3PPRA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
TIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Glycine betaine/carnitine/choline-binding protein
total genus 103
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3pprA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3pprA02
4IO2A 4I8CA 1MPCA 2R9JA 4NF6A 1QKBA 2G93A 2I3WA 3LSWA 4ZEBA 3SEXA 2DYXA 3VLVA 1I69A 4LQ5A 1US5A 3T93B 4HW8A 3B7DA 3O66A 2A5TB 2D5WA 3KBRA 1N04A 2XXXA 1QW0A 2YJPA 5ITOA 1ZBMA 4I1DA 2F7CA 4OERA 5DEXA 1MG1A 2ZNUA 5L9MA 3SEWA 1H43A 5LOMA 3S9LC 2XXHA 4FORA 2ESNA 3HHGA 4EXKA 1XVYA 3IOVA 1MXXA 5K2YA 5I2NA 5I59A 5A5XA 1SVXB 2XHDA 3K00A 4HS7A 3O6HA 5CMKA 2PX1A 1DTGA 2DE4A 3QUFA 3HCQA 2F7BA 3U1OA 3UN6A 1O63A 2NUVA 3G3IA 4BDLA 1PB7A 3M3KA 4F3PA 4H8IA 4MFIA 2QRYA 4IGTA 3B6QA 4KR5A 3TTNA 1B7UA 2DWAA 3FZVA 4H5FA 2V3TA 4U23A 5I57A 5DTBA 5EHSA 2P1SA 2Y84A 2G29A 2D21A 2Q8JA 3VVDA 3MWBA 2Q2AA 3FASA 3OEKA 5JTYB 4IO3A 1URDA 2OJTA 3H6TA 3WAEA 3K1NA 2H4IA 2ONKE 3C36A 4FIMA 5FTHA 3S4UA 4F19A 4QFNA 3RN8A 2DOJA 4EQ7A 4GD5A 4P0GA 3JYRA 3Q25A 1EU8A 1FQCA 5L8DA 3LC8A 4KCCA 2I4CA 2Y7WA 2XXUA 3H6WA 3QSLA 4UA8A 3O29A 4LZ5A 4NEDA 3HSTA 1PB9A 4U1OA 1MY2A 3O2AA 4O3BA 3CFZA 2ONSA 1QVSA 2I58A 3ZS6A 3UA8A 1QULA 3TEPA 3MJNA 4GLIA 4G77A 3B6WA 3AXFA 4H67A 3USDA 4DCYA 4DE8A 1B32A 5DYHA 4ZZAA 1YTVA 4ECFA 4QHQA 2VGQA 3C31A 3TPAA 2UVIA 4H6DA 4N13A 4FE8A 4GFRA 5H8HB 2AL5A 2FYIA 4ZDMA 1B3LA 3PUXE 4QFLA 2XX7A 3ZKLA 5J1DA 5JTYA 4NF5B 5JK4A 1MY3A 1B4HA 1N3WA 1JVXA 2V3UA 3OOAA 3Q27A 4POWA 1B0LA 5DVFA 1GTKA 1RYOA 4ONYA 5CMBA 5H8HA 3SKPA 5I58B 4OQOA 4PP0A 3CSGA 3UORA 3MVXA 1URGA 2VP1A 5FTIA 3TTMA 2ZYMA 4G8HA 1JW5A 4R72A 1GVCA 1SW2A 3VXCA 5CBRA 5KCJA 1AL3A 1ZTYA 2F97A 2QSXA 3E13X 4IO5A 4PFTA 4QFPA 1Y3PA 3Q28A 4NF8A 1MRPA 2KLFA 3CRBA 3SDFA 1H45A 1SD3A 1R9QA 4JDFA 2RINA 3PPQA 4MLQA 1Z7ME 3IORA 2DWHA 3FV2A 4PE5B 4G8NA 1JETA 1GR2A 1MPDA 1UIUA 1XHYA 1POTA 1Y3QA 2GHAA 3CSBA 4MBPA 4YB5A 4ZE8A 4F1VA 3RGYA 3FXQA 1TT1A 2VHAA 1LAFE 1M5FA 4GOTA 2O1LA 4U2RA 5AA4A 3MPKA 3MVYA 4OESA 3DELB 3IB1A 5EHMA 5I84A 4F22A 3ILTB 1IXHA 2DS9A 3KOSA 4WEPA 2FA7A 4KCDA 1MDP1 2ABHA 1N76A 1NNKA 1VE4A 3O6GA 2FNCA 3PUZE 4G68A 3U94A 4DIGA 4ELRA 4F2QA 4C1TA 5ISUA 4PFWA 3KG2A 1MXWA 1Q35A 1VFEA 3KN8A 3OO9A 3RT6B 3WAFA 3RTFB 2IEEA 1BP5A 1B58A 4ND9A 4RK2A 4JSDA 1XT8A 4OFOA 1P1NA 4ZEKA 4R6HA 1NL5A 2I49A 3E3KA 4QSDA 4RA1A 4X1BA 3T9UA 1OIBA 2H25A 3TTLA 4EXLA 3S9EA 3IR1A 1NMUA 4QSCA 1EH3A 2F7AA 2I48A 2A5SA 2RF1A 2XD2A 1FTOA 3FVGA 4XXUA 2NVUB 4ELQA 4IO4A 4XKQA 4O3AA 1YPNA 4WXJA 5L9OA 3FXUA 3VXBA 3VVFA 3MUQA 2H5YA 4H0WA 2UVGA 3N5LA 1HSJA 4OEUA 2LAOA 3MZ9A 5AA2B 1NNFA 4L17A 1P1QA 2Q89A 3MAMA 2Y7IA 2DXYA 3LSFB 2REGA 1PDAA 4QF9A 4R73A 3FXRA 3KGCA 4H5GA 4IO7A 1ZJLA 4JSOA 2ANJA 5DEXB 5A5XB 1TFAA 5AA2A 1BLFA 2PT2A 4U4SA 3VFJA 5ELVA 1UIVA 3C32A 5JEIA 2V93A 1DPPA 2NXOA 4ZS9A 2DQVA 4IY5A 5HBCA 3TODA 2X7QA 2O1MA 1B4ZA 3Q26A 4N6PA 2XX9A 2DE3A 3W9WA 3HHFA 1A54A 4OYVA 4ZE9A 5F7VA 1B52A 2HZLA 4FAJA 4LZ7A 2B3FA 1MQDA 1MXYA 2F5XA 1OVBA 3OMBA 2O51A 2DVCA 4E0WA 1HSLA 2QPQA 4YB6A 1B6HA 1Y3NA 1MDQA 1OMPA 5M2VA 4LQ2A 2DVZA 2GHBA 2Z22A 2PVUA 3HV1A 1MM7A 3JZJA 1MH3A 1QUIA 3K6UA 4KYSA 1B51A 4OHNA 2F8DA 3CVGA 4GXSB 1Y1MA 2XXVA 4R74A 1UTHA 5AA1A 2NWJA 2ZNTA 4OENA 4YMAA 2HAVA 3KN3A 3T9VA 1VR5A 4RYAA 2QJEA 1Q1KA 2O68A 3PPRA 2DWIA 2E0SA 3I3VA 1OLAA 1OVTA 5H8FB 1WDNA 4KI0E 4NF5A 4EQ9A 2ZNSA 2A5TA 1SW4A 4F39A 3FATA 3PUWE 1B3EA 5I2NB 5H8NA 3ODBA 4BDRA 4HCYA 1LSTA 4G2ZA 3PMXA 3HPIA 1FQBA 2RKMA 4RPNA 3VLUA 3MPLA 4I62A 1S9TA 1FW0A 4P0IA 2UYFA 3V89B 2F36A 3EHTA 1M5EA 3O9PA 3QXMA 4POXA 2NOOA 1R9LA 3KSJA 3PPNA 4LONB 1A7LA 5H8NB 3HN0A 3KN7A 3G3KA 5H8QA 3OO6A 2O69A 3BKIB 3R7XA 3TCFA 4M1VA 1A8FA 1B05A 2OLBA 1IEJA 1MXZA 2ZYNA 1B40A 2YPNA 3LR1A 4OTEA 4QSEA 4PETA 1FQEA 3K2DA 4YKKA 5H8SA 4ZECA 3MP6A 4F3SA 5KDTB 2XXIA 5BWJA 1FTKA 3A09A 4KPTA 1LFGA 5B70A 3FJ7A 3H3GA 3PMVA 4AB5A 1IXCA 2VD3A 4ZZEA 2DWJA 2RCAA 1A55A 1B5JA 3A3UA 4GF8A 1KWHA 3QUJA 1LAXA 1N7WA 4NF4B 4MLVA 4NE4A 3FVNA 1M5DA 4GVOA 4X9TA 3W15C 1B3GA 2F34A 3LBSA 5BUUA 2RCBA 3SETA 1VSOA 4LVQA 4UACA 2OWTA 3DP8A 3FUZA 1IIWA 3DP4A 3TTKA 1POY1 1R6ZA 1PBPA 2YLNA 4EF2A 5CBSA 2QS2A 1XC1A 1B7ZA 1MQIA 1LBCA 3JV9A 1FTJA 3K4UA 1SI0A 3KJ7A 3KSXA 5FHMA 5ITPA 5TU0A 1B1XA 3DLNA 3TCHA 1B5IA 1LBBA 3ZKKA 4ZEFA 3FIRA 4GRKA 5KDTA 3BFUA 5AA3A 1QUKA 4XKRA 4YKIA 3T9XB 4BLAA 5CMCA 1USYE 3BFTA 2WKYA 2QS1A 3L6HA 2O84X 4M4GA 4LA9A 3RPWA 4DXBA 3CG3A 3SESA 3C4MA 5FHOA 5TPAA 2O7UA 4F3BA 3THIA 1II5A 2THIA 3G3HA 3LUYA 4PFUA 4YU0A 2I4BA 2UXAA 4H8JA 3E9XA 1IUDA 3RQTA 3MZBA 3R6UA 5CI5A 4DDDA 4F3GA 1ZLQA 2RC8A 4NF4A 1EZOA 3CFLA 4X1DA 2VOZA 2ZXTA 1D9VA 2UVJA 4XKNA 3PMWA 2QS4A 4HCWA 1ZKBA 1PBQA 3IOTA 3CI8A 3H06B 2RC7A 4YICA 4ESXA 1AOVA 3LSXA 1NNPA 3K1PA 4I9DA 5B7DA 4F1UA 3PUVE 3ZSFA 2GH9A 2REJA 3FJGA 1SQYA 1TXFA 1GV8A 1MY1A 3H7MA 2PBWA 3D4CA 4JWOA 1O64A 4NTLA 4YKJA 4ZEDA 2V84A 3EF7A 1NH8A 3IO6A 3UK4A 2I0CA 2AL4A 3SEUA 1SI1A 4R6YA 1P99A 1R1NA 4OFJA 4F29A 2CZLA 5I2KA 1CE2A 1MQJA 5IAIA 3MVZA 1JVYA 3UGWA 4RK9A 3RT8A 3V8XB 4BDNA 4RNSA 2R6GE 2XXRA 2I3VA 3IO4A 3PV0E 1YCJA 4GL8A 3TZAA 4C1UA 1QKAA 3Q29A 3IB2A 2QS3A 3N6TA 4ELOA 2CMOA 5AA4B 4OVJA 5KZTA 4DCXA 3G3JA 1IXIA 3RNNA 4FECA 1Y4CA 1BKAA 2P2AA 4YKPA 3KZGA 1LAHE 2R71A 4U1ZA 5CC2A 1N3XA 2D3IA 2XXPA 3IB0A 3IAZA 3LSLA 1Y20A 2XXTA 3BBRA 3FVOA 4JB7A 1JEUA 2H9BA 4OMBA 4R6KA 4TLLB 4EF1A 1I6QA 1WODA 2Z8EA 4R2FA 1ZMGA 5AA2D 4G68C 2XD3A 3H6UA 2BJJX 4GIZA 3O6IA 3QIMA 1I6AA 1LB9A 1F9BA 1FTMA 1JW4A 4R2BA 4LP2B 4KFQA 3PPOA 1Y1ZA 4OEVA 4E0XA 3U72A 3GBAA 1MM6A 1MPBA 1A99A 1B5HA 1H3DA 1MXUA 1M5BA 1RYXA 2HXWA 1ZU0A 3OD7A 1MS7A 4MF3A 4U21A 2UYEA 3VLWA 3RUMA 3N6UA 3KEIA 3MQ9A 1IITA 2OZZA 1S50A 2Q2CA 3MZ1A 2O6AA 1DOTA 5I59B 2OCUA 2ONRA 1H76A 1USYH 1O7TA 2XX8A 3MP8A 3PU5A 2QMXA 4KHZE 1JW1A 3G7WA 3VE1B 1LCFA 4DXUA 1SBPA 2HEUA 3E4RA 2HCAA 4U22A 4ESWA 4R75A 1DTZA 1N7XA 2X7PA 3DM0A 3PGFA 4JBZA 3TMGA 2Y7PA 1UTHB 3IJXB 1N0TA 1SYIA 3M8UA 3MVWA 3TTRA 4K3FA 1LFIA 4G68B 2IA4A 1FQAA 1QUJA 3I6VA 4JXIA 3IK6B 4LATA 4N07A 3TFLA 4BDMA 3FVKA 2O7IA 1P1WA 3C9HA 4G8MA 4R9GA 4YZZA 3FJMA 3PD8A 4NWDA 4ELPA 2E1SA 3O28A 3VV5A 2GFEA 3M3LA 1UTBA 4KD5A 1LFHA 1IQ7A 1I6BA 3H4ZA 4O3CA 3IL1B 4TOZA 2Y7RA 3EPEA 3K1MA 2OWSA 2HFBA 4FEBA 4TQUQ 2VD2A 1MY0A 3F11A 4XIGQ 4JWYA 2AYSA 5TP9B 2W7YA 5K2XA 1XS5A 1B9JA 1HSEA 1YAEA 1AIVA 4NMYA 4OXVA 1A40A 4OETA 3U92A 1JQFA 3QAXA 4KYDA 4RJZA 1FTLA 3GLBA 5CRYA 1SDXA 2Q9TA 1EZ9A 4XTCQ 1OLCA 2H98A 1B46A 2PT1A 3T96B 3TAJA 3B6TA 2M8CA 2Q88A 4U4XA 4G4PA 5TPAB 1NH7A 1LAGE 1D9YA 5I56B 5ICTA 4Z7EA 4XKPA 3N94A 4ZEIA 3H6VA 1D3KA 5H8FA 1H44A 4QFOA 4R9FA 3IOUA 2I6EA 1A8EA 1LGBC 4IGRA 2AIXA 5HPQA 3GZGA 4MH5A 3OO7A 2HAUA 3FV1A 2UVHA 1OQHA 3GXAA 1JNFA 3V5AA 3S9MC 2DP8A 4P11A 5I58A 4LZ8A 1TWYA 4OWDA 3PPPA 3UP9A 3CG1A 3U93A 3OENA 4JWXA 3C34A 4YB7A 4Z0IA 1ATGA 3G3FA 1B3HA 4HTGA 2XXYA 4PQJA 1L5TA 4IB2A 2DE2A 1XVXA 5EYFA 3ILUB 3MC2A 4Q5TA 4AQ4A 4IO6A 3UIFA 4BDQA 3RLFE 4F31B 1RKMA 2Y7KA 4NWCA 5DVJA 2V25A 4F18A 1B0HA 3IJOB 2DSFA 4EUOA 4GWOA 3CFXA 4NF8B 1P1UA 4KYEA 5HM4B 4X48A 1DSNA 4QFKA 5F1QA 3M3FA 3IX1A 2OBGA 5I56A 1DPEA 4AB6A 4YMBA 1MY4A 4PFYA 4F2OA 3EN3A 5TP9A 1MQHA 3DP6A 3CR9A 5DT6A 3PD9A 2Z8FA 3K01A 2F6PA 3FGSA 3K02A 4IY6A 2ZYOA 3K0VA 3SERA 1IXGA 1Z7NE 4FATA 1P1OA 3CIJA 1B7HA 1SW1A 1Y9UA 2XXQA 1CB6A 2F78A 3D4GA 3EHSA 1SW5A 3OXNA 4F1YA 4H1XA 5AE4A 4Q0CA 5L9SA 3GBBA 2X26A 4EDPA 3I5OA 3TELA 4RPOA 3SEVA 3RTWB 4H65A 1US4A 5CM6A 3QYTA 1BIYA 1B3FA 2PMSA 3HO7A 4GQOA 3R26A 4KQPA 1S7YA 3TDJA 3TUSA 3TQWA 1PC3A 2DXRA 5DVIA 1SYHA 3A3CA 1UQWA 2B3BA 2F35A 2V3QA 3KOTA 3EQ1A 4OZ9A 3MBPA 4Q30B 4WEDA 3KFMA 5H8QB 1LLSA 1LB8A 3N26A 1IZ1A 2ZYKA 4DXCA 3S9NC 3QK6A 3K6XA 2QL3A 4FEDA 3T9HB 3VVEA 1MXVA 1ZIUA 4TLMB 2B65A 3ONMA 4BDOA 3U8QA 1EZPA 3SEYA 1AH5A 2ALUA 3TYHA 1B1HA 3C35A 3KJTA 4Q8RA 2I0BA 1T0KA 1NKXA 2QMWA 5ICQA 4NF6B 1VFDA 2ZMBA 3FD3A 4QRZA 3W9VA 2Z23A 3EHUA 1ANFA 4FJPA 4RY1A 3V83A 1FCKA 1J1NA 3C33A 3L6GA 3PUYE 1PB8A 1WVJA 3OSQA 1UTBB 1FQDA 1QJMA 3H03A 4WKMA 3OEMA 1MQGA 1MH4A 3MW0A 1B2HA 3OO8A 1FQFA 1D4NA 4C0RA 3MP1A 1URSA 3OSRA 4THIA 2GRVA 1PEBA 2XXWA 3T66A 5KCJB 5I2KB 3T22A 2F6GA 5IKBA 1N84A 2H99A 3OELA 1TFDA 3TQLA 4RXLA 1OQGA 5CMMA 5FHNA 4YAHX 3TCGA 1AMFA 1JEVA 4GXAA 4ISUA 2HQ0A 4OFLA 2HZKA 3ECRA 1ELJA 1DMBA 3G3GA 1Y4TA 3O97A 3P7IA 4DZ1A 1NFTA 3S2VA 3TKDA 2RC9A 2Z8DA 3IOWA 3K6VA 4LUBA 3K6WA 1NNTA 3VDFA 1XOCA 4DLDA 1M5CA 1BTJA 2OK2A 2PYYA 2P0SA 1LCTA 3RY3A 5I57B 4EQBA 4GL0A 1GGGA
chains in the Genus database with same CATH superfamily
1QKBA 4LQ5A 3T93B 3B7DA 4OA4A 1N04A 2XXXA 1QW0A 5TP9A 2CZIA 4I1DA 4OERA 3SEWA 5L9MA 4FORA 5ET7A 4GWXA 4EXKA 5A5XA 1SVXB 2XHDA 3B8BA 1FSAA 3QUFA 3HCQA 4BDLA 3GYYA 2NUVA 4H8IA 4KR5A 3FZVA 2V3TA 5DTBA 5EHSA 2P1SA 2Y84A 2Q8JA 2D21A 4NX1A 2ZZVA 1URDA 4OVSA 3WAEA 3K1NA 4F19A 3JYRA 3Q25A 1EU8A 2I4CA 2XXUA 4U1OA 1NV6A 4LZ5A 1MY2A 4IR8A 3CFZA 2ONSA 2I58A 4PBQA 4GLIA 5DYHA 1YTVA 4ECFA 2VGQA 1FBGA 4FE8A 2AL5A 5J1DA 3PUXE 1IMCA 1FJ9A 4POWA 5EQAA 1GTKA 2PFZA 4OQOA 3CSGA 3VXCA 4IO5A 1Y3PA 3CRBA 1H45A 3FV2A 1GR2A 1MPDA 1XHYA 1POTA 3CSBA 2Y5LA 4MBPA 1LAFE 2O1LA 4PFRA 1IXHA 3PTYA 2FA7A 4NF6B 1N76A 3PUZE 4PFWA 4N4UA 1MXWA 1B58A 2FBPA 4RK2A 2I49A 3E3KA 3TTLA 2H25A 4DI4B 2WBDA 5DW8A 1NUZA 4F2QA 4ELQA 1FTOA 4XXUA 2NVUB 2UVGA 1HSJA 5LDZA 3MZ9A 4L17A 1P1QA 2DXYA 4H5GA 3VFJA 1FPJA 5HBCA 5I5PA 2X7QA 2O1MA 3HHFA 1A54A 5F7VA 2HZLA 4LZ7A 2O51A 4E0WA 2QPQA 1B6HA 4LQ2A 2GHBA 2PVUA 1FPLA 4OHNA 4GXSB 1Y1MA 2ZNTA 2HAVA 3T9VA 4UABA 2QJEA 2PCRA 3I3VA 2XA5A 2KR0A 2ZNSA 1FPFA 4PGPA 3ODBA 4HCYA 2GQ1A 1FQBA 3VLUA 4I62A 1S9TA 4P0IA 5H8NB 2NOOA 3PPNA 3KN7A 4MCOA 4MHFA 1IMEA 2O69A 3OO6A 3R7XA 1RDZA 2ZYNA 1FQEA 5KDTB 3MP6A 4X8RA 4KPTA 3A09A 3FJ7A 3H3GA 4ZZEA 2DWJA 1B5JA 4N6KA 4I3EA 4NF4B 1N7WA 4MLVA 2F34A 4LVQA 3FUZA 1IIWA 3TTKA 3K4UA 1MQIA 3KJ7A 5T3JA 1SI0A 5FHMA 5TU0A 3TCHA 1LBBA 4GRKA 3BFUA 4YKIA 5CMCA 1USYE 2WKYA 4M4GA 4LA9A 4DXBA 3SESA 5FHOA 4PFUA 3MZBA 5CI5A 1ZLQA 2RC8A 4NF4A 4HCWA 1LBYA 4YICA 2QS4A 3CI8A 4QXDA 3FXBA 4F1UA 1LBXA 4ZEDA 3H7MA 4YKJA 2AL4A 3SEUA 1P99A 1R1NA 1CE2A 5IAIA 1JVYA 3RT8A 4BDNA 2QVVA 2XXRA 3ROJA 3G3JA 5CC2A 1N3XA 2XXPA 3LSLA 4R6KA 2Z8EA 1WODA 1ZMGA 4PF6A 4O7IA 1LB9A 5IZZA 4R2BA 3U72A 3GBAA 1A99A 1B5HA 4F3GA 1ZU0A 3MQ9A 3MZ1A 5I59B 4N81A 2ONRA 3MP8A 1O7TA 2HCAA 4NF0A 3DM0A 1FTAA 4JBZA 2Y7PA 1N0TA 3TTRA 1LFIA 1FQAA 3IK6B 4G8MA 5B7DA 1P1WA 1SPIA 4YZZA 4NWDA 3VV5A 3M3LA 3LV0A 4KD5A 1FBPA 1IQ7A 2WX9A 2VD2A 3F11A 4JWYA 1XS5A 1HSEA 1YAEA 1FPDA 4OETA 3GLBA 2PT1A 2VPOA 2L5VA 2M8CA 5TPAB 1D9YA 5ICTA 4DI3D 4ZEIA 3H6VA 1NUWA 4IGRA 4HE0A 4P11A 4LZ8A 1TWYA 4OWDA 3UP9A 3CG1A 4Z0IA 4HTGA 3MC2A 4Q5TA 3UIFA 2Y7KA 5DVJA 4GX4A 1NI9A 4NF8B 4I40A 4KYEA 4PCDA 3M3FA 1DPEA 4YMBA 3BIHA 4OVRA 5J16A 3DP6A 2F6PA 4FATA 4Q0CA 2X26A 4EDPA 3TELA 3RTWB 1BIYA 3R26A 1SYHA 3A3CA 2V3QA 3EQ1A 4WEDA 3MBPA 4Q30B 3K6XA 3T9HB 2MKZA 2B65A 3ONMA 1EZPA 1T0KA 3KJTA 1VFDA 4QRZA 4FJPA 3H03A 1D4NA 4THIA 2GRVA 4H46A 3OELA 3TQLA 3KC0A 4GXAA 1ELJA 1DMBA 5KCJA 1NFTA 3TKDA 1EYJA 2RC9A 2Z8DA 3IOWA 3K6VA 3VDFA 4PC9A 5EQ7A 5I57B 4EQBA 4GL0A 1GGGA 1JP4A 1MPCA 2I3WA 1K9ZA 2YJPA 1ZBMA 5DEXA 1H43A 1XVYA 5K2YA 5I2NA 4I3YA 4N8YA 4HS7A 3O6HA 2PX1A 3UN6A 3U1OA 1O63A 3B6QA 3TTNA 4U23A 5JTYB 4IO3A 3H6TA 2H4IA 2HHMA 2DOJA 1FQCA 3LC8A 4KCCA 2Y7WA 3O29A 1PB9A 4O3BA 2FVZA 3ZS6A 1QULA 3B6WA 3AXFA 3USDA 1NV0A 3TPAA 2FYIA 5JTYA 1B3LA 4QFLA 2V3UA 1N3WA 5DVFA 1RYOA 5H8HA 4PP0A 1URGA 2ZYMA 4R72A 1JW5A 2OX3A 2F97A 2QSXA 3E13X 2KLFA 4P1LA 1R9QA 2RINA 4PE5B 4G8NA 4AS5A 4YB5A 4ZE8A 3RGYA 3FXQA 2CZKA 1M5FA 3MVYA 4WEPA 3U94A 5ISUA 1YYZA 1Q35A 1VFEA 3KN8A 1G0IA 3RT6B 3WAFA 3RTFB 2IEEA 4OFOA 1P1NA 4R6HA 4PF8A 1EH3A 1EZOA 3FVGA 2XD2A 4XKQA 4O3AA 4WXJA 3FXUA 3MUQA 5AA2B 1NNFA 4XF5A 2REGA 1PDAA 4JSOA 1BLFA 2PT2A 4U4SA 4ZS9A 3TODA 1B4ZA 2DE3A 3W9WA 1FPIA 4ZE9A 4PE3A 4FAJA 4AS4A 1MXYA 2F5XA 1OVBA 2DVCA 1HSLA 1Y3NA 1MDQA 1OMPA 5M2VA 4X04A 1FBDA 3JZJA 2CZHA 4KYSA 3K6UA 1B51A 3CVGA 1VR5A 4RYAA 2O68A 2XWVA 3PPRA 2WYKA 4F39A 3FATA 1B3EA 5H8NA 1LSTA 2RKMA 4RPNA 3MPLA 3V89B 3EHTA 1M5EA 4PAFA 3KSJA 4LONB 3HN0A 3BKIB 1A8FA 1B05A 1IEJA 1MXZA 3LR1A 1B40A 3T0JA 4YKKA 4OTEA 5H8SA 4PETA 4ZECA 1FTKA 3A29A 1IXCA 2VD3A 1A55A 1KWHA 1FBFA 4JVDA 3FVNA 4NE4A 4X9TA 5BUUA 2Q74A 4G61A 4UACA 2OWTA 3DP8A 3DP4A 4EF2A 5CBSA 1XC1A 1LBCA 3KSXA 4HE1A 1B1XA 3DLNA 4BLAA 1NUXA 1IMBA 3CG3A 4F3BA 3C4MA 2O7UA 3THIA 1II5A 2THIA 3G3HA 3LUYA 2I4BA 1IUDA 3RQTA 4X1DA 2VOZA 2ZXTA 2UVJA 3PMWA 1AOVA 2RC7A 3K1PA 3PUVE 2REJA 1SQYA 3D4CA 1INPA 2V84A 3EF7A 1NH8A 5FBPA 1SI1A 2QFLA 5I2KA 4RK9A 5IM2A 2R6GE 2I3VA 4XFEA 3Q29A 3N6TA 2CMOA 4OVJA 1BKAA 1LAHE 4LN5A 4U1ZA 4XEQA 2H9BA 4EF1A 3IFCA 5AA2D 1EYKA 1I6AA 4MAGA 3PPOA 4E0XA 1MPBA 1H3DA 1MXUA 1RYXA 2CEXA 2UYEA 3VLWA 3KEIA 1IMFA 2O6AA 1DOTA 1H76A 1USYH 4ESXA 4MNPA 3RPLA 4ESWA 1N7XA 4MJOA 1UTHB 3IJXB 4H45A 5IGAA 4K3FA 2IA4A 2O7IA 4R9GA 3C9HA 3FJMA 3O28A 2GFEA 1LFHA 3H4ZA 4O3CA 3IL1B 4TOZA 2OWSA 2HFBA 2W7YA 4NMYA 5CRYA 3TAJA 2Q88A 4G4PA 1NH7A 4MMPA 4XKPA 1LGBC 4OVQA 3OO7A 3FV1A 2UVHA 3S9MC 3LUZA 3U93A 4JWXA 4YB7A 3G3FA 1B3HA 4GWYA 2XXYA 4PTKA 5EYFA 4BDQA 4F31B 1FPGA 4NWCA 4F18A 1B0HA 2DSFA 1P1UA 1DSNA 5F1QA 4PFYA 1MQHA 4N91A 5DT6A 3PD9A 3SERA 4P3LA 1IXGA 1CB6A 3EHSA 3OXNA 2KQZA 4H1XA 5I3SA 5AE4A 3GBBA 4RPOA 1US4A 1B3FA 3HO7A 1S7YA 3TQWA 1PC3A 2DXRA 2WBBA 1UQWA 3RPWA 1LLSA 1MXVA 1ZIUA 4TLMB 4BDOA 1AH5A 1B1HA 3C35A 2QMWA 5ICQA 3W9VA 3EHUA 3V83A 1WVJA 2F3DA 4WKMA 3OEMA 1MQGA 3MW0A 1B2HA 3MYUA 4O8MA 2XXWA 5I2KB 2F6GA 4P9KA 5FHNA 5CMMA 4YAHX 4ISUA 2HQ0A 3ECRA 3G3GA 3S2VA 3FBPA 4LUBA 1KA0A 1BTJA 4JVCA 1LBWA 2R9JA 4NF6A 3LSWA 3VLVA 1US5A 3O66A 2A5TB 1DCUA 5EQ9A 2ZNUA 5LOMA 3S9LC 2XXHA 2ESNA 1MXXA 1NV3A 5CMKA 1DTGA 2F7BA 3G3IA 1PB7A 3QMFA 4PAKA 1B7UA 2DWAA 4H5FA 3VVDA 1NUYA 3MWBA 2Q2AA 3C36A 5FTHA 2FIEA 3S4UA 4QFNA 3RN8A 4EQ7A 5L8DA 3H6WA 3QSLA 4KXPA 4NAPA 3NOHA 3O2AA 1KZ8A 3TEPA 3MJNA 4H67A 3C31A 2XWIA 1NV7A 2UVIA 1KA1A 4GFRA 5H8HB 4ZDMA 3ZKLA 4NF5B 5JK4A 1MY3A 4GX6A 3RUMA 5CMBA 3MVXA 2VP1A 1AL3A 4PFTA 2V4CA 3Q28A 1MRPA 4GBWA 4JDFA 4MLQA 1Z7ME 3IORA 5I7IA 1UIUA 1Y3QA 2GHAA 4N8GA 1TT1A 4NHBA 4GOTA 5AA4A 4U2RA 4OESA 3DELB 3IB1A 5EHMA 4F22A 2ABHA 3O6GA 4G68A 3T1BA 4PFBA 3KG2A 3OO9A 1BP5A 4JSDA 1XT8A 1DBZA 1NL5A 4X1BA 4QSDA 4RA1A 4HE2A 3T9UA 3S9EA 1OIBA 1XI6A 2JJKA 4QSCA 2F7AA 2I48A 2RF1A 4IO4A 5A5LA 5L9OA 1NV2A 3VXBA 3VVFA 4H0WA 3N5LA 4QF9A 4R73A 3KGCA 4IO7A 1ZJLA 2ANJA 5DEXB 1TFAA 5AA2A 5ELVA 1UIVA 3C32A 2V93A 2NXOA 2DQVA 4IY5A 1LBZA 4N6PA 4GBVA 5LTCA 3OMBA 4MNIA 2Z22A 1MH3A 1QUIA 4MX6A 1UTHA 4OENA 5ESYA 4OVPA 1WDNA 2VPNA 3HFUA 4NF5A 4EQ9A 2A5TA 4P47A 4BDRA 4G2ZA 3PMXA 3HPIA 1FW0A 2UYFA 4POXA 1A7LA 5H8QA 4NN3A 3TCFA 4NQ8A 2OLBA 4QSEA 1FPBA 4F3SA 5BWJA 4AB5A 2RCAA 3A3UA 4GF8A 3QUJA 1LAXA 1B3GA 3LBSA 1VSOA 2QVRA 1POY1 1PBPA 2ZZXA 2QS2A 2BJIA 3JV9A 5ITPA 3ZKKA 5AA3A 1QUKA 4XKRA 5ET8A 2QS1A 5TPAA 1NV4A 4YU0A 3R6UA 4DDDA 3CFLA 3IOTA 3H06B 1NNPA 4I9DA 3IFAA 1NV1A 3FJGA 1TXFA 1MY1A 4NTLA 2PBWA 4JWOA 1O64A 3IO6A 3UK4A 2HXRA 2I0CA 5EYGA 4R6YA 4OFJA 2CZLA 1MQJA 3UGWA 4GL8A 3IO4A 4C1UA 2QS3A 4ELOA 5AA4B 4DCXA 2WYPA 1IXIA 3RNNA 4FECA 1Y4CA 2P2AA 2R71A 3IAZA 2Q8MA 3BBRA 4JB7A 4TLLB 4OMBA 1JEUA 4R2FA 4G68C 3H6UA 4O94A 4GIZA 3O6IA 3QIMA 4LP2B 1Y1ZA 4GWWA 2HXWA 1M5BA 4MF3A 3OD7A 4U21A 3N6UA 2Q2CA 1S50A 2OCUA 4KHZE 2QMXA 3G7WA 1SBPA 2F3BA 1DTZA 5EQ8A 5IZ1A 4OANA 3M8UA 1QUJA 1K9YA 4ELPA 1UTBA 1I6BA 2Y7RA 3K1MA 1IMDA 4FEBA 4XIGQ 5TP9B 2AYSA 5K2XA 1B9JA 4OXVA 1A40A 3U92A 3QAXA 4KYDA 2PFYA 1FTLA 1EZ9A 2H98A 3T96B 4PFIA 3B6TA 2P3NA 5I56B 3N94A 1D3KA 3IOUA 2I6EA 1A8EA 2AIXA 5HPQA 4MH5A 1OQHA 3GXAA 5I58A 1FPEA 4GWZA 3PPPA 3UORA 3VE1B 3C34A 1ATGA 1L5TA 4IB2A 4AQ4A 1FBHA 1RKMA 3IJOB 3CFXA 5HM4B 4X48A 4QFKA 2OBGA 5I56A 4AB6A 1MY4A 2Z8FA 4IY6A 1YZ0A 1B7HA 2F78A 3D4GA 4F1YA 3SEVA 4H65A 4MIJA 3QYTA 4KQPA 4GQOA 3E79A 5DVIA 2B3BA 3KOTA 3KFMA 3N26A 2ZYKA 3S9NC 3QK6A 2QL3A 3VVEA 2CEYA 2R8TA 3SEYA 4Q8RA 2ALUA 3TYHA 2I0BA 1NKXA 2ZMBA 2WEFA 3CHGA 2B4MA 3PUYE 1PB8A 3OSQA 1UTBB 4GX3A 1FQDA 1QJMA 1MH4A 3OO8A 1FQFA 3MP1A 1URSA 3OSRA 4HXVA 3T66A 5IKBA 2H99A 1TFDA 1OQGA 4PGNA 1IMAA 1JEVA 3TCGA 5IZ3B 4OFLA 3O97A 3P7IA 5KDTA 3K6WA 1M5CA 2P0SA 1LCTA 4FBPA 4IO2A 4I8CA 3SEXA 4ZEBA 2G93A 2XWKA 2DYXA 1I69A 2P3VA 4HW8A 3KBRA 2D5WA 5ITOA 5A5XB 2F7CA 1MG1A 3HHGA 3IOVA 5I59A 3K00A 2DE4A 4F3PA 3M3KA 4MFIA 2QRYA 4IGTA 4PDHA 5I57A 2G29A 3FASA 3OEKA 2OJTA 2ONKE 4FIMA 4GD5A 4P0GA 4P1EA 1YXIA 4UA8A 4NEDA 1D9QA 3HSTA 2QVUA 1QVSA 2HPGA 1VDWA 4G77A 4DCYA 4DE8A 1B32A 4ZZAA 4QHQA 1CNQA 4H6DA 5ET5A 4N13A 2XX7A 3EKIA 1B4HA 3OOAA 1JVXA 3Q27A 3SKPA 1B0LA 1QGXA 4ONYA 5I58B 3TTMA 5FTIA 3UA8A 5CBRA 4G8HA 1GVCA 1SW2A 1ZTYA 4QFPA 4NF8A 3SDFA 1DK4A 1SD3A 2B4LA 3PPQA 2DWHA 1FPKA 1JETA 4F1VA 2VHAA 3MPKA 5I84A 3ILTB 2DS9A 3KOSA 2VT5A 1MDP1 4KCDA 1NNKA 1VE4A 2FNCA 4DIGA 4ELRA 4C1TA 1FJ6A 4ND9A 4ZEKA 3KBZA 4EXLA 1G0HA 3IR1A 1LEVA 1NMUA 2A5SA 1YPNA 2H5YA 4NG7A 4OEUA 2OWZA 2LAOA 3U65A 2Q89A 3MAMA 2Y7IA 3LSFB 3RPLB 4P8BA 3FXRA 5JEIA 1DPPA 3Q26A 2XX9A 4OYVA 1FBCA 1B52A 2B3FA 1EYIA 1MQDA 5IZ3A 4YB6A 2DDKA 2DVZA 3HV1A 1MM7A 4R74A 2F8DA 2XXVA 5AA1A 2NWJA 4YMAA 2ZZWA 3KN3A 4PDDA 1Q1KA 2DWIA 2E0SA 3RYDA 1OLAA 1OVTA 5H8FB 4KI0E 4GWUA 1SW4A 3PUWE 5I2NB 3E78A 2F36A 3O9PA 3QXMA 1R9LA 4N6DA 3G3KA 4P56A 4M1VA 4DXUA 2YPNA 3K2DA 2XXIA 1LFGA 5B70A 3PMVA 4MEVA 1FBEA 4OVTA 1M5DA 4GVOA 3W15C 2RCBA 3SETA 3ISPA 1R6ZA 2YLNA 4MNCA 1B7ZA 2XXKA 1FTJA 1B5IA 4ZEFA 3FIRA 3T9XB 3BFTA 3L6HA 2O84X 2UXAA 4H8JA 3E9XA 1LBVA 1D9VA 4XKNA 1ZKBA 1PBQA 5EYHA 3LSXA 3ZSFA 2GH9A 5F24A 1GV8A 4F29A 3MVZA 3V8XB 4N15A 4RNSA 3TZAA 3PV0E 1YCJA 1QKAA 3IB2A 5KZTA 1AWBA 3BIGA 3D1RA 4YKPA 3KZGA 2D3IA 3IB0A 1Y20A 2XXTA 3FVOA 1I6QA 2FIXA 2XD3A 2BJJX 1F9BA 1FTMA 1JW4A 4KFQA 4OEVA 1MM6A 1MS7A 1RDYA 1IITA 2OZZA 4O7MA 2XX8A 3PU5A 4PAIA 1JW1A 1LCFA 2HEUA 3E4RA 4U22A 4R75A 2X7PA 3PGFA 3TMGA 1SYIA 3MVWA 4G68B 3I6VA 4JXIA 4LATA 4N07A 4NGUA 3TFLA 4BDMA 3FVKA 3PD8A 2E1SA 2FHYA 3EPEA 4TQUQ 1MY0A 1AIVA 4GWSA 3SZPA 3B50A 1JQFA 4JVIA 4N17A 4RJZA 1SDXA 2Q9TA 4XTCQ 1OLCA 1B46A 4U4XA 1LAGE 4Z7EA 5H8FA 1H44A 4QFOA 4R9FA 3MSTA 3GZGA 2HAUA 3V5AA 1JNFA 2DP8A 3OENA 4PQJA 2DE2A 1XVXA 3ILUB 4QBAA 4IO6A 3RLFE 2V25A 1RDXA 4EUOA 4GWOA 5ET6A 3IX1A 4F2OA 3EN3A 3CR9A 3KC1A 3K01A 3FGSA 3K02A 2ZYOA 3K0VA 1Z7NE 1P1OA 3CIJA 1SW1A 1Y9UA 1SW5A 5L9SA 3I5OA 5CM6A 2PMSA 3TDJA 3TUSA 2F35A 5H8QB 4OZ9A 4DXCA 1LB8A 1IZ1A 1Q9DA 2Y5KA 4FEDA 1NV5A 3U8QA 3FD3A 2Z23A 4RY1A 1ANFA 1J1NA 1FCKA 3C33A 3L6GA 1FRPA 4C0RA 1PEBA 5KCJB 3T22A 1BK4A 1N84A 4RXLA 1AMFA 2HZKA 4PBHA 4DZ1A 1Y4TA 1NNTA 1XOCA 4DLDA 2OK2A 2PYYA 3RY3A 2XWOA 2XXQA
chains in the Genus database with same CATH topology
4IO2A 4I8CA 1MPCA 2R9JA 4NF6A 1QKBA 2G93A 2I3WA 3LSWA 4ZEBA 3SEXA 2DYXA 3VLVA 1I69A 4LQ5A 1US5A 3T93B 4HW8A 3B7DA 3O66A 2A5TB 2D5WA 3KBRA 1N04A 2XXXA 1QW0A 2YJPA 5ITOA 1ZBMA 4I1DA 2F7CA 4OERA 5DEXA 1MG1A 2ZNUA 5L9MA 3SEWA 1H43A 5LOMA 3S9LC 2XXHA 4FORA 2ESNA 3HHGA 4EXKA 1XVYA 3IOVA 1MXXA 5K2YA 5I2NA 5I59A 5A5XA 1SVXB 2XHDA 3K00A 4HS7A 3O6HA 5CMKA 2PX1A 1DTGA 2DE4A 3QUFA 3HCQA 2F7BA 3U1OA 3UN6A 1O63A 2NUVA 3G3IA 4BDLA 1PB7A 3M3KA 4F3PA 4H8IA 4MFIA 2QRYA 4IGTA 3B6QA 4KR5A 3TTNA 1B7UA 2DWAA 3FZVA 4H5FA 2V3TA 4U23A 5I57A 5DTBA 5EHSA 2P1SA 2Y84A 2G29A 2D21A 2Q8JA 3VVDA 3MWBA 2Q2AA 3FASA 3OEKA 5JTYB 4IO3A 1URDA 2OJTA 3H6TA 3WAEA 3K1NA 2H4IA 2ONKE 3C36A 4FIMA 5FTHA 3S4UA 4F19A 4QFNA 3RN8A 2DOJA 4EQ7A 4GD5A 4P0GA 3JYRA 3Q25A 1EU8A 1FQCA 5L8DA 3LC8A 4KCCA 2I4CA 2Y7WA 2XXUA 3H6WA 3QSLA 4UA8A 3O29A 4LZ5A 4NEDA 3HSTA 1PB9A 4U1OA 1MY2A 3O2AA 4O3BA 3CFZA 2ONSA 1QVSA 2I58A 3ZS6A 3UA8A 1QULA 3TEPA 3MJNA 4GLIA 4G77A 3B6WA 3AXFA 4H67A 3USDA 4DCYA 4DE8A 1B32A 5DYHA 4ZZAA 1YTVA 4ECFA 4QHQA 2VGQA 3C31A 3TPAA 2UVIA 4H6DA 4N13A 4FE8A 4GFRA 5H8HB 2AL5A 2FYIA 4ZDMA 1B3LA 3PUXE 4QFLA 2XX7A 3ZKLA 5J1DA 5JTYA 4NF5B 5JK4A 1MY3A 1B4HA 1N3WA 1JVXA 2V3UA 3OOAA 3Q27A 4POWA 1B0LA 5DVFA 1GTKA 1RYOA 4ONYA 5CMBA 5H8HA 3SKPA 5I58B 4OQOA 4PP0A 3CSGA 3UORA 3MVXA 1URGA 2VP1A 5FTIA 3TTMA 2ZYMA 4G8HA 1JW5A 4R72A 1GVCA 1SW2A 3VXCA 5CBRA 5KCJA 1AL3A 1ZTYA 2F97A 2QSXA 3E13X 4IO5A 4PFTA 4QFPA 1Y3PA 3Q28A 4NF8A 1MRPA 2KLFA 3CRBA 3SDFA 1H45A 1SD3A 1R9QA 4JDFA 2RINA 3PPQA 4MLQA 1Z7ME 3IORA 2DWHA 3FV2A 4PE5B 4G8NA 1JETA 1GR2A 1MPDA 1UIUA 1XHYA 1POTA 1Y3QA 2GHAA 3CSBA 4MBPA 4YB5A 4ZE8A 4F1VA 3RGYA 3FXQA 1TT1A 2VHAA 1LAFE 1M5FA 4GOTA 2O1LA 4U2RA 5AA4A 3MPKA 3MVYA 4OESA 3DELB 3IB1A 5EHMA 5I84A 4F22A 3ILTB 1IXHA 2DS9A 3KOSA 4WEPA 2FA7A 4KCDA 1MDP1 2ABHA 1N76A 1NNKA 1VE4A 3O6GA 2FNCA 3PUZE 4G68A 3U94A 4DIGA 4ELRA 4F2QA 4C1TA 5ISUA 4PFWA 3KG2A 1MXWA 1Q35A 1VFEA 3KN8A 3OO9A 3RT6B 3WAFA 3RTFB 2IEEA 1BP5A 1B58A 4ND9A 4RK2A 4JSDA 1XT8A 4OFOA 1P1NA 4ZEKA 4R6HA 1NL5A 2I49A 3E3KA 4QSDA 4RA1A 4X1BA 3T9UA 1OIBA 2H25A 3TTLA 4EXLA 3S9EA 3IR1A 1NMUA 4QSCA 1EH3A 2F7AA 2I48A 2A5SA 2RF1A 2XD2A 1FTOA 3FVGA 4XXUA 2NVUB 4ELQA 4IO4A 4XKQA 4O3AA 1YPNA 4WXJA 5L9OA 3FXUA 3VXBA 3VVFA 3MUQA 2H5YA 4H0WA 2UVGA 3N5LA 1HSJA 4OEUA 2LAOA 3MZ9A 5AA2B 1NNFA 4L17A 1P1QA 2Q89A 3MAMA 2Y7IA 2DXYA 3LSFB 2REGA 1PDAA 4QF9A 4R73A 3FXRA 3KGCA 4H5GA 4IO7A 1ZJLA 4JSOA 2ANJA 5DEXB 5A5XB 1TFAA 5AA2A 1BLFA 2PT2A 4U4SA 3VFJA 5ELVA 1UIVA 3C32A 5JEIA 2V93A 1DPPA 2NXOA 4ZS9A 2DQVA 4IY5A 5HBCA 3TODA 2X7QA 2O1MA 1B4ZA 3Q26A 4N6PA 2XX9A 2DE3A 3W9WA 3HHFA 1A54A 4OYVA 4ZE9A 5F7VA 1B52A 2HZLA 4FAJA 4LZ7A 2B3FA 1MQDA 1MXYA 2F5XA 1OVBA 3OMBA 2O51A 2DVCA 4E0WA 1HSLA 2QPQA 4YB6A 1B6HA 1Y3NA 1MDQA 1OMPA 5M2VA 4LQ2A 2DVZA 2GHBA 2Z22A 2PVUA 3HV1A 1MM7A 3JZJA 1MH3A 1QUIA 3K6UA 4KYSA 1B51A 4OHNA 2F8DA 3CVGA 4GXSB 1Y1MA 2XXVA 4R74A 1UTHA 5AA1A 2NWJA 2ZNTA 4OENA 4YMAA 2HAVA 3KN3A 3T9VA 1VR5A 4RYAA 2QJEA 1Q1KA 2O68A 3PPRA 2DWIA 2E0SA 3I3VA 1OLAA 1OVTA 5H8FB 1WDNA 4KI0E 4NF5A 4EQ9A 2ZNSA 2A5TA 1SW4A 4F39A 3FATA 3PUWE 1B3EA 5I2NB 5H8NA 3ODBA 4BDRA 4HCYA 1LSTA 4G2ZA 3PMXA 3HPIA 1FQBA 2RKMA 4RPNA 3VLUA 3MPLA 4I62A 1S9TA 1FW0A 4P0IA 2UYFA 3V89B 2F36A 3EHTA 1M5EA 3O9PA 3QXMA 4POXA 2NOOA 1R9LA 3KSJA 3PPNA 4LONB 1A7LA 5H8NB 3HN0A 3KN7A 3G3KA 5H8QA 3OO6A 2O69A 3BKIB 3R7XA 3TCFA 4M1VA 1A8FA 1B05A 2OLBA 1IEJA 1MXZA 2ZYNA 1B40A 2YPNA 3LR1A 4OTEA 4QSEA 4PETA 1FQEA 3K2DA 4YKKA 5H8SA 4ZECA 3MP6A 4F3SA 5KDTB 2XXIA 5BWJA 1FTKA 3A09A 4KPTA 1LFGA 5B70A 3FJ7A 3H3GA 3PMVA 4AB5A 1IXCA 2VD3A 4ZZEA 2DWJA 2RCAA 1A55A 1B5JA 3A3UA 4GF8A 1KWHA 3QUJA 1LAXA 1N7WA 4NF4B 4MLVA 4NE4A 3FVNA 1M5DA 4GVOA 4X9TA 3W15C 1B3GA 2F34A 3LBSA 5BUUA 2RCBA 3SETA 1VSOA 4LVQA 4UACA 2OWTA 3DP8A 3FUZA 1IIWA 3DP4A 3TTKA 1POY1 1R6ZA 1PBPA 2YLNA 4EF2A 5CBSA 2QS2A 1XC1A 1B7ZA 1MQIA 1LBCA 3JV9A 1FTJA 3K4UA 1SI0A 3KJ7A 3KSXA 5FHMA 5ITPA 5TU0A 1B1XA 3DLNA 3TCHA 1B5IA 1LBBA 3ZKKA 4ZEFA 3FIRA 4GRKA 5KDTA 3BFUA 5AA3A 1QUKA 4XKRA 4YKIA 3T9XB 4BLAA 5CMCA 1USYE 3BFTA 2WKYA 2QS1A 3L6HA 2O84X 4M4GA 4LA9A 3RPWA 4DXBA 3CG3A 3SESA 3C4MA 5FHOA 5TPAA 2O7UA 4F3BA 3THIA 1II5A 2THIA 3G3HA 3LUYA 4PFUA 4YU0A 2I4BA 2UXAA 4H8JA 3E9XA 1IUDA 3RQTA 3MZBA 3R6UA 5CI5A 4DDDA 4F3GA 1ZLQA 2RC8A 4NF4A 1EZOA 3CFLA 4X1DA 2VOZA 2ZXTA 1D9VA 2UVJA 4XKNA 3PMWA 2QS4A 4HCWA 1ZKBA 1PBQA 3IOTA 3CI8A 3H06B 2RC7A 4YICA 4ESXA 1AOVA 3LSXA 1NNPA 3K1PA 4I9DA 5B7DA 4F1UA 3PUVE 3ZSFA 2GH9A 2REJA 3FJGA 1SQYA 1TXFA 1GV8A 1MY1A 3H7MA 2PBWA 3D4CA 4JWOA 1O64A 4NTLA 4YKJA 4ZEDA 2V84A 3EF7A 1NH8A 3IO6A 3UK4A 2I0CA 2AL4A 3SEUA 1SI1A 4R6YA 1P99A 1R1NA 4OFJA 4F29A 2CZLA 5I2KA 1CE2A 1MQJA 5IAIA 3MVZA 1JVYA 3UGWA 4RK9A 3RT8A 3V8XB 4BDNA 4RNSA 2R6GE 2XXRA 2I3VA 3IO4A 3PV0E 1YCJA 4GL8A 3TZAA 4C1UA 1QKAA 3Q29A 3IB2A 2QS3A 3N6TA 4ELOA 2CMOA 5AA4B 4OVJA 5KZTA 4DCXA 3G3JA 1IXIA 3RNNA 4FECA 1Y4CA 1BKAA 2P2AA 4YKPA 3KZGA 1LAHE 2R71A 4U1ZA 5CC2A 1N3XA 2D3IA 2XXPA 3IB0A 3IAZA 3LSLA 1Y20A 2XXTA 3BBRA 3FVOA 4JB7A 1JEUA 2H9BA 4OMBA 4R6KA 4TLLB 4EF1A 1I6QA 1WODA 2Z8EA 4R2FA 1ZMGA 5AA2D 4G68C 2XD3A 3H6UA 2BJJX 4GIZA 3O6IA 3QIMA 1I6AA 1LB9A 1F9BA 1FTMA 1JW4A 4R2BA 4LP2B 4KFQA 3PPOA 1Y1ZA 4OEVA 4E0XA 3U72A 3GBAA 1MM6A 1MPBA 1A99A 1B5HA 1H3DA 1MXUA 1M5BA 1RYXA 2HXWA 1ZU0A 3OD7A 1MS7A 4MF3A 4U21A 2UYEA 3VLWA 3RUMA 3N6UA 3KEIA 3MQ9A 1IITA 2OZZA 1S50A 2Q2CA 3MZ1A 2O6AA 1DOTA 5I59B 2OCUA 2ONRA 1H76A 1USYH 1O7TA 2XX8A 3MP8A 3PU5A 2QMXA 4KHZE 1JW1A 3G7WA 3VE1B 1LCFA 4DXUA 1SBPA 2HEUA 3E4RA 2HCAA 4U22A 4ESWA 4R75A 1DTZA 1N7XA 2X7PA 3DM0A 3PGFA 4JBZA 3TMGA 2Y7PA 1UTHB 3IJXB 1N0TA 1SYIA 3M8UA 3MVWA 3TTRA 4K3FA 1LFIA 4G68B 2IA4A 1FQAA 1QUJA 3I6VA 4JXIA 3IK6B 4LATA 4N07A 3TFLA 4BDMA 3FVKA 2O7IA 1P1WA 3C9HA 4G8MA 4R9GA 4YZZA 3FJMA 3PD8A 4NWDA 4ELPA 2E1SA 3O28A 3VV5A 2GFEA 3M3LA 1UTBA 4KD5A 1LFHA 1IQ7A 1I6BA 3H4ZA 4O3CA 3IL1B 4TOZA 2Y7RA 3EPEA 3K1MA 2OWSA 2HFBA 4FEBA 4TQUQ 2VD2A 1MY0A 3F11A 4XIGQ 4JWYA 2AYSA 5TP9B 2W7YA 5K2XA 1XS5A 1B9JA 1HSEA 1YAEA 1AIVA 4NMYA 4OXVA 1A40A 4OETA 3U92A 1JQFA 3QAXA 4KYDA 4RJZA 1FTLA 3GLBA 5CRYA 1SDXA 2Q9TA 1EZ9A 4XTCQ 1OLCA 2H98A 1B46A 2PT1A 3T96B 3TAJA 3B6TA 2M8CA 2Q88A 4U4XA 4G4PA 5TPAB 1NH7A 1LAGE 1D9YA 5I56B 5ICTA 4Z7EA 4XKPA 3N94A 4ZEIA 3H6VA 1D3KA 5H8FA 1H44A 4QFOA 4R9FA 3IOUA 2I6EA 1A8EA 1LGBC 4IGRA 2AIXA 5HPQA 3GZGA 4MH5A 3OO7A 2HAUA 3FV1A 2UVHA 1OQHA 3GXAA 1JNFA 3V5AA 3S9MC 2DP8A 4P11A 5I58A 4LZ8A 1TWYA 4OWDA 3PPPA 3UP9A 3CG1A 3U93A 3OENA 4JWXA 3C34A 4YB7A 4Z0IA 1ATGA 3G3FA 1B3HA 4HTGA 2XXYA 4PQJA 1L5TA 4IB2A 2DE2A 1XVXA 5EYFA 3ILUB 3MC2A 4Q5TA 4AQ4A 4IO6A 3UIFA 4BDQA 3RLFE 4F31B 1RKMA 2Y7KA 4NWCA 5DVJA 2V25A 4F18A 1B0HA 3IJOB 2DSFA 4EUOA 4GWOA 3CFXA 4NF8B 1P1UA 4KYEA 5HM4B 4X48A 1DSNA 4QFKA 5F1QA 3M3FA 3IX1A 2OBGA 5I56A 1DPEA 4AB6A 4YMBA 1MY4A 4PFYA 4F2OA 3EN3A 5TP9A 1MQHA 3DP6A 3CR9A 5DT6A 3PD9A 2Z8FA 3K01A 2F6PA 3FGSA 3K02A 4IY6A 2ZYOA 3K0VA 3SERA 1IXGA 1Z7NE 4FATA 1P1OA 3CIJA 1B7HA 1SW1A 1Y9UA 2XXQA 1CB6A 2F78A 3D4GA 3EHSA 1SW5A 3OXNA 4F1YA 4H1XA 5AE4A 4Q0CA 5L9SA 3GBBA 2X26A 4EDPA 3I5OA 3TELA 4RPOA 3SEVA 3RTWB 4H65A 1US4A 5CM6A 3QYTA 1BIYA 1B3FA 2PMSA 3HO7A 4GQOA 3R26A 4KQPA 1S7YA 3TDJA 3TUSA 3TQWA 1PC3A 2DXRA 5DVIA 1SYHA 3A3CA 1UQWA 2B3BA 2F35A 2V3QA 3KOTA 3EQ1A 4OZ9A 3MBPA 4Q30B 4WEDA 3KFMA 5H8QB 1LLSA 1LB8A 3N26A 1IZ1A 2ZYKA 4DXCA 3S9NC 3QK6A 3K6XA 2QL3A 4FEDA 3T9HB 3VVEA 1MXVA 1ZIUA 4TLMB 2B65A 3ONMA 4BDOA 3U8QA 1EZPA 3SEYA 1AH5A 2ALUA 3TYHA 1B1HA 3C35A 3KJTA 4Q8RA 2I0BA 1T0KA 1NKXA 2QMWA 5ICQA 4NF6B 1VFDA 2ZMBA 3FD3A 4QRZA 3W9VA 2Z23A 3EHUA 1ANFA 4FJPA 4RY1A 3V83A 1FCKA 1J1NA 3C33A 3L6GA 3PUYE 1PB8A 1WVJA 3OSQA 1UTBB 1FQDA 1QJMA 3H03A 4WKMA 3OEMA 1MQGA 1MH4A 3MW0A 1B2HA 3OO8A 1FQFA 1D4NA 4C0RA 3MP1A 1URSA 3OSRA 4THIA 2GRVA 1PEBA 2XXWA 3T66A 5KCJB 5I2KB 3T22A 2F6GA 5IKBA 1N84A 2H99A 3OELA 1TFDA 3TQLA 4RXLA 1OQGA 5CMMA 5FHNA 4YAHX 3TCGA 1AMFA 1JEVA 4GXAA 4ISUA 2HQ0A 4OFLA 2HZKA 3ECRA 1ELJA 1DMBA 3G3GA 1Y4TA 3O97A 3P7IA 4DZ1A 1NFTA 3S2VA 3TKDA 2RC9A 2Z8DA 3IOWA 3K6VA 4LUBA 3K6WA 1NNTA 3VDFA 1XOCA 4DLDA 1M5CA 1BTJA 2OK2A 2PYYA 2P0SA 1LCTA 3RY3A 5I57B 4EQBA 4GL0A 1GGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO2 A;  4I8C A;  1MPC A;  2R9J A;  4NF6 A;  1QKB A;  2G93 A;  2I3W A;  3LSW A;  4ZEB A;  3SEX A;  2DYX A;  3VLV A;  1I69 A;  4LQ5 A;  1US5 A;  3T93 B;  4HW8 A;  3B7D A;  3O66 A;  2A5T B;  2D5W A;  3KBR A;  1N04 A;  2XXX A;  1QW0 A;  2YJP A;  5ITO A;  1ZBM A;  4I1D A;  2F7C A;  4OER A;  5DEX A;  1MG1 A;  2ZNU A;  5L9M A;  3SEW A;  1H43 A;  5LOM A;  3S9L C;  2XXH A;  4FOR A;  2ESN A;  3HHG A;  4EXK A;  1XVY A;  3IOV A;  1MXX A;  5K2Y A;  5I2N A;  5I59 A;  5A5X A;  1SVX B;  2XHD A;  3K00 A;  4HS7 A;  3O6H A;  5CMK A;  2PX1 A;  1DTG A;  2DE4 A;  3QUF A;  3HCQ A;  2F7B A;  3U1O A;  3UN6 A;  1O63 A;  2NUV A;  3G3I A;  4BDL A;  1PB7 A;  3M3K A;  4F3P A;  4H8I A;  4MFI A;  2QRY A;  4IGT A;  3B6Q A;  4KR5 A;  3TTN A;  1B7U A;  2DWA A;  3FZV A;  4H5F A;  2V3T A;  4U23 A;  5I57 A;  5DTB A;  5EHS A;  2P1S A;  2Y84 A;  2G29 A;  2D21 A;  2Q8J A;  3VVD A;  3MWB A;  2Q2A A;  3FAS A;  3OEK A;  5JTY B;  4IO3 A;  1URD A;  2OJT A;  3H6T A;  3WAE A;  3K1N A;  2H4I A;  2ONK E;  3C36 A;  4FIM A;  5FTH A;  3S4U A;  4F19 A;  4QFN A;  3RN8 A;  2DOJ A;  4EQ7 A;  4GD5 A;  4P0G A;  3JYR A;  3Q25 A;  1EU8 A;  1FQC A;  5L8D A;  3LC8 A;  4KCC A;  2I4C A;  2Y7W A;  2XXU A;  3H6W A;  3QSL A;  4UA8 A;  3O29 A;  4LZ5 A;  4NED A;  3HST A;  1PB9 A;  4U1O A;  1MY2 A;  3O2A A;  4O3B A;  3CFZ A;  2ONS A;  1QVS A;  2I58 A;  3ZS6 A;  3UA8 A;  1QUL A;  3TEP A;  3MJN A;  4GLI A;  4G77 A;  3B6W A;  3AXF A;  4H67 A;  3USD A;  4DCY A;  4DE8 A;  1B32 A;  5DYH A;  4ZZA A;  1YTV A;  4ECF A;  4QHQ A;  2VGQ A;  3C31 A;  3TPA A;  2UVI A;  4H6D A;  4N13 A;  4FE8 A;  4GFR A;  5H8H B;  2AL5 A;  2FYI A;  4ZDM A;  1B3L A;  3PUX E;  4QFL A;  2XX7 A;  3ZKL A;  5J1D A;  5JTY A;  4NF5 B;  5JK4 A;  1MY3 A;  1B4H A;  1N3W A;  1JVX A;  2V3U A;  3OOA A;  3Q27 A;  4POW A;  1B0L A;  5DVF A;  1GTK A;  1RYO A;  4ONY A;  5CMB A;  5H8H A;  3SKP A;  5I58 B;  4OQO A;  4PP0 A;  3CSG A;  3UOR A;  3MVX A;  1URG A;  2VP1 A;  5FTI A;  3TTM A;  2ZYM A;  4G8H A;  1JW5 A;  4R72 A;  1GVC A;  1SW2 A;  3VXC A;  5CBR A;  5KCJ A;  1AL3 A;  1ZTY A;  2F97 A;  2QSX A;  3E13 X;  4IO5 A;  4PFT A;  4QFP A;  1Y3P A;  3Q28 A;  4NF8 A;  1MRP A;  2KLF A;  3CRB A;  3SDF A;  1H45 A;  1SD3 A;  1R9Q A;  4JDF A;  2RIN A;  3PPQ A;  4MLQ A;  1Z7M E;  3IOR A;  2DWH A;  3FV2 A;  4PE5 B;  4G8N A;  1JET A;  1GR2 A;  1MPD A;  1UIU A;  1XHY A;  1POT A;  1Y3Q A;  2GHA A;  3CSB A;  4MBP A;  4YB5 A;  4ZE8 A;  4F1V A;  3RGY A;  3FXQ A;  1TT1 A;  2VHA A;  1LAF E;  1M5F A;  4GOT A;  2O1L A;  4U2R A;  5AA4 A;  3MPK A;  3MVY A;  4OES A;  3DEL B;  3IB1 A;  5EHM A;  5I84 A;  4F22 A;  3ILT B;  1IXH A;  2DS9 A;  3KOS A;  4WEP A;  2FA7 A;  4KCD A;  1MDP 1;  2ABH A;  1N76 A;  1NNK A;  1VE4 A;  3O6G A;  2FNC A;  3PUZ E;  4G68 A;  3U94 A;  4DIG A;  4ELR A;  4F2Q A;  4C1T A;  5ISU A;  4PFW A;  3KG2 A;  1MXW A;  1Q35 A;  1VFE A;  3KN8 A;  3OO9 A;  3RT6 B;  3WAF A;  3RTF B;  2IEE A;  1BP5 A;  1B58 A;  4ND9 A;  4RK2 A;  4JSD A;  1XT8 A;  4OFO A;  1P1N A;  4ZEK A;  4R6H A;  1NL5 A;  2I49 A;  3E3K A;  4QSD A;  4RA1 A;  4X1B A;  3T9U A;  1OIB A;  2H25 A;  3TTL A;  4EXL A;  3S9E A;  3IR1 A;  1NMU A;  4QSC A;  1EH3 A;  2F7A A;  2I48 A;  2A5S A;  2RF1 A;  2XD2 A;  1FTO A;  3FVG A;  4XXU A;  2NVU B;  4ELQ A;  4IO4 A;  4XKQ A;  4O3A A;  1YPN A;  4WXJ A;  5L9O A;  3FXU A;  3VXB A;  3VVF A;  3MUQ A;  2H5Y A;  4H0W A;  2UVG A;  3N5L A;  1HSJ A;  4OEU A;  2LAO A;  3MZ9 A;  5AA2 B;  1NNF A;  4L17 A;  1P1Q A;  2Q89 A;  3MAM A;  2Y7I A;  2DXY A;  3LSF B;  2REG A;  1PDA A;  4QF9 A;  4R73 A;  3FXR A;  3KGC A;  4H5G A;  4IO7 A;  1ZJL A;  4JSO A;  2ANJ A;  5DEX B;  5A5X B;  1TFA A;  5AA2 A;  1BLF A;  2PT2 A;  4U4S A;  3VFJ A;  5ELV A;  1UIV A;  3C32 A;  5JEI A;  2V93 A;  1DPP A;  2NXO A;  4ZS9 A;  2DQV A;  4IY5 A;  5HBC A;  3TOD A;  2X7Q A;  2O1M A;  1B4Z A;  3Q26 A;  4N6P A;  2XX9 A;  2DE3 A;  3W9W A;  3HHF A;  1A54 A;  4OYV A;  4ZE9 A;  5F7V A;  1B52 A;  2HZL A;  4FAJ A;  4LZ7 A;  2B3F A;  1MQD A;  1MXY A;  2F5X A;  1OVB A;  3OMB A;  2O51 A;  2DVC A;  4E0W A;  1HSL A;  2QPQ A;  4YB6 A;  1B6H A;  1Y3N A;  1MDQ A;  1OMP A;  5M2V A;  4LQ2 A;  2DVZ A;  2GHB A;  2Z22 A;  2PVU A;  3HV1 A;  1MM7 A;  3JZJ A;  1MH3 A;  1QUI A;  3K6U A;  4KYS A;  1B51 A;  4OHN A;  2F8D A;  3CVG A;  4GXS B;  1Y1M A;  2XXV A;  4R74 A;  1UTH A;  5AA1 A;  2NWJ A;  2ZNT A;  4OEN A;  4YMA A;  2HAV A;  3KN3 A;  3T9V A;  1VR5 A;  4RYA A;  2QJE A;  1Q1K A;  2O68 A;  3PPR A;  2DWI A;  2E0S A;  3I3V A;  1OLA A;  1OVT A;  5H8F B;  1WDN A;  4KI0 E;  4NF5 A;  4EQ9 A;  2ZNS A;  2A5T A;  1SW4 A;  4F39 A;  3FAT A;  3PUW E;  1B3E A;  5I2N B;  5H8N A;  3ODB A;  4BDR A;  4HCY A;  1LST A;  4G2Z A;  3PMX A;  3HPI A;  1FQB A;  2RKM A;  4RPN A;  3VLU A;  3MPL A;  4I62 A;  1S9T A;  1FW0 A;  4P0I A;  2UYF A;  3V89 B;  2F36 A;  3EHT A;  1M5E A;  3O9P A;  3QXM A;  4POX A;  2NOO A;  1R9L A;  3KSJ A;  3PPN A;  4LON B;  1A7L A;  5H8N B;  3HN0 A;  3KN7 A;  3G3K A;  5H8Q A;  3OO6 A;  2O69 A;  3BKI B;  3R7X A;  3TCF A;  4M1V A;  1A8F A;  1B05 A;  2OLB A;  1IEJ A;  1MXZ A;  2ZYN A;  1B40 A;  2YPN A;  3LR1 A;  4OTE A;  4QSE A;  4PET A;  1FQE A;  3K2D A;  4YKK A;  5H8S A;  4ZEC A;  3MP6 A;  4F3S A;  5KDT B;  2XXI A;  5BWJ A;  1FTK A;  3A09 A;  4KPT A;  1LFG A;  5B70 A;  3FJ7 A;  3H3G A;  3PMV A;  4AB5 A;  1IXC A;  2VD3 A;  4ZZE A;  2DWJ A;  2RCA A;  1A55 A;  1B5J A;  3A3U A;  4GF8 A;  1KWH A;  3QUJ A;  1LAX A;  1N7W A;  4NF4 B;  4MLV A;  4NE4 A;  3FVN A;  1M5D A;  4GVO A;  4X9T A;  3W15 C;  1B3G A;  2F34 A;  3LBS A;  5BUU A;  2RCB A;  3SET A;  1VSO A;  4LVQ A;  4UAC A;  2OWT A;  3DP8 A;  3FUZ A;  1IIW A;  3DP4 A;  3TTK A;  1POY 1;  1R6Z A;  1PBP A;  2YLN A;  4EF2 A;  5CBS A;  2QS2 A;  1XC1 A;  1B7Z A;  1MQI A;  1LBC A;  3JV9 A;  1FTJ A;  3K4U A;  1SI0 A;  3KJ7 A;  3KSX A;  5FHM A;  5ITP A;  5TU0 A;  1B1X A;  3DLN A;  3TCH A;  1B5I A;  1LBB A;  3ZKK A;  4ZEF A;  3FIR A;  4GRK A;  5KDT A;  3BFU A;  5AA3 A;  1QUK A;  4XKR A;  4YKI A;  3T9X B;  4BLA A;  5CMC A;  1USY E;  3BFT A;  2WKY A;  2QS1 A;  3L6H A;  2O84 X;  4M4G A;  4LA9 A;  3RPW A;  4DXB A;  3CG3 A;  3SES A;  3C4M A;  5FHO A;  5TPA A;  2O7U A;  4F3B A;  3THI A;  1II5 A;  2THI A;  3G3H A;  3LUY A;  4PFU A;  4YU0 A;  2I4B A;  2UXA A;  4H8J A;  3E9X A;  1IUD A;  3RQT A;  3MZB A;  3R6U A;  5CI5 A;  4DDD A;  4F3G A;  1ZLQ A;  2RC8 A;  4NF4 A;  1EZO A;  3CFL A;  4X1D A;  2VOZ A;  2ZXT A;  1D9V A;  2UVJ A;  4XKN A;  3PMW A;  2QS4 A;  4HCW A;  1ZKB A;  1PBQ A;  3IOT A;  3CI8 A;  3H06 B;  2RC7 A;  4YIC A;  4ESX A;  1AOV A;  3LSX A;  1NNP A;  3K1P A;  4I9D A;  5B7D A;  4F1U A;  3PUV E;  3ZSF A;  2GH9 A;  2REJ A;  3FJG A;  1SQY A;  1TXF A;  1GV8 A;  1MY1 A;  3H7M A;  2PBW A;  3D4C A;  4JWO A;  1O64 A;  4NTL A;  4YKJ A;  4ZED A;  2V84 A;  3EF7 A;  1NH8 A;  3IO6 A;  3UK4 A;  2I0C A;  2AL4 A;  3SEU A;  1SI1 A;  4R6Y A;  1P99 A;  1R1N A;  4OFJ A;  4F29 A;  2CZL A;  5I2K A;  1CE2 A;  1MQJ A;  5IAI A;  3MVZ A;  1JVY A;  3UGW A;  4RK9 A;  3RT8 A;  3V8X B;  4BDN A;  4RNS A;  2R6G E;  2XXR A;  2I3V A;  3IO4 A;  3PV0 E;  1YCJ A;  4GL8 A;  3TZA A;  4C1U A;  1QKA A;  3Q29 A;  3IB2 A;  2QS3 A;  3N6T A;  4ELO A;  2CMO A;  5AA4 B;  4OVJ A;  5KZT A;  4DCX A;  3G3J A;  1IXI A;  3RNN A;  4FEC A;  1Y4C A;  1BKA A;  2P2A A;  4YKP A;  3KZG A;  1LAH E;  2R71 A;  4U1Z A;  5CC2 A;  1N3X A;  2D3I A;  2XXP A;  3IB0 A;  3IAZ A;  3LSL A;  1Y20 A;  2XXT A;  3BBR A;  3FVO A;  4JB7 A;  1JEU A;  2H9B A;  4OMB A;  4R6K A;  4TLL B;  4EF1 A;  1I6Q A;  1WOD A;  2Z8E A;  4R2F A;  1ZMG A;  5AA2 D;  4G68 C;  2XD3 A;  3H6U A;  2BJJ X;  4GIZ A;  3O6I A;  3QIM A;  1I6A A;  1LB9 A;  1F9B A;  1FTM A;  1JW4 A;  4R2B A;  4LP2 B;  4KFQ A;  3PPO A;  1Y1Z A;  4OEV A;  4E0X A;  3U72 A;  3GBA A;  1MM6 A;  1MPB A;  1A99 A;  1B5H A;  1H3D A;  1MXU A;  1M5B A;  1RYX A;  2HXW A;  1ZU0 A;  3OD7 A;  1MS7 A;  4MF3 A;  4U21 A;  2UYE A;  3VLW A;  3RUM A;  3N6U A;  3KEI A;  3MQ9 A;  1IIT A;  2OZZ A;  1S50 A;  2Q2C A;  3MZ1 A;  2O6A A;  1DOT A;  5I59 B;  2OCU A;  2ONR A;  1H76 A;  1USY H;  1O7T A;  2XX8 A;  3MP8 A;  3PU5 A;  2QMX A;  4KHZ E;  1JW1 A;  3G7W A;  3VE1 B;  1LCF A;  4DXU A;  1SBP A;  2HEU A;  3E4R A;  2HCA A;  4U22 A;  4ESW A;  4R75 A;  1DTZ A;  1N7X A;  2X7P A;  3DM0 A;  3PGF A;  4JBZ A;  3TMG A;  2Y7P A;  1UTH B;  3IJX B;  1N0T A;  1SYI A;  3M8U A;  3MVW A;  3TTR A;  4K3F A;  1LFI A;  4G68 B;  2IA4 A;  1FQA A;  1QUJ A;  3I6V A;  4JXI A;  3IK6 B;  4LAT A;  4N07 A;  3TFL A;  4BDM A;  3FVK A;  2O7I A;  1P1W A;  3C9H A;  4G8M A;  4R9G A;  4YZZ A;  3FJM A;  3PD8 A;  4NWD A;  4ELP A;  2E1S A;  3O28 A;  3VV5 A;  2GFE A;  3M3L A;  1UTB A;  4KD5 A;  1LFH A;  1IQ7 A;  1I6B A;  3H4Z A;  4O3C A;  3IL1 B;  4TOZ A;  2Y7R A;  3EPE A;  3K1M A;  2OWS A;  2HFB A;  4FEB A;  4TQU Q;  2VD2 A;  1MY0 A;  3F11 A;  4XIG Q;  4JWY A;  2AYS A;  5TP9 B;  2W7Y A;  5K2X A;  1XS5 A;  1B9J A;  1HSE A;  1YAE A;  1AIV A;  4NMY A;  4OXV A;  1A40 A;  4OET A;  3U92 A;  1JQF A;  3QAX A;  4KYD A;  4RJZ A;  1FTL A;  3GLB A;  5CRY A;  1SDX A;  2Q9T A;  1EZ9 A;  4XTC Q;  1OLC A;  2H98 A;  1B46 A;  2PT1 A;  3T96 B;  3TAJ A;  3B6T A;  2M8C A;  2Q88 A;  4U4X A;  4G4P A;  5TPA B;  1NH7 A;  1LAG E;  1D9Y A;  5I56 B;  5ICT A;  4Z7E A;  4XKP A;  3N94 A;  4ZEI A;  3H6V A;  1D3K A;  5H8F A;  1H44 A;  4QFO A;  4R9F A;  3IOU A;  2I6E A;  1A8E A;  1LGB C;  4IGR A;  2AIX A;  5HPQ A;  3GZG A;  4MH5 A;  3OO7 A;  2HAU A;  3FV1 A;  2UVH A;  1OQH A;  3GXA A;  1JNF A;  3V5A A;  3S9M C;  2DP8 A;  4P11 A;  5I58 A;  4LZ8 A;  1TWY A;  4OWD A;  3PPP A;  3UP9 A;  3CG1 A;  3U93 A;  3OEN A;  4JWX A;  3C34 A;  4YB7 A;  4Z0I A;  1ATG A;  3G3F A;  1B3H A;  4HTG A;  2XXY A;  4PQJ A;  1L5T A;  4IB2 A;  2DE2 A;  1XVX A;  5EYF A;  3ILU B;  3MC2 A;  4Q5T A;  4AQ4 A;  4IO6 A;  3UIF A;  4BDQ A;  3RLF E;  4F31 B;  1RKM A;  2Y7K A;  4NWC A;  5DVJ A;  2V25 A;  4F18 A;  1B0H A;  3IJO B;  2DSF A;  4EUO A;  4GWO A;  3CFX A;  4NF8 B;  1P1U A;  4KYE A;  5HM4 B;  4X48 A;  1DSN A;  4QFK A;  5F1Q A;  3M3F A;  3IX1 A;  2OBG A;  5I56 A;  1DPE A;  4AB6 A;  4YMB A;  1MY4 A;  4PFY A;  4F2O A;  3EN3 A;  5TP9 A;  1MQH A;  3DP6 A;  3CR9 A;  5DT6 A;  3PD9 A;  2Z8F A;  3K01 A;  2F6P A;  3FGS A;  3K02 A;  4IY6 A;  2ZYO A;  3K0V A;  3SER A;  1IXG A;  1Z7N E;  4FAT A;  1P1O A;  3CIJ A;  1B7H A;  1SW1 A;  1Y9U A;  2XXQ A;  1CB6 A;  2F78 A;  3D4G A;  3EHS A;  1SW5 A;  3OXN A;  4F1Y A;  4H1X A;  5AE4 A;  4Q0C A;  5L9S A;  3GBB A;  2X26 A;  4EDP A;  3I5O A;  3TEL A;  4RPO A;  3SEV A;  3RTW B;  4H65 A;  1US4 A;  5CM6 A;  3QYT A;  1BIY A;  1B3F A;  2PMS A;  3HO7 A;  4GQO A;  3R26 A;  4KQP A;  1S7Y A;  3TDJ A;  3TUS A;  3TQW A;  1PC3 A;  2DXR A;  5DVI A;  1SYH A;  3A3C A;  1UQW A;  2B3B A;  2F35 A;  2V3Q A;  3KOT A;  3EQ1 A;  4OZ9 A;  3MBP A;  4Q30 B;  4WED A;  3KFM A;  5H8Q B;  1LLS A;  1LB8 A;  3N26 A;  1IZ1 A;  2ZYK A;  4DXC A;  3S9N C;  3QK6 A;  3K6X A;  2QL3 A;  4FED A;  3T9H B;  3VVE A;  1MXV A;  1ZIU A;  4TLM B;  2B65 A;  3ONM A;  4BDO A;  3U8Q A;  1EZP A;  3SEY A;  1AH5 A;  2ALU A;  3TYH A;  1B1H A;  3C35 A;  3KJT A;  4Q8R A;  2I0B A;  1T0K A;  1NKX A;  2QMW A;  5ICQ A;  4NF6 B;  1VFD A;  2ZMB A;  3FD3 A;  4QRZ A;  3W9V A;  2Z23 A;  3EHU A;  1ANF A;  4FJP A;  4RY1 A;  3V83 A;  1FCK A;  1J1N A;  3C33 A;  3L6G A;  3PUY E;  1PB8 A;  1WVJ A;  3OSQ A;  1UTB B;  1FQD A;  1QJM A;  3H03 A;  4WKM A;  3OEM A;  1MQG A;  1MH4 A;  3MW0 A;  1B2H A;  3OO8 A;  1FQF A;  1D4N A;  4C0R A;  3MP1 A;  1URS A;  3OSR A;  4THI A;  2GRV A;  1PEB A;  2XXW A;  3T66 A;  5KCJ B;  5I2K B;  3T22 A;  2F6G A;  5IKB A;  1N84 A;  2H99 A;  3OEL A;  1TFD A;  3TQL A;  4RXL A;  1OQG A;  5CMM A;  5FHN A;  4YAH X;  3TCG A;  1AMF A;  1JEV A;  4GXA A;  4ISU A;  2HQ0 A;  4OFL A;  2HZK A;  3ECR A;  1ELJ A;  1DMB A;  3G3G A;  1Y4T A;  3O97 A;  3P7I A;  4DZ1 A;  1NFT A;  3S2V A;  3TKD A;  2RC9 A;  2Z8D A;  3IOW A;  3K6V A;  4LUB A;  3K6W A;  1NNT A;  3VDF A;  1XOC A;  4DLD A;  1M5C A;  1BTJ A;  2OK2 A;  2PYY A;  2P0S A;  1LCT A;  3RY3 A;  5I57 B;  4EQB A;  4GL0 A;  1GGG A; 
#chains in the Genus database with same CATH topology
 1QKB A;  4LQ5 A;  3T93 B;  3B7D A;  4OA4 A;  1N04 A;  2XXX A;  1QW0 A;  5TP9 A;  2CZI A;  4I1D A;  4OER A;  3SEW A;  5L9M A;  4FOR A;  5ET7 A;  4GWX A;  4EXK A;  5A5X A;  1SVX B;  2XHD A;  3B8B A;  1FSA A;  3QUF A;  3HCQ A;  4BDL A;  3GYY A;  2NUV A;  4H8I A;  4KR5 A;  3FZV A;  2V3T A;  5DTB A;  5EHS A;  2P1S A;  2Y84 A;  2Q8J A;  2D21 A;  4NX1 A;  2ZZV A;  1URD A;  4OVS A;  3WAE A;  3K1N A;  4F19 A;  3JYR A;  3Q25 A;  1EU8 A;  2I4C A;  2XXU A;  4U1O A;  1NV6 A;  4LZ5 A;  1MY2 A;  4IR8 A;  3CFZ A;  2ONS A;  2I58 A;  4PBQ A;  4GLI A;  5DYH A;  1YTV A;  4ECF A;  2VGQ A;  1FBG A;  4FE8 A;  2AL5 A;  5J1D A;  3PUX E;  1IMC A;  1FJ9 A;  4POW A;  5EQA A;  1GTK A;  2PFZ A;  4OQO A;  3CSG A;  3VXC A;  4IO5 A;  1Y3P A;  3CRB A;  1H45 A;  3FV2 A;  1GR2 A;  1MPD A;  1XHY A;  1POT A;  3CSB A;  2Y5L A;  4MBP A;  1LAF E;  2O1L A;  4PFR A;  1IXH A;  3PTY A;  2FA7 A;  4NF6 B;  1N76 A;  3PUZ E;  4PFW A;  4N4U A;  1MXW A;  1B58 A;  2FBP A;  4RK2 A;  2I49 A;  3E3K A;  3TTL A;  2H25 A;  4DI4 B;  2WBD A;  5DW8 A;  1NUZ A;  4F2Q A;  4ELQ A;  1FTO A;  4XXU A;  2NVU B;  2UVG A;  1HSJ A;  5LDZ A;  3MZ9 A;  4L17 A;  1P1Q A;  2DXY A;  4H5G A;  3VFJ A;  1FPJ A;  5HBC A;  5I5P A;  2X7Q A;  2O1M A;  3HHF A;  1A54 A;  5F7V A;  2HZL A;  4LZ7 A;  2O51 A;  4E0W A;  2QPQ A;  1B6H A;  4LQ2 A;  2GHB A;  2PVU A;  1FPL A;  4OHN A;  4GXS B;  1Y1M A;  2ZNT A;  2HAV A;  3T9V A;  4UAB A;  2QJE A;  2PCR A;  3I3V A;  2XA5 A;  2KR0 A;  2ZNS A;  1FPF A;  4PGP A;  3ODB A;  4HCY A;  2GQ1 A;  1FQB A;  3VLU A;  4I62 A;  1S9T A;  4P0I A;  5H8N B;  2NOO A;  3PPN A;  3KN7 A;  4MCO A;  4MHF A;  1IME A;  2O69 A;  3OO6 A;  3R7X A;  1RDZ A;  2ZYN A;  1FQE A;  5KDT B;  3MP6 A;  4X8R A;  4KPT A;  3A09 A;  3FJ7 A;  3H3G A;  4ZZE A;  2DWJ A;  1B5J A;  4N6K A;  4I3E A;  4NF4 B;  1N7W A;  4MLV A;  2F34 A;  4LVQ A;  3FUZ A;  1IIW A;  3TTK A;  3K4U A;  1MQI A;  3KJ7 A;  5T3J A;  1SI0 A;  5FHM A;  5TU0 A;  3TCH A;  1LBB A;  4GRK A;  3BFU A;  4YKI A;  5CMC A;  1USY E;  2WKY A;  4M4G A;  4LA9 A;  4DXB A;  3SES A;  5FHO A;  4PFU A;  3MZB A;  5CI5 A;  1ZLQ A;  2RC8 A;  4NF4 A;  4HCW A;  1LBY A;  4YIC A;  2QS4 A;  3CI8 A;  4QXD A;  3FXB A;  4F1U A;  1LBX A;  4ZED A;  3H7M A;  4YKJ A;  2AL4 A;  3SEU A;  1P99 A;  1R1N A;  1CE2 A;  5IAI A;  1JVY A;  3RT8 A;  4BDN A;  2QVV A;  2XXR A;  3ROJ A;  3G3J A;  5CC2 A;  1N3X A;  2XXP A;  3LSL A;  4R6K A;  2Z8E A;  1WOD A;  1ZMG A;  4PF6 A;  4O7I A;  1LB9 A;  5IZZ A;  4R2B A;  3U72 A;  3GBA A;  1A99 A;  1B5H A;  4F3G A;  1ZU0 A;  3MQ9 A;  3MZ1 A;  5I59 B;  4N81 A;  2ONR A;  3MP8 A;  1O7T A;  2HCA A;  4NF0 A;  3DM0 A;  1FTA A;  4JBZ A;  2Y7P A;  1N0T A;  3TTR A;  1LFI A;  1FQA A;  3IK6 B;  4G8M A;  5B7D A;  1P1W A;  1SPI A;  4YZZ A;  4NWD A;  3VV5 A;  3M3L A;  3LV0 A;  4KD5 A;  1FBP A;  1IQ7 A;  2WX9 A;  2VD2 A;  3F11 A;  4JWY A;  1XS5 A;  1HSE A;  1YAE A;  1FPD A;  4OET A;  3GLB A;  2PT1 A;  2VPO A;  2L5V A;  2M8C A;  5TPA B;  1D9Y A;  5ICT A;  4DI3 D;  4ZEI A;  3H6V A;  1NUW A;  4IGR A;  4HE0 A;  4P11 A;  4LZ8 A;  1TWY A;  4OWD A;  3UP9 A;  3CG1 A;  4Z0I A;  4HTG A;  3MC2 A;  4Q5T A;  3UIF A;  2Y7K A;  5DVJ A;  4GX4 A;  1NI9 A;  4NF8 B;  4I40 A;  4KYE A;  4PCD A;  3M3F A;  1DPE A;  4YMB A;  3BIH A;  4OVR A;  5J16 A;  3DP6 A;  2F6P A;  4FAT A;  4Q0C A;  2X26 A;  4EDP A;  3TEL A;  3RTW B;  1BIY A;  3R26 A;  1SYH A;  3A3C A;  2V3Q A;  3EQ1 A;  4WED A;  3MBP A;  4Q30 B;  3K6X A;  3T9H B;  2MKZ A;  2B65 A;  3ONM A;  1EZP A;  1T0K A;  3KJT A;  1VFD A;  4QRZ A;  4FJP A;  3H03 A;  1D4N A;  4THI A;  2GRV A;  4H46 A;  3OEL A;  3TQL A;  3KC0 A;  4GXA A;  1ELJ A;  1DMB A;  5KCJ A;  1NFT A;  3TKD A;  1EYJ A;  2RC9 A;  2Z8D A;  3IOW A;  3K6V A;  3VDF A;  4PC9 A;  5EQ7 A;  5I57 B;  4EQB A;  4GL0 A;  1GGG A;  1JP4 A;  1MPC A;  2I3W A;  1K9Z A;  2YJP A;  1ZBM A;  5DEX A;  1H43 A;  1XVY A;  5K2Y A;  5I2N A;  4I3Y A;  4N8Y A;  4HS7 A;  3O6H A;  2PX1 A;  3UN6 A;  3U1O A;  1O63 A;  3B6Q A;  3TTN A;  4U23 A;  5JTY B;  4IO3 A;  3H6T A;  2H4I A;  2HHM A;  2DOJ A;  1FQC A;  3LC8 A;  4KCC A;  2Y7W A;  3O29 A;  1PB9 A;  4O3B A;  2FVZ A;  3ZS6 A;  1QUL A;  3B6W A;  3AXF A;  3USD A;  1NV0 A;  3TPA A;  2FYI A;  5JTY A;  1B3L A;  4QFL A;  2V3U A;  1N3W A;  5DVF A;  1RYO A;  5H8H A;  4PP0 A;  1URG A;  2ZYM A;  4R72 A;  1JW5 A;  2OX3 A;  2F97 A;  2QSX A;  3E13 X;  2KLF A;  4P1L A;  1R9Q A;  2RIN A;  4PE5 B;  4G8N A;  4AS5 A;  4YB5 A;  4ZE8 A;  3RGY A;  3FXQ A;  2CZK A;  1M5F A;  3MVY A;  4WEP A;  3U94 A;  5ISU A;  1YYZ A;  1Q35 A;  1VFE A;  3KN8 A;  1G0I A;  3RT6 B;  3WAF A;  3RTF B;  2IEE A;  4OFO A;  1P1N A;  4R6H A;  4PF8 A;  1EH3 A;  1EZO A;  3FVG A;  2XD2 A;  4XKQ A;  4O3A A;  4WXJ A;  3FXU A;  3MUQ A;  5AA2 B;  1NNF A;  4XF5 A;  2REG A;  1PDA A;  4JSO A;  1BLF A;  2PT2 A;  4U4S A;  4ZS9 A;  3TOD A;  1B4Z A;  2DE3 A;  3W9W A;  1FPI A;  4ZE9 A;  4PE3 A;  4FAJ A;  4AS4 A;  1MXY A;  2F5X A;  1OVB A;  2DVC A;  1HSL A;  1Y3N A;  1MDQ A;  1OMP A;  5M2V A;  4X04 A;  1FBD A;  3JZJ A;  2CZH A;  4KYS A;  3K6U A;  1B51 A;  3CVG A;  1VR5 A;  4RYA A;  2O68 A;  2XWV A;  3PPR A;  2WYK A;  4F39 A;  3FAT A;  1B3E A;  5H8N A;  1LST A;  2RKM A;  4RPN A;  3MPL A;  3V89 B;  3EHT A;  1M5E A;  4PAF A;  3KSJ A;  4LON B;  3HN0 A;  3BKI B;  1A8F A;  1B05 A;  1IEJ A;  1MXZ A;  3LR1 A;  1B40 A;  3T0J A;  4YKK A;  4OTE A;  5H8S A;  4PET A;  4ZEC A;  1FTK A;  3A29 A;  1IXC A;  2VD3 A;  1A55 A;  1KWH A;  1FBF A;  4JVD A;  3FVN A;  4NE4 A;  4X9T A;  5BUU A;  2Q74 A;  4G61 A;  4UAC A;  2OWT A;  3DP8 A;  3DP4 A;  4EF2 A;  5CBS A;  1XC1 A;  1LBC A;  3KSX A;  4HE1 A;  1B1X A;  3DLN A;  4BLA A;  1NUX A;  1IMB A;  3CG3 A;  4F3B A;  3C4M A;  2O7U A;  3THI A;  1II5 A;  2THI A;  3G3H A;  3LUY A;  2I4B A;  1IUD A;  3RQT A;  4X1D A;  2VOZ A;  2ZXT A;  2UVJ A;  3PMW A;  1AOV A;  2RC7 A;  3K1P A;  3PUV E;  2REJ A;  1SQY A;  3D4C A;  1INP A;  2V84 A;  3EF7 A;  1NH8 A;  5FBP A;  1SI1 A;  2QFL A;  5I2K A;  4RK9 A;  5IM2 A;  2R6G E;  2I3V A;  4XFE A;  3Q29 A;  3N6T A;  2CMO A;  4OVJ A;  1BKA A;  1LAH E;  4LN5 A;  4U1Z A;  4XEQ A;  2H9B A;  4EF1 A;  3IFC A;  5AA2 D;  1EYK A;  1I6A A;  4MAG A;  3PPO A;  4E0X A;  1MPB A;  1H3D A;  1MXU A;  1RYX A;  2CEX A;  2UYE A;  3VLW A;  3KEI A;  1IMF A;  2O6A A;  1DOT A;  1H76 A;  1USY H;  4ESX A;  4MNP A;  3RPL A;  4ESW A;  1N7X A;  4MJO A;  1UTH B;  3IJX B;  4H45 A;  5IGA A;  4K3F A;  2IA4 A;  2O7I A;  4R9G A;  3C9H A;  3FJM A;  3O28 A;  2GFE A;  1LFH A;  3H4Z A;  4O3C A;  3IL1 B;  4TOZ A;  2OWS A;  2HFB A;  2W7Y A;  4NMY A;  5CRY A;  3TAJ A;  2Q88 A;  4G4P A;  1NH7 A;  4MMP A;  4XKP A;  1LGB C;  4OVQ A;  3OO7 A;  3FV1 A;  2UVH A;  3S9M C;  3LUZ A;  3U93 A;  4JWX A;  4YB7 A;  3G3F A;  1B3H A;  4GWY A;  2XXY A;  4PTK A;  5EYF A;  4BDQ A;  4F31 B;  1FPG A;  4NWC A;  4F18 A;  1B0H A;  2DSF A;  1P1U A;  1DSN A;  5F1Q A;  4PFY A;  1MQH A;  4N91 A;  5DT6 A;  3PD9 A;  3SER A;  4P3L A;  1IXG A;  1CB6 A;  3EHS A;  3OXN A;  2KQZ A;  4H1X A;  5I3S A;  5AE4 A;  3GBB A;  4RPO A;  1US4 A;  1B3F A;  3HO7 A;  1S7Y A;  3TQW A;  1PC3 A;  2DXR A;  2WBB A;  1UQW A;  3RPW A;  1LLS A;  1MXV A;  1ZIU A;  4TLM B;  4BDO A;  1AH5 A;  1B1H A;  3C35 A;  2QMW A;  5ICQ A;  3W9V A;  3EHU A;  3V83 A;  1WVJ A;  2F3D A;  4WKM A;  3OEM A;  1MQG A;  3MW0 A;  1B2H A;  3MYU A;  4O8M A;  2XXW A;  5I2K B;  2F6G A;  4P9K A;  5FHN A;  5CMM A;  4YAH X;  4ISU A;  2HQ0 A;  3ECR A;  3G3G A;  3S2V A;  3FBP A;  4LUB A;  1KA0 A;  1BTJ A;  4JVC A;  1LBW A;  2R9J A;  4NF6 A;  3LSW A;  3VLV A;  1US5 A;  3O66 A;  2A5T B;  1DCU A;  5EQ9 A;  2ZNU A;  5LOM A;  3S9L C;  2XXH A;  2ESN A;  1MXX A;  1NV3 A;  5CMK A;  1DTG A;  2F7B A;  3G3I A;  1PB7 A;  3QMF A;  4PAK A;  1B7U A;  2DWA A;  4H5F A;  3VVD A;  1NUY A;  3MWB A;  2Q2A A;  3C36 A;  5FTH A;  2FIE A;  3S4U A;  4QFN A;  3RN8 A;  4EQ7 A;  5L8D A;  3H6W A;  3QSL A;  4KXP A;  4NAP A;  3NOH A;  3O2A A;  1KZ8 A;  3TEP A;  3MJN A;  4H67 A;  3C31 A;  2XWI A;  1NV7 A;  2UVI A;  1KA1 A;  4GFR A;  5H8H B;  4ZDM A;  3ZKL A;  4NF5 B;  5JK4 A;  1MY3 A;  4GX6 A;  3RUM A;  5CMB A;  3MVX A;  2VP1 A;  1AL3 A;  4PFT A;  2V4C A;  3Q28 A;  1MRP A;  4GBW A;  4JDF A;  4MLQ A;  1Z7M E;  3IOR A;  5I7I A;  1UIU A;  1Y3Q A;  2GHA A;  4N8G A;  1TT1 A;  4NHB A;  4GOT A;  5AA4 A;  4U2R A;  4OES A;  3DEL B;  3IB1 A;  5EHM A;  4F22 A;  2ABH A;  3O6G A;  4G68 A;  3T1B A;  4PFB A;  3KG2 A;  3OO9 A;  1BP5 A;  4JSD A;  1XT8 A;  1DBZ A;  1NL5 A;  4X1B A;  4QSD A;  4RA1 A;  4HE2 A;  3T9U A;  3S9E A;  1OIB A;  1XI6 A;  2JJK A;  4QSC A;  2F7A A;  2I48 A;  2RF1 A;  4IO4 A;  5A5L A;  5L9O A;  1NV2 A;  3VXB A;  3VVF A;  4H0W A;  3N5L A;  4QF9 A;  4R73 A;  3KGC A;  4IO7 A;  1ZJL A;  2ANJ A;  5DEX B;  1TFA A;  5AA2 A;  5ELV A;  1UIV A;  3C32 A;  2V93 A;  2NXO A;  2DQV A;  4IY5 A;  1LBZ A;  4N6P A;  4GBV A;  5LTC A;  3OMB A;  4MNI A;  2Z22 A;  1MH3 A;  1QUI A;  4MX6 A;  1UTH A;  4OEN A;  5ESY A;  4OVP A;  1WDN A;  2VPN A;  3HFU A;  4NF5 A;  4EQ9 A;  2A5T A;  4P47 A;  4BDR A;  4G2Z A;  3PMX A;  3HPI A;  1FW0 A;  2UYF A;  4POX A;  1A7L A;  5H8Q A;  4NN3 A;  3TCF A;  4NQ8 A;  2OLB A;  4QSE A;  1FPB A;  4F3S A;  5BWJ A;  4AB5 A;  2RCA A;  3A3U A;  4GF8 A;  3QUJ A;  1LAX A;  1B3G A;  3LBS A;  1VSO A;  2QVR A;  1POY 1;  1PBP A;  2ZZX A;  2QS2 A;  2BJI A;  3JV9 A;  5ITP A;  3ZKK A;  5AA3 A;  1QUK A;  4XKR A;  5ET8 A;  2QS1 A;  5TPA A;  1NV4 A;  4YU0 A;  3R6U A;  4DDD A;  3CFL A;  3IOT A;  3H06 B;  1NNP A;  4I9D A;  3IFA A;  1NV1 A;  3FJG A;  1TXF A;  1MY1 A;  4NTL A;  2PBW A;  4JWO A;  1O64 A;  3IO6 A;  3UK4 A;  2HXR A;  2I0C A;  5EYG A;  4R6Y A;  4OFJ A;  2CZL A;  1MQJ A;  3UGW A;  4GL8 A;  3IO4 A;  4C1U A;  2QS3 A;  4ELO A;  5AA4 B;  4DCX A;  2WYP A;  1IXI A;  3RNN A;  4FEC A;  1Y4C A;  2P2A A;  2R71 A;  3IAZ A;  2Q8M A;  3BBR A;  4JB7 A;  4TLL B;  4OMB A;  1JEU A;  4R2F A;  4G68 C;  3H6U A;  4O94 A;  4GIZ A;  3O6I A;  3QIM A;  4LP2 B;  1Y1Z A;  4GWW A;  2HXW A;  1M5B A;  4MF3 A;  3OD7 A;  4U21 A;  3N6U A;  2Q2C A;  1S50 A;  2OCU A;  4KHZ E;  2QMX A;  3G7W A;  1SBP A;  2F3B A;  1DTZ A;  5EQ8 A;  5IZ1 A;  4OAN A;  3M8U A;  1QUJ A;  1K9Y A;  4ELP A;  1UTB A;  1I6B A;  2Y7R A;  3K1M A;  1IMD A;  4FEB A;  4XIG Q;  5TP9 B;  2AYS A;  5K2X A;  1B9J A;  4OXV A;  1A40 A;  3U92 A;  3QAX A;  4KYD A;  2PFY A;  1FTL A;  1EZ9 A;  2H98 A;  3T96 B;  4PFI A;  3B6T A;  2P3N A;  5I56 B;  3N94 A;  1D3K A;  3IOU A;  2I6E A;  1A8E A;  2AIX A;  5HPQ A;  4MH5 A;  1OQH A;  3GXA A;  5I58 A;  1FPE A;  4GWZ A;  3PPP A;  3UOR A;  3VE1 B;  3C34 A;  1ATG A;  1L5T A;  4IB2 A;  4AQ4 A;  1FBH A;  1RKM A;  3IJO B;  3CFX A;  5HM4 B;  4X48 A;  4QFK A;  2OBG A;  5I56 A;  4AB6 A;  1MY4 A;  2Z8F A;  4IY6 A;  1YZ0 A;  1B7H A;  2F78 A;  3D4G A;  4F1Y A;  3SEV A;  4H65 A;  4MIJ A;  3QYT A;  4KQP A;  4GQO A;  3E79 A;  5DVI A;  2B3B A;  3KOT A;  3KFM A;  3N26 A;  2ZYK A;  3S9N C;  3QK6 A;  2QL3 A;  3VVE A;  2CEY A;  2R8T A;  3SEY A;  4Q8R A;  2ALU A;  3TYH A;  2I0B A;  1NKX A;  2ZMB A;  2WEF A;  3CHG A;  2B4M A;  3PUY E;  1PB8 A;  3OSQ A;  1UTB B;  4GX3 A;  1FQD A;  1QJM A;  1MH4 A;  3OO8 A;  1FQF A;  3MP1 A;  1URS A;  3OSR A;  4HXV A;  3T66 A;  5IKB A;  2H99 A;  1TFD A;  1OQG A;  4PGN A;  1IMA A;  1JEV A;  3TCG A;  5IZ3 B;  4OFL A;  3O97 A;  3P7I A;  5KDT A;  3K6W A;  1M5C A;  2P0S A;  1LCT A;  4FBP A;  4IO2 A;  4I8C A;  3SEX A;  4ZEB A;  2G93 A;  2XWK A;  2DYX A;  1I69 A;  2P3V A;  4HW8 A;  3KBR A;  2D5W A;  5ITO A;  5A5X B;  2F7C A;  1MG1 A;  3HHG A;  3IOV A;  5I59 A;  3K00 A;  2DE4 A;  4F3P A;  3M3K A;  4MFI A;  2QRY A;  4IGT A;  4PDH A;  5I57 A;  2G29 A;  3FAS A;  3OEK A;  2OJT A;  2ONK E;  4FIM A;  4GD5 A;  4P0G A;  4P1E A;  1YXI A;  4UA8 A;  4NED A;  1D9Q A;  3HST A;  2QVU A;  1QVS A;  2HPG A;  1VDW A;  4G77 A;  4DCY A;  4DE8 A;  1B32 A;  4ZZA A;  4QHQ A;  1CNQ A;  4H6D A;  5ET5 A;  4N13 A;  2XX7 A;  3EKI A;  1B4H A;  3OOA A;  1JVX A;  3Q27 A;  3SKP A;  1B0L A;  1QGX A;  4ONY A;  5I58 B;  3TTM A;  5FTI A;  3UA8 A;  5CBR A;  4G8H A;  1GVC A;  1SW2 A;  1ZTY A;  4QFP A;  4NF8 A;  3SDF A;  1DK4 A;  1SD3 A;  2B4L A;  3PPQ A;  2DWH A;  1FPK A;  1JET A;  4F1V A;  2VHA A;  3MPK A;  5I84 A;  3ILT B;  2DS9 A;  3KOS A;  2VT5 A;  1MDP 1;  4KCD A;  1NNK A;  1VE4 A;  2FNC A;  4DIG A;  4ELR A;  4C1T A;  1FJ6 A;  4ND9 A;  4ZEK A;  3KBZ A;  4EXL A;  1G0H A;  3IR1 A;  1LEV A;  1NMU A;  2A5S A;  1YPN A;  2H5Y A;  4NG7 A;  4OEU A;  2OWZ A;  2LAO A;  3U65 A;  2Q89 A;  3MAM A;  2Y7I A;  3LSF B;  3RPL B;  4P8B A;  3FXR A;  5JEI A;  1DPP A;  3Q26 A;  2XX9 A;  4OYV A;  1FBC A;  1B52 A;  2B3F A;  1EYI A;  1MQD A;  5IZ3 A;  4YB6 A;  2DDK A;  2DVZ A;  3HV1 A;  1MM7 A;  4R74 A;  2F8D A;  2XXV A;  5AA1 A;  2NWJ A;  4YMA A;  2ZZW A;  3KN3 A;  4PDD A;  1Q1K A;  2DWI A;  2E0S A;  3RYD A;  1OLA A;  1OVT A;  5H8F B;  4KI0 E;  4GWU A;  1SW4 A;  3PUW E;  5I2N B;  3E78 A;  2F36 A;  3O9P A;  3QXM A;  1R9L A;  4N6D A;  3G3K A;  4P56 A;  4M1V A;  4DXU A;  2YPN A;  3K2D A;  2XXI A;  1LFG A;  5B70 A;  3PMV A;  4MEV A;  1FBE A;  4OVT A;  1M5D A;  4GVO A;  3W15 C;  2RCB A;  3SET A;  3ISP A;  1R6Z A;  2YLN A;  4MNC A;  1B7Z A;  2XXK A;  1FTJ A;  1B5I A;  4ZEF A;  3FIR A;  3T9X B;  3BFT A;  3L6H A;  2O84 X;  2UXA A;  4H8J A;  3E9X A;  1LBV A;  1D9V A;  4XKN A;  1ZKB A;  1PBQ A;  5EYH A;  3LSX A;  3ZSF A;  2GH9 A;  5F24 A;  1GV8 A;  4F29 A;  3MVZ A;  3V8X B;  4N15 A;  4RNS A;  3TZA A;  3PV0 E;  1YCJ A;  1QKA A;  3IB2 A;  5KZT A;  1AWB A;  3BIG A;  3D1R A;  4YKP A;  3KZG A;  2D3I A;  3IB0 A;  1Y20 A;  2XXT A;  3FVO A;  1I6Q A;  2FIX A;  2XD3 A;  2BJJ X;  1F9B A;  1FTM A;  1JW4 A;  4KFQ A;  4OEV A;  1MM6 A;  1MS7 A;  1RDY A;  1IIT A;  2OZZ A;  4O7M A;  2XX8 A;  3PU5 A;  4PAI A;  1JW1 A;  1LCF A;  2HEU A;  3E4R A;  4U22 A;  4R75 A;  2X7P A;  3PGF A;  3TMG A;  1SYI A;  3MVW A;  4G68 B;  3I6V A;  4JXI A;  4LAT A;  4N07 A;  4NGU A;  3TFL A;  4BDM A;  3FVK A;  3PD8 A;  2E1S A;  2FHY A;  3EPE A;  4TQU Q;  1MY0 A;  1AIV A;  4GWS A;  3SZP A;  3B50 A;  1JQF A;  4JVI A;  4N17 A;  4RJZ A;  1SDX A;  2Q9T A;  4XTC Q;  1OLC A;  1B46 A;  4U4X A;  1LAG E;  4Z7E A;  5H8F A;  1H44 A;  4QFO A;  4R9F A;  3MST A;  3GZG A;  2HAU A;  3V5A A;  1JNF A;  2DP8 A;  3OEN A;  4PQJ A;  2DE2 A;  1XVX A;  3ILU B;  4QBA A;  4IO6 A;  3RLF E;  2V25 A;  1RDX A;  4EUO A;  4GWO A;  5ET6 A;  3IX1 A;  4F2O A;  3EN3 A;  3CR9 A;  3KC1 A;  3K01 A;  3FGS A;  3K02 A;  2ZYO A;  3K0V A;  1Z7N E;  1P1O A;  3CIJ A;  1SW1 A;  1Y9U A;  1SW5 A;  5L9S A;  3I5O A;  5CM6 A;  2PMS A;  3TDJ A;  3TUS A;  2F35 A;  5H8Q B;  4OZ9 A;  4DXC A;  1LB8 A;  1IZ1 A;  1Q9D A;  2Y5K A;  4FED A;  1NV5 A;  3U8Q A;  3FD3 A;  2Z23 A;  4RY1 A;  1ANF A;  1J1N A;  1FCK A;  3C33 A;  3L6G A;  1FRP A;  4C0R A;  1PEB A;  5KCJ B;  3T22 A;  1BK4 A;  1N84 A;  4RXL A;  1AMF A;  2HZK A;  4PBH A;  4DZ1 A;  1Y4T A;  1NNT A;  1XOC A;  4DLD A;  2OK2 A;  2PYY A;  3RY3 A;  2XWO A;  2XXQ A; 
#chains in the Genus database with same CATH homology
 4IO2 A;  4I8C A;  1MPC A;  2R9J A;  4NF6 A;  1QKB A;  2G93 A;  2I3W A;  3LSW A;  4ZEB A;  3SEX A;  2DYX A;  3VLV A;  1I69 A;  4LQ5 A;  1US5 A;  3T93 B;  4HW8 A;  3B7D A;  3O66 A;  2A5T B;  2D5W A;  3KBR A;  1N04 A;  2XXX A;  1QW0 A;  2YJP A;  5ITO A;  1ZBM A;  4I1D A;  2F7C A;  4OER A;  5DEX A;  1MG1 A;  2ZNU A;  5L9M A;  3SEW A;  1H43 A;  5LOM A;  3S9L C;  2XXH A;  4FOR A;  2ESN A;  3HHG A;  4EXK A;  1XVY A;  3IOV A;  1MXX A;  5K2Y A;  5I2N A;  5I59 A;  5A5X A;  1SVX B;  2XHD A;  3K00 A;  4HS7 A;  3O6H A;  5CMK A;  2PX1 A;  1DTG A;  2DE4 A;  3QUF A;  3HCQ A;  2F7B A;  3U1O A;  3UN6 A;  1O63 A;  2NUV A;  3G3I A;  4BDL A;  1PB7 A;  3M3K A;  4F3P A;  4H8I A;  4MFI A;  2QRY A;  4IGT A;  3B6Q A;  4KR5 A;  3TTN A;  1B7U A;  2DWA A;  3FZV A;  4H5F A;  2V3T A;  4U23 A;  5I57 A;  5DTB A;  5EHS A;  2P1S A;  2Y84 A;  2G29 A;  2D21 A;  2Q8J A;  3VVD A;  3MWB A;  2Q2A A;  3FAS A;  3OEK A;  5JTY B;  4IO3 A;  1URD A;  2OJT A;  3H6T A;  3WAE A;  3K1N A;  2H4I A;  2ONK E;  3C36 A;  4FIM A;  5FTH A;  3S4U A;  4F19 A;  4QFN A;  3RN8 A;  2DOJ A;  4EQ7 A;  4GD5 A;  4P0G A;  3JYR A;  3Q25 A;  1EU8 A;  1FQC A;  5L8D A;  3LC8 A;  4KCC A;  2I4C A;  2Y7W A;  2XXU A;  3H6W A;  3QSL A;  4UA8 A;  3O29 A;  4LZ5 A;  4NED A;  3HST A;  1PB9 A;  4U1O A;  1MY2 A;  3O2A A;  4O3B A;  3CFZ A;  2ONS A;  1QVS A;  2I58 A;  3ZS6 A;  3UA8 A;  1QUL A;  3TEP A;  3MJN A;  4GLI A;  4G77 A;  3B6W A;  3AXF A;  4H67 A;  3USD A;  4DCY A;  4DE8 A;  1B32 A;  5DYH A;  4ZZA A;  1YTV A;  4ECF A;  4QHQ A;  2VGQ A;  3C31 A;  3TPA A;  2UVI A;  4H6D A;  4N13 A;  4FE8 A;  4GFR A;  5H8H B;  2AL5 A;  2FYI A;  4ZDM A;  1B3L A;  3PUX E;  4QFL A;  2XX7 A;  3ZKL A;  5J1D A;  5JTY A;  4NF5 B;  5JK4 A;  1MY3 A;  1B4H A;  1N3W A;  1JVX A;  2V3U A;  3OOA A;  3Q27 A;  4POW A;  1B0L A;  5DVF A;  1GTK A;  1RYO A;  4ONY A;  5CMB A;  5H8H A;  3SKP A;  5I58 B;  4OQO A;  4PP0 A;  3CSG A;  3UOR A;  3MVX A;  1URG A;  2VP1 A;  5FTI A;  3TTM A;  2ZYM A;  4G8H A;  1JW5 A;  4R72 A;  1GVC A;  1SW2 A;  3VXC A;  5CBR A;  5KCJ A;  1AL3 A;  1ZTY A;  2F97 A;  2QSX A;  3E13 X;  4IO5 A;  4PFT A;  4QFP A;  1Y3P A;  3Q28 A;  4NF8 A;  1MRP A;  2KLF A;  3CRB A;  3SDF A;  1H45 A;  1SD3 A;  1R9Q A;  4JDF A;  2RIN A;  3PPQ A;  4MLQ A;  1Z7M E;  3IOR A;  2DWH A;  3FV2 A;  4PE5 B;  4G8N A;  1JET A;  1GR2 A;  1MPD A;  1UIU A;  1XHY A;  1POT A;  1Y3Q A;  2GHA A;  3CSB A;  4MBP A;  4YB5 A;  4ZE8 A;  4F1V A;  3RGY A;  3FXQ A;  1TT1 A;  2VHA A;  1LAF E;  1M5F A;  4GOT A;  2O1L A;  4U2R A;  5AA4 A;  3MPK A;  3MVY A;  4OES A;  3DEL B;  3IB1 A;  5EHM A;  5I84 A;  4F22 A;  3ILT B;  1IXH A;  2DS9 A;  3KOS A;  4WEP A;  2FA7 A;  4KCD A;  1MDP 1;  2ABH A;  1N76 A;  1NNK A;  1VE4 A;  3O6G A;  2FNC A;  3PUZ E;  4G68 A;  3U94 A;  4DIG A;  4ELR A;  4F2Q A;  4C1T A;  5ISU A;  4PFW A;  3KG2 A;  1MXW A;  1Q35 A;  1VFE A;  3KN8 A;  3OO9 A;  3RT6 B;  3WAF A;  3RTF B;  2IEE A;  1BP5 A;  1B58 A;  4ND9 A;  4RK2 A;  4JSD A;  1XT8 A;  4OFO A;  1P1N A;  4ZEK A;  4R6H A;  1NL5 A;  2I49 A;  3E3K A;  4QSD A;  4RA1 A;  4X1B A;  3T9U A;  1OIB A;  2H25 A;  3TTL A;  4EXL A;  3S9E A;  3IR1 A;  1NMU A;  4QSC A;  1EH3 A;  2F7A A;  2I48 A;  2A5S A;  2RF1 A;  2XD2 A;  1FTO A;  3FVG A;  4XXU A;  2NVU B;  4ELQ A;  4IO4 A;  4XKQ A;  4O3A A;  1YPN A;  4WXJ A;  5L9O A;  3FXU A;  3VXB A;  3VVF A;  3MUQ A;  2H5Y A;  4H0W A;  2UVG A;  3N5L A;  1HSJ A;  4OEU A;  2LAO A;  3MZ9 A;  5AA2 B;  1NNF A;  4L17 A;  1P1Q A;  2Q89 A;  3MAM A;  2Y7I A;  2DXY A;  3LSF B;  2REG A;  1PDA A;  4QF9 A;  4R73 A;  3FXR A;  3KGC A;  4H5G A;  4IO7 A;  1ZJL A;  4JSO A;  2ANJ A;  5DEX B;  5A5X B;  1TFA A;  5AA2 A;  1BLF A;  2PT2 A;  4U4S A;  3VFJ A;  5ELV A;  1UIV A;  3C32 A;  5JEI A;  2V93 A;  1DPP A;  2NXO A;  4ZS9 A;  2DQV A;  4IY5 A;  5HBC A;  3TOD A;  2X7Q A;  2O1M A;  1B4Z A;  3Q26 A;  4N6P A;  2XX9 A;  2DE3 A;  3W9W A;  3HHF A;  1A54 A;  4OYV A;  4ZE9 A;  5F7V A;  1B52 A;  2HZL A;  4FAJ A;  4LZ7 A;  2B3F A;  1MQD A;  1MXY A;  2F5X A;  1OVB A;  3OMB A;  2O51 A;  2DVC A;  4E0W A;  1HSL A;  2QPQ A;  4YB6 A;  1B6H A;  1Y3N A;  1MDQ A;  1OMP A;  5M2V A;  4LQ2 A;  2DVZ A;  2GHB A;  2Z22 A;  2PVU A;  3HV1 A;  1MM7 A;  3JZJ A;  1MH3 A;  1QUI A;  3K6U A;  4KYS A;  1B51 A;  4OHN A;  2F8D A;  3CVG A;  4GXS B;  1Y1M A;  2XXV A;  4R74 A;  1UTH A;  5AA1 A;  2NWJ A;  2ZNT A;  4OEN A;  4YMA A;  2HAV A;  3KN3 A;  3T9V A;  1VR5 A;  4RYA A;  2QJE A;  1Q1K A;  2O68 A;  3PPR A;  2DWI A;  2E0S A;  3I3V A;  1OLA A;  1OVT A;  5H8F B;  1WDN A;  4KI0 E;  4NF5 A;  4EQ9 A;  2ZNS A;  2A5T A;  1SW4 A;  4F39 A;  3FAT A;  3PUW E;  1B3E A;  5I2N B;  5H8N A;  3ODB A;  4BDR A;  4HCY A;  1LST A;  4G2Z A;  3PMX A;  3HPI A;  1FQB A;  2RKM A;  4RPN A;  3VLU A;  3MPL A;  4I62 A;  1S9T A;  1FW0 A;  4P0I A;  2UYF A;  3V89 B;  2F36 A;  3EHT A;  1M5E A;  3O9P A;  3QXM A;  4POX A;  2NOO A;  1R9L A;  3KSJ A;  3PPN A;  4LON B;  1A7L A;  5H8N B;  3HN0 A;  3KN7 A;  3G3K A;  5H8Q A;  3OO6 A;  2O69 A;  3BKI B;  3R7X A;  3TCF A;  4M1V A;  1A8F A;  1B05 A;  2OLB A;  1IEJ A;  1MXZ A;  2ZYN A;  1B40 A;  2YPN A;  3LR1 A;  4OTE A;  4QSE A;  4PET A;  1FQE A;  3K2D A;  4YKK A;  5H8S A;  4ZEC A;  3MP6 A;  4F3S A;  5KDT B;  2XXI A;  5BWJ A;  1FTK A;  3A09 A;  4KPT A;  1LFG A;  5B70 A;  3FJ7 A;  3H3G A;  3PMV A;  4AB5 A;  1IXC A;  2VD3 A;  4ZZE A;  2DWJ A;  2RCA A;  1A55 A;  1B5J A;  3A3U A;  4GF8 A;  1KWH A;  3QUJ A;  1LAX A;  1N7W A;  4NF4 B;  4MLV A;  4NE4 A;  3FVN A;  1M5D A;  4GVO A;  4X9T A;  3W15 C;  1B3G A;  2F34 A;  3LBS A;  5BUU A;  2RCB A;  3SET A;  1VSO A;  4LVQ A;  4UAC A;  2OWT A;  3DP8 A;  3FUZ A;  1IIW A;  3DP4 A;  3TTK A;  1POY 1;  1R6Z A;  1PBP A;  2YLN A;  4EF2 A;  5CBS A;  2QS2 A;  1XC1 A;  1B7Z A;  1MQI A;  1LBC A;  3JV9 A;  1FTJ A;  3K4U A;  1SI0 A;  3KJ7 A;  3KSX A;  5FHM A;  5ITP A;  5TU0 A;  1B1X A;  3DLN A;  3TCH A;  1B5I A;  1LBB A;  3ZKK A;  4ZEF A;  3FIR A;  4GRK A;  5KDT A;  3BFU A;  5AA3 A;  1QUK A;  4XKR A;  4YKI A;  3T9X B;  4BLA A;  5CMC A;  1USY E;  3BFT A;  2WKY A;  2QS1 A;  3L6H A;  2O84 X;  4M4G A;  4LA9 A;  3RPW A;  4DXB A;  3CG3 A;  3SES A;  3C4M A;  5FHO A;  5TPA A;  2O7U A;  4F3B A;  3THI A;  1II5 A;  2THI A;  3G3H A;  3LUY A;  4PFU A;  4YU0 A;  2I4B A;  2UXA A;  4H8J A;  3E9X A;  1IUD A;  3RQT A;  3MZB A;  3R6U A;  5CI5 A;  4DDD A;  4F3G A;  1ZLQ A;  2RC8 A;  4NF4 A;  1EZO A;  3CFL A;  4X1D A;  2VOZ A;  2ZXT A;  1D9V A;  2UVJ A;  4XKN A;  3PMW A;  2QS4 A;  4HCW A;  1ZKB A;  1PBQ A;  3IOT A;  3CI8 A;  3H06 B;  2RC7 A;  4YIC A;  4ESX A;  1AOV A;  3LSX A;  1NNP A;  3K1P A;  4I9D A;  5B7D A;  4F1U A;  3PUV E;  3ZSF A;  2GH9 A;  2REJ A;  3FJG A;  1SQY A;  1TXF A;  1GV8 A;  1MY1 A;  3H7M A;  2PBW A;  3D4C A;  4JWO A;  1O64 A;  4NTL A;  4YKJ A;  4ZED A;  2V84 A;  3EF7 A;  1NH8 A;  3IO6 A;  3UK4 A;  2I0C A;  2AL4 A;  3SEU A;  1SI1 A;  4R6Y A;  1P99 A;  1R1N A;  4OFJ A;  4F29 A;  2CZL A;  5I2K A;  1CE2 A;  1MQJ A;  5IAI A;  3MVZ A;  1JVY A;  3UGW A;  4RK9 A;  3RT8 A;  3V8X B;  4BDN A;  4RNS A;  2R6G E;  2XXR A;  2I3V A;  3IO4 A;  3PV0 E;  1YCJ A;  4GL8 A;  3TZA A;  4C1U A;  1QKA A;  3Q29 A;  3IB2 A;  2QS3 A;  3N6T A;  4ELO A;  2CMO A;  5AA4 B;  4OVJ A;  5KZT A;  4DCX A;  3G3J A;  1IXI A;  3RNN A;  4FEC A;  1Y4C A;  1BKA A;  2P2A A;  4YKP A;  3KZG A;  1LAH E;  2R71 A;  4U1Z A;  5CC2 A;  1N3X A;  2D3I A;  2XXP A;  3IB0 A;  3IAZ A;  3LSL A;  1Y20 A;  2XXT A;  3BBR A;  3FVO A;  4JB7 A;  1JEU A;  2H9B A;  4OMB A;  4R6K A;  4TLL B;  4EF1 A;  1I6Q A;  1WOD A;  2Z8E A;  4R2F A;  1ZMG A;  5AA2 D;  4G68 C;  2XD3 A;  3H6U A;  2BJJ X;  4GIZ A;  3O6I A;  3QIM A;  1I6A A;  1LB9 A;  1F9B A;  1FTM A;  1JW4 A;  4R2B A;  4LP2 B;  4KFQ A;  3PPO A;  1Y1Z A;  4OEV A;  4E0X A;  3U72 A;  3GBA A;  1MM6 A;  1MPB A;  1A99 A;  1B5H A;  1H3D A;  1MXU A;  1M5B A;  1RYX A;  2HXW A;  1ZU0 A;  3OD7 A;  1MS7 A;  4MF3 A;  4U21 A;  2UYE A;  3VLW A;  3RUM A;  3N6U A;  3KEI A;  3MQ9 A;  1IIT A;  2OZZ A;  1S50 A;  2Q2C A;  3MZ1 A;  2O6A A;  1DOT A;  5I59 B;  2OCU A;  2ONR A;  1H76 A;  1USY H;  1O7T A;  2XX8 A;  3MP8 A;  3PU5 A;  2QMX A;  4KHZ E;  1JW1 A;  3G7W A;  3VE1 B;  1LCF A;  4DXU A;  1SBP A;  2HEU A;  3E4R A;  2HCA A;  4U22 A;  4ESW A;  4R75 A;  1DTZ A;  1N7X A;  2X7P A;  3DM0 A;  3PGF A;  4JBZ A;  3TMG A;  2Y7P A;  1UTH B;  3IJX B;  1N0T A;  1SYI A;  3M8U A;  3MVW A;  3TTR A;  4K3F A;  1LFI A;  4G68 B;  2IA4 A;  1FQA A;  1QUJ A;  3I6V A;  4JXI A;  3IK6 B;  4LAT A;  4N07 A;  3TFL A;  4BDM A;  3FVK A;  2O7I A;  1P1W A;  3C9H A;  4G8M A;  4R9G A;  4YZZ A;  3FJM A;  3PD8 A;  4NWD A;  4ELP A;  2E1S A;  3O28 A;  3VV5 A;  2GFE A;  3M3L A;  1UTB A;  4KD5 A;  1LFH A;  1IQ7 A;  1I6B A;  3H4Z A;  4O3C A;  3IL1 B;  4TOZ A;  2Y7R A;  3EPE A;  3K1M A;  2OWS A;  2HFB A;  4FEB A;  4TQU Q;  2VD2 A;  1MY0 A;  3F11 A;  4XIG Q;  4JWY A;  2AYS A;  5TP9 B;  2W7Y A;  5K2X A;  1XS5 A;  1B9J A;  1HSE A;  1YAE A;  1AIV A;  4NMY A;  4OXV A;  1A40 A;  4OET A;  3U92 A;  1JQF A;  3QAX A;  4KYD A;  4RJZ A;  1FTL A;  3GLB A;  5CRY A;  1SDX A;  2Q9T A;  1EZ9 A;  4XTC Q;  1OLC A;  2H98 A;  1B46 A;  2PT1 A;  3T96 B;  3TAJ A;  3B6T A;  2M8C A;  2Q88 A;  4U4X A;  4G4P A;  5TPA B;  1NH7 A;  1LAG E;  1D9Y A;  5I56 B;  5ICT A;  4Z7E A;  4XKP A;  3N94 A;  4ZEI A;  3H6V A;  1D3K A;  5H8F A;  1H44 A;  4QFO A;  4R9F A;  3IOU A;  2I6E A;  1A8E A;  1LGB C;  4IGR A;  2AIX A;  5HPQ A;  3GZG A;  4MH5 A;  3OO7 A;  2HAU A;  3FV1 A;  2UVH A;  1OQH A;  3GXA A;  1JNF A;  3V5A A;  3S9M C;  2DP8 A;  4P11 A;  5I58 A;  4LZ8 A;  1TWY A;  4OWD A;  3PPP A;  3UP9 A;  3CG1 A;  3U93 A;  3OEN A;  4JWX A;  3C34 A;  4YB7 A;  4Z0I A;  1ATG A;  3G3F A;  1B3H A;  4HTG A;  2XXY A;  4PQJ A;  1L5T A;  4IB2 A;  2DE2 A;  1XVX A;  5EYF A;  3ILU B;  3MC2 A;  4Q5T A;  4AQ4 A;  4IO6 A;  3UIF A;  4BDQ A;  3RLF E;  4F31 B;  1RKM A;  2Y7K A;  4NWC A;  5DVJ A;  2V25 A;  4F18 A;  1B0H A;  3IJO B;  2DSF A;  4EUO A;  4GWO A;  3CFX A;  4NF8 B;  1P1U A;  4KYE A;  5HM4 B;  4X48 A;  1DSN A;  4QFK A;  5F1Q A;  3M3F A;  3IX1 A;  2OBG A;  5I56 A;  1DPE A;  4AB6 A;  4YMB A;  1MY4 A;  4PFY A;  4F2O A;  3EN3 A;  5TP9 A;  1MQH A;  3DP6 A;  3CR9 A;  5DT6 A;  3PD9 A;  2Z8F A;  3K01 A;  2F6P A;  3FGS A;  3K02 A;  4IY6 A;  2ZYO A;  3K0V A;  3SER A;  1IXG A;  1Z7N E;  4FAT A;  1P1O A;  3CIJ A;  1B7H A;  1SW1 A;  1Y9U A;  2XXQ A;  1CB6 A;  2F78 A;  3D4G A;  3EHS A;  1SW5 A;  3OXN A;  4F1Y A;  4H1X A;  5AE4 A;  4Q0C A;  5L9S A;  3GBB A;  2X26 A;  4EDP A;  3I5O A;  3TEL A;  4RPO A;  3SEV A;  3RTW B;  4H65 A;  1US4 A;  5CM6 A;  3QYT A;  1BIY A;  1B3F A;  2PMS A;  3HO7 A;  4GQO A;  3R26 A;  4KQP A;  1S7Y A;  3TDJ A;  3TUS A;  3TQW A;  1PC3 A;  2DXR A;  5DVI A;  1SYH A;  3A3C A;  1UQW A;  2B3B A;  2F35 A;  2V3Q A;  3KOT A;  3EQ1 A;  4OZ9 A;  3MBP A;  4Q30 B;  4WED A;  3KFM A;  5H8Q B;  1LLS A;  1LB8 A;  3N26 A;  1IZ1 A;  2ZYK A;  4DXC A;  3S9N C;  3QK6 A;  3K6X A;  2QL3 A;  4FED A;  3T9H B;  3VVE A;  1MXV A;  1ZIU A;  4TLM B;  2B65 A;  3ONM A;  4BDO A;  3U8Q A;  1EZP A;  3SEY A;  1AH5 A;  2ALU A;  3TYH A;  1B1H A;  3C35 A;  3KJT A;  4Q8R A;  2I0B A;  1T0K A;  1NKX A;  2QMW A;  5ICQ A;  4NF6 B;  1VFD A;  2ZMB A;  3FD3 A;  4QRZ A;  3W9V A;  2Z23 A;  3EHU A;  1ANF A;  4FJP A;  4RY1 A;  3V83 A;  1FCK A;  1J1N A;  3C33 A;  3L6G A;  3PUY E;  1PB8 A;  1WVJ A;  3OSQ A;  1UTB B;  1FQD A;  1QJM A;  3H03 A;  4WKM A;  3OEM A;  1MQG A;  1MH4 A;  3MW0 A;  1B2H A;  3OO8 A;  1FQF A;  1D4N A;  4C0R A;  3MP1 A;  1URS A;  3OSR A;  4THI A;  2GRV A;  1PEB A;  2XXW A;  3T66 A;  5KCJ B;  5I2K B;  3T22 A;  2F6G A;  5IKB A;  1N84 A;  2H99 A;  3OEL A;  1TFD A;  3TQL A;  4RXL A;  1OQG A;  5CMM A;  5FHN A;  4YAH X;  3TCG A;  1AMF A;  1JEV A;  4GXA A;  4ISU A;  2HQ0 A;  4OFL A;  2HZK A;  3ECR A;  1ELJ A;  1DMB A;  3G3G A;  1Y4T A;  3O97 A;  3P7I A;  4DZ1 A;  1NFT A;  3S2V A;  3TKD A;  2RC9 A;  2Z8D A;  3IOW A;  3K6V A;  4LUB A;  3K6W A;  1NNT A;  3VDF A;  1XOC A;  4DLD A;  1M5C A;  1BTJ A;  2OK2 A;  2PYY A;  2P0S A;  1LCT A;  3RY3 A;  5I57 B;  4EQB A;  4GL0 A;  1GGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...