3PPRA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
TIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 103
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pprA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3pprA02
1B0HA 4IB2A 1MRPA 4DZ1A 2XD3A 5AA3A 4FATA 1P99A 4C1TA 3SERA 3I3VA 5AA2D 4Q0CA 1NNFA 1S7YA 3RTFB 2RINA 3MVZA 4ZECA 2HZKA 5I2KA 2E0SA 1IXGA 3S9LC 3Q26A 2NUVA 1YPNA 3IL1B 5F7VA 3TCHA 1FTJA 1B1HA 2VHAA 3PUYE 1PB9A 1YCJA 1MY0A 1QUJA 5CMKA 5HM4B 2F5XA 4R75A 3IB0A 1H43A 2Z23A 2RF1A 1UQWA 1DPPA 5DVFA 2QRYA 2V3TA 4IY6A 3FJ7A 3RLFE 1QW0A 2XXTA 4OEUA 5H8QB 3O29A 3B6QA 1RYXA 4ELPA 2Y7WA 4DCXA 3TPAA 1TFDA 4H65A 3G3HA 3CFXA 2Z8DA 2ESNA 4PFTA 4IO6A 3K0VA 5AA2B 4BDNA 1I6AA 3MW0A 3CSBA 1MQDA 1NFTA 4IGTA 1VR5A 1IXIA 5L9MA 2ONKE 3LUYA 4ELQA 4POXA 4DE8A 3TODA 2A5TA 5I2KB 3KN3A 4L17A 4KHZE 1Y9UA 1B3LA 4Z7EA 1ANFA 5I84A 3TTMA 1EH3A 2O7UA 1MG1A 1B32A 3LSWA 4RNSA 4KCCA 4KYSA 3LC8A 2I4CA 3FJGA 3TDJA 4NTLA 1MXXA 1FW0A 5J1DA 3A3UA 3QAXA 1MDQA 2Y7KA 3PGFA 1WODA 5I2NA 2P2AA 4G2ZA 4OHNA 2OCUA 5L8DA 3CI8A 4YB7A 4FE8A 4NEDA 4YKPA 3ZS6A 2GH9A 2I48A 3TQLA 4F19A 1FTMA 2ZMBA 4Q30B 1EZOA 4R6HA 2DWIA 5TU0A 3VXCA 1SVXB 2VOZA 3M8UA 1UIVA 3H3GA 1LFIA 1ZLQA 3FV1A 4F22A 3E13X 1P1UA 3GLBA 3O6HA 4FAJA 4G68C 2W7YA 1B3GA 3T22A 3CG1A 3KJ7A 3FXUA 3KOSA 1M5FA 4YB5A 1M5CA 3MZ9A 5EHMA 3TTNA 2ALUA 1Z7ME 2F36A 4F2QA 4PFUA 5CMMA 2DYXA 2A5TB 5H8FA 2HEUA 3FV2A 1QKAA 3RPWA 2Q89A 3LBSA 4EXLA 4RA1A 1A7LA 3QUJA 1R6ZA 4F3GA 3UA8A 3L6GA 2G29A 3IB2A 3UORA 1O7TA 2OWTA 3KN7A 4ZEDA 3THIA 2DXYA 2REJA 1ZKBA 1S50A 1JVYA 5I2NB 1HSJA 4M1VA 2QL3A 2ZXTA 4EQ7A 1I69A 2XX8A 5H8HA 4F39A 1XOCA 2QMWA 3IOTA 1S9TA 2H4IA 2PYYA 1MH4A 4R74A 1MXUA 1DOTA 1IEJA 3RNNA 1QUKA 3SEVA 4HW8A 3RT6B 1B1XA 3RY3A 2OJTA 3FXQA 4LP2B 1II5A 2QS2A 4G8MA 1FTOA 5I56A 1PB8A 4H8IA 3KN8A 5L9OA 4NWCA 5FHNA 1AOVA 2HXWA 3MP1A 5JEIA 2HCAA 3VLWA 1Q1KA 1B3EA 3W9VA 4BDOA 2DXRA 4EQBA 3CRBA 2UVGA 1LBCA 4KYDA 4OZ9A 3CIJA 1QJMA 2RC8A 4M4GA 1LSTA 1NKXA 2OWSA 1WDNA 4ELRA 3PUWE 1PBQA 1NNTA 2VD2A 5H8FB 2HFBA 5A5XA 1DPEA 2I49A 2XD2A 3T9XB 2XX9A 2DS9A 3OO8A 2DQVA 4EDPA 1OQGA 3KFMA 4KFQA 4XKQA 4N13A 1SYHA 5H8NB 2UVHA 3V83A 4OWDA 1MXWA 4GFRA 1P1OA 4H67A 4MFIA 3O6GA 3ZKLA 3IJXB 1SW4A 4OVJA 1PC3A 5H8HB 2H98A 1NH7A 2DWJA 1NMUA 1YAEA 1OQHA 2PX1A 3JZJA 2THIA 2O68A 4BDRA 1M5DA 4OERA 2HAVA 4QFKA 1B4HA 5I56B 2QS1A 1LB8A 1A99A 3ODBA 3Q28A 1PBPA 1IITA 2D5WA 3U1OA 4DLDA 4EF1A 3KEIA 3U8QA 3KBRA 1URDA 4RY1A 3PUZE 3K1PA 2H99A 3SEUA 3G3GA 5A5XB 3ILUB 2NXOA 1USYE 4BDQA 3TZAA 1O64A 1B46A 4LZ5A 4GVOA 2GHAA 3HO7A 1FQFA 2DP8A 2Q2AA 3OO6A 2RKMA 1FQAA 5ITOA 5KZTA 3FD3A 2F6GA 2KLFA 4JBZA 1LAXA 4ZEFA 3PUVE 2R9JA 3K6UA 3EN3A 4I1DA 1RYOA 4QSEA 4PFYA 1Y3QA 3LSFB 4F29A 3K01A 3FGSA 5CMCA 4OQOA 3OEMA 3V8XB 3UP9A 4IO7A 2GFEA 3OEKA 4KYEA 1CB6A 2XXVA 4ISUA 1ELJA 2ZYMA 3KG2A 1XT8A 3WAEA 3MVYA 3R7XA 1IUDA 1NH8A 3IB1A 2RC9A 2XXYA 3SETA 1SW5A 3UGWA 1ZIUA 2ZYKA 3IK6B 3BFTA 3PV0E 1XS5A 3FVKA 1OVBA 2DWHA 5K2YA 4GL8A 5AA4A 2D21A 4FECA 5DEXA 4ESWA 1EZPA 1HSEA 3EF7A 2GHBA 5CBSA 2B3FA 2O69A 5JK4A 2V25A 3T9VA 4THIA 4F1YA 1N04A 2ANJA 3GZGA 3PUXE 4U1ZA 1TT1A 3KSXA 3C31A 1SQYA 1FQBA 3USDA 4IO3A 1B58A 5M2VA 1TFAA 1UTBA 1MY1A 2DOJA 1AL3A 4F1VA 4U23A 4DXUA 1SI1A 1YTVA 1MPDA 4U4XA 4X1DA 3TFLA 4MH5A 3DP6A 2HQ0A 4JWXA 2ZYNA 1Y4TA 3P7IA 1LCTA 1M5EA 3MVXA 3LR1A 2Q2CA 3PPOA 3RQTA 1JEUA 3W9WA 3HCQA 1SW2A 5HBCA 5FHMA 1J1NA 1P1NA 2NOOA 5DTBA 5ICTA 4YZZA 2FYIA 2QJEA 1MY2A 3SKPA 4P0GA 1MXZA 2H5YA 1SI0A 3FZVA 3SESA 4R2FA 1D9YA 3K6VA 3ONMA 4G4PA 4RPOA 2O51A 3KJTA 4XXUA 1XHYA 4HCWA 4R9FA 3SEYA 4ZEIA 2XXHA 3EHSA 1PDAA 1MPCA 1CE2A 3G3KA 1BLFA 4KD5A 3TEPA 2F8DA 3T96B 3B6TA 1T0KA 5AA4B 3ZKKA 3VLVA 4WKMA 5DEXB 4U21A 3CFZA 3VLUA 2X7PA 4XIGQ 4RYAA 2HZLA 2H9BA 3UIFA 4F3SA 2BJJX 5I57A 5BUUA 4GRKA 4YB6A 3DELB 4EQ9A 3E3KA 2M8CA 1UTBB 3PPQA 3E4RA 4C0RA 5L9SA 4I9DA 3PD8A 2X7QA 4FIMA 4LQ2A 3H06B 4OTEA 4XTCQ 4OXVA 1HSLA 2RC7A 1EU8A 1AIVA 1R9LA 5K2XA 4QSCA 4LVQA 4F2OA 4PE5B 3G7WA 4ONYA 3IJOB 4FEDA 4FEBA 4RK2A 2REGA 1B0LA 1M5BA 4H5FA 4IO2A 1UTHA 5CI5A 5KCJA 4C1UA 3OOAA 3K1NA 2Z22A 4G68A 2V84A 3ILTB 1N7WA 3SEXA 4LQ5A 1SYIA 4H5GA 3IOVA 1URSA 2ONSA 4K3FA 4O3AA 3U94A 2F35A 1OLAA 4MF3A 2I6EA 4AQ4A 2F78A 1MY4A 3N5LA 3O66A 3GXAA 1ZMGA 1GGGA 4DIGA 3D4GA 2CMOA 5DT6A 1PB7A 3H6VA 1JEVA 2XX7A 2A5SA 4X9TA 4E0WA 3G3JA 3ZSFA 5AE4A 3S2VA 3R6UA 1MDP1 2Y7PA 3KOTA 5I57B 1B51A 2PVUA 3MJNA 4OFJA 1RKMA 3QK6A 4JSOA 2Q8JA 4JDFA 2NVUB 1XC1A 4UA8A 3SDFA 2RCAA 3F11A 4KI0E 1JVXA 1ZBMA 2FA7A 2PBWA 3OSQA 1UTHB 5KCJB 1Y4CA 5CMBA 2DSFA 2QMXA 3KGCA 4G68B 1Y20A 2Q88A 3TELA 1B7UA 4O3BA 3PMWA 2IA4A 1Z7NE 4F3PA 1LLSA 3OO9A 3VE1B 4OFOA 4JB7A 1VFDA 4E0XA 4G8HA 4RK9A 4NWDA 4ESXA 4QFOA 3VVEA 1Y3NA 2DVZA 1SDXA 1WVJA 4AB5A 3K6WA 3MZBA 1MS7A 3S4UA 5TPAA 5DVIA 1N7XA 3B6WA 4IO4A 4O3CA 3M3LA 4RPNA 1MQHA 1B7HA 3TKDA 3LSXA 2FNCA 4TLLB 4KQPA 3CFLA 3OD7A 4X1BA 1B52A 3IOWA 2DWAA 3OXNA 4QFNA 2ZYOA 3O97A 3C32A 3PPPA 4EUOA 3N6TA 4F18A 3JYRA 1BIYA 4HTGA 3MQ9A 5CC2A 3FATA 3MWBA 1SBPA 4GXAA 3S9EA 3OENA 3K6XA 4F3BA 3VVDA 1H3DA 1ZJLA 4ZE8A 2CZLA 5ICQA 2QS4A 4H8JA 1P1WA 1POTA 4YAHX 1GR2A 4KR5A 3O2AA 4DXCA 3Q29A 4Q5TA 1IZ1A 1QVSA 3HHFA 4WEDA 2O1MA 4R6KA 2I0CA 1D4NA 4GIZA 1OLCA 4FORA 5IAIA 4DXBA 3MVWA 5FHOA 4ZZAA 5ITPA 1DTZA 3T9UA 2XXQA 4H1XA 4H6DA 3JV9A 2GRVA 3IO6A 1URGA 1O63A 1ZU0A 5JTYA 2RCBA 1I6QA 4BDMA 1B4ZA 2O84X 3H6TA 4TQUQ 1AMFA 3A09A 3MPLA 3MZ1A 4YICA 5TPAB 2OK2A 4ZEKA 4RXLA 1VE4A 2DE4A 2Z8EA 4QSDA 1Y1ZA 5FTHA 3I5OA 4MLVA 2UVJA 4R72A 4NF8A 1JNFA 2YJPA 5B70A 1IXCA 3MPKA 3L6HA 2O6AA 2F7CA 4JSDA 2F7BA 3HSTA 3H4ZA 3S9MC 4ZEBA 1A8EA 3BKIB 3TMGA 1N0TA 3V89B 1USYH 3O9PA 5TP9A 1B2HA 3N26A 4ECFA 3A3CA 4JXIA 4IGRA 1OVTA 3IAZA 3TAJA 4X48A 5FTIA 2V93A 1FQEA 3R26A 4OEVA 1MQIA 4EF2A 4BDLA 5EHSA 3OO7A 4LUBA 1JQFA 3N6UA 3B7DA 2V3QA 5H8SA 3FUZA 3VFJA 4N07A 1BKAA 3MUQA 2I58A 3Q27A 1MQGA 4U22A 3EHTA 5ISUA 2OBGA 1GVCA 3I6VA 3K02A 3W15C 3M3FA 4HS7A 4YKIA 5BWJA 2NWJA 4LZ8A 3ECRA 5JTYB 3C33A 3RGYA 4F1UA 4LATA 1MQJA 3CG3A 4KPTA 2VP1A 1FQCA 3PPNA 2Y84A 4MLQA 1QUIA 3K1MA 1LAHE 2XXRA 2AL4A 3QIMA 1MXVA 2ONRA 3U92A 4P11A 4PP0A 1Q35A 4U2RA 1POY1 4POWA 3HN0A 3FASA 4R73A 3BBRA 4NF8B 1NNKA 2I4BA 2DE2A 3K00A 3FVGA 2ZNSA 3C9HA 4ZDMA 3VVFA 1N84A 3FJMA 2R6GE 1MH3A 1MM7A 3MP6A 5LOMA 3TQWA 4OESA 5TP9B 3C34A 4GD5A 1FQDA 5HPQA 4GF8A 3TCFA 4NF5A 3HPIA 3CSGA 1F9BA 1Y3PA 3M3KA 4RJZA 4XKPA 2HAUA 3RN8A 2F34A 4OMBA 2O7IA 3E9XA 3BFUA 3VXBA 1B6HA 3TYHA 2Q9TA 3O28A 4P0IA 2QSXA 1SD3A 4H0WA 3RTWB 4XKRA 4QFPA 1I6BA 2IEEA 3O6IA 1UIUA 5B7DA 4NMYA 3EHUA 4DCYA 3AXFA 1QULA 4QHQA 4DDDA 1BTJA 2I3VA 3GBAA 3FVNA 3IOUA 4R9GA 4YKKA 4TLMB 2UYFA 2AIXA 4AB6A 2XHDA 1IXHA 2I0BA 2Y7IA 1ATGA 1US5A 4LZ7A 4ND9A 1TWYA 1D3KA 4JWYA 4BLAA 1DSNA 3IO4A 3EQ1A 1B40A 3PPRA 2B65A 5DVJA 4QRZA 5ELVA 1MXYA 2I3WA 4TOZA 4PETA 3TUSA 1MY3A 1H44A 2D3IA 4NF6A 4QFLA 1JETA 4NF5B 4UACA 4PQJA 3OMBA 3UK4A 1B5IA 2H25A 3HV1A 2Y7RA 3DM0A 4YKJA 2QS3A 3OSRA 4YMAA 3D4CA 4IO5A 2Z8FA 1QKBA 5DYHA 4JWOA 2AL5A 3V5AA 1DMBA 2OZZA 3OELA 5H8NA 1XVYA 3H7MA 3QXMA 4GQOA 2O1LA 2F6PA 1KWHA 3TTKA 5CBRA 3Q25A 2R71A 1B3FA 4PFWA 3TTLA 1GTKA 1B3HA 3TTRA 4LA9A 3H6UA 4MBPA 2VD3A 1A55A 4GL0A 1JW5A 4YU0A 3H03A 1A54A 2F97A 4G8NA 3IORA 3C4MA 1L5TA 1B9JA 4NF4A 3SEWA 5IKBA 1GV8A 3C35A 3DLNA 3VV5A 1A40A 3QSLA 1FCKA 2ZNUA 5CM6A 3G3IA 1IIWA 2P1SA 4GXSB 4OENA 4U4SA 4I62A 1VSOA 4XKNA 4GLIA 5I58A 2ZNTA 3MAMA 4QF9A 5CRYA 4OYVA 4WXJA 1R9QA 5I59A 2PT1A 1SW1A 1D9VA 4NF6B 1N3WA 3HHGA 1B5HA 4ZE9A 3CVGA 1XVXA 4ELOA 1LFHA 1BP5A 1LAGE 3U93A 4F31B 2PMSA 1H76A 3RUMA 1NNPA 1MM6A 3FXRA 1A8FA 2LAOA 3LSLA 3KSJA 2ABHA 4N6PA 4Q8RA 3T93B 1B5JA 3PD9A 1LB9A 5AA1A 3FVOA 3PMXA 4ZZEA 2WKYA 2PT2A 2DE3A 1US4A 2XXUA 1AH5A 2XXXA 2XXWA 1N3XA 3MP8A 3QYTA 2OLBA 3GBBA 1PEBA 3S9NC 3H6WA 2YLNA 4U1OA 3DP4A 4R6YA 4OETA 5EYFA 5KDTA 3IX1A 3K2DA 1MPBA 4OFLA 4R2BA 4Z0IA 2P0SA 4NF4B 1ZTYA 2XXIA 3T66A 1LAFE 4IY5A 2V3UA 1FTLA 1JW1A 3MC2A 3CR9A 4KCDA 5I58B 1H45A 4GWOA 3MBPA 3WAFA 1LGBC 5I59B 2UVIA 1VFEA 2G93A 1FTKA 1OMPA 1Y1MA 3G3FA 4GOTA 2B3BA 3K4UA 2XXPA 3C36A 2UXAA 2X26A 3RT8A 1NL5A 1R1NA 1EZ9A 3DP8A 1TXFA 3FIRA 2YPNA 1OIBA 4NE4A 2QPQA 2UYEA 4LONB 3VDFA 4EXKA 3N94A 1LCFA 3QUFA 2AYSA 4I8CA 4WEPA 2F7AA 3UN6A 4ZS9A 5H8QA 1LBBA 5F1QA 3PMVA 1B7ZA 4G77A 3U72A 3TCGA 1LFGA 2E1SA 1JW4A 3KZGA 1N76A 4FJPA 2DVCA 2VGQA 3EPEA 3T9HB 3PU5A 4YMBA 4HCYA 1B05A 1P1QA 3IR1A 1DTGA 5KDTB 1IQ7A 5AA2A
chains in the Genus database with same CATH superfamily
1B0HA 4IB2A 1MRPA 4DZ1A 2XD3A 5AA3A 4FATA 1P99A 4C1TA 3SERA 3I3VA 5AA2D 3QMFA 4Q0CA 1NNFA 1S7YA 3RTFB 4N6KA 2WBBA 2RINA 1FJ9A 3MVZA 4ZECA 2HZKA 5I2KA 4I40A 2E0SA 1IXGA 3S9LC 3Q26A 2NUVA 2FVZA 1YPNA 3IL1B 5F7VA 3TCHA 1FTJA 1AWBA 1B1HA 2VHAA 3PUYE 1PB9A 4GWYA 4PAIA 1YCJA 5ET6A 1MY0A 1QUJA 5CMKA 5HM4B 2F5XA 4R75A 3IB0A 1H43A 2Z23A 4DI3D 2RF1A 1UQWA 4FBPA 1DPPA 5DVFA 2QRYA 2V3TA 4IY6A 3FJ7A 3RLFE 4PBHA 1QW0A 1FPLA 2XXTA 4OEUA 4MHFA 5H8QB 3O29A 3B6QA 1RYXA 4ELPA 2Y7WA 4DCXA 3TPAA 4GX4A 5LDZA 5ET5A 1TFDA 4PGPA 2XXKA 1INPA 4H65A 3G3HA 3CFXA 2Z8DA 1JP4A 2ESNA 4PFTA 2F3DA 4IO6A 3K0VA 5AA2B 4BDNA 1I6AA 4PE3A 3MW0A 3CSBA 1MQDA 1FSAA 1NFTA 4IGTA 4JVDA 1VR5A 5I5PA 1IXIA 5L9MA 2ONKE 3BIHA 2CZHA 3LUYA 4ELQA 4POXA 4DE8A 4MEVA 3TODA 2A5TA 5I2KB 3KN3A 4L17A 4KHZE 1Y9UA 1B3LA 4Z7EA 1ANFA 5I84A 3TTMA 1EH3A 5EQ8A 2O7UA 1MG1A 1B32A 3LSWA 4RNSA 2CZIA 4KCCA 4KYSA 3LC8A 2I4CA 3FJGA 4OANA 1D9QA 3TDJA 4NTLA 1MXXA 1FW0A 5J1DA 1LBVA 3A3UA 3QAXA 1MDQA 4PAFA 2Y7KA 3PGFA 1WODA 5I2NA 2P2AA 4G2ZA 4OHNA 2OCUA 4XFEA 5L8DA 3CI8A 4YB7A 4FE8A 2B4MA 4NEDA 2KQZA 4YKPA 3ZS6A 2GH9A 2I48A 3TQLA 4F19A 1FTMA 2B4LA 2ZMBA 4Q30B 2WBDA 1EZOA 4R6HA 2DWIA 3B8BA 5TU0A 3VXCA 1SVXB 2VOZA 3M8UA 1UIVA 3H3GA 1LFIA 1ZLQA 3FV1A 4F22A 3E13X 1P1UA 3GLBA 3O6HA 4FAJA 4G68C 5T3JA 2W7YA 1B3GA 3T22A 3CG1A 3KJ7A 4UABA 3FXUA 3KOSA 1M5FA 4OVRA 4YB5A 1M5CA 3MZ9A 5EHMA 1NV1A 3TTNA 2ALUA 1Z7ME 2JJKA 2F36A 4F2QA 4PFUA 5CMMA 2DYXA 2A5TB 4MNCA 5H8FA 2HEUA 3FV2A 1QKAA 4GWWA 3RPWA 2Q89A 3LBSA 4EXLA 4RA1A 1A7LA 3QUJA 1R6ZA 4F3GA 2XWIA 3UA8A 3L6GA 2G29A 3IB2A 1FRPA 3UORA 1O7TA 1NV4A 2OWTA 3KN7A 4N8GA 4ZEDA 3THIA 2DXYA 2REJA 1ZKBA 1S50A 4MJOA 1JVYA 5I2NB 1HSJA 4M1VA 2QL3A 2ZXTA 4EQ7A 1I69A 2XX8A 5H8HA 4F39A 1XOCA 2QMWA 3IOTA 1S9TA 2H4IA 2PYYA 1MH4A 4R74A 1MXUA 1DOTA 1IEJA 3RNNA 1QUKA 3SEVA 4HW8A 3RT6B 1B1XA 3RY3A 2OJTA 3FXQA 4LP2B 1II5A 2QS2A 4G8MA 1FTOA 5I56A 1PB8A 1BK4A 4H8IA 3KN8A 5L9OA 4NWCA 5FHNA 1AOVA 2HXWA 3MP1A 5JEIA 2HCAA 3VLWA 1Q1KA 1B3EA 3W9VA 4BDOA 2DDKA 2DXRA 4PFRA 4EQBA 3CRBA 2UVGA 1LBCA 4KYDA 4OZ9A 3CIJA 1QJMA 2RC8A 4M4GA 1LSTA 1NKXA 2OWSA 1WDNA 5IZZA 4ELRA 3PUWE 1PBQA 5ESYA 1KZ8A 1NNTA 2VD2A 5H8FB 2HFBA 3SZPA 5A5XA 1DPEA 2I49A 2XD2A 3T9XB 2XX9A 2DS9A 3OO8A 2DQVA 4JVCA 4EDPA 1OQGA 4KFQA 3KFMA 4N13A 4XKQA 1SYHA 5H8NB 2UVHA 3V83A 4OWDA 1MXWA 4GFRA 5IZ1A 1P1OA 4H67A 4MFIA 3O6GA 3ZKLA 3IJXB 1SW4A 4OVJA 3KC1A 1KA0A 1PC3A 1CNQA 3T1BA 5H8HB 2H98A 5IGAA 1NH7A 2DWJA 1FBFA 1NMUA 1YAEA 1OQHA 1G0IA 2PX1A 3JZJA 2THIA 2O68A 1XI6A 4BDRA 2PCRA 1M5DA 4OERA 2HAVA 4QFKA 1B4HA 5I56B 2QS1A 1LB8A 1A99A 3ODBA 3Q28A 2QVRA 1PBPA 1IITA 2CZKA 2D5WA 1FTAA 3U1OA 4NN3A 4DLDA 4EF1A 1SPIA 2HHMA 3KEIA 3U8QA 3KBRA 1URDA 4RY1A 3PUZE 4MAGA 2L5VA 3K1PA 1YXIA 2H99A 3SEUA 1YZ0A 1FBHA 4PTKA 3G3GA 5A5XB 3ILUB 2NXOA 1FPBA 4PC9A 1USYE 4BDQA 3TZAA 1O64A 1B46A 4LZ5A 4GVOA 2GHAA 3HO7A 3E78A 1FQFA 2DP8A 2Q2AA 4HXVA 3OO6A 2RKMA 1FQAA 3RPLA 5ITOA 5EQ9A 5KZTA 3FD3A 2F6GA 3LV0A 2KLFA 4JBZA 1LAXA 4ZEFA 3PUVE 2R9JA 5FBPA 3K6UA 3EN3A 4HE2A 1RYOA 4I1DA 4QSEA 4PFYA 1Y3QA 1LBXA 1LBWA 2XWOA 3LSFB 4F29A 3K01A 3FGSA 5CMCA 4OQOA 3OEMA 3GYYA 3V8XB 3UP9A 4IO7A 4MMPA 2GFEA 3OEKA 4KYEA 1CB6A 2XXVA 4ISUA 4P3LA 1ELJA 2ZYMA 3KG2A 4OVTA 1XT8A 3WAEA 3MVYA 3R7XA 1IUDA 1NH8A 3IB1A 2RC9A 2XXYA 3SETA 1SW5A 3UGWA 1ZIUA 2ZYKA 3IK6B 3BFTA 3PV0E 1XS5A 3FVKA 1OVBA 2DWHA 2QFLA 5K2YA 4NHBA 4GL8A 5AA4A 2D21A 4FECA 5DEXA 4ESWA 1EZPA 1HSEA 3EF7A 2GHBA 1NUWA 4GBVA 5CBSA 2B3FA 2O69A 5JK4A 2V25A 3T9VA 1IQ7A 4THIA 4F1YA 1N04A 2ANJA 3GZGA 3PUXE 4U1ZA 1TT1A 3KSXA 3C31A 2WX9A 1SQYA 2MKZA 1FQBA 3USDA 4IO3A 1B58A 5M2VA 1TFAA 1UTBA 3RPLB 1MY1A 2DOJA 1AL3A 4F1VA 4U23A 4DXUA 1SI1A 1YTVA 1MPDA 2Q74A 4U4XA 2ZZWA 4X1DA 1FJ6A 3TFLA 4MH5A 3DP6A 2HQ0A 4JWXA 2ZYNA 1Y4TA 3P7IA 1LCTA 1M5EA 3MVXA 4IR8A 3LR1A 2Q2CA 3PPOA 3RQTA 4O94A 1JEUA 1NV5A 3W9WA 3HCQA 1SW2A 5HBCA 5FHMA 1J1NA 1P1NA 2NOOA 5DTBA 5ICTA 4YZZA 2FYIA 4N6DA 1EYIA 2QJEA 1MY2A 3SKPA 4P0GA 1MXZA 2H5YA 1SI0A 3FZVA 3SESA 4R2FA 1D9YA 3K6VA 1NUYA 3ONMA 4G4PA 4RPOA 2O51A 3KJTA 4XXUA 1XHYA 4HCWA 4R9FA 3SEYA 4ZEIA 2XXHA 3EHSA 1PDAA 1MPCA 1CE2A 3G3KA 1BLFA 4KD5A 3TEPA 1NUZA 2F8DA 3T96B 3B6TA 1T0KA 5AA4B 2WEFA 3VLVA 3ZKKA 4WKMA 2BJIA 5DEXB 4U21A 3CFZA 3VLUA 3RYDA 2X7PA 4XIGQ 4RYAA 2HZLA 1DBZA 2H9BA 3UIFA 4NGUA 2BJJX 4F3SA 5I57A 5BUUA 4GRKA 4YB6A 4PAKA 3DELB 4EQ9A 3E3KA 2M8CA 2WYKA 1UTBB 3PPQA 1NV2A 3E4RA 4C0RA 5L9SA 4I9DA 3PD8A 2X7QA 4FIMA 4LQ2A 3H06B 4OTEA 4XTCQ 4OXVA 1HSLA 2RC7A 1EU8A 1AIVA 4N81A 1R9LA 5K2XA 4QSCA 2P3VA 4LVQA 4F2OA 4PE5B 1FPDA 4MX6A 4ONYA 3G7WA 3IJOB 4FEDA 4GWSA 4FEBA 4PF6A 4RK2A 2REGA 1B0LA 1M5BA 4H5FA 4IO2A 1UTHA 5CI5A 5KCJA 5IM2A 4C1UA 3OOAA 3K1NA 2Z22A 4G68A 1FPGA 2V84A 3ILTB 1N7WA 3SEXA 4LQ5A 1SYIA 4H5GA 3IOVA 1URSA 2ONSA 4K3FA 4O3AA 3U94A 2F35A 1OLAA 4MF3A 2P3NA 2I6EA 4AQ4A 2F78A 1MY4A 3N5LA 3KC0A 3O66A 3GXAA 1ZMGA 1GGGA 1IMFA 1FBDA 4DIGA 4HE1A 3D4GA 2CMOA 5DT6A 1PB7A 3H6VA 1JEVA 2XX7A 2A5SA 3FXBA 4X9TA 3G3JA 4E0WA 1RDXA 3ZSFA 5AE4A 3S2VA 3R6UA 1MDP1 4PDHA 3EKIA 2Y7PA 3KOTA 5I57B 1B51A 2PVUA 3MJNA 4OFJA 2WYPA 3D1RA 4AS4A 1RKMA 3QK6A 4JSOA 2Q8JA 4JDFA 2CEXA 2NVUB 1XC1A 4UA8A 3SDFA 2RCAA 3F11A 4KI0E 3FBPA 1JVXA 3BIGA 1ZBMA 2FA7A 2PBWA 2FHYA 5A5LA 3OSQA 4O7MA 1UTHB 1EYJA 5KCJB 1Y4CA 5CMBA 2DSFA 2QMXA 3KGCA 4G68B 5EYHA 1Y20A 2Q88A 3TELA 1B7UA 4O3BA 4OVSA 3PMWA 2Y5KA 2IA4A 1Z7NE 4F3PA 1LLSA 3OO9A 4H45A 3VE1B 4OFOA 4JB7A 1VFDA 4KXPA 4E0XA 4G8HA 4NX1A 4P56A 1IMCA 4RK9A 4NWDA 4ESXA 4QFOA 4PCDA 1IMEA 3MSTA 3VVEA 1Y3NA 2DVZA 1SDXA 1WVJA 4AB5A 2XA5A 3K6WA 3MZBA 1MS7A 3S4UA 5TPAA 5DVIA 1N7XA 3B6WA 2V4CA 4IO4A 4O3CA 3M3LA 4RPNA 1MQHA 1B7HA 3TKDA 3LSXA 2FNCA 4TLLB 4KQPA 3CFLA 3OD7A 4X1BA 4MNIA 1B52A 3IOWA 1Q9DA 2DWAA 3OXNA 4QFNA 4OVPA 2ZYOA 3O97A 3C32A 3PPPA 4EUOA 3N6TA 4F18A 4PF8A 3JYRA 1BIYA 1NV7A 1VDWA 4HTGA 3MQ9A 5CC2A 3FATA 3MWBA 1SBPA 4GXAA 3S9EA 3OENA 1IMDA 3K6XA 4F3BA 3VVDA 1H3DA 1FBGA 1ZJLA 4ZE8A 4MCOA 2CZLA 4GWUA 4P9KA 5ICQA 2QVVA 2QS4A 4H8JA 1P1WA 1POTA 4YAHX 1GR2A 4KR5A 3O2AA 4DXCA 4OVQA 3Q29A 4Q5TA 1IZ1A 1QVSA 3HHFA 4WEDA 3ROJA 2O1MA 4R6KA 2I0CA 1D4NA 4GIZA 1OLCA 4FORA 5IAIA 4DXBA 3MVWA 5FHOA 4HE0A 4ZZAA 5ITPA 1DTZA 3T9UA 1NI9A 2XXQA 4PBQA 4H1XA 4H6DA 3JV9A 2GRVA 3IO6A 1URGA 1O63A 1ZU0A 5JTYA 2RCBA 1I6QA 4BDMA 1B4ZA 2O84X 1IMAA 4NQ8A 3H6TA 4TQUQ 1AMFA 3A09A 2FBPA 3MPLA 3MZ1A 4YICA 5TPAB 2OK2A 4ZEKA 4RXLA 1VE4A 2DE4A 2Z8EA 4QSDA 1Y1ZA 5FTHA 3A29A 3I5OA 4MLVA 2UVJA 4R72A 4N15A 4NF8A 4GX3A 1JNFA 2YJPA 5B70A 1IXCA 3MPKA 3L6HA 2O6AA 2VT5A 4JSDA 2F7CA 2F7BA 3HSTA 3H4ZA 3S9MC 4MIJA 4ZEBA 1A8EA 2KR0A 3BKIB 2CEYA 3TMGA 1N0TA 4N17A 3V89B 1USYH 1FBCA 3O9PA 5TP9A 1B2HA 4PDDA 3N26A 4ECFA 3A3CA 4JXIA 4IGRA 1OVTA 3IAZA 3TAJA 4X48A 5FTIA 2V93A 2ZZXA 1FQEA 3R26A 4OEVA 1MQIA 4EF2A 1EYKA 5EHSA 4BDLA 3OO7A 4LUBA 1JQFA 4QBAA 3N6UA 1NV0A 3B7DA 2V3QA 5H8SA 1K9YA 3FUZA 1KA1A 3VFJA 4N07A 1BKAA 3MUQA 2I58A 3Q27A 1MQGA 2FIXA 3IFAA 4U22A 4PGNA 3EHTA 5ISUA 2OBGA 1GVCA 3I6VA 4X8RA 3K02A 3W15C 3M3FA 4HS7A 4YKIA 5BWJA 3IFCA 2NWJA 4LZ8A 5ET7A 3ECRA 5JTYB 3C33A 3RGYA 4XF5A 4F1UA 4LATA 1MQJA 3CG3A 4KPTA 2VP1A 1FQCA 3PPNA 5F24A 2Y84A 4MLQA 1QUIA 3K1MA 1LAHE 2XXRA 4XEQA 2AL4A 3QIMA 4N4UA 1MXVA 2ONRA 3PTYA 3U92A 4P11A 4PP0A 1Q35A 1NUXA 1POY1 4U2RA 4POWA 3HN0A 3FASA 4R73A 3BBRA 4NF8B 1NNKA 2I4BA 2DE2A 3K00A 1K9ZA 1FPEA 3FVGA 2ZNSA 3C9HA 4ZDMA 3VVFA 1N84A 3FJMA 2R6GE 4OA4A 1MH3A 1MM7A 3MP6A 5LOMA 3TQWA 4OESA 5TP9B 3C34A 4I3YA 4GD5A 1FQDA 5HPQA 4GF8A 3NOHA 4NF5A 3TCFA 4DI4B 3HPIA 3CSGA 1F9BA 1Y3PA 2XWVA 3M3KA 4RJZA 4XKPA 4I3EA 2HAUA 3RN8A 2F34A 4OMBA 4N91A 2O7IA 3E9XA 3BFUA 4GWZA 3VXBA 1B6HA 3TYHA 2Q9TA 3O28A 4P0IA 2QSXA 1FPJA 1SD3A 4O7IA 4H0WA 3RTWB 4XKRA 4QFPA 1I6BA 2IEEA 3O6IA 1UIUA 5B7DA 4NMYA 3MYUA 3EHUA 4DCYA 3AXFA 1QULA 4QHQA 4DDDA 2Q8MA 1BTJA 2I3VA 3GBAA 3FVNA 3IOUA 4R9GA 4YKKA 4TLMB 2UYFA 2AIXA 4AB6A 5IZ3A 5EQ7A 2XHDA 1IXHA 2I0BA 2VPOA 2Y7IA 1QGXA 1ATGA 1LBZA 1US5A 4LZ7A 4ND9A 1TWYA 1D3KA 4JWYA 5I3SA 1NV6A 4BLAA 1DSNA 3IO4A 3EQ1A 1B40A 3PPRA 2B65A 5DVJA 4QRZA 5ELVA 1MXYA 2I3WA 4TOZA 1FBPA 1DK4A 4P1LA 4PETA 3TUSA 1MY3A 1H44A 2D3IA 5ET8A 4NF6A 5EYGA 4QFLA 1JETA 4NF5B 4UACA 4PQJA 3OMBA 3UK4A 1B5IA 2H25A 3HV1A 2R8TA 2Y7RA 3DM0A 4YKJA 2QS3A 5I7IA 3OSRA 4YMAA 1LEVA 2F3BA 3D4CA 4IO5A 2Z8FA 2Y5LA 3T0JA 1QKBA 3U65A 5DYHA 4PFBA 4JWOA 2AL5A 3V5AA 1DMBA 2FIEA 5J16A 2OZZA 3OELA 4MNPA 5H8NA 1XVYA 3H7MA 3QXMA 4GQOA 2O1LA 2F6PA 1LBYA 2ZZVA 1KWHA 3TTKA 5CBRA 3ISPA 3Q25A 2R71A 1B3FA 4PFWA 3TTLA 1GTKA 1B3HA 3TTRA 5LTCA 4LA9A 3H6UA 4MBPA 2OWZA 5IZ3B 2VD3A 4GWXA 1A55A 4GL0A 1JW5A 4YU0A 3H03A 1A54A 1G0HA 2F97A 3CHGA 1IMBA 4G8NA 3IORA 3C4MA 1L5TA 1B9JA 4NF4A 3SEWA 5IKBA 1GV8A 3C35A 2XWKA 3DLNA 3VV5A 1A40A 3QSLA 1FCKA 2ZNUA 5CM6A 3G3IA 1IIWA 2P1SA 3HFUA 4GXSB 4OENA 4U4SA 4I62A 1VSOA 4GX6A 4XKNA 2PFYA 4GLIA 5I58A 2GQ1A 2ZNTA 3MAMA 4QF9A 5CRYA 4OYVA 4WXJA 3B50A 1R9QA 5I59A 2PT1A 1SW1A 1D9VA 4NF6B 1N3WA 3HHGA 1B5HA 4ZE9A 4P1EA 3CVGA 1XVXA 4ELOA 1LFHA 1BP5A 1LAGE 3U93A 4F31B 4NAPA 1FPFA 2PMSA 1H76A 3RUMA 1NNPA 4GBWA 1MM6A 3FXRA 1A8FA 2LAOA 3LSLA 3KSJA 2ABHA 4N6PA 4NG7A 4Q8RA 3T93B 1RDZA 3KBZA 1B5JA 3PD9A 1LB9A 1DCUA 5AA1A 3FVOA 1FBEA 3PMXA 4X04A 4ZZEA 2WKYA 2PT2A 2DE3A 4O8MA 1US4A 2XXUA 1AH5A 1FPKA 2XXXA 2XXWA 1N3XA 2VPNA 3MP8A 3QYTA 2OLBA 3GBBA 1PEBA 3S9NC 3H6WA 2YLNA 4U1OA 3DP4A 4R6YA 4OETA 5EYFA 5KDTA 3IX1A 4JVIA 3K2DA 1MPBA 4OFLA 4R2BA 4Z0IA 2P0SA 4NF4B 1ZTYA 2XXIA 3T66A 1LAFE 4IY5A 2V3UA 1FTLA 4P8BA 2OX3A 1JW1A 4QXDA 3MC2A 3CR9A 4KCDA 5I58B 1H45A 4GWOA 3MBPA 3WAFA 1LGBC 4G61A 5I59B 2UVIA 1VFEA 2G93A 1FTKA 1OMPA 1Y1MA 3LUZA 3G3FA 4GOTA 2B3BA 3K4UA 2XXPA 3C36A 2UXAA 2X26A 3RT8A 1NL5A 1R1NA 1EZ9A 2HPGA 4LN5A 3DP8A 5DW8A 1TXFA 3FIRA 2YPNA 1OIBA 2HXRA 4NE4A 2QPQA 2UYEA 4LONB 3VDFA 4EXKA 2QVUA 3N94A 3E79A 2PFZA 1LCFA 3QUFA 2AYSA 4I8CA 4WEPA 2F7AA 3UN6A 4N8YA 4ZS9A 5H8QA 1LBBA 4H46A 5F1QA 3PMVA 4NF0A 1B7ZA 4G77A 5EQAA 3U72A 3TCGA 1LFGA 2E1SA 1JW4A 4P47A 3KZGA 1N76A 4FJPA 2DVCA 2VGQA 1NV3A 3EPEA 1YYZA 1FPIA 3T9HB 3PU5A 1RDYA 4AS5A 4YMBA 4HCYA 1B05A 1P1QA 3IR1A 1DTGA 5KDTB 4PFIA 5AA2A
chains in the Genus database with same CATH topology
1B0HA 4IB2A 1MRPA 4DZ1A 2XD3A 5AA3A 4FATA 1P99A 4C1TA 3SERA 3I3VA 5AA2D 4Q0CA 1NNFA 1S7YA 3RTFB 2RINA 3MVZA 4ZECA 2HZKA 5I2KA 2E0SA 1IXGA 3S9LC 3Q26A 2NUVA 1YPNA 3IL1B 5F7VA 3TCHA 1FTJA 1B1HA 2VHAA 3PUYE 1PB9A 1YCJA 1MY0A 1QUJA 5CMKA 5HM4B 2F5XA 4R75A 3IB0A 1H43A 2Z23A 2RF1A 1UQWA 1DPPA 5DVFA 2QRYA 2V3TA 4IY6A 3FJ7A 3RLFE 1QW0A 2XXTA 4OEUA 5H8QB 3O29A 3B6QA 1RYXA 4ELPA 2Y7WA 4DCXA 3TPAA 1TFDA 4H65A 3G3HA 3CFXA 2Z8DA 2ESNA 4PFTA 4IO6A 3K0VA 5AA2B 4BDNA 1I6AA 3MW0A 3CSBA 1MQDA 1NFTA 4IGTA 1VR5A 1IXIA 5L9MA 2ONKE 3LUYA 4ELQA 4POXA 4DE8A 3TODA 2A5TA 5I2KB 3KN3A 4L17A 4KHZE 1Y9UA 1B3LA 4Z7EA 1ANFA 5I84A 3TTMA 1EH3A 2O7UA 1MG1A 1B32A 3LSWA 4RNSA 4KCCA 4KYSA 3LC8A 2I4CA 3FJGA 3TDJA 4NTLA 1MXXA 1FW0A 5J1DA 3A3UA 3QAXA 1MDQA 2Y7KA 3PGFA 1WODA 5I2NA 2P2AA 4G2ZA 4OHNA 2OCUA 5L8DA 3CI8A 4YB7A 4FE8A 4NEDA 4YKPA 3ZS6A 2GH9A 2I48A 3TQLA 4F19A 1FTMA 2ZMBA 4Q30B 1EZOA 4R6HA 2DWIA 5TU0A 3VXCA 1SVXB 2VOZA 3M8UA 1UIVA 3H3GA 1LFIA 1ZLQA 3FV1A 4F22A 3E13X 1P1UA 3GLBA 3O6HA 4FAJA 4G68C 2W7YA 1B3GA 3T22A 3CG1A 3KJ7A 3FXUA 3KOSA 1M5FA 4YB5A 1M5CA 3MZ9A 5EHMA 3TTNA 2ALUA 1Z7ME 2F36A 4F2QA 4PFUA 5CMMA 2DYXA 2A5TB 5H8FA 2HEUA 3FV2A 1QKAA 3RPWA 2Q89A 3LBSA 4EXLA 4RA1A 1A7LA 3QUJA 1R6ZA 4F3GA 3UA8A 3L6GA 2G29A 3IB2A 3UORA 1O7TA 2OWTA 3KN7A 4ZEDA 3THIA 2DXYA 2REJA 1ZKBA 1S50A 1JVYA 5I2NB 1HSJA 4M1VA 2QL3A 2ZXTA 4EQ7A 1I69A 2XX8A 5H8HA 4F39A 1XOCA 2QMWA 3IOTA 1S9TA 2H4IA 2PYYA 1MH4A 4R74A 1MXUA 1DOTA 1IEJA 3RNNA 1QUKA 3SEVA 4HW8A 3RT6B 1B1XA 3RY3A 2OJTA 3FXQA 4LP2B 1II5A 2QS2A 4G8MA 1FTOA 5I56A 1PB8A 4H8IA 3KN8A 5L9OA 4NWCA 5FHNA 1AOVA 2HXWA 3MP1A 5JEIA 2HCAA 3VLWA 1Q1KA 1B3EA 3W9VA 4BDOA 2DXRA 4EQBA 3CRBA 2UVGA 1LBCA 4KYDA 4OZ9A 3CIJA 1QJMA 2RC8A 4M4GA 1LSTA 1NKXA 2OWSA 1WDNA 4ELRA 3PUWE 1PBQA 1NNTA 2VD2A 5H8FB 2HFBA 5A5XA 1DPEA 2I49A 2XD2A 3T9XB 2XX9A 2DS9A 3OO8A 2DQVA 4EDPA 1OQGA 3KFMA 4KFQA 4XKQA 4N13A 1SYHA 5H8NB 2UVHA 3V83A 4OWDA 1MXWA 4GFRA 1P1OA 4H67A 4MFIA 3O6GA 3ZKLA 3IJXB 1SW4A 4OVJA 1PC3A 5H8HB 2H98A 1NH7A 2DWJA 1NMUA 1YAEA 1OQHA 2PX1A 3JZJA 2THIA 2O68A 4BDRA 1M5DA 4OERA 2HAVA 4QFKA 1B4HA 5I56B 2QS1A 1LB8A 1A99A 3ODBA 3Q28A 1PBPA 1IITA 2D5WA 3U1OA 4DLDA 4EF1A 3KEIA 3U8QA 3KBRA 1URDA 4RY1A 3PUZE 3K1PA 2H99A 3SEUA 3G3GA 5A5XB 3ILUB 2NXOA 1USYE 4BDQA 3TZAA 1O64A 1B46A 4LZ5A 4GVOA 2GHAA 3HO7A 1FQFA 2DP8A 2Q2AA 3OO6A 2RKMA 1FQAA 5ITOA 5KZTA 3FD3A 2F6GA 2KLFA 4JBZA 1LAXA 4ZEFA 3PUVE 2R9JA 3K6UA 3EN3A 4I1DA 1RYOA 4QSEA 4PFYA 1Y3QA 3LSFB 4F29A 3K01A 3FGSA 5CMCA 4OQOA 3OEMA 3V8XB 3UP9A 4IO7A 2GFEA 3OEKA 4KYEA 1CB6A 2XXVA 4ISUA 1ELJA 2ZYMA 3KG2A 1XT8A 3WAEA 3MVYA 3R7XA 1IUDA 1NH8A 3IB1A 2RC9A 2XXYA 3SETA 1SW5A 3UGWA 1ZIUA 2ZYKA 3IK6B 3BFTA 3PV0E 1XS5A 3FVKA 1OVBA 2DWHA 5K2YA 4GL8A 5AA4A 2D21A 4FECA 5DEXA 4ESWA 1EZPA 1HSEA 3EF7A 2GHBA 5CBSA 2B3FA 2O69A 5JK4A 2V25A 3T9VA 4THIA 4F1YA 1N04A 2ANJA 3GZGA 3PUXE 4U1ZA 1TT1A 3KSXA 3C31A 1SQYA 1FQBA 3USDA 4IO3A 1B58A 5M2VA 1TFAA 1UTBA 1MY1A 2DOJA 1AL3A 4F1VA 4U23A 4DXUA 1SI1A 1YTVA 1MPDA 4U4XA 4X1DA 3TFLA 4MH5A 3DP6A 2HQ0A 4JWXA 2ZYNA 1Y4TA 3P7IA 1LCTA 1M5EA 3MVXA 3LR1A 2Q2CA 3PPOA 3RQTA 1JEUA 3W9WA 3HCQA 1SW2A 5HBCA 5FHMA 1J1NA 1P1NA 2NOOA 5DTBA 5ICTA 4YZZA 2FYIA 2QJEA 1MY2A 3SKPA 4P0GA 1MXZA 2H5YA 1SI0A 3FZVA 3SESA 4R2FA 1D9YA 3K6VA 3ONMA 4G4PA 4RPOA 2O51A 3KJTA 4XXUA 1XHYA 4HCWA 4R9FA 3SEYA 4ZEIA 2XXHA 3EHSA 1PDAA 1MPCA 1CE2A 3G3KA 1BLFA 4KD5A 3TEPA 2F8DA 3T96B 3B6TA 1T0KA 5AA4B 3ZKKA 3VLVA 4WKMA 5DEXB 4U21A 3CFZA 3VLUA 2X7PA 4XIGQ 4RYAA 2HZLA 2H9BA 3UIFA 4F3SA 2BJJX 5I57A 5BUUA 4GRKA 4YB6A 3DELB 4EQ9A 3E3KA 2M8CA 1UTBB 3PPQA 3E4RA 4C0RA 5L9SA 4I9DA 3PD8A 2X7QA 4FIMA 4LQ2A 3H06B 4OTEA 4XTCQ 4OXVA 1HSLA 2RC7A 1EU8A 1AIVA 1R9LA 5K2XA 4QSCA 4LVQA 4F2OA 4PE5B 3G7WA 4ONYA 3IJOB 4FEDA 4FEBA 4RK2A 2REGA 1B0LA 1M5BA 4H5FA 4IO2A 1UTHA 5CI5A 5KCJA 4C1UA 3OOAA 3K1NA 2Z22A 4G68A 2V84A 3ILTB 1N7WA 3SEXA 4LQ5A 1SYIA 4H5GA 3IOVA 1URSA 2ONSA 4K3FA 4O3AA 3U94A 2F35A 1OLAA 4MF3A 2I6EA 4AQ4A 2F78A 1MY4A 3N5LA 3O66A 3GXAA 1ZMGA 1GGGA 4DIGA 3D4GA 2CMOA 5DT6A 1PB7A 3H6VA 1JEVA 2XX7A 2A5SA 4X9TA 4E0WA 3G3JA 3ZSFA 5AE4A 3S2VA 3R6UA 1MDP1 2Y7PA 3KOTA 5I57B 1B51A 2PVUA 3MJNA 4OFJA 1RKMA 3QK6A 4JSOA 2Q8JA 4JDFA 2NVUB 1XC1A 4UA8A 3SDFA 2RCAA 3F11A 4KI0E 1JVXA 1ZBMA 2FA7A 2PBWA 3OSQA 1UTHB 5KCJB 1Y4CA 5CMBA 2DSFA 2QMXA 3KGCA 4G68B 1Y20A 2Q88A 3TELA 1B7UA 4O3BA 3PMWA 2IA4A 1Z7NE 4F3PA 1LLSA 3OO9A 3VE1B 4OFOA 4JB7A 1VFDA 4E0XA 4G8HA 4RK9A 4NWDA 4ESXA 4QFOA 3VVEA 1Y3NA 2DVZA 1SDXA 1WVJA 4AB5A 3K6WA 3MZBA 1MS7A 3S4UA 5TPAA 5DVIA 1N7XA 3B6WA 4IO4A 4O3CA 3M3LA 4RPNA 1MQHA 1B7HA 3TKDA 3LSXA 2FNCA 4TLLB 4KQPA 3CFLA 3OD7A 4X1BA 1B52A 3IOWA 2DWAA 3OXNA 4QFNA 2ZYOA 3O97A 3C32A 3PPPA 4EUOA 3N6TA 4F18A 3JYRA 1BIYA 4HTGA 3MQ9A 5CC2A 3FATA 3MWBA 1SBPA 4GXAA 3S9EA 3OENA 3K6XA 4F3BA 3VVDA 1H3DA 1ZJLA 4ZE8A 2CZLA 5ICQA 2QS4A 4H8JA 1P1WA 1POTA 4YAHX 1GR2A 4KR5A 3O2AA 4DXCA 3Q29A 4Q5TA 1IZ1A 1QVSA 3HHFA 4WEDA 2O1MA 4R6KA 2I0CA 1D4NA 4GIZA 1OLCA 4FORA 5IAIA 4DXBA 3MVWA 5FHOA 4ZZAA 5ITPA 1DTZA 3T9UA 2XXQA 4H1XA 4H6DA 3JV9A 2GRVA 3IO6A 1URGA 1O63A 1ZU0A 5JTYA 2RCBA 1I6QA 4BDMA 1B4ZA 2O84X 3H6TA 4TQUQ 1AMFA 3A09A 3MPLA 3MZ1A 4YICA 5TPAB 2OK2A 4ZEKA 4RXLA 1VE4A 2DE4A 2Z8EA 4QSDA 1Y1ZA 5FTHA 3I5OA 4MLVA 2UVJA 4R72A 4NF8A 1JNFA 2YJPA 5B70A 1IXCA 3MPKA 3L6HA 2O6AA 2F7CA 4JSDA 2F7BA 3HSTA 3H4ZA 3S9MC 4ZEBA 1A8EA 3BKIB 3TMGA 1N0TA 3V89B 1USYH 3O9PA 5TP9A 1B2HA 3N26A 4ECFA 3A3CA 4JXIA 4IGRA 1OVTA 3IAZA 3TAJA 4X48A 5FTIA 2V93A 1FQEA 3R26A 4OEVA 1MQIA 4EF2A 4BDLA 5EHSA 3OO7A 4LUBA 1JQFA 3N6UA 3B7DA 2V3QA 5H8SA 3FUZA 3VFJA 4N07A 1BKAA 3MUQA 2I58A 3Q27A 1MQGA 4U22A 3EHTA 5ISUA 2OBGA 1GVCA 3I6VA 3K02A 3W15C 3M3FA 4HS7A 4YKIA 5BWJA 2NWJA 4LZ8A 3ECRA 5JTYB 3C33A 3RGYA 4F1UA 4LATA 1MQJA 3CG3A 4KPTA 2VP1A 1FQCA 3PPNA 2Y84A 4MLQA 1QUIA 3K1MA 1LAHE 2XXRA 2AL4A 3QIMA 1MXVA 2ONRA 3U92A 4P11A 4PP0A 1Q35A 4U2RA 1POY1 4POWA 3HN0A 3FASA 4R73A 3BBRA 4NF8B 1NNKA 2I4BA 2DE2A 3K00A 3FVGA 2ZNSA 3C9HA 4ZDMA 3VVFA 1N84A 3FJMA 2R6GE 1MH3A 1MM7A 3MP6A 5LOMA 3TQWA 4OESA 5TP9B 3C34A 4GD5A 1FQDA 5HPQA 4GF8A 3TCFA 4NF5A 3HPIA 3CSGA 1F9BA 1Y3PA 3M3KA 4RJZA 4XKPA 2HAUA 3RN8A 2F34A 4OMBA 2O7IA 3E9XA 3BFUA 3VXBA 1B6HA 3TYHA 2Q9TA 3O28A 4P0IA 2QSXA 1SD3A 4H0WA 3RTWB 4XKRA 4QFPA 1I6BA 2IEEA 3O6IA 1UIUA 5B7DA 4NMYA 3EHUA 4DCYA 3AXFA 1QULA 4QHQA 4DDDA 1BTJA 2I3VA 3GBAA 3FVNA 3IOUA 4R9GA 4YKKA 4TLMB 2UYFA 2AIXA 4AB6A 2XHDA 1IXHA 2I0BA 2Y7IA 1ATGA 1US5A 4LZ7A 4ND9A 1TWYA 1D3KA 4JWYA 4BLAA 1DSNA 3IO4A 3EQ1A 1B40A 3PPRA 2B65A 5DVJA 4QRZA 5ELVA 1MXYA 2I3WA 4TOZA 4PETA 3TUSA 1MY3A 1H44A 2D3IA 4NF6A 4QFLA 1JETA 4NF5B 4UACA 4PQJA 3OMBA 3UK4A 1B5IA 2H25A 3HV1A 2Y7RA 3DM0A 4YKJA 2QS3A 3OSRA 4YMAA 3D4CA 4IO5A 2Z8FA 1QKBA 5DYHA 4JWOA 2AL5A 3V5AA 1DMBA 2OZZA 3OELA 5H8NA 1XVYA 3H7MA 3QXMA 4GQOA 2O1LA 2F6PA 1KWHA 3TTKA 5CBRA 3Q25A 2R71A 1B3FA 4PFWA 3TTLA 1GTKA 1B3HA 3TTRA 4LA9A 3H6UA 4MBPA 2VD3A 1A55A 4GL0A 1JW5A 4YU0A 3H03A 1A54A 2F97A 4G8NA 3IORA 3C4MA 1L5TA 1B9JA 4NF4A 3SEWA 5IKBA 1GV8A 3C35A 3DLNA 3VV5A 1A40A 3QSLA 1FCKA 2ZNUA 5CM6A 3G3IA 1IIWA 2P1SA 4GXSB 4OENA 4U4SA 4I62A 1VSOA 4XKNA 4GLIA 5I58A 2ZNTA 3MAMA 4QF9A 5CRYA 4OYVA 4WXJA 1R9QA 5I59A 2PT1A 1SW1A 1D9VA 4NF6B 1N3WA 3HHGA 1B5HA 4ZE9A 3CVGA 1XVXA 4ELOA 1LFHA 1BP5A 1LAGE 3U93A 4F31B 2PMSA 1H76A 3RUMA 1NNPA 1MM6A 3FXRA 1A8FA 2LAOA 3LSLA 3KSJA 2ABHA 4N6PA 4Q8RA 3T93B 1B5JA 3PD9A 1LB9A 5AA1A 3FVOA 3PMXA 4ZZEA 2WKYA 2PT2A 2DE3A 1US4A 2XXUA 1AH5A 2XXXA 2XXWA 1N3XA 3MP8A 3QYTA 2OLBA 3GBBA 1PEBA 3S9NC 3H6WA 2YLNA 4U1OA 3DP4A 4R6YA 4OETA 5EYFA 5KDTA 3IX1A 3K2DA 1MPBA 4OFLA 4R2BA 4Z0IA 2P0SA 4NF4B 1ZTYA 2XXIA 3T66A 1LAFE 4IY5A 2V3UA 1FTLA 1JW1A 3MC2A 3CR9A 4KCDA 5I58B 1H45A 4GWOA 3MBPA 3WAFA 1LGBC 5I59B 2UVIA 1VFEA 2G93A 1FTKA 1OMPA 1Y1MA 3G3FA 4GOTA 2B3BA 3K4UA 2XXPA 3C36A 2UXAA 2X26A 3RT8A 1NL5A 1R1NA 1EZ9A 3DP8A 1TXFA 3FIRA 2YPNA 1OIBA 4NE4A 2QPQA 2UYEA 4LONB 3VDFA 4EXKA 3N94A 1LCFA 3QUFA 2AYSA 4I8CA 4WEPA 2F7AA 3UN6A 4ZS9A 5H8QA 1LBBA 5F1QA 3PMVA 1B7ZA 4G77A 3U72A 3TCGA 1LFGA 2E1SA 1JW4A 3KZGA 1N76A 4FJPA 2DVCA 2VGQA 3EPEA 3T9HB 3PU5A 4YMBA 4HCYA 1B05A 1P1QA 3IR1A 1DTGA 5KDTB 1IQ7A 5AA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0H A;  4IB2 A;  1MRP A;  4DZ1 A;  2XD3 A;  5AA3 A;  4FAT A;  1P99 A;  4C1T A;  3SER A;  3I3V A;  5AA2 D;  4Q0C A;  1NNF A;  1S7Y A;  3RTF B;  2RIN A;  3MVZ A;  4ZEC A;  2HZK A;  5I2K A;  2E0S A;  1IXG A;  3S9L C;  3Q26 A;  2NUV A;  1YPN A;  3IL1 B;  5F7V A;  3TCH A;  1FTJ A;  1B1H A;  2VHA A;  3PUY E;  1PB9 A;  1YCJ A;  1MY0 A;  1QUJ A;  5CMK A;  5HM4 B;  2F5X A;  4R75 A;  3IB0 A;  1H43 A;  2Z23 A;  2RF1 A;  1UQW A;  1DPP A;  5DVF A;  2QRY A;  2V3T A;  4IY6 A;  3FJ7 A;  3RLF E;  1QW0 A;  2XXT A;  4OEU A;  5H8Q B;  3O29 A;  3B6Q A;  1RYX A;  4ELP A;  2Y7W A;  4DCX A;  3TPA A;  1TFD A;  4H65 A;  3G3H A;  3CFX A;  2Z8D A;  2ESN A;  4PFT A;  4IO6 A;  3K0V A;  5AA2 B;  4BDN A;  1I6A A;  3MW0 A;  3CSB A;  1MQD A;  1NFT A;  4IGT A;  1VR5 A;  1IXI A;  5L9M A;  2ONK E;  3LUY A;  4ELQ A;  4POX A;  4DE8 A;  3TOD A;  2A5T A;  5I2K B;  3KN3 A;  4L17 A;  4KHZ E;  1Y9U A;  1B3L A;  4Z7E A;  1ANF A;  5I84 A;  3TTM A;  1EH3 A;  2O7U A;  1MG1 A;  1B32 A;  3LSW A;  4RNS A;  4KCC A;  4KYS A;  3LC8 A;  2I4C A;  3FJG A;  3TDJ A;  4NTL A;  1MXX A;  1FW0 A;  5J1D A;  3A3U A;  3QAX A;  1MDQ A;  2Y7K A;  3PGF A;  1WOD A;  5I2N A;  2P2A A;  4G2Z A;  4OHN A;  2OCU A;  5L8D A;  3CI8 A;  4YB7 A;  4FE8 A;  4NED A;  4YKP A;  3ZS6 A;  2GH9 A;  2I48 A;  3TQL A;  4F19 A;  1FTM A;  2ZMB A;  4Q30 B;  1EZO A;  4R6H A;  2DWI A;  5TU0 A;  3VXC A;  1SVX B;  2VOZ A;  3M8U A;  1UIV A;  3H3G A;  1LFI A;  1ZLQ A;  3FV1 A;  4F22 A;  3E13 X;  1P1U A;  3GLB A;  3O6H A;  4FAJ A;  4G68 C;  2W7Y A;  1B3G A;  3T22 A;  3CG1 A;  3KJ7 A;  3FXU A;  3KOS A;  1M5F A;  4YB5 A;  1M5C A;  3MZ9 A;  5EHM A;  3TTN A;  2ALU A;  1Z7M E;  2F36 A;  4F2Q A;  4PFU A;  5CMM A;  2DYX A;  2A5T B;  5H8F A;  2HEU A;  3FV2 A;  1QKA A;  3RPW A;  2Q89 A;  3LBS A;  4EXL A;  4RA1 A;  1A7L A;  3QUJ A;  1R6Z A;  4F3G A;  3UA8 A;  3L6G A;  2G29 A;  3IB2 A;  3UOR A;  1O7T A;  2OWT A;  3KN7 A;  4ZED A;  3THI A;  2DXY A;  2REJ A;  1ZKB A;  1S50 A;  1JVY A;  5I2N B;  1HSJ A;  4M1V A;  2QL3 A;  2ZXT A;  4EQ7 A;  1I69 A;  2XX8 A;  5H8H A;  4F39 A;  1XOC A;  2QMW A;  3IOT A;  1S9T A;  2H4I A;  2PYY A;  1MH4 A;  4R74 A;  1MXU A;  1DOT A;  1IEJ A;  3RNN A;  1QUK A;  3SEV A;  4HW8 A;  3RT6 B;  1B1X A;  3RY3 A;  2OJT A;  3FXQ A;  4LP2 B;  1II5 A;  2QS2 A;  4G8M A;  1FTO A;  5I56 A;  1PB8 A;  4H8I A;  3KN8 A;  5L9O A;  4NWC A;  5FHN A;  1AOV A;  2HXW A;  3MP1 A;  5JEI A;  2HCA A;  3VLW A;  1Q1K A;  1B3E A;  3W9V A;  4BDO A;  2DXR A;  4EQB A;  3CRB A;  2UVG A;  1LBC A;  4KYD A;  4OZ9 A;  3CIJ A;  1QJM A;  2RC8 A;  4M4G A;  1LST A;  1NKX A;  2OWS A;  1WDN A;  4ELR A;  3PUW E;  1PBQ A;  1NNT A;  2VD2 A;  5H8F B;  2HFB A;  5A5X A;  1DPE A;  2I49 A;  2XD2 A;  3T9X B;  2XX9 A;  2DS9 A;  3OO8 A;  2DQV A;  4EDP A;  1OQG A;  3KFM A;  4KFQ A;  4XKQ A;  4N13 A;  1SYH A;  5H8N B;  2UVH A;  3V83 A;  4OWD A;  1MXW A;  4GFR A;  1P1O A;  4H67 A;  4MFI A;  3O6G A;  3ZKL A;  3IJX B;  1SW4 A;  4OVJ A;  1PC3 A;  5H8H B;  2H98 A;  1NH7 A;  2DWJ A;  1NMU A;  1YAE A;  1OQH A;  2PX1 A;  3JZJ A;  2THI A;  2O68 A;  4BDR A;  1M5D A;  4OER A;  2HAV A;  4QFK A;  1B4H A;  5I56 B;  2QS1 A;  1LB8 A;  1A99 A;  3ODB A;  3Q28 A;  1PBP A;  1IIT A;  2D5W A;  3U1O A;  4DLD A;  4EF1 A;  3KEI A;  3U8Q A;  3KBR A;  1URD A;  4RY1 A;  3PUZ E;  3K1P A;  2H99 A;  3SEU A;  3G3G A;  5A5X B;  3ILU B;  2NXO A;  1USY E;  4BDQ A;  3TZA A;  1O64 A;  1B46 A;  4LZ5 A;  4GVO A;  2GHA A;  3HO7 A;  1FQF A;  2DP8 A;  2Q2A A;  3OO6 A;  2RKM A;  1FQA A;  5ITO A;  5KZT A;  3FD3 A;  2F6G A;  2KLF A;  4JBZ A;  1LAX A;  4ZEF A;  3PUV E;  2R9J A;  3K6U A;  3EN3 A;  4I1D A;  1RYO A;  4QSE A;  4PFY A;  1Y3Q A;  3LSF B;  4F29 A;  3K01 A;  3FGS A;  5CMC A;  4OQO A;  3OEM A;  3V8X B;  3UP9 A;  4IO7 A;  2GFE A;  3OEK A;  4KYE A;  1CB6 A;  2XXV A;  4ISU A;  1ELJ A;  2ZYM A;  3KG2 A;  1XT8 A;  3WAE A;  3MVY A;  3R7X A;  1IUD A;  1NH8 A;  3IB1 A;  2RC9 A;  2XXY A;  3SET A;  1SW5 A;  3UGW A;  1ZIU A;  2ZYK A;  3IK6 B;  3BFT A;  3PV0 E;  1XS5 A;  3FVK A;  1OVB A;  2DWH A;  5K2Y A;  4GL8 A;  5AA4 A;  2D21 A;  4FEC A;  5DEX A;  4ESW A;  1EZP A;  1HSE A;  3EF7 A;  2GHB A;  5CBS A;  2B3F A;  2O69 A;  5JK4 A;  2V25 A;  3T9V A;  4THI A;  4F1Y A;  1N04 A;  2ANJ A;  3GZG A;  3PUX E;  4U1Z A;  1TT1 A;  3KSX A;  3C31 A;  1SQY A;  1FQB A;  3USD A;  4IO3 A;  1B58 A;  5M2V A;  1TFA A;  1UTB A;  1MY1 A;  2DOJ A;  1AL3 A;  4F1V A;  4U23 A;  4DXU A;  1SI1 A;  1YTV A;  1MPD A;  4U4X A;  4X1D A;  3TFL A;  4MH5 A;  3DP6 A;  2HQ0 A;  4JWX A;  2ZYN A;  1Y4T A;  3P7I A;  1LCT A;  1M5E A;  3MVX A;  3LR1 A;  2Q2C A;  3PPO A;  3RQT A;  1JEU A;  3W9W A;  3HCQ A;  1SW2 A;  5HBC A;  5FHM A;  1J1N A;  1P1N A;  2NOO A;  5DTB A;  5ICT A;  4YZZ A;  2FYI A;  2QJE A;  1MY2 A;  3SKP A;  4P0G A;  1MXZ A;  2H5Y A;  1SI0 A;  3FZV A;  3SES A;  4R2F A;  1D9Y A;  3K6V A;  3ONM A;  4G4P A;  4RPO A;  2O51 A;  3KJT A;  4XXU A;  1XHY A;  4HCW A;  4R9F A;  3SEY A;  4ZEI A;  2XXH A;  3EHS A;  1PDA A;  1MPC A;  1CE2 A;  3G3K A;  1BLF A;  4KD5 A;  3TEP A;  2F8D A;  3T96 B;  3B6T A;  1T0K A;  5AA4 B;  3ZKK A;  3VLV A;  4WKM A;  5DEX B;  4U21 A;  3CFZ A;  3VLU A;  2X7P A;  4XIG Q;  4RYA A;  2HZL A;  2H9B A;  3UIF A;  4F3S A;  2BJJ X;  5I57 A;  5BUU A;  4GRK A;  4YB6 A;  3DEL B;  4EQ9 A;  3E3K A;  2M8C A;  1UTB B;  3PPQ A;  3E4R A;  4C0R A;  5L9S A;  4I9D A;  3PD8 A;  2X7Q A;  4FIM A;  4LQ2 A;  3H06 B;  4OTE A;  4XTC Q;  4OXV A;  1HSL A;  2RC7 A;  1EU8 A;  1AIV A;  1R9L A;  5K2X A;  4QSC A;  4LVQ A;  4F2O A;  4PE5 B;  3G7W A;  4ONY A;  3IJO B;  4FED A;  4FEB A;  4RK2 A;  2REG A;  1B0L A;  1M5B A;  4H5F A;  4IO2 A;  1UTH A;  5CI5 A;  5KCJ A;  4C1U A;  3OOA A;  3K1N A;  2Z22 A;  4G68 A;  2V84 A;  3ILT B;  1N7W A;  3SEX A;  4LQ5 A;  1SYI A;  4H5G A;  3IOV A;  1URS A;  2ONS A;  4K3F A;  4O3A A;  3U94 A;  2F35 A;  1OLA A;  4MF3 A;  2I6E A;  4AQ4 A;  2F78 A;  1MY4 A;  3N5L A;  3O66 A;  3GXA A;  1ZMG A;  1GGG A;  4DIG A;  3D4G A;  2CMO A;  5DT6 A;  1PB7 A;  3H6V A;  1JEV A;  2XX7 A;  2A5S A;  4X9T A;  4E0W A;  3G3J A;  3ZSF A;  5AE4 A;  3S2V A;  3R6U A;  1MDP 1;  2Y7P A;  3KOT A;  5I57 B;  1B51 A;  2PVU A;  3MJN A;  4OFJ A;  1RKM A;  3QK6 A;  4JSO A;  2Q8J A;  4JDF A;  2NVU B;  1XC1 A;  4UA8 A;  3SDF A;  2RCA A;  3F11 A;  4KI0 E;  1JVX A;  1ZBM A;  2FA7 A;  2PBW A;  3OSQ A;  1UTH B;  5KCJ B;  1Y4C A;  5CMB A;  2DSF A;  2QMX A;  3KGC A;  4G68 B;  1Y20 A;  2Q88 A;  3TEL A;  1B7U A;  4O3B A;  3PMW A;  2IA4 A;  1Z7N E;  4F3P A;  1LLS A;  3OO9 A;  3VE1 B;  4OFO A;  4JB7 A;  1VFD A;  4E0X A;  4G8H A;  4RK9 A;  4NWD A;  4ESX A;  4QFO A;  3VVE A;  1Y3N A;  2DVZ A;  1SDX A;  1WVJ A;  4AB5 A;  3K6W A;  3MZB A;  1MS7 A;  3S4U A;  5TPA A;  5DVI A;  1N7X A;  3B6W A;  4IO4 A;  4O3C A;  3M3L A;  4RPN A;  1MQH A;  1B7H A;  3TKD A;  3LSX A;  2FNC A;  4TLL B;  4KQP A;  3CFL A;  3OD7 A;  4X1B A;  1B52 A;  3IOW A;  2DWA A;  3OXN A;  4QFN A;  2ZYO A;  3O97 A;  3C32 A;  3PPP A;  4EUO A;  3N6T A;  4F18 A;  3JYR A;  1BIY A;  4HTG A;  3MQ9 A;  5CC2 A;  3FAT A;  3MWB A;  1SBP A;  4GXA A;  3S9E A;  3OEN A;  3K6X A;  4F3B A;  3VVD A;  1H3D A;  1ZJL A;  4ZE8 A;  2CZL A;  5ICQ A;  2QS4 A;  4H8J A;  1P1W A;  1POT A;  4YAH X;  1GR2 A;  4KR5 A;  3O2A A;  4DXC A;  3Q29 A;  4Q5T A;  1IZ1 A;  1QVS A;  3HHF A;  4WED A;  2O1M A;  4R6K A;  2I0C A;  1D4N A;  4GIZ A;  1OLC A;  4FOR A;  5IAI A;  4DXB A;  3MVW A;  5FHO A;  4ZZA A;  5ITP A;  1DTZ A;  3T9U A;  2XXQ A;  4H1X A;  4H6D A;  3JV9 A;  2GRV A;  3IO6 A;  1URG A;  1O63 A;  1ZU0 A;  5JTY A;  2RCB A;  1I6Q A;  4BDM A;  1B4Z A;  2O84 X;  3H6T A;  4TQU Q;  1AMF A;  3A09 A;  3MPL A;  3MZ1 A;  4YIC A;  5TPA B;  2OK2 A;  4ZEK A;  4RXL A;  1VE4 A;  2DE4 A;  2Z8E A;  4QSD A;  1Y1Z A;  5FTH A;  3I5O A;  4MLV A;  2UVJ A;  4R72 A;  4NF8 A;  1JNF A;  2YJP A;  5B70 A;  1IXC A;  3MPK A;  3L6H A;  2O6A A;  2F7C A;  4JSD A;  2F7B A;  3HST A;  3H4Z A;  3S9M C;  4ZEB A;  1A8E A;  3BKI B;  3TMG A;  1N0T A;  3V89 B;  1USY H;  3O9P A;  5TP9 A;  1B2H A;  3N26 A;  4ECF A;  3A3C A;  4JXI A;  4IGR A;  1OVT A;  3IAZ A;  3TAJ A;  4X48 A;  5FTI A;  2V93 A;  1FQE A;  3R26 A;  4OEV A;  1MQI A;  4EF2 A;  4BDL A;  5EHS A;  3OO7 A;  4LUB A;  1JQF A;  3N6U A;  3B7D A;  2V3Q A;  5H8S A;  3FUZ A;  3VFJ A;  4N07 A;  1BKA A;  3MUQ A;  2I58 A;  3Q27 A;  1MQG A;  4U22 A;  3EHT A;  5ISU A;  2OBG A;  1GVC A;  3I6V A;  3K02 A;  3W15 C;  3M3F A;  4HS7 A;  4YKI A;  5BWJ A;  2NWJ A;  4LZ8 A;  3ECR A;  5JTY B;  3C33 A;  3RGY A;  4F1U A;  4LAT A;  1MQJ A;  3CG3 A;  4KPT A;  2VP1 A;  1FQC A;  3PPN A;  2Y84 A;  4MLQ A;  1QUI A;  3K1M A;  1LAH E;  2XXR A;  2AL4 A;  3QIM A;  1MXV A;  2ONR A;  3U92 A;  4P11 A;  4PP0 A;  1Q35 A;  4U2R A;  1POY 1;  4POW A;  3HN0 A;  3FAS A;  4R73 A;  3BBR A;  4NF8 B;  1NNK A;  2I4B A;  2DE2 A;  3K00 A;  3FVG A;  2ZNS A;  3C9H A;  4ZDM A;  3VVF A;  1N84 A;  3FJM A;  2R6G E;  1MH3 A;  1MM7 A;  3MP6 A;  5LOM A;  3TQW A;  4OES A;  5TP9 B;  3C34 A;  4GD5 A;  1FQD A;  5HPQ A;  4GF8 A;  3TCF A;  4NF5 A;  3HPI A;  3CSG A;  1F9B A;  1Y3P A;  3M3K A;  4RJZ A;  4XKP A;  2HAU A;  3RN8 A;  2F34 A;  4OMB A;  2O7I A;  3E9X A;  3BFU A;  3VXB A;  1B6H A;  3TYH A;  2Q9T A;  3O28 A;  4P0I A;  2QSX A;  1SD3 A;  4H0W A;  3RTW B;  4XKR A;  4QFP A;  1I6B A;  2IEE A;  3O6I A;  1UIU A;  5B7D A;  4NMY A;  3EHU A;  4DCY A;  3AXF A;  1QUL A;  4QHQ A;  4DDD A;  1BTJ A;  2I3V A;  3GBA A;  3FVN A;  3IOU A;  4R9G A;  4YKK A;  4TLM B;  2UYF A;  2AIX A;  4AB6 A;  2XHD A;  1IXH A;  2I0B A;  2Y7I A;  1ATG A;  1US5 A;  4LZ7 A;  4ND9 A;  1TWY A;  1D3K A;  4JWY A;  4BLA A;  1DSN A;  3IO4 A;  3EQ1 A;  1B40 A;  3PPR A;  2B65 A;  5DVJ A;  4QRZ A;  5ELV A;  1MXY A;  2I3W A;  4TOZ A;  4PET A;  3TUS A;  1MY3 A;  1H44 A;  2D3I A;  4NF6 A;  4QFL A;  1JET A;  4NF5 B;  4UAC A;  4PQJ A;  3OMB A;  3UK4 A;  1B5I A;  2H25 A;  3HV1 A;  2Y7R A;  3DM0 A;  4YKJ A;  2QS3 A;  3OSR A;  4YMA A;  3D4C A;  4IO5 A;  2Z8F A;  1QKB A;  5DYH A;  4JWO A;  2AL5 A;  3V5A A;  1DMB A;  2OZZ A;  3OEL A;  5H8N A;  1XVY A;  3H7M A;  3QXM A;  4GQO A;  2O1L A;  2F6P A;  1KWH A;  3TTK A;  5CBR A;  3Q25 A;  2R71 A;  1B3F A;  4PFW A;  3TTL A;  1GTK A;  1B3H A;  3TTR A;  4LA9 A;  3H6U A;  4MBP A;  2VD3 A;  1A55 A;  4GL0 A;  1JW5 A;  4YU0 A;  3H03 A;  1A54 A;  2F97 A;  4G8N A;  3IOR A;  3C4M A;  1L5T A;  1B9J A;  4NF4 A;  3SEW A;  5IKB A;  1GV8 A;  3C35 A;  3DLN A;  3VV5 A;  1A40 A;  3QSL A;  1FCK A;  2ZNU A;  5CM6 A;  3G3I A;  1IIW A;  2P1S A;  4GXS B;  4OEN A;  4U4S A;  4I62 A;  1VSO A;  4XKN A;  4GLI A;  5I58 A;  2ZNT A;  3MAM A;  4QF9 A;  5CRY A;  4OYV A;  4WXJ A;  1R9Q A;  5I59 A;  2PT1 A;  1SW1 A;  1D9V A;  4NF6 B;  1N3W A;  3HHG A;  1B5H A;  4ZE9 A;  3CVG A;  1XVX A;  4ELO A;  1LFH A;  1BP5 A;  1LAG E;  3U93 A;  4F31 B;  2PMS A;  1H76 A;  3RUM A;  1NNP A;  1MM6 A;  3FXR A;  1A8F A;  2LAO A;  3LSL A;  3KSJ A;  2ABH A;  4N6P A;  4Q8R A;  3T93 B;  1B5J A;  3PD9 A;  1LB9 A;  5AA1 A;  3FVO A;  3PMX A;  4ZZE A;  2WKY A;  2PT2 A;  2DE3 A;  1US4 A;  2XXU A;  1AH5 A;  2XXX A;  2XXW A;  1N3X A;  3MP8 A;  3QYT A;  2OLB A;  3GBB A;  1PEB A;  3S9N C;  3H6W A;  2YLN A;  4U1O A;  3DP4 A;  4R6Y A;  4OET A;  5EYF A;  5KDT A;  3IX1 A;  3K2D A;  1MPB A;  4OFL A;  4R2B A;  4Z0I A;  2P0S A;  4NF4 B;  1ZTY A;  2XXI A;  3T66 A;  1LAF E;  4IY5 A;  2V3U A;  1FTL A;  1JW1 A;  3MC2 A;  3CR9 A;  4KCD A;  5I58 B;  1H45 A;  4GWO A;  3MBP A;  3WAF A;  1LGB C;  5I59 B;  2UVI A;  1VFE A;  2G93 A;  1FTK A;  1OMP A;  1Y1M A;  3G3F A;  4GOT A;  2B3B A;  3K4U A;  2XXP A;  3C36 A;  2UXA A;  2X26 A;  3RT8 A;  1NL5 A;  1R1N A;  1EZ9 A;  3DP8 A;  1TXF A;  3FIR A;  2YPN A;  1OIB A;  4NE4 A;  2QPQ A;  2UYE A;  4LON B;  3VDF A;  4EXK A;  3N94 A;  1LCF A;  3QUF A;  2AYS A;  4I8C A;  4WEP A;  2F7A A;  3UN6 A;  4ZS9 A;  5H8Q A;  1LBB A;  5F1Q A;  3PMV A;  1B7Z A;  4G77 A;  3U72 A;  3TCG A;  1LFG A;  2E1S A;  1JW4 A;  3KZG A;  1N76 A;  4FJP A;  2DVC A;  2VGQ A;  3EPE A;  3T9H B;  3PU5 A;  4YMB A;  4HCY A;  1B05 A;  1P1Q A;  3IR1 A;  1DTG A;  5KDT B;  1IQ7 A;  5AA2 A; 
#chains in the Genus database with same CATH topology
 1B0H A;  4IB2 A;  1MRP A;  4DZ1 A;  2XD3 A;  5AA3 A;  4FAT A;  1P99 A;  4C1T A;  3SER A;  3I3V A;  5AA2 D;  3QMF A;  4Q0C A;  1NNF A;  1S7Y A;  3RTF B;  4N6K A;  2WBB A;  2RIN A;  1FJ9 A;  3MVZ A;  4ZEC A;  2HZK A;  5I2K A;  4I40 A;  2E0S A;  1IXG A;  3S9L C;  3Q26 A;  2NUV A;  2FVZ A;  1YPN A;  3IL1 B;  5F7V A;  3TCH A;  1FTJ A;  1AWB A;  1B1H A;  2VHA A;  3PUY E;  1PB9 A;  4GWY A;  4PAI A;  1YCJ A;  5ET6 A;  1MY0 A;  1QUJ A;  5CMK A;  5HM4 B;  2F5X A;  4R75 A;  3IB0 A;  1H43 A;  2Z23 A;  4DI3 D;  2RF1 A;  1UQW A;  4FBP A;  1DPP A;  5DVF A;  2QRY A;  2V3T A;  4IY6 A;  3FJ7 A;  3RLF E;  4PBH A;  1QW0 A;  1FPL A;  2XXT A;  4OEU A;  4MHF A;  5H8Q B;  3O29 A;  3B6Q A;  1RYX A;  4ELP A;  2Y7W A;  4DCX A;  3TPA A;  4GX4 A;  5LDZ A;  5ET5 A;  1TFD A;  4PGP A;  2XXK A;  1INP A;  4H65 A;  3G3H A;  3CFX A;  2Z8D A;  1JP4 A;  2ESN A;  4PFT A;  2F3D A;  4IO6 A;  3K0V A;  5AA2 B;  4BDN A;  1I6A A;  4PE3 A;  3MW0 A;  3CSB A;  1MQD A;  1FSA A;  1NFT A;  4IGT A;  4JVD A;  1VR5 A;  5I5P A;  1IXI A;  5L9M A;  2ONK E;  3BIH A;  2CZH A;  3LUY A;  4ELQ A;  4POX A;  4DE8 A;  4MEV A;  3TOD A;  2A5T A;  5I2K B;  3KN3 A;  4L17 A;  4KHZ E;  1Y9U A;  1B3L A;  4Z7E A;  1ANF A;  5I84 A;  3TTM A;  1EH3 A;  5EQ8 A;  2O7U A;  1MG1 A;  1B32 A;  3LSW A;  4RNS A;  2CZI A;  4KCC A;  4KYS A;  3LC8 A;  2I4C A;  3FJG A;  4OAN A;  1D9Q A;  3TDJ A;  4NTL A;  1MXX A;  1FW0 A;  5J1D A;  1LBV A;  3A3U A;  3QAX A;  1MDQ A;  4PAF A;  2Y7K A;  3PGF A;  1WOD A;  5I2N A;  2P2A A;  4G2Z A;  4OHN A;  2OCU A;  4XFE A;  5L8D A;  3CI8 A;  4YB7 A;  4FE8 A;  2B4M A;  4NED A;  2KQZ A;  4YKP A;  3ZS6 A;  2GH9 A;  2I48 A;  3TQL A;  4F19 A;  1FTM A;  2B4L A;  2ZMB A;  4Q30 B;  2WBD A;  1EZO A;  4R6H A;  2DWI A;  3B8B A;  5TU0 A;  3VXC A;  1SVX B;  2VOZ A;  3M8U A;  1UIV A;  3H3G A;  1LFI A;  1ZLQ A;  3FV1 A;  4F22 A;  3E13 X;  1P1U A;  3GLB A;  3O6H A;  4FAJ A;  4G68 C;  5T3J A;  2W7Y A;  1B3G A;  3T22 A;  3CG1 A;  3KJ7 A;  4UAB A;  3FXU A;  3KOS A;  1M5F A;  4OVR A;  4YB5 A;  1M5C A;  3MZ9 A;  5EHM A;  1NV1 A;  3TTN A;  2ALU A;  1Z7M E;  2JJK A;  2F36 A;  4F2Q A;  4PFU A;  5CMM A;  2DYX A;  2A5T B;  4MNC A;  5H8F A;  2HEU A;  3FV2 A;  1QKA A;  4GWW A;  3RPW A;  2Q89 A;  3LBS A;  4EXL A;  4RA1 A;  1A7L A;  3QUJ A;  1R6Z A;  4F3G A;  2XWI A;  3UA8 A;  3L6G A;  2G29 A;  3IB2 A;  1FRP A;  3UOR A;  1O7T A;  1NV4 A;  2OWT A;  3KN7 A;  4N8G A;  4ZED A;  3THI A;  2DXY A;  2REJ A;  1ZKB A;  1S50 A;  4MJO A;  1JVY A;  5I2N B;  1HSJ A;  4M1V A;  2QL3 A;  2ZXT A;  4EQ7 A;  1I69 A;  2XX8 A;  5H8H A;  4F39 A;  1XOC A;  2QMW A;  3IOT A;  1S9T A;  2H4I A;  2PYY A;  1MH4 A;  4R74 A;  1MXU A;  1DOT A;  1IEJ A;  3RNN A;  1QUK A;  3SEV A;  4HW8 A;  3RT6 B;  1B1X A;  3RY3 A;  2OJT A;  3FXQ A;  4LP2 B;  1II5 A;  2QS2 A;  4G8M A;  1FTO A;  5I56 A;  1PB8 A;  1BK4 A;  4H8I A;  3KN8 A;  5L9O A;  4NWC A;  5FHN A;  1AOV A;  2HXW A;  3MP1 A;  5JEI A;  2HCA A;  3VLW A;  1Q1K A;  1B3E A;  3W9V A;  4BDO A;  2DDK A;  2DXR A;  4PFR A;  4EQB A;  3CRB A;  2UVG A;  1LBC A;  4KYD A;  4OZ9 A;  3CIJ A;  1QJM A;  2RC8 A;  4M4G A;  1LST A;  1NKX A;  2OWS A;  1WDN A;  5IZZ A;  4ELR A;  3PUW E;  1PBQ A;  5ESY A;  1KZ8 A;  1NNT A;  2VD2 A;  5H8F B;  2HFB A;  3SZP A;  5A5X A;  1DPE A;  2I49 A;  2XD2 A;  3T9X B;  2XX9 A;  2DS9 A;  3OO8 A;  2DQV A;  4JVC A;  4EDP A;  1OQG A;  4KFQ A;  3KFM A;  4N13 A;  4XKQ A;  1SYH A;  5H8N B;  2UVH A;  3V83 A;  4OWD A;  1MXW A;  4GFR A;  5IZ1 A;  1P1O A;  4H67 A;  4MFI A;  3O6G A;  3ZKL A;  3IJX B;  1SW4 A;  4OVJ A;  3KC1 A;  1KA0 A;  1PC3 A;  1CNQ A;  3T1B A;  5H8H B;  2H98 A;  5IGA A;  1NH7 A;  2DWJ A;  1FBF A;  1NMU A;  1YAE A;  1OQH A;  1G0I A;  2PX1 A;  3JZJ A;  2THI A;  2O68 A;  1XI6 A;  4BDR A;  2PCR A;  1M5D A;  4OER A;  2HAV A;  4QFK A;  1B4H A;  5I56 B;  2QS1 A;  1LB8 A;  1A99 A;  3ODB A;  3Q28 A;  2QVR A;  1PBP A;  1IIT A;  2CZK A;  2D5W A;  1FTA A;  3U1O A;  4NN3 A;  4DLD A;  4EF1 A;  1SPI A;  2HHM A;  3KEI A;  3U8Q A;  3KBR A;  1URD A;  4RY1 A;  3PUZ E;  4MAG A;  2L5V A;  3K1P A;  1YXI A;  2H99 A;  3SEU A;  1YZ0 A;  1FBH A;  4PTK A;  3G3G A;  5A5X B;  3ILU B;  2NXO A;  1FPB A;  4PC9 A;  1USY E;  4BDQ A;  3TZA A;  1O64 A;  1B46 A;  4LZ5 A;  4GVO A;  2GHA A;  3HO7 A;  3E78 A;  1FQF A;  2DP8 A;  2Q2A A;  4HXV A;  3OO6 A;  2RKM A;  1FQA A;  3RPL A;  5ITO A;  5EQ9 A;  5KZT A;  3FD3 A;  2F6G A;  3LV0 A;  2KLF A;  4JBZ A;  1LAX A;  4ZEF A;  3PUV E;  2R9J A;  5FBP A;  3K6U A;  3EN3 A;  4HE2 A;  1RYO A;  4I1D A;  4QSE A;  4PFY A;  1Y3Q A;  1LBX A;  1LBW A;  2XWO A;  3LSF B;  4F29 A;  3K01 A;  3FGS A;  5CMC A;  4OQO A;  3OEM A;  3GYY A;  3V8X B;  3UP9 A;  4IO7 A;  4MMP A;  2GFE A;  3OEK A;  4KYE A;  1CB6 A;  2XXV A;  4ISU A;  4P3L A;  1ELJ A;  2ZYM A;  3KG2 A;  4OVT A;  1XT8 A;  3WAE A;  3MVY A;  3R7X A;  1IUD A;  1NH8 A;  3IB1 A;  2RC9 A;  2XXY A;  3SET A;  1SW5 A;  3UGW A;  1ZIU A;  2ZYK A;  3IK6 B;  3BFT A;  3PV0 E;  1XS5 A;  3FVK A;  1OVB A;  2DWH A;  2QFL A;  5K2Y A;  4NHB A;  4GL8 A;  5AA4 A;  2D21 A;  4FEC A;  5DEX A;  4ESW A;  1EZP A;  1HSE A;  3EF7 A;  2GHB A;  1NUW A;  4GBV A;  5CBS A;  2B3F A;  2O69 A;  5JK4 A;  2V25 A;  3T9V A;  1IQ7 A;  4THI A;  4F1Y A;  1N04 A;  2ANJ A;  3GZG A;  3PUX E;  4U1Z A;  1TT1 A;  3KSX A;  3C31 A;  2WX9 A;  1SQY A;  2MKZ A;  1FQB A;  3USD A;  4IO3 A;  1B58 A;  5M2V A;  1TFA A;  1UTB A;  3RPL B;  1MY1 A;  2DOJ A;  1AL3 A;  4F1V A;  4U23 A;  4DXU A;  1SI1 A;  1YTV A;  1MPD A;  2Q74 A;  4U4X A;  2ZZW A;  4X1D A;  1FJ6 A;  3TFL A;  4MH5 A;  3DP6 A;  2HQ0 A;  4JWX A;  2ZYN A;  1Y4T A;  3P7I A;  1LCT A;  1M5E A;  3MVX A;  4IR8 A;  3LR1 A;  2Q2C A;  3PPO A;  3RQT A;  4O94 A;  1JEU A;  1NV5 A;  3W9W A;  3HCQ A;  1SW2 A;  5HBC A;  5FHM A;  1J1N A;  1P1N A;  2NOO A;  5DTB A;  5ICT A;  4YZZ A;  2FYI A;  4N6D A;  1EYI A;  2QJE A;  1MY2 A;  3SKP A;  4P0G A;  1MXZ A;  2H5Y A;  1SI0 A;  3FZV A;  3SES A;  4R2F A;  1D9Y A;  3K6V A;  1NUY A;  3ONM A;  4G4P A;  4RPO A;  2O51 A;  3KJT A;  4XXU A;  1XHY A;  4HCW A;  4R9F A;  3SEY A;  4ZEI A;  2XXH A;  3EHS A;  1PDA A;  1MPC A;  1CE2 A;  3G3K A;  1BLF A;  4KD5 A;  3TEP A;  1NUZ A;  2F8D A;  3T96 B;  3B6T A;  1T0K A;  5AA4 B;  2WEF A;  3VLV A;  3ZKK A;  4WKM A;  2BJI A;  5DEX B;  4U21 A;  3CFZ A;  3VLU A;  3RYD A;  2X7P A;  4XIG Q;  4RYA A;  2HZL A;  1DBZ A;  2H9B A;  3UIF A;  4NGU A;  2BJJ X;  4F3S A;  5I57 A;  5BUU A;  4GRK A;  4YB6 A;  4PAK A;  3DEL B;  4EQ9 A;  3E3K A;  2M8C A;  2WYK A;  1UTB B;  3PPQ A;  1NV2 A;  3E4R A;  4C0R A;  5L9S A;  4I9D A;  3PD8 A;  2X7Q A;  4FIM A;  4LQ2 A;  3H06 B;  4OTE A;  4XTC Q;  4OXV A;  1HSL A;  2RC7 A;  1EU8 A;  1AIV A;  4N81 A;  1R9L A;  5K2X A;  4QSC A;  2P3V A;  4LVQ A;  4F2O A;  4PE5 B;  1FPD A;  4MX6 A;  4ONY A;  3G7W A;  3IJO B;  4FED A;  4GWS A;  4FEB A;  4PF6 A;  4RK2 A;  2REG A;  1B0L A;  1M5B A;  4H5F A;  4IO2 A;  1UTH A;  5CI5 A;  5KCJ A;  5IM2 A;  4C1U A;  3OOA A;  3K1N A;  2Z22 A;  4G68 A;  1FPG A;  2V84 A;  3ILT B;  1N7W A;  3SEX A;  4LQ5 A;  1SYI A;  4H5G A;  3IOV A;  1URS A;  2ONS A;  4K3F A;  4O3A A;  3U94 A;  2F35 A;  1OLA A;  4MF3 A;  2P3N A;  2I6E A;  4AQ4 A;  2F78 A;  1MY4 A;  3N5L A;  3KC0 A;  3O66 A;  3GXA A;  1ZMG A;  1GGG A;  1IMF A;  1FBD A;  4DIG A;  4HE1 A;  3D4G A;  2CMO A;  5DT6 A;  1PB7 A;  3H6V A;  1JEV A;  2XX7 A;  2A5S A;  3FXB A;  4X9T A;  3G3J A;  4E0W A;  1RDX A;  3ZSF A;  5AE4 A;  3S2V A;  3R6U A;  1MDP 1;  4PDH A;  3EKI A;  2Y7P A;  3KOT A;  5I57 B;  1B51 A;  2PVU A;  3MJN A;  4OFJ A;  2WYP A;  3D1R A;  4AS4 A;  1RKM A;  3QK6 A;  4JSO A;  2Q8J A;  4JDF A;  2CEX A;  2NVU B;  1XC1 A;  4UA8 A;  3SDF A;  2RCA A;  3F11 A;  4KI0 E;  3FBP A;  1JVX A;  3BIG A;  1ZBM A;  2FA7 A;  2PBW A;  2FHY A;  5A5L A;  3OSQ A;  4O7M A;  1UTH B;  1EYJ A;  5KCJ B;  1Y4C A;  5CMB A;  2DSF A;  2QMX A;  3KGC A;  4G68 B;  5EYH A;  1Y20 A;  2Q88 A;  3TEL A;  1B7U A;  4O3B A;  4OVS A;  3PMW A;  2Y5K A;  2IA4 A;  1Z7N E;  4F3P A;  1LLS A;  3OO9 A;  4H45 A;  3VE1 B;  4OFO A;  4JB7 A;  1VFD A;  4KXP A;  4E0X A;  4G8H A;  4NX1 A;  4P56 A;  1IMC A;  4RK9 A;  4NWD A;  4ESX A;  4QFO A;  4PCD A;  1IME A;  3MST A;  3VVE A;  1Y3N A;  2DVZ A;  1SDX A;  1WVJ A;  4AB5 A;  2XA5 A;  3K6W A;  3MZB A;  1MS7 A;  3S4U A;  5TPA A;  5DVI A;  1N7X A;  3B6W A;  2V4C A;  4IO4 A;  4O3C A;  3M3L A;  4RPN A;  1MQH A;  1B7H A;  3TKD A;  3LSX A;  2FNC A;  4TLL B;  4KQP A;  3CFL A;  3OD7 A;  4X1B A;  4MNI A;  1B52 A;  3IOW A;  1Q9D A;  2DWA A;  3OXN A;  4QFN A;  4OVP A;  2ZYO A;  3O97 A;  3C32 A;  3PPP A;  4EUO A;  3N6T A;  4F18 A;  4PF8 A;  3JYR A;  1BIY A;  1NV7 A;  1VDW A;  4HTG A;  3MQ9 A;  5CC2 A;  3FAT A;  3MWB A;  1SBP A;  4GXA A;  3S9E A;  3OEN A;  1IMD A;  3K6X A;  4F3B A;  3VVD A;  1H3D A;  1FBG A;  1ZJL A;  4ZE8 A;  4MCO A;  2CZL A;  4GWU A;  4P9K A;  5ICQ A;  2QVV A;  2QS4 A;  4H8J A;  1P1W A;  1POT A;  4YAH X;  1GR2 A;  4KR5 A;  3O2A A;  4DXC A;  4OVQ A;  3Q29 A;  4Q5T A;  1IZ1 A;  1QVS A;  3HHF A;  4WED A;  3ROJ A;  2O1M A;  4R6K A;  2I0C A;  1D4N A;  4GIZ A;  1OLC A;  4FOR A;  5IAI A;  4DXB A;  3MVW A;  5FHO A;  4HE0 A;  4ZZA A;  5ITP A;  1DTZ A;  3T9U A;  1NI9 A;  2XXQ A;  4PBQ A;  4H1X A;  4H6D A;  3JV9 A;  2GRV A;  3IO6 A;  1URG A;  1O63 A;  1ZU0 A;  5JTY A;  2RCB A;  1I6Q A;  4BDM A;  1B4Z A;  2O84 X;  1IMA A;  4NQ8 A;  3H6T A;  4TQU Q;  1AMF A;  3A09 A;  2FBP A;  3MPL A;  3MZ1 A;  4YIC A;  5TPA B;  2OK2 A;  4ZEK A;  4RXL A;  1VE4 A;  2DE4 A;  2Z8E A;  4QSD A;  1Y1Z A;  5FTH A;  3A29 A;  3I5O A;  4MLV A;  2UVJ A;  4R72 A;  4N15 A;  4NF8 A;  4GX3 A;  1JNF A;  2YJP A;  5B70 A;  1IXC A;  3MPK A;  3L6H A;  2O6A A;  2VT5 A;  4JSD A;  2F7C A;  2F7B A;  3HST A;  3H4Z A;  3S9M C;  4MIJ A;  4ZEB A;  1A8E A;  2KR0 A;  3BKI B;  2CEY A;  3TMG A;  1N0T A;  4N17 A;  3V89 B;  1USY H;  1FBC A;  3O9P A;  5TP9 A;  1B2H A;  4PDD A;  3N26 A;  4ECF A;  3A3C A;  4JXI A;  4IGR A;  1OVT A;  3IAZ A;  3TAJ A;  4X48 A;  5FTI A;  2V93 A;  2ZZX A;  1FQE A;  3R26 A;  4OEV A;  1MQI A;  4EF2 A;  1EYK A;  5EHS A;  4BDL A;  3OO7 A;  4LUB A;  1JQF A;  4QBA A;  3N6U A;  1NV0 A;  3B7D A;  2V3Q A;  5H8S A;  1K9Y A;  3FUZ A;  1KA1 A;  3VFJ A;  4N07 A;  1BKA A;  3MUQ A;  2I58 A;  3Q27 A;  1MQG A;  2FIX A;  3IFA A;  4U22 A;  4PGN A;  3EHT A;  5ISU A;  2OBG A;  1GVC A;  3I6V A;  4X8R A;  3K02 A;  3W15 C;  3M3F A;  4HS7 A;  4YKI A;  5BWJ A;  3IFC A;  2NWJ A;  4LZ8 A;  5ET7 A;  3ECR A;  5JTY B;  3C33 A;  3RGY A;  4XF5 A;  4F1U A;  4LAT A;  1MQJ A;  3CG3 A;  4KPT A;  2VP1 A;  1FQC A;  3PPN A;  5F24 A;  2Y84 A;  4MLQ A;  1QUI A;  3K1M A;  1LAH E;  2XXR A;  4XEQ A;  2AL4 A;  3QIM A;  4N4U A;  1MXV A;  2ONR A;  3PTY A;  3U92 A;  4P11 A;  4PP0 A;  1Q35 A;  1NUX A;  1POY 1;  4U2R A;  4POW A;  3HN0 A;  3FAS A;  4R73 A;  3BBR A;  4NF8 B;  1NNK A;  2I4B A;  2DE2 A;  3K00 A;  1K9Z A;  1FPE A;  3FVG A;  2ZNS A;  3C9H A;  4ZDM A;  3VVF A;  1N84 A;  3FJM A;  2R6G E;  4OA4 A;  1MH3 A;  1MM7 A;  3MP6 A;  5LOM A;  3TQW A;  4OES A;  5TP9 B;  3C34 A;  4I3Y A;  4GD5 A;  1FQD A;  5HPQ A;  4GF8 A;  3NOH A;  4NF5 A;  3TCF A;  4DI4 B;  3HPI A;  3CSG A;  1F9B A;  1Y3P A;  2XWV A;  3M3K A;  4RJZ A;  4XKP A;  4I3E A;  2HAU A;  3RN8 A;  2F34 A;  4OMB A;  4N91 A;  2O7I A;  3E9X A;  3BFU A;  4GWZ A;  3VXB A;  1B6H A;  3TYH A;  2Q9T A;  3O28 A;  4P0I A;  2QSX A;  1FPJ A;  1SD3 A;  4O7I A;  4H0W A;  3RTW B;  4XKR A;  4QFP A;  1I6B A;  2IEE A;  3O6I A;  1UIU A;  5B7D A;  4NMY A;  3MYU A;  3EHU A;  4DCY A;  3AXF A;  1QUL A;  4QHQ A;  4DDD A;  2Q8M A;  1BTJ A;  2I3V A;  3GBA A;  3FVN A;  3IOU A;  4R9G A;  4YKK A;  4TLM B;  2UYF A;  2AIX A;  4AB6 A;  5IZ3 A;  5EQ7 A;  2XHD A;  1IXH A;  2I0B A;  2VPO A;  2Y7I A;  1QGX A;  1ATG A;  1LBZ A;  1US5 A;  4LZ7 A;  4ND9 A;  1TWY A;  1D3K A;  4JWY A;  5I3S A;  1NV6 A;  4BLA A;  1DSN A;  3IO4 A;  3EQ1 A;  1B40 A;  3PPR A;  2B65 A;  5DVJ A;  4QRZ A;  5ELV A;  1MXY A;  2I3W A;  4TOZ A;  1FBP A;  1DK4 A;  4P1L A;  4PET A;  3TUS A;  1MY3 A;  1H44 A;  2D3I A;  5ET8 A;  4NF6 A;  5EYG A;  4QFL A;  1JET A;  4NF5 B;  4UAC A;  4PQJ A;  3OMB A;  3UK4 A;  1B5I A;  2H25 A;  3HV1 A;  2R8T A;  2Y7R A;  3DM0 A;  4YKJ A;  2QS3 A;  5I7I A;  3OSR A;  4YMA A;  1LEV A;  2F3B A;  3D4C A;  4IO5 A;  2Z8F A;  2Y5L A;  3T0J A;  1QKB A;  3U65 A;  5DYH A;  4PFB A;  4JWO A;  2AL5 A;  3V5A A;  1DMB A;  2FIE A;  5J16 A;  2OZZ A;  3OEL A;  4MNP A;  5H8N A;  1XVY A;  3H7M A;  3QXM A;  4GQO A;  2O1L A;  2F6P A;  1LBY A;  2ZZV A;  1KWH A;  3TTK A;  5CBR A;  3ISP A;  3Q25 A;  2R71 A;  1B3F A;  4PFW A;  3TTL A;  1GTK A;  1B3H A;  3TTR A;  5LTC A;  4LA9 A;  3H6U A;  4MBP A;  2OWZ A;  5IZ3 B;  2VD3 A;  4GWX A;  1A55 A;  4GL0 A;  1JW5 A;  4YU0 A;  3H03 A;  1A54 A;  1G0H A;  2F97 A;  3CHG A;  1IMB A;  4G8N A;  3IOR A;  3C4M A;  1L5T A;  1B9J A;  4NF4 A;  3SEW A;  5IKB A;  1GV8 A;  3C35 A;  2XWK A;  3DLN A;  3VV5 A;  1A40 A;  3QSL A;  1FCK A;  2ZNU A;  5CM6 A;  3G3I A;  1IIW A;  2P1S A;  3HFU A;  4GXS B;  4OEN A;  4U4S A;  4I62 A;  1VSO A;  4GX6 A;  4XKN A;  2PFY A;  4GLI A;  5I58 A;  2GQ1 A;  2ZNT A;  3MAM A;  4QF9 A;  5CRY A;  4OYV A;  4WXJ A;  3B50 A;  1R9Q A;  5I59 A;  2PT1 A;  1SW1 A;  1D9V A;  4NF6 B;  1N3W A;  3HHG A;  1B5H A;  4ZE9 A;  4P1E A;  3CVG A;  1XVX A;  4ELO A;  1LFH A;  1BP5 A;  1LAG E;  3U93 A;  4F31 B;  4NAP A;  1FPF A;  2PMS A;  1H76 A;  3RUM A;  1NNP A;  4GBW A;  1MM6 A;  3FXR A;  1A8F A;  2LAO A;  3LSL A;  3KSJ A;  2ABH A;  4N6P A;  4NG7 A;  4Q8R A;  3T93 B;  1RDZ A;  3KBZ A;  1B5J A;  3PD9 A;  1LB9 A;  1DCU A;  5AA1 A;  3FVO A;  1FBE A;  3PMX A;  4X04 A;  4ZZE A;  2WKY A;  2PT2 A;  2DE3 A;  4O8M A;  1US4 A;  2XXU A;  1AH5 A;  1FPK A;  2XXX A;  2XXW A;  1N3X A;  2VPN A;  3MP8 A;  3QYT A;  2OLB A;  3GBB A;  1PEB A;  3S9N C;  3H6W A;  2YLN A;  4U1O A;  3DP4 A;  4R6Y A;  4OET A;  5EYF A;  5KDT A;  3IX1 A;  4JVI A;  3K2D A;  1MPB A;  4OFL A;  4R2B A;  4Z0I A;  2P0S A;  4NF4 B;  1ZTY A;  2XXI A;  3T66 A;  1LAF E;  4IY5 A;  2V3U A;  1FTL A;  4P8B A;  2OX3 A;  1JW1 A;  4QXD A;  3MC2 A;  3CR9 A;  4KCD A;  5I58 B;  1H45 A;  4GWO A;  3MBP A;  3WAF A;  1LGB C;  4G61 A;  5I59 B;  2UVI A;  1VFE A;  2G93 A;  1FTK A;  1OMP A;  1Y1M A;  3LUZ A;  3G3F A;  4GOT A;  2B3B A;  3K4U A;  2XXP A;  3C36 A;  2UXA A;  2X26 A;  3RT8 A;  1NL5 A;  1R1N A;  1EZ9 A;  2HPG A;  4LN5 A;  3DP8 A;  5DW8 A;  1TXF A;  3FIR A;  2YPN A;  1OIB A;  2HXR A;  4NE4 A;  2QPQ A;  2UYE A;  4LON B;  3VDF A;  4EXK A;  2QVU A;  3N94 A;  3E79 A;  2PFZ A;  1LCF A;  3QUF A;  2AYS A;  4I8C A;  4WEP A;  2F7A A;  3UN6 A;  4N8Y A;  4ZS9 A;  5H8Q A;  1LBB A;  4H46 A;  5F1Q A;  3PMV A;  4NF0 A;  1B7Z A;  4G77 A;  5EQA A;  3U72 A;  3TCG A;  1LFG A;  2E1S A;  1JW4 A;  4P47 A;  3KZG A;  1N76 A;  4FJP A;  2DVC A;  2VGQ A;  1NV3 A;  3EPE A;  1YYZ A;  1FPI A;  3T9H B;  3PU5 A;  1RDY A;  4AS5 A;  4YMB A;  4HCY A;  1B05 A;  1P1Q A;  3IR1 A;  1DTG A;  5KDT B;  4PFI A;  5AA2 A; 
#chains in the Genus database with same CATH homology
 1B0H A;  4IB2 A;  1MRP A;  4DZ1 A;  2XD3 A;  5AA3 A;  4FAT A;  1P99 A;  4C1T A;  3SER A;  3I3V A;  5AA2 D;  4Q0C A;  1NNF A;  1S7Y A;  3RTF B;  2RIN A;  3MVZ A;  4ZEC A;  2HZK A;  5I2K A;  2E0S A;  1IXG A;  3S9L C;  3Q26 A;  2NUV A;  1YPN A;  3IL1 B;  5F7V A;  3TCH A;  1FTJ A;  1B1H A;  2VHA A;  3PUY E;  1PB9 A;  1YCJ A;  1MY0 A;  1QUJ A;  5CMK A;  5HM4 B;  2F5X A;  4R75 A;  3IB0 A;  1H43 A;  2Z23 A;  2RF1 A;  1UQW A;  1DPP A;  5DVF A;  2QRY A;  2V3T A;  4IY6 A;  3FJ7 A;  3RLF E;  1QW0 A;  2XXT A;  4OEU A;  5H8Q B;  3O29 A;  3B6Q A;  1RYX A;  4ELP A;  2Y7W A;  4DCX A;  3TPA A;  1TFD A;  4H65 A;  3G3H A;  3CFX A;  2Z8D A;  2ESN A;  4PFT A;  4IO6 A;  3K0V A;  5AA2 B;  4BDN A;  1I6A A;  3MW0 A;  3CSB A;  1MQD A;  1NFT A;  4IGT A;  1VR5 A;  1IXI A;  5L9M A;  2ONK E;  3LUY A;  4ELQ A;  4POX A;  4DE8 A;  3TOD A;  2A5T A;  5I2K B;  3KN3 A;  4L17 A;  4KHZ E;  1Y9U A;  1B3L A;  4Z7E A;  1ANF A;  5I84 A;  3TTM A;  1EH3 A;  2O7U A;  1MG1 A;  1B32 A;  3LSW A;  4RNS A;  4KCC A;  4KYS A;  3LC8 A;  2I4C A;  3FJG A;  3TDJ A;  4NTL A;  1MXX A;  1FW0 A;  5J1D A;  3A3U A;  3QAX A;  1MDQ A;  2Y7K A;  3PGF A;  1WOD A;  5I2N A;  2P2A A;  4G2Z A;  4OHN A;  2OCU A;  5L8D A;  3CI8 A;  4YB7 A;  4FE8 A;  4NED A;  4YKP A;  3ZS6 A;  2GH9 A;  2I48 A;  3TQL A;  4F19 A;  1FTM A;  2ZMB A;  4Q30 B;  1EZO A;  4R6H A;  2DWI A;  5TU0 A;  3VXC A;  1SVX B;  2VOZ A;  3M8U A;  1UIV A;  3H3G A;  1LFI A;  1ZLQ A;  3FV1 A;  4F22 A;  3E13 X;  1P1U A;  3GLB A;  3O6H A;  4FAJ A;  4G68 C;  2W7Y A;  1B3G A;  3T22 A;  3CG1 A;  3KJ7 A;  3FXU A;  3KOS A;  1M5F A;  4YB5 A;  1M5C A;  3MZ9 A;  5EHM A;  3TTN A;  2ALU A;  1Z7M E;  2F36 A;  4F2Q A;  4PFU A;  5CMM A;  2DYX A;  2A5T B;  5H8F A;  2HEU A;  3FV2 A;  1QKA A;  3RPW A;  2Q89 A;  3LBS A;  4EXL A;  4RA1 A;  1A7L A;  3QUJ A;  1R6Z A;  4F3G A;  3UA8 A;  3L6G A;  2G29 A;  3IB2 A;  3UOR A;  1O7T A;  2OWT A;  3KN7 A;  4ZED A;  3THI A;  2DXY A;  2REJ A;  1ZKB A;  1S50 A;  1JVY A;  5I2N B;  1HSJ A;  4M1V A;  2QL3 A;  2ZXT A;  4EQ7 A;  1I69 A;  2XX8 A;  5H8H A;  4F39 A;  1XOC A;  2QMW A;  3IOT A;  1S9T A;  2H4I A;  2PYY A;  1MH4 A;  4R74 A;  1MXU A;  1DOT A;  1IEJ A;  3RNN A;  1QUK A;  3SEV A;  4HW8 A;  3RT6 B;  1B1X A;  3RY3 A;  2OJT A;  3FXQ A;  4LP2 B;  1II5 A;  2QS2 A;  4G8M A;  1FTO A;  5I56 A;  1PB8 A;  4H8I A;  3KN8 A;  5L9O A;  4NWC A;  5FHN A;  1AOV A;  2HXW A;  3MP1 A;  5JEI A;  2HCA A;  3VLW A;  1Q1K A;  1B3E A;  3W9V A;  4BDO A;  2DXR A;  4EQB A;  3CRB A;  2UVG A;  1LBC A;  4KYD A;  4OZ9 A;  3CIJ A;  1QJM A;  2RC8 A;  4M4G A;  1LST A;  1NKX A;  2OWS A;  1WDN A;  4ELR A;  3PUW E;  1PBQ A;  1NNT A;  2VD2 A;  5H8F B;  2HFB A;  5A5X A;  1DPE A;  2I49 A;  2XD2 A;  3T9X B;  2XX9 A;  2DS9 A;  3OO8 A;  2DQV A;  4EDP A;  1OQG A;  3KFM A;  4KFQ A;  4XKQ A;  4N13 A;  1SYH A;  5H8N B;  2UVH A;  3V83 A;  4OWD A;  1MXW A;  4GFR A;  1P1O A;  4H67 A;  4MFI A;  3O6G A;  3ZKL A;  3IJX B;  1SW4 A;  4OVJ A;  1PC3 A;  5H8H B;  2H98 A;  1NH7 A;  2DWJ A;  1NMU A;  1YAE A;  1OQH A;  2PX1 A;  3JZJ A;  2THI A;  2O68 A;  4BDR A;  1M5D A;  4OER A;  2HAV A;  4QFK A;  1B4H A;  5I56 B;  2QS1 A;  1LB8 A;  1A99 A;  3ODB A;  3Q28 A;  1PBP A;  1IIT A;  2D5W A;  3U1O A;  4DLD A;  4EF1 A;  3KEI A;  3U8Q A;  3KBR A;  1URD A;  4RY1 A;  3PUZ E;  3K1P A;  2H99 A;  3SEU A;  3G3G A;  5A5X B;  3ILU B;  2NXO A;  1USY E;  4BDQ A;  3TZA A;  1O64 A;  1B46 A;  4LZ5 A;  4GVO A;  2GHA A;  3HO7 A;  1FQF A;  2DP8 A;  2Q2A A;  3OO6 A;  2RKM A;  1FQA A;  5ITO A;  5KZT A;  3FD3 A;  2F6G A;  2KLF A;  4JBZ A;  1LAX A;  4ZEF A;  3PUV E;  2R9J A;  3K6U A;  3EN3 A;  4I1D A;  1RYO A;  4QSE A;  4PFY A;  1Y3Q A;  3LSF B;  4F29 A;  3K01 A;  3FGS A;  5CMC A;  4OQO A;  3OEM A;  3V8X B;  3UP9 A;  4IO7 A;  2GFE A;  3OEK A;  4KYE A;  1CB6 A;  2XXV A;  4ISU A;  1ELJ A;  2ZYM A;  3KG2 A;  1XT8 A;  3WAE A;  3MVY A;  3R7X A;  1IUD A;  1NH8 A;  3IB1 A;  2RC9 A;  2XXY A;  3SET A;  1SW5 A;  3UGW A;  1ZIU A;  2ZYK A;  3IK6 B;  3BFT A;  3PV0 E;  1XS5 A;  3FVK A;  1OVB A;  2DWH A;  5K2Y A;  4GL8 A;  5AA4 A;  2D21 A;  4FEC A;  5DEX A;  4ESW A;  1EZP A;  1HSE A;  3EF7 A;  2GHB A;  5CBS A;  2B3F A;  2O69 A;  5JK4 A;  2V25 A;  3T9V A;  4THI A;  4F1Y A;  1N04 A;  2ANJ A;  3GZG A;  3PUX E;  4U1Z A;  1TT1 A;  3KSX A;  3C31 A;  1SQY A;  1FQB A;  3USD A;  4IO3 A;  1B58 A;  5M2V A;  1TFA A;  1UTB A;  1MY1 A;  2DOJ A;  1AL3 A;  4F1V A;  4U23 A;  4DXU A;  1SI1 A;  1YTV A;  1MPD A;  4U4X A;  4X1D A;  3TFL A;  4MH5 A;  3DP6 A;  2HQ0 A;  4JWX A;  2ZYN A;  1Y4T A;  3P7I A;  1LCT A;  1M5E A;  3MVX A;  3LR1 A;  2Q2C A;  3PPO A;  3RQT A;  1JEU A;  3W9W A;  3HCQ A;  1SW2 A;  5HBC A;  5FHM A;  1J1N A;  1P1N A;  2NOO A;  5DTB A;  5ICT A;  4YZZ A;  2FYI A;  2QJE A;  1MY2 A;  3SKP A;  4P0G A;  1MXZ A;  2H5Y A;  1SI0 A;  3FZV A;  3SES A;  4R2F A;  1D9Y A;  3K6V A;  3ONM A;  4G4P A;  4RPO A;  2O51 A;  3KJT A;  4XXU A;  1XHY A;  4HCW A;  4R9F A;  3SEY A;  4ZEI A;  2XXH A;  3EHS A;  1PDA A;  1MPC A;  1CE2 A;  3G3K A;  1BLF A;  4KD5 A;  3TEP A;  2F8D A;  3T96 B;  3B6T A;  1T0K A;  5AA4 B;  3ZKK A;  3VLV A;  4WKM A;  5DEX B;  4U21 A;  3CFZ A;  3VLU A;  2X7P A;  4XIG Q;  4RYA A;  2HZL A;  2H9B A;  3UIF A;  4F3S A;  2BJJ X;  5I57 A;  5BUU A;  4GRK A;  4YB6 A;  3DEL B;  4EQ9 A;  3E3K A;  2M8C A;  1UTB B;  3PPQ A;  3E4R A;  4C0R A;  5L9S A;  4I9D A;  3PD8 A;  2X7Q A;  4FIM A;  4LQ2 A;  3H06 B;  4OTE A;  4XTC Q;  4OXV A;  1HSL A;  2RC7 A;  1EU8 A;  1AIV A;  1R9L A;  5K2X A;  4QSC A;  4LVQ A;  4F2O A;  4PE5 B;  3G7W A;  4ONY A;  3IJO B;  4FED A;  4FEB A;  4RK2 A;  2REG A;  1B0L A;  1M5B A;  4H5F A;  4IO2 A;  1UTH A;  5CI5 A;  5KCJ A;  4C1U A;  3OOA A;  3K1N A;  2Z22 A;  4G68 A;  2V84 A;  3ILT B;  1N7W A;  3SEX A;  4LQ5 A;  1SYI A;  4H5G A;  3IOV A;  1URS A;  2ONS A;  4K3F A;  4O3A A;  3U94 A;  2F35 A;  1OLA A;  4MF3 A;  2I6E A;  4AQ4 A;  2F78 A;  1MY4 A;  3N5L A;  3O66 A;  3GXA A;  1ZMG A;  1GGG A;  4DIG A;  3D4G A;  2CMO A;  5DT6 A;  1PB7 A;  3H6V A;  1JEV A;  2XX7 A;  2A5S A;  4X9T A;  4E0W A;  3G3J A;  3ZSF A;  5AE4 A;  3S2V A;  3R6U A;  1MDP 1;  2Y7P A;  3KOT A;  5I57 B;  1B51 A;  2PVU A;  3MJN A;  4OFJ A;  1RKM A;  3QK6 A;  4JSO A;  2Q8J A;  4JDF A;  2NVU B;  1XC1 A;  4UA8 A;  3SDF A;  2RCA A;  3F11 A;  4KI0 E;  1JVX A;  1ZBM A;  2FA7 A;  2PBW A;  3OSQ A;  1UTH B;  5KCJ B;  1Y4C A;  5CMB A;  2DSF A;  2QMX A;  3KGC A;  4G68 B;  1Y20 A;  2Q88 A;  3TEL A;  1B7U A;  4O3B A;  3PMW A;  2IA4 A;  1Z7N E;  4F3P A;  1LLS A;  3OO9 A;  3VE1 B;  4OFO A;  4JB7 A;  1VFD A;  4E0X A;  4G8H A;  4RK9 A;  4NWD A;  4ESX A;  4QFO A;  3VVE A;  1Y3N A;  2DVZ A;  1SDX A;  1WVJ A;  4AB5 A;  3K6W A;  3MZB A;  1MS7 A;  3S4U A;  5TPA A;  5DVI A;  1N7X A;  3B6W A;  4IO4 A;  4O3C A;  3M3L A;  4RPN A;  1MQH A;  1B7H A;  3TKD A;  3LSX A;  2FNC A;  4TLL B;  4KQP A;  3CFL A;  3OD7 A;  4X1B A;  1B52 A;  3IOW A;  2DWA A;  3OXN A;  4QFN A;  2ZYO A;  3O97 A;  3C32 A;  3PPP A;  4EUO A;  3N6T A;  4F18 A;  3JYR A;  1BIY A;  4HTG A;  3MQ9 A;  5CC2 A;  3FAT A;  3MWB A;  1SBP A;  4GXA A;  3S9E A;  3OEN A;  3K6X A;  4F3B A;  3VVD A;  1H3D A;  1ZJL A;  4ZE8 A;  2CZL A;  5ICQ A;  2QS4 A;  4H8J A;  1P1W A;  1POT A;  4YAH X;  1GR2 A;  4KR5 A;  3O2A A;  4DXC A;  3Q29 A;  4Q5T A;  1IZ1 A;  1QVS A;  3HHF A;  4WED A;  2O1M A;  4R6K A;  2I0C A;  1D4N A;  4GIZ A;  1OLC A;  4FOR A;  5IAI A;  4DXB A;  3MVW A;  5FHO A;  4ZZA A;  5ITP A;  1DTZ A;  3T9U A;  2XXQ A;  4H1X A;  4H6D A;  3JV9 A;  2GRV A;  3IO6 A;  1URG A;  1O63 A;  1ZU0 A;  5JTY A;  2RCB A;  1I6Q A;  4BDM A;  1B4Z A;  2O84 X;  3H6T A;  4TQU Q;  1AMF A;  3A09 A;  3MPL A;  3MZ1 A;  4YIC A;  5TPA B;  2OK2 A;  4ZEK A;  4RXL A;  1VE4 A;  2DE4 A;  2Z8E A;  4QSD A;  1Y1Z A;  5FTH A;  3I5O A;  4MLV A;  2UVJ A;  4R72 A;  4NF8 A;  1JNF A;  2YJP A;  5B70 A;  1IXC A;  3MPK A;  3L6H A;  2O6A A;  2F7C A;  4JSD A;  2F7B A;  3HST A;  3H4Z A;  3S9M C;  4ZEB A;  1A8E A;  3BKI B;  3TMG A;  1N0T A;  3V89 B;  1USY H;  3O9P A;  5TP9 A;  1B2H A;  3N26 A;  4ECF A;  3A3C A;  4JXI A;  4IGR A;  1OVT A;  3IAZ A;  3TAJ A;  4X48 A;  5FTI A;  2V93 A;  1FQE A;  3R26 A;  4OEV A;  1MQI A;  4EF2 A;  4BDL A;  5EHS A;  3OO7 A;  4LUB A;  1JQF A;  3N6U A;  3B7D A;  2V3Q A;  5H8S A;  3FUZ A;  3VFJ A;  4N07 A;  1BKA A;  3MUQ A;  2I58 A;  3Q27 A;  1MQG A;  4U22 A;  3EHT A;  5ISU A;  2OBG A;  1GVC A;  3I6V A;  3K02 A;  3W15 C;  3M3F A;  4HS7 A;  4YKI A;  5BWJ A;  2NWJ A;  4LZ8 A;  3ECR A;  5JTY B;  3C33 A;  3RGY A;  4F1U A;  4LAT A;  1MQJ A;  3CG3 A;  4KPT A;  2VP1 A;  1FQC A;  3PPN A;  2Y84 A;  4MLQ A;  1QUI A;  3K1M A;  1LAH E;  2XXR A;  2AL4 A;  3QIM A;  1MXV A;  2ONR A;  3U92 A;  4P11 A;  4PP0 A;  1Q35 A;  4U2R A;  1POY 1;  4POW A;  3HN0 A;  3FAS A;  4R73 A;  3BBR A;  4NF8 B;  1NNK A;  2I4B A;  2DE2 A;  3K00 A;  3FVG A;  2ZNS A;  3C9H A;  4ZDM A;  3VVF A;  1N84 A;  3FJM A;  2R6G E;  1MH3 A;  1MM7 A;  3MP6 A;  5LOM A;  3TQW A;  4OES A;  5TP9 B;  3C34 A;  4GD5 A;  1FQD A;  5HPQ A;  4GF8 A;  3TCF A;  4NF5 A;  3HPI A;  3CSG A;  1F9B A;  1Y3P A;  3M3K A;  4RJZ A;  4XKP A;  2HAU A;  3RN8 A;  2F34 A;  4OMB A;  2O7I A;  3E9X A;  3BFU A;  3VXB A;  1B6H A;  3TYH A;  2Q9T A;  3O28 A;  4P0I A;  2QSX A;  1SD3 A;  4H0W A;  3RTW B;  4XKR A;  4QFP A;  1I6B A;  2IEE A;  3O6I A;  1UIU A;  5B7D A;  4NMY A;  3EHU A;  4DCY A;  3AXF A;  1QUL A;  4QHQ A;  4DDD A;  1BTJ A;  2I3V A;  3GBA A;  3FVN A;  3IOU A;  4R9G A;  4YKK A;  4TLM B;  2UYF A;  2AIX A;  4AB6 A;  2XHD A;  1IXH A;  2I0B A;  2Y7I A;  1ATG A;  1US5 A;  4LZ7 A;  4ND9 A;  1TWY A;  1D3K A;  4JWY A;  4BLA A;  1DSN A;  3IO4 A;  3EQ1 A;  1B40 A;  3PPR A;  2B65 A;  5DVJ A;  4QRZ A;  5ELV A;  1MXY A;  2I3W A;  4TOZ A;  4PET A;  3TUS A;  1MY3 A;  1H44 A;  2D3I A;  4NF6 A;  4QFL A;  1JET A;  4NF5 B;  4UAC A;  4PQJ A;  3OMB A;  3UK4 A;  1B5I A;  2H25 A;  3HV1 A;  2Y7R A;  3DM0 A;  4YKJ A;  2QS3 A;  3OSR A;  4YMA A;  3D4C A;  4IO5 A;  2Z8F A;  1QKB A;  5DYH A;  4JWO A;  2AL5 A;  3V5A A;  1DMB A;  2OZZ A;  3OEL A;  5H8N A;  1XVY A;  3H7M A;  3QXM A;  4GQO A;  2O1L A;  2F6P A;  1KWH A;  3TTK A;  5CBR A;  3Q25 A;  2R71 A;  1B3F A;  4PFW A;  3TTL A;  1GTK A;  1B3H A;  3TTR A;  4LA9 A;  3H6U A;  4MBP A;  2VD3 A;  1A55 A;  4GL0 A;  1JW5 A;  4YU0 A;  3H03 A;  1A54 A;  2F97 A;  4G8N A;  3IOR A;  3C4M A;  1L5T A;  1B9J A;  4NF4 A;  3SEW A;  5IKB A;  1GV8 A;  3C35 A;  3DLN A;  3VV5 A;  1A40 A;  3QSL A;  1FCK A;  2ZNU A;  5CM6 A;  3G3I A;  1IIW A;  2P1S A;  4GXS B;  4OEN A;  4U4S A;  4I62 A;  1VSO A;  4XKN A;  4GLI A;  5I58 A;  2ZNT A;  3MAM A;  4QF9 A;  5CRY A;  4OYV A;  4WXJ A;  1R9Q A;  5I59 A;  2PT1 A;  1SW1 A;  1D9V A;  4NF6 B;  1N3W A;  3HHG A;  1B5H A;  4ZE9 A;  3CVG A;  1XVX A;  4ELO A;  1LFH A;  1BP5 A;  1LAG E;  3U93 A;  4F31 B;  2PMS A;  1H76 A;  3RUM A;  1NNP A;  1MM6 A;  3FXR A;  1A8F A;  2LAO A;  3LSL A;  3KSJ A;  2ABH A;  4N6P A;  4Q8R A;  3T93 B;  1B5J A;  3PD9 A;  1LB9 A;  5AA1 A;  3FVO A;  3PMX A;  4ZZE A;  2WKY A;  2PT2 A;  2DE3 A;  1US4 A;  2XXU A;  1AH5 A;  2XXX A;  2XXW A;  1N3X A;  3MP8 A;  3QYT A;  2OLB A;  3GBB A;  1PEB A;  3S9N C;  3H6W A;  2YLN A;  4U1O A;  3DP4 A;  4R6Y A;  4OET A;  5EYF A;  5KDT A;  3IX1 A;  3K2D A;  1MPB A;  4OFL A;  4R2B A;  4Z0I A;  2P0S A;  4NF4 B;  1ZTY A;  2XXI A;  3T66 A;  1LAF E;  4IY5 A;  2V3U A;  1FTL A;  1JW1 A;  3MC2 A;  3CR9 A;  4KCD A;  5I58 B;  1H45 A;  4GWO A;  3MBP A;  3WAF A;  1LGB C;  5I59 B;  2UVI A;  1VFE A;  2G93 A;  1FTK A;  1OMP A;  1Y1M A;  3G3F A;  4GOT A;  2B3B A;  3K4U A;  2XXP A;  3C36 A;  2UXA A;  2X26 A;  3RT8 A;  1NL5 A;  1R1N A;  1EZ9 A;  3DP8 A;  1TXF A;  3FIR A;  2YPN A;  1OIB A;  4NE4 A;  2QPQ A;  2UYE A;  4LON B;  3VDF A;  4EXK A;  3N94 A;  1LCF A;  3QUF A;  2AYS A;  4I8C A;  4WEP A;  2F7A A;  3UN6 A;  4ZS9 A;  5H8Q A;  1LBB A;  5F1Q A;  3PMV A;  1B7Z A;  4G77 A;  3U72 A;  3TCG A;  1LFG A;  2E1S A;  1JW4 A;  3KZG A;  1N76 A;  4FJP A;  2DVC A;  2VGQ A;  3EPE A;  3T9H B;  3PU5 A;  4YMB A;  4HCY A;  1B05 A;  1P1Q A;  3IR1 A;  1DTG A;  5KDT B;  1IQ7 A;  5AA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...