3PPRA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
b'TIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 103
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pprA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3pprA02
1RYOA 3VV5A 3SKPA 1B5HA 2XHDA 4QFKA 3RLFE 1OVTA 2E0SA 2HAVA 2I4BA 4NF8A 4N13A 1AOVA 1LFIA 1P1NA 3PPNA 3K01A 2F35A 2QS4A 1B0LA 4OERA 4U1ZA 4QSEA 2DQVA 3KN7A 1A8EA 1B7UA 4GQOA 3GZGA 5BUUA 4BDQA 3M3FA 1DTGA 2ANJA 2UYFA 3A3CA 2W7YA 4U1OA 5HBCA 4R6HA 5F7VA 5I56B 1BKAA 5TU0A 2V3UA 4P0IA 3Q26A 5FTHA 2Y7KA 4LA9A 2Q88A 3KN3A 4I62A 3EHTA 3OENA 2B3FA 1ZLQA 4NF5B 2OZZA 3T66A 3G7WA 4M4GA 2Y7IA 3BFTA 4F22A 1URDA 4DXBA 3OO8A 4R73A 4ZEFA 3K02A 4QSDA 3H06B 1UTHB 3CFXA 4HTGA 1LCTA 3PPOA 2HFBA 2X7PA 1MY2A 2HEUA 3U72A 4ELPA 1NFTA 3LSWA 1IEJA 3TAJA 3FUZA 4ECFA 1ZIUA 4JDFA 2OWTA 3K1NA 4FE8A 4DXUA 3E9XA 3D4CA 3FD3A 3TPAA 1MY0A 2DYXA 3HN0A 4ESXA 1FQCA 4OEUA 3G3JA 1HSLA 3PD8A 2ONKE 4F3GA 3C31A 1PB8A 2I49A 1A55A 1PB7A 1O7TA 1NMUA 1I6AA 4PFUA 3TEPA 3JZJA 5I57B 1SVXB 5I2KB 4GL0A 3FXUA 1Y3QA 4Q30B 5AA2A 5H8FA 1ZJLA 3MP6A 4LUBA 1P99A 1VFDA 4FIMA 1B4ZA 4ZZEA 3IB0A 3QAXA 4JWYA 4YKIA 4PFYA 4RPNA 3MZ1A 5DTBA 3KOTA 4FORA 4U23A 4WEPA 2DE3A 3W9VA 1A54A 1XHYA 5AE4A 4NF4A 4OMBA 3IK6B 4QFNA 4AB5A 2I48A 4DDDA 4WXJA 3HCQA 2O1MA 3UK4A 2H5YA 4ZEDA 2H9BA 4YU0A 1PDAA 2RCBA 4O3BA 1H43A 4RJZA 1UQWA 2WKYA 5KZTA 1P1QA 2ZNSA 1D9YA 1N0TA 2M8CA 5ITOA 4R6YA 3CFLA 3CSBA 2I4CA 4MFIA 3OOAA 3L6HA 1LAXA 3RNNA 4H5FA 2ZNUA 4Q8RA 1ATGA 1D4NA 2ONRA 3KSJA 4I1DA 3JYRA 2RC7A 1VR5A 3I6VA 3DP6A 3OXNA 4PFWA 4G4PA 4RPOA 4PETA 2HXWA 3UP9A 1SQYA 2UXAA 2RKMA 4H65A 3K2DA 4XKQA 1B3EA 2FNCA 5H8HA 3W15C 3VLUA 5DEXB 3IJXB 3CRBA 3FJMA 1JW5A 1AH5A 1NNKA 4RK9A 3RT8A 1XVYA 4OETA 3RY3A 2Q2AA 2ZNTA 4TLLB 3PMWA 1A99A 2DSFA 3V89B 4FAJA 1YTVA 4KCCA 4YZZA 1LLSA 2PYYA 1MXXA 1FTOA 5CBRA 2I3WA 2XXWA 3S9MC 3MBPA 1YAEA 4LP2B 5AA4A 1QW0A 3H4ZA 1Y3NA 3RT6B 4XXUA 2QS2A 5CMCA 2DS9A 1FTJA 1UTBB 3TYHA 1MXVA 3IB2A 4JBZA 1DPPA 2O68A 2ZYOA 2R71A 1FW0A 2ABHA 2A5TB 4H8JA 1GVCA 3KOSA 1MPBA 3SERA 1MQIA 1L5TA 3O29A 2AIXA 2X26A 4ISUA 3OO9A 2F8DA 4H1XA 3EHUA 3K4UA 1TWYA 1Q35A 2NWJA 4M1VA 1NH8A 1MY4A 2Z23A 4KD5A 1NH7A 1USYH 1NNTA 5J1DA 4EF1A 1MQJA 4MBPA 2ONSA 1MQDA 1SYIA 2OJTA 2YLNA 1BP5A 5IKBA 1Y4CA 1T0KA 3KG2A 3MQ9A 5I59A 2HZKA 4NF8B 4X1BA 5H8NA 2GH9A 1POTA 3EPEA 4NF6A 1DPEA 2DWJA 2XXYA 1LBBA 5ISUA 3MVYA 3ECRA 1SBPA 3MP1A 5ELVA 3T22A 3TTMA 3HSTA 5TP9A 3MUQA 3IOVA 4QFLA 4H6DA 3S9LC 1I6BA 1FQFA 4OWDA 3HHGA 3CFZA 3O28A 4NEDA 1Y1ZA 1TXFA 2RF1A 1MH3A 3RGYA 5L9SA 3USDA 4OHNA 3U93A 2REGA 1PEBA 4XKRA 4YB5A 1LFHA 1S50A 1LAFE 2NUVA 2P2AA 1P1UA 4YKKA 2F6GA 1J1NA 4OENA 3B6TA 4OFLA 1M5BA 1H44A 1B51A 5L9MA 1XT8A 1WVJA 4YMBA 1IXHA 3TTRA 3S9NC 2PBWA 3UGWA 3Q27A 5DVJA 4I8CA 3U8QA 5B7DA 3E4RA 4QFOA 1EH3A 3MJNA 1MDQA 2D5WA 3DELB 4KI0E 3MVXA 3ILUB 3BFUA 3FGSA 2ZMBA 1B4HA 1PBQA 3I3VA 5AA2B 1R6ZA 1QKAA 5H8FB 3G3IA 1FCKA 5F1QA 5TPAA 3C32A 4I9DA 1ANFA 4GXSB 4KFQA 1SI1A 1BLFA 3SETA 5A5XA 5DYHA 1KWHA 1I69A 1QJMA 3HPIA 2ALUA 2ZYMA 3O6IA 3P7IA 2CZLA 3V8XB 1US5A 4OVJA 4NMYA 2CMOA 2V84A 3MZBA 3WAFA 4R75A 4EXLA 3H6TA 1FTLA 4EQ9A 3N5LA 3S2VA 1XOCA 3KJ7A 1B40A 1DOTA 3BKIB 1MXZA 3PUZE 3QK6A 4G77A 4YAHX 5BWJA 4PFTA 5HPQA 3CR9A 3DP4A 2BJJX 4KYSA 4U2RA 4PE5B 3TTLA 4G8MA 4RYAA 3BBRA 2Y7RA 4KQPA 3ZKLA 4R9FA 3VXCA 2VD3A 5KCJA 1Q1KA 5H8QA 4F1VA 4FJPA 3VVDA 4QHQA 1URGA 1B7ZA 4F29A 4ZE9A 1N3XA 1AMFA 5CRYA 3G3GA 4IGRA 2ZXTA 3TUSA 4AB6A 4PQJA 2FA7A 2XXRA 5CMMA 2B65A 1ZMGA 3OSQA 3K6XA 4G68A 4MLQA 5K2XA 1LB9A 4RXLA 4LZ8A 1D9VA 1B52A 4Z7EA 1A8FA 2DWAA 2Q8JA 4Z0IA 2DVZA 4L17A 2Z8DA 4RA1A 2VOZA 4U4SA 3K1PA 3RQTA 1B1XA 1MXUA 1SW1A 2F7AA 3O6HA 3TQLA 3LUYA 2O84X 2R9JA 3IAZA 1LB8A 1MQHA 3LC8A 5H8HB 3IORA 4DCXA 3TCFA 3QIMA 1OVBA 5CM6A 1TFDA 5ICTA 4GWOA 2I6EA 2DE2A 3O97A 3FVNA 4ELOA 2FYIA 1FQEA 1MXYA 2ZYKA 1UIUA 4ZDMA 5FHOA 3ZS6A 1SD3A 1LSTA 2QMXA 2D3IA 4POXA 3EN3A 1M5DA 3GLBA 1LAHE 1IIWA 1POY1 4LATA 4F3PA 3LBSA 2O7UA 5AA1A 1EZ9A 2AL5A 2XXVA 5AA4B 1PB9A 1M5FA 4EUOA 5LOMA 4OFJA 4ELQA 2Z22A 3PV0E 3FASA 2B3BA 1JETA 3SDFA 5CMKA 4BDNA 3TMGA 2XD3A 2PT2A 3IR1A 4XKNA 1B7HA 2QRYA 2O1LA 2GRVA 3GBBA 1Z7ME 2DWIA 3T96B 3VLWA 3RPWA 3TTNA 1FTMA 2XXQA 4F1UA 3KJTA 4G8NA 5CBSA 3C9HA 1MS7A 2HQ0A 3ZKKA 3IJOB 4E0WA 2ESNA 3T9XB 3PUYE 3QUFA 1H76A 1LCFA 4ZEKA 3S9EA 3VDFA 4KYDA 1QKBA 2XXUA 1JEVA 1ELJA 2O6AA 3EHSA 2XXHA 2D21A 4X1DA 3SESA 5L9OA 5DVIA 3KFMA 5I59B 4OZ9A 5H8NB 5I58A 1MRPA 5HM4B 4NF6B 4TLMB 4JB7A 5IAIA 1Y1MA 1SW2A 3VVEA 3PPPA 4GXAA 3TTKA 4XTCQ 3TKDA 3ZSFA 3TQWA 3H7MA 3FATA 4DCYA 1MPDA 5TP9B 4QFPA 1AIVA 3OEKA 3CIJA 1JNFA 4HCWA 1N3WA 1HSEA 3KGCA 1IITA 4ZECA 4OXVA 4BDRA 1OLAA 1D3KA 3WAEA 1B58A 1S7YA 3R26A 4OQOA 1A7LA 1MY3A 3GBAA 1XS5A 1AL3A 4JWXA 3L6GA 1Y20A 2X7QA 2IEEA 1P1WA 3O2AA 3IOUA 5EHSA 1QUIA 4F19A 3UORA 5K2YA 3OELA 4IGTA 3HHFA 3FV2A 4KPTA 1VSOA 2QS1A 4FEDA 5JK4A 4F31B 2XXIA 3N6TA 1B2HA 1ZU0A 4GF8A 3OO6A 5AA2D 5DVFA 3C34A 3MC2A 3V83A 5JTYA 2Y7WA 3PUVE 4OFOA 4ESWA 1B32A 3O66A 2OWSA 1QVSA 2F7BA 4IO4A 1USYE 2DWHA 4UA8A 3QUJA 3UIFA 4WEDA 3HV1A 5EHMA 4JSOA 5AA3A 2XD2A 3FVOA 4F39A 4WKMA 3H6WA 1MG1A 5FHNA 5TPAB 3SEUA 1MDP1 4LZ5A 4IO3A 5A5XB 4ZZAA 3V5AA 2I0CA 3TELA 1NL5A 4ZEBA 4ONYA 2G29A 2PT1A 4JWOA 4EXKA 4X9TA 2DP8A 3AXFA 3VXBA 2PMSA 1GGGA 4YB6A 1US4A 3QXMA 4KCDA 1OIBA 2NOOA 1QULA 2GHBA 2QPQA 2R6GE 2F78A 2P1SA 1MPCA 4GL8A 1TT1A 1N04A 4OYVA 1B0HA 3E13X 4BDMA 4KYEA 2I0BA 4YKJA 3T9HB 4IO2A 5KCJB 4GVOA 4C0RA 4KR5A 1DTZA 5H8QB 2V3QA 4LQ5A 2XX8A 4PP0A 4ELRA 4GLIA 4AQ4A 3LSXA 1SW5A 1B3GA 3PUWE 4OESA 3VLVA 4Q0CA 4G68B 1OQGA 3MPKA 2E1SA 3T93B 4DE8A 3GXAA 1R9QA 3CG1A 2XX9A 3SEWA 1SW4A 2IA4A 3MP8A 1Z7NE 3FJGA 3DLNA 3QSLA 3U92A 3PGFA 3KN8A 3O6GA 3Q25A 3DP8A 3H6VA 4POWA 3TCHA 2YPNA 1MY1A 3ILTB 4YMAA 2F97A 1GV8A 4JXIA 3MPLA 3W9WA 4EQBA 3N26A 4IO6A 2F6PA 2OCUA 4NTLA 1B05A 1GTKA 1I6QA 3IO4A 4DZ1A 2QL3A 1CB6A 1P1OA 3TCGA 5EYFA 2Z8FA 5H8SA 3I5OA 4NF4B 4YB7A 1LAGE 3A09A 4R74A 3PUXE 5KDTA 1SDXA 4JSDA 1URSA 1RKMA 3C33A 1IQ7A 1MM6A 4C1UA 3UN6A 5CI5A 2YJPA 3DM0A 4THIA 3E3KA 2UVHA 1QUKA 3H3GA 4QSCA 3TFLA 2RC8A 4X48A 1SI0A 3B6WA 3D4GA 3SEVA 3MVWA 1NKXA 4FEBA 4P11A 4R6KA 4G68C 2RCAA 1FTKA 3OD7A 3K1MA 3KZGA 2PVUA 5I2NA 1MXWA 1GR2A 3F11A 4EQ7A 3KSXA 4GRKA 1NNPA 2DXYA 3G3HA 3QYTA 2O51A 4NE4A 4ND9A 3C36A 2I58A 4DXCA 3CG3A 4IY5A 1JW4A 1H45A 1ZTYA 3N6UA 1B5JA 2I3VA 3VVFA 1WODA 3OMBA 5I58B 2NVUB 2XXTA 2OK2A 3B6QA 4NWCA 3TODA 3LSFB 2A5SA 2QSXA 3ONMA 3PD9A 1II5A 2UVGA 2H4IA 1JVYA 2REJA 4GD5A 1LGBC 3PMVA 3RTWB 5CC2A 2DXRA 4ZS9A 3FIRA 1R1NA 2DVCA 4UACA 1DMBA 3B7DA 3FXRA 2HZLA 1IXGA 3FVKA 4BDLA 2V25A 1ZBMA 1R9LA 4XIGQ 1JEUA 4HW8A 3IOTA 1VFEA 3CI8A 3RTFB 3M3KA 4E0XA 3LSLA 4N6PA 5L8DA 1PC3A 1TFAA 5I56A 2Q9TA 2QJEA 2ZYNA 2H25A 3R7XA 1FQAA 3C4MA 5B70A 2Q89A 5CMBA 2HCAA 1DSNA 2H99A 1JVXA 1VE4A 4NF5A 4N07A 2VP1A 4HCYA 4DLDA 1O64A 4RNSA 3Q28A 1LBCA 3IOWA 3K6VA 3PMXA 3JV9A 2O7IA 5M2VA 4R2FA 1UTHA 1M5CA 1LFGA 3M3LA 3RN8A 1B5IA 5FTIA 2GHAA 1BIYA 1NNFA 3TZAA 2O69A 5JTYB 3K6UA 1M5EA 1B3LA 1UIVA 4RK2A 3FXQA 3MVZA 4MH5A 3LR1A 4TQUQ 2XXXA 4G8HA 1IXCA 3ODBA 1CE2A 1OLCA 5FHMA 3FVGA 2Q2CA 4F1YA 3T9UA 2V3TA 1A40A 4GIZA 2F36A 3Q29A 5ICQA 1YCJA 3U94A 4GFRA 3MZ9A 4H67A 3VFJA 1Y9UA 2Z8EA 4FATA 2OLBA 1OMPA 5I57A 3T9VA 1N7XA 5I2KA 3G3FA 4R2BA 3C35A 3MAMA 4LONB 2LAOA 2UVIA 1MM7A 2P0SA 4FECA 3K0VA 3FJ7A 2XXPA 3OSRA 3MWBA 4LQ2A 1JW1A 3VE1B 3OO7A 4IO7A 2AYSA 1QUJA 2NXOA 2OBGA 1B9JA 2XX7A 1EU8A 4G2ZA 4IO5A 1B1HA 3SEYA 1S9TA 3IL1B 3H03A 3MW0A 4YICA 3EF7A 3CSGA 1BTJA 4OTEA 1YPNA 3H6UA 3PPQA 4TOZA 1XVXA 1PBPA 3K00A 2RINA 2VD2A 4LVQA 3TDJA 4F3BA 2F7CA 4EF2A 5DT6A 4F3SA 4U4XA 2AL4A 3N94A 1B3FA 4ZEIA 4P0GA 5JEIA 2G93A 2HAUA 4QRZA 1JQFA 1EZOA 3K6WA 4K3FA 4GOTA 1SYHA 3R6UA 4QF9A 2DE4A 4H8IA 3UA8A 2V93A 3FV1A 1RYXA 1ZKBA 4HS7A 1N84A 1IUDA 4LZ7A 3KBRA 1Y3PA 1MQGA 4Q5TA 4F2OA 2VGQA 4IB2A 4F2QA 4OEVA 5KDTB 4H0WA 1IZ1A 5DEXA 4NWDA 4IY6A 2THIA 2VHAA 2F5XA 3EQ1A 4DIGA 3FZVA 2RC9A 4EDPA 1B3HA 4H5GA 5ITPA 3O9PA 1FQBA 1WDNA 1B6HA 3PU5A 3IB1A 3RUMA 4F18A 1IXIA 2UYEA 4U22A 2KLFA 1H3DA 2F34A 3SEXA 1HSJA 3G3KA 3IX1A 5I2NB 1Y4TA 4O3AA 2GFEA 3CVGA 4RY1A 4O3CA 4MLVA 1B46A 3THIA 4YKPA 3U1OA 3A3UA 1O63A 4BLAA 1N76A 2H98A 3S4UA 4U21A 1UTBA 1MH4A 3KEIA 4MF3A 5I84A 2QS3A 2UVJA 1F9BA 1FQDA 2A5TA 1OQHA 1XC1A 4BDOA 3IO6A 3M8UA 4R72A 4ZE8A 2DOJA 3HO7A 3PPRA 4XKPA 2Y7PA 2PX1A 4R9GA 1N7WA 4C1TA 3OEMA 4KHZE 1EZPA 2QMWA 2Y84A
chains in the Genus database with same CATH superfamily
1IMFA 1RYOA 3VV5A 3SKPA 4HE0A 1B5HA 2XHDA 4QFKA 4H45A 3RLFE 1OVTA 2E0SA 2HAVA 2I4BA 4NF8A 4N13A 4MAGA 1AOVA 1LFIA 1FRPA 1P1NA 3GYYA 3PPNA 3K01A 2F35A 2QS4A 1B0LA 4OERA 4U1ZA 4QSEA 2DQVA 5EQ9A 3KN7A 1A8EA 1B7UA 4GQOA 3GZGA 5BUUA 2XWVA 4BDQA 3M3FA 1DTGA 3ISPA 2ANJA 2UYFA 3A3CA 2W7YA 4U1OA 5HBCA 4R6HA 5F7VA 5I56B 1BKAA 5TU0A 2V3UA 4P0IA 3Q26A 5FTHA 2Y7KA 4LA9A 2Q88A 2QVUA 3KN3A 4I62A 3E78A 4NHBA 3EHTA 3OENA 4OVTA 2B3FA 1ZLQA 4NF5B 2OZZA 1NV1A 2XWIA 3T66A 1NV6A 3G7WA 4M4GA 2Y7IA 3BFTA 4F22A 1URDA 4DXBA 3OO8A 2FBPA 4R73A 4ZEFA 2B4LA 2FIEA 2WBDA 3K02A 4QSDA 3H06B 1UTHB 3CFXA 4HTGA 1LCTA 3PPOA 2HFBA 2X7PA 1MY2A 4PAFA 2HEUA 3U72A 4ELPA 1NFTA 1IMBA 1INPA 3LSWA 1IEJA 3T0JA 3TAJA 3FUZA 4ECFA 1ZIUA 4JDFA 2OWTA 3K1NA 4FE8A 4DXUA 3E9XA 3D4CA 3FD3A 3TPAA 4NX1A 1MY0A 2DYXA 3HN0A 4ESXA 1FQCA 4OEUA 3G3JA 1HSLA 3PD8A 2ONKE 4F3GA 3C31A 1PB8A 2I49A 1A55A 1PB7A 1O7TA 1NMUA 1I6AA 4PFUA 3TEPA 5ET6A 3JZJA 5I57B 2F3DA 1SVXB 5I2KB 4GL0A 3FXUA 1Y3QA 4Q30B 5AA2A 1K9YA 5H8FA 2ZZWA 1ZJLA 3MP6A 4LUBA 1FPJA 1P99A 1VFDA 4FIMA 2OWZA 1B4ZA 4PAIA 3IB0A 4ZZEA 3QAXA 1NUXA 4JWYA 4YKIA 4HXVA 4PFYA 4RPNA 4X8RA 3MZ1A 5DTBA 3KC0A 3KOTA 4FORA 4NQ8A 4U23A 4WEPA 2DE3A 3W9VA 1A54A 1XHYA 5AE4A 4NF4A 4OMBA 3IK6B 4QFNA 4AB5A 1FSAA 4NGUA 2CZHA 2I48A 4DDDA 4WXJA 3HCQA 2O1MA 4N8YA 3UK4A 2H5YA 4ZEDA 2H9BA 4YU0A 1PDAA 2RCBA 4O3BA 5I7IA 1H43A 4RJZA 1UQWA 1YZ0A 2WKYA 2KR0A 5IGAA 5KZTA 4N6KA 1P1QA 2ZNSA 1D9YA 1N0TA 2M8CA 5ITOA 4R6YA 3CFLA 1NV7A 5EQ8A 3CSBA 2I4CA 4MFIA 4MCOA 3OOAA 3L6HA 1LAXA 3RNNA 4GWUA 4H5FA 2ZNUA 4Q8RA 1ATGA 1D4NA 2ONRA 3KSJA 4I1DA 3JYRA 2RC7A 1VR5A 3I6VA 3DP6A 3OXNA 1RDYA 3FXBA 4PFWA 4G4PA 4RPOA 4PETA 2HXWA 3UP9A 1SQYA 2UXAA 2RKMA 2DDKA 4H65A 3K2DA 4XKQA 1B3EA 4OA4A 2FNCA 2XWOA 5H8HA 3W15C 3VLUA 5DEXB 3IJXB 2QVRA 3CRBA 3FJMA 1JW5A 1KA0A 1AH5A 1NNKA 1FPLA 4RK9A 3RT8A 2VT5A 1XVYA 4OETA 3RY3A 2Q2AA 2ZNTA 4TLLB 3PMWA 1A99A 2DSFA 4MJOA 3V89B 4FAJA 1YTVA 4KCCA 4YZZA 1LLSA 2PYYA 1MXXA 1FTOA 5CBRA 2I3WA 2XXWA 3S9MC 3MBPA 1YAEA 4LP2B 5AA4A 1QW0A 3H4ZA 1Y3NA 3RT6B 4XXUA 2QS2A 5CMCA 2DS9A 1FTJA 1UTBB 3TYHA 1MXVA 3IB2A 4JBZA 1DPPA 2O68A 2ZYOA 2R71A 1FW0A 2ABHA 2A5TB 4H8JA 1GVCA 3KOSA 1G0IA 4NN3A 1MPBA 3SERA 1MQIA 1L5TA 1NV2A 3O29A 2AIXA 2X26A 1LBXA 4ISUA 4PFIA 3OO9A 2F8DA 4H1XA 3EHUA 3K4UA 1TWYA 1Q35A 2NWJA 4M1VA 3B8BA 2ZZXA 1NH8A 1MY4A 2Z23A 4KD5A 1NH7A 5FBPA 1USYH 1NNTA 5J1DA 4EF1A 1MQJA 4MBPA 2ONSA 1MQDA 1SYIA 2OJTA 2YLNA 1BP5A 5IKBA 1Y4CA 2QVVA 3IFAA 1T0KA 3KG2A 3MQ9A 5I59A 2HZKA 4H46A 4NF8B 4X1BA 5H8NA 2GH9A 1POTA 3EPEA 4NF0A 4NF6A 1DPEA 2DWJA 4IR8A 2XXYA 1LBBA 5ISUA 3MVYA 3ECRA 1LBVA 3QMFA 1SBPA 3MP1A 5ELVA 3T22A 3TTMA 4XFEA 3HSTA 5TP9A 2CEYA 3MUQA 2Y5KA 3IOVA 4QFLA 4MIJA 4N8GA 3E79A 4H6DA 3S9LC 1I6BA 1FQFA 4OWDA 3HHGA 3CFZA 3O28A 4NEDA 1Y1ZA 1TXFA 2RF1A 1FJ9A 4O8MA 4P8BA 1CNQA 1MH3A 3RGYA 5L9SA 3USDA 4OHNA 3U93A 4MNPA 5IZZA 2REGA 1PEBA 4XKRA 4YB5A 4GWXA 1LFHA 1S50A 1LAFE 2NUVA 2P2AA 3RPLA 1P1UA 4YKKA 2F6GA 2BJIA 1J1NA 4OENA 1SPIA 4OFLA 3B6TA 1M5BA 1H44A 1B51A 5L9MA 1XT8A 1WVJA 1FBHA 4YMBA 1IXHA 3TTRA 3S9NC 2PBWA 3UGWA 4PBHA 3Q27A 5DVJA 4I8CA 4MMPA 3U8QA 5B7DA 3E4RA 4QFOA 1EH3A 3MJNA 1MDQA 2D5WA 3DELB 4KI0E 3MVXA 3ILUB 3BFUA 3FGSA 2ZMBA 1B4HA 1PBQA 3I3VA 1KA1A 5AA2B 1R6ZA 1QKAA 5H8FB 3G3IA 2P3NA 1FCKA 5F1QA 5TPAA 3C32A 4I9DA 1ANFA 4GXSB 4KFQA 5J16A 1SI1A 1BLFA 2CZKA 3SETA 5A5XA 5DYHA 1KWHA 1I69A 1LBZA 1QJMA 3HPIA 2ALUA 2ZYMA 3O6IA 3P7IA 2CZLA 3V8XB 1US5A 4OVJA 4GWSA 4NMYA 2CMOA 3IFCA 2V84A 3MZBA 1DBZA 3WAFA 4R75A 4EXLA 3H6TA 4HE2A 1FTLA 4EQ9A 3N5LA 4JVCA 3S2VA 1XOCA 1IMDA 3KJ7A 1B40A 4I40A 1DOTA 4NAPA 3BKIB 1MXZA 3PUZE 3QK6A 4G77A 2R8TA 4YAHX 5BWJA 4PFTA 5HPQA 3CR9A 3DP4A 2PCRA 2BJJX 4KYSA 4U2RA 4PE5B 3TTLA 4G8MA 4RYAA 3BBRA 2Y7RA 4KQPA 3ZKLA 4R9FA 3VXCA 2VD3A 5KCJA 2B4MA 1VDWA 1Q1KA 4PE3A 5H8QA 4F1VA 4FJPA 3VVDA 4QHQA 1URGA 1B7ZA 4F29A 4ZE9A 1NV5A 1N3XA 1AMFA 5CRYA 3G3GA 4IGRA 2ZXTA 1FPGA 3TUSA 4AB6A 4PQJA 2FA7A 2XXRA 5CMMA 2B65A 1ZMGA 3OSQA 3K6XA 4G68A 4MLQA 5K2XA 1LB9A 4RXLA 4LZ8A 1D9VA 1B52A 1A8FA 4Z7EA 2DWAA 2Q8JA 4Z0IA 3HFUA 2DVZA 4L17A 4RA1A 2Z8DA 2VOZA 3BIGA 4U4SA 3KC1A 3K1PA 3RQTA 3LV0A 1B1XA 1MXUA 1SW1A 2F7AA 3O6HA 3TQLA 3LUYA 2O84X 2R9JA 3KBZA 3IAZA 4N81A 1AWBA 1LB8A 1MQHA 3LC8A 5H8HB 3IORA 4PTKA 4DCXA 3TCFA 3QIMA 1OVBA 5CM6A 2WX9A 1EYKA 2PFYA 4JVDA 1TFDA 5ICTA 4MNCA 4GWOA 2I6EA 2DE2A 3O97A 3FVNA 4ELOA 2FYIA 1FQEA 1MXYA 2ZYKA 1UIUA 4GX6A 4ZDMA 5FHOA 3ZS6A 1SD3A 1LSTA 2QMXA 2D3IA 4POXA 2GQ1A 3EN3A 1M5DA 3GLBA 1LAHE 1IIWA 1POY1 4LATA 4F3PA 3LBSA 2F3BA 2O7UA 1EZ9A 5AA1A 2AL5A 4P9KA 2XXVA 5AA4B 1PB9A 1M5FA 4EUOA 1YYZA 5LOMA 4OFJA 4ELQA 2Z22A 3PV0E 3FASA 3FBPA 2B3BA 4N17A 1JETA 3SDFA 5CMKA 4BDNA 3TMGA 2XD3A 2PT2A 3IR1A 4XKNA 5IM2A 1B7HA 2QRYA 2O1LA 2GRVA 4OVRA 3GBBA 1Z7ME 2DWIA 3T96B 3VLWA 3RPWA 3TTNA 1FTMA 1NUWA 2XXQA 4F1UA 1FJ6A 3KJTA 4G8NA 5IZ1A 5CBSA 3C9HA 1MS7A 2HQ0A 3ZKKA 5ET8A 3IJOB 4E0WA 2ESNA 3T9XB 3PUYE 3QUFA 1H76A 1LCFA 4ZEKA 3S9EA 3VDFA 4KYDA 1QKBA 2XXUA 1JEVA 4PGPA 1ELJA 2O6AA 3EHSA 4PFBA 4DI4B 2XXHA 2D21A 4X1DA 3SESA 5L9OA 5DVIA 3KFMA 5I59B 4OZ9A 5H8NB 5I58A 1MRPA 4PF8A 5HM4B 1EYJA 4MEVA 4NF6B 4TLMB 3PTYA 4JB7A 5IAIA 1Y1MA 1SW2A 5ET7A 1NV3A 3VVEA 3PPPA 4GXAA 3TTKA 1FBFA 1FBPA 4XTCQ 3TKDA 3ZSFA 3CHGA 3TQWA 3H7MA 3FATA 1QGXA 4DCYA 1MPDA 5TP9B 4QFPA 3D1RA 1AIVA 3OEKA 3CIJA 1JNFA 2OX3A 4HCWA 1N3WA 3LUZA 1HSEA 3KGCA 1IITA 4ZECA 4OXVA 4BDRA 1OLAA 1LBWA 1D3KA 3WAEA 1B58A 1S7YA 3R26A 4I3EA 1A7LA 1MY3A 3GBAA 4OQOA 1XS5A 1AL3A 1K9ZA 4OANA 4JWXA 2WYPA 3L6GA 4XEQA 1FTAA 1Y20A 2X7QA 2IEEA 1P1WA 3O2AA 3IOUA 5EHSA 1QUIA 4F19A 3UORA 5K2YA 2XXKA 4GBWA 3OELA 4IGTA 3HHFA 3FV2A 4KPTA 1VSOA 2QS1A 4FEDA 4QXDA 4PCDA 5JK4A 4F31B 4MX6A 2XXIA 1Q9DA 4GWYA 3N6TA 1B2HA 1ZU0A 4GF8A 3OO6A 5AA2D 5DVFA 3C34A 1RDZA 3MC2A 3V83A 5JTYA 2Y7WA 3PUVE 4OFOA 4P3LA 1B32A 4ESWA 3O66A 2OWSA 1QVSA 2F7BA 4IO4A 1USYE 2DWHA 4UA8A 3QUJA 3UIFA 2VPNA 4N15A 4WEDA 3HV1A 5EHMA 4JSOA 5AA3A 2XD2A 3FVOA 4F39A 4WKMA 3H6WA 1MG1A 5FHNA 5TPAB 3SEUA 1MDP1 4LZ5A 4N4UA 1FBEA 5EQ7A 4IO3A 5A5XB 4ZZAA 2CZIA 3V5AA 2I0CA 5EYGA 3TELA 1NL5A 4ZEBA 4ONYA 2G29A 1IMEA 2PT1A 4JWOA 4EXKA 4O7MA 4X9TA 2DP8A 3AXFA 3VXBA 2PMSA 1GGGA 4YB6A 1US4A 3QXMA 4KCDA 4DI3D 4LN5A 1OIBA 2NOOA 1QULA 2GHBA 2QPQA 2R6GE 2F78A 2P1SA 1MPCA 4NG7A 5ESYA 3T1BA 4GL8A 1TT1A 4PC9A 1N04A 4OYVA 1B0HA 3E13X 1NV4A 4BDMA 4KYEA 2I0BA 4YKJA 3T9HB 4IO2A 5KCJB 4GVOA 2XWKA 4C0RA 4KR5A 1NV0A 1DTZA 5H8QB 2V3QA 2Y5LA 1DK4A 4LQ5A 2XX8A 4PP0A 4ELRA 4GLIA 4AQ4A 3LSXA 2FIXA 1SW5A 1B3GA 3PUWE 4PDDA 4OESA 5IZ3A 3VLVA 4GBVA 4Q0CA 4G68B 1OQGA 4GX3A 3MPKA 2E1SA 3T93B 4DE8A 3GXAA 1R9QA 3CG1A 2XX9A 3SEWA 1JP4A 1RDXA 1SW4A 4PDHA 2IA4A 3MP8A 1Z7NE 3FJGA 3DLNA 3QSLA 3U92A 3PGFA 3KN8A 3O6GA 3Q25A 3DP8A 3H6VA 4POWA 3TCHA 2YPNA 1MY1A 3ILTB 4YMAA 2F97A 5T3JA 1GV8A 4JXIA 3MPLA 3ROJA 4HE1A 3W9WA 4EQBA 3N26A 4IO6A 2F6PA 2OCUA 4NTLA 1B05A 1GTKA 1I6QA 3IO4A 4DZ1A 2QL3A 4X04A 1CB6A 1P1OA 3TCGA 5EYFA 2Z8FA 5H8SA 3I5OA 4NF4B 4YB7A 1LAGE 3A09A 4R74A 4P56A 3PUXE 5KDTA 1SDXA 4JSDA 1URSA 1RKMA 3C33A 1KZ8A 1IQ7A 1MM6A 4C1UA 3UN6A 1FPKA 5CI5A 2YJPA 4KXPA 3DM0A 4THIA 3RYDA 3E3KA 2UVHA 4N6DA 4N91A 1QUKA 3H3GA 4QSCA 3TFLA 2RC8A 4X48A 1SI0A 3B6WA 3D4GA 3SEVA 3MVWA 1NKXA 4FEBA 4P11A 4R6KA 4G68C 2RCAA 1IMCA 1FTKA 3OD7A 3K1MA 3A29A 3KZGA 1BK4A 2PVUA 5I2NA 1MXWA 5ET5A 1GR2A 3F11A 4EQ7A 3KSXA 4GRKA 1NNPA 2DXYA 3G3HA 3QYTA 4NE4A 2O51A 5EQAA 4ND9A 3C36A 2I58A 4FBPA 4DXCA 3CG3A 4IY5A 1JW4A 1H45A 1ZTYA 3N6UA 1B5JA 2I3VA 2XA5A 3VVFA 1NUYA 1WODA 3OMBA 5I58B 2NVUB 2XXTA 2OK2A 1FPIA 3B6QA 4NWCA 3TODA 3LSFB 2A5SA 4G61A 2QSXA 3ONMA 3PD9A 1II5A 2UVGA 3U65A 2H4IA 1JVYA 2REJA 4GD5A 1LGBC 3PMVA 3RTWB 5CC2A 2WBBA 2DXRA 5EYHA 2V4CA 4ZS9A 3FIRA 1R1NA 2DVCA 4UACA 1DMBA 1FPFA 3B7DA 2HZLA 3FXRA 1IXGA 3FVKA 4BDLA 2V25A 1ZBMA 1R9LA 2QFLA 1DCUA 4XIGQ 2KQZA 1JEUA 4HW8A 2HXRA 3IOTA 1VFEA 4PF6A 3CI8A 3RTFB 3M3KA 4E0XA 5F24A 3LSLA 4N6PA 5L8DA 4MHFA 1LBYA 1PC3A 1TFAA 4MNIA 5I56A 2Q9TA 2QJEA 2ZYNA 1LEVA 2H25A 2ZZVA 3R7XA 1FQAA 3C4MA 5B70A 4OVSA 2Q89A 5CMBA 2HCAA 1DSNA 2H99A 1JVXA 1VE4A 4NF5A 4N07A 2VP1A 4HCYA 4DLDA 1O64A 3MSTA 4RNSA 3Q28A 1LBCA 3IOWA 3K6VA 3PMXA 4P47A 3JV9A 2O7IA 4OVPA 5M2VA 4R2FA 1UTHA 1M5CA 1XI6A 1LFGA 3M3LA 3RN8A 1B5IA 5FTIA 2GHAA 1BIYA 1NNFA 5LDZA 3TZAA 2O69A 5JTYB 4GWZA 3K6UA 1M5EA 2FHYA 1B3LA 1UIVA 3EKIA 4PBQA 3SZPA 4RK2A 3FXQA 3MVZA 4MH5A 4O94A 4XF5A 3LR1A 4TQUQ 2XXXA 4G8HA 1IXCA 3ODBA 2P3VA 2FVZA 1CE2A 1OLCA 5FHMA 3FVGA 1FPDA 2Q2CA 4F1YA 3T9UA 2V3TA 1A40A 4GIZA 2F36A 3Q29A 5ICQA 1YCJA 3U94A 4GFRA 3MZ9A 5I3SA 1FBDA 4H67A 3VFJA 1Y9UA 4GX4A 1D9QA 2Z8EA 4FATA 2OLBA 1OMPA 5I57A 3T9VA 1N7XA 5I2KA 3BIHA 3G3FA 5I5PA 4R2BA 3C35A 3MAMA 4LONB 2LAOA 4QBAA 2UVIA 2WEFA 5A5LA 1MM7A 2P0SA 3B50A 4UABA 4FECA 3K0VA 3FJ7A 2XXPA 3OSRA 3MWBA 4LQ2A 1JW1A 3VE1B 3OO7A 4IO7A 2AYSA 1QUJA 4AS4A 2NXOA 3MYUA 2OBGA 1B9JA 2XX7A 1EU8A 2VPOA 1EYIA 3NOHA 4G2ZA 4IO5A 1B1HA 3RPLB 3SEYA 4P1LA 1S9TA 3IL1B 5IZ3B 1FBGA 3H03A 3MW0A 4YICA 3EF7A 3CSGA 1BTJA 4OTEA 1YPNA 3H6UA 3PPQA 4TOZA 1XVXA 1NI9A 2MKZA 1PBPA 3K00A 5DW8A 2RINA 2VD2A 4LVQA 3TDJA 4F3BA 2F7CA 4EF2A 5DT6A 1NUZA 4F3SA 4U4XA 2AL4A 3N94A 2PFZA 4PAKA 1B3FA 4ZEIA 4P0GA 5JEIA 2G93A 2Q8MA 2HAUA 4QRZA 1JQFA 5LTCA 1EZOA 4PGNA 3K6WA 4K3FA 4GOTA 1SYHA 3R6UA 4QF9A 2DE4A 4H8IA 4AS5A 3UA8A 1FBCA 2V93A 3FV1A 1RYXA 1ZKBA 2HPGA 4HS7A 1IMAA 1N84A 1IUDA 4LZ7A 3KBRA 1Y3PA 1MQGA 4Q5TA 4F2OA 2VGQA 4IB2A 4F2QA 4OEVA 5KDTB 4H0WA 1IZ1A 5DEXA 4NWDA 4IY6A 2THIA 2VHAA 2F5XA 3EQ1A 4DIGA 3FZVA 2RC9A 4EDPA 1B3HA 4H5GA 5ITPA 3O9PA 1FQBA 2JJKA 1WDNA 1B6HA 2CEXA 3PU5A 2WYKA 3IB1A 3RUMA 4F18A 1IXIA 2UYEA 4U22A 2KLFA 4P1EA 1H3DA 2F34A 3SEXA 1HSJA 4OVQA 4O7IA 3G3KA 3IX1A 5I2NB 4I3YA 1Y4TA 4O3AA 1G0HA 2GFEA 3CVGA 4RY1A 4O3CA 4MLVA 1B46A 3THIA 4YKPA 3U1OA 1FPBA 3A3UA 1O63A 4BLAA 1N76A 2H98A 4GWWA 3S4UA 4JVIA 4U21A 1UTBA 2Q74A 1MH4A 3KEIA 2HHMA 4MF3A 2L5VA 5I84A 2QS3A 2UVJA 4PFRA 1F9BA 1FQDA 2A5TA 1OQHA 1XC1A 4BDOA 3IO6A 3M8UA 4R72A 4ZE8A 2DOJA 3HO7A 3PPRA 4XKPA 2Y7PA 2PX1A 4R9GA 1N7WA 4C1TA 3OEMA 4KHZE 1FPEA 1EZPA 1YXIA 2QMWA 2Y84A
chains in the Genus database with same CATH topology
1RYOA 3VV5A 3SKPA 1B5HA 2XHDA 4QFKA 3RLFE 1OVTA 2E0SA 2HAVA 2I4BA 4NF8A 4N13A 1AOVA 1LFIA 1P1NA 3PPNA 3K01A 2F35A 2QS4A 1B0LA 4OERA 4U1ZA 4QSEA 2DQVA 3KN7A 1A8EA 1B7UA 4GQOA 3GZGA 5BUUA 4BDQA 3M3FA 1DTGA 2ANJA 2UYFA 3A3CA 2W7YA 4U1OA 5HBCA 4R6HA 5F7VA 5I56B 1BKAA 5TU0A 2V3UA 4P0IA 3Q26A 5FTHA 2Y7KA 4LA9A 2Q88A 3KN3A 4I62A 3EHTA 3OENA 2B3FA 1ZLQA 4NF5B 2OZZA 3T66A 3G7WA 4M4GA 2Y7IA 3BFTA 4F22A 1URDA 4DXBA 3OO8A 4R73A 4ZEFA 3K02A 4QSDA 3H06B 1UTHB 3CFXA 4HTGA 1LCTA 3PPOA 2HFBA 2X7PA 1MY2A 2HEUA 3U72A 4ELPA 1NFTA 3LSWA 1IEJA 3TAJA 3FUZA 4ECFA 1ZIUA 4JDFA 2OWTA 3K1NA 4FE8A 4DXUA 3E9XA 3D4CA 3FD3A 3TPAA 1MY0A 2DYXA 3HN0A 4ESXA 1FQCA 4OEUA 3G3JA 1HSLA 3PD8A 2ONKE 4F3GA 3C31A 1PB8A 2I49A 1A55A 1PB7A 1O7TA 1NMUA 1I6AA 4PFUA 3TEPA 3JZJA 5I57B 1SVXB 5I2KB 4GL0A 3FXUA 1Y3QA 4Q30B 5AA2A 5H8FA 1ZJLA 3MP6A 4LUBA 1P99A 1VFDA 4FIMA 1B4ZA 4ZZEA 3IB0A 3QAXA 4JWYA 4YKIA 4PFYA 4RPNA 3MZ1A 5DTBA 3KOTA 4FORA 4U23A 4WEPA 2DE3A 3W9VA 1A54A 1XHYA 5AE4A 4NF4A 4OMBA 3IK6B 4QFNA 4AB5A 2I48A 4DDDA 4WXJA 3HCQA 2O1MA 3UK4A 2H5YA 4ZEDA 2H9BA 4YU0A 1PDAA 2RCBA 4O3BA 1H43A 4RJZA 1UQWA 2WKYA 5KZTA 1P1QA 2ZNSA 1D9YA 1N0TA 2M8CA 5ITOA 4R6YA 3CFLA 3CSBA 2I4CA 4MFIA 3OOAA 3L6HA 1LAXA 3RNNA 4H5FA 2ZNUA 4Q8RA 1ATGA 1D4NA 2ONRA 3KSJA 4I1DA 3JYRA 2RC7A 1VR5A 3I6VA 3DP6A 3OXNA 4PFWA 4G4PA 4RPOA 4PETA 2HXWA 3UP9A 1SQYA 2UXAA 2RKMA 4H65A 3K2DA 4XKQA 1B3EA 2FNCA 5H8HA 3W15C 3VLUA 5DEXB 3IJXB 3CRBA 3FJMA 1JW5A 1AH5A 1NNKA 4RK9A 3RT8A 1XVYA 4OETA 3RY3A 2Q2AA 2ZNTA 4TLLB 3PMWA 1A99A 2DSFA 3V89B 4FAJA 1YTVA 4KCCA 4YZZA 1LLSA 2PYYA 1MXXA 1FTOA 5CBRA 2I3WA 2XXWA 3S9MC 3MBPA 1YAEA 4LP2B 5AA4A 1QW0A 3H4ZA 1Y3NA 3RT6B 4XXUA 2QS2A 5CMCA 2DS9A 1FTJA 1UTBB 3TYHA 1MXVA 3IB2A 4JBZA 1DPPA 2O68A 2ZYOA 2R71A 1FW0A 2ABHA 2A5TB 4H8JA 1GVCA 3KOSA 1MPBA 3SERA 1MQIA 1L5TA 3O29A 2AIXA 2X26A 4ISUA 3OO9A 2F8DA 4H1XA 3EHUA 3K4UA 1TWYA 1Q35A 2NWJA 4M1VA 1NH8A 1MY4A 2Z23A 4KD5A 1NH7A 1USYH 1NNTA 5J1DA 4EF1A 1MQJA 4MBPA 2ONSA 1MQDA 1SYIA 2OJTA 2YLNA 1BP5A 5IKBA 1Y4CA 1T0KA 3KG2A 3MQ9A 5I59A 2HZKA 4NF8B 4X1BA 5H8NA 2GH9A 1POTA 3EPEA 4NF6A 1DPEA 2DWJA 2XXYA 1LBBA 5ISUA 3MVYA 3ECRA 1SBPA 3MP1A 5ELVA 3T22A 3TTMA 3HSTA 5TP9A 3MUQA 3IOVA 4QFLA 4H6DA 3S9LC 1I6BA 1FQFA 4OWDA 3HHGA 3CFZA 3O28A 4NEDA 1Y1ZA 1TXFA 2RF1A 1MH3A 3RGYA 5L9SA 3USDA 4OHNA 3U93A 2REGA 1PEBA 4XKRA 4YB5A 1LFHA 1S50A 1LAFE 2NUVA 2P2AA 1P1UA 4YKKA 2F6GA 1J1NA 4OENA 3B6TA 4OFLA 1M5BA 1H44A 1B51A 5L9MA 1XT8A 1WVJA 4YMBA 1IXHA 3TTRA 3S9NC 2PBWA 3UGWA 3Q27A 5DVJA 4I8CA 3U8QA 5B7DA 3E4RA 4QFOA 1EH3A 3MJNA 1MDQA 2D5WA 3DELB 4KI0E 3MVXA 3ILUB 3BFUA 3FGSA 2ZMBA 1B4HA 1PBQA 3I3VA 5AA2B 1R6ZA 1QKAA 5H8FB 3G3IA 1FCKA 5F1QA 5TPAA 3C32A 4I9DA 1ANFA 4GXSB 4KFQA 1SI1A 1BLFA 3SETA 5A5XA 5DYHA 1KWHA 1I69A 1QJMA 3HPIA 2ALUA 2ZYMA 3O6IA 3P7IA 2CZLA 3V8XB 1US5A 4OVJA 4NMYA 2CMOA 2V84A 3MZBA 3WAFA 4R75A 4EXLA 3H6TA 1FTLA 4EQ9A 3N5LA 3S2VA 1XOCA 3KJ7A 1B40A 1DOTA 3BKIB 1MXZA 3PUZE 3QK6A 4G77A 4YAHX 5BWJA 4PFTA 5HPQA 3CR9A 3DP4A 2BJJX 4KYSA 4U2RA 4PE5B 3TTLA 4G8MA 4RYAA 3BBRA 2Y7RA 4KQPA 3ZKLA 4R9FA 3VXCA 2VD3A 5KCJA 1Q1KA 5H8QA 4F1VA 4FJPA 3VVDA 4QHQA 1URGA 1B7ZA 4F29A 4ZE9A 1N3XA 1AMFA 5CRYA 3G3GA 4IGRA 2ZXTA 3TUSA 4AB6A 4PQJA 2FA7A 2XXRA 5CMMA 2B65A 1ZMGA 3OSQA 3K6XA 4G68A 4MLQA 5K2XA 1LB9A 4RXLA 4LZ8A 1D9VA 1B52A 4Z7EA 1A8FA 2DWAA 2Q8JA 4Z0IA 2DVZA 4L17A 2Z8DA 4RA1A 2VOZA 4U4SA 3K1PA 3RQTA 1B1XA 1MXUA 1SW1A 2F7AA 3O6HA 3TQLA 3LUYA 2O84X 2R9JA 3IAZA 1LB8A 1MQHA 3LC8A 5H8HB 3IORA 4DCXA 3TCFA 3QIMA 1OVBA 5CM6A 1TFDA 5ICTA 4GWOA 2I6EA 2DE2A 3O97A 3FVNA 4ELOA 2FYIA 1FQEA 1MXYA 2ZYKA 1UIUA 4ZDMA 5FHOA 3ZS6A 1SD3A 1LSTA 2QMXA 2D3IA 4POXA 3EN3A 1M5DA 3GLBA 1LAHE 1IIWA 1POY1 4LATA 4F3PA 3LBSA 2O7UA 5AA1A 1EZ9A 2AL5A 2XXVA 5AA4B 1PB9A 1M5FA 4EUOA 5LOMA 4OFJA 4ELQA 2Z22A 3PV0E 3FASA 2B3BA 1JETA 3SDFA 5CMKA 4BDNA 3TMGA 2XD3A 2PT2A 3IR1A 4XKNA 1B7HA 2QRYA 2O1LA 2GRVA 3GBBA 1Z7ME 2DWIA 3T96B 3VLWA 3RPWA 3TTNA 1FTMA 2XXQA 4F1UA 3KJTA 4G8NA 5CBSA 3C9HA 1MS7A 2HQ0A 3ZKKA 3IJOB 4E0WA 2ESNA 3T9XB 3PUYE 3QUFA 1H76A 1LCFA 4ZEKA 3S9EA 3VDFA 4KYDA 1QKBA 2XXUA 1JEVA 1ELJA 2O6AA 3EHSA 2XXHA 2D21A 4X1DA 3SESA 5L9OA 5DVIA 3KFMA 5I59B 4OZ9A 5H8NB 5I58A 1MRPA 5HM4B 4NF6B 4TLMB 4JB7A 5IAIA 1Y1MA 1SW2A 3VVEA 3PPPA 4GXAA 3TTKA 4XTCQ 3TKDA 3ZSFA 3TQWA 3H7MA 3FATA 4DCYA 1MPDA 5TP9B 4QFPA 1AIVA 3OEKA 3CIJA 1JNFA 4HCWA 1N3WA 1HSEA 3KGCA 1IITA 4ZECA 4OXVA 4BDRA 1OLAA 1D3KA 3WAEA 1B58A 1S7YA 3R26A 4OQOA 1A7LA 1MY3A 3GBAA 1XS5A 1AL3A 4JWXA 3L6GA 1Y20A 2X7QA 2IEEA 1P1WA 3O2AA 3IOUA 5EHSA 1QUIA 4F19A 3UORA 5K2YA 3OELA 4IGTA 3HHFA 3FV2A 4KPTA 1VSOA 2QS1A 4FEDA 5JK4A 4F31B 2XXIA 3N6TA 1B2HA 1ZU0A 4GF8A 3OO6A 5AA2D 5DVFA 3C34A 3MC2A 3V83A 5JTYA 2Y7WA 3PUVE 4OFOA 4ESWA 1B32A 3O66A 2OWSA 1QVSA 2F7BA 4IO4A 1USYE 2DWHA 4UA8A 3QUJA 3UIFA 4WEDA 3HV1A 5EHMA 4JSOA 5AA3A 2XD2A 3FVOA 4F39A 4WKMA 3H6WA 1MG1A 5FHNA 5TPAB 3SEUA 1MDP1 4LZ5A 4IO3A 5A5XB 4ZZAA 3V5AA 2I0CA 3TELA 1NL5A 4ZEBA 4ONYA 2G29A 2PT1A 4JWOA 4EXKA 4X9TA 2DP8A 3AXFA 3VXBA 2PMSA 1GGGA 4YB6A 1US4A 3QXMA 4KCDA 1OIBA 2NOOA 1QULA 2GHBA 2QPQA 2R6GE 2F78A 2P1SA 1MPCA 4GL8A 1TT1A 1N04A 4OYVA 1B0HA 3E13X 4BDMA 4KYEA 2I0BA 4YKJA 3T9HB 4IO2A 5KCJB 4GVOA 4C0RA 4KR5A 1DTZA 5H8QB 2V3QA 4LQ5A 2XX8A 4PP0A 4ELRA 4GLIA 4AQ4A 3LSXA 1SW5A 1B3GA 3PUWE 4OESA 3VLVA 4Q0CA 4G68B 1OQGA 3MPKA 2E1SA 3T93B 4DE8A 3GXAA 1R9QA 3CG1A 2XX9A 3SEWA 1SW4A 2IA4A 3MP8A 1Z7NE 3FJGA 3DLNA 3QSLA 3U92A 3PGFA 3KN8A 3O6GA 3Q25A 3DP8A 3H6VA 4POWA 3TCHA 2YPNA 1MY1A 3ILTB 4YMAA 2F97A 1GV8A 4JXIA 3MPLA 3W9WA 4EQBA 3N26A 4IO6A 2F6PA 2OCUA 4NTLA 1B05A 1GTKA 1I6QA 3IO4A 4DZ1A 2QL3A 1CB6A 1P1OA 3TCGA 5EYFA 2Z8FA 5H8SA 3I5OA 4NF4B 4YB7A 1LAGE 3A09A 4R74A 3PUXE 5KDTA 1SDXA 4JSDA 1URSA 1RKMA 3C33A 1IQ7A 1MM6A 4C1UA 3UN6A 5CI5A 2YJPA 3DM0A 4THIA 3E3KA 2UVHA 1QUKA 3H3GA 4QSCA 3TFLA 2RC8A 4X48A 1SI0A 3B6WA 3D4GA 3SEVA 3MVWA 1NKXA 4FEBA 4P11A 4R6KA 4G68C 2RCAA 1FTKA 3OD7A 3K1MA 3KZGA 2PVUA 5I2NA 1MXWA 1GR2A 3F11A 4EQ7A 3KSXA 4GRKA 1NNPA 2DXYA 3G3HA 3QYTA 2O51A 4NE4A 4ND9A 3C36A 2I58A 4DXCA 3CG3A 4IY5A 1JW4A 1H45A 1ZTYA 3N6UA 1B5JA 2I3VA 3VVFA 1WODA 3OMBA 5I58B 2NVUB 2XXTA 2OK2A 3B6QA 4NWCA 3TODA 3LSFB 2A5SA 2QSXA 3ONMA 3PD9A 1II5A 2UVGA 2H4IA 1JVYA 2REJA 4GD5A 1LGBC 3PMVA 3RTWB 5CC2A 2DXRA 4ZS9A 3FIRA 1R1NA 2DVCA 4UACA 1DMBA 3B7DA 3FXRA 2HZLA 1IXGA 3FVKA 4BDLA 2V25A 1ZBMA 1R9LA 4XIGQ 1JEUA 4HW8A 3IOTA 1VFEA 3CI8A 3RTFB 3M3KA 4E0XA 3LSLA 4N6PA 5L8DA 1PC3A 1TFAA 5I56A 2Q9TA 2QJEA 2ZYNA 2H25A 3R7XA 1FQAA 3C4MA 5B70A 2Q89A 5CMBA 2HCAA 1DSNA 2H99A 1JVXA 1VE4A 4NF5A 4N07A 2VP1A 4HCYA 4DLDA 1O64A 4RNSA 3Q28A 1LBCA 3IOWA 3K6VA 3PMXA 3JV9A 2O7IA 5M2VA 4R2FA 1UTHA 1M5CA 1LFGA 3M3LA 3RN8A 1B5IA 5FTIA 2GHAA 1BIYA 1NNFA 3TZAA 2O69A 5JTYB 3K6UA 1M5EA 1B3LA 1UIVA 4RK2A 3FXQA 3MVZA 4MH5A 3LR1A 4TQUQ 2XXXA 4G8HA 1IXCA 3ODBA 1CE2A 1OLCA 5FHMA 3FVGA 2Q2CA 4F1YA 3T9UA 2V3TA 1A40A 4GIZA 2F36A 3Q29A 5ICQA 1YCJA 3U94A 4GFRA 3MZ9A 4H67A 3VFJA 1Y9UA 2Z8EA 4FATA 2OLBA 1OMPA 5I57A 3T9VA 1N7XA 5I2KA 3G3FA 4R2BA 3C35A 3MAMA 4LONB 2LAOA 2UVIA 1MM7A 2P0SA 4FECA 3K0VA 3FJ7A 2XXPA 3OSRA 3MWBA 4LQ2A 1JW1A 3VE1B 3OO7A 4IO7A 2AYSA 1QUJA 2NXOA 2OBGA 1B9JA 2XX7A 1EU8A 4G2ZA 4IO5A 1B1HA 3SEYA 1S9TA 3IL1B 3H03A 3MW0A 4YICA 3EF7A 3CSGA 1BTJA 4OTEA 1YPNA 3H6UA 3PPQA 4TOZA 1XVXA 1PBPA 3K00A 2RINA 2VD2A 4LVQA 3TDJA 4F3BA 2F7CA 4EF2A 5DT6A 4F3SA 4U4XA 2AL4A 3N94A 1B3FA 4ZEIA 4P0GA 5JEIA 2G93A 2HAUA 4QRZA 1JQFA 1EZOA 3K6WA 4K3FA 4GOTA 1SYHA 3R6UA 4QF9A 2DE4A 4H8IA 3UA8A 2V93A 3FV1A 1RYXA 1ZKBA 4HS7A 1N84A 1IUDA 4LZ7A 3KBRA 1Y3PA 1MQGA 4Q5TA 4F2OA 2VGQA 4IB2A 4F2QA 4OEVA 5KDTB 4H0WA 1IZ1A 5DEXA 4NWDA 4IY6A 2THIA 2VHAA 2F5XA 3EQ1A 4DIGA 3FZVA 2RC9A 4EDPA 1B3HA 4H5GA 5ITPA 3O9PA 1FQBA 1WDNA 1B6HA 3PU5A 3IB1A 3RUMA 4F18A 1IXIA 2UYEA 4U22A 2KLFA 1H3DA 2F34A 3SEXA 1HSJA 3G3KA 3IX1A 5I2NB 1Y4TA 4O3AA 2GFEA 3CVGA 4RY1A 4O3CA 4MLVA 1B46A 3THIA 4YKPA 3U1OA 3A3UA 1O63A 4BLAA 1N76A 2H98A 3S4UA 4U21A 1UTBA 1MH4A 3KEIA 4MF3A 5I84A 2QS3A 2UVJA 1F9BA 1FQDA 2A5TA 1OQHA 1XC1A 4BDOA 3IO6A 3M8UA 4R72A 4ZE8A 2DOJA 3HO7A 3PPRA 4XKPA 2Y7PA 2PX1A 4R9GA 1N7WA 4C1TA 3OEMA 4KHZE 1EZPA 2QMWA 2Y84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYO A;  3VV5 A;  3SKP A;  1B5H A;  2XHD A;  4QFK A;  3RLF E;  1OVT A;  2E0S A;  2HAV A;  2I4B A;  4NF8 A;  4N13 A;  1AOV A;  1LFI A;  1P1N A;  3PPN A;  3K01 A;  2F35 A;  2QS4 A;  1B0L A;  4OER A;  4U1Z A;  4QSE A;  2DQV A;  3KN7 A;  1A8E A;  1B7U A;  4GQO A;  3GZG A;  5BUU A;  4BDQ A;  3M3F A;  1DTG A;  2ANJ A;  2UYF A;  3A3C A;  2W7Y A;  4U1O A;  5HBC A;  4R6H A;  5F7V A;  5I56 B;  1BKA A;  5TU0 A;  2V3U A;  4P0I A;  3Q26 A;  5FTH A;  2Y7K A;  4LA9 A;  2Q88 A;  3KN3 A;  4I62 A;  3EHT A;  3OEN A;  2B3F A;  1ZLQ A;  4NF5 B;  2OZZ A;  3T66 A;  3G7W A;  4M4G A;  2Y7I A;  3BFT A;  4F22 A;  1URD A;  4DXB A;  3OO8 A;  4R73 A;  4ZEF A;  3K02 A;  4QSD A;  3H06 B;  1UTH B;  3CFX A;  4HTG A;  1LCT A;  3PPO A;  2HFB A;  2X7P A;  1MY2 A;  2HEU A;  3U72 A;  4ELP A;  1NFT A;  3LSW A;  1IEJ A;  3TAJ A;  3FUZ A;  4ECF A;  1ZIU A;  4JDF A;  2OWT A;  3K1N A;  4FE8 A;  4DXU A;  3E9X A;  3D4C A;  3FD3 A;  3TPA A;  1MY0 A;  2DYX A;  3HN0 A;  4ESX A;  1FQC A;  4OEU A;  3G3J A;  1HSL A;  3PD8 A;  2ONK E;  4F3G A;  3C31 A;  1PB8 A;  2I49 A;  1A55 A;  1PB7 A;  1O7T A;  1NMU A;  1I6A A;  4PFU A;  3TEP A;  3JZJ A;  5I57 B;  1SVX B;  5I2K B;  4GL0 A;  3FXU A;  1Y3Q A;  4Q30 B;  5AA2 A;  5H8F A;  1ZJL A;  3MP6 A;  4LUB A;  1P99 A;  1VFD A;  4FIM A;  1B4Z A;  4ZZE A;  3IB0 A;  3QAX A;  4JWY A;  4YKI A;  4PFY A;  4RPN A;  3MZ1 A;  5DTB A;  3KOT A;  4FOR A;  4U23 A;  4WEP A;  2DE3 A;  3W9V A;  1A54 A;  1XHY A;  5AE4 A;  4NF4 A;  4OMB A;  3IK6 B;  4QFN A;  4AB5 A;  2I48 A;  4DDD A;  4WXJ A;  3HCQ A;  2O1M A;  3UK4 A;  2H5Y A;  4ZED A;  2H9B A;  4YU0 A;  1PDA A;  2RCB A;  4O3B A;  1H43 A;  4RJZ A;  1UQW A;  2WKY A;  5KZT A;  1P1Q A;  2ZNS A;  1D9Y A;  1N0T A;  2M8C A;  5ITO A;  4R6Y A;  3CFL A;  3CSB A;  2I4C A;  4MFI A;  3OOA A;  3L6H A;  1LAX A;  3RNN A;  4H5F A;  2ZNU A;  4Q8R A;  1ATG A;  1D4N A;  2ONR A;  3KSJ A;  4I1D A;  3JYR A;  2RC7 A;  1VR5 A;  3I6V A;  3DP6 A;  3OXN A;  4PFW A;  4G4P A;  4RPO A;  4PET A;  2HXW A;  3UP9 A;  1SQY A;  2UXA A;  2RKM A;  4H65 A;  3K2D A;  4XKQ A;  1B3E A;  2FNC A;  5H8H A;  3W15 C;  3VLU A;  5DEX B;  3IJX B;  3CRB A;  3FJM A;  1JW5 A;  1AH5 A;  1NNK A;  4RK9 A;  3RT8 A;  1XVY A;  4OET A;  3RY3 A;  2Q2A A;  2ZNT A;  4TLL B;  3PMW A;  1A99 A;  2DSF A;  3V89 B;  4FAJ A;  1YTV A;  4KCC A;  4YZZ A;  1LLS A;  2PYY A;  1MXX A;  1FTO A;  5CBR A;  2I3W A;  2XXW A;  3S9M C;  3MBP A;  1YAE A;  4LP2 B;  5AA4 A;  1QW0 A;  3H4Z A;  1Y3N A;  3RT6 B;  4XXU A;  2QS2 A;  5CMC A;  2DS9 A;  1FTJ A;  1UTB B;  3TYH A;  1MXV A;  3IB2 A;  4JBZ A;  1DPP A;  2O68 A;  2ZYO A;  2R71 A;  1FW0 A;  2ABH A;  2A5T B;  4H8J A;  1GVC A;  3KOS A;  1MPB A;  3SER A;  1MQI A;  1L5T A;  3O29 A;  2AIX A;  2X26 A;  4ISU A;  3OO9 A;  2F8D A;  4H1X A;  3EHU A;  3K4U A;  1TWY A;  1Q35 A;  2NWJ A;  4M1V A;  1NH8 A;  1MY4 A;  2Z23 A;  4KD5 A;  1NH7 A;  1USY H;  1NNT A;  5J1D A;  4EF1 A;  1MQJ A;  4MBP A;  2ONS A;  1MQD A;  1SYI A;  2OJT A;  2YLN A;  1BP5 A;  5IKB A;  1Y4C A;  1T0K A;  3KG2 A;  3MQ9 A;  5I59 A;  2HZK A;  4NF8 B;  4X1B A;  5H8N A;  2GH9 A;  1POT A;  3EPE A;  4NF6 A;  1DPE A;  2DWJ A;  2XXY A;  1LBB A;  5ISU A;  3MVY A;  3ECR A;  1SBP A;  3MP1 A;  5ELV A;  3T22 A;  3TTM A;  3HST A;  5TP9 A;  3MUQ A;  3IOV A;  4QFL A;  4H6D A;  3S9L C;  1I6B A;  1FQF A;  4OWD A;  3HHG A;  3CFZ A;  3O28 A;  4NED A;  1Y1Z A;  1TXF A;  2RF1 A;  1MH3 A;  3RGY A;  5L9S A;  3USD A;  4OHN A;  3U93 A;  2REG A;  1PEB A;  4XKR A;  4YB5 A;  1LFH A;  1S50 A;  1LAF E;  2NUV A;  2P2A A;  1P1U A;  4YKK A;  2F6G A;  1J1N A;  4OEN A;  3B6T A;  4OFL A;  1M5B A;  1H44 A;  1B51 A;  5L9M A;  1XT8 A;  1WVJ A;  4YMB A;  1IXH A;  3TTR A;  3S9N C;  2PBW A;  3UGW A;  3Q27 A;  5DVJ A;  4I8C A;  3U8Q A;  5B7D A;  3E4R A;  4QFO A;  1EH3 A;  3MJN A;  1MDQ A;  2D5W A;  3DEL B;  4KI0 E;  3MVX A;  3ILU B;  3BFU A;  3FGS A;  2ZMB A;  1B4H A;  1PBQ A;  3I3V A;  5AA2 B;  1R6Z A;  1QKA A;  5H8F B;  3G3I A;  1FCK A;  5F1Q A;  5TPA A;  3C32 A;  4I9D A;  1ANF A;  4GXS B;  4KFQ A;  1SI1 A;  1BLF A;  3SET A;  5A5X A;  5DYH A;  1KWH A;  1I69 A;  1QJM A;  3HPI A;  2ALU A;  2ZYM A;  3O6I A;  3P7I A;  2CZL A;  3V8X B;  1US5 A;  4OVJ A;  4NMY A;  2CMO A;  2V84 A;  3MZB A;  3WAF A;  4R75 A;  4EXL A;  3H6T A;  1FTL A;  4EQ9 A;  3N5L A;  3S2V A;  1XOC A;  3KJ7 A;  1B40 A;  1DOT A;  3BKI B;  1MXZ A;  3PUZ E;  3QK6 A;  4G77 A;  4YAH X;  5BWJ A;  4PFT A;  5HPQ A;  3CR9 A;  3DP4 A;  2BJJ X;  4KYS A;  4U2R A;  4PE5 B;  3TTL A;  4G8M A;  4RYA A;  3BBR A;  2Y7R A;  4KQP A;  3ZKL A;  4R9F A;  3VXC A;  2VD3 A;  5KCJ A;  1Q1K A;  5H8Q A;  4F1V A;  4FJP A;  3VVD A;  4QHQ A;  1URG A;  1B7Z A;  4F29 A;  4ZE9 A;  1N3X A;  1AMF A;  5CRY A;  3G3G A;  4IGR A;  2ZXT A;  3TUS A;  4AB6 A;  4PQJ A;  2FA7 A;  2XXR A;  5CMM A;  2B65 A;  1ZMG A;  3OSQ A;  3K6X A;  4G68 A;  4MLQ A;  5K2X A;  1LB9 A;  4RXL A;  4LZ8 A;  1D9V A;  1B52 A;  4Z7E A;  1A8F A;  2DWA A;  2Q8J A;  4Z0I A;  2DVZ A;  4L17 A;  2Z8D A;  4RA1 A;  2VOZ A;  4U4S A;  3K1P A;  3RQT A;  1B1X A;  1MXU A;  1SW1 A;  2F7A A;  3O6H A;  3TQL A;  3LUY A;  2O84 X;  2R9J A;  3IAZ A;  1LB8 A;  1MQH A;  3LC8 A;  5H8H B;  3IOR A;  4DCX A;  3TCF A;  3QIM A;  1OVB A;  5CM6 A;  1TFD A;  5ICT A;  4GWO A;  2I6E A;  2DE2 A;  3O97 A;  3FVN A;  4ELO A;  2FYI A;  1FQE A;  1MXY A;  2ZYK A;  1UIU A;  4ZDM A;  5FHO A;  3ZS6 A;  1SD3 A;  1LST A;  2QMX A;  2D3I A;  4POX A;  3EN3 A;  1M5D A;  3GLB A;  1LAH E;  1IIW A;  1POY 1;  4LAT A;  4F3P A;  3LBS A;  2O7U A;  5AA1 A;  1EZ9 A;  2AL5 A;  2XXV A;  5AA4 B;  1PB9 A;  1M5F A;  4EUO A;  5LOM A;  4OFJ A;  4ELQ A;  2Z22 A;  3PV0 E;  3FAS A;  2B3B A;  1JET A;  3SDF A;  5CMK A;  4BDN A;  3TMG A;  2XD3 A;  2PT2 A;  3IR1 A;  4XKN A;  1B7H A;  2QRY A;  2O1L A;  2GRV A;  3GBB A;  1Z7M E;  2DWI A;  3T96 B;  3VLW A;  3RPW A;  3TTN A;  1FTM A;  2XXQ A;  4F1U A;  3KJT A;  4G8N A;  5CBS A;  3C9H A;  1MS7 A;  2HQ0 A;  3ZKK A;  3IJO B;  4E0W A;  2ESN A;  3T9X B;  3PUY E;  3QUF A;  1H76 A;  1LCF A;  4ZEK A;  3S9E A;  3VDF A;  4KYD A;  1QKB A;  2XXU A;  1JEV A;  1ELJ A;  2O6A A;  3EHS A;  2XXH A;  2D21 A;  4X1D A;  3SES A;  5L9O A;  5DVI A;  3KFM A;  5I59 B;  4OZ9 A;  5H8N B;  5I58 A;  1MRP A;  5HM4 B;  4NF6 B;  4TLM B;  4JB7 A;  5IAI A;  1Y1M A;  1SW2 A;  3VVE A;  3PPP A;  4GXA A;  3TTK A;  4XTC Q;  3TKD A;  3ZSF A;  3TQW A;  3H7M A;  3FAT A;  4DCY A;  1MPD A;  5TP9 B;  4QFP A;  1AIV A;  3OEK A;  3CIJ A;  1JNF A;  4HCW A;  1N3W A;  1HSE A;  3KGC A;  1IIT A;  4ZEC A;  4OXV A;  4BDR A;  1OLA A;  1D3K A;  3WAE A;  1B58 A;  1S7Y A;  3R26 A;  4OQO A;  1A7L A;  1MY3 A;  3GBA A;  1XS5 A;  1AL3 A;  4JWX A;  3L6G A;  1Y20 A;  2X7Q A;  2IEE A;  1P1W A;  3O2A A;  3IOU A;  5EHS A;  1QUI A;  4F19 A;  3UOR A;  5K2Y A;  3OEL A;  4IGT A;  3HHF A;  3FV2 A;  4KPT A;  1VSO A;  2QS1 A;  4FED A;  5JK4 A;  4F31 B;  2XXI A;  3N6T A;  1B2H A;  1ZU0 A;  4GF8 A;  3OO6 A;  5AA2 D;  5DVF A;  3C34 A;  3MC2 A;  3V83 A;  5JTY A;  2Y7W A;  3PUV E;  4OFO A;  4ESW A;  1B32 A;  3O66 A;  2OWS A;  1QVS A;  2F7B A;  4IO4 A;  1USY E;  2DWH A;  4UA8 A;  3QUJ A;  3UIF A;  4WED A;  3HV1 A;  5EHM A;  4JSO A;  5AA3 A;  2XD2 A;  3FVO A;  4F39 A;  4WKM A;  3H6W A;  1MG1 A;  5FHN A;  5TPA B;  3SEU A;  1MDP 1;  4LZ5 A;  4IO3 A;  5A5X B;  4ZZA A;  3V5A A;  2I0C A;  3TEL A;  1NL5 A;  4ZEB A;  4ONY A;  2G29 A;  2PT1 A;  4JWO A;  4EXK A;  4X9T A;  2DP8 A;  3AXF A;  3VXB A;  2PMS A;  1GGG A;  4YB6 A;  1US4 A;  3QXM A;  4KCD A;  1OIB A;  2NOO A;  1QUL A;  2GHB A;  2QPQ A;  2R6G E;  2F78 A;  2P1S A;  1MPC A;  4GL8 A;  1TT1 A;  1N04 A;  4OYV A;  1B0H A;  3E13 X;  4BDM A;  4KYE A;  2I0B A;  4YKJ A;  3T9H B;  4IO2 A;  5KCJ B;  4GVO A;  4C0R A;  4KR5 A;  1DTZ A;  5H8Q B;  2V3Q A;  4LQ5 A;  2XX8 A;  4PP0 A;  4ELR A;  4GLI A;  4AQ4 A;  3LSX A;  1SW5 A;  1B3G A;  3PUW E;  4OES A;  3VLV A;  4Q0C A;  4G68 B;  1OQG A;  3MPK A;  2E1S A;  3T93 B;  4DE8 A;  3GXA A;  1R9Q A;  3CG1 A;  2XX9 A;  3SEW A;  1SW4 A;  2IA4 A;  3MP8 A;  1Z7N E;  3FJG A;  3DLN A;  3QSL A;  3U92 A;  3PGF A;  3KN8 A;  3O6G A;  3Q25 A;  3DP8 A;  3H6V A;  4POW A;  3TCH A;  2YPN A;  1MY1 A;  3ILT B;  4YMA A;  2F97 A;  1GV8 A;  4JXI A;  3MPL A;  3W9W A;  4EQB A;  3N26 A;  4IO6 A;  2F6P A;  2OCU A;  4NTL A;  1B05 A;  1GTK A;  1I6Q A;  3IO4 A;  4DZ1 A;  2QL3 A;  1CB6 A;  1P1O A;  3TCG A;  5EYF A;  2Z8F A;  5H8S A;  3I5O A;  4NF4 B;  4YB7 A;  1LAG E;  3A09 A;  4R74 A;  3PUX E;  5KDT A;  1SDX A;  4JSD A;  1URS A;  1RKM A;  3C33 A;  1IQ7 A;  1MM6 A;  4C1U A;  3UN6 A;  5CI5 A;  2YJP A;  3DM0 A;  4THI A;  3E3K A;  2UVH A;  1QUK A;  3H3G A;  4QSC A;  3TFL A;  2RC8 A;  4X48 A;  1SI0 A;  3B6W A;  3D4G A;  3SEV A;  3MVW A;  1NKX A;  4FEB A;  4P11 A;  4R6K A;  4G68 C;  2RCA A;  1FTK A;  3OD7 A;  3K1M A;  3KZG A;  2PVU A;  5I2N A;  1MXW A;  1GR2 A;  3F11 A;  4EQ7 A;  3KSX A;  4GRK A;  1NNP A;  2DXY A;  3G3H A;  3QYT A;  2O51 A;  4NE4 A;  4ND9 A;  3C36 A;  2I58 A;  4DXC A;  3CG3 A;  4IY5 A;  1JW4 A;  1H45 A;  1ZTY A;  3N6U A;  1B5J A;  2I3V A;  3VVF A;  1WOD A;  3OMB A;  5I58 B;  2NVU B;  2XXT A;  2OK2 A;  3B6Q A;  4NWC A;  3TOD A;  3LSF B;  2A5S A;  2QSX A;  3ONM A;  3PD9 A;  1II5 A;  2UVG A;  2H4I A;  1JVY A;  2REJ A;  4GD5 A;  1LGB C;  3PMV A;  3RTW B;  5CC2 A;  2DXR A;  4ZS9 A;  3FIR A;  1R1N A;  2DVC A;  4UAC A;  1DMB A;  3B7D A;  3FXR A;  2HZL A;  1IXG A;  3FVK A;  4BDL A;  2V25 A;  1ZBM A;  1R9L A;  4XIG Q;  1JEU A;  4HW8 A;  3IOT A;  1VFE A;  3CI8 A;  3RTF B;  3M3K A;  4E0X A;  3LSL A;  4N6P A;  5L8D A;  1PC3 A;  1TFA A;  5I56 A;  2Q9T A;  2QJE A;  2ZYN A;  2H25 A;  3R7X A;  1FQA A;  3C4M A;  5B70 A;  2Q89 A;  5CMB A;  2HCA A;  1DSN A;  2H99 A;  1JVX A;  1VE4 A;  4NF5 A;  4N07 A;  2VP1 A;  4HCY A;  4DLD A;  1O64 A;  4RNS A;  3Q28 A;  1LBC A;  3IOW A;  3K6V A;  3PMX A;  3JV9 A;  2O7I A;  5M2V A;  4R2F A;  1UTH A;  1M5C A;  1LFG A;  3M3L A;  3RN8 A;  1B5I A;  5FTI A;  2GHA A;  1BIY A;  1NNF A;  3TZA A;  2O69 A;  5JTY B;  3K6U A;  1M5E A;  1B3L A;  1UIV A;  4RK2 A;  3FXQ A;  3MVZ A;  4MH5 A;  3LR1 A;  4TQU Q;  2XXX A;  4G8H A;  1IXC A;  3ODB A;  1CE2 A;  1OLC A;  5FHM A;  3FVG A;  2Q2C A;  4F1Y A;  3T9U A;  2V3T A;  1A40 A;  4GIZ A;  2F36 A;  3Q29 A;  5ICQ A;  1YCJ A;  3U94 A;  4GFR A;  3MZ9 A;  4H67 A;  3VFJ A;  1Y9U A;  2Z8E A;  4FAT A;  2OLB A;  1OMP A;  5I57 A;  3T9V A;  1N7X A;  5I2K A;  3G3F A;  4R2B A;  3C35 A;  3MAM A;  4LON B;  2LAO A;  2UVI A;  1MM7 A;  2P0S A;  4FEC A;  3K0V A;  3FJ7 A;  2XXP A;  3OSR A;  3MWB A;  4LQ2 A;  1JW1 A;  3VE1 B;  3OO7 A;  4IO7 A;  2AYS A;  1QUJ A;  2NXO A;  2OBG A;  1B9J A;  2XX7 A;  1EU8 A;  4G2Z A;  4IO5 A;  1B1H A;  3SEY A;  1S9T A;  3IL1 B;  3H03 A;  3MW0 A;  4YIC A;  3EF7 A;  3CSG A;  1BTJ A;  4OTE A;  1YPN A;  3H6U A;  3PPQ A;  4TOZ A;  1XVX A;  1PBP A;  3K00 A;  2RIN A;  2VD2 A;  4LVQ A;  3TDJ A;  4F3B A;  2F7C A;  4EF2 A;  5DT6 A;  4F3S A;  4U4X A;  2AL4 A;  3N94 A;  1B3F A;  4ZEI A;  4P0G A;  5JEI A;  2G93 A;  2HAU A;  4QRZ A;  1JQF A;  1EZO A;  3K6W A;  4K3F A;  4GOT A;  1SYH A;  3R6U A;  4QF9 A;  2DE4 A;  4H8I A;  3UA8 A;  2V93 A;  3FV1 A;  1RYX A;  1ZKB A;  4HS7 A;  1N84 A;  1IUD A;  4LZ7 A;  3KBR A;  1Y3P A;  1MQG A;  4Q5T A;  4F2O A;  2VGQ A;  4IB2 A;  4F2Q A;  4OEV A;  5KDT B;  4H0W A;  1IZ1 A;  5DEX A;  4NWD A;  4IY6 A;  2THI A;  2VHA A;  2F5X A;  3EQ1 A;  4DIG A;  3FZV A;  2RC9 A;  4EDP A;  1B3H A;  4H5G A;  5ITP A;  3O9P A;  1FQB A;  1WDN A;  1B6H A;  3PU5 A;  3IB1 A;  3RUM A;  4F18 A;  1IXI A;  2UYE A;  4U22 A;  2KLF A;  1H3D A;  2F34 A;  3SEX A;  1HSJ A;  3G3K A;  3IX1 A;  5I2N B;  1Y4T A;  4O3A A;  2GFE A;  3CVG A;  4RY1 A;  4O3C A;  4MLV A;  1B46 A;  3THI A;  4YKP A;  3U1O A;  3A3U A;  1O63 A;  4BLA A;  1N76 A;  2H98 A;  3S4U A;  4U21 A;  1UTB A;  1MH4 A;  3KEI A;  4MF3 A;  5I84 A;  2QS3 A;  2UVJ A;  1F9B A;  1FQD A;  2A5T A;  1OQH A;  1XC1 A;  4BDO A;  3IO6 A;  3M8U A;  4R72 A;  4ZE8 A;  2DOJ A;  3HO7 A;  3PPR A;  4XKP A;  2Y7P A;  2PX1 A;  4R9G A;  1N7W A;  4C1T A;  3OEM A;  4KHZ E;  1EZP A;  2QMW A;  2Y84 A; 
#chains in the Genus database with same CATH topology
 1IMF A;  1RYO A;  3VV5 A;  3SKP A;  4HE0 A;  1B5H A;  2XHD A;  4QFK A;  4H45 A;  3RLF E;  1OVT A;  2E0S A;  2HAV A;  2I4B A;  4NF8 A;  4N13 A;  4MAG A;  1AOV A;  1LFI A;  1FRP A;  1P1N A;  3GYY A;  3PPN A;  3K01 A;  2F35 A;  2QS4 A;  1B0L A;  4OER A;  4U1Z A;  4QSE A;  2DQV A;  5EQ9 A;  3KN7 A;  1A8E A;  1B7U A;  4GQO A;  3GZG A;  5BUU A;  2XWV A;  4BDQ A;  3M3F A;  1DTG A;  3ISP A;  2ANJ A;  2UYF A;  3A3C A;  2W7Y A;  4U1O A;  5HBC A;  4R6H A;  5F7V A;  5I56 B;  1BKA A;  5TU0 A;  2V3U A;  4P0I A;  3Q26 A;  5FTH A;  2Y7K A;  4LA9 A;  2Q88 A;  2QVU A;  3KN3 A;  4I62 A;  3E78 A;  4NHB A;  3EHT A;  3OEN A;  4OVT A;  2B3F A;  1ZLQ A;  4NF5 B;  2OZZ A;  1NV1 A;  2XWI A;  3T66 A;  1NV6 A;  3G7W A;  4M4G A;  2Y7I A;  3BFT A;  4F22 A;  1URD A;  4DXB A;  3OO8 A;  2FBP A;  4R73 A;  4ZEF A;  2B4L A;  2FIE A;  2WBD A;  3K02 A;  4QSD A;  3H06 B;  1UTH B;  3CFX A;  4HTG A;  1LCT A;  3PPO A;  2HFB A;  2X7P A;  1MY2 A;  4PAF A;  2HEU A;  3U72 A;  4ELP A;  1NFT A;  1IMB A;  1INP A;  3LSW A;  1IEJ A;  3T0J A;  3TAJ A;  3FUZ A;  4ECF A;  1ZIU A;  4JDF A;  2OWT A;  3K1N A;  4FE8 A;  4DXU A;  3E9X A;  3D4C A;  3FD3 A;  3TPA A;  4NX1 A;  1MY0 A;  2DYX A;  3HN0 A;  4ESX A;  1FQC A;  4OEU A;  3G3J A;  1HSL A;  3PD8 A;  2ONK E;  4F3G A;  3C31 A;  1PB8 A;  2I49 A;  1A55 A;  1PB7 A;  1O7T A;  1NMU A;  1I6A A;  4PFU A;  3TEP A;  5ET6 A;  3JZJ A;  5I57 B;  2F3D A;  1SVX B;  5I2K B;  4GL0 A;  3FXU A;  1Y3Q A;  4Q30 B;  5AA2 A;  1K9Y A;  5H8F A;  2ZZW A;  1ZJL A;  3MP6 A;  4LUB A;  1FPJ A;  1P99 A;  1VFD A;  4FIM A;  2OWZ A;  1B4Z A;  4PAI A;  3IB0 A;  4ZZE A;  3QAX A;  1NUX A;  4JWY A;  4YKI A;  4HXV A;  4PFY A;  4RPN A;  4X8R A;  3MZ1 A;  5DTB A;  3KC0 A;  3KOT A;  4FOR A;  4NQ8 A;  4U23 A;  4WEP A;  2DE3 A;  3W9V A;  1A54 A;  1XHY A;  5AE4 A;  4NF4 A;  4OMB A;  3IK6 B;  4QFN A;  4AB5 A;  1FSA A;  4NGU A;  2CZH A;  2I48 A;  4DDD A;  4WXJ A;  3HCQ A;  2O1M A;  4N8Y A;  3UK4 A;  2H5Y A;  4ZED A;  2H9B A;  4YU0 A;  1PDA A;  2RCB A;  4O3B A;  5I7I A;  1H43 A;  4RJZ A;  1UQW A;  1YZ0 A;  2WKY A;  2KR0 A;  5IGA A;  5KZT A;  4N6K A;  1P1Q A;  2ZNS A;  1D9Y A;  1N0T A;  2M8C A;  5ITO A;  4R6Y A;  3CFL A;  1NV7 A;  5EQ8 A;  3CSB A;  2I4C A;  4MFI A;  4MCO A;  3OOA A;  3L6H A;  1LAX A;  3RNN A;  4GWU A;  4H5F A;  2ZNU A;  4Q8R A;  1ATG A;  1D4N A;  2ONR A;  3KSJ A;  4I1D A;  3JYR A;  2RC7 A;  1VR5 A;  3I6V A;  3DP6 A;  3OXN A;  1RDY A;  3FXB A;  4PFW A;  4G4P A;  4RPO A;  4PET A;  2HXW A;  3UP9 A;  1SQY A;  2UXA A;  2RKM A;  2DDK A;  4H65 A;  3K2D A;  4XKQ A;  1B3E A;  4OA4 A;  2FNC A;  2XWO A;  5H8H A;  3W15 C;  3VLU A;  5DEX B;  3IJX B;  2QVR A;  3CRB A;  3FJM A;  1JW5 A;  1KA0 A;  1AH5 A;  1NNK A;  1FPL A;  4RK9 A;  3RT8 A;  2VT5 A;  1XVY A;  4OET A;  3RY3 A;  2Q2A A;  2ZNT A;  4TLL B;  3PMW A;  1A99 A;  2DSF A;  4MJO A;  3V89 B;  4FAJ A;  1YTV A;  4KCC A;  4YZZ A;  1LLS A;  2PYY A;  1MXX A;  1FTO A;  5CBR A;  2I3W A;  2XXW A;  3S9M C;  3MBP A;  1YAE A;  4LP2 B;  5AA4 A;  1QW0 A;  3H4Z A;  1Y3N A;  3RT6 B;  4XXU A;  2QS2 A;  5CMC A;  2DS9 A;  1FTJ A;  1UTB B;  3TYH A;  1MXV A;  3IB2 A;  4JBZ A;  1DPP A;  2O68 A;  2ZYO A;  2R71 A;  1FW0 A;  2ABH A;  2A5T B;  4H8J A;  1GVC A;  3KOS A;  1G0I A;  4NN3 A;  1MPB A;  3SER A;  1MQI A;  1L5T A;  1NV2 A;  3O29 A;  2AIX A;  2X26 A;  1LBX A;  4ISU A;  4PFI A;  3OO9 A;  2F8D A;  4H1X A;  3EHU A;  3K4U A;  1TWY A;  1Q35 A;  2NWJ A;  4M1V A;  3B8B A;  2ZZX A;  1NH8 A;  1MY4 A;  2Z23 A;  4KD5 A;  1NH7 A;  5FBP A;  1USY H;  1NNT A;  5J1D A;  4EF1 A;  1MQJ A;  4MBP A;  2ONS A;  1MQD A;  1SYI A;  2OJT A;  2YLN A;  1BP5 A;  5IKB A;  1Y4C A;  2QVV A;  3IFA A;  1T0K A;  3KG2 A;  3MQ9 A;  5I59 A;  2HZK A;  4H46 A;  4NF8 B;  4X1B A;  5H8N A;  2GH9 A;  1POT A;  3EPE A;  4NF0 A;  4NF6 A;  1DPE A;  2DWJ A;  4IR8 A;  2XXY A;  1LBB A;  5ISU A;  3MVY A;  3ECR A;  1LBV A;  3QMF A;  1SBP A;  3MP1 A;  5ELV A;  3T22 A;  3TTM A;  4XFE A;  3HST A;  5TP9 A;  2CEY A;  3MUQ A;  2Y5K A;  3IOV A;  4QFL A;  4MIJ A;  4N8G A;  3E79 A;  4H6D A;  3S9L C;  1I6B A;  1FQF A;  4OWD A;  3HHG A;  3CFZ A;  3O28 A;  4NED A;  1Y1Z A;  1TXF A;  2RF1 A;  1FJ9 A;  4O8M A;  4P8B A;  1CNQ A;  1MH3 A;  3RGY A;  5L9S A;  3USD A;  4OHN A;  3U93 A;  4MNP A;  5IZZ A;  2REG A;  1PEB A;  4XKR A;  4YB5 A;  4GWX A;  1LFH A;  1S50 A;  1LAF E;  2NUV A;  2P2A A;  3RPL A;  1P1U A;  4YKK A;  2F6G A;  2BJI A;  1J1N A;  4OEN A;  1SPI A;  4OFL A;  3B6T A;  1M5B A;  1H44 A;  1B51 A;  5L9M A;  1XT8 A;  1WVJ A;  1FBH A;  4YMB A;  1IXH A;  3TTR A;  3S9N C;  2PBW A;  3UGW A;  4PBH A;  3Q27 A;  5DVJ A;  4I8C A;  4MMP A;  3U8Q A;  5B7D A;  3E4R A;  4QFO A;  1EH3 A;  3MJN A;  1MDQ A;  2D5W A;  3DEL B;  4KI0 E;  3MVX A;  3ILU B;  3BFU A;  3FGS A;  2ZMB A;  1B4H A;  1PBQ A;  3I3V A;  1KA1 A;  5AA2 B;  1R6Z A;  1QKA A;  5H8F B;  3G3I A;  2P3N A;  1FCK A;  5F1Q A;  5TPA A;  3C32 A;  4I9D A;  1ANF A;  4GXS B;  4KFQ A;  5J16 A;  1SI1 A;  1BLF A;  2CZK A;  3SET A;  5A5X A;  5DYH A;  1KWH A;  1I69 A;  1LBZ A;  1QJM A;  3HPI A;  2ALU A;  2ZYM A;  3O6I A;  3P7I A;  2CZL A;  3V8X B;  1US5 A;  4OVJ A;  4GWS A;  4NMY A;  2CMO A;  3IFC A;  2V84 A;  3MZB A;  1DBZ A;  3WAF A;  4R75 A;  4EXL A;  3H6T A;  4HE2 A;  1FTL A;  4EQ9 A;  3N5L A;  4JVC A;  3S2V A;  1XOC A;  1IMD A;  3KJ7 A;  1B40 A;  4I40 A;  1DOT A;  4NAP A;  3BKI B;  1MXZ A;  3PUZ E;  3QK6 A;  4G77 A;  2R8T A;  4YAH X;  5BWJ A;  4PFT A;  5HPQ A;  3CR9 A;  3DP4 A;  2PCR A;  2BJJ X;  4KYS A;  4U2R A;  4PE5 B;  3TTL A;  4G8M A;  4RYA A;  3BBR A;  2Y7R A;  4KQP A;  3ZKL A;  4R9F A;  3VXC A;  2VD3 A;  5KCJ A;  2B4M A;  1VDW A;  1Q1K A;  4PE3 A;  5H8Q A;  4F1V A;  4FJP A;  3VVD A;  4QHQ A;  1URG A;  1B7Z A;  4F29 A;  4ZE9 A;  1NV5 A;  1N3X A;  1AMF A;  5CRY A;  3G3G A;  4IGR A;  2ZXT A;  1FPG A;  3TUS A;  4AB6 A;  4PQJ A;  2FA7 A;  2XXR A;  5CMM A;  2B65 A;  1ZMG A;  3OSQ A;  3K6X A;  4G68 A;  4MLQ A;  5K2X A;  1LB9 A;  4RXL A;  4LZ8 A;  1D9V A;  1B52 A;  1A8F A;  4Z7E A;  2DWA A;  2Q8J A;  4Z0I A;  3HFU A;  2DVZ A;  4L17 A;  4RA1 A;  2Z8D A;  2VOZ A;  3BIG A;  4U4S A;  3KC1 A;  3K1P A;  3RQT A;  3LV0 A;  1B1X A;  1MXU A;  1SW1 A;  2F7A A;  3O6H A;  3TQL A;  3LUY A;  2O84 X;  2R9J A;  3KBZ A;  3IAZ A;  4N81 A;  1AWB A;  1LB8 A;  1MQH A;  3LC8 A;  5H8H B;  3IOR A;  4PTK A;  4DCX A;  3TCF A;  3QIM A;  1OVB A;  5CM6 A;  2WX9 A;  1EYK A;  2PFY A;  4JVD A;  1TFD A;  5ICT A;  4MNC A;  4GWO A;  2I6E A;  2DE2 A;  3O97 A;  3FVN A;  4ELO A;  2FYI A;  1FQE A;  1MXY A;  2ZYK A;  1UIU A;  4GX6 A;  4ZDM A;  5FHO A;  3ZS6 A;  1SD3 A;  1LST A;  2QMX A;  2D3I A;  4POX A;  2GQ1 A;  3EN3 A;  1M5D A;  3GLB A;  1LAH E;  1IIW A;  1POY 1;  4LAT A;  4F3P A;  3LBS A;  2F3B A;  2O7U A;  1EZ9 A;  5AA1 A;  2AL5 A;  4P9K A;  2XXV A;  5AA4 B;  1PB9 A;  1M5F A;  4EUO A;  1YYZ A;  5LOM A;  4OFJ A;  4ELQ A;  2Z22 A;  3PV0 E;  3FAS A;  3FBP A;  2B3B A;  4N17 A;  1JET A;  3SDF A;  5CMK A;  4BDN A;  3TMG A;  2XD3 A;  2PT2 A;  3IR1 A;  4XKN A;  5IM2 A;  1B7H A;  2QRY A;  2O1L A;  2GRV A;  4OVR A;  3GBB A;  1Z7M E;  2DWI A;  3T96 B;  3VLW A;  3RPW A;  3TTN A;  1FTM A;  1NUW A;  2XXQ A;  4F1U A;  1FJ6 A;  3KJT A;  4G8N A;  5IZ1 A;  5CBS A;  3C9H A;  1MS7 A;  2HQ0 A;  3ZKK A;  5ET8 A;  3IJO B;  4E0W A;  2ESN A;  3T9X B;  3PUY E;  3QUF A;  1H76 A;  1LCF A;  4ZEK A;  3S9E A;  3VDF A;  4KYD A;  1QKB A;  2XXU A;  1JEV A;  4PGP A;  1ELJ A;  2O6A A;  3EHS A;  4PFB A;  4DI4 B;  2XXH A;  2D21 A;  4X1D A;  3SES A;  5L9O A;  5DVI A;  3KFM A;  5I59 B;  4OZ9 A;  5H8N B;  5I58 A;  1MRP A;  4PF8 A;  5HM4 B;  1EYJ A;  4MEV A;  4NF6 B;  4TLM B;  3PTY A;  4JB7 A;  5IAI A;  1Y1M A;  1SW2 A;  5ET7 A;  1NV3 A;  3VVE A;  3PPP A;  4GXA A;  3TTK A;  1FBF A;  1FBP A;  4XTC Q;  3TKD A;  3ZSF A;  3CHG A;  3TQW A;  3H7M A;  3FAT A;  1QGX A;  4DCY A;  1MPD A;  5TP9 B;  4QFP A;  3D1R A;  1AIV A;  3OEK A;  3CIJ A;  1JNF A;  2OX3 A;  4HCW A;  1N3W A;  3LUZ A;  1HSE A;  3KGC A;  1IIT A;  4ZEC A;  4OXV A;  4BDR A;  1OLA A;  1LBW A;  1D3K A;  3WAE A;  1B58 A;  1S7Y A;  3R26 A;  4I3E A;  1A7L A;  1MY3 A;  3GBA A;  4OQO A;  1XS5 A;  1AL3 A;  1K9Z A;  4OAN A;  4JWX A;  2WYP A;  3L6G A;  4XEQ A;  1FTA A;  1Y20 A;  2X7Q A;  2IEE A;  1P1W A;  3O2A A;  3IOU A;  5EHS A;  1QUI A;  4F19 A;  3UOR A;  5K2Y A;  2XXK A;  4GBW A;  3OEL A;  4IGT A;  3HHF A;  3FV2 A;  4KPT A;  1VSO A;  2QS1 A;  4FED A;  4QXD A;  4PCD A;  5JK4 A;  4F31 B;  4MX6 A;  2XXI A;  1Q9D A;  4GWY A;  3N6T A;  1B2H A;  1ZU0 A;  4GF8 A;  3OO6 A;  5AA2 D;  5DVF A;  3C34 A;  1RDZ A;  3MC2 A;  3V83 A;  5JTY A;  2Y7W A;  3PUV E;  4OFO A;  4P3L A;  1B32 A;  4ESW A;  3O66 A;  2OWS A;  1QVS A;  2F7B A;  4IO4 A;  1USY E;  2DWH A;  4UA8 A;  3QUJ A;  3UIF A;  2VPN A;  4N15 A;  4WED A;  3HV1 A;  5EHM A;  4JSO A;  5AA3 A;  2XD2 A;  3FVO A;  4F39 A;  4WKM A;  3H6W A;  1MG1 A;  5FHN A;  5TPA B;  3SEU A;  1MDP 1;  4LZ5 A;  4N4U A;  1FBE A;  5EQ7 A;  4IO3 A;  5A5X B;  4ZZA A;  2CZI A;  3V5A A;  2I0C A;  5EYG A;  3TEL A;  1NL5 A;  4ZEB A;  4ONY A;  2G29 A;  1IME A;  2PT1 A;  4JWO A;  4EXK A;  4O7M A;  4X9T A;  2DP8 A;  3AXF A;  3VXB A;  2PMS A;  1GGG A;  4YB6 A;  1US4 A;  3QXM A;  4KCD A;  4DI3 D;  4LN5 A;  1OIB A;  2NOO A;  1QUL A;  2GHB A;  2QPQ A;  2R6G E;  2F78 A;  2P1S A;  1MPC A;  4NG7 A;  5ESY A;  3T1B A;  4GL8 A;  1TT1 A;  4PC9 A;  1N04 A;  4OYV A;  1B0H A;  3E13 X;  1NV4 A;  4BDM A;  4KYE A;  2I0B A;  4YKJ A;  3T9H B;  4IO2 A;  5KCJ B;  4GVO A;  2XWK A;  4C0R A;  4KR5 A;  1NV0 A;  1DTZ A;  5H8Q B;  2V3Q A;  2Y5L A;  1DK4 A;  4LQ5 A;  2XX8 A;  4PP0 A;  4ELR A;  4GLI A;  4AQ4 A;  3LSX A;  2FIX A;  1SW5 A;  1B3G A;  3PUW E;  4PDD A;  4OES A;  5IZ3 A;  3VLV A;  4GBV A;  4Q0C A;  4G68 B;  1OQG A;  4GX3 A;  3MPK A;  2E1S A;  3T93 B;  4DE8 A;  3GXA A;  1R9Q A;  3CG1 A;  2XX9 A;  3SEW A;  1JP4 A;  1RDX A;  1SW4 A;  4PDH A;  2IA4 A;  3MP8 A;  1Z7N E;  3FJG A;  3DLN A;  3QSL A;  3U92 A;  3PGF A;  3KN8 A;  3O6G A;  3Q25 A;  3DP8 A;  3H6V A;  4POW A;  3TCH A;  2YPN A;  1MY1 A;  3ILT B;  4YMA A;  2F97 A;  5T3J A;  1GV8 A;  4JXI A;  3MPL A;  3ROJ A;  4HE1 A;  3W9W A;  4EQB A;  3N26 A;  4IO6 A;  2F6P A;  2OCU A;  4NTL A;  1B05 A;  1GTK A;  1I6Q A;  3IO4 A;  4DZ1 A;  2QL3 A;  4X04 A;  1CB6 A;  1P1O A;  3TCG A;  5EYF A;  2Z8F A;  5H8S A;  3I5O A;  4NF4 B;  4YB7 A;  1LAG E;  3A09 A;  4R74 A;  4P56 A;  3PUX E;  5KDT A;  1SDX A;  4JSD A;  1URS A;  1RKM A;  3C33 A;  1KZ8 A;  1IQ7 A;  1MM6 A;  4C1U A;  3UN6 A;  1FPK A;  5CI5 A;  2YJP A;  4KXP A;  3DM0 A;  4THI A;  3RYD A;  3E3K A;  2UVH A;  4N6D A;  4N91 A;  1QUK A;  3H3G A;  4QSC A;  3TFL A;  2RC8 A;  4X48 A;  1SI0 A;  3B6W A;  3D4G A;  3SEV A;  3MVW A;  1NKX A;  4FEB A;  4P11 A;  4R6K A;  4G68 C;  2RCA A;  1IMC A;  1FTK A;  3OD7 A;  3K1M A;  3A29 A;  3KZG A;  1BK4 A;  2PVU A;  5I2N A;  1MXW A;  5ET5 A;  1GR2 A;  3F11 A;  4EQ7 A;  3KSX A;  4GRK A;  1NNP A;  2DXY A;  3G3H A;  3QYT A;  4NE4 A;  2O51 A;  5EQA A;  4ND9 A;  3C36 A;  2I58 A;  4FBP A;  4DXC A;  3CG3 A;  4IY5 A;  1JW4 A;  1H45 A;  1ZTY A;  3N6U A;  1B5J A;  2I3V A;  2XA5 A;  3VVF A;  1NUY A;  1WOD A;  3OMB A;  5I58 B;  2NVU B;  2XXT A;  2OK2 A;  1FPI A;  3B6Q A;  4NWC A;  3TOD A;  3LSF B;  2A5S A;  4G61 A;  2QSX A;  3ONM A;  3PD9 A;  1II5 A;  2UVG A;  3U65 A;  2H4I A;  1JVY A;  2REJ A;  4GD5 A;  1LGB C;  3PMV A;  3RTW B;  5CC2 A;  2WBB A;  2DXR A;  5EYH A;  2V4C A;  4ZS9 A;  3FIR A;  1R1N A;  2DVC A;  4UAC A;  1DMB A;  1FPF A;  3B7D A;  2HZL A;  3FXR A;  1IXG A;  3FVK A;  4BDL A;  2V25 A;  1ZBM A;  1R9L A;  2QFL A;  1DCU A;  4XIG Q;  2KQZ A;  1JEU A;  4HW8 A;  2HXR A;  3IOT A;  1VFE A;  4PF6 A;  3CI8 A;  3RTF B;  3M3K A;  4E0X A;  5F24 A;  3LSL A;  4N6P A;  5L8D A;  4MHF A;  1LBY A;  1PC3 A;  1TFA A;  4MNI A;  5I56 A;  2Q9T A;  2QJE A;  2ZYN A;  1LEV A;  2H25 A;  2ZZV A;  3R7X A;  1FQA A;  3C4M A;  5B70 A;  4OVS A;  2Q89 A;  5CMB A;  2HCA A;  1DSN A;  2H99 A;  1JVX A;  1VE4 A;  4NF5 A;  4N07 A;  2VP1 A;  4HCY A;  4DLD A;  1O64 A;  3MST A;  4RNS A;  3Q28 A;  1LBC A;  3IOW A;  3K6V A;  3PMX A;  4P47 A;  3JV9 A;  2O7I A;  4OVP A;  5M2V A;  4R2F A;  1UTH A;  1M5C A;  1XI6 A;  1LFG A;  3M3L A;  3RN8 A;  1B5I A;  5FTI A;  2GHA A;  1BIY A;  1NNF A;  5LDZ A;  3TZA A;  2O69 A;  5JTY B;  4GWZ A;  3K6U A;  1M5E A;  2FHY A;  1B3L A;  1UIV A;  3EKI A;  4PBQ A;  3SZP A;  4RK2 A;  3FXQ A;  3MVZ A;  4MH5 A;  4O94 A;  4XF5 A;  3LR1 A;  4TQU Q;  2XXX A;  4G8H A;  1IXC A;  3ODB A;  2P3V A;  2FVZ A;  1CE2 A;  1OLC A;  5FHM A;  3FVG A;  1FPD A;  2Q2C A;  4F1Y A;  3T9U A;  2V3T A;  1A40 A;  4GIZ A;  2F36 A;  3Q29 A;  5ICQ A;  1YCJ A;  3U94 A;  4GFR A;  3MZ9 A;  5I3S A;  1FBD A;  4H67 A;  3VFJ A;  1Y9U A;  4GX4 A;  1D9Q A;  2Z8E A;  4FAT A;  2OLB A;  1OMP A;  5I57 A;  3T9V A;  1N7X A;  5I2K A;  3BIH A;  3G3F A;  5I5P A;  4R2B A;  3C35 A;  3MAM A;  4LON B;  2LAO A;  4QBA A;  2UVI A;  2WEF A;  5A5L A;  1MM7 A;  2P0S A;  3B50 A;  4UAB A;  4FEC A;  3K0V A;  3FJ7 A;  2XXP A;  3OSR A;  3MWB A;  4LQ2 A;  1JW1 A;  3VE1 B;  3OO7 A;  4IO7 A;  2AYS A;  1QUJ A;  4AS4 A;  2NXO A;  3MYU A;  2OBG A;  1B9J A;  2XX7 A;  1EU8 A;  2VPO A;  1EYI A;  3NOH A;  4G2Z A;  4IO5 A;  1B1H A;  3RPL B;  3SEY A;  4P1L A;  1S9T A;  3IL1 B;  5IZ3 B;  1FBG A;  3H03 A;  3MW0 A;  4YIC A;  3EF7 A;  3CSG A;  1BTJ A;  4OTE A;  1YPN A;  3H6U A;  3PPQ A;  4TOZ A;  1XVX A;  1NI9 A;  2MKZ A;  1PBP A;  3K00 A;  5DW8 A;  2RIN A;  2VD2 A;  4LVQ A;  3TDJ A;  4F3B A;  2F7C A;  4EF2 A;  5DT6 A;  1NUZ A;  4F3S A;  4U4X A;  2AL4 A;  3N94 A;  2PFZ A;  4PAK A;  1B3F A;  4ZEI A;  4P0G A;  5JEI A;  2G93 A;  2Q8M A;  2HAU A;  4QRZ A;  1JQF A;  5LTC A;  1EZO A;  4PGN A;  3K6W A;  4K3F A;  4GOT A;  1SYH A;  3R6U A;  4QF9 A;  2DE4 A;  4H8I A;  4AS5 A;  3UA8 A;  1FBC A;  2V93 A;  3FV1 A;  1RYX A;  1ZKB A;  2HPG A;  4HS7 A;  1IMA A;  1N84 A;  1IUD A;  4LZ7 A;  3KBR A;  1Y3P A;  1MQG A;  4Q5T A;  4F2O A;  2VGQ A;  4IB2 A;  4F2Q A;  4OEV A;  5KDT B;  4H0W A;  1IZ1 A;  5DEX A;  4NWD A;  4IY6 A;  2THI A;  2VHA A;  2F5X A;  3EQ1 A;  4DIG A;  3FZV A;  2RC9 A;  4EDP A;  1B3H A;  4H5G A;  5ITP A;  3O9P A;  1FQB A;  2JJK A;  1WDN A;  1B6H A;  2CEX A;  3PU5 A;  2WYK A;  3IB1 A;  3RUM A;  4F18 A;  1IXI A;  2UYE A;  4U22 A;  2KLF A;  4P1E A;  1H3D A;  2F34 A;  3SEX A;  1HSJ A;  4OVQ A;  4O7I A;  3G3K A;  3IX1 A;  5I2N B;  4I3Y A;  1Y4T A;  4O3A A;  1G0H A;  2GFE A;  3CVG A;  4RY1 A;  4O3C A;  4MLV A;  1B46 A;  3THI A;  4YKP A;  3U1O A;  1FPB A;  3A3U A;  1O63 A;  4BLA A;  1N76 A;  2H98 A;  4GWW A;  3S4U A;  4JVI A;  4U21 A;  1UTB A;  2Q74 A;  1MH4 A;  3KEI A;  2HHM A;  4MF3 A;  2L5V A;  5I84 A;  2QS3 A;  2UVJ A;  4PFR A;  1F9B A;  1FQD A;  2A5T A;  1OQH A;  1XC1 A;  4BDO A;  3IO6 A;  3M8U A;  4R72 A;  4ZE8 A;  2DOJ A;  3HO7 A;  3PPR A;  4XKP A;  2Y7P A;  2PX1 A;  4R9G A;  1N7W A;  4C1T A;  3OEM A;  4KHZ E;  1FPE A;  1EZP A;  1YXI A;  2QMW A;  2Y84 A; 
#chains in the Genus database with same CATH homology
 1RYO A;  3VV5 A;  3SKP A;  1B5H A;  2XHD A;  4QFK A;  3RLF E;  1OVT A;  2E0S A;  2HAV A;  2I4B A;  4NF8 A;  4N13 A;  1AOV A;  1LFI A;  1P1N A;  3PPN A;  3K01 A;  2F35 A;  2QS4 A;  1B0L A;  4OER A;  4U1Z A;  4QSE A;  2DQV A;  3KN7 A;  1A8E A;  1B7U A;  4GQO A;  3GZG A;  5BUU A;  4BDQ A;  3M3F A;  1DTG A;  2ANJ A;  2UYF A;  3A3C A;  2W7Y A;  4U1O A;  5HBC A;  4R6H A;  5F7V A;  5I56 B;  1BKA A;  5TU0 A;  2V3U A;  4P0I A;  3Q26 A;  5FTH A;  2Y7K A;  4LA9 A;  2Q88 A;  3KN3 A;  4I62 A;  3EHT A;  3OEN A;  2B3F A;  1ZLQ A;  4NF5 B;  2OZZ A;  3T66 A;  3G7W A;  4M4G A;  2Y7I A;  3BFT A;  4F22 A;  1URD A;  4DXB A;  3OO8 A;  4R73 A;  4ZEF A;  3K02 A;  4QSD A;  3H06 B;  1UTH B;  3CFX A;  4HTG A;  1LCT A;  3PPO A;  2HFB A;  2X7P A;  1MY2 A;  2HEU A;  3U72 A;  4ELP A;  1NFT A;  3LSW A;  1IEJ A;  3TAJ A;  3FUZ A;  4ECF A;  1ZIU A;  4JDF A;  2OWT A;  3K1N A;  4FE8 A;  4DXU A;  3E9X A;  3D4C A;  3FD3 A;  3TPA A;  1MY0 A;  2DYX A;  3HN0 A;  4ESX A;  1FQC A;  4OEU A;  3G3J A;  1HSL A;  3PD8 A;  2ONK E;  4F3G A;  3C31 A;  1PB8 A;  2I49 A;  1A55 A;  1PB7 A;  1O7T A;  1NMU A;  1I6A A;  4PFU A;  3TEP A;  3JZJ A;  5I57 B;  1SVX B;  5I2K B;  4GL0 A;  3FXU A;  1Y3Q A;  4Q30 B;  5AA2 A;  5H8F A;  1ZJL A;  3MP6 A;  4LUB A;  1P99 A;  1VFD A;  4FIM A;  1B4Z A;  4ZZE A;  3IB0 A;  3QAX A;  4JWY A;  4YKI A;  4PFY A;  4RPN A;  3MZ1 A;  5DTB A;  3KOT A;  4FOR A;  4U23 A;  4WEP A;  2DE3 A;  3W9V A;  1A54 A;  1XHY A;  5AE4 A;  4NF4 A;  4OMB A;  3IK6 B;  4QFN A;  4AB5 A;  2I48 A;  4DDD A;  4WXJ A;  3HCQ A;  2O1M A;  3UK4 A;  2H5Y A;  4ZED A;  2H9B A;  4YU0 A;  1PDA A;  2RCB A;  4O3B A;  1H43 A;  4RJZ A;  1UQW A;  2WKY A;  5KZT A;  1P1Q A;  2ZNS A;  1D9Y A;  1N0T A;  2M8C A;  5ITO A;  4R6Y A;  3CFL A;  3CSB A;  2I4C A;  4MFI A;  3OOA A;  3L6H A;  1LAX A;  3RNN A;  4H5F A;  2ZNU A;  4Q8R A;  1ATG A;  1D4N A;  2ONR A;  3KSJ A;  4I1D A;  3JYR A;  2RC7 A;  1VR5 A;  3I6V A;  3DP6 A;  3OXN A;  4PFW A;  4G4P A;  4RPO A;  4PET A;  2HXW A;  3UP9 A;  1SQY A;  2UXA A;  2RKM A;  4H65 A;  3K2D A;  4XKQ A;  1B3E A;  2FNC A;  5H8H A;  3W15 C;  3VLU A;  5DEX B;  3IJX B;  3CRB A;  3FJM A;  1JW5 A;  1AH5 A;  1NNK A;  4RK9 A;  3RT8 A;  1XVY A;  4OET A;  3RY3 A;  2Q2A A;  2ZNT A;  4TLL B;  3PMW A;  1A99 A;  2DSF A;  3V89 B;  4FAJ A;  1YTV A;  4KCC A;  4YZZ A;  1LLS A;  2PYY A;  1MXX A;  1FTO A;  5CBR A;  2I3W A;  2XXW A;  3S9M C;  3MBP A;  1YAE A;  4LP2 B;  5AA4 A;  1QW0 A;  3H4Z A;  1Y3N A;  3RT6 B;  4XXU A;  2QS2 A;  5CMC A;  2DS9 A;  1FTJ A;  1UTB B;  3TYH A;  1MXV A;  3IB2 A;  4JBZ A;  1DPP A;  2O68 A;  2ZYO A;  2R71 A;  1FW0 A;  2ABH A;  2A5T B;  4H8J A;  1GVC A;  3KOS A;  1MPB A;  3SER A;  1MQI A;  1L5T A;  3O29 A;  2AIX A;  2X26 A;  4ISU A;  3OO9 A;  2F8D A;  4H1X A;  3EHU A;  3K4U A;  1TWY A;  1Q35 A;  2NWJ A;  4M1V A;  1NH8 A;  1MY4 A;  2Z23 A;  4KD5 A;  1NH7 A;  1USY H;  1NNT A;  5J1D A;  4EF1 A;  1MQJ A;  4MBP A;  2ONS A;  1MQD A;  1SYI A;  2OJT A;  2YLN A;  1BP5 A;  5IKB A;  1Y4C A;  1T0K A;  3KG2 A;  3MQ9 A;  5I59 A;  2HZK A;  4NF8 B;  4X1B A;  5H8N A;  2GH9 A;  1POT A;  3EPE A;  4NF6 A;  1DPE A;  2DWJ A;  2XXY A;  1LBB A;  5ISU A;  3MVY A;  3ECR A;  1SBP A;  3MP1 A;  5ELV A;  3T22 A;  3TTM A;  3HST A;  5TP9 A;  3MUQ A;  3IOV A;  4QFL A;  4H6D A;  3S9L C;  1I6B A;  1FQF A;  4OWD A;  3HHG A;  3CFZ A;  3O28 A;  4NED A;  1Y1Z A;  1TXF A;  2RF1 A;  1MH3 A;  3RGY A;  5L9S A;  3USD A;  4OHN A;  3U93 A;  2REG A;  1PEB A;  4XKR A;  4YB5 A;  1LFH A;  1S50 A;  1LAF E;  2NUV A;  2P2A A;  1P1U A;  4YKK A;  2F6G A;  1J1N A;  4OEN A;  3B6T A;  4OFL A;  1M5B A;  1H44 A;  1B51 A;  5L9M A;  1XT8 A;  1WVJ A;  4YMB A;  1IXH A;  3TTR A;  3S9N C;  2PBW A;  3UGW A;  3Q27 A;  5DVJ A;  4I8C A;  3U8Q A;  5B7D A;  3E4R A;  4QFO A;  1EH3 A;  3MJN A;  1MDQ A;  2D5W A;  3DEL B;  4KI0 E;  3MVX A;  3ILU B;  3BFU A;  3FGS A;  2ZMB A;  1B4H A;  1PBQ A;  3I3V A;  5AA2 B;  1R6Z A;  1QKA A;  5H8F B;  3G3I A;  1FCK A;  5F1Q A;  5TPA A;  3C32 A;  4I9D A;  1ANF A;  4GXS B;  4KFQ A;  1SI1 A;  1BLF A;  3SET A;  5A5X A;  5DYH A;  1KWH A;  1I69 A;  1QJM A;  3HPI A;  2ALU A;  2ZYM A;  3O6I A;  3P7I A;  2CZL A;  3V8X B;  1US5 A;  4OVJ A;  4NMY A;  2CMO A;  2V84 A;  3MZB A;  3WAF A;  4R75 A;  4EXL A;  3H6T A;  1FTL A;  4EQ9 A;  3N5L A;  3S2V A;  1XOC A;  3KJ7 A;  1B40 A;  1DOT A;  3BKI B;  1MXZ A;  3PUZ E;  3QK6 A;  4G77 A;  4YAH X;  5BWJ A;  4PFT A;  5HPQ A;  3CR9 A;  3DP4 A;  2BJJ X;  4KYS A;  4U2R A;  4PE5 B;  3TTL A;  4G8M A;  4RYA A;  3BBR A;  2Y7R A;  4KQP A;  3ZKL A;  4R9F A;  3VXC A;  2VD3 A;  5KCJ A;  1Q1K A;  5H8Q A;  4F1V A;  4FJP A;  3VVD A;  4QHQ A;  1URG A;  1B7Z A;  4F29 A;  4ZE9 A;  1N3X A;  1AMF A;  5CRY A;  3G3G A;  4IGR A;  2ZXT A;  3TUS A;  4AB6 A;  4PQJ A;  2FA7 A;  2XXR A;  5CMM A;  2B65 A;  1ZMG A;  3OSQ A;  3K6X A;  4G68 A;  4MLQ A;  5K2X A;  1LB9 A;  4RXL A;  4LZ8 A;  1D9V A;  1B52 A;  4Z7E A;  1A8F A;  2DWA A;  2Q8J A;  4Z0I A;  2DVZ A;  4L17 A;  2Z8D A;  4RA1 A;  2VOZ A;  4U4S A;  3K1P A;  3RQT A;  1B1X A;  1MXU A;  1SW1 A;  2F7A A;  3O6H A;  3TQL A;  3LUY A;  2O84 X;  2R9J A;  3IAZ A;  1LB8 A;  1MQH A;  3LC8 A;  5H8H B;  3IOR A;  4DCX A;  3TCF A;  3QIM A;  1OVB A;  5CM6 A;  1TFD A;  5ICT A;  4GWO A;  2I6E A;  2DE2 A;  3O97 A;  3FVN A;  4ELO A;  2FYI A;  1FQE A;  1MXY A;  2ZYK A;  1UIU A;  4ZDM A;  5FHO A;  3ZS6 A;  1SD3 A;  1LST A;  2QMX A;  2D3I A;  4POX A;  3EN3 A;  1M5D A;  3GLB A;  1LAH E;  1IIW A;  1POY 1;  4LAT A;  4F3P A;  3LBS A;  2O7U A;  5AA1 A;  1EZ9 A;  2AL5 A;  2XXV A;  5AA4 B;  1PB9 A;  1M5F A;  4EUO A;  5LOM A;  4OFJ A;  4ELQ A;  2Z22 A;  3PV0 E;  3FAS A;  2B3B A;  1JET A;  3SDF A;  5CMK A;  4BDN A;  3TMG A;  2XD3 A;  2PT2 A;  3IR1 A;  4XKN A;  1B7H A;  2QRY A;  2O1L A;  2GRV A;  3GBB A;  1Z7M E;  2DWI A;  3T96 B;  3VLW A;  3RPW A;  3TTN A;  1FTM A;  2XXQ A;  4F1U A;  3KJT A;  4G8N A;  5CBS A;  3C9H A;  1MS7 A;  2HQ0 A;  3ZKK A;  3IJO B;  4E0W A;  2ESN A;  3T9X B;  3PUY E;  3QUF A;  1H76 A;  1LCF A;  4ZEK A;  3S9E A;  3VDF A;  4KYD A;  1QKB A;  2XXU A;  1JEV A;  1ELJ A;  2O6A A;  3EHS A;  2XXH A;  2D21 A;  4X1D A;  3SES A;  5L9O A;  5DVI A;  3KFM A;  5I59 B;  4OZ9 A;  5H8N B;  5I58 A;  1MRP A;  5HM4 B;  4NF6 B;  4TLM B;  4JB7 A;  5IAI A;  1Y1M A;  1SW2 A;  3VVE A;  3PPP A;  4GXA A;  3TTK A;  4XTC Q;  3TKD A;  3ZSF A;  3TQW A;  3H7M A;  3FAT A;  4DCY A;  1MPD A;  5TP9 B;  4QFP A;  1AIV A;  3OEK A;  3CIJ A;  1JNF A;  4HCW A;  1N3W A;  1HSE A;  3KGC A;  1IIT A;  4ZEC A;  4OXV A;  4BDR A;  1OLA A;  1D3K A;  3WAE A;  1B58 A;  1S7Y A;  3R26 A;  4OQO A;  1A7L A;  1MY3 A;  3GBA A;  1XS5 A;  1AL3 A;  4JWX A;  3L6G A;  1Y20 A;  2X7Q A;  2IEE A;  1P1W A;  3O2A A;  3IOU A;  5EHS A;  1QUI A;  4F19 A;  3UOR A;  5K2Y A;  3OEL A;  4IGT A;  3HHF A;  3FV2 A;  4KPT A;  1VSO A;  2QS1 A;  4FED A;  5JK4 A;  4F31 B;  2XXI A;  3N6T A;  1B2H A;  1ZU0 A;  4GF8 A;  3OO6 A;  5AA2 D;  5DVF A;  3C34 A;  3MC2 A;  3V83 A;  5JTY A;  2Y7W A;  3PUV E;  4OFO A;  4ESW A;  1B32 A;  3O66 A;  2OWS A;  1QVS A;  2F7B A;  4IO4 A;  1USY E;  2DWH A;  4UA8 A;  3QUJ A;  3UIF A;  4WED A;  3HV1 A;  5EHM A;  4JSO A;  5AA3 A;  2XD2 A;  3FVO A;  4F39 A;  4WKM A;  3H6W A;  1MG1 A;  5FHN A;  5TPA B;  3SEU A;  1MDP 1;  4LZ5 A;  4IO3 A;  5A5X B;  4ZZA A;  3V5A A;  2I0C A;  3TEL A;  1NL5 A;  4ZEB A;  4ONY A;  2G29 A;  2PT1 A;  4JWO A;  4EXK A;  4X9T A;  2DP8 A;  3AXF A;  3VXB A;  2PMS A;  1GGG A;  4YB6 A;  1US4 A;  3QXM A;  4KCD A;  1OIB A;  2NOO A;  1QUL A;  2GHB A;  2QPQ A;  2R6G E;  2F78 A;  2P1S A;  1MPC A;  4GL8 A;  1TT1 A;  1N04 A;  4OYV A;  1B0H A;  3E13 X;  4BDM A;  4KYE A;  2I0B A;  4YKJ A;  3T9H B;  4IO2 A;  5KCJ B;  4GVO A;  4C0R A;  4KR5 A;  1DTZ A;  5H8Q B;  2V3Q A;  4LQ5 A;  2XX8 A;  4PP0 A;  4ELR A;  4GLI A;  4AQ4 A;  3LSX A;  1SW5 A;  1B3G A;  3PUW E;  4OES A;  3VLV A;  4Q0C A;  4G68 B;  1OQG A;  3MPK A;  2E1S A;  3T93 B;  4DE8 A;  3GXA A;  1R9Q A;  3CG1 A;  2XX9 A;  3SEW A;  1SW4 A;  2IA4 A;  3MP8 A;  1Z7N E;  3FJG A;  3DLN A;  3QSL A;  3U92 A;  3PGF A;  3KN8 A;  3O6G A;  3Q25 A;  3DP8 A;  3H6V A;  4POW A;  3TCH A;  2YPN A;  1MY1 A;  3ILT B;  4YMA A;  2F97 A;  1GV8 A;  4JXI A;  3MPL A;  3W9W A;  4EQB A;  3N26 A;  4IO6 A;  2F6P A;  2OCU A;  4NTL A;  1B05 A;  1GTK A;  1I6Q A;  3IO4 A;  4DZ1 A;  2QL3 A;  1CB6 A;  1P1O A;  3TCG A;  5EYF A;  2Z8F A;  5H8S A;  3I5O A;  4NF4 B;  4YB7 A;  1LAG E;  3A09 A;  4R74 A;  3PUX E;  5KDT A;  1SDX A;  4JSD A;  1URS A;  1RKM A;  3C33 A;  1IQ7 A;  1MM6 A;  4C1U A;  3UN6 A;  5CI5 A;  2YJP A;  3DM0 A;  4THI A;  3E3K A;  2UVH A;  1QUK A;  3H3G A;  4QSC A;  3TFL A;  2RC8 A;  4X48 A;  1SI0 A;  3B6W A;  3D4G A;  3SEV A;  3MVW A;  1NKX A;  4FEB A;  4P11 A;  4R6K A;  4G68 C;  2RCA A;  1FTK A;  3OD7 A;  3K1M A;  3KZG A;  2PVU A;  5I2N A;  1MXW A;  1GR2 A;  3F11 A;  4EQ7 A;  3KSX A;  4GRK A;  1NNP A;  2DXY A;  3G3H A;  3QYT A;  2O51 A;  4NE4 A;  4ND9 A;  3C36 A;  2I58 A;  4DXC A;  3CG3 A;  4IY5 A;  1JW4 A;  1H45 A;  1ZTY A;  3N6U A;  1B5J A;  2I3V A;  3VVF A;  1WOD A;  3OMB A;  5I58 B;  2NVU B;  2XXT A;  2OK2 A;  3B6Q A;  4NWC A;  3TOD A;  3LSF B;  2A5S A;  2QSX A;  3ONM A;  3PD9 A;  1II5 A;  2UVG A;  2H4I A;  1JVY A;  2REJ A;  4GD5 A;  1LGB C;  3PMV A;  3RTW B;  5CC2 A;  2DXR A;  4ZS9 A;  3FIR A;  1R1N A;  2DVC A;  4UAC A;  1DMB A;  3B7D A;  3FXR A;  2HZL A;  1IXG A;  3FVK A;  4BDL A;  2V25 A;  1ZBM A;  1R9L A;  4XIG Q;  1JEU A;  4HW8 A;  3IOT A;  1VFE A;  3CI8 A;  3RTF B;  3M3K A;  4E0X A;  3LSL A;  4N6P A;  5L8D A;  1PC3 A;  1TFA A;  5I56 A;  2Q9T A;  2QJE A;  2ZYN A;  2H25 A;  3R7X A;  1FQA A;  3C4M A;  5B70 A;  2Q89 A;  5CMB A;  2HCA A;  1DSN A;  2H99 A;  1JVX A;  1VE4 A;  4NF5 A;  4N07 A;  2VP1 A;  4HCY A;  4DLD A;  1O64 A;  4RNS A;  3Q28 A;  1LBC A;  3IOW A;  3K6V A;  3PMX A;  3JV9 A;  2O7I A;  5M2V A;  4R2F A;  1UTH A;  1M5C A;  1LFG A;  3M3L A;  3RN8 A;  1B5I A;  5FTI A;  2GHA A;  1BIY A;  1NNF A;  3TZA A;  2O69 A;  5JTY B;  3K6U A;  1M5E A;  1B3L A;  1UIV A;  4RK2 A;  3FXQ A;  3MVZ A;  4MH5 A;  3LR1 A;  4TQU Q;  2XXX A;  4G8H A;  1IXC A;  3ODB A;  1CE2 A;  1OLC A;  5FHM A;  3FVG A;  2Q2C A;  4F1Y A;  3T9U A;  2V3T A;  1A40 A;  4GIZ A;  2F36 A;  3Q29 A;  5ICQ A;  1YCJ A;  3U94 A;  4GFR A;  3MZ9 A;  4H67 A;  3VFJ A;  1Y9U A;  2Z8E A;  4FAT A;  2OLB A;  1OMP A;  5I57 A;  3T9V A;  1N7X A;  5I2K A;  3G3F A;  4R2B A;  3C35 A;  3MAM A;  4LON B;  2LAO A;  2UVI A;  1MM7 A;  2P0S A;  4FEC A;  3K0V A;  3FJ7 A;  2XXP A;  3OSR A;  3MWB A;  4LQ2 A;  1JW1 A;  3VE1 B;  3OO7 A;  4IO7 A;  2AYS A;  1QUJ A;  2NXO A;  2OBG A;  1B9J A;  2XX7 A;  1EU8 A;  4G2Z A;  4IO5 A;  1B1H A;  3SEY A;  1S9T A;  3IL1 B;  3H03 A;  3MW0 A;  4YIC A;  3EF7 A;  3CSG A;  1BTJ A;  4OTE A;  1YPN A;  3H6U A;  3PPQ A;  4TOZ A;  1XVX A;  1PBP A;  3K00 A;  2RIN A;  2VD2 A;  4LVQ A;  3TDJ A;  4F3B A;  2F7C A;  4EF2 A;  5DT6 A;  4F3S A;  4U4X A;  2AL4 A;  3N94 A;  1B3F A;  4ZEI A;  4P0G A;  5JEI A;  2G93 A;  2HAU A;  4QRZ A;  1JQF A;  1EZO A;  3K6W A;  4K3F A;  4GOT A;  1SYH A;  3R6U A;  4QF9 A;  2DE4 A;  4H8I A;  3UA8 A;  2V93 A;  3FV1 A;  1RYX A;  1ZKB A;  4HS7 A;  1N84 A;  1IUD A;  4LZ7 A;  3KBR A;  1Y3P A;  1MQG A;  4Q5T A;  4F2O A;  2VGQ A;  4IB2 A;  4F2Q A;  4OEV A;  5KDT B;  4H0W A;  1IZ1 A;  5DEX A;  4NWD A;  4IY6 A;  2THI A;  2VHA A;  2F5X A;  3EQ1 A;  4DIG A;  3FZV A;  2RC9 A;  4EDP A;  1B3H A;  4H5G A;  5ITP A;  3O9P A;  1FQB A;  1WDN A;  1B6H A;  3PU5 A;  3IB1 A;  3RUM A;  4F18 A;  1IXI A;  2UYE A;  4U22 A;  2KLF A;  1H3D A;  2F34 A;  3SEX A;  1HSJ A;  3G3K A;  3IX1 A;  5I2N B;  1Y4T A;  4O3A A;  2GFE A;  3CVG A;  4RY1 A;  4O3C A;  4MLV A;  1B46 A;  3THI A;  4YKP A;  3U1O A;  3A3U A;  1O63 A;  4BLA A;  1N76 A;  2H98 A;  3S4U A;  4U21 A;  1UTB A;  1MH4 A;  3KEI A;  4MF3 A;  5I84 A;  2QS3 A;  2UVJ A;  1F9B A;  1FQD A;  2A5T A;  1OQH A;  1XC1 A;  4BDO A;  3IO6 A;  3M8U A;  4R72 A;  4ZE8 A;  2DOJ A;  3HO7 A;  3PPR A;  4XKP A;  2Y7P A;  2PX1 A;  4R9G A;  1N7W A;  4C1T A;  3OEM A;  4KHZ E;  1EZP A;  2QMW A;  2Y84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...