  1IMA A;  4EDP A;  1XS5 A;  3HPI A;  1FBF A;  3MUQ A;  4MHF A;  1RDY A;  4KHZ E;  4F2O A;  4PBH A;  2QMX A;  4KQP A;  2V3Q A;  3DP8 A;  3H7M A;  2F36 A;  4GX6 A;  3VE1 B;  2XXV A;  5ET6 A;  4PFY A;  4XKQ A;  4MLV A;  4KXP A;  1FTL A;  2AL5 A;  3IX1 A;  5AA2 B;  1SW4 A;  5J16 A;  1B05 A;  1JP4 A;  1B1X A;  5IAI A;  3O9P A;  4LVQ A;  3ZS6 A;  2HXW A;  5K2Y A;  2PMS A;  4PFR A;  4WEP A;  3RTW B;  3OO6 A;  4NF4 B;  1SI1 A;  4H5G A;  3JYR A;  3TDJ A;  2GFE A;  2I3V A;  3CSG A;  3A3C A;  4XKR A;  3MVY A;  2RIN A;  5IKB A;  4R6K A;  3GBB A;  5KCJ B;  3HV1 A;  1NUW A;  1FPI A;  1NH7 A;  4QSE A;  3OEK A;  2DE2 A;  3R6U A;  3U94 A;  2XD3 A;  4PF6 A;  3LSF B;  1FSA A;  3KOS A;  1R6Z A;  2BJI A;  1NNT A;  3RPW A;  1AWB A;  1JVX A;  5BWJ A;  5EQ7 A;  2DS9 A;  4QFL A;  4F2Q A;  4OVR A;  2VT5 A;  2DWJ A;  2VD2 A;  4DIG A;  3BBR A;  5L9M A;  3Q25 A;  1QUL A;  3H6W A;  3G3F A;  1N0T A;  5IZ1 A;  2F97 A;  3T9H B;  2FIX A;  1JET A;  1TXF A;  2OWT A;  5H8F B;  1Q9D A;  2OK2 A;  4HS7 A;  4GWY A;  4F3P A;  4F39 A;  2UVH A;  5I56 A;  4IO7 A;  1NUX A;  1B3G A;  4AB6 A;  2L5V A;  1ZLQ A;  1EZ9 A;  1QKB A;  4G8M A;  2AIX A;  4FEC A;  4M1V A;  1ELJ A;  5BUU A;  4EF2 A;  4FAJ A;  1B2H A;  5HPQ A;  1NNK A;  3PV0 E;  1H45 A;  2F7A A;  2Z8E A;  5LOM A;  4I8C A;  3TPA A;  4MF3 A;  1NV3 A;  3KFM A;  2Y7K A;  1A7L A;  2G29 A;  3PPO A;  4P47 A;  2Z8D A;  1NNP A;  4DXB A;  5TU0 A;  2WBD A;  4P3L A;  3MVZ A;  4PBQ A;  3IFC A;  2QVU A;  5DVI A;  3K4U A;  3FVN A;  4H65 A;  1Q35 A;  4MCO A;  2H99 A;  4QFK A;  3FIR A;  4YAH X;  4P1E A;  1MXU A;  4TLM B;  3CIJ A;  5FTH A;  4OZ9 A;  1TFA A;  3IAZ A;  1OLA A;  1WOD A;  1LFG A;  3B6T A;  3VXB A;  3TEP A;  1Q1K A;  4GLI A;  1A54 A;  4OHN A;  1FPG A;  4X04 A;  3V8X B;  4OEN A;  5AA4 A;  2G93 A;  5CMB A;  4ZEF A;  4OES A;  5DEX A;  1SW5 A;  1M5B A;  3GZG A;  4OVJ A;  4Q5T A;  2F5X A;  4PFU A;  3O28 A;  2O51 A;  1JQF A;  4NN3 A;  1H43 A;  3CSB A;  4GIZ A;  4RPO A;  3RPL A;  3O29 A;  1MPC A;  4O3A A;  4DCX A;  1P99 A;  4GX4 A;  2XXP A;  3EQ1 A;  5I59 B;  4C0R A;  1DSN A;  2Y5K A;  2HPG A;  2YJP A;  4HE0 A;  4NF5 A;  4EUO A;  3FXR A;  3O2A A;  3G3H A;  2PCR A;  1ZMG A;  2Y7I A;  1H76 A;  4P11 A;  3ZKL A;  2NVU B;  4HW8 A;  3VXC A;  1D9V A;  5JK4 A;  4XKN A;  3L6G A;  3K02 A;  4EQ7 A;  3LBS A;  1ZU0 A;  1I69 A;  3GXA A;  1QUJ A;  3KBR A;  4GL8 A;  1XI6 A;  3E78 A;  3VLU A;  1YAE A;  1MY0 A;  1OVT A;  2QL3 A;  1XVX A;  5JEI A;  3N6T A;  1K9Y A;  4Q8R A;  1LBY A;  2R8T A;  4POX A;  4P9K A;  1BLF A;  4OQO A;  3VFJ A;  1MH3 A;  2Q74 A;  2P0S A;  4MNP A;  3EHS A;  1P1W A;  4GBW A;  2RC9 A;  1IXC A;  3MZ1 A;  3TCH A;  1J1N A;  1AH5 A;  1M5F A;  2UVJ A;  4ND9 A;  5KZT A;  4P56 A;  3D1R A;  1FJ6 A;  4QHQ A;  1FRP A;  1B3L A;  3TCF A;  2HEU A;  3GYY A;  1B58 A;  3K2D A;  2QRY A;  1SYI A;  4OYV A;  5FHO A;  3A09 A;  1EU8 A;  1IQ7 A;  4OFL A;  1OIB A;  5JTY A;  1NFT A;  4IB2 A;  1MY3 A;  5EQ8 A;  4ELQ A;  4PP0 A;  2F34 A;  4NG7 A;  5I2K B;  1S7Y A;  4HCY A;  4R2B A;  3PUX E;  3M3F A;  4LZ8 A;  5J1D A;  1WDN A;  2UVI A;  3MBP A;  1FPB A;  4N8Y A;  3IJX B;  4ELO A;  3FVK A;  3KG2 A;  3PUY E;  4DE8 A;  5B7D A;  4C1T A;  1MDP 1;  2UYF A;  1VE4 A;  3QAX A;  4ELR A;  4P0I A;  4MNI A;  1B7U A;  2CZH A;  2UVG A;  3TYH A;  2GH9 A;  3I3V A;  2WYP A;  3MVX A;  4G2Z A;  3USD A;  4QSD A;  1IZ1 A;  5FBP A;  1B46 A;  3MJN A;  2Q89 A;  4I3Y A;  1Z7N E;  4ZE9 A;  3T9X B;  1B51 A;  5H8Q B;  4ZEB A;  4NHB A;  1JW4 A;  1ZJL A;  3LSX A;  3UIF A;  5ICT A;  2DWI A;  4EQ9 A;  1QW0 A;  3PPN A;  3NOH A;  4H8I A;  1IXH A;  3ILT B;  3QSL A;  3O66 A;  3H6T A;  2PYY A;  3FBP A;  2VPO A;  1GR2 A;  2F3D A;  3EHU A;  4FJP A;  1WVJ A;  3UN6 A;  4DCY A;  3U8Q A;  1QUK A;  4X9T A;  2Z22 A;  1JEU A;  3FXB A;  2I4C A;  1PB9 A;  5H8H A;  3IO4 A;  1FTJ A;  4IGR A;  2HCA A;  2I48 A;  5AE4 A;  2HQ0 A;  5F7V A;  4G68 A;  5H8F A;  3FGS A;  1D9Q A;  4QSC A;  3Q29 A;  3MZ9 A;  3RN8 A;  5ISU A;  3Q27 A;  3K01 A;  3TTK A;  5EYF A;  5AA1 A;  1OMP A;  2FBP A;  5HBC A;  1FJ9 A;  4G4P A;  3JV9 A;  4Z7E A;  2ZZV A;  4YMB A;  4LA9 A;  1EYJ A;  5IGA A;  1N7X A;  1POT A;  2A5T B;  3FJM A;  5B70 A;  3OOA A;  2B3B A;  1B5I A;  3MAM A;  2R71 A;  4KYS A;  1FTO A;  3THI A;  3IOT A;  4G68 C;  4AS5 A;  4BDN A;  2V93 A;  3A29 A;  3CG1 A;  1IIT A;  5I57 A;  5ESY A;  4GXA A;  4F29 A;  5TP9 A;  1HSE A;  3UK4 A;  4OXV A;  4R6Y A;  4JVI A;  3LC8 A;  3OSQ A;  3IOR A;  4GFR A;  2FIE A;  1B0L A;  3IOV A;  2ZYO A;  1KZ8 A;  3IO6 A;  2QPQ A;  2REJ A;  4ZEK A;  1UTB A;  2HAU A;  2UYE A;  4MFI A;  3KGC A;  2FHY A;  1R9L A;  2CZI A;  4E0X A;  1QVS A;  2Z8F A;  2NXO A;  2RKM A;  4E0W A;  4JVD A;  3RUM A;  1FPE A;  5I7I A;  5K2X A;  3EN3 A;  4BDR A;  4FAT A;  3U93 A;  2H25 A;  2XX8 A;  1T0K A;  5ICQ A;  4KCD A;  3TMG A;  2A5S A;  3MPK A;  4RK9 A;  3V83 A;  1MPB A;  2Z23 A;  1MRP A;  1ZTY A;  1YPN A;  1YTV A;  1POY 1;  3KN7 A;  3SEW A;  3HO7 A;  3N6U A;  3MQ9 A;  3OMB A;  3T93 B;  2DXY A;  2HXR A;  2ZXT A;  3FJG A;  4NF5 B;  1FTM A;  2V25 A;  4OFO A;  4U23 A;  3B50 A;  3KBZ A;  4ZE8 A;  2HZK A;  3O6G A;  4TQU Q;  3VVD A;  1N3W A;  4H5F A;  2OX3 A;  4NGU A;  1IMB A;  1FCK A;  1BK4 A;  3CG3 A;  3HCQ A;  1NV0 A;  4N6P A;  3IFA A;  2QS4 A;  4JWY A;  3SES A;  3DEL B;  4F1U A;  2OCU A;  2FA7 A;  4JB7 A;  1YZ0 A;  2F6G A;  3D4G A;  2ZZW A;  4XTC Q;  2YPN A;  1QGX A;  2V3U A;  2BJJ X;  1SVX B;  5I56 B;  3JZJ A;  4MIJ A;  3CFL A;  3E9X A;  1O64 A;  3UOR A;  3EF7 A;  1FBG A;  2PBW A;  4GL0 A;  1IMC A;  2ZYK A;  3QIM A;  2ZYN A;  4U1Z A;  3FUZ A;  1USY H;  3T66 A;  4F3S A;  1VSO A;  1PC3 A;  4UAC A;  1FQF A;  3FV1 A;  3UGW A;  4EQB A;  4NAP A;  3TTM A;  3R7X A;  3CFX A;  2O69 A;  3C34 A;  1VR5 A;  2RC8 A;  2DE4 A;  4C1U A;  1F9B A;  2R9J A;  3OO7 A;  3K1P A;  4XFE A;  3GBA A;  4U1O A;  2XWI A;  1LFI A;  3O97 A;  5CI5 A;  3N94 A;  1AMF A;  4O7I A;  4ZEI A;  3ILU B;  4KR5 A;  1NNF A;  4PAF A;  3SDF A;  4Q0C A;  5IM2 A;  1NV4 A;  1LBX A;  3H4Z A;  2PFY A;  4JBZ A;  3T96 B;  3G3K A;  2XX9 A;  1FQA A;  2XWK A;  3CVG A;  4YKI A;  2QJE A;  3LUZ A;  1PB8 A;  1MY1 A;  4YKJ A;  1NV7 A;  5TPA B;  2Y84 A;  4DLD A;  4F1Y A;  1XT8 A;  2ZZX A;  3EKI A;  4OFJ A;  4NF8 A;  1CNQ A;  3MST A;  4LP2 B;  5DEX B;  2P2A A;  1FBP A;  2Q8J A;  3C35 A;  2QMW A;  2REG A;  3K6U A;  4IR8 A;  4LAT A;  3TZA A;  5F1Q A;  1XHY A;  3RPL B;  1NV5 A;  1Y3Q A;  2FYI A;  4G8N A;  4M4G A;  3LSL A;  4F1V A;  3V5A A;  4GWO A;  4OA4 A;  4JXI A;  3HN0 A;  3IR1 A;  4MEV A;  4O7M A;  4MJO A;  2X7P A;  1R9Q A;  1LB9 A;  3U92 A;  1UTH A;  1SPI A;  4ONY A;  1NV6 A;  2QVR A;  2DP8 A;  1RDZ A;  1FPJ A;  1B52 A;  4GOT A;  4GRK A;  4AS4 A;  4DZ1 A;  3OEM A;  4NF0 A;  4I62 A;  2VD3 A;  3C36 A;  1P1O A;  4IO3 A;  4OVS A;  2JJK A;  4P8B A;  1M5C A;  1TWY A;  2V4C A;  4O8M A;  3B6Q A;  2MKZ A;  4NF4 A;  2F3B A;  3PPP A;  4G77 A;  4H6D A;  4FIM A;  4GX3 A;  4DXU A;  3FXU A;  5I2N B;  5KCJ A;  5L8D A;  1URD A;  2XXQ A;  3G3I A;  4OEU A;  2XXY A;  1GVC A;  4NWC A;  2RF1 A;  3M3K A;  3T0J A;  4LUB A;  3ONM A;  1MQH A;  4R74 A;  1S9T A;  1MG1 A;  3S2V A;  4IO4 A;  1B5J A;  2H4I A;  4QBA A;  2X26 A;  3UP9 A;  4ZDM A;  3VDF A;  2XX7 A;  5AA2 D;  4U4X A;  2FVZ A;  3QUF A;  4MH5 A;  3PPR A;  2O7U A;  1B32 A;  1FQD A;  3FV2 A;  3K6X A;  4R9F A;  2Q9T A;  3WAF A;  1Y3N A;  2M8C A;  4O3C A;  1MDQ A;  2V84 A;  4F3G A;  5ET8 A;  1SBP A;  2VP1 A;  4THI A;  1B4H A;  2YLN A;  1MXZ A;  1B7H A;  3QYT A;  1LGB C;  2XA5 A;  3ROJ A;  3MC2 A;  2DDK A;  3DM0 A;  1JVY A;  3BKI B;  4ZS9 A;  1EYK A;  3MP8 A;  3PD9 A;  1IMD A;  2XXT A;  3Q28 A;  1SW2 A;  5ET5 A;  5CMC A;  4RK2 A;  1S50 A;  5IZZ A;  4R73 A;  5H8N B;  4BDQ A;  5I58 A;  4N07 A;  4OVP A;  2PFZ A;  3E13 X;  4NED A;  4O3B A;  1YCJ A;  1MS7 A;  5A5X A;  4O94 A;  2HFB A;  2KLF A;  3T9U A;  2LAO A;  4RXL A;  3K6W A;  3TQL A;  1P1N A;  3B6W A;  2B65 A;  2Y7P A;  1PBP A;  2WYK A;  4RYA A;  1DPE A;  1MXV A;  5DYH A;  3WAE A;  5CMM A;  2W7Y A;  2I0B A;  4YZZ A;  1B3F A;  1B0H A;  1PEB A;  1HSL A;  2F7B A;  3HHF A;  2KQZ A;  5EYG A;  2Q88 A;  5DVJ A;  1MM7 A;  4NMY A;  3MW0 A;  1IME A;  4F31 B;  5AA2 A;  4KYE A;  5KDT B;  3CHG A;  3S4U A;  3HST A;  3OSR A;  4NF6 B;  3PMV A;  4N91 A;  1FPD A;  3KZG A;  4R2F A;  5HM4 B;  4PFB A;  2RCB A;  1VDW A;  3D4C A;  3U72 A;  5CBR A;  4BDL A;  2HZL A;  4I3E A;  1NUZ A;  3IJO B;  2GQ1 A;  3LSW A;  1ZKB A;  1EZO A;  1CB6 A;  2ZMB A;  1DTG A;  3SER A;  1OLC A;  5ET7 A;  2QS1 A;  1LAH E;  4PFT A;  4MLQ A;  5EYH A;  3RTF B;  2ANJ A;  4PE3 A;  1SDX A;  2OZZ A;  4FE8 A;  4U21 A;  3KJ7 A;  4GWW A;  4NTL A;  1XC1 A;  4I40 A;  1I6A A;  1BKA A;  4EXL A;  2RCA A;  4ISU A;  4YB7 A;  1ATG A;  2I49 A;  1JEV A;  3AXF A;  2PVU A;  3ECR A;  1FBC A;  3TTR A;  1A99 A;  5TP9 B;  3W15 C;  1DCU A;  2O7I A;  2E0S A;  1FPK A;  4Z0I A;  3QUJ A;  4RJZ A;  3T9V A;  3H03 A;  5F24 A;  4ESX A;  2PT1 A;  2QVV A;  4X1B A;  3K1M A;  1LCT A;  3DP6 A;  2Y5L A;  1UTB B;  4P0G A;  3PPQ A;  1USY E;  3VVE A;  4KYD A;  3ODB A;  2D5W A;  1Y4C A;  3TKD A;  1KA1 A;  2I58 A;  1FBD A;  2ZNT A;  4N6D A;  2VHA A;  3IB2 A;  4RY1 A;  4N15 A;  4PQJ A;  5I3S A;  1NKX A;  1Y20 A;  4ZZE A;  4N81 A;  2ONK E;  5FHM A;  1FPF A;  2CZK A;  1FTK A;  1NL5 A;  5IZ3 A;  1RYO A;  1FQC A;  2D3I A;  3EHT A;  3VLV A;  4PAK A;  1LAX A;  4NQ8 A;  1EYI A;  3FJ7 A;  5DT6 A;  4HE2 A;  3C31 A;  4OET A;  5I59 A;  1A8F A;  1ZIU A;  4IY5 A;  3SET A;  3MYU A;  3O6H A;  5ELV A;  3RLF E;  1D3K A;  1OQG A;  2Q2C A;  1B3E A;  4KPT A;  2VGQ A;  2THI A;  4HXV A;  2GHB A;  1LCF A;  4BDO A;  4OER A;  1OVB A;  1FQE A;  3PD8 A;  3LR1 A;  1GGG A;  3IL1 B;  5DVF A;  2OBG A;  3OEL A;  4U4S A;  3HFU A;  3RGY A;  1L5T A;  3M3L A;  4F22 A;  2WEF A;  4IO6 A;  1ZBM A;  4U2R A;  4G8H A;  4ZED A;  3TUS A;  1PB7 A;  4X8R A;  1KA0 A;  4GWX A;  3BFU A;  1G0I A;  1LEV A;  3Q26 A;  4KI0 E;  4I9D A;  1MXX A;  4JWO A;  4LQ2 A;  4PF8 A;  4YKP A;  3LV0 A;  3T22 A;  4UAB A;  3G7W A;  3OO8 A;  5DTB A;  5H8Q A;  1D9Y A;  4JSO A;  4QRZ A;  2WBB A;  3RNN A;  4DXC A;  2PX1 A;  4GF8 A;  5A5L A;  2Q8M A;  1QUI A;  1LST A;  2CEX A;  3SKP A;  3TFL A;  1MY2 A;  4OVT A;  3EPE A;  1CE2 A;  2OJT A;  1SQY A;  4I1D A;  2OWS A;  3KSX A;  4HE1 A;  3HHG A;  1UQW A;  4AQ4 A;  3TEL A;  4H1X A;  1VFD A;  3TAJ A;  3PMW A;  2X7Q A;  1GV8 A;  4R72 A;  5LDZ A;  3K00 A;  2GHA A;  4NWD A;  3OEN A;  3QMF A;  3V89 B;  2O68 A;  3KOT A;  2XXW A;  3ZKK A;  1M5D A;  2VPN A;  4LQ5 A;  3N5L A;  3T1B A;  4PCD A;  1LBB A;  2RC7 A;  2XXK A;  1JW5 A;  4MAG A;  2VOZ A;  3SEX A;  4WKM A;  2DVC A;  2DWH A;  2DOJ A;  1FQB A;  2XD2 A;  2ONS A;  2Q2A A;  5L9O A;  3MVW A;  3UA8 A;  1FBH A;  2I3W A;  1NV1 A;  4DI3 D;  2B4L A;  3OXN A;  3GLB A;  2P3N A;  3C4M A;  3SEU A;  2P1S A;  1Y1Z A;  4FBP A;  2I6E A;  2H5Y A;  2V3T A;  2F8D A;  2ESN A;  1IXI A;  4H8J A;  2B4M A;  4PGP A;  4GWS A;  1B3H A;  4GBV A;  3RT6 B;  3SZP A;  4LZ5 A;  2ONR A;  1LAF E;  1NH8 A;  1B7Z A;  1N76 A;  4F19 A;  5DW8 A;  1MM6 A;  4IY6 A;  5KDT A;  1FW0 A;  1SI0 A;  1P1Q A;  3IB0 A;  4NF6 A;  1NUY A;  2DVZ A;  3PMX A;  3H6V A;  1DPP A;  2PT2 A;  3C33 A;  1INP A;  4ESW A;  4KCC A;  3CI8 A;  3PTY A;  3KSJ A;  1SYH A;  1KWH A;  2NUV A;  4PE5 B;  4OEV A;  2DSF A;  3U1O A;  2DYX A;  3CFZ A;  4EXK A;  4EF1 A;  5M2V A;  2A5T A;  4GWZ A;  3TQW A;  3ZSF A;  2XXU A;  4GXS B;  5T3J A;  3G3J A;  1EH3 A;  1LAG E;  3PUV E;  1IIW A;  1M5E A;  2QFL A;  2DQV A;  4R75 A;  1PBQ A;  1RKM A;  1FPL A;  3PUZ E;  1SW1 A;  1YYZ A;  3I5O A;  3RQT A;  4U22 A;  2XWV A;  1AOV A;  1NMU A;  5I2K A;  1MQD A;  5CMK A;  1LBV A;  3R26 A;  4LZ7 A;  1II5 A;  3FVO A;  4MX6 A;  2HHM A;  1D4N A;  3CRB A;  4YB6 A;  1B5H A;  4RNS A;  3B8B A;  1FTA A;  1JNF A;  4GD5 A;  1B1H A;  3VV5 A;  1N3X A;  3BIH A;  4GQO A;  4N8G A;  3S9L C;  1DTZ A;  3H06 B;  4Q30 B;  3H6U A;  5FTI A;  4OMB A;  4PGN A;  2ZNU A;  4G61 A;  4X1D A;  1LFH A;  2IA4 A;  2XWO A;  1IMF A;  1XOC A;  1K9Z A;  1IUD A;  5I58 B;  4JVC A;  3C9H A;  5IZ3 B;  2XXX A;  1NV2 A;  2NWJ A;  2AYS A;  3KC0 A;  5LTC A;  5A5X B;  4WXJ A;  3RT8 A;  4IO2 A;  4H45 A;  2UXA A;  1TFD A;  1MXY A;  1MH4 A;  3KC1 A;  3MP6 A;  5ITO A;  1UIV A;  1MQJ A;  3L6H A;  3W9V A;  1BTJ A;  2DWA A;  1PDA A;  3S9N C;  1I6B A;  5EHS A;  2QSX A;  1Y3P A;  5TPA A;  3MPL A;  4DDD A;  2DXR A;  4NF8 B;  1XVY A;  2O1M A;  4FEB A;  4K3F A;  4MNC A;  2WKY A;  2ZNS A;  3K0V A;  4R9G A;  3G3G A;  1N7W A;  3S9E A;  3KN8 A;  2WX9 A;  4TLL B;  4GVO A;  1EZP A;  4QFO A;  5I5P A;  3K1N A;  2H9B A;  4N17 A;  2NOO A;  3SEV A;  3FAS A;  2F6P A;  2Y7R A;  4QXD A;  4H0W A;  1A55 A;  2IEE A;  5FHN A;  4WED A;  3PGF A;  3MP1 A;  4LON B;  1BIY A;  1IEJ A;  4PDH A;  4POW A;  1US5 A;  4IGT A;  4JDF A;  2KR0 A;  3OD7 A;  4HTG A;  2DE3 A;  3BFT A;  3PU5 A;  3I6V A;  4F18 A;  3FXQ A;  3IK6 B;  3QXM A;  1B6H A;  1Y4T A;  4FOR A;  5I57 B;  3IOU A;  1H44 A;  1RYX A;  3RYD A;  1DMB A;  4GWU A;  3TTL A;  4X48 A;  4OWD A;  1QKA A;  2F78 A;  1A8E A;  2AL4 A;  4UA8 A;  5EQA A;  1JW1 A;  4YIC A;  4H46 A;  1TT1 A;  1ANF A;  5EHM A;  1US4 A;  1FBE A;  4H67 A;  4XF5 A;  1DOT A;  4ZZA A;  4NX1 A;  1OQH A;  4JSD A;  4F3B A;  3M8U A;  3DLN A;  4P1L A;  1LLS A;  2B3F A;  2P3V A;  5EQ9 A;  2XXI A;  4ECF A;  1B9J A;  2CMO A;  1BP5 A;  3QK6 A;  5H8S A;  1MQI A;  1B4Z A;  1VFE A;  4RA1 A;  1DK4 A;  3O6I A;  4PET A;  5JTY B;  4YKK A;  3A3U A;  2QS3 A;  2QS2 A;  4QFP A;  1N84 A;  3ISP A;  2CEY A;  5CM6 A;  4MMP A;  4L17 A;  1NI9 A;  4N13 A;  4ELP A;  3E79 A;  3FD3 A;  3DP4 A;  2XXH A;  3FZV A;  1UIU A;  2FNC A;  3PUW E;  1N04 A;  1AL3 A;  3KJT A;  2E1S A;  4TOZ A;  2OWZ A;  5CRY A; 
#chains in the Genus database with same CATH homology
 2R6G E;  4MBP A;  1MY2 A;  2OLB A;  4HCW A;  4LAT A;  5F1Q A;  3TZA A;  3N6T A;  3E4R A;  1QJM A;  3B7D A;  4KFQ A;  4Q8R A;  5L9S A;  3EPE A;  1O63 A;  4BLA A;  4POX A;  1CE2 A;  1R1N A;  1XHY A;  1BLF A;  1UTH B;  4OQO A;  4RPN A;  2OJT A;  3VFJ A;  5AA4 B;  1MH3 A;  3CR9 A;  1SQY A;  4XXU A;  2O6A A;  2P0S A;  1Y3Q A;  2FYI A;  4I1D A;  2H98 A;  3EHS A;  4G8N A;  1P1W A;  2OWS A;  2RC9 A;  4M4G A;  1IXC A;  3MZ1 A;  3KSX A;  3TCH A;  2HAV A;  3LSL A;  4F1V A;  1J1N A;  1AH5 A;  1M5F A;  2UVJ A;  4ND9 A;  5KZT A;  3HHG A;  1UQW A;  3V5A A;  4GWO A;  4AQ4 A;  3TEL A;  4QHQ A;  4H1X A;  1B3L A;  1VFD A;  4R6H A;  3TAJ A;  3TCF A;  4JXI A;  3PMW A;  3HN0 A;  3IR1 A;  2X7Q A;  2HEU A;  1GV8 A;  2X7P A;  4ZEC A;  1R9Q A;  1B58 A;  3K2D A;  4R72 A;  3K00 A;  1LB9 A;  2GHA A;  4NWD A;  3U92 A;  1UTH A;  2QRY A;  1SYI A;  4ONY A;  3K6V A;  5AA3 A;  3OEN A;  4OYV A;  5FHO A;  1AIV A;  2I4B A;  2DP8 A;  3A09 A;  1EU8 A;  3V89 B;  1IQ7 A;  2O68 A;  3KOT A;  2Y7W A;  2XXW A;  1OIB A;  1B52 A;  4OFL A;  3ZKK A;  1M5D A;  4LQ5 A;  1URG A;  3N5L A;  4GOT A;  3W9W A;  5JTY A;  1NFT A;  4GRK A;  1LBB A;  5I84 A;  1B40 A;  4DZ1 A;  3OEM A;  2O1L A;  1MY3 A;  4IB2 A;  2RC7 A;  1JW5 A;  4I62 A;  4ELQ A;  2D21 A;  4PP0 A;  2VD3 A;  2VOZ A;  3C36 A;  1P1O A;  2F34 A;  3SEX A;  4IO3 A;  4WKM A;  1Y1M A;  2DVC A;  2DWH A;  3OO9 A;  5I2K B;  2DOJ A;  1MXW A;  1M5C A;  2I0C A;  1S7Y A;  1TWY A;  4JWX A;  4ZE9 A;  1FQB A;  2XD2 A;  3MWB A;  2F7C A;  3B6Q A;  1MY4 A;  4HCY A;  2ONS A;  3IOW A;  4NF4 A;  4R2B A;  3PUX E;  5FHN A;  3E3K A;  3M3F A;  2GRV A;  2Q2A A;  4LZ8 A;  3PPP A;  3VLW A;  4G77 A;  1WDN A;  2UVI A;  4H6D A;  5J1D A;  3VVF A;  2O84 X;  4FIM A;  3MBP A;  3MVW A;  5L9O A;  4DXU A;  3FXU A;  3K6U A;  3IJX B;  4ELO A;  3FVK A;  3KG2 A;  5I2N B;  4PFW A;  5KCJ A;  3PUY E;  5L8D A;  1URD A;  3UA8 A;  2XXQ A;  4DE8 A;  2I3W A;  5B7D A;  3G3I A;  4YB5 A;  4OEU A;  4C1T A;  1MDP 1;  1Z7M E;  2UYF A;  1GTK A;  2XXY A;  1GVC A;  4NWC A;  3OXN A;  2RF1 A;  3TTN A;  1VE4 A;  4XKP A;  3QAX A;  4NE4 A;  5H8H B;  1MQG A;  3M3K A;  3GLB A;  4QF9 A;  4LUB A;  4ELR A;  3C4M A;  4P0I A;  3FVG A;  4BDM A;  3SEU A;  3FAT A;  2P1S A;  3ONM A;  3SEY A;  1B7U A;  1LBC A;  1MQH A;  1Y1Z A;  2I6E A;  4G68 B;  2UVG A;  3TYH A;  2ALU A;  2CZL A;  4R74 A;  5CBS A;  3S9M C;  2H5Y A;  3LUY A;  3KN3 A;  1S9T A;  3RY3 A;  2V3T A;  1LB8 A;  2F8D A;  2ESN A;  4AB5 A;  1IXI A;  1I6Q A;  1MG1 A;  2GH9 A;  4H8J A;  4IO5 A;  3I3V A;  3S2V A;  4IO4 A;  5I2N A;  1B5J A;  2H4I A;  1H3D A;  3MVX A;  4G2Z A;  3KEI A;  3P7I A;  1B3H A;  3USD A;  4QSD A;  3RT6 B;  2X26 A;  4LZ5 A;  4ZDM A;  3UP9 A;  3VDF A;  2XX7 A;  1A40 A;  1IZ1 A;  5AA2 D;  2ONR A;  1LAF E;  1NH8 A;  4U4X A;  3H3G A;  1B7Z A;  1B46 A;  3MJN A;  1N76 A;  4F19 A;  1MM6 A;  3QUF A;  2Q89 A;  4OTE A;  4IY6 A;  5KDT A;  4MH5 A;  3T9X B;  1Z7N E;  3PPR A;  2XXR A;  2O7U A;  1B32 A;  1FW0 A;  1B51 A;  1FQD A;  1P1Q A;  1SD3 A;  1SI0 A;  3IB0 A;  4KD5 A;  4NF6 A;  5H8Q B;  4ZEB A;  2DVZ A;  1JW4 A;  1ZJL A;  3FV2 A;  3K6X A;  3LSX A;  3PMX A;  3UIF A;  2F35 A;  5ICT A;  3H6V A;  2DWI A;  4EQ9 A;  4R9F A;  2Q9T A;  1QW0 A;  3PPN A;  4H8I A;  1DPP A;  1IXH A;  3WAF A;  2PT2 A;  3ILT B;  1Y3N A;  2M8C A;  3QSL A;  4FED A;  3O66 A;  4O3C A;  3H6T A;  2PYY A;  3C33 A;  1MDQ A;  2V84 A;  1GR2 A;  1MPD A;  4QFN A;  1IXG A;  4YU0 A;  3EHU A;  1HSJ A;  4FJP A;  1WVJ A;  4XIG Q;  1O7T A;  1Y9U A;  2ZYM A;  3UN6 A;  4F3G A;  5ITP A;  3F11 A;  1SBP A;  3MZB A;  4KCC A;  4ESW A;  5H8N A;  3TOD A;  2VP1 A;  3CI8 A;  4DCY A;  3U8Q A;  1B4H A;  2YLN A;  1MXZ A;  1QUK A;  1B7H A;  2ABH A;  4THI A;  3QYT A;  3KSJ A;  4X9T A;  1LGB C;  1P1U A;  2XHD A;  3C32 A;  1SYH A;  2Z22 A;  3N26 A;  5CC2 A;  1JEU A;  1KWH A;  2NUV A;  3MC2 A;  4PE5 B;  3IB1 A;  4OEV A;  1URS A;  2DSF A;  3TCG A;  3DM0 A;  1JVY A;  2I4C A;  3U1O A;  1PB9 A;  3BKI B;  5H8H A;  4ZS9 A;  3IO4 A;  2DYX A;  3CFZ A;  4EDP A;  4EXK A;  1XS5 A;  3HPI A;  1FTJ A;  4IGR A;  2HCA A;  2I48 A;  3MP8 A;  3PD9 A;  5M2V A;  4EF1 A;  5AE4 A;  3MUQ A;  2HQ0 A;  2XXT A;  2A5T A;  5F7V A;  4G68 A;  3Q28 A;  4KHZ E;  1SW2 A;  3FGS A;  4QSC A;  3TQW A;  4F2O A;  5H8F A;  3ZSF A;  2XXU A;  4GXS B;  2QMX A;  3Q29 A;  5CMC A;  3MZ9 A;  4KQP A;  2V3Q A;  4RK2 A;  1S50 A;  3DP8 A;  3H7M A;  2F36 A;  4R73 A;  3G3J A;  3RN8 A;  1EH3 A;  5ISU A;  5H8N B;  4BDQ A;  1LAG E;  3PUV E;  3Q27 A;  5I58 A;  4N07 A;  3K01 A;  3VE1 B;  3E13 X;  3TTK A;  5EYF A;  1IIW A;  4NED A;  2XXV A;  1M5E A;  4O3B A;  5AA1 A;  2DQV A;  1OMP A;  4R75 A;  1PBQ A;  4PFY A;  1RKM A;  4XKQ A;  1YCJ A;  5HBC A;  4MLV A;  1MS7 A;  3PUZ E;  4G4P A;  1SW1 A;  1FTL A;  2AL5 A;  3I5O A;  3JV9 A;  2HFB A;  3IX1 A;  4Z7E A;  5A5X A;  2KLF A;  5AA2 B;  1SW4 A;  4YMB A;  3RQT A;  3T9U A;  4U22 A;  2LAO A;  4LA9 A;  1B05 A;  4RXL A;  1B1X A;  1N7X A;  1POT A;  3K6W A;  2A5T B;  1P1N A;  1NMU A;  3B6W A;  2B65 A;  2Y7P A;  3FJM A;  1PBP A;  1AOV A;  5B70 A;  5IAI A;  3O9P A;  4RYA A;  4LVQ A;  3OOA A;  2B3B A;  1DPE A;  1B5I A;  1MXV A;  2HXW A;  5DYH A;  3ZS6 A;  5K2Y A;  3MAM A;  2R71 A;  3WAE A;  5I2K A;  4KYS A;  5CMM A;  2PMS A;  1LST A;  2W7Y A;  3TFL A;  2I0B A;  4WEP A;  1FTO A;  1MQD A;  4YZZ A;  3RTW B;  3THI A;  3IOT A;  3OO6 A;  4NF4 B;  1SI1 A;  3R26 A;  4G68 C;  4H5G A;  4LZ7 A;  3SKP A;  1B3F A;  1B0H A;  1II5 A;  1PEB A;  3FVO A;  1HSL A;  3JYR A;  4BDN A;  2F7B A;  2V93 A;  3TDJ A;  1D4N A;  2GFE A;  2I3V A;  3CRB A;  3CSG A;  3A3C A;  3HHF A;  3MVY A;  4XKR A;  2RIN A;  3CG1 A;  1IIT A;  2Q88 A;  1B5H A;  4YB6 A;  4RNS A;  5DVJ A;  5I57 A;  5IKB A;  1MM7 A;  4NMY A;  4R6K A;  3GBB A;  3MW0 A;  4F31 B;  5AA2 A;  3HV1 A;  1JNF A;  4KYE A;  5KCJ B;  3S4U A;  3HST A;  3OSR A;  5KDT B;  4NF6 B;  4GXA A;  4GD5 A;  1B1H A;  3VV5 A;  4F29 A;  5TP9 A;  1HSE A;  3UK4 A;  1NH7 A;  1N3X A;  4QSE A;  4OXV A;  4R6Y A;  3OEK A;  2DE2 A;  3PMV A;  3R6U A;  3U94 A;  3LC8 A;  3KZG A;  3OSQ A;  4GQO A;  3S9L C;  1DTZ A;  3IOR A;  2XD3 A;  4R2F A;  5HM4 B;  3H06 B;  3LSF B;  4GFR A;  2RCB A;  3KOS A;  4Q30 B;  3H6U A;  3D4C A;  5FTI A;  1R6Z A;  1B0L A;  4OMB A;  1NNT A;  3IOV A;  3RPW A;  3U72 A;  2ZNU A;  2ZYO A;  5CBR A;  3IO6 A;  4X1D A;  1LFH A;  2IA4 A;  1JVX A;  2QPQ A;  5BWJ A;  2DS9 A;  4QFL A;  4F2Q A;  2REJ A;  4BDL A;  2HZL A;  1XOC A;  2DWJ A;  2VD2 A;  4ZEK A;  4DIG A;  5I58 B;  1IUD A;  1UTB A;  2HAU A;  3BBR A;  3IJO B;  3C9H A;  5L9M A;  3Q25 A;  2XXX A;  2UYE A;  4MFI A;  3KGC A;  3LSW A;  1QUL A;  1ZKB A;  1R9L A;  1EZO A;  3H6W A;  2NWJ A;  4E0X A;  2AYS A;  3G3F A;  1N0T A;  1CB6 A;  1QVS A;  2ZMB A;  2Z8F A;  2NXO A;  5A5X B;  4WXJ A;  2F97 A;  2RKM A;  3T9H B;  3RT8 A;  4E0W A;  1DTG A;  3SER A;  4IO2 A;  1JET A;  1TXF A;  1OLC A;  2UXA A;  2OWT A;  5H8F B;  2QS1 A;  1LAH E;  2OK2 A;  4PFT A;  1TFD A;  5K2X A;  3RUM A;  1MXY A;  4MLQ A;  1MH4 A;  3EN3 A;  4HS7 A;  2ANJ A;  3RTF B;  3TQL A;  1SDX A;  3MP6 A;  4BDR A;  4F39 A;  2UVH A;  5ITO A;  3U93 A;  4F3P A;  4FAT A;  2OZZ A;  5I56 A;  2H25 A;  4IO7 A;  4FE8 A;  4U21 A;  2XX8 A;  1T0K A;  1UIV A;  3KJ7 A;  1MQJ A;  3L6H A;  3W9V A;  4NTL A;  4KCD A;  1BTJ A;  2DWA A;  3TMG A;  5ICQ A;  1XC1 A;  1B3G A;  1I6A A;  2A5S A;  4AB6 A;  1BKA A;  3MPK A;  4RK9 A;  1PDA A;  3V83 A;  3S9N C;  4EXL A;  1MPB A;  1ZLQ A;  2RCA A;  1EZ9 A;  1QKB A;  2Z23 A;  4ISU A;  1I6B A;  4YB7 A;  5EHS A;  1ATG A;  2I49 A;  4G8M A;  2AIX A;  1MRP A;  1JEV A;  1YPN A;  1YTV A;  1ZTY A;  2QSX A;  4FEC A;  1POY 1;  3KN7 A;  4M1V A;  3AXF A;  1Y3P A;  1ELJ A;  2PVU A;  3ECR A;  5TPA A;  3SEW A;  3MPL A;  3HO7 A;  5BUU A;  3TTR A;  1A99 A;  4EF2 A;  4DDD A;  4FAJ A;  1B2H A;  5HPQ A;  2DXR A;  3N6U A;  1NNK A;  3PV0 E;  1XVY A;  3MQ9 A;  4NF8 B;  5TP9 B;  3OMB A;  3T93 B;  2DXY A;  1H45 A;  2O1M A;  3W15 C;  4FEB A;  4K3F A;  2O7I A;  2E0S A;  2F7A A;  2Z8E A;  5LOM A;  4I8C A;  3TPA A;  4Z0I A;  3QUJ A;  2WKY A;  2ZNS A;  2ZXT A;  3K0V A;  4MF3 A;  3FJG A;  4NF5 B;  3KFM A;  4RJZ A;  1FTM A;  2V25 A;  1A7L A;  2Y7K A;  3G3G A;  4OFO A;  4R9G A;  3T9V A;  4U23 A;  3H03 A;  2HZK A;  2G29 A;  3PPO A;  4ZE8 A;  4ESX A;  1N7W A;  2PT1 A;  3S9E A;  2Z8D A;  3KN8 A;  3O6G A;  4X1B A;  4TLL B;  4GVO A;  4TQU Q;  3VVD A;  1N3W A;  3K1M A;  4H5F A;  1LCT A;  1EZP A;  4QFO A;  1FCK A;  2H9B A;  3CG3 A;  3DP6 A;  3HCQ A;  1UTB B;  1NNP A;  3K1N A;  4DXB A;  4P0G A;  5TU0 A;  3PPQ A;  1USY E;  4N6P A;  3VVE A;  2QS4 A;  4JWY A;  4KYD A;  3SES A;  3DEL B;  3ODB A;  2D5W A;  1Y4C A;  4F1U A;  2NOO A;  3TKD A;  3MVZ A;  3SEV A;  3FAS A;  2F6P A;  2Y7R A;  2OCU A;  2I58 A;  2FA7 A;  5DVI A;  2ZNT A;  4H0W A;  4JB7 A;  1A55 A;  3K4U A;  2IEE A;  3PGF A;  3FVN A;  4H65 A;  1Q35 A;  4WED A;  2F6G A;  2VHA A;  3D4G A;  3IB2 A;  2H99 A;  3MP1 A;  2YPN A;  4LON B;  1BIY A;  3FIR A;  1IEJ A;  4QFK A;  4RY1 A;  4XTC Q;  1MXU A;  4TLM B;  4PQJ A;  3CIJ A;  4YAH X;  5FTH A;  4OZ9 A;  2V3U A;  1US5 A;  4POW A;  1NKX A;  4IGT A;  1TFA A;  2BJJ X;  3IAZ A;  1Y20 A;  1SVX B;  3OD7 A;  1OLA A;  2ONK E;  4JDF A;  4ZZE A;  5I56 B;  1WOD A;  4HTG A;  5FHM A;  3JZJ A;  1LFG A;  1FTK A;  2DE3 A;  1NL5 A;  3B6T A;  3BFT A;  3I6V A;  3PU5 A;  1RYO A;  3CFL A;  3E9X A;  3FXQ A;  3VXB A;  4F18 A;  1FQC A;  3TEP A;  1Q1K A;  3IK6 B;  4GLI A;  2D3I A;  1O64 A;  3QXM A;  3EHT A;  3VLV A;  1B6H A;  1Y4T A;  4FOR A;  1LAX A;  3UOR A;  5I57 B;  1A54 A;  3IOU A;  3EF7 A;  1H44 A;  2PBW A;  4GL0 A;  1RYX A;  4OHN A;  2ZYK A;  1DMB A;  3QIM A;  3FJ7 A;  3V8X B;  3TTL A;  5DT6 A;  4OEN A;  4X48 A;  3C31 A;  4OET A;  4OWD A;  5AA4 A;  2G93 A;  5CMB A;  5I59 A;  1A8F A;  1ZIU A;  1QKA A;  2F78 A;  4IY5 A;  1A8E A;  4ZEF A;  2AL4 A;  3SET A;  3O6H A;  4OES A;  4UA8 A;  1JW1 A;  2ZYN A;  3FUZ A;  4U1Z A;  4YIC A;  5DEX A;  5ELV A;  3RLF E;  1TT1 A;  1D3K A;  1SW5 A;  1ANF A;  5EHM A;  1OQG A;  1USY H;  1US4 A;  2Q2C A;  1B3E A;  1M5B A;  3GZG A;  4KPT A;  2VGQ A;  4OVJ A;  4Q5T A;  3T66 A;  4F3S A;  2THI A;  1VSO A;  2GHB A;  1LCF A;  2F5X A;  4OER A;  4PFU A;  4H67 A;  1PC3 A;  4BDO A;  3O28 A;  2O51 A;  4UAC A;  1JQF A;  1FQF A;  1H43 A;  3FV1 A;  3UGW A;  1DOT A;  4EQB A;  3TTM A;  3R7X A;  1OVB A;  4ZZA A;  3CFX A;  2O69 A;  1FQE A;  3CSB A;  4GIZ A;  4RPO A;  3C34 A;  3PD8 A;  1OQH A;  1VR5 A;  1MPC A;  2RC8 A;  3O29 A;  4JSD A;  4O3A A;  2DE4 A;  3LR1 A;  4C1U A;  1GGG A;  1F9B A;  1P99 A;  3IL1 B;  4DCX A;  2XXP A;  2R9J A;  3EQ1 A;  3OO7 A;  5I59 B;  5DVF A;  2OBG A;  3K1P A;  4C0R A;  4F3B A;  3M8U A;  3OEL A;  4U4S A;  3DLN A;  1DSN A;  3RGY A;  3GBA A;  4U1O A;  2YJP A;  1LFI A;  3O97 A;  1LLS A;  1L5T A;  3M3L A;  4F22 A;  5CI5 A;  3N94 A;  1AMF A;  2B3F A;  5CMK A;  4NF5 A;  4ZEI A;  4EUO A;  3FXR A;  3ILU B;  3O2A A;  3G3H A;  4IO6 A;  1ZBM A;  2XXI A;  4U2R A;  4KR5 A;  1NNF A;  4G8H A;  3SDF A;  4ZED A;  3TUS A;  1PB7 A;  4Q0C A;  1ZMG A;  2Y7I A;  1H76 A;  4ECF A;  1B9J A;  4P11 A;  2CMO A;  3BFU A;  1BP5 A;  3H4Z A;  3QK6 A;  4JBZ A;  5H8S A;  2NVU B;  1MQI A;  3ZKL A;  4HW8 A;  3VXC A;  3T96 B;  1D9V A;  3G3K A;  1B4Z A;  3Q26 A;  4KI0 E;  2XX9 A;  5JK4 A;  1VFE A;  4XKN A;  1FQA A;  4I9D A;  3L6G A;  1MXX A;  3CVG A;  4RA1 A;  4JWO A;  3O6I A;  4YKI A;  2QJE A;  4LQ2 A;  4PET A;  4YKP A;  4YKK A;  5JTY B;  3A3U A;  3K02 A;  3T22 A;  4EQ7 A;  1PB8 A;  2QS3 A;  2QS2 A;  1MY1 A;  4QFP A;  3G7W A;  3LBS A;  4YKJ A;  1N84 A;  1ZU0 A;  3OO8 A;  5TPA B;  1I69 A;  4YMA A;  5CM6 A;  3GXA A;  2Y84 A;  1QUJ A;  4DLD A;  4F1Y A;  1XT8 A;  5DTB A;  5H8Q A;  3KBR A;  1D9Y A;  4GL8 A;  4OFJ A;  4L17 A;  4JSO A;  4NF8 A;  4QRZ A;  4N13 A;  4ELP A;  4LP2 B;  3VLU A;  5DEX B;  2P2A A;  3FD3 A;  2Q8J A;  3RNN A;  4DXC A;  3C35 A;  1YAE A;  1MY0 A;  2QMW A;  3DP4 A;  2XXH A;  2PX1 A;  3FZV A;  1UIU A;  1OVT A;  2FNC A;  2QL3 A;  1XVX A;  3PUW E;  1N04 A;  1AL3 A;  2REG A;  5JEI A;  4GF8 A;  3KJT A;  1QUI A;  2E1S A;  4TOZ A;  5CRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...